BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24199_g1_i1 len=3822 path=[407:0-642 1050:643-2893 3301:2894-2928
@96@!:2929-3332 3738:3333-3821]

Length=3822
                                                                      Score     E

ref|XP_009786789.1|  PREDICTED: uncharacterized protein KIAA0930 ...    540   9e-177   
ref|XP_009786790.1|  PREDICTED: uncharacterized protein KIAA0930 ...    531   1e-173   
ref|XP_011069807.1|  PREDICTED: uncharacterized protein KIAA0930 ...    525   4e-171   
ref|XP_004238070.1|  PREDICTED: uncharacterized protein KIAA0930 ...    525   6e-171   
ref|XP_011085427.1|  PREDICTED: regulatory protein NPR3-like            530   4e-170   
emb|CDP01019.1|  unnamed protein product                                520   3e-169   
ref|XP_006366625.1|  PREDICTED: regulatory protein NPR3-like            524   6e-168   
ref|XP_009777160.1|  PREDICTED: regulatory protein NPR3-like isof...    522   3e-167   
ref|XP_002285434.1|  PREDICTED: uncharacterized protein KIAA0930 ...    514   9e-167   Vitis vinifera
emb|CDP17457.1|  unnamed protein product                                520   5e-166   
ref|XP_009621669.1|  PREDICTED: regulatory protein NPR3-like            518   9e-166   
ref|NP_001233844.1|  NIM1-like protein 2                                517   2e-165   
ref|XP_010999903.1|  PREDICTED: uncharacterized protein KIAA0930 ...    508   1e-164   
ref|XP_006433846.1|  hypothetical protein CICLE_v10001411mg             505   2e-163   
ref|XP_006356844.1|  PREDICTED: uncharacterized protein KIAA0930 ...    503   5e-163   
ref|XP_002320676.1|  hypothetical protein POPTR_0014s01400g             504   6e-163   Populus trichocarpa [western balsam poplar]
gb|EYU32381.1|  hypothetical protein MIMGU_mgv1a007750mg                503   1e-162   
ref|XP_006581279.1|  PREDICTED: uncharacterized protein KIAA0930 ...    503   2e-162   
ref|XP_009629505.1|  PREDICTED: regulatory protein NPR3-like            509   4e-162   
ref|XP_010061636.1|  PREDICTED: uncharacterized protein KIAA0930 ...    501   1e-161   
ref|XP_004142903.1|  PREDICTED: uncharacterized protein KIAA0930 ...    499   5e-161   
ref|XP_007018449.1|  Cw7 protein isoform 1                              500   6e-161   
ref|XP_006472487.1|  PREDICTED: uncharacterized protein LOC102625...    498   9e-161   
ref|XP_008444527.1|  PREDICTED: uncharacterized protein KIAA0930 ...    498   1e-160   
ref|XP_010061640.1|  PREDICTED: uncharacterized protein KIAA0930 ...    496   3e-160   
gb|EYU42809.1|  hypothetical protein MIMGU_mgv1a003347mg                501   5e-159   
ref|XP_010273418.1|  PREDICTED: uncharacterized protein KIAA0930 ...    493   6e-159   
ref|XP_004501504.1|  PREDICTED: uncharacterized protein KIAA0930 ...    493   8e-159   
ref|XP_010061637.1|  PREDICTED: uncharacterized protein KIAA0930 ...    493   8e-159   
gb|KDP41590.1|  hypothetical protein JCGZ_15997                         493   1e-158   
ref|XP_007136782.1|  hypothetical protein PHAVU_009G073700g             493   1e-158   
ref|XP_009759449.1|  PREDICTED: uncharacterized protein KIAA0930 ...    493   3e-158   
ref|XP_009759451.1|  PREDICTED: uncharacterized protein KIAA0930 ...    491   8e-158   
gb|AGV54635.1|  hypothetical protein                                    490   9e-158   
ref|XP_010687685.1|  PREDICTED: uncharacterized protein LOC104901...    489   2e-157   
gb|KEH35838.1|  CW7 protein, putative                                   488   8e-157   
ref|XP_009375131.1|  PREDICTED: uncharacterized protein KIAA0930 ...    488   1e-156   
ref|XP_009361048.1|  PREDICTED: uncharacterized protein KIAA0930 ...    487   2e-156   
ref|XP_002322351.2|  ankyrin repeat family protein                      493   4e-156   Populus trichocarpa [western balsam poplar]
ref|XP_010061638.1|  PREDICTED: uncharacterized protein KIAA0930 ...    486   4e-156   
ref|XP_004290992.1|  PREDICTED: uncharacterized protein LOC101294908    485   7e-156   
ref|XP_011040366.1|  PREDICTED: regulatory protein NPR3-like isof...    493   7e-156   
ref|XP_009786055.1|  PREDICTED: regulatory protein NPR3-like isof...    489   1e-154   
ref|XP_009759446.1|  PREDICTED: uncharacterized protein LOC104211...    484   1e-154   
ref|XP_009786050.1|  PREDICTED: regulatory protein NPR3-like isof...    489   2e-154   
gb|KGN62429.1|  hypothetical protein Csa_2G354060                       481   2e-154   
ref|XP_007018451.1|  Cw7 protein isoform 3                              481   4e-154   
ref|XP_006578064.1|  PREDICTED: uncharacterized protein KIAA0930-...    481   5e-154   
ref|XP_011040365.1|  PREDICTED: regulatory protein NPR3-like isof...    487   9e-154   
ref|XP_006472488.1|  PREDICTED: uncharacterized protein LOC102625...    479   9e-154   
ref|XP_008380107.1|  PREDICTED: uncharacterized protein KIAA0930 ...    480   1e-153   
ref|XP_008220394.1|  PREDICTED: uncharacterized protein KIAA0930 ...    479   2e-153   
gb|AEE81755.1|  regulatory protein NPR2                                 486   3e-153   
ref|XP_009361040.1|  PREDICTED: uncharacterized protein KIAA0930 ...    479   4e-153   
ref|XP_010687693.1|  PREDICTED: uncharacterized protein LOC104901...    477   6e-153   
ref|XP_009356589.1|  PREDICTED: regulatory protein NPR3-like            485   6e-153   
ref|XP_009759448.1|  PREDICTED: uncharacterized protein KIAA0930 ...    478   2e-152   
ref|XP_007214958.1|  hypothetical protein PRUPE_ppa003232mg             483   4e-152   
ref|XP_009759450.1|  PREDICTED: uncharacterized protein KIAA0930 ...    475   7e-152   
ref|XP_010272311.1|  PREDICTED: regulatory protein NPR3 isoform X1      480   2e-151   
ref|XP_004303897.1|  PREDICTED: regulatory protein NPR3-like            480   2e-151   
ref|XP_002520549.1|  Regulatory protein NPR1, putative                  480   5e-151   Ricinus communis
ref|XP_011001309.1|  PREDICTED: regulatory protein NPR3-like            480   5e-151   
ref|XP_006376994.1|  hypothetical protein POPTR_0012s11900g             479   1e-150   
ref|XP_003519533.1|  PREDICTED: regulatory protein NPR3-like isof...    477   8e-150   
ref|XP_002274045.1|  PREDICTED: regulatory protein NPR3 isoform X1      476   1e-149   Vitis vinifera
gb|KDP22628.1|  hypothetical protein JCGZ_02854                         476   2e-149   
ref|XP_009786791.1|  PREDICTED: uncharacterized protein KIAA0930 ...    466   3e-149   
ref|NP_001238674.1|  NPR1-2 protein                                     475   3e-149   
ref|XP_010110124.1|  hypothetical protein L484_003753                   468   5e-149   
ref|XP_010272312.1|  PREDICTED: regulatory protein NPR3 isoform X2      474   7e-149   
ref|XP_002510059.1|  cw7 protein, putative                              467   7e-149   Ricinus communis
ref|XP_008348376.1|  PREDICTED: LOW QUALITY PROTEIN: regulatory p...    473   2e-148   
ref|XP_008451832.1|  PREDICTED: LOW QUALITY PROTEIN: regulatory p...    473   2e-148   
gb|KHN14362.1|  Regulatory protein NPR3                                 473   2e-148   
ref|NP_001238658.1|  NPR1-1 protein                                     473   3e-148   
ref|XP_010092646.1|  Regulatory protein                                 472   4e-148   
ref|XP_007223312.1|  hypothetical protein PRUPE_ppa007301mg             464   5e-148   
ref|XP_006472489.1|  PREDICTED: uncharacterized protein LOC102625...    464   5e-148   
ref|XP_010548546.1|  PREDICTED: uncharacterized protein KIAA0930 ...    462   2e-147   
ref|NP_564743.1|  protein CW7                                           462   3e-147   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010056640.1|  PREDICTED: regulatory protein NPR3-like            469   4e-147   
ref|XP_010511044.1|  PREDICTED: uncharacterized protein KIAA0930 ...    461   8e-147   
ref|XP_010414709.1|  PREDICTED: uncharacterized protein KIAA0930 ...    460   2e-146   
ref|NP_849828.1|  protein CW7                                           459   5e-146   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011096773.1|  PREDICTED: regulatory protein NPR3-like            466   5e-146   
ref|XP_011026213.1|  PREDICTED: regulatory protein NPR3-like            466   9e-146   
ref|XP_003545296.1|  PREDICTED: regulatory protein NPR3-like            466   1e-145   
ref|XP_010548530.1|  PREDICTED: uncharacterized protein KIAA0930 ...    458   1e-145   
ref|XP_004486434.1|  PREDICTED: regulatory protein NPR3-like isof...    465   2e-145   
gb|AGL61506.1|  NPR1                                                    464   2e-145   
ref|XP_010936178.1|  PREDICTED: uncharacterized protein KIAA0930 ...    457   4e-145   
ref|XP_010511043.1|  PREDICTED: uncharacterized protein KIAA0930 ...    456   6e-145   
ref|XP_006392279.1|  hypothetical protein EUTSA_v10023553mg             454   1e-144   
ref|XP_010414708.1|  PREDICTED: uncharacterized protein KIAA0930 ...    456   1e-144   
ref|XP_002888204.1|  hypothetical protein ARALYDRAFT_475360             456   1e-144   
ref|XP_004486433.1|  PREDICTED: regulatory protein NPR3-like isof...    463   1e-144   
gb|KHN11992.1|  Regulatory protein NPR3                                 463   1e-144   
ref|XP_003594464.1|  NPR1-1 protein                                     463   1e-144   
gb|KHG26685.1|  hypothetical protein F383_10565                         455   2e-144   
ref|XP_006302376.1|  hypothetical protein CARUB_v10020440mg             455   2e-144   
ref|XP_010470227.1|  PREDICTED: uncharacterized protein KIAA0930 ...    455   2e-144   
ref|XP_004169978.1|  PREDICTED: regulatory protein NPR3-like            462   2e-144   
ref|XP_008459083.1|  PREDICTED: regulatory protein NPR3-like            462   3e-144   
ref|XP_007147518.1|  hypothetical protein PHAVU_006G131400g             462   4e-144   
ref|XP_009777172.1|  PREDICTED: regulatory protein NPR3-like isof...    458   8e-144   
ref|XP_009377037.1|  PREDICTED: regulatory protein NPR3-like            460   1e-143   
ref|XP_010664489.1|  PREDICTED: uncharacterized protein KIAA0930 ...    452   1e-143   
ref|XP_007213800.1|  hypothetical protein PRUPE_ppa003221mg             460   2e-143   
gb|KDO44756.1|  hypothetical protein CISIN_1g007550mg                   460   3e-143   
ref|XP_009102905.1|  PREDICTED: uncharacterized protein KIAA0930 ...    452   3e-143   
gb|ABF48718.1|  ankyrin repeat BTB/POZ domain-containing protein        462   3e-143   Populus trichocarpa [western balsam poplar]
gb|KDO44755.1|  hypothetical protein CISIN_1g007550mg                   460   3e-143   
ref|XP_004147747.1|  PREDICTED: regulatory protein NPR3-like            459   5e-143   
ref|XP_004497710.1|  PREDICTED: regulatory protein NPR3-like            459   6e-143   
gb|AGC39275.1|  NPR1-like3 protein                                      458   7e-143   
gb|AAT57642.1|  NIM1-like protein 1                                     458   7e-143   Helianthus annuus
ref|XP_007024872.1|  NPR1-like protein 4                                458   8e-143   
ref|XP_010414712.1|  PREDICTED: uncharacterized protein KIAA0930 ...    449   9e-143   
ref|XP_010093184.1|  Regulatory protein                                 458   1e-142   
ref|XP_010470226.1|  PREDICTED: uncharacterized protein KIAA0930 ...    450   1e-142   
gb|KFK40880.1|  hypothetical protein AALP_AA2G054300                    449   2e-142   
emb|CDP17620.1|  unnamed protein product                                457   2e-142   
ref|XP_010511047.1|  PREDICTED: uncharacterized protein KIAA0930 ...    448   3e-142   
ref|XP_008229582.1|  PREDICTED: regulatory protein NPR3-like            456   6e-142   
ref|XP_008342333.1|  PREDICTED: regulatory protein NPR3-like            455   1e-141   
emb|CDY45883.1|  BnaC01g28190D                                          448   1e-141   
ref|XP_006437091.1|  hypothetical protein CICLE_v10031020mg             455   2e-141   
gb|KHG00475.1|  Regulatory NPR3 -like protein                           454   3e-141   
ref|XP_008806697.1|  PREDICTED: regulatory protein NPR3-like            454   4e-141   
ref|XP_010414711.1|  PREDICTED: uncharacterized protein KIAA0930 ...    445   5e-141   
ref|XP_004293735.1|  PREDICTED: regulatory protein NPR3-like isof...    452   6e-141   
ref|XP_007141442.1|  hypothetical protein PHAVU_008G195900g             453   7e-141   
ref|XP_010470230.1|  PREDICTED: uncharacterized protein KIAA0930 ...    444   7e-141   
emb|CDY44552.1|  BnaA01g21870D                                          446   8e-141   
ref|XP_010511045.1|  PREDICTED: uncharacterized protein KIAA0930 ...    445   9e-141   
ref|XP_010414710.1|  PREDICTED: uncharacterized protein KIAA0930 ...    445   1e-140   
ref|NP_001289241.1|  uncharacterized protein LOC103945128               452   1e-140   
ref|XP_010511046.1|  PREDICTED: uncharacterized protein KIAA0930 ...    443   1e-140   
ref|XP_004293734.1|  PREDICTED: regulatory protein NPR3-like isof...    452   2e-140   
emb|CAN67078.1|  hypothetical protein VITISV_004499                     453   3e-140   Vitis vinifera
ref|XP_008225738.1|  PREDICTED: regulatory protein NPR3-like            451   3e-140   
ref|XP_010999904.1|  PREDICTED: uncharacterized protein KIAA0930 ...    442   6e-140   
ref|XP_009759447.1|  PREDICTED: uncharacterized protein LOC104211...    445   6e-140   
gb|ABK62792.1|  NPR-1                                                   450   7e-140   Pyrus pyrifolia [sha li]
gb|KHN45127.1|  Hypothetical protein glysoja_031355                     442   1e-139   
ref|XP_009102913.1|  PREDICTED: uncharacterized protein KIAA0930 ...    441   1e-139   
ref|NP_001280793.1|  regulatory protein NPR3-like                       450   1e-139   
gb|ACC77697.1|  NPR1-like protein                                       449   1e-139   Malus domestica [apple tree]
ref|XP_008225741.1|  PREDICTED: regulatory protein NPR3-like            449   2e-139   
gb|KDO77444.1|  hypothetical protein CISIN_1g007849mg                   449   2e-139   
ref|XP_004501505.1|  PREDICTED: uncharacterized protein KIAA0930 ...    441   3e-139   
ref|XP_010470229.1|  PREDICTED: uncharacterized protein KIAA0930 ...    440   3e-139   
ref|XP_006468441.1|  PREDICTED: regulatory protein NPR3-like            448   5e-139   
ref|XP_009387108.1|  PREDICTED: uncharacterized protein KIAA0930 ...    441   6e-139   
ref|XP_009602190.1|  PREDICTED: regulatory protein NPR3-like            447   6e-139   
ref|XP_010908601.1|  PREDICTED: regulatory protein NPR3-like            447   1e-138   
ref|XP_010470228.1|  PREDICTED: uncharacterized protein KIAA0930 ...    439   1e-138   
ref|XP_008383328.1|  PREDICTED: regulatory protein NPR3-like            447   1e-138   
ref|XP_002307566.2|  hypothetical protein POPTR_0005s22770g             447   2e-138   Populus trichocarpa [western balsam poplar]
ref|XP_011032773.1|  PREDICTED: regulatory protein NPR3-like            447   2e-138   
ref|XP_003617362.1|  NPR1-1 protein                                     447   2e-138   
gb|ACU78081.1|  NPR1-like protein                                       446   3e-138   
gb|ABN45747.1|  nonexpressor of pathogenesis-related genes 3            446   4e-138   Nicotiana glutinosa
ref|XP_004303898.1|  PREDICTED: regulatory protein NPR3-like            446   5e-138   
ref|XP_010655930.1|  PREDICTED: regulatory protein NPR3 isoform X2      441   7e-138   
ref|XP_007048936.1|  NPR1-like protein 3, putative                      445   7e-138   
ref|XP_007214668.1|  hypothetical protein PRUPE_ppa003290mg             445   7e-138   
ref|XP_010942675.1|  PREDICTED: regulatory protein NPR3-like            445   9e-138   
gb|KHG09335.1|  Regulatory NPR3 -like protein                           443   3e-137   
gb|ADP95762.1|  npr1 protein                                            443   4e-137   
ref|XP_009341186.1|  PREDICTED: regulatory protein NPR3-like isof...    441   1e-136   
ref|XP_009357280.1|  PREDICTED: regulatory protein NPR3-like isof...    440   3e-136   
ref|XP_006857089.1|  hypothetical protein AMTR_s00065p00106950          433   8e-136   
ref|XP_010273453.1|  PREDICTED: uncharacterized protein LOC104608...    431   1e-135   
ref|XP_008787319.1|  PREDICTED: regulatory protein NPR3-like            439   2e-135   
gb|KHN04424.1|  Hypothetical protein glysoja_019511                     431   2e-135   
gb|ACJ04030.1|  NPR1-like protein                                       438   3e-135   Musa ABB Group [cooking banana]
gb|KEH35839.1|  CW7 protein, putative                                   426   1e-134   
ref|XP_009341187.1|  PREDICTED: regulatory protein NPR3-like isof...    436   1e-134   
ref|XP_009397343.1|  PREDICTED: regulatory protein NPR3-like            436   2e-134   
ref|XP_009357282.1|  PREDICTED: regulatory protein NPR3-like isof...    435   4e-134   
ref|XP_009776511.1|  PREDICTED: regulatory protein NPR3-like isof...    435   4e-134   
gb|EYU43699.1|  hypothetical protein MIMGU_mgv1a003483mg                434   5e-134   
gb|AHF20180.1|  ankyrin-repeat protein                                  435   6e-134   
ref|XP_008371834.1|  PREDICTED: regulatory protein NPR3 isoform X1      434   6e-134   
ref|XP_009357279.1|  PREDICTED: regulatory protein NPR3-like            433   3e-133   
gb|AAT57641.1|  NIM1-like protein 1                                     433   3e-133   Nicotiana tabacum [American tobacco]
gb|KHN38349.1|  Regulatory protein NPR3                                 428   7e-133   
gb|ACE86413.1|  NPR1-like protein                                       431   8e-133   Musa ABB Group [cooking banana]
ref|XP_006353069.1|  PREDICTED: regulatory protein NPR3-like            430   3e-132   
ref|XP_009375133.1|  PREDICTED: uncharacterized protein KIAA0930 ...    422   4e-132   
ref|XP_009361062.1|  PREDICTED: uncharacterized protein KIAA0930 ...    421   6e-132   
ref|NP_001234562.1|  NIM1-like protein 1                                429   6e-132   
dbj|BAB82429.1|  hypothetical protein                                   419   1e-131   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008371836.1|  PREDICTED: regulatory protein NPR3 isoform X2      428   2e-131   
ref|XP_009399066.1|  PREDICTED: regulatory protein NPR3-like isof...    427   3e-131   
gb|AHF20181.1|  ankyrin-repeat protein                                  427   4e-131   
gb|AFO10948.1|  non-expressor of PR1-like protein                       424   4e-131   
gb|KHG02161.1|  hypothetical protein F383_23944                         416   3e-130   
ref|NP_849827.1|  protein CW7                                           410   9e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009361056.1|  PREDICTED: uncharacterized protein KIAA0930 ...    413   1e-128   
gb|AGI38074.1|  nonexpressor of pathogenesis-related protein 1          416   1e-128   
ref|NP_001052185.1|  Os04g0183100                                       414   1e-128   Oryza sativa Japonica Group [Japonica rice]
emb|CAH65852.1|  OSIGBa0140C02.4                                        412   3e-128   Oryza sativa [red rice]
gb|AGI38062.1|  nonexpressor of pathogenesis-related protein 1          415   5e-128   
gb|AGI38064.1|  nonexpressor of pathogenesis-related protein 1          415   5e-128   
gb|AGI38060.1|  nonexpressor of pathogenesis-related protein 1          414   8e-128   
gb|AGI38063.1|  nonexpressor of pathogenesis-related protein 1          414   8e-128   
gb|AGI38071.1|  nonexpressor of pathogenesis-related protein 1          414   1e-127   
gb|AGI38075.1|  nonexpressor of pathogenesis-related protein 1          414   1e-127   
ref|XP_004491374.1|  PREDICTED: regulatory protein NPR3-like            417   1e-127   
ref|XP_009399065.1|  PREDICTED: regulatory protein NPR3-like isof...    417   3e-127   
gb|AGI38061.1|  nonexpressor of pathogenesis-related protein 1          412   4e-127   
gb|AGI38077.1|  nonexpressor of pathogenesis-related protein 1          412   5e-127   
gb|AGI38065.1|  nonexpressor of pathogenesis-related protein 1          411   1e-126   
gb|ACJ45014.1|  NPR1-2 protein                                          411   2e-126   Glycine max [soybeans]
gb|AGI38066.1|  nonexpressor of pathogenesis-related protein 1          410   2e-126   
ref|XP_010536418.1|  PREDICTED: regulatory protein NPR3-like isof...    413   7e-126   
ref|XP_004983490.1|  PREDICTED: uncharacterized protein KIAA0930 ...    406   1e-125   
ref|NP_001059288.1|  Os07g0248800                                       406   1e-125   Oryza sativa Japonica Group [Japonica rice]
gb|EEC81801.1|  hypothetical protein OsI_25521                          406   1e-125   Oryza sativa Indica Group [Indian rice]
ref|XP_006652114.1|  PREDICTED: uncharacterized protein KIAA0930 ...    405   1e-125   
gb|AGI38059.1|  nonexpressor of pathogenesis-related protein 1          408   1e-125   
gb|KFK41854.1|  hypothetical protein AALP_AA2G179400                    411   2e-125   
gb|AAK62787.1|AC027036_8  unknown protein                               417   3e-125   Arabidopsis thaliana [mouse-ear cress]
gb|AGI38068.1|  nonexpressor of pathogenesis-related protein 1          407   4e-125   
ref|XP_010538609.1|  PREDICTED: regulatory protein NPR3-like            411   4e-125   
gb|AIM54370.1|  nonexpressor of pathogenesis-related protein 1          410   5e-125   
gb|AGI38069.1|  nonexpressor of pathogenesis-related protein 1          407   5e-125   
gb|EEC71545.1|  hypothetical protein OsI_03882                          409   8e-125   Oryza sativa Indica Group [Indian rice]
gb|EEE66887.1|  hypothetical protein OsJ_23709                          404   9e-125   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010936179.1|  PREDICTED: uncharacterized protein KIAA0930 ...    400   1e-124   
ref|XP_009759452.1|  PREDICTED: uncharacterized protein LOC104211...    402   1e-124   
ref|XP_004983491.1|  PREDICTED: uncharacterized protein KIAA0930 ...    401   6e-124   
ref|NP_001044363.1|  Os01g0767900                                       409   7e-124   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009387109.1|  PREDICTED: uncharacterized protein KIAA0930 ...    399   8e-124   
dbj|BAD53355.1|  putative NPR1                                          409   1e-123   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006280229.1|  hypothetical protein CARUB_v10026146mg             406   1e-123   
gb|AFW84951.1|  regulatory protein NPR1                                 406   9e-123   
ref|NP_001147587.1|  regulatory protein NPR1                            405   1e-122   Zea mays [maize]
ref|XP_006644769.1|  PREDICTED: LOW QUALITY PROTEIN: regulatory p...    405   1e-122   
emb|CDX99350.1|  BnaC01g12020D                                          404   2e-122   
ref|XP_003569900.1|  PREDICTED: regulatory protein NPR3-like            405   2e-122   
ref|XP_002865280.1|  hypothetical protein ARALYDRAFT_494469             403   4e-122   
gb|KEH37013.1|  regulatory protein NPR1                                 399   1e-121   
ref|XP_004970097.1|  PREDICTED: regulatory protein NPR3-like            402   2e-121   
emb|CDX78955.1|  BnaA01g10220D                                          401   2e-121   
ref|XP_006853358.1|  hypothetical protein AMTR_s00032p00112510          401   3e-121   
ref|XP_006398160.1|  hypothetical protein EUTSA_v10000824mg             400   3e-121   
ref|XP_003573754.1|  PREDICTED: uncharacterized protein KIAA0930 ...    393   4e-121   
ref|NP_199324.2|  NPR1-like protein 3                                   400   4e-121   Arabidopsis thaliana [mouse-ear cress]
gb|ACJ45012.1|  NPR1-1 protein                                          397   5e-121   Glycine max [soybeans]
ref|XP_009133120.1|  PREDICTED: regulatory protein NPR4                 399   1e-120   
ref|XP_010238747.1|  PREDICTED: uncharacterized protein KIAA0930 ...    391   2e-120   
ref|XP_010441782.1|  PREDICTED: regulatory protein NPR3                 396   8e-120   
gb|KEH35840.1|  CW7 protein, putative                                   385   1e-119   
ref|XP_009776515.1|  PREDICTED: regulatory protein NPR3-like isof...    395   2e-119   
ref|XP_002467403.1|  hypothetical protein SORBIDRAFT_01g027460          391   2e-119   Sorghum bicolor [broomcorn]
ref|XP_010494583.1|  PREDICTED: regulatory protein NPR3                 395   2e-119   
ref|XP_010054033.1|  PREDICTED: regulatory protein NPR3-like            394   4e-119   
ref|XP_010481651.1|  PREDICTED: regulatory protein NPR3-like            394   4e-119   
ref|XP_009587524.1|  PREDICTED: uncharacterized protein KIAA0930 ...    382   5e-119   
ref|XP_006413943.1|  hypothetical protein EUTSA_v10024752mg             394   7e-119   
ref|XP_002456404.1|  hypothetical protein SORBIDRAFT_03g035720          395   9e-119   Sorghum bicolor [broomcorn]
gb|KDO44757.1|  hypothetical protein CISIN_1g007550mg                   391   9e-119   
ref|NP_001141790.1|  uncharacterized protein LOC100273926               387   2e-118   Zea mays [maize]
ref|XP_010536434.1|  PREDICTED: regulatory protein NPR3-like isof...    390   2e-118   
gb|KDO77445.1|  hypothetical protein CISIN_1g007849mg                   389   5e-118   
gb|AAL91603.1|AC099400_9  Hypothetical protein                          384   6e-118   Oryza sativa Japonica Group [Japonica rice]
dbj|BAB09496.1|  regulatory protein NPR1-like; transcription fact...    392   7e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009101624.1|  PREDICTED: LOW QUALITY PROTEIN: regulatory p...    390   1e-117   
gb|KDO77446.1|  hypothetical protein CISIN_1g007849mg                   387   3e-117   
dbj|BAJ94508.1|  predicted protein                                      390   4e-117   
emb|CDM84353.1|  unnamed protein product                                390   4e-117   
ref|XP_009128768.1|  PREDICTED: LOW QUALITY PROTEIN: regulatory p...    389   5e-117   
ref|XP_008668050.1|  PREDICTED: uncharacterized protein LOC100273...    382   5e-117   
ref|XP_002867926.1|  predicted protein                                  388   1e-116   
gb|EPS64461.1|  hypothetical protein M569_10317                         379   3e-116   
ref|XP_006437106.1|  hypothetical protein CICLE_v10030929mg             388   6e-116   
gb|EMS60174.1|  Regulatory protein NPR4                                 382   7e-116   
ref|XP_009587525.1|  PREDICTED: uncharacterized protein KIAA0930 ...    373   1e-115   
gb|AGI38070.1|  nonexpressor of pathogenesis-related protein 1          381   2e-115   
ref|XP_010439666.1|  PREDICTED: regulatory protein NPR4-like            384   4e-115   
ref|XP_010434372.1|  PREDICTED: regulatory protein NPR4                 383   9e-115   
gb|EMT27088.1|  hypothetical protein F775_31940                         378   2e-114   
ref|XP_006472492.1|  PREDICTED: uncharacterized protein LOC102625...    369   1e-113   
ref|XP_006285143.1|  hypothetical protein CARUB_v10006486mg             379   3e-113   
ref|XP_010449314.1|  PREDICTED: regulatory protein NPR4-like            378   5e-113   
ref|XP_006472490.1|  PREDICTED: uncharacterized protein LOC102625...    367   1e-112   
ref|XP_010234614.1|  PREDICTED: uncharacterized protein LOC100822...    369   2e-112   
ref|NP_193701.2|  NPR1-like protein 4                                   375   4e-112   
ref|XP_008220395.1|  PREDICTED: uncharacterized protein LOC103320...    367   4e-112   
gb|AAF79743.1|AC009317_2  T30E16.4                                      376   6e-112   
gb|EMS57699.1|  hypothetical protein TRIUR3_16590                       366   3e-110   
ref|XP_006448743.1|  hypothetical protein CICLE_v10017873mg             367   1e-109   
ref|XP_007018450.1|  Cw7 protein isoform 2                              358   3e-109   
emb|CDY26398.1|  BnaA02g23720D                                          367   4e-109   
emb|CDX82577.1|  BnaC07g02890D                                          363   5e-108   
ref|XP_009759454.1|  PREDICTED: uncharacterized protein LOC104211...    352   1e-106   
emb|CAA19683.1|  putative protein                                       361   2e-106   
emb|CBI29072.3|  unnamed protein product                                354   2e-106   
ref|XP_006484991.1|  PREDICTED: regulatory protein NPR4-like isof...    361   2e-106   
ref|XP_006484984.1|  PREDICTED: regulatory protein NPR4-like isof...    359   4e-106   
ref|XP_006472491.1|  PREDICTED: uncharacterized protein LOC102625...    349   5e-106   
emb|CDY39410.1|  BnaAnng05410D                                          355   3e-105   
ref|XP_002300863.2|  hypothetical protein POPTR_0002s05740g             350   1e-104   
dbj|BAJ92052.1|  predicted protein                                      345   5e-104   
gb|EMT06126.1|  Glycerol-3-phosphate dehydrogenase SDP6, mitochon...    363   2e-103   
ref|XP_006437095.1|  hypothetical protein CICLE_v10033533mg             348   1e-102   
ref|XP_010238749.1|  PREDICTED: uncharacterized protein KIAA0930 ...    340   1e-102   
ref|XP_010511048.1|  PREDICTED: uncharacterized protein KIAA0930 ...    340   3e-102   
ref|XP_010511049.1|  PREDICTED: uncharacterized protein KIAA0930 ...    339   5e-102   
ref|XP_006437103.1|  hypothetical protein CICLE_v10031115mg             345   2e-101   
ref|XP_006651667.1|  PREDICTED: regulatory protein NPR4-like            343   5e-101   
ref|NP_001050850.1|  Os03g0667100                                       345   5e-101   
gb|AAR87167.1|  expressed protein (with alternative splicing)           345   5e-101   
gb|AAR87166.1|  expressed protein (with alternative splicing)           345   8e-101   
ref|XP_006437097.1|  hypothetical protein CICLE_v10031343mg             341   1e-100   
dbj|BAJ91588.1|  predicted protein                                      343   2e-100   
dbj|BAJ90272.1|  predicted protein                                      342   6e-100   
ref|XP_006484986.1|  PREDICTED: regulatory protein NPR4-like isof...    338   7e-100   
gb|KEH28396.1|  NPR1/NIM1-like regulatory protein, putative             337   7e-100   
ref|XP_006437092.1|  hypothetical protein CICLE_v10031432mg             338   8e-100   
ref|XP_002464110.1|  hypothetical protein SORBIDRAFT_01g012450          342   1e-99    
ref|XP_006437094.1|  hypothetical protein CICLE_v10031258mg             338   1e-99    
ref|XP_004982222.1|  PREDICTED: regulatory protein NPR3-like            341   2e-99    
ref|XP_008790265.1|  PREDICTED: uncharacterized protein KIAA0930 ...    329   2e-99    
gb|EAY91301.1|  hypothetical protein OsI_12918                          344   2e-99    
gb|KCW68625.1|  hypothetical protein EUGRSUZ_F02230                     327   3e-99    
ref|XP_006484985.1|  PREDICTED: regulatory protein NPR4-like isof...    337   4e-99    
dbj|BAJ87143.1|  predicted protein                                      338   1e-98    
gb|EMT27860.1|  Regulatory protein NPR1                                 338   2e-98    
ref|XP_006484992.1|  PREDICTED: regulatory protein NPR4-like isof...    338   3e-98    
gb|KDO39823.1|  hypothetical protein CISIN_1g008204mg                   336   6e-98    
tpg|DAA52628.1|  TPA: hypothetical protein ZEAMMB73_148488              332   1e-96    
ref|XP_006484994.1|  PREDICTED: regulatory protein NPR4-like isof...    329   1e-96    
ref|XP_006485155.1|  PREDICTED: regulatory protein NPR4-like            332   2e-96    
ref|XP_010262064.1|  PREDICTED: regulatory protein NPR1-like            332   2e-96    
ref|XP_008380174.1|  PREDICTED: regulatory protein NPR3-like            326   3e-96    
gb|KDO81143.1|  hypothetical protein CISIN_1g0161611mg                  317   5e-96    
ref|XP_003561461.1|  PREDICTED: regulatory protein NPR3-like            330   9e-96    
ref|XP_002514127.1|  Regulatory protein NPR1, putative                  327   2e-94    
ref|XP_011003334.1|  PREDICTED: regulatory protein NPR1                 325   7e-94    
gb|AEY99652.1|  NPR1-1                                                  322   6e-93    
gb|ABA38911.1|  NPR1-like protein                                       313   8e-93    
ref|XP_002308281.1|  Regulatory protein NPR1                            321   2e-92    
gb|ABA38910.1|  NPR1-like protein                                       311   4e-92    
gb|KDP33858.1|  hypothetical protein JCGZ_07429                         320   6e-92    
ref|XP_010915286.1|  PREDICTED: regulatory protein NPR1-like isof...    318   9e-92    
ref|XP_010090069.1|  Regulatory protein                                 319   1e-91    
ref|XP_006484993.1|  PREDICTED: regulatory protein NPR4-like isof...    316   2e-91    
ref|XP_008242373.1|  PREDICTED: regulatory protein NPR1                 317   9e-91    
ref|XP_006437099.1|  hypothetical protein CICLE_v100337992mg            312   1e-90    
gb|AHF20183.1|  non-expressor of pr1                                    316   1e-90    
ref|XP_009388569.1|  PREDICTED: regulatory protein NPR1-like            315   2e-90    
emb|CAP12787.1|  NPR1 protein                                           313   2e-90    
gb|KHG24206.1|  Regulatory NPR1 -like protein                           314   8e-90    
ref|XP_010925463.1|  PREDICTED: regulatory protein NPR1-like            313   9e-90    
ref|XP_008782513.1|  PREDICTED: regulatory protein NPR1                 312   2e-89    
gb|ABC54558.1|  nonexpresser of pathogenesis-related 1                  313   2e-89    
gb|ABG38308.1|  NPR1                                                    311   3e-89    
gb|KCW89778.1|  hypothetical protein EUGRSUZ_A02033                     306   4e-89    
emb|CDP03145.1|  unnamed protein product                                311   5e-89    
ref|XP_007202872.1|  hypothetical protein PRUPE_ppa015728mg             311   5e-89    
gb|ABL63913.1|  NPR1-like protein                                       311   5e-89    
ref|XP_006451500.1|  hypothetical protein CICLE_v10007832mg             311   5e-89    
ref|XP_008807141.1|  PREDICTED: regulatory protein NPR1-like            310   6e-89    
ref|XP_010047547.1|  PREDICTED: regulatory protein NPR1 isoform X1      311   1e-88    
ref|XP_009402935.1|  PREDICTED: regulatory protein NPR1-like            310   1e-88    
gb|AAM62410.1|AF480488_1  NPR1                                          309   3e-88    
ref|XP_006357709.1|  PREDICTED: regulatory protein NPR1-like            308   5e-88    
gb|ABA38903.1|  NPR1-like protein                                       300   6e-88    
ref|XP_010924980.1|  PREDICTED: regulatory protein NPR1-like isof...    307   6e-88    
gb|KCW89777.1|  hypothetical protein EUGRSUZ_A02033                     305   7e-88    
gb|KDO39256.1|  hypothetical protein CISIN_1g045501mg                   300   2e-87    
gb|EYU28391.1|  hypothetical protein MIMGU_mgv1a003409mg                307   2e-87    
gb|ABA38902.1|  NPR1-like protein                                       298   2e-87    
ref|XP_007012790.1|  Regulatory protein isoform 1                       306   3e-87    
ref|XP_009606361.1|  PREDICTED: regulatory protein NPR1                 306   4e-87    
ref|XP_010049461.1|  PREDICTED: regulatory protein NPR1-like isof...    306   5e-87    
ref|XP_010049459.1|  PREDICTED: regulatory protein NPR1-like isof...    306   7e-87    
ref|XP_002281475.1|  PREDICTED: regulatory protein NPR1                 305   7e-87    
ref|XP_001764094.1|  predicted protein                                  296   9e-87    
ref|XP_010242246.1|  PREDICTED: regulatory protein NPR1-like            304   1e-86    
gb|ADI24348.1|  non-expressor of PR1                                    305   1e-86    
ref|XP_006853864.1|  hypothetical protein AMTR_s00036p00114630          304   1e-86    
ref|XP_006437096.1|  hypothetical protein CICLE_v10031343mg             300   1e-86    
ref|XP_009408867.1|  PREDICTED: regulatory protein NPR1-like            303   2e-86    
ref|XP_006437101.1|  hypothetical protein CICLE_v10031310mg             301   2e-86    
gb|AAS55117.1|  NPR1                                                    303   2e-86    
gb|ABX71071.1|  NPR1                                                    303   3e-86    
gb|KCW82057.1|  hypothetical protein EUGRSUZ_C03423                     306   4e-86    
ref|XP_009802447.1|  PREDICTED: regulatory protein NPR1                 302   6e-86    
ref|XP_003534926.1|  PREDICTED: LOW QUALITY PROTEIN: regulatory p...    301   1e-85    
ref|XP_009361630.1|  PREDICTED: regulatory protein NPR1                 299   8e-85    
gb|ABM64782.1|  regulatory protein NPR1                                 299   1e-84    
ref|NP_001234558.1|  non-inducible immunity 1                           298   1e-84    
ref|XP_006413942.1|  hypothetical protein EUTSA_v10024752mg             292   5e-84    
ref|XP_004173414.1|  PREDICTED: uncharacterized protein KIAA0930 ...    285   5e-84    
ref|XP_010696528.1|  PREDICTED: regulatory protein NPR1-like            297   7e-84    
gb|AEP68016.1|  NPR1                                                    295   9e-84    
gb|ABI93182.1|  NPR1-like protein                                       294   3e-83    
gb|ABR23001.1|  NPR1                                                    295   3e-83    
ref|XP_004288961.1|  PREDICTED: regulatory protein NPR2-like            294   4e-83    
ref|XP_011078001.1|  PREDICTED: regulatory protein NPR1-like isof...    294   4e-83    
ref|XP_010238748.1|  PREDICTED: uncharacterized protein LOC100831...    286   1e-82    
ref|XP_002970834.1|  hypothetical protein SELMODRAFT_94386              285   2e-82    
ref|XP_006451499.1|  hypothetical protein CICLE_v10007832mg             291   5e-82    
ref|XP_008391028.1|  PREDICTED: regulatory protein NPR1                 291   7e-82    
gb|KDO40806.1|  hypothetical protein CISIN_1g007758mg                   285   8e-82    
gb|KGN53513.1|  hypothetical protein Csa_4G063470                       281   2e-81    
ref|XP_006391648.1|  hypothetical protein EUTSA_v10023365mg             289   3e-81    
ref|XP_011078003.1|  PREDICTED: regulatory protein NPR1-like isof...    289   3e-81    
emb|CDY34413.1|  BnaA09g11550D                                          287   1e-80    
ref|XP_002969566.1|  hypothetical protein SELMODRAFT_91353              278   4e-80    
ref|XP_006645596.1|  PREDICTED: regulatory protein NPR1-like            282   5e-80    
ref|XP_003564857.1|  PREDICTED: regulatory protein NPR1 isoform X2      285   6e-80    
gb|EMS49421.1|  Regulatory protein NPR3                                 285   7e-80    
ref|XP_010545358.1|  PREDICTED: regulatory protein NPR1                 285   8e-80    
gb|ABR46023.1|  non-expressor of PR1                                    285   1e-79    
gb|ABR46027.1|  non-expressor of PR1                                    285   1e-79    
ref|NP_176610.1|  Regulatory protein NPR1                               285   1e-79    
gb|ABR46021.1|  non-expressor of PR1                                    284   1e-79    
gb|ABR46031.1|  non-expressor of PR1                                    284   2e-79    
gb|AAM65726.1|  Regulatory protein NPR1 (Nonexpresser of PR genes...    283   3e-79    
gb|KDO81142.1|  hypothetical protein CISIN_1g0161611mg                  267   8e-79    
gb|ABR46016.1|  non-expressor of PR1                                    282   8e-79    
emb|CAJ19095.1|  NPR1-like 1 protein                                    281   9e-79    
ref|XP_002886354.1|  non-expressor of PR1                               281   1e-78    
gb|KDO40807.1|  hypothetical protein CISIN_1g014994mg                   275   3e-78    
gb|ABR46014.1|  non-expressor of PR1                                    280   4e-78    
gb|ABR46015.1|  non-expressor of PR1                                    280   5e-78    
gb|ABR46032.1|  non-expressor of PR1                                    280   5e-78    
ref|XP_010430550.1|  PREDICTED: regulatory protein NPR1 isoform X1      280   6e-78    
ref|XP_010430551.1|  PREDICTED: regulatory protein NPR1 isoform X2      280   7e-78    
ref|XP_010430552.1|  PREDICTED: regulatory protein NPR1 isoform X3      280   7e-78    
ref|XP_010915287.1|  PREDICTED: regulatory protein NPR1-like isof...    277   9e-78    
gb|ABR46012.1|  non-expressor of PR1                                    279   1e-77    
gb|AGH18701.1|  NPR1-like 1 protein                                     278   1e-77    
ref|XP_006302049.1|  hypothetical protein CARUB_v10020031mg             279   1e-77    
ref|XP_009112889.1|  PREDICTED: regulatory protein NPR1                 276   5e-77    
ref|XP_010473687.1|  PREDICTED: regulatory protein NPR1-like            276   1e-76    
ref|NP_001042286.1|  Os01g0194300                                       275   1e-76    
gb|AAX18700.1|  NPR1-like 1                                             275   2e-76    
ref|XP_002455011.1|  hypothetical protein SORBIDRAFT_03g002980          275   2e-76    
tpg|DAA52994.1|  TPA: regulatory protein NPR1                           275   2e-76    
ref|NP_001152107.1|  LOC100285744                                       271   3e-76    
ref|XP_010418483.1|  PREDICTED: regulatory protein NPR1-like            274   5e-76    
emb|CDY25575.1|  BnaC09g12000D                                          272   2e-75    
gb|AAP92751.1|  NPR1-like protein                                       271   6e-75    
gb|AES65476.2|  regulatory protein NPR1                                 271   7e-75    
ref|XP_003595225.1|  NPR1                                               271   7e-75    
ref|XP_006492802.1|  PREDICTED: regulatory protein NPR3-like            263   2e-74    
ref|XP_004968514.1|  PREDICTED: regulatory protein NPR1-like            268   4e-74    
ref|XP_009412232.1|  PREDICTED: regulatory protein NPR1-like            267   1e-73    
ref|NP_194342.1|  regulatory protein NPR2                               268   1e-73    
ref|XP_006413228.1|  hypothetical protein EUTSA_v10024745mg             267   2e-73    
ref|XP_010433547.1|  PREDICTED: regulatory protein NPR2-like isof...    267   2e-73    
ref|XP_010924981.1|  PREDICTED: regulatory protein NPR1-like isof...    263   7e-73    
ref|XP_010924982.1|  PREDICTED: regulatory protein NPR1-like isof...    262   8e-73    
ref|XP_009385599.1|  PREDICTED: regulatory protein NPR1-like isof...    263   2e-72    
ref|XP_010438799.1|  PREDICTED: regulatory protein NPR2-like            263   4e-72    
ref|XP_006413224.1|  hypothetical protein EUTSA_v10024746mg             263   5e-72    
ref|XP_002869627.1|  ankyrin repeat family protein                      263   6e-72    
ref|XP_010448322.1|  PREDICTED: regulatory protein NPR2-like            263   1e-71    
ref|XP_009392990.1|  PREDICTED: regulatory protein NPR1-like isof...    261   1e-71    
gb|ABA60143.1|  NPR1-like protein                                       251   2e-71    
gb|AHF20182.1|  non-expressor of pr1                                    261   2e-71    
gb|ABA60144.1|  NPR1-like protein                                       250   2e-71    
gb|ABA60145.1|  NPR1-like protein                                       250   2e-71    
gb|ABA41258.1|  NPR1-like protein                                       250   3e-71    
ref|XP_006437109.1|  hypothetical protein CICLE_v10031627mg             255   3e-71    
ref|XP_010047548.1|  PREDICTED: regulatory protein NPR1 isoform X2      259   3e-71    
emb|CDY50004.1|  BnaC08g12110D                                          260   5e-71    
gb|ABA60146.1|  NPR1-like protein                                       248   8e-71    
gb|KFK29121.1|  hypothetical protein AALP_AA7G091600                    259   1e-70    
tpg|DAA46595.1|  TPA: hypothetical protein ZEAMMB73_803115              247   1e-70    
gb|ABR21207.1|  putative NPR1                                           258   1e-70    
emb|CDX89364.1|  BnaA01g15290D                                          258   3e-70    
ref|XP_009139896.1|  PREDICTED: regulatory protein NPR1-like            257   4e-70    
gb|ABA60140.1|  NPR1-like protein                                       245   7e-70    
gb|ABA60139.1|  NPR1-like protein                                       245   1e-69    
gb|AAV52267.1|  putative NPR1 transcriptional factor                    256   1e-69    
gb|KFK36581.1|  hypothetical protein AALP_AA4G142100                    256   1e-69    
gb|ABA38918.1|  NPR1-like protein                                       244   2e-69    
gb|AAM88865.2|AF527176_1  putative NPR1                                 254   3e-69    
gb|ABA38913.1|  NPR1-like protein                                       244   4e-69    
emb|CDX94376.1|  BnaC01g18080D                                          255   4e-69    
gb|ABA41259.1|  NPR1-like protein                                       242   1e-68    
ref|XP_006283373.1|  hypothetical protein CARUB_v10004416mg             252   3e-68    
gb|ABB59684.1|  NPR1-like protein                                       241   3e-68    
gb|ABA38912.1|  NPR1-like protein                                       241   4e-68    
gb|ABC94642.2|  NPR1                                                    252   4e-68    
gb|ABA38914.1|  NPR1-like protein                                       241   4e-68    
gb|ABB59685.1|  NPR1-like protein                                       239   1e-67    
ref|XP_009109186.1|  PREDICTED: regulatory protein NPR1-like            251   1e-67    
gb|ABA38915.1|  NPR1-like protein                                       239   2e-67    
gb|ABA41263.1|  NPR1-like protein                                       239   3e-67    
gb|ABA41265.1|  NPR1-like protein                                       238   3e-67    



>ref|XP_009786789.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X1 
[Nicotiana sylvestris]
Length=390

 Score =   540 bits (1391),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 283/393 (72%), Positives = 327/393 (83%), Gaps = 17/393 (4%)
 Frame = +1

Query  2404  LLGNGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKES  2583
             +LG+G  QTPSR +LL MVKK+S  LGKTIVE+E+ SDVE DP FWH+++D+YF+ G+ES
Sbjct  1     MLGDGA-QTPSRSDLLCMVKKNSNMLGKTIVEDEETSDVETDPIFWHDIMDVYFIRGRES  59

Query  2584  RGRQEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYL  2763
             RGRQEDDL+FFV+K+ LQ + SN +   NSPYFVRRW+PKLDDL G +S  VDWRRS+YL
Sbjct  60    RGRQEDDLVFFVKKLHLQNHGSNEDESVNSPYFVRRWAPKLDDLTGASSSDVDWRRSFYL  119

Query  2764  NLIAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVET  2943
             NLIA T+FSVTVAICS +VLKNYQTGKD+PLSPIYKV+KTVYASPSRINFHLDSRKEVET
Sbjct  120   NLIAQTSFSVTVAICSQQVLKNYQTGKDRPLSPIYKVIKTVYASPSRINFHLDSRKEVET  179

Query  2944  TPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPS----------DSSQSE  3093
             T AYP+ICFAVDDFDSTFDAVVLTDVDHCYCV+LNA+DGAAFPS          +SS+S+
Sbjct  180   TSAYPEICFAVDDFDSTFDAVVLTDVDHCYCVLLNAHDGAAFPSERKQQDYSPANSSKSD  239

Query  3094  TSGGKTQSSKITIFSGFVSYQMVRDAYDAGRTgfgsllslhssgKTDRIYMKGPGGRGEV  3273
             TS GK  +SKIT+FSGFVSYQMVRDAYDAGR+GFGSLLSLHS GKTDRIYMKGPGGRGEV
Sbjct  240   TSSGKVPTSKITLFSGFVSYQMVRDAYDAGRSGFGSLLSLHSVGKTDRIYMKGPGGRGEV  299

Query  3274  EVAVSGVVDQSKEEYGHHP----PKKGLsfsavvrraasvasvaakhayaaasatrssDE  3441
             EVAVSGVVDQSK+++ HH      +KGL  S       + +  +    +A A+A+ + DE
Sbjct  300   EVAVSGVVDQSKQDFSHHSVDNDSRKGL--SFSAVVRRAASVASEAAKHAYAAASATRDE  357

Query  3442  EMIPLKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
              MIPLKCCLMSISLPWEHIAHDLL KGSPPVNL
Sbjct  358   GMIPLKCCLMSISLPWEHIAHDLLFKGSPPVNL  390



>ref|XP_009786790.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X2 
[Nicotiana sylvestris]
Length=387

 Score =   531 bits (1369),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 281/393 (72%), Positives = 326/393 (83%), Gaps = 20/393 (5%)
 Frame = +1

Query  2404  LLGNGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKES  2583
             +LG+G  QTPSR +LL MVKK+S  LGKTIVE+E+ SDVE DP FWH+++D+YF+ G+ES
Sbjct  1     MLGDGA-QTPSRSDLLCMVKKNSNMLGKTIVEDEETSDVETDPIFWHDIMDVYFIRGRES  59

Query  2584  RGRQEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYL  2763
             RGRQEDDL+FFV+K++   + SN +   NSPYFVRRW+PKLDDL G +S  VDWRRS+YL
Sbjct  60    RGRQEDDLVFFVKKLN---HGSNEDESVNSPYFVRRWAPKLDDLTGASSSDVDWRRSFYL  116

Query  2764  NLIAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVET  2943
             NLIA T+FSVTVAICS +VLKNYQTGKD+PLSPIYKV+KTVYASPSRINFHLDSRKEVET
Sbjct  117   NLIAQTSFSVTVAICSQQVLKNYQTGKDRPLSPIYKVIKTVYASPSRINFHLDSRKEVET  176

Query  2944  TPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPS----------DSSQSE  3093
             T AYP+ICFAVDDFDSTFDAVVLTDVDHCYCV+LNA+DGAAFPS          +SS+S+
Sbjct  177   TSAYPEICFAVDDFDSTFDAVVLTDVDHCYCVLLNAHDGAAFPSERKQQDYSPANSSKSD  236

Query  3094  TSGGKTQSSKITIFSGFVSYQMVRDAYDAGRTgfgsllslhssgKTDRIYMKGPGGRGEV  3273
             TS GK  +SKIT+FSGFVSYQMVRDAYDAGR+GFGSLLSLHS GKTDRIYMKGPGGRGEV
Sbjct  237   TSSGKVPTSKITLFSGFVSYQMVRDAYDAGRSGFGSLLSLHSVGKTDRIYMKGPGGRGEV  296

Query  3274  EVAVSGVVDQSKEEYGHHP----PKKGLsfsavvrraasvasvaakhayaaasatrssDE  3441
             EVAVSGVVDQSK+++ HH      +KGL  S       + +  +    +A A+A+ + DE
Sbjct  297   EVAVSGVVDQSKQDFSHHSVDNDSRKGL--SFSAVVRRAASVASEAAKHAYAAASATRDE  354

Query  3442  EMIPLKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
              MIPLKCCLMSISLPWEHIAHDLL KGSPPVNL
Sbjct  355   GMIPLKCCLMSISLPWEHIAHDLLFKGSPPVNL  387



>ref|XP_011069807.1| PREDICTED: uncharacterized protein KIAA0930 homolog [Sesamum 
indicum]
Length=395

 Score =   525 bits (1353),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 291/396 (73%), Positives = 331/396 (84%), Gaps = 18/396 (5%)
 Frame = +1

Query  2404  LLGNGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKES  2583
             +LG+G  QTP+R ELLSMV+KHSK +G+TI+EE +  DVEMD  FWH++LDLYFV  +ES
Sbjct  1     MLGDGS-QTPTRHELLSMVRKHSKLIGQTILEENETDDVEMDSAFWHDILDLYFVRSRES  59

Query  2584  RGRQEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYL  2763
             RGR++DDLIFFVRK++LQ  + + N E NSPYFVRRW+PKLDDL+GENS+ VDWRRS+YL
Sbjct  60    RGREDDDLIFFVRKLNLQAQKPSDNVESNSPYFVRRWAPKLDDLIGENSIYVDWRRSFYL  119

Query  2764  NLIAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVET  2943
             NLIAHT+FSVTVAICSH+VL+ Y   + K LSPIYKVVKTVYASPSRINFHLDSRKEVET
Sbjct  120   NLIAHTSFSVTVAICSHQVLRQYHASQGKTLSPIYKVVKTVYASPSRINFHLDSRKEVET  179

Query  2944  TPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFP----------SDSSQSE  3093
             TPAYPDICFAVDDFDSTFDAVVLTD DHCYCV+LNA+DGAAFP          SD S SE
Sbjct  180   TPAYPDICFAVDDFDSTFDAVVLTDTDHCYCVLLNAHDGAAFPCEKKPEQPAGSDISSSE  239

Query  3094  --TSGGKTQSSKITIFSGFVSYQMVRDAYDAGRTg-fgsllslhssgKTDRIYMKGPGGR  3264
               T GGK ++SKIT+FSGFVSYQMVR+AYDAGRTG    L   HSSGKTDRIYMKGPGGR
Sbjct  240   NVTGGGKIKNSKITLFSGFVSYQMVREAYDAGRTGFGSLLSLGHSSGKTDRIYMKGPGGR  299

Query  3265  GEVEVAVSGVVDQSKEEYGHHPP----KKGLsfsavvrraasvasvaakhayaaasatrs  3432
             GEVEVAVSGV+DQSK E G   P    K+GL    +VR AASVAS AAKHAYAAAS++R 
Sbjct  300   GEVEVAVSGVLDQSKMELGPQSPIQISKRGLGIGTIVRTAASVASTAAKHAYAAASSSRP  359

Query  3433  sDEEMIPLKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
             ++EEM+PLKCCLMSISLPWE+IAHDLL KGSPPVNL
Sbjct  360   TEEEMLPLKCCLMSISLPWENIAHDLLFKGSPPVNL  395



>ref|XP_004238070.1| PREDICTED: uncharacterized protein KIAA0930 homolog [Solanum 
lycopersicum]
Length=389

 Score =   525 bits (1351),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 280/393 (71%), Positives = 320/393 (81%), Gaps = 18/393 (5%)
 Frame = +1

Query  2404  LLGNGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKES  2583
             +LG G  QTPSR ELL MVKK+SK LG+TIVE+E  SDVE DP+FWH V+D+YF+ G+ES
Sbjct  1     MLGEGA-QTPSRSELLCMVKKNSKMLGQTIVEDE-TSDVETDPRFWHGVMDVYFIRGRES  58

Query  2584  RGRQEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYL  2763
             RGRQEDDL+FFV+K+ LQ + SN N   NSPYFVRRW+PKLDDL+G ++  VDWRRS+YL
Sbjct  59    RGRQEDDLVFFVKKLHLQKHGSNENESANSPYFVRRWAPKLDDLIGASASDVDWRRSFYL  118

Query  2764  NLIAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVET  2943
             NLIA T+FSVTVAICS +VL+NYQTGKD+PLSPIYKVVKTVYASPSRINFHLDSRKEVET
Sbjct  119   NLIAQTSFSVTVAICSQQVLQNYQTGKDRPLSPIYKVVKTVYASPSRINFHLDSRKEVET  178

Query  2944  TPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDSSQSETS--------  3099
             T AYP+ICFAVDDFDSTFDAVVLTDVDHCYCV+LNA+DGAAFP +  + + S        
Sbjct  179   TSAYPEICFAVDDFDSTFDAVVLTDVDHCYCVLLNAHDGAAFPRERIRQDCSPADTSSSD  238

Query  3100  --GGKTQSSKITIFSGFVSYQMVRDAYDAGRTgfgsllslhssgKTDRIYMKGPGGRGEV  3273
                GK  +SKIT+FSGFVSYQMVRDAYDAGR+GFGSLLSLHS GKTDRIYMKGPGGRGEV
Sbjct  239   TSSGKAPTSKITLFSGFVSYQMVRDAYDAGRSGFGSLLSLHSVGKTDRIYMKGPGGRGEV  298

Query  3274  EVAVSGVVDQSKEEYGH----HPPKKGLsfsavvrraasvasvaakhayaaasatrssDE  3441
             EVAVSGVVDQSK++       H  KKGL  S       + +  +    +A A+A+ + DE
Sbjct  299   EVAVSGVVDQSKQDLSQNSVDHDSKKGL--SFSAVVRRAASVASEAAKHAYAAASATRDE  356

Query  3442  EMIPLKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
              MIPLKCCLMSISLPWEHIAHDLL KGSPPVNL
Sbjct  357   GMIPLKCCLMSISLPWEHIAHDLLFKGSPPVNL  389



>ref|XP_011085427.1| PREDICTED: regulatory protein NPR3-like [Sesamum indicum]
 ref|XP_011085428.1| PREDICTED: regulatory protein NPR3-like [Sesamum indicum]
Length=587

 Score =   530 bits (1365),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 313/530 (59%), Positives = 389/530 (73%), Gaps = 21/530 (4%)
 Frame = -2

Query  1721  YNDADIEVEGILVGVNRGILAARSQFFHEEFkkak--kdcdgkpKFLMTELVPCGWVGYE  1548
             Y+DA+IEVEGI VGV+R ILAARSQFFHE F+KA      + K K+L++ELVP G +GYE
Sbjct  62    YSDAEIEVEGITVGVHRCILAARSQFFHEIFEKANQGSVKESKQKYLLSELVPDGRIGYE  121

Query  1547  AFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVMLI  1368
             AFMV L+Y+YTGK KASP EVSTCVDESC H AC PAI+YAV++MYASA FQIKELVM++
Sbjct  122   AFMVVLHYLYTGKVKASPSEVSTCVDESCAHDACAPAINYAVEMMYASAAFQIKELVMVV  181

Query  1367  QRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISSD  1188
             QR L   V+ A +EDVIPIL+V FR  L  L+  CV+R+  S+LD+ T+E ELP  +   
Sbjct  182   QRRLLNYVEKAFVEDVIPILMVAFRSELKQLLSHCVQRIARSDLDDITIEKELPHEVLDG  241

Query  1187  IKARRLNQQ-----------GANEKKIRKILRALDCNDVELVKLLLEESDITLDDayavh  1041
             +K+ R+  +             NEK IR+I RALD +DVELVKLLL+ES+I+LD AYA+H
Sbjct  242   VKSLRIKSKQDEEHDSVQVDSLNEKSIRRIHRALDSDDVELVKLLLDESNISLDAAYALH  301

Query  1040  yaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDAT  861
             YA AYCN K+VNEVL LG  D+NLRN+RGYTVLHVAARRKDP+I+V +L++ GAS+ D T
Sbjct  302   YATAYCNPKIVNEVLNLGNADVNLRNSRGYTVLHVAARRKDPSIVVGLLNQ-GASVSDTT  360

Query  860   CSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVS---LPSSTT  690
               +G TAVTICRR TRPKD+++ T+ G+E N DRLCIDVLE  M   NP++     SS  
Sbjct  361   -GDGQTAVTICRRLTRPKDFHEATKHGQETNKDRLCIDVLEREMRR-NPLAGNMCMSSMM  418

Query  689   LENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVGL  510
             + +DL M L  LENRVA+AR L+P EAR+ M+IAHAD+T EF GLS  +G  GN + V L
Sbjct  419   VADDLHMRLLLLENRVAMARLLFPLEARLAMQIAHADATSEFTGLSAAKGSYGNFREVDL  478

Query  509   TGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQT  330
               +P +QVKRL  R +AL+KT E GRRFF NCS+VLD+L   D   SL  LE GTPEEQ 
Sbjct  479   NEIPSEQVKRLQLRLQALQKTEETGRRFFPNCSEVLDRLLEYDTSGSL-LLEKGTPEEQR  537

Query  329   NKKRRYMELKEEVMKAFDKDMAQNR-VGLsscsssstspkmsatSKVRKK  183
              K+ RY+ELK +VMKAF+KD+A+N  V LSS  S S+S K S   KVRK+
Sbjct  538   TKRMRYIELKADVMKAFNKDIAENNWVNLSSSPSCSSSAKGSMMHKVRKR  587



>emb|CDP01019.1| unnamed protein product [Coffea canephora]
Length=390

 Score =   520 bits (1340),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 297/395 (75%), Positives = 337/395 (85%), Gaps = 21/395 (5%)
 Frame = +1

Query  2404  LLGNGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKES  2583
             +L +G  QTPSRFELLSMV+KHSKFL K   +E+D SDVEMD  FWH+VL++YFV GKES
Sbjct  1     MLRDGMTQTPSRFELLSMVRKHSKFLAKPSADEDDASDVEMDTHFWHDVLNVYFVSGKES  60

Query  2584  RGRQEDDLIFFVRKMSLQGYESNGNSE---DNSPYFVRRWSPKLDDLLGENSVGVDWRRS  2754
             RGRQEDD++FFVRK    G + NG+SE   DNSP+FVRRW+PKLD+L+G++ + VDWRRS
Sbjct  61    RGRQEDDMLFFVRK----GSDGNGSSESGEDNSPFFVRRWAPKLDELVGDSLLTVDWRRS  116

Query  2755  YYLNLIAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKE  2934
             +YLNLIAH++F+VTVAICSH+VL+NYQ+ + +PL+PIYKVVKTVYASPSRINFHLDSRK 
Sbjct  117   FYLNLIAHSSFTVTVAICSHQVLRNYQSVQGRPLAPIYKVVKTVYASPSRINFHLDSRKA  176

Query  2935  VETTPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDSSQ---------  3087
             VETT AYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFP ++ Q         
Sbjct  177   VETTAAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPYENLQQDNSSRDNF  236

Query  3088  ---SETSGGKTQSSKITIFSGFVSYQMVRDAYDAGRTgfgsllslhss-gKTDRIYMKGP  3255
                S T+  KT+SSK T+FSGFVSYQMVRDAYDAGRTGFGSLLSL  S GK DR+YMKGP
Sbjct  237   SLKSGTTAVKTKSSKTTLFSGFVSYQMVRDAYDAGRTGFGSLLSLAHSPGKADRLYMKGP  296

Query  3256  GGRGEVEVAVSGVVDQSKEEYGHHPPKKGLsfsavvrraasvasvaakhayaaasatrss  3435
             GGRGEVEVAVSGVVDQ KEE+ HH   KGLS   +VRRAASVASVAAKHAYAAAS+TRSS
Sbjct  297   GGRGEVEVAVSGVVDQGKEEWDHH-SSKGLSIGKIVRRAASVASVAAKHAYAAASSTRSS  355

Query  3436  DEEMIPLKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
              EEM+PL+CCLMSISLPWEHIAHDLL KGSPPVNL
Sbjct  356   YEEMLPLRCCLMSISLPWEHIAHDLLFKGSPPVNL  390



>ref|XP_006366625.1| PREDICTED: regulatory protein NPR3-like [Solanum tuberosum]
Length=575

 Score =   524 bits (1349),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 324/535 (61%), Positives = 402/535 (75%), Gaps = 23/535 (4%)
 Frame = -2

Query  1733  EYEDYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdgkpK--FLMTELVPCGW  1560
             EY +Y+DA+I VEGI VGVNR ILAARSQFFHE+FK+  ++     K  +L+ +LV    
Sbjct  46    EY-NYSDAEIVVEGIDVGVNRCILAARSQFFHEKFKEQNENSLKNEKPKYLLKDLVRVAS  104

Query  1559  VGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKEL  1380
             +GYE FMV LNY+YTGK K+SP EVS+CVD +C H ACRPAI+YAV+LMYAS+TFQIKEL
Sbjct  105   IGYEVFMVLLNYLYTGKIKSSPSEVSSCVDNACAHDACRPAINYAVELMYASSTFQIKEL  164

Query  1379  VMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGA  1200
             VM+++R+LD  VD A  EDVIPILLV F C    L+E C++RV  S+LDN TLE ELP  
Sbjct  165   VMVVERYLDNFVDKATPEDVIPILLVAFHCKSNQLLEHCIQRVARSDLDNATLEKELPHE  224

Query  1199  ISSDIKARRL-NQQGA----------NEKKIRKILRALDCNDVELVKLLLEESDITLDDa  1053
             + +DIK+RRL ++QG           +EK+IR+IL+AL+ +D+EL+ LLLEES++TL+DA
Sbjct  225   VLTDIKSRRLKSRQGTEQESLEEDSLSEKRIRRILKALESDDIELLTLLLEESNVTLNDA  284

Query  1052  yavhyaaaYCNSKVVNEVLGLG-KVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGAS  876
              A+HYAAAYCNSKVVNEVL LG   D+NL+N+RGY VLHVAARRK+P+II+ +L K GAS
Sbjct  285   CALHYAAAYCNSKVVNEVLELGLGADVNLQNSRGYNVLHVAARRKEPSIIMGLLAK-GAS  343

Query  875   IRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPV--SLP  702
             + D T  +GHTA++ICRR TR KDYN   E+G+  N DRLCIDVLE  M+  NP+  S+ 
Sbjct  344   VLDTT-RDGHTALSICRRLTRLKDYNDPPEQGKVTNKDRLCIDVLEREMIR-NPMIGSMS  401

Query  701   SST-TLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNL  525
             SS+  L ++L+M L   ENRVALAR L+P+EA + MEIAHADST EF GLS   GLC N 
Sbjct  402   SSSLVLADELLMRLLLFENRVALARMLFPQEAMLAMEIAHADSTAEFTGLSATNGLCRNP  461

Query  524   KGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGT  345
             +GV L  LP +QVKRL ER  AL +TVE GRRFF NCS+VLD+L  DD LDSL  LESGT
Sbjct  462   RGVDLNKLPSEQVKRLQERLVALLRTVETGRRFFPNCSEVLDRLLEDDKLDSL-MLESGT  520

Query  344   PEEQTNKKRRYMELKEEVMKAFDKDMAQ-NRVGLsscsssstspkmsatSKVRKK  183
             PEEQ +KK RY ELK+EVM+AF KD A+ N  G S+ SSSS SPK + + K RKK
Sbjct  521   PEEQRSKKMRYTELKDEVMEAFKKDKAEKNWAGFSTSSSSSCSPKTNVSHKFRKK  575



>ref|XP_009777160.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009777161.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009777162.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009777163.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009777164.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009777165.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009777166.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009777167.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009777168.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009777170.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009777171.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
Length=574

 Score =   522 bits (1345),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 317/533 (59%), Positives = 397/533 (74%), Gaps = 25/533 (5%)
 Frame = -2

Query  1736  GEYEDYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg-kpKFLMTELVPCGW  1560
              EY DY+DA+I V+GI VGVNR ILAARSQFFH++FK  +      KPK+L+ +L+P G 
Sbjct  52    AEY-DYSDAEIVVDGITVGVNRCILAARSQFFHKKFKDNENSVKEGKPKYLLKDLLPGGS  110

Query  1559  VGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKEL  1380
             +GYEAFMVFLNY+YTGK K  PPEVSTCVD +C H ACRPAI+YAV+LMYA ATFQIKEL
Sbjct  111   IGYEAFMVFLNYLYTGKLKPPPPEVSTCVDITCTHDACRPAINYAVELMYAFATFQIKEL  170

Query  1379  VMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGA  1200
             VM +QRHL  LVD A ++DVIPILLV F CSL  L+ERCV++V  S+LD FTLE ELP  
Sbjct  171   VMAVQRHLVNLVDEATVDDVIPILLVAFHCSLDLLLERCVQKVERSDLDIFTLEKELPSK  230

Query  1199  ISSDIKARRLNQQ-----------GANEKKIRKILRALDCNDVELVKLLLEESDITLDDa  1053
             + +DIKARRL  Q             +EK+IRKIL+AL+ +D+EL+KLLL ES++TL+DA
Sbjct  231   VLTDIKARRLKSQIVIEQDTMEGGSLHEKRIRKILKALESDDIELLKLLLGESNVTLNDA  290

Query  1052  yavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASI  873
              A+HYAAAYCNSKVVNEVL +G  D+NLRN+RGYTVLHV ARR +P+II+++LDK GAS 
Sbjct  291   CALHYAAAYCNSKVVNEVLKMGIADVNLRNSRGYTVLHVGARRMEPSIIMSLLDK-GASA  349

Query  872   RDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPV---SLP  702
              D T  +G TA++IC R TR KDYN+T +EGE  N DRLCIDVLE   MN NP+      
Sbjct  350   LDTTL-DGLTALSICLRVTRLKDYNETAKEGEITNKDRLCIDVLER-EMNRNPMIGNIST  407

Query  701   SSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLK  522
             SS+ + +DL+  L  LENRVA+AR ++P EA++ M+IAH +ST EF GLS +  LCG+L 
Sbjct  408   SSSVVADDLLAMLLLLENRVAMARMMFPIEAKLAMDIAHVESTSEFTGLSEINDLCGDLT  467

Query  521   GVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTP  342
             GV L G PP+ VK L ER  AL+KTV+ GRRFF NCSD+LDK+     L+ L +LESGTP
Sbjct  468   GVVLNGFPPENVKGLQERLAALQKTVDTGRRFFPNCSDILDKM-----LNPL-TLESGTP  521

Query  341   EEQTNKKRRYMELKEEVMKAFDKDMAQNRVGLsscsssstspkmsatSKVRKK  183
             EEQ +KK RY +LK++  KAF+KD A+N       SS+++SPK +   K+RKK
Sbjct  522   EEQRSKKMRYEQLKDDFEKAFNKDKAENHWAGFKTSSTTSSPKSNKRKKIRKK  574



>ref|XP_002285434.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X1 
[Vitis vinifera]
 emb|CBI19370.3| unnamed protein product [Vitis vinifera]
Length=396

 Score =   514 bits (1324),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 283/397 (71%), Positives = 332/397 (84%), Gaps = 19/397 (5%)
 Frame = +1

Query  2404  LLGNGGGQTPSRFELLSMVKKHSKFLGKTIVE-EEDPSDVEMDPQFWHEVLDLYFVCGKE  2580
             +LG+GG +TP+R+ELLSMVKKHS  L  T V+ E+D SDVEMDP FWH++LDLYF+CG+E
Sbjct  1     MLGDGG-ETPTRYELLSMVKKHSSSLKNTTVDDEQDASDVEMDPSFWHDILDLYFICGRE  59

Query  2581  SRGRQEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYY  2760
             SRGRQ+DDLIFFVRK+SL GY  N + E   PYFVRRW+PKLD L+ ENS  VDWRRS+Y
Sbjct  60    SRGRQDDDLIFFVRKLSLHGYGFNDHMEGIPPYFVRRWAPKLDKLVSENSAEVDWRRSFY  119

Query  2761  LNLIAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVE  2940
             LNLIAHT+F+VTVAICSH+VL+N+QTG+D PLSPIYKVVKTVYASPSR+ FHLDS+KEVE
Sbjct  120   LNLIAHTSFTVTVAICSHQVLRNHQTGQDSPLSPIYKVVKTVYASPSRVEFHLDSKKEVE  179

Query  2941  TTPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPS-----DSSQSETS--  3099
             T PAYPDICFAVDDFDSTFDAVVLT+ DHCYCV+LNA+DGAAFPS     D S S TS  
Sbjct  180   TIPAYPDICFAVDDFDSTFDAVVLTETDHCYCVLLNAHDGAAFPSEKTSPDCSSSNTSSL  239

Query  3100  -----GGKTQSSKITIFSGFVSYQMVRDAYDAGRTgf-gsllslhssgKTDRIYMKGPGG  3261
                    K++++K+T+FSGFVSYQMVR+AYDAG++ F   LL   S+GKTDR+YMKGPGG
Sbjct  240   RIDTDSEKSKNTKLTLFSGFVSYQMVREAYDAGKSRFGSLLLLGQSAGKTDRLYMKGPGG  299

Query  3262  RGEVEVAVSGVVDQSKEEYGH----HPPKKGLsfsavvrraasvasvaakhayaaasatr  3429
             RGEVEVAVSGV DQS++  G     H  K+G     +VR+AA+VASVAAKHAYAAA+ATR
Sbjct  300   RGEVEVAVSGVADQSQQPSGPSSPVHASKRGFGIGTIVRKAATVASVAAKHAYAAAAATR  359

Query  3430  ssDEEMIPLKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
             SSDEEM+PLKCCLMSISLPWEHIA+DL+ KGSPPVNL
Sbjct  360   SSDEEMLPLKCCLMSISLPWEHIAYDLMFKGSPPVNL  396



>emb|CDP17457.1| unnamed protein product [Coffea canephora]
Length=590

 Score =   520 bits (1338),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 300/510 (59%), Positives = 379/510 (74%), Gaps = 21/510 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcd--gkpKFLMTELVPCGWVGY  1551
             DY+DA+I VEG  VGVNR ILA+RS FFH+ FKK+        KP ++MTELVP G +GY
Sbjct  61    DYSDAEIVVEGTSVGVNRCILASRSPFFHDLFKKSNAGSANGTKPNYVMTELVPRGKIGY  120

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             E FMVFLNYVY+GK K+SP EVSTCVDESC H AC PAI+YAV+LMYASATFQ+ ELV++
Sbjct  121   ETFMVFLNYVYSGKLKSSPTEVSTCVDESCAHDACGPAINYAVELMYASATFQMNELVLV  180

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
             +QR L   VD A +EDVIPI +V F C L  L+   ++R+  S+LD+ TLE ELP  + +
Sbjct  181   VQRRLLNFVDKAFVEDVIPITIVAFHCKLNQLLSHSIQRIARSDLDDLTLEKELPHEVLT  240

Query  1190  DIKARR----LNQQGAN-------EKKIRKILRALDCNDVELVKLLLEESDITLDDayav  1044
             DIK+ R     + Q  N       +K+IR+I +ALD +DVEL++LLL ESDITLD A+ +
Sbjct  241   DIKSFRKQYDQDLQHDNGEVNFITDKRIRRIHKALDSDDVELLRLLLAESDITLDAAFGL  300

Query  1043  hyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDA  864
             HYAAAYCN KVV EVL LG  +LNLRN+RGYTVLHVAARRKDP++IV +L K GA + D+
Sbjct  301   HYAAAYCNPKVVTEVLSLGNANLNLRNSRGYTVLHVAARRKDPSVIVGLLSK-GACVSDS  359

Query  863   TCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVS---LPSST  693
             T  +G T++TICRR TRPKDYN++T++G+E N D+LCIDVLE  M+  NP++     SS 
Sbjct  360   T-DDGRTSITICRRLTRPKDYNESTKQGQETNKDKLCIDVLEREMLR-NPLAGNMSMSSM  417

Query  692   TLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVG  513
              + +DLVM L  LENRVALAR L+PREA++ MEIA+A ST EF GL+  +  CGNL+ V 
Sbjct  418   MVADDLVMRLLLLENRVALARVLFPREAKLAMEIANAHSTSEFAGLAASKASCGNLREVD  477

Query  512   LTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQ  333
             L  +P +QVKRL  R +AL+KTVE GRRFF NCS+VLD+   DD+ ++L  LE+G  EE 
Sbjct  478   LNEIPYEQVKRLQLRLQALQKTVETGRRFFPNCSEVLDRFLEDDMQETL-LLENGPLEEH  536

Query  332   TNKKRRYMELKEEVMKAFDKDMAQNR-VGL  246
             + KK RYMELK+EV+KAFDKD A+N  VGL
Sbjct  537   STKKMRYMELKDEVLKAFDKDKAENNWVGL  566



>ref|XP_009621669.1| PREDICTED: regulatory protein NPR3-like [Nicotiana tomentosiformis]
 ref|XP_009621670.1| PREDICTED: regulatory protein NPR3-like [Nicotiana tomentosiformis]
 ref|XP_009621671.1| PREDICTED: regulatory protein NPR3-like [Nicotiana tomentosiformis]
Length=571

 Score =   518 bits (1334),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 303/510 (59%), Positives = 381/510 (75%), Gaps = 26/510 (5%)
 Frame = -2

Query  1736  GEYEDYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg-kpKFLMTELVPCGW  1560
              EY DY+DA+I V+GI VGVNR ILAARSQFFH++FK+ +      KPK+L+ +LVPCG 
Sbjct  52    AEY-DYSDAEIVVDGITVGVNRCILAARSQFFHKKFKENENSVKEGKPKYLLKDLVPCGS  110

Query  1559  VGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKEL  1380
             +GYEAFMV LNY+YTGK K+ PPEVSTCVD +C H ACRPA++YAV+LMYA ATFQIKEL
Sbjct  111   IGYEAFMVLLNYLYTGKLKSPPPEVSTCVDITCTHDACRPAVNYAVELMYACATFQIKEL  170

Query  1379  VMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGA  1200
             V  +QR L  LVD A ++DVIPILLV F CSL  L+E CV++V  S+L+ FTLE ELP  
Sbjct  171   VKAVQRRLINLVDEATVDDVIPILLVAFHCSLGLLLEHCVQKVERSDLEIFTLEKELPSK  230

Query  1199  ISSDIKARRLNQQ------------GANEKKIRKILRALDCNDVELVKLLLEESDITLDD  1056
             +  DI ARRL  Q              +EK+IRKIL+AL+ +D+EL+KLLL ES++TL+D
Sbjct  231   VLIDINARRLKSQIVIEQDVIMEGGSLHEKRIRKILKALESDDIELLKLLLGESNVTLND  290

Query  1055  ayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGAS  876
             A A+HYAAAYCNSKVVNEVL LG  D+NLRN+RGYTVLH+ ARR +P+II+++LDK GAS
Sbjct  291   ACALHYAAAYCNSKVVNEVLKLGIADVNLRNSRGYTVLHIGARRMEPSIIMSLLDK-GAS  349

Query  875   IRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPV---SL  705
               D T  +G TA++IC R TR KDYN+T +EG+  N DRLCIDVLE   MN NP+     
Sbjct  350   ALDTTL-DGLTALSICLRVTRLKDYNETAKEGQITNKDRLCIDVLER-EMNRNPMIGNIA  407

Query  704   PSSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNL  525
              SS+ + ++L+  L  LENRVA+AR ++P EA++ M+IAH DST EF GLS +  LCG+L
Sbjct  408   TSSSEVADELLAMLLLLENRVAMARMMFPIEAKLAMDIAHVDSTSEFTGLSEINNLCGDL  467

Query  524   KGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGT  345
              GV L   PP++VK L ER EAL+KTV+ GRRFF NCSD+LDK+     L+ L +LESGT
Sbjct  468   TGVVLNEFPPEKVKGLQERLEALQKTVDTGRRFFPNCSDILDKM-----LNPL-TLESGT  521

Query  344   PEEQTNKKRRYMELKEEVMKAFDKDMAQNR  255
             PEEQ +KK RY +LK++  KAF+KD AQN 
Sbjct  522   PEEQRSKKMRYEQLKDDFEKAFNKDKAQNH  551



>ref|NP_001233844.1| NIM1-like protein 2 [Solanum lycopersicum]
 ref|XP_010323612.1| PREDICTED: NIM1-like protein 2 isoform X1 [Solanum lycopersicum]
 ref|XP_010323613.1| PREDICTED: NIM1-like protein 2 isoform X1 [Solanum lycopersicum]
 gb|AAT57639.1| NIM1-like protein 2 [Solanum lycopersicum]
Length=573

 Score =   517 bits (1332),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 307/506 (61%), Positives = 379/506 (75%), Gaps = 20/506 (4%)
 Frame = -2

Query  1733  EYEDYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdgkpK--FLMTELVPCGW  1560
             EY DY+DA+I VEGI VGVNR ILAARSQFFHE+FK+  ++     K  +L+ +LV    
Sbjct  46    EY-DYSDAEIVVEGINVGVNRCILAARSQFFHEKFKEKNENSLKNEKPKYLLKDLVCVSS  104

Query  1559  VGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKEL  1380
             +GYE FMV LNY+YTGK K+SP EVS+CVD +C H ACRPAI+YAV+LMYAS+TFQIKEL
Sbjct  105   IGYEVFMVLLNYLYTGKIKSSPSEVSSCVDNACAHDACRPAINYAVELMYASSTFQIKEL  164

Query  1379  VMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGA  1200
             VM ++R+LD  VD A  EDVIPILLV F      L+E C++RV  S+LDN TLE ELP  
Sbjct  165   VMFVERYLDNFVDKATPEDVIPILLVAFHRKSNQLLEHCIQRVARSDLDNATLEKELPHE  224

Query  1199  ISSDIKARRL-NQQGA--------NEKKIRKILRALDCNDVELVKLLLEESDITLDDaya  1047
             + +DIK+RRL ++QG         +EK+IR+IL+AL+ +D+EL+ LLLEES++TL+DA A
Sbjct  225   VLTDIKSRRLKSRQGTEQESLDSLSEKRIRRILKALESDDIELLTLLLEESNVTLNDACA  284

Query  1046  vhyaaaYCNSKVVNEVLGLG-KVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIR  870
             +HYAAAYCNSKVVNEVL LG   D+NL+N+RGY VLHVAARRK+P+II+ +L K GAS+ 
Sbjct  285   LHYAAAYCNSKVVNEVLELGLGADVNLQNSRGYNVLHVAARRKEPSIIMGLLAK-GASVL  343

Query  869   DATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPV---SLPS  699
             D T  +GHTA++ICRR TR KDYN   ++G+  N DRLCIDVLE  M+  NP+      S
Sbjct  344   DTT-RDGHTALSICRRLTRLKDYNDPPKQGKVTNKDRLCIDVLEREMIR-NPMIGSMCSS  401

Query  698   STTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKG  519
             S  L ++L+M L   ENRVALAR L+P+EA + MEIAHADST EF GLS   GLC N  G
Sbjct  402   SLVLADELLMRLLLFENRVALARMLFPQEAMLAMEIAHADSTAEFTGLSATNGLCKNPGG  461

Query  518   VGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPE  339
             V L  LP +QVKRL +R  AL KTV+ GRRFF NCS+VLD+L  DD LDSL  LESGTPE
Sbjct  462   VDLNKLPSEQVKRLQDRLGALLKTVDTGRRFFPNCSEVLDRLLEDDKLDSL-MLESGTPE  520

Query  338   EQTNKKRRYMELKEEVMKAFDKDMAQ  261
             EQ +KK RY ELK+EVM+AF KD A+
Sbjct  521   EQRSKKMRYTELKDEVMEAFKKDKAE  546



>ref|XP_010999903.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X1 
[Populus euphratica]
Length=394

 Score =   508 bits (1308),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 277/396 (70%), Positives = 331/396 (84%), Gaps = 19/396 (5%)
 Frame = +1

Query  2404  LLGNGGGQTPSRFELLSMVKKHSKFLGKTIVE--EEDPSDVEMDPQFWHEVLDLYFVCGK  2577
             +LG+GG +TPSRFELLSMVKKHSK LGKT VE  EED +DVEMD +FWH+VLDLYF+ GK
Sbjct  1     MLGDGG-ETPSRFELLSMVKKHSKLLGKTTVEDEEEDAADVEMDSRFWHDVLDLYFIRGK  59

Query  2578  ESRGRQEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSY  2757
             ESR +Q+DDL+FFVRK S QGY  N + E  +PYFVRRW+PK+D+L+ E+S  VDWRRS+
Sbjct  60    ESRRKQDDDLVFFVRKRSTQGYGFNDSVESAAPYFVRRWAPKMDNLVSESSAEVDWRRSF  119

Query  2758  YLNLIAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEV  2937
             YLNLIAHT+++VTVAICS +VL+N+Q G+D  LSPIYKVVKTVYASPSR+ FHLDS+KEV
Sbjct  120   YLNLIAHTSYTVTVAICSQQVLRNHQAGQDTQLSPIYKVVKTVYASPSRVYFHLDSKKEV  179

Query  2938  ETTPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSD------------S  3081
             ETTPAYPDICFAVDDFDSTFDAVVLT+ DHCYCV+LNA+DGAAFPSD            S
Sbjct  180   ETTPAYPDICFAVDDFDSTFDAVVLTERDHCYCVLLNAHDGAAFPSDKELHDGSSSSNFS  239

Query  3082  SQSETSGGKTQSSKITIFSGFVSYQMVRDAYDAGRTgfgsllslhssgKTDRIYMKGPGG  3261
              +++TS GK ++SK+T+FSGFVSYQMVR+AYDAG++     L   S GKTDR+YMKGPGG
Sbjct  240   QKNDTSSGKEKNSKLTLFSGFVSYQMVREAYDAGKS-RFGSLLGQSPGKTDRLYMKGPGG  298

Query  3262  RGEVEVAVSGVVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrs  3432
             RGEVEVAVSGV DQS+++ G   P   KKG    +V R+AASVASVAAKHA+AAAS++ S
Sbjct  299   RGEVEVAVSGVADQSQQDVGPFSPVTSKKGFGIGSVFRKAASVASVAAKHAFAAASSSIS  358

Query  3433  sDEEMIPLKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
             SD+EM+PLKCCLMSISLPWE+IA+DLL KGSPPVN+
Sbjct  359   SDDEMLPLKCCLMSISLPWEYIAYDLLFKGSPPVNM  394



>ref|XP_006433846.1| hypothetical protein CICLE_v10001411mg [Citrus clementina]
 gb|ESR47086.1| hypothetical protein CICLE_v10001411mg [Citrus clementina]
Length=394

 Score =   505 bits (1301),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 276/389 (71%), Positives = 322/389 (83%), Gaps = 16/389 (4%)
 Frame = +1

Query  2422  GQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGRQED  2601
             G+TPSR ELLSMVKKHS  LGKT+VEE+D  DVEMD +FWH+V DLYF+ GKESRGRQ+D
Sbjct  6     GETPSRSELLSMVKKHSNLLGKTLVEEQDAVDVEMDSRFWHDVFDLYFIRGKESRGRQDD  65

Query  2602  DLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLIAHT  2781
             DL+FFVRK+SL G   N N ED + YFVRRW+PKLDDLLG+N   VDWRRS+YLN+IAHT
Sbjct  66    DLLFFVRKVSLHGIVFNDNEEDLTSYFVRRWAPKLDDLLGKNLSEVDWRRSFYLNMIAHT  125

Query  2782  TFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPAYPD  2961
              FSVTVAICSH+VL+N+Q G D PLSPIYKVVKTVYASPSR+NF LDS+KEVET PAYPD
Sbjct  126   AFSVTVAICSHQVLRNHQAGTDTPLSPIYKVVKTVYASPSRVNFQLDSKKEVETKPAYPD  185

Query  2962  ICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDSS------------QSETSGG  3105
             ICFAVDDFDSTFDAVVL+D DHCYCVILNA+ GAAFPS+              +++   G
Sbjct  186   ICFAVDDFDSTFDAVVLSDTDHCYCVILNAHGGAAFPSEKEANNSSSSNSSPMKTDMDSG  245

Query  3106  KTQSSKITIFSGFVSYQMVRDAYDAGRTgf-gsllslhssgKTDRIYMKGPGGRGEVEVA  3282
             KT+++K+T+FSGFVSYQMVR+AYDAG++ F   L   HS GKTDR+YMKGPGGRGEVEVA
Sbjct  246   KTRNAKLTLFSGFVSYQMVREAYDAGKSRFGSLLSLSHSLGKTDRLYMKGPGGRGEVEVA  305

Query  3283  VSGVVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrssDEEMIP  3453
             VSGV DQS ++     P   K+G +  ++VR+AASVASVAAKHAYAAA+AT +SD+EM+P
Sbjct  306   VSGVADQSDQDSAPFSPVVSKRGFAIGSIVRKAASVASVAAKHAYAAAAATTTSDDEMLP  365

Query  3454  LKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
             LKCCLMSISLPWEHIA+DLL KGSPPVNL
Sbjct  366   LKCCLMSISLPWEHIAYDLLFKGSPPVNL  394



>ref|XP_006356844.1| PREDICTED: uncharacterized protein KIAA0930 homolog [Solanum 
tuberosum]
Length=373

 Score =   503 bits (1296),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 267/376 (71%), Positives = 307/376 (82%), Gaps = 17/376 (5%)
 Frame = +1

Query  2455  MVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGRQEDDLIFFVRKMSL  2634
             MVKK+SK LGKTIVE+E  SDVE DP+FWH V+D+YF+ G+ESRGRQEDDL+FFV+K+ L
Sbjct  1     MVKKNSKMLGKTIVEDER-SDVETDPRFWHGVMDVYFIRGRESRGRQEDDLVFFVKKLHL  59

Query  2635  QGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLIAHTTFSVTVAICSH  2814
             Q + SN +   N+PYFVRRW+PKLDDL+G ++  VDWRRS+YLNLIA T+FSVTVAICS 
Sbjct  60    QKHGSNEDESANTPYFVRRWAPKLDDLIGASASDVDWRRSFYLNLIAQTSFSVTVAICSQ  119

Query  2815  EVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPAYPDICFAVDDFDST  2994
             +VL+NYQTGKD+PLSPIYKVVKTVYASPSRINFHLDSRKEVETT AYP+ICFAVDDFDST
Sbjct  120   QVLQNYQTGKDRPLSPIYKVVKTVYASPSRINFHLDSRKEVETTSAYPEICFAVDDFDST  179

Query  2995  FDAVVLTDVDHCYCVILNANDGAAFPSDSSQSETS----------GGKTQSSKITIFSGF  3144
             FDAVVLTDVDHCYCV+LNA+DGAAFP +  + + S           GK  +SKIT+FSGF
Sbjct  180   FDAVVLTDVDHCYCVLLNAHDGAAFPRERIRQDCSPADTSSSDTSSGKAPTSKITLFSGF  239

Query  3145  VSYQMVRDAYDAGRTgfgsllslhssgKTDRIYMKGPGGRGEVEVAVSGVVDQSKEEYGH  3324
             VSYQMVRDAYDAGR+GFGSLLSLHS GKTDRIYMKGPGGRGEVEVAVSGVVDQSK++   
Sbjct  240   VSYQMVRDAYDAGRSGFGSLLSLHSVGKTDRIYMKGPGGRGEVEVAVSGVVDQSKQDLSQ  299

Query  3325  ----HPPKKGLsfsavvrraasvasvaakhayaaasatrssDEEMIPLKCCLMSISLPWE  3492
                 H  KKGL  S       + +  +    +A A+A+ + DE M PLKCCLMSISLPWE
Sbjct  300   NSVDHDSKKGL--SFSAVVRRAASVASEAAKHAYAAASATRDEGMTPLKCCLMSISLPWE  357

Query  3493  HIAHDLLLKGSPPVNL  3540
             HIAHDLL KGSPPVNL
Sbjct  358   HIAHDLLFKGSPPVNL  373



>ref|XP_002320676.1| hypothetical protein POPTR_0014s01400g [Populus trichocarpa]
 gb|EEE98991.1| hypothetical protein POPTR_0014s01400g [Populus trichocarpa]
Length=392

 Score =   504 bits (1297),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 273/394 (69%), Positives = 327/394 (83%), Gaps = 17/394 (4%)
 Frame = +1

Query  2404  LLGNGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKES  2583
             +LG+GG +TPSR ELLSMVKKHSK LGKT VEEED +DVEMD +FWH+VLDLYF+ GKES
Sbjct  1     MLGDGG-ETPSRSELLSMVKKHSKLLGKTTVEEEDAADVEMDSRFWHDVLDLYFIRGKES  59

Query  2584  RGRQEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYL  2763
             R +Q+DDL+FFVRK + QGY  N + E  + YFVRRW+PKLD+L+ E+S  VDWRRS+YL
Sbjct  60    RRKQDDDLVFFVRKRNTQGYGFNDSVESAASYFVRRWAPKLDNLVSESSAEVDWRRSFYL  119

Query  2764  NLIAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVET  2943
             NLIAHT+++VTVAICS +VL+N+Q G+D  LSPIYKVVKTVYASPSR+ FHLDS+KEVET
Sbjct  120   NLIAHTSYTVTVAICSQQVLRNHQAGQDTQLSPIYKVVKTVYASPSRVYFHLDSKKEVET  179

Query  2944  TPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDS------------SQ  3087
             TPAYPDICFAVDDFDSTFDAVVLT+ DHCYCV+LNA+DGAAFPSD              +
Sbjct  180   TPAYPDICFAVDDFDSTFDAVVLTESDHCYCVLLNAHDGAAFPSDKELQDGSSSSNFCQK  239

Query  3088  SETSGGKTQSSKITIFSGFVSYQMVRDAYDAGRTgfgsllslhssgKTDRIYMKGPGGRG  3267
             ++TS GK ++SK+T+FSGFVSYQMVR+AYDAG++     L   S GKTDR+YMKGPGGRG
Sbjct  240   NDTSPGKEKNSKLTLFSGFVSYQMVREAYDAGKS-RFGSLLGQSPGKTDRLYMKGPGGRG  298

Query  3268  EVEVAVSGVVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrssD  3438
             EVEVAVSGV DQS+++ G   P   KKG    +V  +AASVASVAAKHA+AAAS++ SSD
Sbjct  299   EVEVAVSGVADQSQQDVGPFSPVTSKKGFGIGSVFLKAASVASVAAKHAFAAASSSVSSD  358

Query  3439  EEMIPLKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
             +EM+PLKCCLMSISLPWE+IA+DLL KGSPPVN+
Sbjct  359   DEMLPLKCCLMSISLPWEYIAYDLLFKGSPPVNM  392



>gb|EYU32381.1| hypothetical protein MIMGU_mgv1a007750mg [Erythranthe guttata]
Length=396

 Score =   503 bits (1296),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 281/397 (71%), Positives = 321/397 (81%), Gaps = 19/397 (5%)
 Frame = +1

Query  2404  LLGNGGGQTPSRFELLSMVKKHSKF-LGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKE  2580
             +LG+   QTP+R ELLSMVKKHSK  L  T+ E+E  +DVEMD  FWH+++DLYFV  +E
Sbjct  1     MLGDKS-QTPTRHELLSMVKKHSKLILDTTLDEDETSADVEMDSGFWHDIIDLYFVSSRE  59

Query  2581  SRGRQEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYY  2760
             SRGR++DDL+FFVRK  L     + ++E NSPYFVRRW+PKLDDL+G+NS  +DWRRS+Y
Sbjct  60    SRGREDDDLVFFVRKTGLHAQRPSDSAEANSPYFVRRWAPKLDDLVGDNSTIIDWRRSFY  119

Query  2761  LNLIAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVE  2940
             LNLIAHTTFSVTVAICSH+VL+ Y   + K LSPIYKV+KTVYASPSRINFHLDSRKEVE
Sbjct  120   LNLIAHTTFSVTVAICSHQVLRQYHASQGKTLSPIYKVLKTVYASPSRINFHLDSRKEVE  179

Query  2941  TTPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDSSQSE---------  3093
             TTPAYP+ICFAVDDFDSTFDAVVLTD DHCYCV+LNA+DGAAFP D+   +         
Sbjct  180   TTPAYPEICFAVDDFDSTFDAVVLTDTDHCYCVLLNAHDGAAFPRDTKTEQVSSDVSSSD  239

Query  3094  ---TSGGKTQSSKITIFSGFVSYQMVRDAYDAGRTg-fgsllslhssgKTDRIYMKGPGG  3261
                 S GK + SKIT+FSGFVSYQMVR+AYDAGRTG    L   HSSG+TDRIYMKGPGG
Sbjct  240   NAAASAGKIKKSKITLFSGFVSYQMVREAYDAGRTGFGSLLSLGHSSGRTDRIYMKGPGG  299

Query  3262  RGEVEVAVSGVVDQSKEEYGHHP----PKKGLsfsavvrraasvasvaakhayaaasatr  3429
             RGEVEVAVSGV+DQSK E G H     PKKGL    +VR AASVAS AAK+AYAAAS+TR
Sbjct  300   RGEVEVAVSGVLDQSKTELGPHSPIQIPKKGLGIGTMVRTAASVASTAAKNAYAAASSTR  359

Query  3430  ssDEEMIPLKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
              SDEEM+PLKCCLMSISLPWE+IAHDLL KGSPPVNL
Sbjct  360   PSDEEMLPLKCCLMSISLPWENIAHDLLFKGSPPVNL  396



>ref|XP_006581279.1| PREDICTED: uncharacterized protein KIAA0930 homolog [Glycine 
max]
Length=394

 Score =   503 bits (1294),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 275/395 (70%), Positives = 323/395 (82%), Gaps = 17/395 (4%)
 Frame = +1

Query  2404  LLGNGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKES  2583
             +LG+GG +TPSR+ELLSMVKKHS  +GKT+VEE+D SD+EMD +FWH+V DLYFVCGKES
Sbjct  1     MLGDGG-ETPSRYELLSMVKKHSNLIGKTVVEEQDASDIEMDMRFWHDVFDLYFVCGKES  59

Query  2584  RGRQEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYL  2763
             RGRQ+DDL+FFVRK+   G  SN  +E   PYFVRRW+PKL DL+ E S+ VDWRRS+YL
Sbjct  60    RGRQDDDLVFFVRKLGSHGSGSNNKTESVDPYFVRRWAPKLSDLVDETSIDVDWRRSFYL  119

Query  2764  NLIAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVET  2943
             NLIAHT+FSVTVAICSH+ L N++ G+D PLSPIYKVVKTVYASPSR+NF LDS+KEVET
Sbjct  120   NLIAHTSFSVTVAICSHQDLLNHRAGEDTPLSPIYKVVKTVYASPSRVNFQLDSKKEVET  179

Query  2944  TPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSD------------SSQ  3087
             TPAYPDICFA+DDFDSTFDAVVLT+ DHCYCV+LNA+DGAAFPS+            S Q
Sbjct  180   TPAYPDICFAIDDFDSTFDAVVLTEKDHCYCVVLNAHDGAAFPSEKVSNDCSTSDSSSLQ  239

Query  3088  SETSGGKTQSSKITIFSGFVSYQMVRDAYDAGRTgf-gsllslhssgKTDRIYMKGPGGR  3264
               T   K + +K+T+FSGFVSYQMVRDAYDAGR+ F   L  +HSSGKTDRIYMKGPGGR
Sbjct  240   VHTISAKKKDTKLTLFSGFVSYQMVRDAYDAGRSRFGSLLSVVHSSGKTDRIYMKGPGGR  299

Query  3265  GEVEVAVSGVVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrss  3435
             GEVEVAVSGV DQS E+ G   P   KKG     +VR+AAS ASVAA+HAYAAASA+  +
Sbjct  300   GEVEVAVSGVADQSHEDSGPFSPVISKKGFGLGVIVRKAASAASVAARHAYAAASASSPT  359

Query  3436  DEEMIPLKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
              +E+IPLKC LMSISLPWE+IA+DLL KG+PPVN+
Sbjct  360   FDELIPLKCSLMSISLPWEYIAYDLLFKGAPPVNM  394



>ref|XP_009629505.1| PREDICTED: regulatory protein NPR3-like [Nicotiana tomentosiformis]
 ref|XP_009629506.1| PREDICTED: regulatory protein NPR3-like [Nicotiana tomentosiformis]
 ref|XP_009629507.1| PREDICTED: regulatory protein NPR3-like [Nicotiana tomentosiformis]
 ref|XP_009629508.1| PREDICTED: regulatory protein NPR3-like [Nicotiana tomentosiformis]
 ref|XP_009629509.1| PREDICTED: regulatory protein NPR3-like [Nicotiana tomentosiformis]
Length=579

 Score =   509 bits (1310),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 305/507 (60%), Positives = 378/507 (75%), Gaps = 21/507 (4%)
 Frame = -2

Query  1733  EYEDYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg--kpKFLMTELVPCGW  1560
             EY DY+DA+I VEGI VGVNR ILAARSQFFHE+FKK  ++     KPK+L+ +LVP   
Sbjct  51    EY-DYSDAEIVVEGISVGVNRCILAARSQFFHEKFKKHNENTSKDEKPKYLLKDLVPFAS  109

Query  1559  VGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKEL  1380
             +GYE F+VFLNY+YTGK K SP EVSTCVD  C H ACRPAI+Y V+LMYAS+TFQI EL
Sbjct  110   IGYEVFLVFLNYLYTGKIKPSPQEVSTCVDNVCAHDACRPAINYFVELMYASSTFQINEL  169

Query  1379  VMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGA  1200
              M+++R L   VD A+ EDVIPILLV F CS   L+E C++RV  S+LDN TLE EL   
Sbjct  170   AMVVERRLVNFVDKASPEDVIPILLVAFHCSSNQLLEHCIQRVAGSDLDNATLEKELRHE  229

Query  1199  ISSDIKARRLNQQ-----------GANEKKIRKILRALDCNDVELVKLLLEESDITLDDa  1053
             + +DIK RRL  +             +EK+IR+IL+AL+ +D+EL+KLLLEES++TLDDA
Sbjct  230   VLTDIKTRRLKSRQELEQDSIEVDSLSEKRIRRILKALESDDIELLKLLLEESNVTLDDA  289

Query  1052  yavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASI  873
              A+HYAAAYCNSKVVNEVL L   D+NL+N+RGY VLHVAARRK+P+II+ +L+K GAS 
Sbjct  290   CALHYAAAYCNSKVVNEVLELDLADVNLQNSRGYNVLHVAARRKEPSIIMGLLEK-GASF  348

Query  872   RDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNP---VSLP  702
              + T  +G+TA++ICRR TRPKDYN+ T++G+E N DR+CID+LE    N NP   +   
Sbjct  349   LNTT-RDGNTALSICRRLTRPKDYNEPTKQGKETNKDRICIDILER-ETNRNPMVGIMSS  406

Query  701   SSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLK  522
             SS  L ++L+M L   ENRVALAR LYP EA++ ME AHA  TLEF G+S   GL  NL+
Sbjct  407   SSLVLADELLMRLLLFENRVALARMLYPHEAKLAMEKAHAHLTLEFTGISATNGLSRNLR  466

Query  521   GVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTP  342
             GV L  LP +QVKRL ER  AL+KTVE GRRFF NCS+VLD+L  DD+LDSL +LE GT 
Sbjct  467   GVDLNELPSEQVKRLQERLCALQKTVETGRRFFPNCSEVLDRLLEDDMLDSL-TLERGTA  525

Query  341   EEQTNKKRRYMELKEEVMKAFDKDMAQ  261
             EEQ  KK RY ELK++VMKAF+KD A+
Sbjct  526   EEQRLKKMRYTELKDDVMKAFNKDKAE  552



>ref|XP_010061636.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X1 
[Eucalyptus grandis]
Length=396

 Score =   501 bits (1289),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 277/391 (71%), Positives = 322/391 (82%), Gaps = 18/391 (5%)
 Frame = +1

Query  2422  GQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGRQED  2601
             G TP+R+ELLSMVKKHS  +GKT VEE+DPSDVEMDP+FWH+V D YF+ GKESRGRQ+D
Sbjct  6     GDTPTRYELLSMVKKHSSLIGKTNVEEQDPSDVEMDPKFWHDVFDFYFIRGKESRGRQDD  65

Query  2602  DLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLIAHT  2781
             DL+FFVRKM   G  SN + +  SPYFVRRW+ +LD LLG++S  VDWRRS+YLNLIAHT
Sbjct  66    DLLFFVRKMRTHGDPSNESPDGVSPYFVRRWASELDKLLGDSSDEVDWRRSFYLNLIAHT  125

Query  2782  TFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPAYPD  2961
             +F+VTVAICSHEVL+N+Q+G+D PLSPIYKVVKTVYASPSR+NFHLDS+KEVETTPAYPD
Sbjct  126   SFTVTVAICSHEVLRNHQSGQDTPLSPIYKVVKTVYASPSRVNFHLDSKKEVETTPAYPD  185

Query  2962  ICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDSSQ------------SETSGG  3105
             ICFAVDDFDSTFDAVVL+  DHCYCV+LNA+DGAAFP+   Q            +E S G
Sbjct  186   ICFAVDDFDSTFDAVVLSSTDHCYCVLLNAHDGAAFPTQKEQNDCISSSDTPLRTEASCG  245

Query  3106  KTQSSKITIFSGFVSYQMVRDAYDAGRTgfgsl-lslhssgKTDRIYMKGPGGRGEVEVA  3282
              ++S KIT+FSGFVSYQMVR+AY+AG++ FG L    HS GK DR+YMKGPGGRGEVEVA
Sbjct  246   NSKSIKITLFSGFVSYQMVREAYNAGKSQFGGLWSLGHSLGKQDRLYMKGPGGRGEVEVA  305

Query  3283  VSGVVDQSKEEYGHHPP----KKGLsfsavvrraasvasvaakhayaaasatrssDEE-M  3447
             VSGV+DQS E+ G   P     +G    ++VR+AASVASVAAKHAYA ASAT S D+E M
Sbjct  306   VSGVIDQSNEDVGPFSPVSVSNRGFGIGSIVRKAASVASVAAKHAYAVASATTSHDDELM  365

Query  3448  IPLKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
             IPLKCCLMSISLPWEHIA+DLL KGSPPVNL
Sbjct  366   IPLKCCLMSISLPWEHIAYDLLFKGSPPVNL  396



>ref|XP_004142903.1| PREDICTED: uncharacterized protein KIAA0930 homolog [Cucumis 
sativus]
Length=393

 Score =   499 bits (1284),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 259/394 (66%), Positives = 314/394 (80%), Gaps = 16/394 (4%)
 Frame = +1

Query  2404  LLGNGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKES  2583
             +LG+GG +TP R+ELL+MVKKHS  +G+T+V+E+D SDVE DP+FWH+V+DLYF+ GKES
Sbjct  1     MLGDGG-ETPCRYELLNMVKKHSNLIGQTVVDEQDVSDVERDPRFWHDVMDLYFIRGKES  59

Query  2584  RGRQEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYL  2763
             RGRQ+DDL+FFVRK+  QGY S+ ++   SPYFVRRW+ KLD+L+G+ SV VDWRRS+YL
Sbjct  60    RGRQDDDLVFFVRKVKSQGYGSDDDNGGTSPYFVRRWASKLDNLVGDASVDVDWRRSFYL  119

Query  2764  NLIAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVET  2943
             NLIAHT+F+VTVAICSH VL+N+Q G    LSPIYKVVKTVYASPSR+NFHLDS+KEVET
Sbjct  120   NLIAHTSFTVTVAICSHLVLRNHQAGHTTSLSPIYKVVKTVYASPSRVNFHLDSKKEVET  179

Query  2944  TPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSD------------SSQ  3087
             TPAYPDICFAVDDFDSTFDAVVLT+ DHCYCV+LNA+DGAAFP+             +S 
Sbjct  180   TPAYPDICFAVDDFDSTFDAVVLTETDHCYCVLLNAHDGAAFPAKDNAENCNSSNFVASS  239

Query  3088  SETSGGKTQSSKITIFSGFVSYQMVRDAYDAGRTg-fgsllslhssgKTDRIYMKGPGGR  3264
              ++    T++SKIT+FSGFVSYQMVRDAYDAG++     L   H+SGKTD+IYMKGPGGR
Sbjct  240   LDSDSQNTKNSKITLFSGFVSYQMVRDAYDAGKSRFGSLLSLGHASGKTDKIYMKGPGGR  299

Query  3265  GEVEVAVSGVVDQSKEEYGHHPP--KKGLsfsavvrraasvasvaakhayaaasatrssD  3438
             GEVEVAVSGV DQS ++ G   P   K       + R A+  +  A     AA+++ SSD
Sbjct  300   GEVEVAVSGVADQSLQDSGPFSPVVSKTGFGIGTIVRRAASVATVAARQAYAAASSSSSD  359

Query  3439  EEMIPLKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
             +EMIPLKCCLMSISLPWE+IAHDLL KGSPPVNL
Sbjct  360   DEMIPLKCCLMSISLPWEYIAHDLLFKGSPPVNL  393



>ref|XP_007018449.1| Cw7 protein isoform 1 [Theobroma cacao]
 gb|EOY15674.1| Cw7 protein isoform 1 [Theobroma cacao]
Length=438

 Score =   500 bits (1288),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 279/390 (72%), Positives = 325/390 (83%), Gaps = 18/390 (5%)
 Frame = +1

Query  2419  GGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGRQE  2598
             G +TPSRFELLSMVKKHS  LGKT V+E D SDV+MD QFWH+V +LYFV G+ESRGRQ+
Sbjct  51    GEETPSRFELLSMVKKHSNLLGKTTVDEHDASDVQMDGQFWHDVFNLYFVRGRESRGRQD  110

Query  2599  DDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLIAH  2778
             DDLIFFVRK   +G++ N   E  +PYFVRRW+P+LD+L+G +   VDWRRS+YLN+IAH
Sbjct  111   DDLIFFVRKW--RGHDFNDKDEGFAPYFVRRWAPELDNLVGASLSDVDWRRSFYLNMIAH  168

Query  2779  TTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPAYP  2958
             T++SVTVAICSH VL+N+Q G+D PLSPIYKVVKTVYASPSR+NFHLDS+KEVETTPAYP
Sbjct  169   TSYSVTVAICSHHVLRNHQAGQDTPLSPIYKVVKTVYASPSRVNFHLDSKKEVETTPAYP  228

Query  2959  DICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPS-----DSSQS-------ETSG  3102
             DICFA+DDFDSTFDA+VLTD DHCYCV+LNA DGAAFPS     DSS S       +T+ 
Sbjct  229   DICFAIDDFDSTFDAMVLTDTDHCYCVLLNALDGAAFPSEKETNDSSSSDKLPLRVDTNS  288

Query  3103  GKTQSSKITIFSGFVSYQMVRDAYDAGRTgf-gsllslhssgKTDRIYMKGPGGRGEVEV  3279
              KT++SK+T+FSGFVSYQMVRDAYDAG + F   L   HSSGKTDR+YMKGPGG GEVEV
Sbjct  289   MKTKTSKLTLFSGFVSYQMVRDAYDAGSSRFGSLLSLGHSSGKTDRLYMKGPGGCGEVEV  348

Query  3280  AVSGVVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrssDEEMI  3450
             AVSGV DQSK++ G   P   K+G    ++VR+AASVASVAAKHAYAAA+AT +SDEEMI
Sbjct  349   AVSGVADQSKQDSGPFSPVISKRGFGLGSIVRKAASVASVAAKHAYAAAAATSTSDEEMI  408

Query  3451  PLKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
             PLKCCLMSI+LPWEHIA+DLL KGSPPVNL
Sbjct  409   PLKCCLMSITLPWEHIAYDLLFKGSPPVNL  438



>ref|XP_006472487.1| PREDICTED: uncharacterized protein LOC102625521 isoform X1 [Citrus 
sinensis]
Length=394

 Score =   498 bits (1283),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 272/389 (70%), Positives = 318/389 (82%), Gaps = 16/389 (4%)
 Frame = +1

Query  2422  GQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGRQED  2601
             G+TPSR ELLSMVKKHS  LGKT+VEE+D  DVEMD +FWH+V DLYF+ GKESRGRQ+D
Sbjct  6     GETPSRSELLSMVKKHSNLLGKTLVEEQDAVDVEMDSRFWHDVFDLYFIRGKESRGRQDD  65

Query  2602  DLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLIAHT  2781
             DL+FFVRK+ L G   N N ED + YFVRRW+PKLDDLLG+N   V WRRS+YLN+IAHT
Sbjct  66    DLLFFVRKVGLHGILFNDNEEDLTSYFVRRWAPKLDDLLGKNLSEVHWRRSFYLNMIAHT  125

Query  2782  TFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPAYPD  2961
              FSVTVAICSH+ L+N+Q G D PLSPIYKVVKTVYASPSR+NF LDS+KEVET PAYPD
Sbjct  126   AFSVTVAICSHQELRNHQAGTDTPLSPIYKVVKTVYASPSRVNFQLDSKKEVETKPAYPD  185

Query  2962  ICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDSS------------QSETSGG  3105
             ICFAVDDFDSTFDAVVL+D DHCYCVILNA+ GAAFPS+              +++   G
Sbjct  186   ICFAVDDFDSTFDAVVLSDTDHCYCVILNAHGGAAFPSEKEANNSSSSNSSPMKTDMDSG  245

Query  3106  KTQSSKITIFSGFVSYQMVRDAYDAGRTg-fgsllslhssgKTDRIYMKGPGGRGEVEVA  3282
             KT+++K+T+FSGFVSYQMVR+AYDAG++     L   HS GKTDR+YMKGPGGRGEVEVA
Sbjct  246   KTRNAKLTLFSGFVSYQMVREAYDAGKSRFGSLLSLSHSLGKTDRLYMKGPGGRGEVEVA  305

Query  3283  VSGVVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrssDEEMIP  3453
             VSGV DQS ++     P   K+G +  ++VR+AASVASVAAKHAYAAA+AT +SD+EM+P
Sbjct  306   VSGVADQSDQDSAPFSPVVSKRGFAIGSIVRKAASVASVAAKHAYAAAAATTTSDDEMLP  365

Query  3454  LKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
             LKCCLMSISLPWEHIA+DLL KGSPPVNL
Sbjct  366   LKCCLMSISLPWEHIAYDLLFKGSPPVNL  394



>ref|XP_008444527.1| PREDICTED: uncharacterized protein KIAA0930 homolog [Cucumis 
melo]
Length=393

 Score =   498 bits (1282),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 264/397 (66%), Positives = 315/397 (79%), Gaps = 22/397 (6%)
 Frame = +1

Query  2404  LLGNGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKES  2583
             +LG+GG +TP R+ELL+MVKKHS  +G+T+V+E+D SDVE DP+FWH+V+DLYF+ GKES
Sbjct  1     MLGDGG-ETPCRYELLNMVKKHSNLIGQTVVDEQDVSDVETDPRFWHDVMDLYFIRGKES  59

Query  2584  RGRQEDDLIFFVRKMSLQGYESNGNSEDN---SPYFVRRWSPKLDDLLGENSVGVDWRRS  2754
             RGRQ+DDL+FFVRK+  QGY   GN +DN   SPYFVRRW+ KLD+L+G+ SV VDWRRS
Sbjct  60    RGRQDDDLVFFVRKVKPQGY---GNDDDNGGTSPYFVRRWASKLDNLVGDASVDVDWRRS  116

Query  2755  YYLNLIAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKE  2934
             +YLNLIAHTTF+VTVAICSH VL+N+Q G    LSPIYKVVKTVYASPSR+NFHLDS+KE
Sbjct  117   FYLNLIAHTTFTVTVAICSHLVLRNHQAGHTTSLSPIYKVVKTVYASPSRVNFHLDSKKE  176

Query  2935  VETTPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPS-------DSSQ--  3087
             VETTPAYPDICFAVDDFDSTFDAVVLT+ DHCYCV+LNA+DGAAFP+       DSS   
Sbjct  177   VETTPAYPDICFAVDDFDSTFDAVVLTETDHCYCVLLNAHDGAAFPAKDNAENCDSSNFV  236

Query  3088  ---SETSGGKTQSSKITIFSGFVSYQMVRDAYDAGRTg-fgsllslhssgKTDRIYMKGP  3255
                 ++    T++SKIT+FSGFVSYQMVRDAYDAG++     L   H+SGKTD+IYMKGP
Sbjct  237   VSSMDSDSQNTKNSKITLFSGFVSYQMVRDAYDAGKSRFGSLLSLGHASGKTDKIYMKGP  296

Query  3256  GGRGEVEVAVSGVVDQSKEEYGHHPP--KKGLsfsavvrraasvasvaakhayaaasatr  3429
             GGRGEVEVAVSGV DQS ++ G   P   K       + R A+  +  A     AA+++ 
Sbjct  297   GGRGEVEVAVSGVADQSLQDSGPFSPVVSKTGFGIGTIVRRAASVATVAARQAYAAASSS  356

Query  3430  ssDEEMIPLKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
              SD+EMIPLKCCLMSISLPWE+IAHDLL KGSPPVNL
Sbjct  357   GSDDEMIPLKCCLMSISLPWEYIAHDLLFKGSPPVNL  393



>ref|XP_010061640.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X4 
[Eucalyptus grandis]
Length=386

 Score =   496 bits (1278),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 273/381 (72%), Positives = 320/381 (84%), Gaps = 8/381 (2%)
 Frame = +1

Query  2422  GQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGRQED  2601
             G TP+R+ELLSMVKKHS  +GKT VEE+DPSDVEMDP+FWH+V D YF+ GKESRGRQ+D
Sbjct  6     GDTPTRYELLSMVKKHSSLIGKTNVEEQDPSDVEMDPKFWHDVFDFYFIRGKESRGRQDD  65

Query  2602  DLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLIAHT  2781
             DL+FFVRKM   G  SN + +  SPYFVRRW+ +LD LLG++S  VDWRRS+YLNLIAHT
Sbjct  66    DLLFFVRKMRTHGDPSNESPDGVSPYFVRRWASELDKLLGDSSDEVDWRRSFYLNLIAHT  125

Query  2782  TFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPAYPD  2961
             +F+VTVAICSHEVL+N+Q+G+D PLSPIYKVVKTVYASPSR+NFHLDS+KEVETTPAYPD
Sbjct  126   SFTVTVAICSHEVLRNHQSGQDTPLSPIYKVVKTVYASPSRVNFHLDSKKEVETTPAYPD  185

Query  2962  ICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDSSQSE--TSGGKTQSSKITIF  3135
             ICFAVDDFDSTFDAVVL+  DHCYCV+LNA+DGAAFP+   Q++  +S      ++IT+F
Sbjct  186   ICFAVDDFDSTFDAVVLSSTDHCYCVLLNAHDGAAFPTQKEQNDCISSSDTPLRTEITLF  245

Query  3136  SGFVSYQMVRDAYDAGRTgfgsl-lslhssgKTDRIYMKGPGGRGEVEVAVSGVVDQSKE  3312
             SGFVSYQMVR+AY+AG++ FG L    HS GK DR+YMKGPGGRGEVEVAVSGV+DQS E
Sbjct  246   SGFVSYQMVREAYNAGKSQFGGLWSLGHSLGKQDRLYMKGPGGRGEVEVAVSGVIDQSNE  305

Query  3313  EYGHHPP----KKGLsfsavvrraasvasvaakhayaaasatrssDEE-MIPLKCCLMSI  3477
             + G   P     +G    ++VR+AASVASVAAKHAYA ASAT S D+E MIPLKCCLMSI
Sbjct  306   DVGPFSPVSVSNRGFGIGSIVRKAASVASVAAKHAYAVASATTSHDDELMIPLKCCLMSI  365

Query  3478  SLPWEHIAHDLLLKGSPPVNL  3540
             SLPWEHIA+DLL KGSPPVNL
Sbjct  366   SLPWEHIAYDLLFKGSPPVNL  386



>gb|EYU42809.1| hypothetical protein MIMGU_mgv1a003347mg [Erythranthe guttata]
Length=591

 Score =   501 bits (1290),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 294/517 (57%), Positives = 371/517 (72%), Gaps = 26/517 (5%)
 Frame = -2

Query  1745  IDPGEYEDYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdgkpK------FLM  1584
             I   EY DY+DA+IEVEGI VGV+R ILAARS FFHE FK    +     K      +++
Sbjct  57    IGGAEY-DYSDAEIEVEGIAVGVSRCILAARSHFFHEIFKNNNAESRSSTKEGKKPKYIL  115

Query  1583  TELVPCGWVGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYAS  1404
             +ELVP G +GYEAF V LNY+YTGK KASP EV+TCVDESC H AC PAI+YAV++MYAS
Sbjct  116   SELVPHGKIGYEAFTVVLNYLYTGKVKASPAEVATCVDESCAHDACGPAINYAVEMMYAS  175

Query  1403  ATFQIKELVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFT  1224
             ATFQIKELVM++QR L   VD A +EDVIPIL+V   C+L  L+  C++R+  S+LDN  
Sbjct  176   ATFQIKELVMVVQRRLLNFVDKAFVEDVIPILIVASTCNLNELLSHCLQRIARSDLDNTI  235

Query  1223  LENELPGAISSDIKARRL---NQQ---------GANEKKIRKILRALDCNDVELVKLLLE  1080
             +E ELP    +++K+ RL   NQ+           NEK+I++I RALD NDVELVK+LLE
Sbjct  236   IEKELPYQTQNEVKSLRLKSNNQEEEHDSIQADPTNEKRIKRIHRALDSNDVELVKMLLE  295

Query  1079  ESDITLDDayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVA  900
             ES I+LD A A+HYAAAYCN K+V EVL LG  D++LR+ RGYTVLHVAARRKDP+I+V 
Sbjct  296   ESGISLDSALALHYAAAYCNPKIVAEVLNLGFADVSLRDPRGYTVLHVAARRKDPSIVVG  355

Query  899   ILDKSGASIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNG  720
             +L K GAS+ D T  +G TAVTICRR TRPKD+N+ +  G+E N DRLCIDVLE  +   
Sbjct  356   LLTK-GASVSDRT-RDGVTAVTICRRLTRPKDFNEASVHGKETNTDRLCIDVLEREIRR-  412

Query  719   NPVS---LPSSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSG  549
             NP++     SS  + +DL M L  LENRVA+AR L+P EAR+ M+IAHA+ST EF GLS 
Sbjct  413   NPLAGNMSVSSMMVADDLHMRLLLLENRVAMARTLFPLEARVAMQIAHAESTFEFAGLSA  472

Query  548   MEGLCGNLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDS  369
              +G  GN + V L  +P +QVK+L  R +AL+KTVE GRRFF NCS+VL  L  +D    
Sbjct  473   SKGSYGNFREVDLNEIPSEQVKKLHLRLQALQKTVETGRRFFPNCSEVL-DLLLEDDTLG  531

Query  368   LESLESGTPEEQTNKKRRYMELKEEVMKAFDKDMAQN  258
                LE G+PEEQ  K+ RY+ELKE+V+KAF+KD+A++
Sbjct  532   DLLLEKGSPEEQRTKRMRYIELKEDVIKAFNKDIAEH  568



>ref|XP_010273418.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X1 
[Nelumbo nucifera]
 ref|XP_010273427.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X1 
[Nelumbo nucifera]
 ref|XP_010273435.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X1 
[Nelumbo nucifera]
 ref|XP_010273444.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X1 
[Nelumbo nucifera]
Length=394

 Score =   493 bits (1270),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 268/395 (68%), Positives = 321/395 (81%), Gaps = 17/395 (4%)
 Frame = +1

Query  2404  LLGNGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKES  2583
             +LG+GG +TPSR+ELLSMV+KHS  LGKT V+E+D +D+EMD  FWH+ LDLYF+  +ES
Sbjct  1     MLGDGG-ETPSRYELLSMVRKHSNLLGKTSVDEDDGTDIEMDAGFWHDFLDLYFIRSRES  59

Query  2584  RGRQEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYL  2763
             RGRQ+DDL+FFVRKM+L GY  N N E+  PYFVRRW+PKL+ +LGEN V VDWRRS+YL
Sbjct  60    RGRQDDDLVFFVRKMNLHGYGFNDNMEELPPYFVRRWAPKLEKVLGENPVEVDWRRSFYL  119

Query  2764  NLIAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVET  2943
             NLIAHT+F+VTVAICS + L N+Q   D PLSPIYKVVKTVYASPSR+NFHLDS+KE ET
Sbjct  120   NLIAHTSFTVTVAICSIQALHNHQNEADTPLSPIYKVVKTVYASPSRVNFHLDSKKEAET  179

Query  2944  TPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDSSQS-----------  3090
              PAYPDICFAVDDFDSTFDAVVLT+ DHCYCV+LNA+DGAAFP++               
Sbjct  180   VPAYPDICFAVDDFDSTFDAVVLTETDHCYCVLLNAHDGAAFPTEKEVDGSSSSNKSSLT  239

Query  3091  -ETSGGKTQSSKITIFSGFVSYQMVRDAYDAGRTgfgsllslhssgKTDRIYMKGPGGRG  3267
              +T  G+ + SK+T+FSGFVSYQMVRDAY+AG++ FGSLLS+    K DR+YMKGPGGRG
Sbjct  240   IDTDSGRVKKSKLTLFSGFVSYQMVRDAYEAGKSRFGSLLSIGHIPKPDRLYMKGPGGRG  299

Query  3268  EVEVAVSGVVDQSKEEYGHHPP----KKGLsfsavvrraasvasvaakhayaaasatrss  3435
             EVEVAVSGV DQS++  G H P    ++G    ++VRRAAS ASVAAKHAYAAA+AT   
Sbjct  300   EVEVAVSGVADQSQQFSGPHSPLQISQRGFGIGSIVRRAASAASVAAKHAYAAAAATMRP  359

Query  3436  DEEMIPLKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
             D+EM+PLKCCLMSISLPWEHIA+DLL KG+PPV+L
Sbjct  360   DDEMLPLKCCLMSISLPWEHIAYDLLFKGNPPVSL  394



>ref|XP_004501504.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X1 
[Cicer arietinum]
Length=396

 Score =   493 bits (1270),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 279/397 (70%), Positives = 329/397 (83%), Gaps = 19/397 (5%)
 Frame = +1

Query  2404  LLGNGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKES  2583
             +LG+GG +TPSR+ELLSMVKKHS  +GKT+VEE+D SDVEMD +FWH+V DLYFV GKES
Sbjct  1     MLGDGG-ETPSRYELLSMVKKHSNLIGKTVVEEQDSSDVEMDMKFWHDVFDLYFVRGKES  59

Query  2584  RGRQEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYL  2763
             RGRQ+DDL+FFVRK+  +   SN +SE   PYFVRRW+P+L +L+ E S+ VDWRRS+YL
Sbjct  60    RGRQDDDLVFFVRKLVSRSSGSNNDSESVDPYFVRRWAPELSNLVDETSIDVDWRRSFYL  119

Query  2764  NLIAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVET  2943
             NLIAHT+FSVTVAICSH+VL+N+Q GKD  LSPIYKVVKTVYASPSR+NF LDS+KEVET
Sbjct  120   NLIAHTSFSVTVAICSHQVLQNHQAGKDTSLSPIYKVVKTVYASPSRVNFQLDSKKEVET  179

Query  2944  TPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFP----------SDSSQSE  3093
             TPAYPDICFA+DDFDSTFDAVVLT+ DHCYCV+LNA+DGAAFP          SD+S  E
Sbjct  180   TPAYPDICFAIDDFDSTFDAVVLTEKDHCYCVVLNAHDGAAFPIEEVSNDCSTSDNSSPE  239

Query  3094  ----TSGGKTQSSKITIFSGFVSYQMVRDAYDAGRTgfgsllslhss-gKTDRIYMKGPG  3258
                 T+  K + +K+T+FSGFVSYQMVRDAYDAG++ FGSLLS     GKTDRIYMKGPG
Sbjct  240   LCFGTNSTKKKDTKLTLFSGFVSYQMVRDAYDAGKSRFGSLLSGGHYPGKTDRIYMKGPG  299

Query  3259  GRGEVEVAVSGVVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatr  3429
             GRGEVEVAVSGV DQS+++ G   P   KKG     +VRRAASVASVAA+HAYAAASA+ 
Sbjct  300   GRGEVEVAVSGVSDQSQQDSGPPSPVISKKGFGIGVIVRRAASVASVAARHAYAAASASS  359

Query  3430  ssDEEMIPLKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
             S+ +EMIPLKC LMSISLPWE+IA+DLL KG+PPVN+
Sbjct  360   SNFDEMIPLKCSLMSISLPWEYIAYDLLFKGAPPVNM  396



>ref|XP_010061637.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X2 
[Eucalyptus grandis]
 gb|KCW68623.1| hypothetical protein EUGRSUZ_F02230 [Eucalyptus grandis]
Length=395

 Score =   493 bits (1269),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 272/390 (70%), Positives = 321/390 (82%), Gaps = 17/390 (4%)
 Frame = +1

Query  2422  GQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGRQED  2601
             G TP+R+ELLSMVKKHS  +GKT VEE+DPSDVEMDP+FWH+V D YF+ GKESRGRQ+D
Sbjct  6     GDTPTRYELLSMVKKHSSLIGKTNVEEQDPSDVEMDPKFWHDVFDFYFIRGKESRGRQDD  65

Query  2602  DLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLIAHT  2781
             DL+FFVRKM   G  SN + +  SPYFVRRW+ +LD LLG++S  VDWRRS+YLNLIAHT
Sbjct  66    DLLFFVRKMRTHGDPSNESPDGVSPYFVRRWASELDKLLGDSSDEVDWRRSFYLNLIAHT  125

Query  2782  TFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPAYPD  2961
             +F+VTVAICSHEVL+N+Q+G+D PLSPIYKVVKTVYASPSR+NFHLDS+KEVETTPAYPD
Sbjct  126   SFTVTVAICSHEVLRNHQSGQDTPLSPIYKVVKTVYASPSRVNFHLDSKKEVETTPAYPD  185

Query  2962  ICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDSSQ------------SETSGG  3105
             ICFAVDDFDSTFDAVVL+  DHCYCV+LNA+DGAAFP+   Q            +E S G
Sbjct  186   ICFAVDDFDSTFDAVVLSSTDHCYCVLLNAHDGAAFPTQKEQNDCISSSDTPLRTEASCG  245

Query  3106  KTQSSKITIFSGFVSYQMVRDAYDAGRTgfgsl-lslhssgKTDRIYMKGPGGRGEVEVA  3282
              ++S KIT+FSGFVSYQMVR+AY+AG++ FG L    HS GK DR+YMKGPGGRGEVEVA
Sbjct  246   NSKSIKITLFSGFVSYQMVREAYNAGKSQFGGLWSLGHSLGKQDRLYMKGPGGRGEVEVA  305

Query  3283  VSGVVDQSKEEYG---HHPPKKGLsfsavvrraasvasvaakhayaaasatrssDEE-MI  3450
             VSGV+++ K++      +   +G    ++VR+AASVASVAAKHAYA ASAT S D+E MI
Sbjct  306   VSGVIEKGKQKSSTGKRNRLTRGFGIGSIVRKAASVASVAAKHAYAVASATTSHDDELMI  365

Query  3451  PLKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
             PLKCCLMSISLPWEHIA+DLL KGSPPVNL
Sbjct  366   PLKCCLMSISLPWEHIAYDLLFKGSPPVNL  395



>gb|KDP41590.1| hypothetical protein JCGZ_15997 [Jatropha curcas]
Length=394

 Score =   493 bits (1268),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 271/390 (69%), Positives = 328/390 (84%), Gaps = 16/390 (4%)
 Frame = +1

Query  2419  GGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGRQE  2598
             G  TPSR+ELLSMVKKHSK L K    E+D SDVEMD +FW+++LDLYF+ GKESRGRQ+
Sbjct  5     GEDTPSRYELLSMVKKHSKLLSKATESEQDASDVEMDGRFWYDMLDLYFIRGKESRGRQD  64

Query  2599  DDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLIAH  2778
             DDL+FFVRKM  +GY  N   +   PYFVRRW+PKLD+L+ E+S  +DWRRS+YLNLIAH
Sbjct  65    DDLVFFVRKMGTEGYGFNDIVQGVPPYFVRRWAPKLDNLVSEHSKEIDWRRSFYLNLIAH  124

Query  2779  TTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPAYP  2958
             T+F+VTVAICSH+VL+N+Q G+D PLSPIYKVVKTVYASPSR++F LDS+KEVETTPAYP
Sbjct  125   TSFTVTVAICSHQVLRNHQAGQDAPLSPIYKVVKTVYASPSRVDFQLDSKKEVETTPAYP  184

Query  2959  DICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDSS------------QSETSG  3102
             DICFA+DDFDSTFDAVVLT+ DHCYCV+LNA+ GAAFP++              +++T+ 
Sbjct  185   DICFAIDDFDSTFDAVVLTEPDHCYCVLLNAHGGAAFPTEKGSPDTSSSSNSPLKTDTTF  244

Query  3103  GKTQSSKITIFSGFVSYQMVRDAYDAGRTgfgsllslhss-gKTDRIYMKGPGGRGEVEV  3279
              KT++SK+T+FSGFVSYQMVR+AYDAG++ FGSLLSL  S GKTD++YMKGPGGRGEVEV
Sbjct  245   AKTKNSKLTLFSGFVSYQMVREAYDAGKSRFGSLLSLGQSPGKTDKLYMKGPGGRGEVEV  304

Query  3280  AVSGVVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrssDEEMI  3450
             AVSGV DQS++++G   P   KKG    ++VR+AASVASVAAKHAYAAA+A+ SSD+EM+
Sbjct  305   AVSGVADQSQQDFGPFSPVTSKKGFGIGSIVRKAASVASVAAKHAYAAAAASTSSDDEML  364

Query  3451  PLKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
             PLKCCLMSISLPWEHIA+DLL KGSPPVNL
Sbjct  365   PLKCCLMSISLPWEHIAYDLLFKGSPPVNL  394



>ref|XP_007136782.1| hypothetical protein PHAVU_009G073700g [Phaseolus vulgaris]
 gb|ESW08776.1| hypothetical protein PHAVU_009G073700g [Phaseolus vulgaris]
Length=394

 Score =   493 bits (1268),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 270/390 (69%), Positives = 317/390 (81%), Gaps = 16/390 (4%)
 Frame = +1

Query  2419  GGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGRQE  2598
             G +TPSR+ELLSMVKKHS  +GKT+VEE+D SD+EMD +FWH+V DLYFVCGKESRGRQ+
Sbjct  5     GDETPSRYELLSMVKKHSNLIGKTVVEEQDASDIEMDMRFWHDVFDLYFVCGKESRGRQD  64

Query  2599  DDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLIAH  2778
             DDL+FFVRK+      SN  +E   PYFVRRW+PKL DL+ E S+ VDWRRS+YLNLIAH
Sbjct  65    DDLVFFVRKLGSLVSGSNNKTESVEPYFVRRWAPKLHDLVDETSIDVDWRRSFYLNLIAH  124

Query  2779  TTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPAYP  2958
             T+FSVTVAICSH+ L N++ G+DKPLSPIYK+VKTVYASPSR+NF LDS+KEVETTPAYP
Sbjct  125   TSFSVTVAICSHQDLINHRAGQDKPLSPIYKIVKTVYASPSRVNFQLDSKKEVETTPAYP  184

Query  2959  DICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDSS------------QSETSG  3102
             DICFA+DDFDSTFDAVVLT+ DHCYCV+LNA+DGAAFPS+              +  T  
Sbjct  185   DICFAIDDFDSTFDAVVLTEKDHCYCVVLNAHDGAAFPSEKVSSDCSTSNSSSLEVHTRS  244

Query  3103  GKTQSSKITIFSGFVSYQMVRDAYDAGRTgf-gsllslhssgKTDRIYMKGPGGRGEVEV  3279
              K + +K+T+FSGFVSYQMVRDAYDAGR+ F   L   HSSGKTDRIYMKGPGGRGEVEV
Sbjct  245   AKKRDTKLTLFSGFVSYQMVRDAYDAGRSRFGSLLSVGHSSGKTDRIYMKGPGGRGEVEV  304

Query  3280  AVSGVVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrssDEEMI  3450
             AVSGV DQS+E+ G   P   KKG     +VR+AAS ASVAAKHAYAAASA+ S+ +E+I
Sbjct  305   AVSGVADQSQEDSGPFSPVISKKGFGLGVIVRKAASAASVAAKHAYAAASASSSNFDELI  364

Query  3451  PLKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
             PLKC LMSISLPWE+IA+DLL KG+P VN+
Sbjct  365   PLKCSLMSISLPWEYIAYDLLFKGAPAVNM  394



>ref|XP_009759449.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X4 
[Nicotiana sylvestris]
Length=423

 Score =   493 bits (1268),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 287/377 (76%), Positives = 321/377 (85%), Gaps = 16/377 (4%)
 Frame = +1

Query  2425  QTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGRQEDD  2604
             QTPSR ELLSMVKKHS+ LGKT V+EED SDVE+DP+FWH+V+DLYF+CGKESRGRQEDD
Sbjct  7     QTPSRSELLSMVKKHSEMLGKTTVDEEDASDVEVDPRFWHDVMDLYFICGKESRGRQEDD  66

Query  2605  LIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLIAHTT  2784
             L+FFV+++     ESN   +D+SPYFVRRW+PKLDDL+G NS  VDWRRS+YLNLI+ T+
Sbjct  67    LVFFVKRIR---NESNEYVDDDSPYFVRRWAPKLDDLIGGNSSDVDWRRSFYLNLISQTS  123

Query  2785  FSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPAYPDI  2964
             FSVTV I SH VL +YQ GKD PLSPIYKVVKTVYASPSRI  HLDSRKEVETTPAYP+I
Sbjct  124   FSVTVTIYSHRVLMSYQNGKDGPLSPIYKVVKTVYASPSRIKIHLDSRKEVETTPAYPEI  183

Query  2965  CFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDSSQSE------------TSGGK  3108
             CFA+DDFDSTF AVVLTDVDHCYCV+LNA+DGAAFPS+ +  E            TS GK
Sbjct  184   CFAIDDFDSTFGAVVLTDVDHCYCVLLNAHDGAAFPSERALRESSSCDTSSSKSDTSSGK  243

Query  3109  TQSSKITIFSGFVSYQMVRDAYDAGRTgfgsllslhssgKTDRIYMKGPGGRGEVEVAVS  3288
              + SKIT+FSGF+SY+MVRDAYD GR+G GSLLSL+SSGKTDRIYMKGPGGRGEVEVAVS
Sbjct  244   VRRSKITLFSGFISYEMVRDAYDDGRSGLGSLLSLNSSGKTDRIYMKGPGGRGEVEVAVS  303

Query  3289  GVVDQSKEEYGHHPPKKGLsfsavvrraasvasvaakhayaaasatrssDEEMIPLKCCL  3468
             GVVDQSK+E GHH   KGLSF  VVRRAASVAS+AAKHAYAAASATR  D  +IPLKCCL
Sbjct  304   GVVDQSKQESGHH-STKGLSFGVVVRRAASVASMAAKHAYAAASATRCPDGGLIPLKCCL  362

Query  3469  MSISLPWEHIAHDLLLK  3519
             MSISLPWEHIAHDLL K
Sbjct  363   MSISLPWEHIAHDLLFK  379



>ref|XP_009759451.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X6 
[Nicotiana sylvestris]
Length=396

 Score =   491 bits (1263),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 291/394 (74%), Positives = 325/394 (82%), Gaps = 28/394 (7%)
 Frame = +1

Query  2425  QTPSR------------FELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFV  2568
             QTPSR             ELLSMVKKHS+ LGKT V+EED SDVE+DP+FWH+V+DLYF+
Sbjct  7     QTPSRNLCDTYKVAGNWSELLSMVKKHSEMLGKTTVDEEDASDVEVDPRFWHDVMDLYFI  66

Query  2569  CGKESRGRQEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWR  2748
             CGKESRGRQEDDL+FFV+++     ESN   +D+SPYFVRRW+PKLDDL+G NS  VDWR
Sbjct  67    CGKESRGRQEDDLVFFVKRIR---NESNEYVDDDSPYFVRRWAPKLDDLIGGNSSDVDWR  123

Query  2749  RSYYLNLIAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSR  2928
             RS+YLNLI+ T+FSVTV I SH VL +YQ GKD PLSPIYKVVKTVYASPSRI  HLDSR
Sbjct  124   RSFYLNLISQTSFSVTVTIYSHRVLMSYQNGKDGPLSPIYKVVKTVYASPSRIKIHLDSR  183

Query  2929  KEVETTPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDSSQSE-----  3093
             KEVETTPAYP+ICFA+DDFDSTF AVVLTDVDHCYCV+LNA+DGAAFPS+ +  E     
Sbjct  184   KEVETTPAYPEICFAIDDFDSTFGAVVLTDVDHCYCVLLNAHDGAAFPSERALRESSSCD  243

Query  3094  -------TSGGKTQSSKITIFSGFVSYQMVRDAYDAGRTgfgsllslhssgKTDRIYMKG  3252
                    TS GK + SKIT+FSGF+SY+MVRDAYD GR+G GSLLSL+SSGKTDRIYMKG
Sbjct  244   TSSSKSDTSSGKVRRSKITLFSGFISYEMVRDAYDDGRSGLGSLLSLNSSGKTDRIYMKG  303

Query  3253  PGGRGEVEVAVSGVVDQSKEEYGHHPPKKGLsfsavvrraasvasvaakhayaaasatrs  3432
             PGGRGEVEVAVSGVVDQSK+E GHH   KGLSF  VVRRAASVAS+AAKHAYAAASATR 
Sbjct  304   PGGRGEVEVAVSGVVDQSKQESGHH-STKGLSFGVVVRRAASVASMAAKHAYAAASATRC  362

Query  3433  sDEEMIPLKCCLMSISLPWEHIAHDLLLKGSPPV  3534
              D  +IPLKCCLMSISLPWEHIAHDLL KG PPV
Sbjct  363   PDGGLIPLKCCLMSISLPWEHIAHDLLFKGKPPV  396



>gb|AGV54635.1| hypothetical protein [Phaseolus vulgaris]
Length=394

 Score =   490 bits (1262),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 269/390 (69%), Positives = 316/390 (81%), Gaps = 16/390 (4%)
 Frame = +1

Query  2419  GGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGRQE  2598
             G +TPSR+ELLSMVKKHS  +GKT+VEE+D SD+EMD +FWH+V DLYFVCGKESRGRQ+
Sbjct  5     GDETPSRYELLSMVKKHSNLIGKTVVEEQDASDIEMDMRFWHDVFDLYFVCGKESRGRQD  64

Query  2599  DDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLIAH  2778
             DDL+FFVRK+      SN  +E   PYFVRRW+PKL DL+ E S+ VDWRRS+YLNLIAH
Sbjct  65    DDLVFFVRKLGSHVSGSNNKTESVEPYFVRRWAPKLHDLVDETSIDVDWRRSFYLNLIAH  124

Query  2779  TTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPAYP  2958
             T+FSVTVAICSH+ L N++ G+DKPLSPIYK+VKTVYASPSR+NF LD +KEVETTPAYP
Sbjct  125   TSFSVTVAICSHQDLINHRAGQDKPLSPIYKIVKTVYASPSRVNFQLDFKKEVETTPAYP  184

Query  2959  DICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDSS------------QSETSG  3102
             DICFA+DDFDSTFDAVVLT+ DHCYCV+LNA+DGAAFPS+              +  T  
Sbjct  185   DICFAIDDFDSTFDAVVLTEKDHCYCVVLNAHDGAAFPSEKVSSDCSTSNSSSLEVHTRS  244

Query  3103  GKTQSSKITIFSGFVSYQMVRDAYDAGRTgf-gsllslhssgKTDRIYMKGPGGRGEVEV  3279
              K + +K+T+FSGFVSYQMVRDAYDAGR+ F   L   HSSGKTDRIYMKGPGGRGEVEV
Sbjct  245   AKKRDTKLTLFSGFVSYQMVRDAYDAGRSRFGSLLSVGHSSGKTDRIYMKGPGGRGEVEV  304

Query  3280  AVSGVVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrssDEEMI  3450
             AVSGV DQS+E+ G   P   KKG     +VR+AAS ASVAAKHAYAAASA+ S+ +E+I
Sbjct  305   AVSGVADQSQEDSGPFSPVISKKGFGLGVIVRKAASAASVAAKHAYAAASASSSNFDELI  364

Query  3451  PLKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
             PLKC LMSISLPWE+IA+DLL KG+P VN+
Sbjct  365   PLKCSLMSISLPWEYIAYDLLFKGAPAVNM  394



>ref|XP_010687685.1| PREDICTED: uncharacterized protein LOC104901770 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=389

 Score =   489 bits (1259),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 248/387 (64%), Positives = 301/387 (78%), Gaps = 15/387 (4%)
 Frame = +1

Query  2419  GGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGRQE  2598
             GG+TPSR+ELLS+VKKHS  LGKT+V+EED SDVE+D  FWH++L+LYFV GKES+GRQ+
Sbjct  5     GGETPSRYELLSLVKKHSSLLGKTVVDEEDASDVELDQAFWHDILNLYFVQGKESKGRQD  64

Query  2599  DDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLIAH  2778
             DDLIFFVRKM+L GY +N   + N+PYFVRRW+ KLD ++G++ + VDWRRS YLNLIAH
Sbjct  65    DDLIFFVRKMNLHGYGTNDELDANAPYFVRRWASKLDKMVGDDLIEVDWRRSLYLNLIAH  124

Query  2779  TTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPAYP  2958
             T+F+VTVAICS++VL++++ G+D PLSPIYKVVKTVYASPSR+NFHLDSRKE ET PAYP
Sbjct  125   TSFTVTVAICSNQVLQHHRVGQDTPLSPIYKVVKTVYASPSRVNFHLDSRKEAETVPAYP  184

Query  2959  DICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDS---------SQSETSGGKT  3111
             DICFA+DDFDST D VVL+D DHCYCV+LNA+ GAAFPS+           ++E    KT
Sbjct  185   DICFAIDDFDSTIDTVVLSDPDHCYCVVLNAHGGAAFPSEKPEHEVIEKLQKTEGDSRKT  244

Query  3112  QSSKITIFSGFVSYQMVRDAYDAGR-TgfgsllslhssgKTDRIYMKGPGGRGEVEVAVS  3288
               +K+TIFSGFVSYQMVR+AYDAGR      L   HSSGK DRIYMKGPGGRGEVEVAVS
Sbjct  245   NKTKVTIFSGFVSYQMVREAYDAGRFRLGSLLSFSHSSGKVDRIYMKGPGGRGEVEVAVS  304

Query  3289  GVVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrssDEEMIPLK  3459
             GV DQS+   G   P   K G           + +  +     A A+A+ ++D+EM+PLK
Sbjct  305   GVEDQSQHSLGPSSPVNSKSGF--GLATIVRKAASVASVAAKQAYAAASNTTDDEMLPLK  362

Query  3460  CCLMSISLPWEHIAHDLLLKGSPPVNL  3540
             CCLMSISLPWE+IAHDLL KG PPVN+
Sbjct  363   CCLMSISLPWENIAHDLLFKGGPPVNM  389



>gb|KEH35838.1| CW7 protein, putative [Medicago truncatula]
Length=394

 Score =   488 bits (1256),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 270/395 (68%), Positives = 323/395 (82%), Gaps = 17/395 (4%)
 Frame = +1

Query  2404  LLGNGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKES  2583
             +LG+GG +TPSR+ELL MVKKHS  +GKT+VEE+D  DVEMD +FWH+V DLYFV GKES
Sbjct  1     MLGDGG-ETPSRYELLCMVKKHSNLIGKTVVEEQDAPDVEMDMKFWHDVFDLYFVRGKES  59

Query  2584  RGRQEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYL  2763
             RGRQ+DDL+FFVRK+  +   SN + E   PYFVRRW+P+L +L+ E S+ VDWRRS+YL
Sbjct  60    RGRQDDDLVFFVRKLVSRVSGSNNDPESVDPYFVRRWAPELSNLVDETSIDVDWRRSFYL  119

Query  2764  NLIAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVET  2943
             NLIAHT+FSVTVAICS +VL+N+Q G+D  LSPIYKVVKTVYASPSR+NF LDS KEVET
Sbjct  120   NLIAHTSFSVTVAICSQQVLQNHQAGRDTSLSPIYKVVKTVYASPSRVNFQLDSTKEVET  179

Query  2944  TPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDSSQSE----------  3093
             TPAYPDICFA+DDFDSTFDAVVLT+ DHCYCV+LNA+DGAAFPSD   ++          
Sbjct  180   TPAYPDICFAIDDFDSTFDAVVLTERDHCYCVVLNAHDGAAFPSDKVSNDCSTSDDSSPE  239

Query  3094  --TSGGKTQSSKITIFSGFVSYQMVRDAYDAGRTgfgsllslhss-gKTDRIYMKGPGGR  3264
               TS    + +K+T+FSGFVSYQMVRDAYDAG++ FGSLLS+    GKTDRIYMKGPGGR
Sbjct  240   VCTSSTTKKDTKLTLFSGFVSYQMVRDAYDAGKSRFGSLLSVGHFPGKTDRIYMKGPGGR  299

Query  3265  GEVEVAVSGVVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrss  3435
             GEVEVAVSGV DQS+++ G H P    KG     +VRRAA+VASVAA+HAYAAAS++ S+
Sbjct  300   GEVEVAVSGVADQSQQDSGPHSPVVSNKGFGLGVIVRRAATVASVAARHAYAAASSSSSN  359

Query  3436  DEEMIPLKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
              +EMIPLKC LMSISLPWE+IA+DLL KG+PPVN+
Sbjct  360   FDEMIPLKCSLMSISLPWEYIAYDLLFKGAPPVNM  394



>ref|XP_009375131.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009350338.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X1 
[Pyrus x bretschneideri]
Length=399

 Score =   488 bits (1255),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 269/396 (68%), Positives = 324/396 (82%), Gaps = 19/396 (5%)
 Frame = +1

Query  2404  LLGNGGGQTPSRFELLSMVKKHSKFLGKTIV--EEEDPSDVEMDPQFWHEVLDLYFVCGK  2577
             +LG+G   TPSRFELLSMVKKHS  LGKT++  +E+D SDVE+D +FWH+VLDLYFV GK
Sbjct  6     MLGHGE-DTPSRFELLSMVKKHSSLLGKTVIVADEDDTSDVELDHRFWHDVLDLYFVRGK  64

Query  2578  ESRGRQEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSY  2757
             +SRGRQ+DDL+FFVRK+S  GY  N   E  SPYFVRRW+PKLD+L+GE++V VDWRRS+
Sbjct  65    DSRGRQDDDLVFFVRKLSSYGYGFNDGKEGVSPYFVRRWAPKLDNLIGESNVDVDWRRSF  124

Query  2758  YLNLIAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEV  2937
             YLNLIAHT+F+VTVAICSH+ L+N+Q  +  PLSPIYKVVKTVYASPSR+NF LDS+KEV
Sbjct  125   YLNLIAHTSFTVTVAICSHQDLRNHQAEQRIPLSPIYKVVKTVYASPSRVNFQLDSKKEV  184

Query  2938  ETTPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDSS-----------  3084
             ETTPAYPDICFA+DDFDSTFDAVVLT+ DHCYCVILNA+DGAAFP +             
Sbjct  185   ETTPAYPDICFAIDDFDSTFDAVVLTETDHCYCVILNAHDGAAFPREKESNDCSSSDSSS  244

Query  3085  -QSETSGGKTQSSKITIFSGFVSYQMVRDAYDAGRTgfgsllslhssgKTDRIYMKGPGG  3261
              + ET+  K +++K+T+FSGFVSYQMVRDAYDAG++     L  HS GKTD++YMKGPGG
Sbjct  245   LRVETNSAKMKNTKLTLFSGFVSYQMVRDAYDAGKS-RFGNLLGHSPGKTDKLYMKGPGG  303

Query  3262  RGEVEVAVSGVVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrs  3432
             RGEVEVAVS V DQS+++ G   P   K+G    ++VR+AASVASVAAK+AYAAAS+T S
Sbjct  304   RGEVEVAVSRVADQSQQDLGPFSPVISKRGFGIGSIVRKAASVASVAAKNAYAAASSTHS  363

Query  3433  sDEEMIPLKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
              D+EM+PLKCCLMSISLPWE IA+DLL KG+PPV L
Sbjct  364   FDDEMVPLKCCLMSISLPWEQIAYDLLFKGTPPVTL  399



>ref|XP_009361048.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X2 
[Pyrus x bretschneideri]
Length=396

 Score =   487 bits (1253),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 269/396 (68%), Positives = 325/396 (82%), Gaps = 19/396 (5%)
 Frame = +1

Query  2404  LLGNGGGQTPSRFELLSMVKKHSKFLGKTIV--EEEDPSDVEMDPQFWHEVLDLYFVCGK  2577
             +LG+G  +TP+RFELLSMVKKHS  LGKT++  +E+D SDVE+D +FWH++LDLYFV GK
Sbjct  3     MLGHGE-ETPTRFELLSMVKKHSSLLGKTVIVADEDDTSDVELDHRFWHDMLDLYFVRGK  61

Query  2578  ESRGRQEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSY  2757
             +SRGRQ+DDL+FFVRK+S  GY  N   E  SPYFVRRW+ KLDDL+GE++V VDWRRS+
Sbjct  62    DSRGRQDDDLVFFVRKLSSYGYGFNDGKEGVSPYFVRRWAHKLDDLIGESNVDVDWRRSF  121

Query  2758  YLNLIAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEV  2937
             YLNLIAHT+F+VTVAICSH+ L+N+Q  +  PLSPIYKVVKTVYASPSR+NF LDS KEV
Sbjct  122   YLNLIAHTSFTVTVAICSHQDLRNHQADQGIPLSPIYKVVKTVYASPSRVNFQLDSEKEV  181

Query  2938  ETTPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFP------------SDS  3081
             ETTPAYPDICFA+DDFDSTFDAVVLT+ D+CYCVILNA+DGAAFP            S S
Sbjct  182   ETTPAYPDICFAIDDFDSTFDAVVLTETDNCYCVILNAHDGAAFPRVKESDECSSGDSSS  241

Query  3082  SQSETSGGKTQSSKITIFSGFVSYQMVRDAYDAGRTgfgsllslhssgKTDRIYMKGPGG  3261
              + ET+  KT+++K+T+FSGFVSYQMVRDAYDAG++     L  HS GKTD++YMKGPGG
Sbjct  242   LRIETNSAKTKNTKLTLFSGFVSYQMVRDAYDAGKS-RFGNLLGHSPGKTDKLYMKGPGG  300

Query  3262  RGEVEVAVSGVVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrs  3432
             RGEVE+AVSGV DQS+++ G   P   K G    ++VR+AASVASVAAK+AYAAAS+T S
Sbjct  301   RGEVEIAVSGVADQSQQDLGPFSPVISKTGFGIGSIVRKAASVASVAAKNAYAAASSTHS  360

Query  3433  sDEEMIPLKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
              D+EM+PLKCCLMSISLPWE IA+DLL KG+PPV L
Sbjct  361   FDDEMVPLKCCLMSISLPWEQIAYDLLFKGTPPVTL  396



>ref|XP_002322351.2| ankyrin repeat family protein [Populus trichocarpa]
 gb|EEF06478.2| ankyrin repeat family protein [Populus trichocarpa]
Length=587

 Score =   493 bits (1270),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 286/510 (56%), Positives = 367/510 (72%), Gaps = 21/510 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg--kpKFLMTELVPCGWVGY  1551
             DY+DADI VEG  +GV+R IL ARS+FFHE F++ K   +   KPK+ M++L+PCG VGY
Sbjct  62    DYSDADIVVEGTAIGVHRCILGARSKFFHELFRREKGSSEKEGKPKYCMSDLLPCGKVGY  121

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF++FL+Y+YTGK K SP EVSTCVD  C H ACRPAI++AV+LMYAS+ FQ+ ELV L
Sbjct  122   EAFLIFLSYLYTGKLKPSPMEVSTCVDNVCAHDACRPAINFAVELMYASSIFQVPELVSL  181

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
              QR L   V  A +ED+IPIL+V F C L+ LV +CV R+  S+LDN ++E ELP  ++ 
Sbjct  182   FQRRLQNFVGKALVEDMIPILVVAFHCQLSQLVTQCVDRIARSDLDNISIEKELPHDVAV  241

Query  1190  DIKARRLNQ-----------QGANEKKIRKILRALDCNDVELVKLLLEESDITLDDayav  1044
             +IK  R                  EK+I++I  ALD +DVELVKLLL ESDITLDDA A+
Sbjct  242   EIKLLRRKSISDEENNTEAVDALREKRIKRIHMALDSDDVELVKLLLTESDITLDDANAL  301

Query  1043  hyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDA  864
             HYAA+YC+ KVV+EVL LG  D+NLRN+RGYTVLH+AA RK+P++IV++L K GAS  D 
Sbjct  302   HYAASYCDLKVVSEVLSLGLADVNLRNSRGYTVLHIAAMRKEPSVIVSMLAK-GASALDL  360

Query  863   TCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVSLPSST---  693
             T S+G +AV+ICRR TRPKDY+  TE+G+E N DRLCID+LE  M   NP++  +S    
Sbjct  361   T-SDGQSAVSICRRLTRPKDYHAKTEQGQEANKDRLCIDILEREMRR-NPMAGSASITSH  418

Query  692   TLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVG  513
             T+ +DL M+L +LENRVA AR  +P EA++ M+IAHA +T EF GL+  +G  GNL+ V 
Sbjct  419   TMVDDLHMKLLYLENRVAFARLFFPTEAKLAMDIAHAATTPEFAGLAASKGSNGNLREVD  478

Query  512   LTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQ  333
             L   P  Q KRL  R EAL KTVE+GRR+F +CS+VLDK   DD+ D L  LE GTP+EQ
Sbjct  479   LNETPIMQNKRLRSRMEALMKTVEMGRRYFPSCSEVLDKFMEDDLPD-LFYLEKGTPDEQ  537

Query  332   TNKKRRYMELKEEVMKAFDKDMAQ-NRVGL  246
               K+ R+MELKE+V +AF KD A+ NR GL
Sbjct  538   RIKRTRFMELKEDVHRAFTKDKAEINRTGL  567



>ref|XP_010061638.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X3 
[Eucalyptus grandis]
 gb|KCW68624.1| hypothetical protein EUGRSUZ_F02230 [Eucalyptus grandis]
Length=393

 Score =   486 bits (1251),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 271/386 (70%), Positives = 316/386 (82%), Gaps = 18/386 (5%)
 Frame = +1

Query  2422  GQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGRQED  2601
             G TP+R+ELLSMVKKHS  +GKT VEE+DPSDVEMDP+FWH+V D YF+ GKESRGRQ+D
Sbjct  6     GDTPTRYELLSMVKKHSSLIGKTNVEEQDPSDVEMDPKFWHDVFDFYFIRGKESRGRQDD  65

Query  2602  DLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLIAHT  2781
             DL+FFVRKM   G  SN + +  SPYFVRRW+ +LD LLG++S  VDWRRS+YLNLIAHT
Sbjct  66    DLLFFVRKMRTHGDPSNESPDGVSPYFVRRWASELDKLLGDSSDEVDWRRSFYLNLIAHT  125

Query  2782  TFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPAYPD  2961
             +F+VTVAICSHEVL+N+Q+G+D PLSPIYKVVKTVYASPSR+NFHLDS+KEVETTPAYPD
Sbjct  126   SFTVTVAICSHEVLRNHQSGQDTPLSPIYKVVKTVYASPSRVNFHLDSKKEVETTPAYPD  185

Query  2962  ICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDSSQ------------SETSGG  3105
             ICFAVDDFDSTFDAVVL+  DHCYCV+LNA+DGAAFP+   Q            +E S G
Sbjct  186   ICFAVDDFDSTFDAVVLSSTDHCYCVLLNAHDGAAFPTQKEQNDCISSSDTPLRTEASCG  245

Query  3106  KTQSSKITIFSGFVSYQMVRDAYDAGRTgfgsl-lslhssgKTDRIYMKGPGGRGEVEVA  3282
              ++S KIT+FSGFVSYQMVR+AY+AG++ FG L    HS GK DR+YMKGPGGRGEVEVA
Sbjct  246   NSKSIKITLFSGFVSYQMVREAYNAGKSQFGGLWSLGHSLGKQDRLYMKGPGGRGEVEVA  305

Query  3283  VSGVVDQSKEEYGHHPP----KKGLsfsavvrraasvasvaakhayaaasatrssDEE-M  3447
             VSGV+DQS E+ G   P     +G    ++VR+AASVASVAAKHAYA ASAT S D+E M
Sbjct  306   VSGVIDQSNEDVGPFSPVSVSNRGFGIGSIVRKAASVASVAAKHAYAVASATTSHDDELM  365

Query  3448  IPLKCCLMSISLPWEHIAHDLLLKGS  3525
             IPLKCCLMSISLPWEHIA+DLL K S
Sbjct  366   IPLKCCLMSISLPWEHIAYDLLFKLS  391



>ref|XP_004290992.1| PREDICTED: uncharacterized protein LOC101294908 [Fragaria vesca 
subsp. vesca]
Length=386

 Score =   485 bits (1248),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 273/395 (69%), Positives = 325/395 (82%), Gaps = 25/395 (6%)
 Frame = +1

Query  2404  LLGNGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKES  2583
             +LG+G  +TPSR ELL+MVKKHS  LGKT+V   D SDVEMDP+FWH+V D YF+ GK+S
Sbjct  1     MLGDGE-ETPSRCELLTMVKKHSTLLGKTVV---DASDVEMDPRFWHDVFDFYFLRGKDS  56

Query  2584  RGRQEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYL  2763
             R RQ+DDL+FFVRK+S QG+     ++D  PYFVRRW+PKLD+LLGE ++ VDWRRS++L
Sbjct  57    RRRQDDDLVFFVRKLSSQGF-----NDDVPPYFVRRWAPKLDNLLGEKALEVDWRRSFHL  111

Query  2764  NLIAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVET  2943
             NLIAHTTF+VTVAICSH+ L+N+Q  +DKPLSPIYKVVKTVYASPSR+NFHLDS+KEVET
Sbjct  112   NLIAHTTFTVTVAICSHQDLRNHQAEQDKPLSPIYKVVKTVYASPSRVNFHLDSQKEVET  171

Query  2944  TPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDSS------------Q  3087
             TPAYPDICFAVDDFDSTFDAVVLT+ DHCYCVILNA+DGAAFP+               +
Sbjct  172   TPAYPDICFAVDDFDSTFDAVVLTETDHCYCVILNAHDGAAFPTAKEPDDCSSSDTSSLK  231

Query  3088  SETSGGKTQSSKITIFSGFVSYQMVRDAYDAGRTgfgsllslhss-gKTDRIYMKGPGGR  3264
              + S  K +SSK+T+FSGFVSYQMVRDAYDAG++ FG+LLSL  S GK DR+YMKGPGG 
Sbjct  232   VDISSVKAKSSKLTLFSGFVSYQMVRDAYDAGKSRFGNLLSLAHSPGKQDRLYMKGPGGH  291

Query  3265  GEVEVAVSGVVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrss  3435
             GEVEVAVSGVVDQS+++ G   P   K G     +VR+AASVASVAAK+AYAAA+++   
Sbjct  292   GEVEVAVSGVVDQSQQDTGPFSPVTSKTGFGIGFMVRKAASVASVAAKNAYAAAASSHGF  351

Query  3436  DEEMIPLKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
             DEE+IPLKCCLMSISLPWEHIA+DLL KG+PPVNL
Sbjct  352   DEELIPLKCCLMSISLPWEHIAYDLLFKGTPPVNL  386



>ref|XP_011040366.1| PREDICTED: regulatory protein NPR3-like isoform X2 [Populus euphratica]
Length=587

 Score =   493 bits (1268),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 286/510 (56%), Positives = 367/510 (72%), Gaps = 21/510 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg--kpKFLMTELVPCGWVGY  1551
             DY+DADI VEG  +GV+R IL ARS+FFHE F++ K   +   KPK+ M++L+PCG VGY
Sbjct  62    DYSDADIVVEGTAIGVHRCILGARSRFFHELFRREKGSSEKEGKPKYCMSDLLPCGKVGY  121

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF++FL+Y+YTGK K SP EVSTCVD  C H ACRPAI++AV+L+YAS+ FQ+ ELV L
Sbjct  122   EAFLIFLSYLYTGKLKPSPMEVSTCVDNVCAHDACRPAINFAVELLYASSIFQVPELVSL  181

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
              QR L   V  A +ED+IPIL+V F C L+ LV +CV RV  S+LDN ++E ELP  ++ 
Sbjct  182   FQRRLQNFVGKALVEDMIPILVVAFHCQLSQLVTQCVDRVARSDLDNISIEKELPHDVAV  241

Query  1190  DIKARRLNQ-----------QGANEKKIRKILRALDCNDVELVKLLLEESDITLDDayav  1044
             +IK  R                  EK+I++I  ALD +DVELVKLLL ESDITLDDA A+
Sbjct  242   EIKLLRRKSISDEENNTEAVDALREKRIKRIHMALDSDDVELVKLLLTESDITLDDANAL  301

Query  1043  hyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDA  864
             HYAA+YC+ KVV+EVL LG  D+NLRN+RGYTVLH+AA RK+P++IV++L K GAS  D 
Sbjct  302   HYAASYCDLKVVSEVLSLGLADVNLRNSRGYTVLHIAAMRKEPSVIVSMLAK-GASALDL  360

Query  863   TCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVSLPSST---  693
             T S+G +AV+ICRR TRPKDY+  TE+G+E N DRLCID+LE  M   NP++  +S    
Sbjct  361   T-SDGQSAVSICRRLTRPKDYHAKTEQGQEANKDRLCIDILEREMRR-NPMAGSASITSH  418

Query  692   TLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVG  513
             T+ +DL M+L +LENRVA AR  +P EA++ M+IAHA +T EF GL+  +G  GNL+ V 
Sbjct  419   TMVDDLHMKLLYLENRVAFARLFFPTEAKLAMDIAHAATTPEFAGLAASKGSNGNLREVD  478

Query  512   LTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQ  333
             L   P  Q KRL  R EAL KTVE+GRR+F +CS+VLDK   DD+ D L  LE GTP+EQ
Sbjct  479   LNETPIMQNKRLRSRMEALMKTVEMGRRYFPSCSEVLDKFMEDDLPD-LFYLEKGTPDEQ  537

Query  332   TNKKRRYMELKEEVMKAFDKDMAQ-NRVGL  246
               K+ R+MELKE+V +AF KD A+ NR GL
Sbjct  538   RIKRTRFMELKEDVQRAFTKDKAEINRTGL  567



>ref|XP_009786055.1| PREDICTED: regulatory protein NPR3-like isoform X2 [Nicotiana 
sylvestris]
Length=579

 Score =   489 bits (1259),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 294/506 (58%), Positives = 376/506 (74%), Gaps = 19/506 (4%)
 Frame = -2

Query  1733  EYEDYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg--kpKFLMTELVPCGW  1560
             EY DY+DA++ VEGI VGVNR ILAARSQFFHE+FKK  ++     KPK+L+ +LVP   
Sbjct  51    EY-DYSDAEVVVEGISVGVNRCILAARSQFFHEKFKKHNENTSKDEKPKYLLKDLVPFAS  109

Query  1559  VGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKEL  1380
             +GYE F VFLNY+YTGK K SPPEVSTCVD  C H ACRPAI+Y ++LMYAS+TFQI EL
Sbjct  110   IGYEVFSVFLNYLYTGKIKPSPPEVSTCVDNVCAHDACRPAINYFMELMYASSTFQINEL  169

Query  1379  VMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGA  1200
             +M+++R L   +D A  EDVIPILLV F CS   L+E C++RVT S+LDN TLE ELP  
Sbjct  170   IMVVERRLVNFIDKATPEDVIPILLVAFHCSSNQLLEHCIQRVTRSDLDNATLEKELPHE  229

Query  1199  ISSDIKARRLNQQ-----------GANEKKIRKILRALDCNDVELVKLLLEESDITLDDa  1053
             + +DIK RRL  +             +EK+IR+IL+AL+ +D+EL+KLLLEES++TLDDA
Sbjct  230   VLTDIKTRRLKSRQELEHDSIEVDSLSEKRIRRILKALESDDIELLKLLLEESNVTLDDA  289

Query  1052  yavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASI  873
              A+HYAAAYCNSKVVNEVL L   D+NL+N+RGY VLH+AARRK+P+II+ +L+K GAS+
Sbjct  290   CALHYAAAYCNSKVVNEVLELDLADVNLQNSRGYNVLHIAARRKEPSIIMGLLEK-GASV  348

Query  872   RDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVSLPSST  693
              + T  +G+TA++ICRR TRPKDYN+ T++G+E N DR+CID+LE   +    V + SS+
Sbjct  349   LNTT-RDGNTALSICRRLTRPKDYNEPTKQGKETNKDRICIDILERETIRNPMVGIMSSS  407

Query  692   T--LENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKG  519
             +  L ++L+M L   ENRVALAR L+P EA++ ME AHA+STLEF G+S   GL  NL+G
Sbjct  408   SLVLADELLMRLLLFENRVALARMLFPHEAKLAMEKAHANSTLEFTGISATNGLSRNLRG  467

Query  518   VGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPE  339
             V L  LP +QVKRL ER  AL+KTVE G+RFF NCS+VL     +D L    +LE GT E
Sbjct  468   VDLNELPSEQVKRLQERLCALQKTVETGQRFFPNCSEVL-DRLLEDDLLDSLTLERGTAE  526

Query  338   EQTNKKRRYMELKEEVMKAFDKDMAQ  261
             EQ  KK RY ELK++VM AF+KD A+
Sbjct  527   EQRLKKMRYTELKDDVMNAFNKDKAE  552



>ref|XP_009759446.1| PREDICTED: uncharacterized protein LOC104211982 isoform X1 [Nicotiana 
sylvestris]
Length=435

 Score =   484 bits (1245),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 287/389 (74%), Positives = 321/389 (83%), Gaps = 28/389 (7%)
 Frame = +1

Query  2425  QTPSR------------FELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFV  2568
             QTPSR             ELLSMVKKHS+ LGKT V+EED SDVE+DP+FWH+V+DLYF+
Sbjct  7     QTPSRNLCDTYKVAGNWSELLSMVKKHSEMLGKTTVDEEDASDVEVDPRFWHDVMDLYFI  66

Query  2569  CGKESRGRQEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWR  2748
             CGKESRGRQEDDL+FFV+++     ESN   +D+SPYFVRRW+PKLDDL+G NS  VDWR
Sbjct  67    CGKESRGRQEDDLVFFVKRIR---NESNEYVDDDSPYFVRRWAPKLDDLIGGNSSDVDWR  123

Query  2749  RSYYLNLIAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSR  2928
             RS+YLNLI+ T+FSVTV I SH VL +YQ GKD PLSPIYKVVKTVYASPSRI  HLDSR
Sbjct  124   RSFYLNLISQTSFSVTVTIYSHRVLMSYQNGKDGPLSPIYKVVKTVYASPSRIKIHLDSR  183

Query  2929  KEVETTPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDSSQSE-----  3093
             KEVETTPAYP+ICFA+DDFDSTF AVVLTDVDHCYCV+LNA+DGAAFPS+ +  E     
Sbjct  184   KEVETTPAYPEICFAIDDFDSTFGAVVLTDVDHCYCVLLNAHDGAAFPSERALRESSSCD  243

Query  3094  -------TSGGKTQSSKITIFSGFVSYQMVRDAYDAGRTgfgsllslhssgKTDRIYMKG  3252
                    TS GK + SKIT+FSGF+SY+MVRDAYD GR+G GSLLSL+SSGKTDRIYMKG
Sbjct  244   TSSSKSDTSSGKVRRSKITLFSGFISYEMVRDAYDDGRSGLGSLLSLNSSGKTDRIYMKG  303

Query  3253  PGGRGEVEVAVSGVVDQSKEEYGHHPPKKGLsfsavvrraasvasvaakhayaaasatrs  3432
             PGGRGEVEVAVSGVVDQSK+E GHH   KGLSF  VVRRAASVAS+AAKHAYAAASATR 
Sbjct  304   PGGRGEVEVAVSGVVDQSKQESGHH-STKGLSFGVVVRRAASVASMAAKHAYAAASATRC  362

Query  3433  sDEEMIPLKCCLMSISLPWEHIAHDLLLK  3519
              D  +IPLKCCLMSISLPWEHIAHDLL K
Sbjct  363   PDGGLIPLKCCLMSISLPWEHIAHDLLFK  391



>ref|XP_009786050.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009786051.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009786052.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009786054.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
Length=587

 Score =   489 bits (1258),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 294/506 (58%), Positives = 376/506 (74%), Gaps = 19/506 (4%)
 Frame = -2

Query  1733  EYEDYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg--kpKFLMTELVPCGW  1560
             EY DY+DA++ VEGI VGVNR ILAARSQFFHE+FKK  ++     KPK+L+ +LVP   
Sbjct  51    EY-DYSDAEVVVEGISVGVNRCILAARSQFFHEKFKKHNENTSKDEKPKYLLKDLVPFAS  109

Query  1559  VGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKEL  1380
             +GYE F VFLNY+YTGK K SPPEVSTCVD  C H ACRPAI+Y ++LMYAS+TFQI EL
Sbjct  110   IGYEVFSVFLNYLYTGKIKPSPPEVSTCVDNVCAHDACRPAINYFMELMYASSTFQINEL  169

Query  1379  VMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGA  1200
             +M+++R L   +D A  EDVIPILLV F CS   L+E C++RVT S+LDN TLE ELP  
Sbjct  170   IMVVERRLVNFIDKATPEDVIPILLVAFHCSSNQLLEHCIQRVTRSDLDNATLEKELPHE  229

Query  1199  ISSDIKARRLNQQ-----------GANEKKIRKILRALDCNDVELVKLLLEESDITLDDa  1053
             + +DIK RRL  +             +EK+IR+IL+AL+ +D+EL+KLLLEES++TLDDA
Sbjct  230   VLTDIKTRRLKSRQELEHDSIEVDSLSEKRIRRILKALESDDIELLKLLLEESNVTLDDA  289

Query  1052  yavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASI  873
              A+HYAAAYCNSKVVNEVL L   D+NL+N+RGY VLH+AARRK+P+II+ +L+K GAS+
Sbjct  290   CALHYAAAYCNSKVVNEVLELDLADVNLQNSRGYNVLHIAARRKEPSIIMGLLEK-GASV  348

Query  872   RDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVSLPSST  693
              + T  +G+TA++ICRR TRPKDYN+ T++G+E N DR+CID+LE   +    V + SS+
Sbjct  349   LNTT-RDGNTALSICRRLTRPKDYNEPTKQGKETNKDRICIDILERETIRNPMVGIMSSS  407

Query  692   T--LENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKG  519
             +  L ++L+M L   ENRVALAR L+P EA++ ME AHA+STLEF G+S   GL  NL+G
Sbjct  408   SLVLADELLMRLLLFENRVALARMLFPHEAKLAMEKAHANSTLEFTGISATNGLSRNLRG  467

Query  518   VGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPE  339
             V L  LP +QVKRL ER  AL+KTVE G+RFF NCS+VL     +D L    +LE GT E
Sbjct  468   VDLNELPSEQVKRLQERLCALQKTVETGQRFFPNCSEVL-DRLLEDDLLDSLTLERGTAE  526

Query  338   EQTNKKRRYMELKEEVMKAFDKDMAQ  261
             EQ  KK RY ELK++VM AF+KD A+
Sbjct  527   EQRLKKMRYTELKDDVMNAFNKDKAE  552



>gb|KGN62429.1| hypothetical protein Csa_2G354060 [Cucumis sativus]
Length=377

 Score =   481 bits (1237),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 250/378 (66%), Positives = 300/378 (79%), Gaps = 17/378 (4%)
 Frame = +1

Query  2455  MVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGRQEDDLIFFVRKMSL  2634
             MVKKHS  +G+T+V+E+D SDVE DP+FWH+V+DLYF+ GKESRGRQ+DDL+FFVRK+  
Sbjct  1     MVKKHSNLIGQTVVDEQDVSDVERDPRFWHDVMDLYFIRGKESRGRQDDDLVFFVRKVKS  60

Query  2635  QGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLIAHTTFSVTVAICSH  2814
             QGY S+ ++   SPYFVRRW+ KLD+L+G+ SV VDWRRS+YLNLIAHT+F+VTVAICSH
Sbjct  61    QGYGSDDDNGGTSPYFVRRWASKLDNLVGDASVDVDWRRSFYLNLIAHTSFTVTVAICSH  120

Query  2815  EVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPAYPDICFAVDDFDST  2994
              VL+N+Q G    LSPIYKVVKTVYASPSR+NFHLDS+KEVETTPAYPDICFAVDDFDST
Sbjct  121   LVLRNHQAGHTTSLSPIYKVVKTVYASPSRVNFHLDSKKEVETTPAYPDICFAVDDFDST  180

Query  2995  FDAVVLTDVDHCYCVILNANDGAAFPSD------------SSQSETSGGKTQSSKITIFS  3138
             FDAVVLT+ DHCYCV+LNA+DGAAFP+             +S  ++    T++SKIT+FS
Sbjct  181   FDAVVLTETDHCYCVLLNAHDGAAFPAKDNAENCNSSNFVASSLDSDSQNTKNSKITLFS  240

Query  3139  GFVSYQMVRDAYDAGRTg-fgsllslhssgKTDRIYMKGPGGRGEVEVAVSGVVDQSKEE  3315
             GFVSYQMVRDAYDAG++     L   H+SGKTD+IYMKGPGGRGEVEVAVSGV DQS ++
Sbjct  241   GFVSYQMVRDAYDAGKSRFGSLLSLGHASGKTDKIYMKGPGGRGEVEVAVSGVADQSLQD  300

Query  3316  YGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrssDEEMIPLKCCLMSISLP  3486
              G   P   K G      + R A+  +  A     AA+++ SSD+EMIPLKCCLMSISLP
Sbjct  301   SGPFSPVVSKTGF-GIGTIVRRAASVATVAARQAYAAASSSSSDDEMIPLKCCLMSISLP  359

Query  3487  WEHIAHDLLLKGSPPVNL  3540
             WE+IAHDLL KGSPPVNL
Sbjct  360   WEYIAHDLLFKGSPPVNL  377



>ref|XP_007018451.1| Cw7 protein isoform 3 [Theobroma cacao]
 gb|EOY15676.1| Cw7 protein isoform 3 [Theobroma cacao]
Length=403

 Score =   481 bits (1238),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 255/387 (66%), Positives = 296/387 (76%), Gaps = 47/387 (12%)
 Frame = +1

Query  2419  GGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGRQE  2598
             G +TPSRFELLSMVKKHS  LGKT V+E D SDV+MD QFWH+V +LYFV G+ESRGRQ+
Sbjct  51    GEETPSRFELLSMVKKHSNLLGKTTVDEHDASDVQMDGQFWHDVFNLYFVRGRESRGRQD  110

Query  2599  DDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLIAH  2778
             DDLIFFVRK   +G++ N   E  +PYFVRRW+P+LD+L+G +   VDWRRS+YLN+IAH
Sbjct  111   DDLIFFVRKW--RGHDFNDKDEGFAPYFVRRWAPELDNLVGASLSDVDWRRSFYLNMIAH  168

Query  2779  TTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPAYP  2958
             T++SVTVAICSH VL+N+Q G+D PLSPIYKVVKTVYASPSR+NFHLDS+KEVETTPAYP
Sbjct  169   TSYSVTVAICSHHVLRNHQAGQDTPLSPIYKVVKTVYASPSRVNFHLDSKKEVETTPAYP  228

Query  2959  DICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPS-----DSSQS-------ETSG  3102
             DICFA+DDFDSTFDA+VLTD DHCYCV+LNA DGAAFPS     DSS S       +T+ 
Sbjct  229   DICFAIDDFDSTFDAMVLTDTDHCYCVLLNALDGAAFPSEKETNDSSSSDKLPLRVDTNS  288

Query  3103  GKTQSSKITIFSGFVSYQMVRDAYDAGRTgf-gsllslhssgKTDRIYMKGPGGRGEVEV  3279
              KT++SK+T+FSGFVSYQMVRDAYDAG + F   L   HSSGKTDR+YMKGPGG GEVEV
Sbjct  289   MKTKTSKLTLFSGFVSYQMVRDAYDAGSSRFGSLLSLGHSSGKTDRLYMKGPGGCGEVEV  348

Query  3280  AVSGVVDQSKEEYGHHPPKKGLsfsavvrraasvasvaakhayaaasatrssDEEMIPLK  3459
             AVSGV  +                                    AA+AT +SDEEMIPLK
Sbjct  349   AVSGVAAKHAYA--------------------------------AAAATSTSDEEMIPLK  376

Query  3460  CCLMSISLPWEHIAHDLLLKGSPPVNL  3540
             CCLMSI+LPWEHIA+DLL KGSPPVNL
Sbjct  377   CCLMSITLPWEHIAYDLLFKGSPPVNL  403



>ref|XP_006578064.1| PREDICTED: uncharacterized protein KIAA0930-like [Glycine max]
Length=400

 Score =   481 bits (1237),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 265/401 (66%), Positives = 317/401 (79%), Gaps = 23/401 (6%)
 Frame = +1

Query  2404  LLGNGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKES  2583
             +LG+GG + PSR+ELLSMVKKHS  +GKT+VEE+  SD+EMD +FWH+V DLYFVCGKES
Sbjct  1     MLGDGG-EIPSRYELLSMVKKHSNLIGKTVVEEQHASDIEMDMRFWHDVFDLYFVCGKES  59

Query  2584  RGRQEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYL  2763
             RGRQ+DDL+FFVRK+   G  SN  +E   PYFVRRW+PKL +L+ E S+ V+WRRS+YL
Sbjct  60    RGRQDDDLVFFVRKLGSHGSGSNNKTESVDPYFVRRWAPKLSNLVDETSIDVNWRRSFYL  119

Query  2764  NLIAHTTFSVTVAICSHEVLKNYQ------TGKDKPLSPIYKVVKTVYASPSRINFHLDS  2925
             NLIAHT+FSVTVAICSH+ L N++       G+D PLSPIYKVVKTVYASPSR+NF LDS
Sbjct  120   NLIAHTSFSVTVAICSHQDLLNHRAGQDTPAGQDTPLSPIYKVVKTVYASPSRVNFQLDS  179

Query  2926  RKEVETTPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDSSQSETS--  3099
              KEVETTPAYPDICFA+DDFDSTFDAVVLT+ DHCYCV+LNA+DGAAFPS+   ++ S  
Sbjct  180   EKEVETTPAYPDICFAIDDFDSTFDAVVLTEKDHCYCVVLNAHDGAAFPSEKVANDCSTS  239

Query  3100  ----------GGKTQSSKITIFSGFVSYQMVRDAYDAGRTg-fgsllslhssgKTDRIYM  3246
                         K +++K+T+ SGFVSYQMVRDAYDAGR+     L   HSSGKTDRIYM
Sbjct  240   DSSSLPVHSSSAKKRNTKLTLLSGFVSYQMVRDAYDAGRSRFGSLLSVGHSSGKTDRIYM  299

Query  3247  KGPGGRGEVEVAVSGVVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaa  3417
             KGPGGRGEVEVAVSGV DQS+++ G   P   KKG     +V +AAS ASVAA+HAYAAA
Sbjct  300   KGPGGRGEVEVAVSGVADQSQQDSGPFSPVISKKGFGLGVIVHKAASAASVAARHAYAAA  359

Query  3418  satrssDEEMIPLKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
             SA+  + +E+IPLKC LMSISLPWE IA+DLL KG+PPVN+
Sbjct  360   SASSPNFDELIPLKCSLMSISLPWEFIAYDLLFKGAPPVNM  400



>ref|XP_011040365.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Populus euphratica]
Length=589

 Score =   487 bits (1254),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 283/504 (56%), Positives = 366/504 (73%), Gaps = 20/504 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg--kpKFLMTELVPCGWVGY  1551
             DY+DADI VEG  +GV+R IL ARS+FFHE F++ K   +   KPK+ M++L+PCG VGY
Sbjct  62    DYSDADIVVEGTAIGVHRCILGARSRFFHELFRREKGSSEKEGKPKYCMSDLLPCGKVGY  121

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF++FL+Y+YTGK K SP EVSTCVD  C H ACRPAI++AV+L+YAS+ FQ+ ELV L
Sbjct  122   EAFLIFLSYLYTGKLKPSPMEVSTCVDNVCAHDACRPAINFAVELLYASSIFQVPELVSL  181

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
              QR L   V  A +ED+IPIL+V F C L+ LV +CV RV  S+LDN ++E ELP  ++ 
Sbjct  182   FQRRLQNFVGKALVEDMIPILVVAFHCQLSQLVTQCVDRVARSDLDNISIEKELPHDVAV  241

Query  1190  DIKARRL--------NQQGAN---EKKIRKILRALDCNDVELVKLLLEESDITLDDayav  1044
             +IK  R         N +  +   EK+I++I  ALD +DVELVKLLL ESDITLDDA A+
Sbjct  242   EIKLLRRKSISDEENNTEAVDALREKRIKRIHMALDSDDVELVKLLLTESDITLDDANAL  301

Query  1043  hyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDA  864
             HYAA+YC+ KVV+EVL LG  D+NLRN+RGYTVLH+AA RK+P++IV++L K GAS  D 
Sbjct  302   HYAASYCDLKVVSEVLSLGLADVNLRNSRGYTVLHIAAMRKEPSVIVSMLAK-GASALDL  360

Query  863   TCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVSLPSST---  693
             T S+G +AV+ICRR TRPKDY+  TE+G+E N DRLCID+LE  M   NP++  +S    
Sbjct  361   T-SDGQSAVSICRRLTRPKDYHAKTEQGQEANKDRLCIDILEREMRR-NPMAGSASITSH  418

Query  692   TLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVG  513
             T+ +DL M+L +LENRVA AR  +P EA++ M+IAHA +T EF GL+  +G  GNL+ V 
Sbjct  419   TMVDDLHMKLLYLENRVAFARLFFPTEAKLAMDIAHAATTPEFAGLAASKGSNGNLREVD  478

Query  512   LTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQ  333
             L   P  Q KRL  R EAL KTVE+GRR+F +CS+VLDK   DD+ D L  LE GTP+EQ
Sbjct  479   LNETPIMQNKRLRSRMEALMKTVEMGRRYFPSCSEVLDKFMEDDLPD-LFYLEKGTPDEQ  537

Query  332   TNKKRRYMELKEEVMKAFDKDMAQ  261
               K+ R+MELKE+V +AF KD A+
Sbjct  538   RIKRTRFMELKEDVQRAFTKDKAE  561



>ref|XP_006472488.1| PREDICTED: uncharacterized protein LOC102625521 isoform X2 [Citrus 
sinensis]
Length=391

 Score =   479 bits (1234),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 266/389 (68%), Positives = 313/389 (80%), Gaps = 19/389 (5%)
 Frame = +1

Query  2422  GQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGRQED  2601
             G+TPSR ELLSMVKKHS  LGKT+VEE+D  DVEMD +FWH+V DLYF+ GKESRGRQ+D
Sbjct  6     GETPSRSELLSMVKKHSNLLGKTLVEEQDAVDVEMDSRFWHDVFDLYFIRGKESRGRQDD  65

Query  2602  DLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLIAHT  2781
             DL+FFVRK+ L G   N N ED + YFVRRW+PK+        + V WRRS+YLN+IAHT
Sbjct  66    DLLFFVRKVGLHGILFNDNEEDLTSYFVRRWAPKVK---APEIIEVHWRRSFYLNMIAHT  122

Query  2782  TFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPAYPD  2961
              FSVTVAICSH+ L+N+Q G D PLSPIYKVVKTVYASPSR+NF LDS+KEVET PAYPD
Sbjct  123   AFSVTVAICSHQELRNHQAGTDTPLSPIYKVVKTVYASPSRVNFQLDSKKEVETKPAYPD  182

Query  2962  ICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDSS------------QSETSGG  3105
             ICFAVDDFDSTFDAVVL+D DHCYCVILNA+ GAAFPS+              +++   G
Sbjct  183   ICFAVDDFDSTFDAVVLSDTDHCYCVILNAHGGAAFPSEKEANNSSSSNSSPMKTDMDSG  242

Query  3106  KTQSSKITIFSGFVSYQMVRDAYDAGRTgf-gsllslhssgKTDRIYMKGPGGRGEVEVA  3282
             KT+++K+T+FSGFVSYQMVR+AYDAG++ F   L   HS GKTDR+YMKGPGGRGEVEVA
Sbjct  243   KTRNAKLTLFSGFVSYQMVREAYDAGKSRFGSLLSLSHSLGKTDRLYMKGPGGRGEVEVA  302

Query  3283  VSGVVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrssDEEMIP  3453
             VSGV DQS ++     P   K+G +  ++VR+AASVASVAAKHAYAAA+AT +SD+EM+P
Sbjct  303   VSGVADQSDQDSAPFSPVVSKRGFAIGSIVRKAASVASVAAKHAYAAAAATTTSDDEMLP  362

Query  3454  LKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
             LKCCLMSISLPWEHIA+DLL KGSPPVNL
Sbjct  363   LKCCLMSISLPWEHIAYDLLFKGSPPVNL  391



>ref|XP_008380107.1| PREDICTED: uncharacterized protein KIAA0930 homolog [Malus domestica]
Length=399

 Score =   480 bits (1235),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 268/396 (68%), Positives = 322/396 (81%), Gaps = 19/396 (5%)
 Frame = +1

Query  2404  LLGNGGGQTPSRFELLSMVKKHSKFLGKTIV--EEEDPSDVEMDPQFWHEVLDLYFVCGK  2577
             +LG+G   TPSRFELLSMVKKHS  LGKT++  +E+D SDVE+D +FWH+VLD YFV GK
Sbjct  6     MLGHGE-DTPSRFELLSMVKKHSSLLGKTVIVADEDDTSDVELDHRFWHDVLDFYFVRGK  64

Query  2578  ESRGRQEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSY  2757
             +SRGRQ+DDL+FFVRK+   GY  +   E  SPYFVRRW+PKLDDL+GE++V VDWRR++
Sbjct  65    DSRGRQDDDLVFFVRKLISYGYGFSDGKEGVSPYFVRRWAPKLDDLIGESNVDVDWRRTF  124

Query  2758  YLNLIAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEV  2937
             YLNLIAHT+F+VTVAICSH+ L+N+Q  +  PLSPIYKVVKTVYASPSR+NF LDS+KEV
Sbjct  125   YLNLIAHTSFTVTVAICSHQDLRNHQAQQGIPLSPIYKVVKTVYASPSRVNFQLDSKKEV  184

Query  2938  ETTPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAF----------PSDSSQ  3087
             ETTPAYPDICFA+DDFD TFDAVVLT+ DHCYCVILNA+DGAAF          PSDSS 
Sbjct  185   ETTPAYPDICFAIDDFDXTFDAVVLTETDHCYCVILNAHDGAAFPREKESNDCSPSDSSS  244

Query  3088  --SETSGGKTQSSKITIFSGFVSYQMVRDAYDAGRTgfgsllslhssgKTDRIYMKGPGG  3261
                ET+    +++K+T+FSGFVSYQMVRDAYDAG++     L  HS GKTD++YMKGPGG
Sbjct  245   LTVETNSAXMKNTKLTLFSGFVSYQMVRDAYDAGKS-RFGNLLGHSPGKTDKLYMKGPGG  303

Query  3262  RGEVEVAVSGVVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrs  3432
             RGEVEVAVS V DQS+++ G   P   K+G    ++VR+AASVASVAAK+AYAAAS+T S
Sbjct  304   RGEVEVAVSRVADQSQQDXGPFSPVISKRGFGIGSIVRKAASVASVAAKNAYAAASSTYS  363

Query  3433  sDEEMIPLKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
              D+EM+PLKCCLMSISLPWE IA+DLL KG+PPV L
Sbjct  364   FDDEMVPLKCCLMSISLPWEQIAYDLLFKGTPPVTL  399



>ref|XP_008220394.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X1 
[Prunus mume]
Length=408

 Score =   479 bits (1234),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 272/407 (67%), Positives = 325/407 (80%), Gaps = 36/407 (9%)
 Frame = +1

Query  2419  GGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGRQE  2598
             G +TPSRFELLSMVKKHS  LGKT+V+ +D SDVEMD +FWH+VLDLYF+ GK+SRGRQ+
Sbjct  5     GEETPSRFELLSMVKKHSSLLGKTVVDADDVSDVEMDHKFWHDVLDLYFIRGKDSRGRQD  64

Query  2599  DDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLIAH  2778
             DDL+FFVRK+S  G+ S+   E  SPYFVRRW+PKLD+L+GEN+V VDWRRSYYLNLIAH
Sbjct  65    DDLVFFVRKLSSYGHGSS--DESVSPYFVRRWAPKLDNLIGENNVEVDWRRSYYLNLIAH  122

Query  2779  TTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPAYP  2958
             T+F+VTVAICSH+ L+N+Q  +  PLSPIYKVVKTVYASPSR+NF LDSRKEVETTPAYP
Sbjct  123   TSFTVTVAICSHQDLRNHQAEQGTPLSPIYKVVKTVYASPSRVNFQLDSRKEVETTPAYP  182

Query  2959  DICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFP----------------------  3072
             DICFA+DDFDSTFDAVVLT+ DHCYCVILNA+DGAAFP                      
Sbjct  183   DICFAIDDFDSTFDAVVLTETDHCYCVILNAHDGAAFPRVKEEDGCSSSDSSSLRVETNY  242

Query  3073  --------SDSSQSETSGGKTQSSKITIFSGFVSYQMVRDAYDAGRTgfgsllslhssgK  3228
                     S S + ET+  KT+++K+T+FSGFVSYQMVRDAYDAG++     L  HS GK
Sbjct  243   SKTKNTIDSSSLRVETNYSKTKNTKLTLFSGFVSYQMVRDAYDAGKS-RFGNLLGHSPGK  301

Query  3229  TDRIYMKGPGGRGEVEVAVSGVVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaak  3399
              DR+YMKGPGGRGEVEVAVSGV DQS+++ G   P   K+G    ++VR+AASVASVAAK
Sbjct  302   QDRLYMKGPGGRGEVEVAVSGVADQSQQDLGPFSPVISKQGFGIGSIVRKAASVASVAAK  361

Query  3400  hayaaasatrssDEEMIPLKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
             +AYAAA+++ S D+EM+PLKCCLMSI+LPWEHIA+DLL KG+PPVNL
Sbjct  362   NAYAAAASSHSFDDEMVPLKCCLMSITLPWEHIAYDLLFKGTPPVNL  408



>gb|AEE81755.1| regulatory protein NPR2 [Populus deltoides]
Length=587

 Score =   486 bits (1251),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 280/511 (55%), Positives = 365/511 (71%), Gaps = 23/511 (5%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg--kpKFLMTELVPCGWVGY  1551
             DY+DADI VEG  +GV+R IL ARS+FFHE F++ K   +   KPK+ +++L+ CG VGY
Sbjct  62    DYSDADIVVEGTAIGVHRCILGARSKFFHELFRREKGSSEKEGKPKYCLSDLLTCGKVGY  121

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF++FL+Y+YTGK K SP EVSTCVD  C H ACRPAI++AV+LMYAS+ FQ+ ELV L
Sbjct  122   EAFLIFLSYLYTGKLKPSPMEVSTCVDNVCAHDACRPAINFAVELMYASSIFQVPELVSL  181

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
              QR L   V  A +ED+IPIL+V F C L+ LV +CV R+  S+LDN ++E ELP  ++ 
Sbjct  182   FQRRLQNFVGKALVEDMIPILVVAFHCQLSQLVTQCVDRIARSDLDNISIEKELPHDVAV  241

Query  1190  DIKARRLNQ-----------QGANEKKIRKILRALDCNDVELVKLLLEESDITLDDayav  1044
             +IK  R N                EK+I++I  ALD +DVELVKLLL ESDITLDDA A+
Sbjct  242   EIKLLRRNSISDEENNTEAVDALREKRIKRIHMALDSDDVELVKLLLTESDITLDDANAL  301

Query  1043  hyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDA  864
             HYAA+YC+ KVV+EVL LG  D+NLRN+RGYTVLH+AA RK+P++IV++L K  ++++  
Sbjct  302   HYAASYCDLKVVSEVLSLGLADVNLRNSRGYTVLHIAAMRKEPSVIVSMLAKGASALQ--  359

Query  863   TCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVM----MNGNPVSLPSS  696
               S+G +AV+ICRR TRPKDY+  TE+G+E N DRLCID+LE  M    M GN  +  +S
Sbjct  360   LTSDGQSAVSICRRLTRPKDYHAKTEQGQEANKDRLCIDILEREMRRNPMAGN--ASITS  417

Query  695   TTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGV  516
              T+ +DL M+L +LENRVA AR  +P EA++ M+IAHA +T EF GL+  +G  GNL+ V
Sbjct  418   HTMVDDLHMKLLYLENRVAFARLFFPTEAKLAMDIAHAATTPEFAGLAASKGSNGNLREV  477

Query  515   GLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEE  336
              L   P  Q KRL  R EAL KTVE+GRR+F +CS+VLDK   DD+ D L  LE GTP+E
Sbjct  478   DLNETPIMQNKRLRSRMEALMKTVEMGRRYFPSCSEVLDKFMEDDLPD-LFYLEKGTPDE  536

Query  335   QTNKKRRYMELKEEVMKAFDKDMAQ-NRVGL  246
             Q  K+ R+MELKE+V +AF KD A+ N  GL
Sbjct  537   QRIKRTRFMELKEDVHRAFTKDKAEINLTGL  567



>ref|XP_009361040.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X1 
[Pyrus x bretschneideri]
Length=408

 Score =   479 bits (1232),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 269/408 (66%), Positives = 325/408 (80%), Gaps = 31/408 (8%)
 Frame = +1

Query  2404  LLGNGGGQTPSRFELLSMVKKHSKFLGKTIV--EEEDPSDVEMDPQFWHEVLDLYFVCGK  2577
             +LG+G  +TP+RFELLSMVKKHS  LGKT++  +E+D SDVE+D +FWH++LDLYFV GK
Sbjct  3     MLGHGE-ETPTRFELLSMVKKHSSLLGKTVIVADEDDTSDVELDHRFWHDMLDLYFVRGK  61

Query  2578  ESRGRQEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSY  2757
             +SRGRQ+DDL+FFVRK+S  GY  N   E  SPYFVRRW+ KLDDL+GE++V VDWRRS+
Sbjct  62    DSRGRQDDDLVFFVRKLSSYGYGFNDGKEGVSPYFVRRWAHKLDDLIGESNVDVDWRRSF  121

Query  2758  YLNLIAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYK------------VVKTVYASPS  2901
             YLNLIAHT+F+VTVAICSH+ L+N+Q  +  PLSPIYK            VVKTVYASPS
Sbjct  122   YLNLIAHTSFTVTVAICSHQDLRNHQADQGIPLSPIYKSMFSIRLVAPLQVVKTVYASPS  181

Query  2902  RINFHLDSRKEVETTPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFP---  3072
             R+NF LDS KEVETTPAYPDICFA+DDFDSTFDAVVLT+ D+CYCVILNA+DGAAFP   
Sbjct  182   RVNFQLDSEKEVETTPAYPDICFAIDDFDSTFDAVVLTETDNCYCVILNAHDGAAFPRVK  241

Query  3073  ---------SDSSQSETSGGKTQSSKITIFSGFVSYQMVRDAYDAGRTgfgsllslhssg  3225
                      S S + ET+  KT+++K+T+FSGFVSYQMVRDAYDAG++     L  HS G
Sbjct  242   ESDECSSGDSSSLRIETNSAKTKNTKLTLFSGFVSYQMVRDAYDAGKS-RFGNLLGHSPG  300

Query  3226  KTDRIYMKGPGGRGEVEVAVSGVVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaa  3396
             KTD++YMKGPGGRGEVE+AVSGV DQS+++ G   P   K G    ++VR+AASVASVAA
Sbjct  301   KTDKLYMKGPGGRGEVEIAVSGVADQSQQDLGPFSPVISKTGFGIGSIVRKAASVASVAA  360

Query  3397  khayaaasatrssDEEMIPLKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
             K+AYAAAS+T S D+EM+PLKCCLMSISLPWE IA+DLL KG+PPV L
Sbjct  361   KNAYAAASSTHSFDDEMVPLKCCLMSISLPWEQIAYDLLFKGTPPVTL  408



>ref|XP_010687693.1| PREDICTED: uncharacterized protein LOC104901770 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=382

 Score =   477 bits (1228),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 243/380 (64%), Positives = 295/380 (78%), Gaps = 15/380 (4%)
 Frame = +1

Query  2419  GGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGRQE  2598
             GG+TPSR+ELLS+VKKHS  LGKT+V+EED SDVE+D  FWH++L+LYFV GKES+GRQ+
Sbjct  5     GGETPSRYELLSLVKKHSSLLGKTVVDEEDASDVELDQAFWHDILNLYFVQGKESKGRQD  64

Query  2599  DDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLIAH  2778
             DDLIFFVRKM+L GY +N   + N+PYFVRRW+ KLD ++G++ + VDWRRS YLNLIAH
Sbjct  65    DDLIFFVRKMNLHGYGTNDELDANAPYFVRRWASKLDKMVGDDLIEVDWRRSLYLNLIAH  124

Query  2779  TTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPAYP  2958
             T+F+VTVAICS++VL++++ G+D PLSPIYKVVKTVYASPSR+NFHLDSRKE ET PAYP
Sbjct  125   TSFTVTVAICSNQVLQHHRVGQDTPLSPIYKVVKTVYASPSRVNFHLDSRKEAETVPAYP  184

Query  2959  DICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDS---------SQSETSGGKT  3111
             DICFA+DDFDST D VVL+D DHCYCV+LNA+ GAAFPS+           ++E    KT
Sbjct  185   DICFAIDDFDSTIDTVVLSDPDHCYCVVLNAHGGAAFPSEKPEHEVIEKLQKTEGDSRKT  244

Query  3112  QSSKITIFSGFVSYQMVRDAYDAGR-TgfgsllslhssgKTDRIYMKGPGGRGEVEVAVS  3288
               +K+TIFSGFVSYQMVR+AYDAGR      L   HSSGK DRIYMKGPGGRGEVEVAVS
Sbjct  245   NKTKVTIFSGFVSYQMVREAYDAGRFRLGSLLSFSHSSGKVDRIYMKGPGGRGEVEVAVS  304

Query  3289  GVVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrssDEEMIPLK  3459
             GV DQS+   G   P   K G           + +  +     A A+A+ ++D+EM+PLK
Sbjct  305   GVEDQSQHSLGPSSPVNSKSGF--GLATIVRKAASVASVAAKQAYAAASNTTDDEMLPLK  362

Query  3460  CCLMSISLPWEHIAHDLLLK  3519
             CCLMSISLPWE+IAHDLL K
Sbjct  363   CCLMSISLPWENIAHDLLFK  382



>ref|XP_009356589.1| PREDICTED: regulatory protein NPR3-like [Pyrus x bretschneideri]
 ref|XP_009356590.1| PREDICTED: regulatory protein NPR3-like [Pyrus x bretschneideri]
Length=591

 Score =   485 bits (1248),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 283/511 (55%), Positives = 365/511 (71%), Gaps = 19/511 (4%)
 Frame = -2

Query  1745  IDPGEYEDYNDADIEVEGILVGVNRGILAARSQFFHEEFkkak--kdcdgkpKFLMTELV  1572
             +DP E+ DY+DA+I VEG  VGVNR ILA+RSQFF E F+K     + +GKP++LM+ELV
Sbjct  58    LDP-EF-DYSDAEIVVEGNTVGVNRCILASRSQFFQELFRKGSDDSNKEGKPRYLMSELV  115

Query  1571  PCGWVGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQ  1392
             P G VGYEAF VFLNY+YTGK   SP EVSTCVD+ C H AC PAI+YAV+LMYAS+TFQ
Sbjct  116   PNGGVGYEAFKVFLNYLYTGKLNPSPREVSTCVDDGCPHDACGPAINYAVELMYASSTFQ  175

Query  1391  IKELVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENE  1212
             +KELV L+QR L   V+ A IEDVIPIL+  F C L+ L+  C++R+  S LDN  +E E
Sbjct  176   MKELVQLVQRRLSNFVEKALIEDVIPILIAAFHCQLSQLLSHCIQRIVRSKLDNMAIEKE  235

Query  1211  LPGAISSDIKARRLNQQGANE-----------KKIRKILRALDCNDVELVKLLLEESDIT  1065
              P  +S+DIK+ RL     +E           K+IR+I +ALD +DVELV LLL+ESDIT
Sbjct  236   FPHEVSNDIKSLRLKSHENDESSMMEIESIEDKRIRRIHKALDSDDVELVGLLLKESDIT  295

Query  1064  LDDayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKS  885
             LDDAYA+HYAAAYC+ KVV EVLGLG+ +LNLRN+RG+TVLHVAARRK PA++V +LD+ 
Sbjct  296   LDDAYALHYAAAYCDPKVVKEVLGLGEANLNLRNSRGHTVLHVAARRKLPAVLVPLLDRG  355

Query  884   GASIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVS-  708
              +++   T S+G T V ICRR TRPKD+ + T++G+E N DRLCID+LE  M   +    
Sbjct  356   ASALE--TTSDGQTPVAICRRLTRPKDFWENTKQGQESNKDRLCIDLLEREMQRNSTSGN  413

Query  707   -LPSSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCG  531
              L  S  + +DL + L +LENRVA AR L+P EA++ ME+A A ST  + GL+   G  G
Sbjct  414   MLIISEVIPDDLHVRLDYLENRVAFARLLFPAEAKLAMEMADAHSTSVYTGLAASRGSSG  473

Query  530   NLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLES  351
             NL+ V L   P  + KRL  R +AL KTV++GRRFF NCS+VLDK   D++  +   L+ 
Sbjct  474   NLREVDLNETPSGRTKRLQIRMQALIKTVKMGRRFFPNCSEVLDKFLDDEMDMADFILDK  533

Query  350   GTPEEQTNKKRRYMELKEEVMKAFDKDMAQN  258
             GTPEEQ  K+ R++ELK++V KAF KDMA+N
Sbjct  534   GTPEEQRIKRMRFLELKDDVQKAFCKDMAEN  564



>ref|XP_009759448.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X3 
[Nicotiana sylvestris]
Length=430

 Score =   478 bits (1229),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 285/384 (74%), Positives = 319/384 (83%), Gaps = 23/384 (6%)
 Frame = +1

Query  2425  QTPSR------------FELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFV  2568
             QTPSR             ELLSMVKKHS+ LGKT V+EED SDVE+DP+FWH+V+DLYF+
Sbjct  7     QTPSRNLCDTYKVAGNWSELLSMVKKHSEMLGKTTVDEEDASDVEVDPRFWHDVMDLYFI  66

Query  2569  CGKESRGRQEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWR  2748
             CGKESRGRQEDDL+FFV+++     ESN   +D+SPYFVRRW+PKLDDL+G NS  VDWR
Sbjct  67    CGKESRGRQEDDLVFFVKRIR---NESNEYVDDDSPYFVRRWAPKLDDLIGGNSSDVDWR  123

Query  2749  RSYYLNLIAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSR  2928
             RS+YLNLI+ T+FSVTV I SH VL +YQ GKD PLSPIYKVVKTVYASPSRI  HLDSR
Sbjct  124   RSFYLNLISQTSFSVTVTIYSHRVLMSYQNGKDGPLSPIYKVVKTVYASPSRIKIHLDSR  183

Query  2929  KEVETTPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDSSQSE-----  3093
             KEVETTPAYP+ICFA+DDFDSTF AVVLTDVDHCYCV+LNA+DGAAFPS+ +  E     
Sbjct  184   KEVETTPAYPEICFAIDDFDSTFGAVVLTDVDHCYCVLLNAHDGAAFPSERALRESSSCD  243

Query  3094  --TSGGKTQSSKITIFSGFVSYQMVRDAYDAGRTgfgsllslhssgKTDRIYMKGPGGRG  3267
               +S   T S KIT+FSGF+SY+MVRDAYD GR+G GSLLSL+SSGKTDRIYMKGPGGRG
Sbjct  244   TSSSKSDTSSGKITLFSGFISYEMVRDAYDDGRSGLGSLLSLNSSGKTDRIYMKGPGGRG  303

Query  3268  EVEVAVSGVVDQSKEEYGHHPPKKGLsfsavvrraasvasvaakhayaaasatrssDEEM  3447
             EVEVAVSGVVDQSK+E GHH   KGLSF  VVRRAASVAS+AAKHAYAAASATR  D  +
Sbjct  304   EVEVAVSGVVDQSKQESGHH-STKGLSFGVVVRRAASVASMAAKHAYAAASATRCPDGGL  362

Query  3448  IPLKCCLMSISLPWEHIAHDLLLK  3519
             IPLKCCLMSISLPWEHIAHDLL K
Sbjct  363   IPLKCCLMSISLPWEHIAHDLLFK  386



>ref|XP_007214958.1| hypothetical protein PRUPE_ppa003232mg [Prunus persica]
 gb|EMJ16157.1| hypothetical protein PRUPE_ppa003232mg [Prunus persica]
Length=590

 Score =   483 bits (1243),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 289/510 (57%), Positives = 365/510 (72%), Gaps = 22/510 (4%)
 Frame = -2

Query  1733  EYEDYNDADIEVEGILVGVNRGILAARSQFFHEEFkkak--kdcdgkpKFLMTELVPCGW  1560
             EY DYNDA+I VEG  VGVNR ILAARS+FF + FK+       +GKPK+LM++LVP G 
Sbjct  61    EY-DYNDAEIIVEGNTVGVNRCILAARSEFFQDLFKQGNDDSIKEGKPKYLMSDLVPNGR  119

Query  1559  VGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKEL  1380
             VGYEAF V LNY+YTGK + SP EVSTCVD  C H AC PAI+YAV+LMYASATFQ+KEL
Sbjct  120   VGYEAFKVILNYLYTGKLQPSPREVSTCVDHHCAHDACGPAINYAVELMYASATFQMKEL  179

Query  1379  VMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGA  1200
             V L+QR L   V+ A IEDVIPIL+V F C L+ L+  C++RV  S+LD+  +E ELP  
Sbjct  180   VQLVQRRLSNFVEKAFIEDVIPILVVAFHCQLSQLLSDCIQRVARSDLDSVAIEKELPHE  239

Query  1199  ISSDIKARRLNQQGANE-----------KKIRKILRALDCNDVELVKLLLEESDITLDDa  1053
             +S+DIK+  L  Q  +E           K+IR+I +ALD +DVELV+LLL+ESDITLDDA
Sbjct  240   VSNDIKSLCLRSQEKDESSMMEMEPVKDKRIRRIHKALDSDDVELVELLLKESDITLDDA  299

Query  1052  yavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASI  873
             YA+HYA AYC+ KVV EVLGLG   +NL NARGYTVLHVAARRK PA++V +L++ GAS 
Sbjct  300   YALHYAVAYCDPKVVKEVLGLGLATINLCNARGYTVLHVAARRKHPAVMVPLLNR-GASA  358

Query  872   RDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVM----MNGNPVSL  705
              + T  +G TAV ICRR TRPKD+ + TE+G+E N DR+CID+LE  M    M+GN   +
Sbjct  359   SETTV-DGRTAVAICRRLTRPKDFYENTEKGQESNKDRMCIDLLEREMQRNSMSGNLSII  417

Query  704   PSSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNL  525
               S  + +DL + L +LENRVA AR L+P EA++ ME+A A +T    GLS   G  GNL
Sbjct  418   --SEVMADDLNVRLDYLENRVAFARLLFPAEAKLAMEMADACTTSMHTGLSTSRGSSGNL  475

Query  524   KGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGT  345
             + V L   P  + KRL  R +AL+KTVE+GRRFF +CS+VLDK   D++  +   LE GT
Sbjct  476   REVDLNETPSGRTKRLQARMQALRKTVEMGRRFFPHCSEVLDKFLDDEMDMADFILEKGT  535

Query  344   PEEQTNKKRRYMELKEEVMKAFDKDMAQNR  255
             PEEQ  KK R++ELK++V KAF KDMA+N+
Sbjct  536   PEEQRKKKTRFLELKDDVQKAFCKDMAENK  565



>ref|XP_009759450.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X5 
[Nicotiana sylvestris]
Length=407

 Score =   475 bits (1223),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 278/367 (76%), Positives = 312/367 (85%), Gaps = 16/367 (4%)
 Frame = +1

Query  2455  MVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGRQEDDLIFFVRKMSL  2634
             MVKKHS+ LGKT V+EED SDVE+DP+FWH+V+DLYF+CGKESRGRQEDDL+FFV+++  
Sbjct  1     MVKKHSEMLGKTTVDEEDASDVEVDPRFWHDVMDLYFICGKESRGRQEDDLVFFVKRIR-  59

Query  2635  QGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLIAHTTFSVTVAICSH  2814
                ESN   +D+SPYFVRRW+PKLDDL+G NS  VDWRRS+YLNLI+ T+FSVTV I SH
Sbjct  60    --NESNEYVDDDSPYFVRRWAPKLDDLIGGNSSDVDWRRSFYLNLISQTSFSVTVTIYSH  117

Query  2815  EVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPAYPDICFAVDDFDST  2994
              VL +YQ GKD PLSPIYKVVKTVYASPSRI  HLDSRKEVETTPAYP+ICFA+DDFDST
Sbjct  118   RVLMSYQNGKDGPLSPIYKVVKTVYASPSRIKIHLDSRKEVETTPAYPEICFAIDDFDST  177

Query  2995  FDAVVLTDVDHCYCVILNANDGAAFPSDSSQSE------------TSGGKTQSSKITIFS  3138
             F AVVLTDVDHCYCV+LNA+DGAAFPS+ +  E            TS GK + SKIT+FS
Sbjct  178   FGAVVLTDVDHCYCVLLNAHDGAAFPSERALRESSSCDTSSSKSDTSSGKVRRSKITLFS  237

Query  3139  GFVSYQMVRDAYDAGRTgfgsllslhssgKTDRIYMKGPGGRGEVEVAVSGVVDQSKEEY  3318
             GF+SY+MVRDAYD GR+G GSLLSL+SSGKTDRIYMKGPGGRGEVEVAVSGVVDQSK+E 
Sbjct  238   GFISYEMVRDAYDDGRSGLGSLLSLNSSGKTDRIYMKGPGGRGEVEVAVSGVVDQSKQES  297

Query  3319  GHHPPKKGLsfsavvrraasvasvaakhayaaasatrssDEEMIPLKCCLMSISLPWEHI  3498
             GHH   KGLSF  VVRRAASVAS+AAKHAYAAASATR  D  +IPLKCCLMSISLPWEHI
Sbjct  298   GHH-STKGLSFGVVVRRAASVASMAAKHAYAAASATRCPDGGLIPLKCCLMSISLPWEHI  356

Query  3499  AHDLLLK  3519
             AHDLL K
Sbjct  357   AHDLLFK  363



>ref|XP_010272311.1| PREDICTED: regulatory protein NPR3 isoform X1 [Nelumbo nucifera]
Length=571

 Score =   480 bits (1236),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 288/504 (57%), Positives = 355/504 (70%), Gaps = 22/504 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg--kpKFLMTELVPCGWVGY  1551
             DY+DA++ VEG  VGV+R ILAARS+FFHE F K K       KP++ MT+LVP G VGY
Sbjct  62    DYSDAEVIVEGNTVGVHRCILAARSRFFHELFTKTKGSPQKEGKPQYNMTDLVPYGKVGY  121

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF +FL+Y+YTGK K SP EVSTCVD SC H ACRPAI++ V+LMY SA FQI ELV L
Sbjct  122   EAFTIFLSYLYTGKLKPSPAEVSTCVDSSCAHDACRPAINFIVELMYTSAHFQITELVSL  181

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
              QR L   V+ A  EDVIPIL+V F C L  L++ CV+R+  S+LD+ +LE +LP  +  
Sbjct  182   FQRRLLIFVEKAFAEDVIPILMVAFHCQLNHLIDHCVQRIARSDLDSISLE-KLPNEVKM  240

Query  1190  DIKARRLNQQ----------GANEKKIRKILRALDCNDVELVKLLLEESDITLDDayavh  1041
             DIK+ RL                EK IR+I +ALD +DVELVKLLL ES +TLDDA A+H
Sbjct  241   DIKSLRLKSHLDEASAMDVDPVREKNIRRIHKALDSDDVELVKLLLNESGVTLDDANALH  300

Query  1040  yaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDAT  861
             YAAAYC+ KVV EVL LG  + NLR+ARGYTVLHVAA RK+P+IIV +L+K GAS  + T
Sbjct  301   YAAAYCDPKVVAEVLDLGLANANLRDARGYTVLHVAAMRKEPSIIVRLLNK-GASALELT  359

Query  860   CSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPV----SLPSST  693
              S+G +AV ICRR TRPKDYN  T +G+E N DR+CID+LE   M  NP+    S+ S  
Sbjct  360   -SDGQSAVRICRRLTRPKDYNAKTIQGQETNKDRICIDILER-EMRRNPMAGATSISSPA  417

Query  692   TLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVG  513
             T E DL M+L +LENRVA AR L+P EAR+ ME AHADST EF GLS  +G  GNL+ V 
Sbjct  418   TSE-DLHMKLLYLENRVAFARLLFPTEARLAMESAHADSTFEFAGLSASKGSSGNLREVD  476

Query  512   LTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQ  333
             L   P  Q KRL  R EAL+KTVE+GRR+F +CS+VLDK   DD+ D L  LE G+ +EQ
Sbjct  477   LNETPTTQNKRLHSRMEALQKTVEVGRRYFPHCSEVLDKFMEDDLPD-LFFLEKGSLDEQ  535

Query  332   TNKKRRYMELKEEVMKAFDKDMAQ  261
               K+ R++ELK +V KAF+KD A+
Sbjct  536   RIKRSRFVELKRDVQKAFNKDKAE  559



>ref|XP_004303897.1| PREDICTED: regulatory protein NPR3-like [Fragaria vesca subsp. 
vesca]
Length=578

 Score =   480 bits (1236),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 286/513 (56%), Positives = 359/513 (70%), Gaps = 24/513 (5%)
 Frame = -2

Query  1745  IDPGEYEDYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg--kpKFLMTELV  1572
             +DP +Y DY+DA+I VEG  V VNR ILAAR QFFHE F+K   +     KP+++M+ELV
Sbjct  58    VDP-QY-DYSDAEIVVEGTPVSVNRCILAARGQFFHEVFQKGSDNKSKEGKPQYVMSELV  115

Query  1571  PCGWVGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQ  1392
             PCG VG EAF VFLNY+YTGK K SPPEVSTCV++ C H AC PAI+YAV+LMYAS+TFQ
Sbjct  116   PCGRVGCEAFKVFLNYLYTGKLKPSPPEVSTCVEDVCAHDACGPAINYAVELMYASSTFQ  175

Query  1391  IKELVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENE  1212
             +KELV ++QR L   VD A +EDVIPIL+  F C L+ L+  CV+RV+ S+LDN  LE E
Sbjct  176   MKELVQVVQRRLWNFVDKALVEDVIPILVAAFHCQLSQLLSHCVQRVSRSDLDNVALEKE  235

Query  1211  LPGAISSDIKARRLNQQGANE--------------KKIRKILRALDCNDVELVKLLLEES  1074
             LP  +  DIK+ RL  Q  +E              K IR+I RALD +DVELV LLL ES
Sbjct  236   LPHEVFDDIKSLRLKSQEKDESVMLEQEPREDKRLKSIRRIHRALDSDDVELVTLLLNES  295

Query  1073  D-ITLDDayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAI  897
             D ITLDDA+A+HYA AYC+ K+V EVLGLG  D+NLRNAR +TVLHVAARRK+P++IV +
Sbjct  296   DSITLDDAHALHYAVAYCDPKIVKEVLGLGLADVNLRNAREHTVLHVAARRKEPSVIVHL  355

Query  896   LDKSGASIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGN  717
             L+K  +++   T S+G TAV ICRR TRPKDYN+ T++GEE N DR+CID+LE  M   +
Sbjct  356   LNKGASALE--TTSDGQTAVAICRRLTRPKDYNENTKQGEESNKDRMCIDLLEREMRRNS  413

Query  716   PVSLPSSTT--LENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGME  543
                  S+T+    ++  + L +LENRVA A  L+P EA++ ME+A AD T E+ GLS   
Sbjct  414   ICGNLSNTSHMAADNFHVSLSYLENRVAFAHLLFPAEAKLAMEMADADLTSEYPGLSKSR  473

Query  542   GLCGNLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLE  363
                G+L+ V L   P  + KRL E+ + L KTVE GRRFF +CS VLDK   DD+     
Sbjct  474   ISNGHLREVDLNETPSGRAKRLQEKMQTLIKTVEKGRRFFPHCSAVLDKFL-DDLGMGDY  532

Query  362   SLESGTPEEQTNKKRRYMELKEEVMKAFDKDMA  264
              LE GTPEEQ NKKRR++ELK +V KAF KDMA
Sbjct  533   FLEKGTPEEQKNKKRRFLELKADVQKAFCKDMA  565



>ref|XP_002520549.1| Regulatory protein NPR1, putative [Ricinus communis]
 gb|EEF41835.1| Regulatory protein NPR1, putative [Ricinus communis]
Length=590

 Score =   480 bits (1235),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 278/507 (55%), Positives = 361/507 (71%), Gaps = 20/507 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg--kpKFLMTELVPCGWVGY  1551
             DY+DADI VEG  VG++R ILAARS+FFH+ FK+ K   +   KPK+ M +L+PCG VGY
Sbjct  62    DYSDADIVVEGKPVGIHRCILAARSRFFHDLFKQEKGSLEKDGKPKYCMNDLLPCGEVGY  121

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF++FLNY+YTGK K SP EVSTCVD  C H ACRPAI++AV+L+YAS+ FQ+ ELV L
Sbjct  122   EAFLIFLNYLYTGKLKPSPMEVSTCVDNVCTHDACRPAINFAVELLYASSIFQVPELVSL  181

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
              QR L   V    +EDVIPIL+V F C    LV +CV R+  S+LDN ++E ELP  ++ 
Sbjct  182   FQRRLLNFVGKTYVEDVIPILVVAFHCQSNQLVAQCVDRIARSDLDNISIEKELPYEVAE  241

Query  1190  DIKARRLNQQGAN-----------EKKIRKILRALDCNDVELVKLLLEESDITLDDayav  1044
             +I+  R+     +           EK+IR+I +ALD +DVELVKLLL ES++T+DDA A+
Sbjct  242   NIRLLRIKPISDDEENVEVVDPLREKRIRRIHKALDSDDVELVKLLLTESEVTMDDANAL  301

Query  1043  hyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDA  864
             HYA AYC+ KVV+EVLGLG  D+N RN++GYTVLH+AA R++P++IV++L K GA   D 
Sbjct  302   HYATAYCDPKVVSEVLGLGLADVNRRNSQGYTVLHIAAMRREPSVIVSLLTK-GACALDL  360

Query  863   TCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVSLPSSTTLE  684
             T S+G +AV+ICRR TRPKDY+  TE+G+E N DRLCIDVLE   M  NP++  +S T +
Sbjct  361   T-SDGRSAVSICRRLTRPKDYHAKTEQGQEANKDRLCIDVLER-EMRRNPMAGDASITSQ  418

Query  683   ---NDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVG  513
                +DL M+L +LENRVA AR  +P EA++ M+IAHA +T EF GLS  +G  GN + V 
Sbjct  419   ATPDDLHMKLLYLENRVAFARLFFPAEAKVAMDIAHAQTTSEFAGLSATKGSNGNFREVD  478

Query  512   LTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQ  333
             L   P  Q KRL  R EAL KTVE+GRR+F  CS+VLDK   DD+ D L  LE GTP+EQ
Sbjct  479   LNETPIMQNKRLRSRLEALMKTVEMGRRYFPKCSEVLDKFMEDDLPD-LFYLEKGTPDEQ  537

Query  332   TNKKRRYMELKEEVMKAFDKDMAQNRV  252
               K+ R+MELK++V KAF+KD A+  V
Sbjct  538   RIKRMRFMELKDDVQKAFNKDKAERSV  564



>ref|XP_011001309.1| PREDICTED: regulatory protein NPR3-like [Populus euphratica]
Length=587

 Score =   480 bits (1235),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 280/503 (56%), Positives = 360/503 (72%), Gaps = 20/503 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg--kpKFLMTELVPCGWVGY  1551
             +Y+DADI VEGI VGV+R ILA+RS+FFHE F++ K   +   KPK+ M+EL+P G VGY
Sbjct  62    EYSDADIVVEGIAVGVHRCILASRSKFFHELFRREKGSLEKDGKPKYCMSELLPYGNVGY  121

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF++FL+Y+YTGK K SP EVSTCVD  C H ACRPAI +AV+LMYAS+ FQ+ ELV L
Sbjct  122   EAFLIFLSYLYTGKLKPSPMEVSTCVDNVCAHDACRPAITFAVELMYASSIFQVPELVSL  181

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
              QR L   V  A  EDVIPIL+V F C  + L+ +CV R+  SNL+N ++E ELP  ++ 
Sbjct  182   FQRRLLNFVRKALAEDVIPILVVAFHCQSSQLIAQCVDRIAVSNLENISIEKELPHEVAD  241

Query  1190  DIKARRL--------NQQGAN---EKKIRKILRALDCNDVELVKLLLEESDITLDDayav  1044
              IK  R         N +  +   EK+I++I  ALD +DVELVKLLL ESDI+LDDA A+
Sbjct  242   KIKQLRRKPISDDENNTEAGDHLREKRIKRIHMALDSDDVELVKLLLTESDISLDDANAL  301

Query  1043  hyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDA  864
             HY A+YC+ KV++EVL LG  ++NLRN+RGYTVLH+AA RK+P++IV++L K GAS  D 
Sbjct  302   HYCASYCDLKVMSEVLSLGLANVNLRNSRGYTVLHIAAMRKEPSLIVSLLAK-GASALDL  360

Query  863   TCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMN---GNPVSLPSST  693
             T S+G +AV++CRR TRPKDY+  TE+G+E N DRLCID+LE  M     G   S+ +S 
Sbjct  361   T-SDGQSAVSLCRRLTRPKDYHAKTEQGQEANKDRLCIDILEREMRRNPLGGSASI-TSH  418

Query  692   TLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVG  513
             T+ +DL M+L +LENRVA AR  +P EA++ M+IAHA +T EF GL+   G  GNL+ V 
Sbjct  419   TMVDDLHMKLLYLENRVAFARLFFPTEAKLAMDIAHAATTSEFAGLAASNGSSGNLREVD  478

Query  512   LTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQ  333
             L   P  Q KRL  R EAL KTVE+GRR+F NCS+VLDK   DD+ D L  LE GTP+EQ
Sbjct  479   LNETPIMQNKRLRSRMEALSKTVEMGRRYFPNCSEVLDKFMEDDLPD-LFFLEKGTPDEQ  537

Query  332   TNKKRRYMELKEEVMKAFDKDMA  264
               K+ R+MELKE+V KAF+KD A
Sbjct  538   RIKRTRFMELKEDVQKAFNKDKA  560



>ref|XP_006376994.1| hypothetical protein POPTR_0012s11900g [Populus trichocarpa]
 gb|ERP54791.1| hypothetical protein POPTR_0012s11900g [Populus trichocarpa]
Length=587

 Score =   479 bits (1233),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 280/503 (56%), Positives = 360/503 (72%), Gaps = 20/503 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg--kpKFLMTELVPCGWVGY  1551
             +Y+DADI VEGI VGV+R ILA+RS+FFHE F++ K   +   KPK+ M+EL+P G VGY
Sbjct  62    EYSDADIVVEGIAVGVHRCILASRSKFFHELFRREKGSLEKDGKPKYCMSELLPYGNVGY  121

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF++FL+Y+YTGK K SP EVSTCVD  C H +CRPAI +AV+L YAS+ FQ+ ELV L
Sbjct  122   EAFLIFLSYLYTGKLKPSPMEVSTCVDNVCAHDSCRPAITFAVELTYASSIFQVPELVSL  181

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
              QR L   V  A  EDVIPIL+V F C  + L+ +CV R+  SNLDN ++E ELP  ++ 
Sbjct  182   FQRRLLNFVRKALAEDVIPILVVAFHCQSSQLIAQCVDRIAVSNLDNISIEKELPHEVAD  241

Query  1190  DIKARRL--------NQQGAN---EKKIRKILRALDCNDVELVKLLLEESDITLDDayav  1044
              IK  R         N +  +   EK+I++I  ALD +DVELVKLLL ESDI+LDDA A+
Sbjct  242   KIKQLRRKPISDDENNTEAGDPLREKRIKRIHMALDSDDVELVKLLLTESDISLDDANAL  301

Query  1043  hyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDA  864
             HY A+YC+ KV++EVL LG  ++NLRN+RGYTVLH+AA RK+P++IV++L K GAS  D 
Sbjct  302   HYCASYCDLKVMSEVLSLGLANVNLRNSRGYTVLHIAAMRKEPSVIVSLLAK-GASALDL  360

Query  863   TCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMM---NGNPVSLPSST  693
             T S+G +AV+ICRR TRPKDY+  TE+G+E N DRLCID+LE  M     G   S+ +S 
Sbjct  361   T-SDGQSAVSICRRLTRPKDYHAKTEQGQEANKDRLCIDILEREMRRNPRGGSASI-TSH  418

Query  692   TLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVG  513
             T+ +DL M+L +LENRVA AR  +P EA++ M+IAHA +T EF GL+  +G  GNL+ V 
Sbjct  419   TMVDDLHMKLLYLENRVAFARLFFPTEAKLAMDIAHAATTSEFAGLAASKGSSGNLREVD  478

Query  512   LTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQ  333
             L   P  Q KRL  R EAL KTVE+GRR+F NCS+VLDK   DD+ D L  LE GTP+EQ
Sbjct  479   LNETPIMQNKRLRSRMEALMKTVEMGRRYFPNCSEVLDKFMEDDLPD-LFFLEKGTPDEQ  537

Query  332   TNKKRRYMELKEEVMKAFDKDMA  264
               K+ R+MELKE+V KAF+KD A
Sbjct  538   RIKRTRFMELKEDVQKAFNKDKA  560



>ref|XP_003519533.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Glycine max]
 ref|XP_006575639.1| PREDICTED: regulatory protein NPR3-like isoform X2 [Glycine max]
 ref|XP_006575640.1| PREDICTED: regulatory protein NPR3-like isoform X3 [Glycine max]
Length=590

 Score =   477 bits (1227),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 280/507 (55%), Positives = 356/507 (70%), Gaps = 18/507 (4%)
 Frame = -2

Query  1733  EYEDYNDADIEVEGILVGVNRGILAARSQFFHEEFkkak--kdcdgkpKFLMTELVPCGW  1560
             EY DY+DA+I VE I VG++R ILA+RS FFHE FKK       +GKP++LM++LVP G 
Sbjct  59    EY-DYSDAEILVEDIPVGIHRCILASRSLFFHELFKKGTDGSGKEGKPRYLMSDLVPYGT  117

Query  1559  VGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKEL  1380
             VGYEAF VFL Y+YTG+ KASP EV+TCVDE+C H ACRPAI+YA++LMYASATFQ+KEL
Sbjct  118   VGYEAFQVFLYYLYTGRLKASPTEVTTCVDETCTHDACRPAINYALELMYASATFQMKEL  177

Query  1379  VMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGA  1200
             V+L QRHL   V+ A +EDVIPIL+  F C L  L+ +C+RRV  S+ DN +LE ELP  
Sbjct  178   VLLFQRHLLNFVEKALVEDVIPILMAAFNCQLDQLLSQCIRRVARSDFDNTSLEKELPRE  237

Query  1199  ISSDIKARRLNQQ-----------GANEKKIRKILRALDCNDVELVKLLLEESDITLDDa  1053
             + ++IK  RL  Q             NEK IR+I +ALD +DVEL+KLLL ES +TLDDA
Sbjct  238   VVTEIKLLRLPFQPESTPNAMEVESLNEKSIRRIHKALDSDDVELLKLLLNESSVTLDDA  297

Query  1052  yavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASI  873
             +A+HYA AY +SKV+ EVL LG  D+  RN+RGYTVLHVAARRKDP+I+VA+L+K GA  
Sbjct  298   HALHYACAYSDSKVIQEVLSLGMADILRRNSRGYTVLHVAARRKDPSILVALLNK-GACA  356

Query  872   RDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVM-MNGNPVSLPSS  696
              D T  +G TA+ IC+R TR KDY + T + +E N DRLC+DVLE  M  N   V++  S
Sbjct  357   SDTT-PDGQTALAICQRLTRYKDYQEQTVQCKESNKDRLCVDVLEREMRRNSMTVNMSVS  415

Query  695   TTLE-NDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKG  519
             + L  NDL M L +LE+RVA AR  +P EAR+ +E A ADS+  +   S ++G  GNLK 
Sbjct  416   SQLTANDLHMRLDYLEDRVAFARLFFPAEARVAIENAEADSSSMYANSSALKGTNGNLKQ  475

Query  518   VGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPE  339
             V L   P    ++L  R  AL KTVE GRRFF +CS+VLDK   DD +  +  LE G+ +
Sbjct  476   VDLNESPSAHTRKLQLRLHALMKTVENGRRFFPHCSEVLDKFLEDDDMPDVFFLEKGSED  535

Query  338   EQTNKKRRYMELKEEVMKAFDKDMAQN  258
             EQ  KK R+MELK++V KAF KDMA+N
Sbjct  536   EQRIKKARFMELKDDVQKAFHKDMAEN  562



>ref|XP_002274045.1| PREDICTED: regulatory protein NPR3 isoform X1 [Vitis vinifera]
Length=587

 Score =   476 bits (1225),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 285/511 (56%), Positives = 364/511 (71%), Gaps = 23/511 (5%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg--kpKFLMTELVPCGWVGY  1551
             DY+DA+I VEGI VGV+R ILAARS+FF++ FK+ K   +   KP++ M++ +P G VGY
Sbjct  62    DYSDAEIIVEGIPVGVHRCILAARSRFFYDLFKREKSSSEKDGKPRYCMSDFLPYGKVGY  121

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF++FL+Y+YTGK KASP EVSTCVD  C H ACRPAID++V+LMYASA FQ+ ELV L
Sbjct  122   EAFLIFLSYLYTGKLKASPLEVSTCVDTGCAHDACRPAIDFSVELMYASAIFQVPELVSL  181

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
              QR L   +  A +EDVIPIL+V + C  + LV +CV RV  S+LD+ +LE +LP  ++ 
Sbjct  182   FQRRLTNFIGKALLEDVIPILVVAYHCKSSVLVNQCVDRVARSDLDSISLEKDLPYEVAE  241

Query  1190  DIKARRLNQQ-----------GANEKKIRKILRALDCNDVELVKLLLEESDITLDDayav  1044
              IK  RL  Q             +EK++R+IL+ALD +DVELVKLLL ES ITLD+AYA+
Sbjct  242   SIKLLRLKSQPDDECNTVPVDPVHEKRVRRILKALDSDDVELVKLLLSESGITLDEAYAL  301

Query  1043  hyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDA  864
             HYAAAYC+ KVV+EVL LG  D+N  N RGYTVLHVAA RK+P+IIV++L K GA   + 
Sbjct  302   HYAAAYCDPKVVSEVLSLGLADVNRHNPRGYTVLHVAAMRKEPSIIVSLLTK-GAHASER  360

Query  863   TCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNP----VSLPSS  696
             T S+G +AV+ICRR TRPKDY+   E+G+E N DR+CIDVLE   M  NP    VS+ SS
Sbjct  361   T-SDGQSAVSICRRLTRPKDYHAKMEQGQETNKDRICIDVLER-EMRRNPLAGDVSI-SS  417

Query  695   TTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGV  516
              T+ +DL M+L +LENRVA AR  +P EA++ MEIAHA++T EF GLS  +   GNL+ V
Sbjct  418   PTMADDLHMKLLYLENRVAFARLFFPSEAKLAMEIAHAETTSEFAGLSASKRSSGNLREV  477

Query  515   GLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEE  336
              L   P  Q +RL  R  AL KTVE+GRR+F +CS VLDK   DD+ D L  LE GT +E
Sbjct  478   DLNETPIMQNQRLRSRMNALVKTVEMGRRYFPHCSQVLDKFMEDDLPD-LFYLEKGTLDE  536

Query  335   QTNKKRRYMELKEEVMKAFDKDMAQ-NRVGL  246
             Q  K+ R+MELKE+V +AF KD A+ NR GL
Sbjct  537   QRIKRTRFMELKEDVQRAFTKDKAEFNRSGL  567



>gb|KDP22628.1| hypothetical protein JCGZ_02854 [Jatropha curcas]
Length=587

 Score =   476 bits (1225),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 288/514 (56%), Positives = 365/514 (71%), Gaps = 23/514 (4%)
 Frame = -2

Query  1745  IDPGEYEDYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg--kpKFLMTELV  1572
             IDP    DY+DA+I VEG  VGV+R ILAARS+FFHE FK+ K   D   KPK+ M++L+
Sbjct  60    IDPSC--DYSDAEIIVEGKPVGVHRCILAARSKFFHELFKQEKGSSDKGGKPKYEMSDLL  117

Query  1571  PCGWVGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQ  1392
             P G VGYEAF++FLNY+YTGK K SP EVSTCVD  C H ACRPAI++AV+L+YAS+ FQ
Sbjct  118   PYGKVGYEAFLIFLNYMYTGKLKPSPMEVSTCVDNVCSHDACRPAINFAVELLYASSIFQ  177

Query  1391  IKELVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENE  1212
             + ELV L QR L   V  A +EDVIPIL+V F C    LV +CV R+  S+LDN ++E E
Sbjct  178   VPELVSLFQRRLLNFVGKAYVEDVIPILVVAFHCQSNQLVAQCVDRIARSDLDNMSIERE  237

Query  1211  LPGAISSDIK---ARRLNQQGAN--------EKKIRKILRALDCNDVELVKLLLEESDIT  1065
             LP  +S DIK    R +++   N        EK+IR+I +ALD +DVELVKLLL ES +T
Sbjct  238   LPYEVSEDIKFLRKRPVSEDEENTEAVDPMHEKRIRRIHKALDSDDVELVKLLLTESAVT  297

Query  1064  LDDayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKS  885
             LDDA A+HYAAAYC+ KVV+EVL L   D+NL N++GYTVLHVAA R++P++IV++L K 
Sbjct  298   LDDARALHYAAAYCDPKVVSEVLSLDLADVNLTNSQGYTVLHVAAMRREPSVIVSLLAK-  356

Query  884   GASIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPV--  711
             GA   D T S+G +AV+ICRR TRPKDY+   E+G+E N DRLCIDVLE   M  NP+  
Sbjct  357   GACALDLT-SDGRSAVSICRRLTRPKDYHAKIEQGQEANKDRLCIDVLER-EMRRNPMAG  414

Query  710   -SLPSSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLC  534
              +  +S T+ +DL M+L +LENRVA AR  +P EA++ M+IAHA +T EF GLS  +   
Sbjct  415   DASITSHTMSDDLHMKLLYLENRVAFARLFFPTEAKVAMDIAHAKTTHEFAGLSASKA-N  473

Query  533   GNLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLE  354
             GNL+ V L   P  Q KRL+ R EAL KTVE+GRR+F +CS+VLDK   DD+ D L  LE
Sbjct  474   GNLREVDLNETPITQNKRLLSRLEALMKTVEMGRRYFPSCSEVLDKFMEDDLPD-LFYLE  532

Query  353   SGTPEEQTNKKRRYMELKEEVMKAFDKDMAQNRV  252
              GTP EQ  K+ R+MELKE+V KAF+KD A+  V
Sbjct  533   KGTPAEQRIKRMRFMELKEDVQKAFNKDKAERSV  566



>ref|XP_009786791.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X3 
[Nicotiana sylvestris]
Length=341

 Score =   466 bits (1198),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 253/383 (66%), Positives = 291/383 (76%), Gaps = 46/383 (12%)
 Frame = +1

Query  2404  LLGNGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKES  2583
             +LG+G  QTPSR +LL MVKK+S  LGKTIVE+E+ SDVE DP FWH+++D+YF+ G+ES
Sbjct  1     MLGDGA-QTPSRSDLLCMVKKNSNMLGKTIVEDEETSDVETDPIFWHDIMDVYFIRGRES  59

Query  2584  RGRQEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYL  2763
             RGRQEDDL+FFV+K+ LQ + SN +   NSPYFVRRW+PKLDDL G +S  VDWRRS+YL
Sbjct  60    RGRQEDDLVFFVKKLHLQNHGSNEDESVNSPYFVRRWAPKLDDLTGASSSDVDWRRSFYL  119

Query  2764  NLIAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVET  2943
             NLIA T+FSVTVAICS +VLKNYQTGKD+PLSPIYKV+KTVYASPSRINFHLDSRKEVET
Sbjct  120   NLIAQTSFSVTVAICSQQVLKNYQTGKDRPLSPIYKVIKTVYASPSRINFHLDSRKEVET  179

Query  2944  TPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDSSQSETSGGKTQSSK  3123
             T AYP+ICFAVDDFDSTFDAV                                       
Sbjct  180   TSAYPEICFAVDDFDSTFDAV---------------------------------------  200

Query  3124  ITIFSGFVSYQMVRDAYDAGRTgfgsllslhssgKTDRIYMKGPGGRGEVEVAVSGVVDQ  3303
             IT+FSGFVSYQMVRDAYDAGR+GFGSLLSLHS GKTDRIYMKGPGGRGEVEVAVSGVVDQ
Sbjct  201   ITLFSGFVSYQMVRDAYDAGRSGFGSLLSLHSVGKTDRIYMKGPGGRGEVEVAVSGVVDQ  260

Query  3304  SKEEYGHHP----PKKGLsfsavvrraasvasvaakhayaaasatrssDEEMIPLKCCLM  3471
             SK+++ HH      +KGL  S       + +  +    +A A+A+ + DE MIPLKCCLM
Sbjct  261   SKQDFSHHSVDNDSRKGL--SFSAVVRRAASVASEAAKHAYAAASATRDEGMIPLKCCLM  318

Query  3472  SISLPWEHIAHDLLLKGSPPVNL  3540
             SISLPWEHIAHDLL KGSPPVNL
Sbjct  319   SISLPWEHIAHDLLFKGSPPVNL  341



>ref|NP_001238674.1| NPR1-2 protein [Glycine max]
 gb|ACJ45015.1| NPR1-2 protein [Glycine max]
Length=590

 Score =   475 bits (1223),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 283/506 (56%), Positives = 357/506 (71%), Gaps = 22/506 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg--kpKFLMTELVPCGWVGY  1551
             DY+DADI VEGI V V+R ILA+RS+FFHE FK+ K   +   K K+ M++L+P G VGY
Sbjct  62    DYSDADIVVEGISVSVHRCILASRSKFFHELFKREKGSSEKEGKLKYNMSDLLPYGKVGY  121

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF++FL YVYTGK K SP EVSTCVD  C H ACRPAI++AV+LMYAS  FQI E V L
Sbjct  122   EAFLIFLGYVYTGKLKPSPMEVSTCVDSVCAHDACRPAINFAVELMYASYIFQIPEFVSL  181

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
              QR L   +  A +EDVIPIL V F C L+ LV +C+ RV  S+LD  +++ ELP  +S 
Sbjct  182   FQRRLLNFIGKALVEDVIPILTVAFHCQLSQLVNQCIDRVARSDLDQISIDQELPNELSQ  241

Query  1190  DIKARRLNQQGANE-----------KKIRKILRALDCNDVELVKLLLEESDITLDDayav  1044
              +K  R N Q   E           K+I +I +ALD +DVELVKLLL ESDITLD+A A+
Sbjct  242   KVKLLRRNPQRDVENDASIVDALSLKRITRIHKALDSDDVELVKLLLNESDITLDEANAL  301

Query  1043  hyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDA  864
             HYAAAYC+ KVV+EVLGLG  ++NLRN+RGYTVLH+AA RK+P+IIV++L K GA   D 
Sbjct  302   HYAAAYCDPKVVSEVLGLGLANVNLRNSRGYTVLHIAAMRKEPSIIVSLLTK-GACASDL  360

Query  863   TCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPV---SLPSST  693
             T  +G +AV+ICRR TRPKDY+  TE+G+E N DR+CIDVLE  M   NP+   +  SS 
Sbjct  361   TF-DGQSAVSICRRLTRPKDYHAKTEQGKETNKDRICIDVLEREMWR-NPLAGDACMSSH  418

Query  692   TLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSG--MEGLCGNLKG  519
             T+ +DL M+L +LENRVA AR  +P EA++ M+IAHA++T EF GLS    +G  GNL+ 
Sbjct  419   TMADDLHMKLLYLENRVAFARLFFPSEAKLAMDIAHAETTSEFAGLSASNSKGSNGNLRE  478

Query  518   VGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPE  339
             V L   P  Q KRL  R EAL KTVE+GRR+F +CS+VLDK   DD+ D L  LE GT E
Sbjct  479   VDLNETPIVQSKRLFSRMEALMKTVEMGRRYFPHCSEVLDKFMEDDLPD-LFYLEKGTNE  537

Query  338   EQTNKKRRYMELKEEVMKAFDKDMAQ  261
             EQ  K+ R+MELK++V KAF+ D A+
Sbjct  538   EQRIKRTRFMELKDDVHKAFNMDKAE  563



>ref|XP_010110124.1| hypothetical protein L484_003753 [Morus notabilis]
 gb|EXC25265.1| hypothetical protein L484_003753 [Morus notabilis]
Length=414

 Score =   468 bits (1204),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 259/396 (65%), Positives = 318/396 (80%), Gaps = 20/396 (5%)
 Frame = +1

Query  2404  LLGNGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKES  2583
             +LG+G  +TPSR ELLSMVK++SK LGKT+++EE+ SDVE DP+FWH+VLDLYF  GKES
Sbjct  1     MLGDGE-ETPSRSELLSMVKRNSKLLGKTVLDEENSSDVERDPRFWHDVLDLYFFRGKES  59

Query  2584  RGRQEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYL  2763
             R RQ+DDL+F VRK+  QGY SN + ED SPYFVRRW+PKLD+++GE SV VDWRRS+YL
Sbjct  60    RRRQDDDLVFLVRKLGSQGYGSNDDKEDVSPYFVRRWAPKLDNVVGEISVDVDWRRSFYL  119

Query  2764  NLIAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVET  2943
             NLIAHT+F+VTVAICSH+ L N+Q  +D PLSPIYKVVKTVYASP+R+NF LDS+KE ET
Sbjct  120   NLIAHTSFTVTVAICSHQELLNHQAARDTPLSPIYKVVKTVYASPTRVNFQLDSKKEAET  179

Query  2944  TPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDSSQ------------  3087
              PAYPDICF+VDDFDSTFDAVVLT+ DHCYCV+LNA+ GAAFP D+ Q            
Sbjct  180   KPAYPDICFSVDDFDSTFDAVVLTETDHCYCVLLNADGGAAFPVDNKQHDSSSTDSSSRR  239

Query  3088  SETSGGKTQSSKITIFSGFVSYQMVRDAYD----AGRTgfgsllslhssgKTDRIYMKGP  3255
             ++TS   T+++K+T+FSGFVSYQMVRDAYD    +       L   +S GKTDR+YMKGP
Sbjct  240   TDTSNANTKNTKLTLFSGFVSYQMVRDAYDGILFSKSRFGSLLAFRNSPGKTDRLYMKGP  299

Query  3256  GGRGEVEVAVSGVVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasat  3426
             GGRGEV+VAVSGV DQS ++ G   P   K+G    ++VR+AA+VA+VAAKHAYAAA+A+
Sbjct  300   GGRGEVDVAVSGVADQSHQDPGPFSPVVSKRGFGIGSIVRKAAAVATVAAKHAYAAAAAS  359

Query  3427  rssDEEMIPLKCCLMSISLPWEHIAHDLLLKGSPPV  3534
              S DEEM+PLKCCLMSISLPWE+IA+DLL K +P +
Sbjct  360   SSLDEEMVPLKCCLMSISLPWEYIANDLLFKPNPHI  395



>ref|XP_010272312.1| PREDICTED: regulatory protein NPR3 isoform X2 [Nelumbo nucifera]
Length=570

 Score =   474 bits (1219),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 287/504 (57%), Positives = 354/504 (70%), Gaps = 23/504 (5%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg--kpKFLMTELVPCGWVGY  1551
             DY+DA++ VEG  VGV+R ILAARS+FFHE F K K       KP++ MT+LVP G VGY
Sbjct  62    DYSDAEVIVEGNTVGVHRCILAARSRFFHELFTKTKGSPQKEGKPQYNMTDLVPYGKVGY  121

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF +FL+Y+YTGK K SP EVSTCVD SC H ACRPAI++ V+LMY SA FQI ELV L
Sbjct  122   EAFTIFLSYLYTGKLKPSPAEVSTCVDSSCAHDACRPAINFIVELMYTSAHFQITELVSL  181

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
              QR L   V+ A  EDVIPIL+V F C L  L++ CV+R+  S+LD+ +LE +LP  +  
Sbjct  182   FQRRLLIFVEKAFAEDVIPILMVAFHCQLNHLIDHCVQRIARSDLDSISLE-KLPNEVKM  240

Query  1190  DIKARRLNQQ----------GANEKKIRKILRALDCNDVELVKLLLEESDITLDDayavh  1041
             DIK+ RL                EK IR+I +ALD +DVELVKLLL ES +TLDDA A+H
Sbjct  241   DIKSLRLKSHLDEASAMDVDPVREKNIRRIHKALDSDDVELVKLLLNESGVTLDDANALH  300

Query  1040  yaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDAT  861
             YAAAYC+ KVV EVL LG  + NLR+ARGYTVLHVAA RK+P+IIV +L+K GAS  + T
Sbjct  301   YAAAYCDPKVVAEVLDLGLANANLRDARGYTVLHVAAMRKEPSIIVRLLNK-GASALELT  359

Query  860   CSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPV----SLPSST  693
              S+G +AV ICRR TRPKDYN  T +G+E N DR+CID+LE  M   NP+    S+ S  
Sbjct  360   -SDGQSAVRICRRLTRPKDYNAKTIQGQETNKDRICIDILEREMRR-NPMAGATSISSPA  417

Query  692   TLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVG  513
             T E DL M+L +LENRVA AR L+P EAR+ ME AHADST EF GLS  +G  GNL+ V 
Sbjct  418   TSE-DLHMKLLYLENRVAFARLLFPTEARLAMESAHADSTFEFAGLSASKGSSGNLREVD  476

Query  512   LTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQ  333
             L   P  Q KRL  R EAL+KT E+GRR+F +CS+VLDK   DD+ D L  LE G+ +EQ
Sbjct  477   LNETPTTQNKRLHSRMEALQKT-EVGRRYFPHCSEVLDKFMEDDLPD-LFFLEKGSLDEQ  534

Query  332   TNKKRRYMELKEEVMKAFDKDMAQ  261
               K+ R++ELK +V KAF+KD A+
Sbjct  535   RIKRSRFVELKRDVQKAFNKDKAE  558



>ref|XP_002510059.1| cw7 protein, putative [Ricinus communis]
 gb|EEF52246.1| cw7 protein, putative [Ricinus communis]
Length=399

 Score =   467 bits (1202),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 263/388 (68%), Positives = 321/388 (83%), Gaps = 19/388 (5%)
 Frame = +1

Query  2404  LLGNGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKES  2583
             +LG+G   TPSR+ELLSMVKKHS  LGK+  E +D +DVEMD  FW+++LDLYF+ G+ES
Sbjct  1     MLGDGE-DTPSRYELLSMVKKHSTLLGKS-TEVDDATDVEMDGHFWYDMLDLYFIRGRES  58

Query  2584  RGRQEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYL  2763
             RGRQ+DDL+FFV+KM  +GY  N N +  SPYFVRRW+PKL+ L+ +NS  VDWRRS+YL
Sbjct  59    RGRQDDDLVFFVKKMGTEGYGFNDNMQGVSPYFVRRWAPKLESLISDNS-EVDWRRSFYL  117

Query  2764  NLIAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVET  2943
             NLIAHT+FSVTVAICSH+ L+N+Q G +  LSPIYKVVKTVYAS SR+NFHLDS+K +ET
Sbjct  118   NLIAHTSFSVTVAICSHQALRNHQAGPNTQLSPIYKVVKTVYASASRVNFHLDSKKAIET  177

Query  2944  TPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSD------------SSQ  3087
             TPAYPDICFAVDDFDSTFDAVVLT+ DHCYCV+LNA+ GAAFP +              +
Sbjct  178   TPAYPDICFAVDDFDSTFDAVVLTEKDHCYCVLLNAHGGAAFPCERESPDSSSNSVSPVE  237

Query  3088  SETSGGKTQSSKITIFSGFVSYQMVRDAYDAGRTgfgsllslhss-gKTDRIYMKGPGGR  3264
              +TS GKT++SK+T+FSGFVSYQMVR+AYDAG++ FGSLLSL  S GKTD++YMKGPGGR
Sbjct  238   VDTSSGKTKNSKLTLFSGFVSYQMVREAYDAGKSRFGSLLSLGHSPGKTDKLYMKGPGGR  297

Query  3265  GEVEVAVSGVVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrss  3435
             GEVEVAVSGV DQS++++G   P   K+G    ++VR+AASVASVAAKHAYAAA+A+ SS
Sbjct  298   GEVEVAVSGVADQSQQDFGPFSPVTSKRGFGIGSIVRKAASVASVAAKHAYAAAAASTSS  357

Query  3436  DEEMIPLKCCLMSISLPWEHIAHDLLLK  3519
             DEEM+PLKCCLM++SLPWEHIA+DLL K
Sbjct  358   DEEMVPLKCCLMAVSLPWEHIAYDLLFK  385



>ref|XP_008348376.1| PREDICTED: LOW QUALITY PROTEIN: regulatory protein NPR3-like, 
partial [Malus domestica]
Length=586

 Score =   473 bits (1217),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 277/506 (55%), Positives = 360/506 (71%), Gaps = 21/506 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkak--kdcdgkpKFLMTELVPCGWVGY  1551
             DY+DA+I VEG  VGVNR ILA+RSQFF E F+K     + +GKP++LM+ELVP G VGY
Sbjct  58    DYSDAEIVVEGNTVGVNRCILASRSQFFQELFRKGSDDSNKEGKPRYLMSELVPNGGVGY  117

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF VFLNY+YTGK   SP EVSTCVD+ C H AC PAI+Y V+LMYAS+TFQ+KELV L
Sbjct  118   EAFKVFLNYLYTGKLNPSPREVSTCVDDGCPHDACGPAINYVVELMYASSTFQMKELVQL  177

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
             +QR L   V+ A IEDVIPIL   F C L+ L+  C++R+  S+LD   +  E P  +S+
Sbjct  178   VQRRLSNFVEKALIEDVIPILKAAFHCQLSQLLSHCIQRIARSDLDYMAIGKEFPHEVSN  237

Query  1190  DIKARRLNQQGANE-----------KKIRKILRALDCNDVELVKLLLEESDITLDDayav  1044
             DIK+ RL     +E           K+IR+I +ALD +DVELV LLL+ESDITLDDAYA+
Sbjct  238   DIKSLRLKSHENDESSMMEIELIEDKRIRRIHKALDSDDVELVGLLLKESDITLDDAYAL  297

Query  1043  hyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDA  864
             HYA AYC+ KVV EVL LG+ +LNLRN+RG+TVLHVAARRK PA++V +LD+  +++   
Sbjct  298   HYAVAYCDPKVVKEVLSLGEANLNLRNSRGHTVLHVAARRKLPAVLVPLLDRGASALE--  355

Query  863   TCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVM----MNGNPVSLPSS  696
             T S+G T V ICRR TRPKD+ + T++G+E N DRLCI++LE  M    ++GN VS+ S 
Sbjct  356   TTSDGQTPVAICRRLTRPKDFLENTKQGQESNKDRLCIELLEREMRRNSISGN-VSIISE  414

Query  695   TTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGV  516
               + +DL + L +LENRVA AR L+P EA++ ME+A A ST  + GL+   G  GNL+ V
Sbjct  415   -VIPDDLHVRLDYLENRVAFARLLFPAEAKLAMEMADAHSTSVYTGLAASRGSSGNLREV  473

Query  515   GLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEE  336
              L   P  + KRL  R +AL KTV++GRRFF NCS+VLDK   D++  +   L+ GTPEE
Sbjct  474   DLNETPSGRTKRLQIRMQALIKTVKMGRRFFPNCSEVLDKFLDDEMDMADFILDKGTPEE  533

Query  335   QTNKKRRYMELKEEVMKAFDKDMAQN  258
             Q  K+ R++ELK++V KAF KDMA+N
Sbjct  534   QRIKRMRFLELKDDVQKAFCKDMAEN  559



>ref|XP_008451832.1| PREDICTED: LOW QUALITY PROTEIN: regulatory protein NPR3-like 
[Cucumis melo]
Length=586

 Score =   473 bits (1217),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 288/504 (57%), Positives = 352/504 (70%), Gaps = 20/504 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg--kpKFLMTELVPCGWVGY  1551
             DY DA I VEGI VGV+R ILAARSQFFHE FK+         KPK+ M++LV    VG 
Sbjct  62    DYTDAVIVVEGIEVGVHRCILAARSQFFHELFKQEVDSSTEDGKPKYCMSKLVAFSKVGI  121

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF V LNY+YTGK K SPPEVSTCVDE+C H AC PAI+YAV+LMYASATF++KE+V+L
Sbjct  122   EAFKVILNYLYTGKLKPSPPEVSTCVDEACAHDACGPAINYAVELMYASATFKMKEMVLL  181

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
             +QR L   V+ AA+EDVI IL+  F C L  L   C++RV  S+LD  +LE ELP  ++S
Sbjct  182   VQRRLLNFVEKAAVEDVITILIAAFHCHLDQLHSPCIQRVARSDLDAVSLERELPDEVAS  241

Query  1190  DIKARRLNQQGAN------------EKKIRKILRALDCNDVELVKLLL-EESDITLDDay  1050
             +IK+ R+  Q               EKKIR++ +ALD +DVEL+KLLL E SDITL+DAY
Sbjct  242   EIKSLRMKSQQDTEADIVEEVDLNREKKIRRLHKALDSDDVELLKLLLIESSDITLNDAY  301

Query  1049  avhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIR  870
             A+HYA AYC+ KV+ EVL LG  DLNL+N RG TVLHVAARRKDP IIVA+LDK GAS  
Sbjct  302   ALHYATAYCDPKVIKEVLNLGLADLNLKNLRGQTVLHVAARRKDPKIIVALLDK-GASAL  360

Query  869   DATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVM-MNGNPVSLPSST  693
             + T ++G TAVTICRR TRP+DYN+TT++G+E N DRLCIDVLE  M  N     +  +T
Sbjct  361   EPT-ADGQTAVTICRRLTRPRDYNETTQKGQESNKDRLCIDVLEREMRRNSFSTGMEMAT  419

Query  692   TLE-NDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGV  516
              +   D+ + L +LENRVA AR   P EA++ MEIA ADST+ + G    +G  GNL  V
Sbjct  420   QISAADMHVMLDYLENRVAFARLFXPVEAKVAMEIADADSTIAYTGPVSSKGSSGNLLKV  479

Query  515   GLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEE  336
              L   P    KRL  R +AL KTVE GRR+F NCS+VLD   ADD+ D L  LE GTPEE
Sbjct  480   DLNETPSVGTKRLQSRMQALMKTVETGRRYFPNCSEVLDNFLADDMPDLL-FLEKGTPEE  538

Query  335   QTNKKRRYMELKEEVMKAFDKDMA  264
             Q  KK R+MELK++V KAF KD+A
Sbjct  539   QRKKKARFMELKDDVQKAFCKDLA  562



>gb|KHN14362.1| Regulatory protein NPR3 [Glycine soja]
Length=590

 Score =   473 bits (1217),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 283/506 (56%), Positives = 356/506 (70%), Gaps = 22/506 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg--kpKFLMTELVPCGWVGY  1551
             DY+DADI VEGI V V+R ILA+RS+FFHE FK+ K   +   K K+ M++L+P G VGY
Sbjct  62    DYSDADIVVEGISVSVHRCILASRSKFFHELFKREKGSSEKEGKLKYNMSDLLPYGKVGY  121

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF +FL YVYTGK K SP EVSTCVD  C H ACRPAI++AV+LMYAS  FQI E V L
Sbjct  122   EAFPIFLGYVYTGKLKPSPMEVSTCVDSVCAHDACRPAINFAVELMYASYIFQIPEFVSL  181

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
              QR L   +  A +EDVIPIL V F C L+ LV +C+ RV  S+LD  +++ ELP  +S 
Sbjct  182   FQRRLLNFIGKALVEDVIPILTVAFHCQLSQLVNQCIDRVARSDLDQISIDQELPNELSQ  241

Query  1190  DIKARRLNQQGANE-----------KKIRKILRALDCNDVELVKLLLEESDITLDDayav  1044
              +K  R N Q   E           K+I +I +ALD +DVELVKLLL ESDITLD+A A+
Sbjct  242   KVKLLRRNPQRDVENDASIVDALSLKRITRIHKALDSDDVELVKLLLNESDITLDEANAL  301

Query  1043  hyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDA  864
             HYAAAYC+ KVV+EVLGLG  ++NLRN+RGYTVLH+AA RK+P+IIV++L K GA   D 
Sbjct  302   HYAAAYCDPKVVSEVLGLGLANVNLRNSRGYTVLHIAAMRKEPSIIVSLLTK-GACASDL  360

Query  863   TCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPV---SLPSST  693
             T  +G +AV+ICRR TRPKDY+  TE+G+E N DR+CIDVLE  M   NP+   +  SS 
Sbjct  361   TF-DGQSAVSICRRLTRPKDYHAKTEQGKETNKDRICIDVLEREMWR-NPLAGDACMSSH  418

Query  692   TLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSG--MEGLCGNLKG  519
             T+ +DL M+L +LENRVA AR  +P EA++ M+IAHA++T EF GLS    +G  GNL+ 
Sbjct  419   TMADDLHMKLLYLENRVAFARLFFPSEAKLAMDIAHAETTSEFAGLSASNSKGSNGNLRE  478

Query  518   VGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPE  339
             V L   P  Q KRL  R EAL KTVE+GRR+F +CS+VLDK   DD+ D L  LE GT E
Sbjct  479   VDLNETPIVQSKRLFSRMEALMKTVEMGRRYFPHCSEVLDKFMEDDLPD-LFYLEKGTNE  537

Query  338   EQTNKKRRYMELKEEVMKAFDKDMAQ  261
             EQ  K+ R+MELK++V KAF+ D A+
Sbjct  538   EQRIKRTRFMELKDDVHKAFNMDKAE  563



>ref|NP_001238658.1| NPR1-1 protein [Glycine max]
 gb|ACJ45013.1| NPR1-1 protein [Glycine max]
 gb|KHN22972.1| Regulatory protein NPR3 [Glycine soja]
Length=590

 Score =   473 bits (1217),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 283/506 (56%), Positives = 358/506 (71%), Gaps = 22/506 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg--kpKFLMTELVPCGWVGY  1551
             DY+DAD+ VEGI V V+R ILA+RS+FFHE FK+ K   +   K K+ M +L+P G VGY
Sbjct  62    DYSDADLVVEGIPVSVHRCILASRSKFFHELFKREKGSSEKEGKLKYNMNDLLPYGKVGY  121

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF++FL YVYTGK K SP EVSTCVD  C H ACRPAI++AV+LMYAS+ FQI ELV L
Sbjct  122   EAFLIFLGYVYTGKLKPSPMEVSTCVDNVCAHDACRPAINFAVELMYASSIFQIPELVSL  181

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
              QR L   +  A +EDVIPIL V F C    LV +C+ RV  S+LD  +++ ELP  +S 
Sbjct  182   FQRRLLNFIGKALVEDVIPILTVAFHCQSNQLVNQCIDRVARSDLDQISIDQELPHELSQ  241

Query  1190  DIK-ARRLNQQGANE----------KKIRKILRALDCNDVELVKLLLEESDITLDDayav  1044
              +K  RR  QQ              K+I +I +ALD +DVELVKLLL ESDITLD+A A+
Sbjct  242   KVKLLRRKPQQDVENDASVVDALSLKRITRIHKALDSDDVELVKLLLNESDITLDEANAL  301

Query  1043  hyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDA  864
             HYAAAYC+ KVV+EVLGLG  ++NLRN+RGYTVLH+AA RK+P+IIV++L K GA   D 
Sbjct  302   HYAAAYCDPKVVSEVLGLGLANVNLRNSRGYTVLHIAAMRKEPSIIVSLLTK-GACASDL  360

Query  863   TCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPV---SLPSST  693
             T  +G +AV+ICRR TRPKDY+  TE+G+E N DR+CIDVLE   M  NP+   +  SS 
Sbjct  361   TF-DGQSAVSICRRLTRPKDYHAKTEQGKETNKDRICIDVLER-EMRRNPMAGDACMSSH  418

Query  692   TLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSG--MEGLCGNLKG  519
             T+ +DL M+L +LENRVA AR  +P EA++ M+IAHA++T EF GLS    +G  GNL+ 
Sbjct  419   TMADDLHMKLLYLENRVAFARLFFPSEAKLAMDIAHAETTSEFAGLSASNSKGSNGNLRE  478

Query  518   VGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPE  339
             V L   P  Q KRL+ R EAL KTVE+GRR+F +CS+VLDK   DD+ D L  LE GT E
Sbjct  479   VDLNETPIVQNKRLLSRMEALTKTVEMGRRYFPHCSEVLDKFMEDDLPD-LFYLEKGTHE  537

Query  338   EQTNKKRRYMELKEEVMKAFDKDMAQ  261
             EQ  K+ R+MELK++V KAF+KD A+
Sbjct  538   EQRIKRTRFMELKDDVHKAFNKDKAE  563



>ref|XP_010092646.1| Regulatory protein [Morus notabilis]
 gb|EXB51897.1| Regulatory protein [Morus notabilis]
Length=582

 Score =   472 bits (1215),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 285/515 (55%), Positives = 360/515 (70%), Gaps = 21/515 (4%)
 Frame = -2

Query  1736  GEYEDYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg---kpKFLMTELVPC  1566
             G   DY+DAD+ VEG  VGV+R ILAARS FFH+ FKK K   +    KPK+ + +L+P 
Sbjct  51    GSSCDYSDADVIVEGTRVGVHRCILAARSGFFHDLFKKDKGVSEKGGGKPKYCLEDLLPY  110

Query  1565  GWVGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIK  1386
             G VGYEAF+V L+YVYTGK K SP EVSTCVD  C H +CRPAI++AV+LMYAS+ FQ+ 
Sbjct  111   GSVGYEAFLVLLSYVYTGKLKPSPMEVSTCVDNICPHDSCRPAINFAVELMYASSIFQMP  170

Query  1385  ELVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELP  1206
             ELV   QR L   V  A +EDVIPIL+V F C L+ L  +CV RV  S+L+  +LE ELP
Sbjct  171   ELVSPFQRRLLNFVGKALVEDVIPILVVAFHCQLSQLFAQCVDRVARSDLEIVSLEKELP  230

Query  1205  GAISSDIKARRLNQQGAN-----------EKKIRKILRALDCNDVELVKLLLEESDITLD  1059
               +  +IK  R   Q ++           EK+IR+I +ALD +DVELVKLLL ES+ITLD
Sbjct  231   HEVVENIKVLRGKSQCSDKDNTESVDPLREKRIRRIHKALDSDDVELVKLLLTESEITLD  290

Query  1058  DayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGA  879
             DA A+HYAAAYC+ KVVNEVLGLG  D+NL+N+RGYTVLH+AA RK+P+IIV++L K GA
Sbjct  291   DANALHYAAAYCDPKVVNEVLGLGLADVNLQNSRGYTVLHIAAMRKEPSIIVSLLTK-GA  349

Query  878   SIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNG--NPVSL  705
                D T S+G +AV+ICRR TRPKDY+   E+G+E N DR+CIDVLE  M      P + 
Sbjct  350   CASDLT-SDGQSAVSICRRLTRPKDYHAKMEQGQETNKDRICIDVLEREMRRNPMAPNAS  408

Query  704   PSSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGM-EGLCGN  528
              SS T+ +DL M L +LENRVA AR  +P EA++ M+IAHA++T EF  L+   +   GN
Sbjct  409   ISSQTMADDLHMRLLYLENRVAFARLFFPSEAKLAMDIAHAETTSEFARLAAASKSSSGN  468

Query  527   LKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESG  348
              + V L   P  Q KRL  R EAL KTVE+GRR+F +CS+VLDK   DD+ + L  LE G
Sbjct  469   FREVDLNETPIVQKKRLFSRMEALMKTVEMGRRYFPHCSEVLDKFMEDDLPEML-YLEKG  527

Query  347   TPEEQTNKKRRYMELKEEVMKAFDKDMAQ-NRVGL  246
             T EEQ  K+ RYMELK++V KAF+KD A+ +RVGL
Sbjct  528   TTEEQKIKRMRYMELKDDVQKAFNKDKAEFDRVGL  562



>ref|XP_007223312.1| hypothetical protein PRUPE_ppa007301mg [Prunus persica]
 gb|EMJ24511.1| hypothetical protein PRUPE_ppa007301mg [Prunus persica]
Length=374

 Score =   464 bits (1193),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 260/377 (69%), Positives = 312/377 (83%), Gaps = 18/377 (5%)
 Frame = +1

Query  2455  MVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGRQEDDLIFFVRKMSL  2634
             MVKKHS  LGKT+V+ +D SDVEMD +FWH+VLDLYF+ GK+SRGRQ+DDL+FFVRK+S 
Sbjct  1     MVKKHSSLLGKTVVDADDVSDVEMDHKFWHDVLDLYFIRGKDSRGRQDDDLVFFVRKLSS  60

Query  2635  QGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLIAHTTFSVTVAICSH  2814
              G+ S+   E  SPYFVRRW+PKLD+L+GEN+V VDWRRSYYLNLIAHT+F+VTVAICSH
Sbjct  61    YGHGSS--DESVSPYFVRRWAPKLDNLIGENNVEVDWRRSYYLNLIAHTSFTVTVAICSH  118

Query  2815  EVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPAYPDICFAVDDFDST  2994
             + L+N+Q  +  PLSPIYKVVKTVYASPSR+NF LDSRKEVETTPAYPDICFA+DDFDST
Sbjct  119   QDLRNHQAEQGTPLSPIYKVVKTVYASPSRVNFQLDSRKEVETTPAYPDICFAIDDFDST  178

Query  2995  FDAVVLTDVDHCYCVILNANDGAAFPSDSSQS------------ETSGGKTQSSKITIFS  3138
             FDAVVLT+ DHCYCVILNA+DGAAFP    +             ET+  KT+++K+T+FS
Sbjct  179   FDAVVLTETDHCYCVILNAHDGAAFPRVKEEDGCSSSDSSSLRVETNSSKTKNTKLTLFS  238

Query  3139  GFVSYQMVRDAYDAGRTgfgsllslhssgKTDRIYMKGPGGRGEVEVAVSGVVDQSKEEY  3318
             GFVSYQMVRDAYDAG++     L  HS GK DR+YMKGPGGRGEVEVAVSGV DQS+++ 
Sbjct  239   GFVSYQMVRDAYDAGKS-RFGNLLGHSPGKQDRLYMKGPGGRGEVEVAVSGVADQSQQDL  297

Query  3319  GHHPP---KKGLsfsavvrraasvasvaakhayaaasatrssDEEMIPLKCCLMSISLPW  3489
             G   P   K+G    ++VR+AASVASVAAK+AYAAA+++ S D+EM+PLKCCLMSI+LPW
Sbjct  298   GPFSPVISKQGFGIGSIVRKAASVASVAAKNAYAAAASSHSFDDEMVPLKCCLMSITLPW  357

Query  3490  EHIAHDLLLKGSPPVNL  3540
             EHIA+DLL KG+PPVNL
Sbjct  358   EHIAYDLLFKGTPPVNL  374



>ref|XP_006472489.1| PREDICTED: uncharacterized protein LOC102625521 isoform X3 [Citrus 
sinensis]
Length=380

 Score =   464 bits (1194),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 261/389 (67%), Positives = 305/389 (78%), Gaps = 30/389 (8%)
 Frame = +1

Query  2422  GQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGRQED  2601
             G+TPSR ELLSMVKKHS  LGKT+VEE+D  DVEMD +FWH+V DLYF+ GKESRGRQ+D
Sbjct  6     GETPSRSELLSMVKKHSNLLGKTLVEEQDAVDVEMDSRFWHDVFDLYFIRGKESRGRQDD  65

Query  2602  DLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLIAHT  2781
             DL+FFVRK+ L G   N N ED + YFVR                V WRRS+YLN+IAHT
Sbjct  66    DLLFFVRKVGLHGILFNDNEEDLTSYFVRS--------------EVHWRRSFYLNMIAHT  111

Query  2782  TFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPAYPD  2961
              FSVTVAICSH+ L+N+Q G D PLSPIYKVVKTVYASPSR+NF LDS+KEVET PAYPD
Sbjct  112   AFSVTVAICSHQELRNHQAGTDTPLSPIYKVVKTVYASPSRVNFQLDSKKEVETKPAYPD  171

Query  2962  ICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDSS------------QSETSGG  3105
             ICFAVDDFDSTFDAVVL+D DHCYCVILNA+ GAAFPS+              +++   G
Sbjct  172   ICFAVDDFDSTFDAVVLSDTDHCYCVILNAHGGAAFPSEKEANNSSSSNSSPMKTDMDSG  231

Query  3106  KTQSSKITIFSGFVSYQMVRDAYDAGRTg-fgsllslhssgKTDRIYMKGPGGRGEVEVA  3282
             KT+++K+T+FSGFVSYQMVR+AYDAG++     L   HS GKTDR+YMKGPGGRGEVEVA
Sbjct  232   KTRNAKLTLFSGFVSYQMVREAYDAGKSRFGSLLSLSHSLGKTDRLYMKGPGGRGEVEVA  291

Query  3283  VSGVVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrssDEEMIP  3453
             VSGV DQS ++     P   K+G +  ++VR+AASVASVAAKHAYAAA+AT +SD+EM+P
Sbjct  292   VSGVADQSDQDSAPFSPVVSKRGFAIGSIVRKAASVASVAAKHAYAAAAATTTSDDEMLP  351

Query  3454  LKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
             LKCCLMSISLPWEHIA+DLL KGSPPVNL
Sbjct  352   LKCCLMSISLPWEHIAYDLLFKGSPPVNL  380



>ref|XP_010548546.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X3 
[Tarenaya hassleriana]
Length=389

 Score =   462 bits (1190),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 241/385 (63%), Positives = 294/385 (76%), Gaps = 11/385 (3%)
 Frame = +1

Query  2419  GGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGRQE  2598
             G  TPSR E+LSMV+KHSK LGK    E+D SDVEMD  FWH + D+YF+ G ESRGRQ+
Sbjct  5     GEDTPSRHEILSMVRKHSKSLGKLGANEKDASDVEMDSNFWHGIFDVYFIRGNESRGRQD  64

Query  2599  DDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLIAH  2778
             DDL+FFV+KMS + Y  N N E  +PYFVRRW+PKLD++LGE+   VDWR+S+YLN+IAH
Sbjct  65    DDLLFFVKKMSCKPYGLNENEEAPAPYFVRRWAPKLDEILGESLPDVDWRKSFYLNMIAH  124

Query  2779  TTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPAYP  2958
             T+F+VTVAICSHE LK+YQT +D  LSP+YKVVKTVYASPSR+NFHLDS+K  ETTPAYP
Sbjct  125   TSFTVTVAICSHEALKSYQTDRDTSLSPVYKVVKTVYASPSRVNFHLDSKKGDETTPAYP  184

Query  2959  DICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPS------DSSQSETSGGKTQSS  3120
             DI FAVDDFDSTFDAVVLT+ DHCYCV+LNA+DGAAFPS      +++ +++   + +++
Sbjct  185   DISFAVDDFDSTFDAVVLTEKDHCYCVLLNAHDGAAFPSEKGEDANNANTDSDSSRMKNA  244

Query  3121  KITIFSGFVSYQMVRDAYDAGRTg-fgsllslhssgKTDRIYMKGPGGRGEVEVAVSGVV  3297
             K+T+FSGFVSY MVRDAY+AGR+     L   H++GK DR+YM+GPGGRGEVEVAVSGV+
Sbjct  245   KVTLFSGFVSYHMVRDAYEAGRSRFGSLLSLGHNTGKADRLYMRGPGGRGEVEVAVSGVI  304

Query  3298  DQSKEEYGHHPP----KKGLsfsavvrraasvasvaakhayaaasatrssDEEMIPLKCC  3465
             DQS  + G   P    K+    S   R A      A +   AA SA+   DE M PLKCC
Sbjct  305   DQSGVDVGPMSPLQTKKRIGLGSIFHRAATVATVAAKQAIAAATSASSDEDEMMFPLKCC  364

Query  3466  LMSISLPWEHIAHDLLLKGSPPVNL  3540
             LMSISLPW+ IAHDLL KGSPPVN+
Sbjct  365   LMSISLPWDSIAHDLLFKGSPPVNM  389



>ref|NP_564743.1| protein CW7 [Arabidopsis thaliana]
 dbj|BAA87952.1| CW7 [Arabidopsis thaliana]
 gb|AAO44091.1| At1g59520 [Arabidopsis thaliana]
 dbj|BAE99786.1| CW7 [Arabidopsis thaliana]
 gb|AEE33583.1| protein CW7 [Arabidopsis thaliana]
Length=388

 Score =   462 bits (1189),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 259/386 (67%), Positives = 304/386 (79%), Gaps = 11/386 (3%)
 Frame = +1

Query  2413  NGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGR  2592
             N G  TPSR E+LSMVKKHSK LGKT ++E+D SDVEMD  FWH V D+YFV   ESR R
Sbjct  3     NDGEVTPSRHEILSMVKKHSKSLGKTSLDEQDASDVEMDSNFWHGVFDVYFVRCMESRRR  62

Query  2593  QEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLI  2772
             Q+DDL+FFVRK+S + Y    N +  +PYFVRRW+PKLD+LLGE+   VDWR+S+YLN+I
Sbjct  63    QDDDLLFFVRKLSCKSYGLTENEDAPAPYFVRRWAPKLDELLGESLAEVDWRKSFYLNMI  122

Query  2773  AHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPA  2952
             AHT+F+VTVAICS+E LK YQ  KD  LSPIYKVVKTVYASPSR+NFHLDS+KEVETTPA
Sbjct  123   AHTSFTVTVAICSNEALKTYQGSKDTKLSPIYKVVKTVYASPSRVNFHLDSKKEVETTPA  182

Query  2953  YPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPS----DSSQSETSGG--KTQ  3114
             YP+ICFAVDDFDSTFDAVVLTD DHCYCV+LN++DGAAFPS    DSS S T+      +
Sbjct  183   YPEICFAVDDFDSTFDAVVLTDKDHCYCVLLNSHDGAAFPSATVKDSSDSNTNADPRTVK  242

Query  3115  SSKITIFSGFVSYQMVRDAYDAGRTgf-gsllslhssgKTDRIYMKGPGGRGEVEVAVSG  3291
               K+T+FSGFVSYQMVR+AY+ GR  F   L   H +GK DR+YM+GPGGRGEVEVAVSG
Sbjct  243   DPKVTLFSGFVSYQMVREAYEGGRNRFGSLLSLGHITGKADRLYMRGPGGRGEVEVAVSG  302

Query  3292  VVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrssDEEMIPLKC  3462
             VVDQS+   G   P   KK +   ++ R+AASVASVAAKHA AAA+A+   D EM PLKC
Sbjct  303   VVDQSQVVLGPVSPMSSKKSIDLGSIFRKAASVASVAAKHAIAAATASYDED-EMFPLKC  361

Query  3463  CLMSISLPWEHIAHDLLLKGSPPVNL  3540
             CLMSISLPW+ IAHDLL K +PPVN+
Sbjct  362   CLMSISLPWDTIAHDLLFKATPPVNM  387



>ref|XP_010056640.1| PREDICTED: regulatory protein NPR3-like [Eucalyptus grandis]
 gb|KCW73444.1| hypothetical protein EUGRSUZ_E01922 [Eucalyptus grandis]
Length=585

 Score =   469 bits (1208),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 281/504 (56%), Positives = 354/504 (70%), Gaps = 20/504 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg--kpKFLMTELVPCGWVGY  1551
             DY+DADI VE I VGV+R ILAARS FF+  FK+ K   +   KPK+ M +L+P G VGY
Sbjct  62    DYSDADIVVENISVGVHRCILAARSDFFNNLFKREKGSSEKEGKPKYNMDDLLPYGKVGY  121

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF++FL+Y YTGK K SP EVSTCVD+ C H AC PAI++AV+LMYAS  FQI+ELV L
Sbjct  122   EAFLIFLSYAYTGKLKRSPLEVSTCVDDMCSHDACSPAINFAVELMYASYIFQIRELVSL  181

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
             +QRHL   V  A  ED+IPIL V F C L  L  +CV RV  S+LDN  LE ELP  ++ 
Sbjct  182   LQRHLVNFVGKARSEDIIPILTVAFHCELNQLEMQCVDRVARSDLDNIALEKELPPKVAE  241

Query  1190  DIKARRLNQQGAN-----------EKKIRKILRALDCNDVELVKLLLEESDITLDDayav  1044
             +IK  RL  Q  +           EK+I++I +ALD +D+ELV LLL ES+I LD+AY +
Sbjct  242   EIKLLRLKFQPKDETNLEIPDPLREKRIKRIHKALDSDDIELVTLLLSESNINLDEAYGL  301

Query  1043  hyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDA  864
             HYAAAYC+ KVV+E+LGLG  ++NLRN RGYTVLHVAA RK+  IIV++L K GA   + 
Sbjct  302   HYAAAYCDPKVVSELLGLGLANVNLRNPRGYTVLHVAAMRKETKIIVSLLSK-GACASEL  360

Query  863   TCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVSLPSSTT--  690
             T  +G  AV+ICRR TRPKDYN  TE+ +E N DRLCIDVLE  +   NP++  +S +  
Sbjct  361   T-PDGQNAVSICRRLTRPKDYNAKTEQCQEANKDRLCIDVLERELWR-NPLAGDASVSYP  418

Query  689   -LENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVG  513
              + +DL M+L +LENRVA AR  +P EA++ M+IAHA+ T EF GLS  +G  GNL+ V 
Sbjct  419   IVSDDLHMKLLYLENRVAFARLFFPTEAKLAMDIAHAEMTAEFAGLSARKGSSGNLREVD  478

Query  512   LTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQ  333
             L   P DQ KRL  R EAL++TVE+GRR+F NCS+VLDK   DD+ D L  LE GTP+EQ
Sbjct  479   LNETPIDQNKRLRSRMEALQRTVEMGRRYFPNCSEVLDKFMEDDLPD-LCYLEKGTPDEQ  537

Query  332   TNKKRRYMELKEEVMKAFDKDMAQ  261
               K RR+MELK++V KAF KD A+
Sbjct  538   RIKTRRFMELKDDVQKAFSKDKAE  561



>ref|XP_010511044.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X2 
[Camelina sativa]
Length=388

 Score =   461 bits (1187),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 255/386 (66%), Positives = 303/386 (78%), Gaps = 11/386 (3%)
 Frame = +1

Query  2413  NGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGR  2592
             N G  TPSR E+LSMVKKHSK LG T ++E+D SDVEMD  FWH V D+YF+   ESR R
Sbjct  3     NDGEATPSRHEILSMVKKHSKSLGNTSLDEQDASDVEMDSNFWHGVFDVYFIRCMESRRR  62

Query  2593  QEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLI  2772
             Q+DDL+FFVRK+S + Y    N +  +PYFVRRW+PKLD+LLGE+   VDWR+S+YLN+I
Sbjct  63    QDDDLLFFVRKLSCKSYGLTENDDAPAPYFVRRWAPKLDELLGESLAEVDWRKSFYLNMI  122

Query  2773  AHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPA  2952
             AHT+F+VTVAICS+E LK YQ  KD  LSPIYKVVKTVYASPSR+NFHLDS+KEVETTPA
Sbjct  123   AHTSFTVTVAICSNEALKTYQGSKDTKLSPIYKVVKTVYASPSRVNFHLDSKKEVETTPA  182

Query  2953  YPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPS----DSSQSETSG--GKTQ  3114
             YP+ICFAVDDFDSTFDAVVL + DHCYCV+LN++DGAAFPS    DSS+S T+      +
Sbjct  183   YPEICFAVDDFDSTFDAVVLNEKDHCYCVLLNSHDGAAFPSENVKDSSESSTNTEPRSVK  242

Query  3115  SSKITIFSGFVSYQMVRDAYDAGRTgf-gsllslhssgKTDRIYMKGPGGRGEVEVAVSG  3291
               K+T+FSGFVSYQMVR+AY+ GR  F   L   H++GK DR+YM+GPGGRGEVEVAVSG
Sbjct  243   DPKVTLFSGFVSYQMVREAYEGGRNRFGSLLSLGHNTGKADRLYMRGPGGRGEVEVAVSG  302

Query  3292  VVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrssDEEMIPLKC  3462
             V+DQS+   G   P   KK +   ++ R+AA VASVAAKHA AAA+A+   D EM PLKC
Sbjct  303   VIDQSQVVVGPVSPMSSKKSIDLGSIFRKAAYVASVAAKHAIAAATASYDED-EMFPLKC  361

Query  3463  CLMSISLPWEHIAHDLLLKGSPPVNL  3540
             CLMSISLPWE IAHDLL K SPPVN+
Sbjct  362   CLMSISLPWETIAHDLLFKASPPVNM  387



>ref|XP_010414709.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X2 
[Camelina sativa]
Length=388

 Score =   460 bits (1184),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 257/386 (67%), Positives = 304/386 (79%), Gaps = 11/386 (3%)
 Frame = +1

Query  2413  NGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGR  2592
             N G  TPSR E+LSMVKKHSK LG T ++E+D SDVEMD  FWH V D+YF+   ESR R
Sbjct  3     NDGEATPSRHEILSMVKKHSKSLGNTSLDEQDASDVEMDSNFWHGVFDVYFIRCMESRRR  62

Query  2593  QEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLI  2772
             Q+DDL+FFVRK+S + Y    N E  +PYFVRRW+PKLD+LLGE+   VDWR+S+YLN+I
Sbjct  63    QDDDLLFFVRKLSCKSYGLTENDEAPAPYFVRRWAPKLDELLGESLAEVDWRKSFYLNMI  122

Query  2773  AHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPA  2952
             AHT+F+VTVAICS+E LK YQ  KD  LSPIYKVVKTVYASPSR+NFHLDS+KEVETTPA
Sbjct  123   AHTSFTVTVAICSNEALKTYQGSKDTKLSPIYKVVKTVYASPSRVNFHLDSKKEVETTPA  182

Query  2953  YPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPS----DSSQSETSG--GKTQ  3114
             YP+ICFAVDDFDSTFDAVVLT+ DHCYCV+LN++DGAAFPS    DSS S T+      +
Sbjct  183   YPEICFAVDDFDSTFDAVVLTEKDHCYCVLLNSHDGAAFPSANDKDSSDSNTNTEPKSVK  242

Query  3115  SSKITIFSGFVSYQMVRDAYDAGRTgf-gsllslhssgKTDRIYMKGPGGRGEVEVAVSG  3291
               K+T+FSGFVSYQMVR+AY+ GR  F   L   H++GK DR+YM+GPGGRGEVEVAVSG
Sbjct  243   DPKVTLFSGFVSYQMVREAYEGGRNRFGSLLSLGHNTGKADRLYMRGPGGRGEVEVAVSG  302

Query  3292  VVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrssDEEMIPLKC  3462
             V+DQS+   G   P   KK +   ++ R+AASVASVAAKHA AAA+A+   D EM PLKC
Sbjct  303   VIDQSQVVVGPVSPMSSKKSIDLGSIFRKAASVASVAAKHAIAAATASYDED-EMFPLKC  361

Query  3463  CLMSISLPWEHIAHDLLLKGSPPVNL  3540
             CLMSISLPW+ IAHDLL K SPPVN+
Sbjct  362   CLMSISLPWDTIAHDLLFKASPPVNM  387



>ref|NP_849828.1| protein CW7 [Arabidopsis thaliana]
 gb|AEE33582.1| protein CW7 [Arabidopsis thaliana]
 gb|AEM36359.1| At1g59520 [Arabidopsis thaliana]
Length=388

 Score =   459 bits (1181),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 257/386 (67%), Positives = 303/386 (78%), Gaps = 11/386 (3%)
 Frame = +1

Query  2413  NGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGR  2592
             N G  TPSR E+LSMVKKHSK LGKT ++E+D SDVEMD  FWH V D+YFV   ESR R
Sbjct  3     NDGEVTPSRHEILSMVKKHSKSLGKTSLDEQDASDVEMDSNFWHGVFDVYFVRCMESRRR  62

Query  2593  QEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLI  2772
             Q+DDL+FFVRK+S + Y    N +  +PYFVRRW+PKLD+LLGE+   VDWR+S+YLN+I
Sbjct  63    QDDDLLFFVRKLSCKSYGLTENEDAPAPYFVRRWAPKLDELLGESLAEVDWRKSFYLNMI  122

Query  2773  AHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPA  2952
             AHT+F+VTVAICS+E LK YQ  KD  LSPIYKVVKTVYASPSR+NFHLDS+K +ETTPA
Sbjct  123   AHTSFTVTVAICSNEALKTYQGSKDTKLSPIYKVVKTVYASPSRVNFHLDSKKAMETTPA  182

Query  2953  YPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPS----DSSQSETSGG--KTQ  3114
             YP+ICFAVDDFDSTFDAVVLTD DHCYCV+LN++DGAAFPS    DSS S T+      +
Sbjct  183   YPEICFAVDDFDSTFDAVVLTDKDHCYCVLLNSHDGAAFPSATVKDSSDSNTNADPRTVK  242

Query  3115  SSKITIFSGFVSYQMVRDAYDAGRTgf-gsllslhssgKTDRIYMKGPGGRGEVEVAVSG  3291
               K+T+FSGFVSYQMVR+AY+ GR  F   L   H +GK DR+YM+GPGGRGEVEVAVSG
Sbjct  243   DPKVTLFSGFVSYQMVREAYEGGRNRFGSLLSLGHITGKADRLYMRGPGGRGEVEVAVSG  302

Query  3292  VVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrssDEEMIPLKC  3462
             VVDQS+   G   P   KK +   ++ R+AASVASVAAKHA AAA+A+   D EM PLKC
Sbjct  303   VVDQSQVVLGPVSPMSSKKSIDLGSIFRKAASVASVAAKHAIAAATASYDED-EMFPLKC  361

Query  3463  CLMSISLPWEHIAHDLLLKGSPPVNL  3540
             CLMSISLPW+ IAHDLL K +PPVN+
Sbjct  362   CLMSISLPWDTIAHDLLFKATPPVNM  387



>ref|XP_011096773.1| PREDICTED: regulatory protein NPR3-like [Sesamum indicum]
Length=563

 Score =   466 bits (1198),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 269/504 (53%), Positives = 354/504 (70%), Gaps = 20/504 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkak--kdcdgkpKFLMTELVPCGWVGY  1551
             D++DADI VE   VG++R ILAARS+FF + F+K K     +GKPK+ MT ++P G +GY
Sbjct  39    DFSDADIVVEDNSVGIHRCILAARSKFFFDLFRKDKGCVGKEGKPKYWMTNILPYGRIGY  98

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF+ FL+Y+YTGK + SP EVSTCVD  C H  CRPAID+AV+LMYASA FQ+ ELV L
Sbjct  99    EAFLTFLSYLYTGKLRPSPVEVSTCVDNICAHDVCRPAIDFAVELMYASAIFQVSELVSL  158

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
              QR L  LV  A +EDVIPI++V F C L+ L+ +C+ RV  S+L+  ++E ELP  ++ 
Sbjct  159   FQRRLLNLVGKAVVEDVIPIVVVAFHCQLSQLLTQCIHRVARSDLEAISIEKELPSKVAE  218

Query  1190  DIKARRLNQQ-----------GANEKKIRKILRALDCNDVELVKLLLEESDITLDDayav  1044
             +I+  RLN Q             +EK++++I +ALD +DVELV+LLL ESDITLD+AYA+
Sbjct  219   EIRLLRLNSQVEQENKVATVDPLHEKRVKRIHKALDSDDVELVRLLLTESDITLDEAYAL  278

Query  1043  hyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDA  864
             HYA AYC+ K+V EVL LG  D+NLRN RG TVLH+AARRK+P+IIV++L K GAS  + 
Sbjct  279   HYAIAYCDPKIVTEVLSLGLSDVNLRNTRGNTVLHIAARRKEPSIIVSLLTK-GASASEP  337

Query  863   TCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPV---SLPSST  693
             T   G +A++IC+RSTRPK+Y    E+G+E N DR+CID+LE   M  NP+   +  SS 
Sbjct  338   TF-EGQSALSICKRSTRPKEYQMKREKGQEANKDRMCIDILER-EMRRNPIAGDASISSL  395

Query  692   TLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVG  513
              + +DL M+  +LE+RVA AR  +P EA++ MEIAHA++T E  GL    G  GNL  V 
Sbjct  396   AMADDLHMKFLYLEDRVAFARMFFPTEAKLAMEIAHAETTSELAGLLSSRGSSGNLMEVD  455

Query  512   LTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQ  333
             L   P  Q KRL+ R E L +TVELGRR+F +CS VLDK   DD+ D+   LE GTPEEQ
Sbjct  456   LNETPITQNKRLLSRIETLTRTVELGRRYFPHCSQVLDKFMEDDLPDAF-YLEKGTPEEQ  514

Query  332   TNKKRRYMELKEEVMKAFDKDMAQ  261
               K+ RYMELK+EV +AF+KD A+
Sbjct  515   RMKRMRYMELKDEVNRAFNKDKAE  538



>ref|XP_011026213.1| PREDICTED: regulatory protein NPR3-like [Populus euphratica]
 ref|XP_011026214.1| PREDICTED: regulatory protein NPR3-like [Populus euphratica]
Length=591

 Score =   466 bits (1199),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 282/513 (55%), Positives = 362/513 (71%), Gaps = 26/513 (5%)
 Frame = -2

Query  1733  EYEDYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg--kpKFLMTELVPCGW  1560
             EY DY+DA+I VEG  VGV+R +LAARSQFFHE FKK   +     KP++LM++LVP G 
Sbjct  60    EY-DYSDAEIFVEGTPVGVHRCVLAARSQFFHELFKKGNNNSTNGDKPRYLMSDLVPYGG  118

Query  1559  VGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKEL  1380
             VGYEAF VFL+Y+YTGK K  PPEVS CVD++C H ACRPAI+Y V+LM ASATFQ+KEL
Sbjct  119   VGYEAFHVFLHYLYTGKLKPCPPEVSRCVDDACAHDACRPAINYVVELMCASATFQMKEL  178

Query  1379  VMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGA  1200
             V+L QR L   ++ A +EDVIPIL+  F   L  L+  C+ R+  S+LD+  ++ ELP  
Sbjct  179   VLLFQRRLLNFIEKALVEDVIPILMAAFHYQLGQLLSHCIERLVRSDLDSTCIDKELPDE  238

Query  1199  ISSDIKARR---LNQQGAN--------EKKIRKILRALDCNDVELVKLLLEESDITLDDa  1053
             ISS IK  R   L +  ++        E+  R+I +ALD +DVELV+LLL ES++TLDDA
Sbjct  239   ISSKIKLLRKKSLPEAESSVEEVDPILERSFRRIHQALDSDDVELVELLLRESNLTLDDA  298

Query  1052  yavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASI  873
             YA+HYA AYC+ K+V EVLGLG  DLNLRN+RGY+VLHVAARRK+P+II+A+L + GAS 
Sbjct  299   YALHYAVAYCDPKIVKEVLGLGSADLNLRNSRGYSVLHVAARRKEPSIIMALLTR-GASA  357

Query  872   RDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVM-----MNGNPVS  708
              + T  +G  AV ICRR TR KDYN+ T++G+E N DR+CIDVLE  M     M+ N   
Sbjct  358   SETTL-DGQNAVAICRRLTRSKDYNENTKQGQESNKDRICIDVLETDMRRRTSMSANVSI  416

Query  707   LPSSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGL--SGMEGLC  534
             L  S ++ +DL M+L +LENRVA AR L+P EAR+ M+ A+A+ST  + GL  S  +G  
Sbjct  417   L--SPSVADDLSMKLDYLENRVAFARLLFPAEARLAMDSANANSTSMYTGLLASKSKGSS  474

Query  533   GNLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLE  354
             G+L+ V L   P  Q KRL  R +AL KTVE GR +F +CS+VLDK   DD+ D+L  L+
Sbjct  475   GDLREVDLNETPTVQAKRLQSRLQALHKTVETGRLYFPHCSEVLDKFLDDDMPDAL-FLD  533

Query  353   SGTPEEQTNKKRRYMELKEEVMKAFDKDMAQNR  255
              GTPEEQ  KK R+MELK++V KAF KDM  NR
Sbjct  534   KGTPEEQKTKKMRFMELKDDVQKAFYKDMENNR  566



>ref|XP_003545296.1| PREDICTED: regulatory protein NPR3-like [Glycine max]
Length=590

 Score =   466 bits (1198),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 275/507 (54%), Positives = 358/507 (71%), Gaps = 18/507 (4%)
 Frame = -2

Query  1733  EYEDYNDADIEVEGILVGVNRGILAARSQFFHEEFkkak--kdcdgkpKFLMTELVPCGW  1560
             EY DY+DA+I +E I VG++R ILA+RS FFHE FKK       +GKP++LM++L+P G 
Sbjct  59    EY-DYSDAEILIEDIPVGIHRCILASRSPFFHELFKKGTDGSGKEGKPRYLMSDLMPYGT  117

Query  1559  VGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKEL  1380
             VGY+AF VFL Y+YTG+ KASP E +TCVDE+C H ACRPAI++A++LMYASATFQ+KEL
Sbjct  118   VGYQAFQVFLYYLYTGRLKASPTEETTCVDETCIHVACRPAINHALELMYASATFQMKEL  177

Query  1379  VMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGA  1200
             V+L QRHL   V+ A +EDVIPIL+  F C L  L+ RC++RV  S+ DN +LE ELP  
Sbjct  178   VLLFQRHLLNFVEKALVEDVIPILMAAFNCQLDQLLSRCIQRVARSDFDNTSLEKELPHE  237

Query  1199  ISSDIKARRLNQQ-----------GANEKKIRKILRALDCNDVELVKLLLEESDITLDDa  1053
             + ++IK+ RL+ Q             NEK IR+I +ALD +DVEL+KLLL ES +TLDDA
Sbjct  238   VLTEIKSLRLSFQPESTPNAMEAESLNEKSIRRIHKALDSDDVELLKLLLNESSVTLDDA  297

Query  1052  yavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASI  873
             YA+HYA AY +SKV+ EVL LG  D+  RN+RGYTVLHVAARRKDP+I+VA+L+K GA  
Sbjct  298   YALHYACAYSDSKVIQEVLSLGMADILRRNSRGYTVLHVAARRKDPSILVALLNK-GARA  356

Query  872   RDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVM-MNGNPVSLPSS  696
              D T  +G TA+ IC+R TR KDY++ T + +E N DRLC+DVLE  M  N   V++  S
Sbjct  357   SDTT-PDGQTALAICQRLTRCKDYHEKTVQCKESNKDRLCVDVLEREMRRNSMTVNMSVS  415

Query  695   TTLE-NDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKG  519
             + L  +DL M L +LE+RVA AR L+P EAR+ +E A ADS+  +   S ++   GN K 
Sbjct  416   SQLTADDLHMRLDYLEDRVAFARLLFPAEARVAIENAEADSSSLYANSSALKVTNGNPKE  475

Query  518   VGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPE  339
             V L   P  + ++L  R  AL KTVE GRRFF +CS+VLDK   DD +  +  LE G+ E
Sbjct  476   VDLNESPSARTRKLQLRLHALMKTVENGRRFFPHCSEVLDKFLEDDEMPDVFFLEKGSEE  535

Query  338   EQTNKKRRYMELKEEVMKAFDKDMAQN  258
             EQ  KK R+MELK++V KAF KDMA+N
Sbjct  536   EQRIKKARFMELKDDVQKAFHKDMAEN  562



>ref|XP_010548530.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X1 
[Tarenaya hassleriana]
 ref|XP_010548538.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X2 
[Tarenaya hassleriana]
Length=390

 Score =   458 bits (1178),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 241/386 (62%), Positives = 294/386 (76%), Gaps = 12/386 (3%)
 Frame = +1

Query  2419  GGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGRQE  2598
             G  TPSR E+LSMV+KHSK LGK    E+D SDVEMD  FWH + D+YF+ G ESRGRQ+
Sbjct  5     GEDTPSRHEILSMVRKHSKSLGKLGANEKDASDVEMDSNFWHGIFDVYFIRGNESRGRQD  64

Query  2599  DDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPK-LDDLLGENSVGVDWRRSYYLNLIA  2775
             DDL+FFV+KMS + Y  N N E  +PYFVRRW+PK LD++LGE+   VDWR+S+YLN+IA
Sbjct  65    DDLLFFVKKMSCKPYGLNENEEAPAPYFVRRWAPKQLDEILGESLPDVDWRKSFYLNMIA  124

Query  2776  HTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPAY  2955
             HT+F+VTVAICSHE LK+YQT +D  LSP+YKVVKTVYASPSR+NFHLDS+K  ETTPAY
Sbjct  125   HTSFTVTVAICSHEALKSYQTDRDTSLSPVYKVVKTVYASPSRVNFHLDSKKGDETTPAY  184

Query  2956  PDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPS------DSSQSETSGGKTQS  3117
             PDI FAVDDFDSTFDAVVLT+ DHCYCV+LNA+DGAAFPS      +++ +++   + ++
Sbjct  185   PDISFAVDDFDSTFDAVVLTEKDHCYCVLLNAHDGAAFPSEKGEDANNANTDSDSSRMKN  244

Query  3118  SKITIFSGFVSYQMVRDAYDAGRTg-fgsllslhssgKTDRIYMKGPGGRGEVEVAVSGV  3294
             +K+T+FSGFVSY MVRDAY+AGR+     L   H++GK DR+YM+GPGGRGEVEVAVSGV
Sbjct  245   AKVTLFSGFVSYHMVRDAYEAGRSRFGSLLSLGHNTGKADRLYMRGPGGRGEVEVAVSGV  304

Query  3295  VDQSKEEYGHHPP----KKGLsfsavvrraasvasvaakhayaaasatrssDEEMIPLKC  3462
             +DQS  + G   P    K+    S   R A      A +   AA SA+   DE M PLKC
Sbjct  305   IDQSGVDVGPMSPLQTKKRIGLGSIFHRAATVATVAAKQAIAAATSASSDEDEMMFPLKC  364

Query  3463  CLMSISLPWEHIAHDLLLKGSPPVNL  3540
             CLMSISLPW+ IAHDLL KGSPPVN+
Sbjct  365   CLMSISLPWDSIAHDLLFKGSPPVNM  390



>ref|XP_004486434.1| PREDICTED: regulatory protein NPR3-like isoform X2 [Cicer arietinum]
Length=591

 Score =   465 bits (1197),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 281/507 (55%), Positives = 361/507 (71%), Gaps = 23/507 (5%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFk----kakkdcdgkpKFLMTELVPCGWV  1557
             DY+DA+I VEGILV V+R +LA+RS+FFHE FK    K     +GK K+ +++L+P G V
Sbjct  63    DYSDAEIVVEGILVRVHRCVLASRSKFFHELFKRGKDKGSSKNEGKLKYCLSDLLPYGKV  122

Query  1556  GYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELV  1377
             GYEAF++FL+YVY+GK K SP EVSTCVD  C H AC PAI++AV++MYAS+ FQI ELV
Sbjct  123   GYEAFIIFLSYVYSGKLKPSPMEVSTCVDNVCAHDACGPAINFAVEVMYASSIFQIPELV  182

Query  1376  MLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAI  1197
              L QR L   V  A +EDVIPIL+V F C L+ LV  CV RV  S+L+  ++E ELP  +
Sbjct  183   SLFQRRLLNFVGKALVEDVIPILMVAFHCQLSQLVALCVDRVARSDLNQISIEKELPCEL  242

Query  1196  SSDIKA--RRLNQQGANE----------KKIRKILRALDCNDVELVKLLLEESDITLDDa  1053
             S  +K   R L QQ +            K+I +I +ALD +DVELVKLLL ESDITLD+A
Sbjct  243   SEKVKLLRRDLQQQDSENYAPVVDALSLKRITRIHKALDSDDVELVKLLLNESDITLDEA  302

Query  1052  yavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASI  873
              A+HYAAAYC+ KVV+EVLGLG  ++NLRN+RGYTVLHVAA RK+P+IIV++L  +GA  
Sbjct  303   GALHYAAAYCDPKVVSEVLGLGMANVNLRNSRGYTVLHVAAMRKEPSIIVSLL-TNGACA  361

Query  872   RDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVS---LP  702
              D T  +G +AV+ICRR TRPKDY+  TE+G+E N DR+CIDVL+   M  NP++     
Sbjct  362   SDLTF-DGQSAVSICRRLTRPKDYHPKTEQGKETNKDRICIDVLQR-EMRRNPLAGDLSV  419

Query  701   SSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLK  522
             SS T+ +DL M+L +LENRVA AR  +P EA++ M+IA A++T EF GLS  +G  GNL 
Sbjct  420   SSQTVADDLHMKLLYLENRVAFARLFFPLEAKLAMDIARAETTSEFAGLSTSKGSNGNLM  479

Query  521   GVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTP  342
              V L   P  Q KRL+ R EAL KTVE+GRR+F +CS+VLDK   DD+ D L  LE GT 
Sbjct  480   EVDLNETPLMQNKRLISRMEALMKTVEMGRRYFPHCSEVLDKFMEDDLPD-LFYLEKGTQ  538

Query  341   EEQTNKKRRYMELKEEVMKAFDKDMAQ  261
             EEQ  K+ R++ELKE+V KAF+KD A+
Sbjct  539   EEQRVKRTRFIELKEDVNKAFNKDKAE  565



>gb|AGL61506.1| NPR1 [Morus alba var. multicaulis]
Length=581

 Score =   464 bits (1195),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 284/514 (55%), Positives = 357/514 (69%), Gaps = 20/514 (4%)
 Frame = -2

Query  1736  GEYEDYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg---kpKFLMTELVPC  1566
             G   DY+DAD+ VEG  VGV+R ILAARS FFH+ FKK K   +    KPK+ + +L+P 
Sbjct  51    GSSCDYSDADVIVEGTHVGVHRCILAARSGFFHDLFKKDKGISEKGGGKPKYCLKDLLPY  110

Query  1565  GWVGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIK  1386
             G VGYEAF+V L+YVYTGK K SP EVSTCVD  C H +CRPAI++AV+LMYAS+ FQ+ 
Sbjct  111   GSVGYEAFLVLLSYVYTGKLKPSPMEVSTCVDNICAHDSCRPAINFAVELMYASSIFQMP  170

Query  1385  ELVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELP  1206
             ELV   QR L   V  A +EDVIPIL V F C L+ L   CV RV  S+L+  +LE ELP
Sbjct  171   ELVSQFQRRLLNFVGKALVEDVIPILGVAFHCQLSQLFAECVDRVARSDLEIVSLEKELP  230

Query  1205  GAISSDIKARRL--------NQQGAN---EKKIRKILRALDCNDVELVKLLLEESDITLD  1059
               ++ +IK  R         N + A+   EK+IR+I +ALD +DVELV+LLL ES+ITLD
Sbjct  231   HEVAENIKVLRRKSPCGDKDNTESADPLREKRIRRIHKALDSDDVELVELLLTESEITLD  290

Query  1058  DayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGA  879
             DA A+HYAAAYC+ KVV EVLGLG  D+NL+N+RGYTVLHVAA RK P+IIV++L K GA
Sbjct  291   DANALHYAAAYCDPKVVTEVLGLGLADVNLQNSRGYTVLHVAAMRKVPSIIVSLLTK-GA  349

Query  878   SIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNG--NPVSL  705
                D T S+G +AV+ICRR TRPKDY+   E+G+E N DR+CIDVLE  M      P + 
Sbjct  350   YASDLT-SDGQSAVSICRRLTRPKDYHAKMEQGQETNKDRICIDVLEREMRRNPMAPNAS  408

Query  704   PSSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNL  525
              SS T  +DL M L  LENRVALAR  +P EA++ M+IAHA++T EF  L+  +   GN 
Sbjct  409   ISSQTTADDLHMRLLNLENRVALARLFFPSEAKLAMDIAHAETTSEFARLTASKSSSGNF  468

Query  524   KGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGT  345
             + V L   P  Q KRL  R EAL KTVE+G+R+F +CS+VLDK   DD L  +  LE+GT
Sbjct  469   REVDLNETPIVQKKRLFSRMEALMKTVEMGKRYFPHCSEVLDKFMVDD-LPGMLYLETGT  527

Query  344   PEEQTNKKRRYMELKEEVMKAFDKDMAQ-NRVGL  246
              EEQ  K+ R+MELK++V KAF+KD A+ +RVGL
Sbjct  528   TEEQKIKRMRFMELKDDVQKAFNKDKAEIDRVGL  561



>ref|XP_010936178.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X1 
[Elaeis guineensis]
Length=403

 Score =   457 bits (1177),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 231/386 (60%), Positives = 286/386 (74%), Gaps = 15/386 (4%)
 Frame = +1

Query  2428  TPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGRQEDDL  2607
              PSR+ELLSMV+KHS  +G+T V+E+D SD+ MD QFWH++LDLYF+ G+ S+GRQEDDL
Sbjct  18    NPSRYELLSMVRKHSNLVGETAVDEQDASDIGMDAQFWHKMLDLYFIHGRISKGRQEDDL  77

Query  2608  IFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLIAHTTF  2787
             IFFVR MSL GY  N   E + P+FVRRW+P+L+ ++GEN   VDWRRS+YLNLIAHT+F
Sbjct  78    IFFVRNMSLHGYGFNDTMEGHPPFFVRRWAPQLEKVVGENCADVDWRRSFYLNLIAHTSF  137

Query  2788  SVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPAYPDIC  2967
             +VTVAICS + L  +Q G+   LSPIYKVVKTVYASPSR+NFHLD +K VET PAYP+IC
Sbjct  138   TVTVAICSIQDLHKHQNGEVTSLSPIYKVVKTVYASPSRVNFHLDHKKAVETLPAYPNIC  197

Query  2968  FAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDSSQS----------ETSGGKTQS  3117
             FAVDDFD TFDAVVL++ DHCYCV+LNA+ GAAFP++  Q           E    + +S
Sbjct  198   FAVDDFDDTFDAVVLSETDHCYCVLLNAHGGAAFPAEEDQPDCDSSVSLRLENDPERARS  257

Query  3118  SKITIFSGFVSYQMVRDAYDAGRTg-fgsllslhssgKTDRIYMKGPGGRGEVEVAVSGV  3294
             SK+T+FSGFVSYQMVR+AYDAG++     L   H   KTDR+YM+GPGGRGEVEVAVSG+
Sbjct  258   SKLTLFSGFVSYQMVREAYDAGKSRFGSLLSIGHVQAKTDRLYMRGPGGRGEVEVAVSGI  317

Query  3295  VDQSKEEYGHHPP----KKGLsfsavvrraasvasvaakhayaaasatrssDEEMIPLKC  3462
              DQS +  G   P    K+GL          + ++ +    +A A   RSSD E++PLKC
Sbjct  318   ADQSHQYTGPPSPLQLSKRGLGIGLGTIVHRAASAASELAKHAYAVTNRSSDLELLPLKC  377

Query  3463  CLMSISLPWEHIAHDLLLKGSPPVNL  3540
             CLMSISLPWE IAHDLL K +PPV+L
Sbjct  378   CLMSISLPWELIAHDLLFKANPPVSL  403



>ref|XP_010511043.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X1 
[Camelina sativa]
Length=389

 Score =   456 bits (1174),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 255/387 (66%), Positives = 303/387 (78%), Gaps = 12/387 (3%)
 Frame = +1

Query  2413  NGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGR  2592
             N G  TPSR E+LSMVKKHSK LG T ++E+D SDVEMD  FWH V D+YF+   ESR R
Sbjct  3     NDGEATPSRHEILSMVKKHSKSLGNTSLDEQDASDVEMDSNFWHGVFDVYFIRCMESRRR  62

Query  2593  QEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPK-LDDLLGENSVGVDWRRSYYLNL  2769
             Q+DDL+FFVRK+S + Y    N +  +PYFVRRW+PK LD+LLGE+   VDWR+S+YLN+
Sbjct  63    QDDDLLFFVRKLSCKSYGLTENDDAPAPYFVRRWAPKQLDELLGESLAEVDWRKSFYLNM  122

Query  2770  IAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTP  2949
             IAHT+F+VTVAICS+E LK YQ  KD  LSPIYKVVKTVYASPSR+NFHLDS+KEVETTP
Sbjct  123   IAHTSFTVTVAICSNEALKTYQGSKDTKLSPIYKVVKTVYASPSRVNFHLDSKKEVETTP  182

Query  2950  AYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPS----DSSQSETSG--GKT  3111
             AYP+ICFAVDDFDSTFDAVVL + DHCYCV+LN++DGAAFPS    DSS+S T+      
Sbjct  183   AYPEICFAVDDFDSTFDAVVLNEKDHCYCVLLNSHDGAAFPSENVKDSSESSTNTEPRSV  242

Query  3112  QSSKITIFSGFVSYQMVRDAYDAGRTgf-gsllslhssgKTDRIYMKGPGGRGEVEVAVS  3288
             +  K+T+FSGFVSYQMVR+AY+ GR  F   L   H++GK DR+YM+GPGGRGEVEVAVS
Sbjct  243   KDPKVTLFSGFVSYQMVREAYEGGRNRFGSLLSLGHNTGKADRLYMRGPGGRGEVEVAVS  302

Query  3289  GVVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrssDEEMIPLK  3459
             GV+DQS+   G   P   KK +   ++ R+AA VASVAAKHA AAA+A+   D EM PLK
Sbjct  303   GVIDQSQVVVGPVSPMSSKKSIDLGSIFRKAAYVASVAAKHAIAAATASYDED-EMFPLK  361

Query  3460  CCLMSISLPWEHIAHDLLLKGSPPVNL  3540
             CCLMSISLPWE IAHDLL K SPPVN+
Sbjct  362   CCLMSISLPWETIAHDLLFKASPPVNM  388



>ref|XP_006392279.1| hypothetical protein EUTSA_v10023553mg [Eutrema salsugineum]
 gb|ESQ29565.1| hypothetical protein EUTSA_v10023553mg [Eutrema salsugineum]
Length=356

 Score =   454 bits (1169),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 235/386 (61%), Positives = 280/386 (73%), Gaps = 43/386 (11%)
 Frame = +1

Query  2413  NGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGR  2592
             N G +TPSR E+LSMVKKHSK LGK  ++E+D SDVEMD  FWH V D+YF+ G ESR R
Sbjct  3     NDGEETPSRHEILSMVKKHSKSLGKMSLDEQDASDVEMDSNFWHGVFDVYFIRGMESRRR  62

Query  2593  QEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLI  2772
             Q+DDL+FFVRK+S Q Y    N E  +PYFVRRW+PKLD+LLGE+   VDWR+S+YLN++
Sbjct  63    QDDDLLFFVRKVSCQSYGLTENEEAPAPYFVRRWAPKLDELLGESLADVDWRKSFYLNMV  122

Query  2773  AHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPA  2952
             AHT+F+VTVAICS+E LK YQ  KD  LSPIYKVVKTVYASPSR+NFHLDS+KEVETTPA
Sbjct  123   AHTSFTVTVAICSNEALKTYQGSKDTTLSPIYKVVKTVYASPSRVNFHLDSKKEVETTPA  182

Query  2953  YPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPS-------DSSQSETSGG--  3105
             YP+ICFAVDDFDSTFDAVVLT+ DHCYCV+LN++DGAAFPS       DSS S T+    
Sbjct  183   YPEICFAVDDFDSTFDAVVLTEKDHCYCVLLNSHDGAAFPSVNGKIDKDSSGSNTNTDPR  242

Query  3106  KTQSSKITIFSGFVSYQMVRDAYDAGRTgf-gsllslhssgKTDRIYMKGPGGRGEVEVA  3282
             + +  K+T+FSGFVSYQMVR+AY+ GR  F   L   H +GK DR+YM+GPGGRGEVEVA
Sbjct  243   RAKDPKVTLFSGFVSYQMVREAYEGGRNRFGSLLSLGHHTGKADRLYMRGPGGRGEVEVA  302

Query  3283  VSGVVDQSKEEYGHHPPKKGLsfsavvrraasvasvaakhayaaasatrssDEEMIPLKC  3462
             VSGV+ +                                     A+     ++EM PLKC
Sbjct  303   VSGVIAKHAIA---------------------------------AATASYDEDEMFPLKC  329

Query  3463  CLMSISLPWEHIAHDLLLKGSPPVNL  3540
             CLMSISLPW+ IAHDLL KGSPPVN+
Sbjct  330   CLMSISLPWDTIAHDLLFKGSPPVNM  355



>ref|XP_010414708.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X1 
[Camelina sativa]
Length=389

 Score =   456 bits (1172),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 257/387 (66%), Positives = 304/387 (79%), Gaps = 12/387 (3%)
 Frame = +1

Query  2413  NGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGR  2592
             N G  TPSR E+LSMVKKHSK LG T ++E+D SDVEMD  FWH V D+YF+   ESR R
Sbjct  3     NDGEATPSRHEILSMVKKHSKSLGNTSLDEQDASDVEMDSNFWHGVFDVYFIRCMESRRR  62

Query  2593  QEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPK-LDDLLGENSVGVDWRRSYYLNL  2769
             Q+DDL+FFVRK+S + Y    N E  +PYFVRRW+PK LD+LLGE+   VDWR+S+YLN+
Sbjct  63    QDDDLLFFVRKLSCKSYGLTENDEAPAPYFVRRWAPKQLDELLGESLAEVDWRKSFYLNM  122

Query  2770  IAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTP  2949
             IAHT+F+VTVAICS+E LK YQ  KD  LSPIYKVVKTVYASPSR+NFHLDS+KEVETTP
Sbjct  123   IAHTSFTVTVAICSNEALKTYQGSKDTKLSPIYKVVKTVYASPSRVNFHLDSKKEVETTP  182

Query  2950  AYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPS----DSSQSETSG--GKT  3111
             AYP+ICFAVDDFDSTFDAVVLT+ DHCYCV+LN++DGAAFPS    DSS S T+      
Sbjct  183   AYPEICFAVDDFDSTFDAVVLTEKDHCYCVLLNSHDGAAFPSANDKDSSDSNTNTEPKSV  242

Query  3112  QSSKITIFSGFVSYQMVRDAYDAGRTgf-gsllslhssgKTDRIYMKGPGGRGEVEVAVS  3288
             +  K+T+FSGFVSYQMVR+AY+ GR  F   L   H++GK DR+YM+GPGGRGEVEVAVS
Sbjct  243   KDPKVTLFSGFVSYQMVREAYEGGRNRFGSLLSLGHNTGKADRLYMRGPGGRGEVEVAVS  302

Query  3289  GVVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrssDEEMIPLK  3459
             GV+DQS+   G   P   KK +   ++ R+AASVASVAAKHA AAA+A+   D EM PLK
Sbjct  303   GVIDQSQVVVGPVSPMSSKKSIDLGSIFRKAASVASVAAKHAIAAATASYDED-EMFPLK  361

Query  3460  CCLMSISLPWEHIAHDLLLKGSPPVNL  3540
             CCLMSISLPW+ IAHDLL K SPPVN+
Sbjct  362   CCLMSISLPWDTIAHDLLFKASPPVNM  388



>ref|XP_002888204.1| hypothetical protein ARALYDRAFT_475360 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64463.1| hypothetical protein ARALYDRAFT_475360 [Arabidopsis lyrata subsp. 
lyrata]
Length=389

 Score =   456 bits (1172),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 257/387 (66%), Positives = 305/387 (79%), Gaps = 12/387 (3%)
 Frame = +1

Query  2413  NGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGR  2592
             N G +TPSR E+LSMVKKHSK LGKT ++E+D SDVEMD  FWH V D+YF+   ESR R
Sbjct  3     NDGEETPSRHEILSMVKKHSKSLGKTSIDEQDASDVEMDSNFWHGVFDVYFIRCMESRRR  62

Query  2593  QEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLI  2772
             Q+DDL+FFVRK+S + Y    N E  +PYFVRRW+PKLD+LLGE+   VDWR+S+YLN+I
Sbjct  63    QDDDLLFFVRKLSCKSYGLTENEEAPAPYFVRRWAPKLDELLGESLAEVDWRKSFYLNMI  122

Query  2773  AHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPA  2952
             AHT+++VTVAICS+E LK YQ  KD  LSPIYKVVKTVYASPSR+NFHLDS+KEVETTPA
Sbjct  123   AHTSYTVTVAICSNEALKTYQGNKDTKLSPIYKVVKTVYASPSRVNFHLDSKKEVETTPA  182

Query  2953  YPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPS----DSSQSETSGG--KTQ  3114
             YP+ICFAVDDFDSTFDAVVLT+ DHCYCV+LN++DGAAFPS    DSS S TS      +
Sbjct  183   YPEICFAVDDFDSTFDAVVLTEKDHCYCVLLNSHDGAAFPSATVKDSSDSNTSADPRSVK  242

Query  3115  SSKITIFSGFVSYQMVRDAYDAGRTgf-gsllslhssgKTDRIYMKGPGGRGEVEVAVSG  3291
               K+T+FSGFVSYQMVR+AY+  R  F   L   H++GK DR+YM+GPGGRGEVEVAVSG
Sbjct  243   DPKVTLFSGFVSYQMVREAYEGERNRFGSLLSLGHNTGKADRLYMRGPGGRGEVEVAVSG  302

Query  3292  VVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrssDEEMIPLKC  3462
             V+DQS+   G   P   KK +   ++ R+AASVASVAAKHA AAA+A+   D EM PLKC
Sbjct  303   VIDQSQVVLGPVSPMSSKKSIDLGSIFRKAASVASVAAKHAIAAATASYDED-EMFPLKC  361

Query  3463  CLMSISLPWEHIAHDLLLK-GSPPVNL  3540
             CLMSISLPW+ IAHDLL K  SPPVN+
Sbjct  362   CLMSISLPWDTIAHDLLFKVPSPPVNM  388



>ref|XP_004486433.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Cicer arietinum]
Length=595

 Score =   463 bits (1192),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 280/507 (55%), Positives = 360/507 (71%), Gaps = 23/507 (5%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFk----kakkdcdgkpKFLMTELVPCGWV  1557
             DY+DA+I VEGILV V+R +LA+RS+FFHE FK    K     +GK K+ +++L+P G V
Sbjct  63    DYSDAEIVVEGILVRVHRCVLASRSKFFHELFKRGKDKGSSKNEGKLKYCLSDLLPYGKV  122

Query  1556  GYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELV  1377
             GYEAF++FL+YVY+GK K SP EVSTCVD  C H AC PAI++AV++MYAS+ FQI ELV
Sbjct  123   GYEAFIIFLSYVYSGKLKPSPMEVSTCVDNVCAHDACGPAINFAVEVMYASSIFQIPELV  182

Query  1376  MLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAI  1197
              L QR L   V  A +EDVIPIL+V F C L+ LV  CV RV  S+L+  ++E ELP  +
Sbjct  183   SLFQRRLLNFVGKALVEDVIPILMVAFHCQLSQLVALCVDRVARSDLNQISIEKELPCEL  242

Query  1196  SSDIKA--RRLNQQGANE----------KKIRKILRALDCNDVELVKLLLEESDITLDDa  1053
             S  +K   R L QQ +            K+I +I +ALD +DVELVKLLL ESDITLD+A
Sbjct  243   SEKVKLLRRDLQQQDSENYAPVVDALSLKRITRIHKALDSDDVELVKLLLNESDITLDEA  302

Query  1052  yavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASI  873
              A+HYAAAYC+ KVV+EVLGLG  ++NLRN+RGYTVLHVAA RK+P+IIV++L  +GA  
Sbjct  303   GALHYAAAYCDPKVVSEVLGLGMANVNLRNSRGYTVLHVAAMRKEPSIIVSLL-TNGACA  361

Query  872   RDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVS---LP  702
              D T  +G +AV+ICRR TRPKDY+  TE+G+E N DR+CIDVL+   M  NP++     
Sbjct  362   SDLT-FDGQSAVSICRRLTRPKDYHPKTEQGKETNKDRICIDVLQR-EMRRNPLAGDLSV  419

Query  701   SSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLK  522
             SS T+ +DL M+L +LENRVA AR  +P EA++ M+IA A++T EF GLS  +G  GNL 
Sbjct  420   SSQTVADDLHMKLLYLENRVAFARLFFPLEAKLAMDIARAETTSEFAGLSTSKGSNGNLM  479

Query  521   GVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTP  342
              V L   P  Q KRL+ R EAL KTVE+G R+F +CS+VLDK   DD+ D L  LE GT 
Sbjct  480   EVDLNETPLMQNKRLISRMEALMKTVEMGHRYFPHCSEVLDKFMEDDLPD-LFYLEKGTQ  538

Query  341   EEQTNKKRRYMELKEEVMKAFDKDMAQ  261
             EEQ  K+ R++ELKE+V KAF+KD A+
Sbjct  539   EEQRVKRTRFIELKEDVNKAFNKDKAE  565



>gb|KHN11992.1| Regulatory protein NPR3 [Glycine soja]
Length=590

 Score =   463 bits (1191),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 273/507 (54%), Positives = 356/507 (70%), Gaps = 18/507 (4%)
 Frame = -2

Query  1733  EYEDYNDADIEVEGILVGVNRGILAARSQFFHEEFkkak--kdcdgkpKFLMTELVPCGW  1560
             EY DY+DA+I +E I VG++R ILA+RS FFHE FKK       +GKP++LM++L+P G 
Sbjct  59    EY-DYSDAEILIEDIPVGIHRCILASRSPFFHELFKKGTDGSGKEGKPRYLMSDLMPYGT  117

Query  1559  VGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKEL  1380
             VGY+AF VFL Y+YTG+ KASP E +TCVDE+C H ACRPAI++A++LMYAS TFQ+KEL
Sbjct  118   VGYQAFQVFLYYLYTGRLKASPTEETTCVDETCIHVACRPAINHALELMYASVTFQMKEL  177

Query  1379  VMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGA  1200
             V+L QRHL   V+ A +EDVIPIL+  F C L  L+ RC++RV  S+ DN +LE ELP  
Sbjct  178   VLLFQRHLLNFVEKALVEDVIPILMAAFNCQLDQLLSRCIQRVARSDFDNTSLEKELPHE  237

Query  1199  ISSDIKARRLNQQ-----------GANEKKIRKILRALDCNDVELVKLLLEESDITLDDa  1053
             + ++IK+ RL  Q             NEK IR+I +ALD +DVEL+KLLL ES +TLDDA
Sbjct  238   VLTEIKSLRLPFQPESTPNAMEAESLNEKSIRRIHKALDSDDVELLKLLLNESSVTLDDA  297

Query  1052  yavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASI  873
             +A+HYA AY +SKV+ EVL LG  D+  RN+RGYTVLHVAARRKDP+I+VA+L+K GA  
Sbjct  298   HALHYACAYSDSKVIQEVLSLGMADILRRNSRGYTVLHVAARRKDPSILVALLNK-GARA  356

Query  872   RDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVM-MNGNPVSLPSS  696
              D T  +G TA+ IC+R TR KDY++ T + +E N DRLC+DVLE  M  N   V++  S
Sbjct  357   SDTT-PDGQTALAICQRLTRCKDYHEKTVQCKESNKDRLCVDVLEREMRRNSMTVNMSVS  415

Query  695   TTLE-NDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKG  519
             + L  +DL M L +LE+RVA AR L+P EAR+ +E A ADS+  +   S ++   GN K 
Sbjct  416   SQLTADDLHMRLDYLEDRVAFARLLFPAEARVAIENAEADSSSLYANSSALKVTNGNPKE  475

Query  518   VGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPE  339
             V L   P  + ++L  R  AL KTVE GRRFF +CS+VLDK   DD +  +  LE G+ E
Sbjct  476   VDLNESPSARTRKLQLRLHALMKTVENGRRFFPHCSEVLDKFLEDDEMPDVFFLEKGSEE  535

Query  338   EQTNKKRRYMELKEEVMKAFDKDMAQN  258
             EQ  KK R+MELK++V KAF KDMA+N
Sbjct  536   EQRIKKARFMELKDDVQKAFHKDMAEN  562



>ref|XP_003594464.1| NPR1-1 protein [Medicago truncatula]
 gb|AES64715.1| regulatory protein NPR1 [Medicago truncatula]
Length=589

 Score =   463 bits (1191),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 275/505 (54%), Positives = 353/505 (70%), Gaps = 20/505 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdgkp----KFLMTELVPCGWV  1557
             DY DADI VEGI V ++R IL +RS+FFHE FK++K     K     K+ +++L+P G V
Sbjct  62    DYGDADIIVEGIPVRIHRCILGSRSKFFHEIFKRSKDKGLSKNEGRLKYCLSDLLPYGKV  121

Query  1556  GYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELV  1377
             GYEAF++FL+YVY+GK K SP EVSTCVD  C H AC PAI++AV+LMYAS+ FQI ELV
Sbjct  122   GYEAFLIFLSYVYSGKLKPSPMEVSTCVDNVCAHDACGPAINFAVELMYASSIFQIPELV  181

Query  1376  MLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAI  1197
              L QR L   V  A +EDVI IL+  F C L  L  +CV RV  S+LD  ++E ELP  +
Sbjct  182   SLFQRRLLNFVGKALVEDVISILMASFHCQLNQLAAQCVDRVARSDLDQISIEKELPHEL  241

Query  1196  SSDIKA--RRLNQQGANE---------KKIRKILRALDCNDVELVKLLLEESDITLDDay  1050
             S  +K   R L+Q   N+         K+I +I +ALD +DVELVKLLL ESDITLD+A 
Sbjct  242   SEKVKLLRRDLHQNDENDAPVVDTLSLKRITRIHKALDSDDVELVKLLLNESDITLDEAG  301

Query  1049  avhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIR  870
             A+HYA A+C+ KVV+EVLGLG  ++NLRN+RGYTVLH+AA RK+P+IIV++L K GA   
Sbjct  302   ALHYAVAHCDPKVVSEVLGLGLANVNLRNSRGYTVLHIAAMRKEPSIIVSLLTK-GACAS  360

Query  869   DATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVSLP--SS  696
             D T  +G +AV+ICRR TRPKDY+  TE+G+E N DR+CIDVLE  M      + P  SS
Sbjct  361   DLTF-DGQSAVSICRRLTRPKDYHTKTEQGKETNKDRICIDVLEREMRRNPLATDPSVSS  419

Query  695   TTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGV  516
              T+ +DL M+L +LENRVA AR  +P EA++ M+IA A++T EF GLS  +G  GNL+ V
Sbjct  420   HTVADDLHMKLLYLENRVAFARLFFPLEAKLAMDIARAETTSEFAGLSASKGSNGNLREV  479

Query  515   GLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEE  336
              L   P  Q KRL+ R EAL KTVE+GRR+F +CS+VLDK   DD+ D L  LE GT EE
Sbjct  480   DLNETPIMQNKRLISRMEALMKTVEMGRRYFPHCSEVLDKFMEDDLPD-LFYLEKGTQEE  538

Query  335   QTNKKRRYMELKEEVMKAFDKDMAQ  261
             Q  K+ R++ELK++V KAF KD A+
Sbjct  539   QRVKRTRFVELKDDVNKAFSKDKAE  563



>gb|KHG26685.1| hypothetical protein F383_10565 [Gossypium arboreum]
Length=374

 Score =   455 bits (1170),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 266/390 (68%), Positives = 307/390 (79%), Gaps = 36/390 (9%)
 Frame = +1

Query  2419  GGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGRQE  2598
             G +TPSRFELLS+V+KHS  LGKT V+EED +DVEMD +FWH++ DLYFV GKESRGRQ+
Sbjct  5     GEETPSRFELLSVVRKHSNLLGKTTVDEEDATDVEMDGKFWHDIFDLYFVRGKESRGRQD  64

Query  2599  DDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLIAH  2778
             DDLIFFVRK   +G+  N + E  +PYFVRRW+P+LD L+G++   VDWRRS+YLN+IAH
Sbjct  65    DDLIFFVRKW--KGHSFNESEESVAPYFVRRWAPELDKLVGDSLSVVDWRRSFYLNMIAH  122

Query  2779  TTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPAYP  2958
             T         SH VL+N+Q G+D PLS IYKVVKTVYASPSR         EVETTPAYP
Sbjct  123   T---------SHNVLRNHQVGQDTPLSAIYKVVKTVYASPSR---------EVETTPAYP  164

Query  2959  DICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPS-----DSSQS-------ETSG  3102
             DICFA+DDFDSTFDAVVLT+ DHCYCV+LNA DGAAFPS     DSS S       +T+ 
Sbjct  165   DICFAIDDFDSTFDAVVLTETDHCYCVLLNALDGAAFPSEKDTNDSSSSNKVPLRVDTNS  224

Query  3103  GKTQSSKITIFSGFVSYQMVRDAYDAGRTg-fgsllslhssgKTDRIYMKGPGGRGEVEV  3279
              KT++SK+T+FSGFVSYQMVRDAYDAG +G    L   HSSGK DR+YMKGPGGRGEVEV
Sbjct  225   MKTKNSKLTLFSGFVSYQMVRDAYDAGSSGFGSLLSMGHSSGKKDRLYMKGPGGRGEVEV  284

Query  3280  AVSGVVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrssDEEMI  3450
             AVSGVVDQSKE+ G   P   KKG    ++VR+AASVASVAAK+AYA ASAT SSDEEMI
Sbjct  285   AVSGVVDQSKEDSGPFSPIISKKGFGLGSIVRKAASVASVAAKNAYAVASATSSSDEEMI  344

Query  3451  PLKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
             PLKCCLMSI+LPWEHIA+DLL KGSPPVNL
Sbjct  345   PLKCCLMSITLPWEHIAYDLLFKGSPPVNL  374



>ref|XP_006302376.1| hypothetical protein CARUB_v10020440mg [Capsella rubella]
 gb|EOA35274.1| hypothetical protein CARUB_v10020440mg [Capsella rubella]
Length=388

 Score =   455 bits (1170),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 255/386 (66%), Positives = 303/386 (78%), Gaps = 11/386 (3%)
 Frame = +1

Query  2413  NGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGR  2592
             N G +TPSR E+LSMVKKHSK LG+T  +E D SDVEMD  FWH V D+YF+   ESR R
Sbjct  3     NDGEETPSRHEILSMVKKHSKSLGQTSPDEADASDVEMDSNFWHGVFDVYFIRCMESRRR  62

Query  2593  QEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLI  2772
             Q+DDL+FFVRK+S + Y    N +  +PYFVRRW+PKLD+LLGE+   VDWR+S+YLN+I
Sbjct  63    QDDDLLFFVRKLSCKSYGLTENEDAPAPYFVRRWAPKLDELLGESLAEVDWRKSFYLNMI  122

Query  2773  AHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPA  2952
             AHT+F+VTVAICS+E LK YQ  KD  LSPIYKVVKTVYASPSR+NFHLDS+KEVETTPA
Sbjct  123   AHTSFTVTVAICSNEALKTYQGSKDTKLSPIYKVVKTVYASPSRVNFHLDSKKEVETTPA  182

Query  2953  YPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPS----DSSQSETSG--GKTQ  3114
             YP+ICFAVDDFDSTFDAVVLT+ DHCYCV+LN++DGAAFPS    DSS S T+      +
Sbjct  183   YPEICFAVDDFDSTFDAVVLTEKDHCYCVLLNSHDGAAFPSANVKDSSDSNTNTEPRSVK  242

Query  3115  SSKITIFSGFVSYQMVRDAYDAGRTgf-gsllslhssgKTDRIYMKGPGGRGEVEVAVSG  3291
               K+T+FSGFVSYQMVR+AY+ GR  F   L   H++GK DR+YM+GPGGRGEVEVAVSG
Sbjct  243   DPKVTLFSGFVSYQMVREAYEGGRNRFGSLLSLGHNTGKADRLYMRGPGGRGEVEVAVSG  302

Query  3292  VVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrssDEEMIPLKC  3462
             V+DQS+   G   P   KK +   ++ R+AASVASVAAKHA AAA+A+   D EM PLKC
Sbjct  303   VIDQSQVVLGPVSPMSSKKSIDLGSIFRKAASVASVAAKHAIAAATASYDED-EMFPLKC  361

Query  3463  CLMSISLPWEHIAHDLLLKGSPPVNL  3540
             CLMSISLPW+ IAHDLL K S PVN+
Sbjct  362   CLMSISLPWDTIAHDLLFKASAPVNM  387



>ref|XP_010470227.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X2 
[Camelina sativa]
Length=388

 Score =   455 bits (1170),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 252/386 (65%), Positives = 301/386 (78%), Gaps = 11/386 (3%)
 Frame = +1

Query  2413  NGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGR  2592
             N G  TPSR E+LSMVKKHSK LG T ++E+D SDVEMD  FWH + D+YF+   ESR R
Sbjct  3     NDGEATPSRHEILSMVKKHSKSLGSTSLDEQDASDVEMDSNFWHGLFDVYFIRCMESRRR  62

Query  2593  QEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLI  2772
             Q+DDL+FFVRK+S + Y    N E  +PYFVRRW+PKL++LLGE+   VDWR+S+YLN+I
Sbjct  63    QDDDLLFFVRKLSCKSYGLTENDEAPAPYFVRRWAPKLNELLGESLAEVDWRKSFYLNMI  122

Query  2773  AHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPA  2952
             AHT+F+VTVAICS+E LK YQ  KD  LSPIYKVVKTVYASPSR+NFHLDS+KEVETTPA
Sbjct  123   AHTSFTVTVAICSNEALKTYQGSKDTKLSPIYKVVKTVYASPSRVNFHLDSKKEVETTPA  182

Query  2953  YPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDS------SQSETSGGKTQ  3114
             YP+ICFAVDDFDSTFDAVVLT+ DHCYCV+LN++DGAAFPS +      S S T     +
Sbjct  183   YPEICFAVDDFDSTFDAVVLTEKDHCYCVLLNSHDGAAFPSANNKDSSDSNSNTEPKSVK  242

Query  3115  SSKITIFSGFVSYQMVRDAYDAGRTgf-gsllslhssgKTDRIYMKGPGGRGEVEVAVSG  3291
               K+T+FSGFVSYQMVR+AY+ GR  F   L   H++GK DR+YM+GPGGRGEVEVAVSG
Sbjct  243   DPKVTLFSGFVSYQMVREAYEGGRNRFGSLLSLGHNTGKADRLYMRGPGGRGEVEVAVSG  302

Query  3292  VVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrssDEEMIPLKC  3462
             V+DQS+   G   P   KK +   ++ R+AASVASVAAKHA AAA+A+   D EM PLKC
Sbjct  303   VIDQSQVVVGPVSPMSSKKSIDLGSIFRKAASVASVAAKHAIAAATASYDED-EMFPLKC  361

Query  3463  CLMSISLPWEHIAHDLLLKGSPPVNL  3540
             CLMSISLPW+ IAHDLL K  PPVN+
Sbjct  362   CLMSISLPWDTIAHDLLFKAFPPVNM  387



>ref|XP_004169978.1| PREDICTED: regulatory protein NPR3-like [Cucumis sativus]
Length=585

 Score =   462 bits (1189),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 282/504 (56%), Positives = 350/504 (69%), Gaps = 20/504 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg--kpKFLMTELVPCGWVGY  1551
             DY DA I VEGI VGV+R ILAARSQFFHE FK+         KPK+ M++LV    VG 
Sbjct  62    DYTDAVIVVEGIEVGVHRCILAARSQFFHELFKQEVDSSTEDGKPKYCMSKLVAFRKVGI  121

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF V LNY+YTGK K SPPEVSTCVDE+C H AC PAI+YAV+LMYASATF++KE+V+L
Sbjct  122   EAFKVILNYLYTGKLKPSPPEVSTCVDEACAHDACGPAINYAVELMYASATFKMKEMVLL  181

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
             +QR L   V+ AA+EDVI +L+  F C L  L   C++RV  SNLD  +L  ELP  I+S
Sbjct  182   VQRRLLNFVEKAAVEDVITLLIAAFHCHLDQLHTPCIQRVARSNLDAVSLGRELPDEIAS  241

Query  1190  DIKARRLNQQGAN------------EKKIRKILRALDCNDVELVKLLL-EESDITLDDay  1050
             +IK+ R+  Q               EKKIR++ +ALD +DVEL+ LLL E SDITL+DAY
Sbjct  242   EIKSLRMKSQQETEPDIVEEADLNREKKIRRLHKALDSDDVELLGLLLRESSDITLNDAY  301

Query  1049  avhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIR  870
             A+HYA AYC+ KV+ EVL LG  DLN +N RG TVLHVAARRKDP IIVA+LDK GAS  
Sbjct  302   ALHYATAYCDPKVIKEVLNLGLADLNHKNLRGQTVLHVAARRKDPNIIVALLDK-GASAL  360

Query  869   DATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVM-MNGNPVSLPSST  693
             + T ++G TAVTICRR TRP+D+N+TT++G+  N DRLCIDVLE  M  N     +  +T
Sbjct  361   EPT-ADGQTAVTICRRLTRPRDFNETTQKGQVSNKDRLCIDVLEREMRRNSFSSGMEMAT  419

Query  692   TLE-NDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGV  516
              +   D+ + L +LENRVA AR  +P EA++ MEIA A ST+ ++G    +G  GNL  V
Sbjct  420   QISATDMHVMLDYLENRVAFARLFFPAEAKVAMEIADAGSTIAYIGPVPAKGSSGNLLKV  479

Query  515   GLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEE  336
              L   P    KRL  R +AL KTVE GRR+F +CS+VLD   ADD+ D L  LE+GTPEE
Sbjct  480   DLNETPSVGTKRLQSRMQALMKTVETGRRYFPHCSEVLDNFLADDMPDLL-FLETGTPEE  538

Query  335   QTNKKRRYMELKEEVMKAFDKDMA  264
             Q  KK R+MELK++V KAF KD+A
Sbjct  539   QRKKKARFMELKDDVQKAFCKDLA  562



>ref|XP_008459083.1| PREDICTED: regulatory protein NPR3-like [Cucumis melo]
Length=586

 Score =   462 bits (1188),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 276/501 (55%), Positives = 350/501 (70%), Gaps = 18/501 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg--kpKFLMTELVPCGWVGY  1551
             DY DADI VEG+ VG++R ILA RS+FFH  F+K +K      KP++ M EL+P G VG+
Sbjct  61    DYTDADIVVEGVPVGIHRCILAVRSRFFHYLFQKDEKPAMKDGKPQYHMNELLPYGKVGH  120

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF++ L+Y+Y+GK  +SP  VSTCVD SC H AC PAID+AVQL YAS+ FQI ELV L
Sbjct  121   EAFLILLSYLYSGKLNSSPANVSTCVDNSCAHDACGPAIDFAVQLTYASSIFQIPELVSL  180

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
              QRHL   V  A +E+VI IL+V F C L+PLV +C+ R+  S+LD  +LE  LP  ++ 
Sbjct  181   FQRHLLNYVVKALVENVIQILVVAFHCQLSPLVTQCIDRIARSDLDCASLEKGLPYEVAE  240

Query  1190  DIKARRLNQQGANE----------KKIRKILRALDCNDVELVKLLLEESDITLDDayavh  1041
              IK  RL  +G +E          KKI+KI  ALD +DVEL+KLLL ESD+TLD+A A+H
Sbjct  241   RIKLVRLKSRGGDEQNLVADSPRDKKIKKICLALDSDDVELMKLLLSESDVTLDEANALH  300

Query  1040  yaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDAT  861
             YAAAYC+ K + EVL L   D+NLRN+RGYTVLHVAA RKDP++I+++L+K GA   D T
Sbjct  301   YAAAYCDPKSLTEVLNLNIADVNLRNSRGYTVLHVAAMRKDPSVIMSLLNK-GAWAFDLT  359

Query  860   CSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVSLPS--STTL  687
               +G TA  IC+R TRPKDY+  TE+G+E N DRLCID+LE  M   NP S  S  S  +
Sbjct  360   -PDGRTAANICQRLTRPKDYHAKTEKGQETNKDRLCIDILEREMWR-NPTSDSSILSLAM  417

Query  686   ENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVGLT  507
              +D+ M+L +LENRVA AR L+P EAR+ M+IA+AD+T EFVGLS  +    NL+ V L 
Sbjct  418   ADDVHMKLIYLENRVAFARLLFPSEARLAMDIANADTTSEFVGLSMPKNSNKNLREVNLN  477

Query  506   GLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQTN  327
               P  Q KR + R +AL KTVE+GRRFF NCS+ LDK  ADD+ D L  LE GT EEQ  
Sbjct  478   ETPSVQNKRFLSRMQALLKTVEMGRRFFPNCSEALDKFVADDLPD-LFYLEKGTVEEQRI  536

Query  326   KKRRYMELKEEVMKAFDKDMA  264
             K++R+ ELK +V KAFDKD A
Sbjct  537   KRKRFKELKNDVQKAFDKDKA  557



>ref|XP_007147518.1| hypothetical protein PHAVU_006G131400g [Phaseolus vulgaris]
 gb|ESW19512.1| hypothetical protein PHAVU_006G131400g [Phaseolus vulgaris]
Length=590

 Score =   462 bits (1188),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 275/506 (54%), Positives = 356/506 (70%), Gaps = 22/506 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg--kpKFLMTELVPCGWVGY  1551
             DY+DADI VEGI V V+R +LA+RS+FFHE FK+ K   +   K K+ M++L+P G VGY
Sbjct  62    DYSDADIIVEGIPVSVHRCVLASRSKFFHELFKREKGSSEKEGKLKYNMSDLLPYGKVGY  121

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF++FL YVYT K K SP EVSTCVD  C H ACRPAI++AV+LMYAS+ FQI ELV L
Sbjct  122   EAFLIFLGYVYTAKLKPSPMEVSTCVDNVCAHDACRPAINFAVELMYASSIFQIPELVSL  181

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
              QR L   +  A +EDVIPIL V F C  + L+ +C+ RV  S+LD  +++ ELP  +S 
Sbjct  182   FQRRLLNFIGKALVEDVIPILTVAFHCKSSQLITQCIDRVARSDLDQISVDKELPHELSG  241

Query  1190  DIKARRLNQQGANE-----------KKIRKILRALDCNDVELVKLLLEESDITLDDayav  1044
              +K  R N Q   E           K+I +I +ALD +DVELVKLLL ES+ITLD+A+A+
Sbjct  242   KVKLLRHNPQQEVENDASALDALSLKRITRIHKALDSDDVELVKLLLNESEITLDEAHAL  301

Query  1043  hyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDA  864
             HYAAAYC+ KVV+EVLGLG  ++NLRN+RGY+VLH+AA R++P+IIV++L K GA   D 
Sbjct  302   HYAAAYCDPKVVSEVLGLGLANVNLRNSRGYSVLHIAAMRREPSIIVSLLTK-GACASDL  360

Query  863   TCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPV---SLPSST  693
             T  +G +AV+ICRR TRPKDY+  TE+G+E N DR+CIDVLE   M  NP+   +  SS 
Sbjct  361   TF-DGQSAVSICRRLTRPKDYHAKTEQGKETNKDRICIDVLER-EMRRNPLAGDACISSH  418

Query  692   TLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLC--GNLKG  519
             T+ +DL M+L +LENRVA AR  +P EA++ M+IAHA++T EF GLS        GNL+ 
Sbjct  419   TMADDLHMKLLYLENRVAFARLFFPSEAKLAMDIAHAETTSEFAGLSASNPKISNGNLRE  478

Query  518   VGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPE  339
             V L   P  Q KRL+ R EAL KTV++GRR+F +CSDVLDK   DD+ D L  LE GT E
Sbjct  479   VDLNETPIVQNKRLLSRMEALMKTVKMGRRYFPHCSDVLDKFMEDDLPD-LFYLEKGTQE  537

Query  338   EQTNKKRRYMELKEEVMKAFDKDMAQ  261
             EQ  K+ R++ELK++V KAF KD  +
Sbjct  538   EQRIKRTRFIELKDDVHKAFSKDKTE  563



>ref|XP_009777172.1| PREDICTED: regulatory protein NPR3-like isoform X2 [Nicotiana 
sylvestris]
Length=503

 Score =   458 bits (1178),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 272/455 (60%), Positives = 337/455 (74%), Gaps = 19/455 (4%)
 Frame = -2

Query  1736  GEYEDYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdgkp-KFLMTELVPCGW  1560
              EY DY+DA+I V+GI VGVNR ILAARSQFFH++FK  +        K+L+ +L+P G 
Sbjct  52    AEY-DYSDAEIVVDGITVGVNRCILAARSQFFHKKFKDNENSVKEGKPKYLLKDLLPGGS  110

Query  1559  VGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKEL  1380
             +GYEAFMVFLNY+YTGK K  PPEVSTCVD +C H ACRPAI+YAV+LMYA ATFQIKEL
Sbjct  111   IGYEAFMVFLNYLYTGKLKPPPPEVSTCVDITCTHDACRPAINYAVELMYAFATFQIKEL  170

Query  1379  VMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGA  1200
             VM +QRHL  LVD A ++DVIPILLV F CSL  L+ERCV++V  S+LD FTLE ELP  
Sbjct  171   VMAVQRHLVNLVDEATVDDVIPILLVAFHCSLDLLLERCVQKVERSDLDIFTLEKELPSK  230

Query  1199  ISSDIKARRLNQQ-----------GANEKKIRKILRALDCNDVELVKLLLEESDITLDDa  1053
             + +DIKARRL  Q             +EK+IRKIL+AL+ +D+EL+KLLL ES++TL+DA
Sbjct  231   VLTDIKARRLKSQIVIEQDTMEGGSLHEKRIRKILKALESDDIELLKLLLGESNVTLNDA  290

Query  1052  yavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASI  873
              A+HYAAAYCNSKVVNEVL +G  D+NLRN+RGYTVLHV ARR +P+II+++LDK GAS 
Sbjct  291   CALHYAAAYCNSKVVNEVLKMGIADVNLRNSRGYTVLHVGARRMEPSIIMSLLDK-GASA  349

Query  872   RDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPV---SLP  702
              D T  +G TA++IC R TR KDYN+T +EGE  N DRLCIDVLE   MN NP+      
Sbjct  350   LDTTL-DGLTALSICLRVTRLKDYNETAKEGEITNKDRLCIDVLER-EMNRNPMIGNIST  407

Query  701   SSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLK  522
             SS+ + +DL+  L  LENRVA+AR ++P EA++ M+IAH +ST EF GLS +  LCG+L 
Sbjct  408   SSSVVADDLLAMLLLLENRVAMARMMFPIEAKLAMDIAHVESTSEFTGLSEINDLCGDLT  467

Query  521   GVGLTGLPPDQVKRLMERREALKKTVELGRRFFRN  417
             GV L G PP+ VK L ER  AL+KT + G    RN
Sbjct  468   GVVLNGFPPENVKGLQERLAALQKTGDQGGEPLRN  502



>ref|XP_009377037.1| PREDICTED: regulatory protein NPR3-like [Pyrus x bretschneideri]
Length=583

 Score =   460 bits (1184),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 289/526 (55%), Positives = 363/526 (69%), Gaps = 13/526 (2%)
 Frame = -2

Query  1733  EYEDYNDADIEVEGILVGVNRGILAARSQFFHEEFkkak--kdcdgkpKFLMTELVPCGW  1560
             EY DY+DA+I VEG  VGVNR ILA+RSQFF + F+K       +GKP++LM+ELVP G 
Sbjct  61    EY-DYSDAEIVVEGNTVGVNRCILASRSQFFQDLFRKGSDDAKKEGKPRYLMSELVPNGK  119

Query  1559  VGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKEL  1380
             VGYEAF VFLNY+YTGK   SP EVSTCVD+ C H AC PAI YAV+LMYAS+TFQ+KEL
Sbjct  120   VGYEAFKVFLNYLYTGKLNPSPVEVSTCVDDRCPHDACGPAISYAVELMYASSTFQMKEL  179

Query  1379  VMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGA  1200
             V L++ HL   V+ A +EDVIPIL+  F C L  L+  C++ V SS+LD   +E ELP  
Sbjct  180   VQLVEHHLSNFVEKALVEDVIPILVAAFHCQLDQLLSHCIQMVASSDLDIMAIEKELPHK  239

Query  1199  ISSDIKARRLNQQ---GANEKKIRKILRALDCNDVELVKLLLEESDITLDDayavhyaaa  1029
             +S+DIK  R   Q      +K+IR I +ALD +DVELV LLL+ES ITLD+AYA+HYA A
Sbjct  240   VSNDIKLNRPKPQEMEPVEDKRIRSIHKALDSDDVELVGLLLKESGITLDEAYALHYAVA  299

Query  1028  YCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDATCSNG  849
             YC+ KVV EVLGLGK + NL N+RG+T LHVAARRK PA++  +L K GAS  + T SNG
Sbjct  300   YCDPKVVKEVLGLGKANPNLCNSRGHTALHVAARRKLPAVLFPLL-KWGASASETT-SNG  357

Query  848   HTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVSLPSSTTLE---ND  678
              T   ICRR TRPKDY + T++G+E N DRLCID+LE  M   N +S   S  L+   +D
Sbjct  358   QTPAAICRRLTRPKDYWENTQQGQESNKDRLCIDLLEREMQR-NSISGNMSIILKEIADD  416

Query  677   LVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVGLTGLP  498
             L M L +LE+RVA AR L+P EA++ ME+A A ST  + GL+   G  GNL+ V L   P
Sbjct  417   LHMRLDYLEDRVAFARLLFPAEAKLAMEMADAHSTSAYTGLTASRGSSGNLREVDLNETP  476

Query  497   PDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQTNKKR  318
               + KRL  + +AL  TV++GR FF NCS+VLDK   D++      LE GTPEEQ  K+ 
Sbjct  477   SGRTKRLQTKMQALLNTVKIGRHFFPNCSEVLDKFLEDELDMPDFILERGTPEEQRIKRM  536

Query  317   RYMELKEEVMKAFDKDMA-QNRVGLsscsssstspkmsatSKVRKK  183
             R++ELKE+V +AF KD+A QNR  LS  SS S+S K     KVRK+
Sbjct  537   RFLELKEDVQQAFYKDIAEQNRSALSFSSSCSSSLKEGVKRKVRKR  582



>ref|XP_010664489.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X2 
[Vitis vinifera]
Length=372

 Score =   452 bits (1163),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 259/397 (65%), Positives = 308/397 (78%), Gaps = 43/397 (11%)
 Frame = +1

Query  2404  LLGNGGGQTPSRFELLSMVKKHSKFLGKTIVE-EEDPSDVEMDPQFWHEVLDLYFVCGKE  2580
             +LG+GG +TP+R+ELLSMVKKHS  L  T V+ E+D SDVEMDP FWH++LDLYF+CG+E
Sbjct  1     MLGDGG-ETPTRYELLSMVKKHSSSLKNTTVDDEQDASDVEMDPSFWHDILDLYFICGRE  59

Query  2581  SRGRQEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYY  2760
             SRGRQ+DDLIFFVRK+SL GY  N + E   PYFVRRW+PKLD L+ ENS  VDWRRS+Y
Sbjct  60    SRGRQDDDLIFFVRKLSLHGYGFNDHMEGIPPYFVRRWAPKLDKLVSENSAEVDWRRSFY  119

Query  2761  LNLIAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVE  2940
             LNLIAHT+F+VTVAICSH+VL+N+QTG+D PLSPIYKVVKTVYASPSR+ FHLDS+KE  
Sbjct  120   LNLIAHTSFTVTVAICSHQVLRNHQTGQDSPLSPIYKVVKTVYASPSRVEFHLDSKKE--  177

Query  2941  TTPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPS-----DSSQSETS--  3099
                                   VLT+ DHCYCV+LNA+DGAAFPS     D S S TS  
Sbjct  178   ----------------------VLTETDHCYCVLLNAHDGAAFPSEKTSPDCSSSNTSSL  215

Query  3100  -----GGKTQSSKITIFSGFVSYQMVRDAYDAGRTg-fgsllslhssgKTDRIYMKGPGG  3261
                    K++++K+T+FSGFVSYQMVR+AYDAG++     LL   S+GKTDR+YMKGPGG
Sbjct  216   RIDTDSEKSKNTKLTLFSGFVSYQMVREAYDAGKSRFGSLLLLGQSAGKTDRLYMKGPGG  275

Query  3262  RGEVEVAVSGVVDQSKEEYGH----HPPKKGLsfsavvrraasvasvaakhayaaasatr  3429
             RGEVEVAVSGV DQS++  G     H  K+G     +VR+AA+VASVAAKHAYAAA+ATR
Sbjct  276   RGEVEVAVSGVADQSQQPSGPSSPVHASKRGFGIGTIVRKAATVASVAAKHAYAAAAATR  335

Query  3430  ssDEEMIPLKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
             SSDEEM+PLKCCLMSISLPWEHIA+DL+ KGSPPVNL
Sbjct  336   SSDEEMLPLKCCLMSISLPWEHIAYDLMFKGSPPVNL  372



>ref|XP_007213800.1| hypothetical protein PRUPE_ppa003221mg [Prunus persica]
 gb|EMJ14999.1| hypothetical protein PRUPE_ppa003221mg [Prunus persica]
Length=591

 Score =   460 bits (1184),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 281/503 (56%), Positives = 350/503 (70%), Gaps = 20/503 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkka--kkdcdgkpKFLMTELVPCGWVGY  1551
             DY+DA I VEG  VGV R ILA+RS FF E FK+A    + +GKP + M++L+P G V Y
Sbjct  65    DYSDAVIIVEGKSVGVYRCILASRSSFFGELFKRANGSSEKEGKPTYCMSDLLPYGNVLY  124

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF+VFL+YVYTGK K  P EVSTCV   C H AC PAI++AV+LMYAS+ FQ+ +LV +
Sbjct  125   EAFLVFLSYVYTGKLKPFPMEVSTCVHSVCAHDACGPAINFAVELMYASSVFQMPDLVSI  184

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
             +QR L   V  A  +DVIPILLVGF C L+ L+++C+ RV  S+LD+ +LE ELP  I  
Sbjct  185   LQRRLINFVGKALADDVIPILLVGFHCKLSQLIDQCIERVARSDLDSISLEKELPDEIVE  244

Query  1190  DIKARRLNQQG-----------ANEKKIRKILRALDCNDVELVKLLLEESDITLDDayav  1044
              IK  R N Q              EK+IR+I +ALD +DVELVKLLL ESDITLD+A A+
Sbjct  245   KIKIIRHNSQQDCDPNIAAVDPLREKRIRRIHKALDSDDVELVKLLLSESDITLDEANAL  304

Query  1043  hyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDA  864
             HYAAAYC+ KVV EV+GLG VD+NLRN+RGYTVLH+A  RK+P+IIV +L K GA + + 
Sbjct  305   HYAAAYCDPKVVTEVIGLGLVDVNLRNSRGYTVLHIAVMRKEPSIIVLLLTK-GARVSEL  363

Query  863   TCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVSLP---SST  693
             T  +G +AV+ICRR TR KDY+  TE GEE N DR+CIDVLE  M   NP++     SS 
Sbjct  364   TL-DGESAVSICRRLTRAKDYHSKTERGEEANKDRICIDVLEREMQR-NPMAADASISSQ  421

Query  692   TLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVG  513
              + +DL M+L  LENRVA AR L+P EA++ M IAHA++T +F GLS  +G  GNL  V 
Sbjct  422   IMPDDLHMQLLNLENRVAFARLLFPTEAKVAMAIAHAETTSQFSGLSSFKGSTGNLMDVD  481

Query  512   LTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQ  333
             L   P  Q KRL  R EAL KTV  GR +F +CS+VLDK   DD+ D L  LE+GTP+EQ
Sbjct  482   LNETPTVQNKRLRSRLEALMKTVSTGRSYFPHCSEVLDKFIKDDLPD-LFFLETGTPDEQ  540

Query  332   TNKKRRYMELKEEVMKAFDKDMA  264
               K+ R+MELKEEV KAF KD A
Sbjct  541   KIKRTRFMELKEEVQKAFSKDKA  563



>gb|KDO44756.1| hypothetical protein CISIN_1g007550mg [Citrus sinensis]
Length=595

 Score =   460 bits (1183),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 294/516 (57%), Positives = 359/516 (70%), Gaps = 28/516 (5%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkka-----kkdcdgkpKFLMTELVPCGW  1560
             DY DADI VEG  V V+R IL+ARSQFFHE FKK          +GKPK+LMTELVP G 
Sbjct  64    DYTDADIVVEGKSVAVHRCILSARSQFFHELFKKGNDNDGSAVSEGKPKYLMTELVPYGK  123

Query  1559  VGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKEL  1380
             VGYEAF V L Y YTGK K SP EVSTCVD++C H AC PAI+YA++LMYASA FQ+KEL
Sbjct  124   VGYEAFNVILYYFYTGKLKPSPSEVSTCVDDACAHDACPPAINYAIELMYASAAFQMKEL  183

Query  1379  VMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGA  1200
             V+L QR L   V+ A +EDVIPIL+  F C L  L   CV+RV  SNLD+  LE ELP  
Sbjct  184   VLLFQRRLLNFVEKALVEDVIPILVAAFHCQLNQLRSHCVQRVVRSNLDDVCLEKELPDE  243

Query  1199  ISSDIKARRLNQQGANE-----------KKIRKILRALDCNDVELVKLLLEESDITLDDa  1053
             +S +IK+ R+      E           K++R+I +ALD +DVEL+KLLL+ES++TLDDA
Sbjct  244   VSGEIKSLRVKSDEECEANIAEVDPMHAKRVRRIHKALDSDDVELLKLLLDESNVTLDDA  303

Query  1052  yavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASI  873
             YA+HYAAAYCN KV  EVL +G  DLNL+NARG+TVLHVAARRK+PA++V +L K   + 
Sbjct  304   YALHYAAAYCNPKVFKEVLNMGLADLNLKNARGHTVLHVAARRKEPAVLVTLLSKGACA-  362

Query  872   RDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVM----MNGNPVSL  705
                T S+G TAV ICRR TR KDY + T++G+E N DRLCIDVLE  M    M+GN ++L
Sbjct  363   -SETTSDGQTAVAICRRMTRRKDYIEATKQGQETNKDRLCIDVLEREMRRNSMSGN-LAL  420

Query  704   PSSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGL--SGMEGLCG  531
              SS  + +D  M+L +LENRVA AR L+P EAR+ M IA AD+T  + GL  S  +G  G
Sbjct  421   -SSEVMADDFQMKLNYLENRVAFARLLFPSEARVAMHIADADATNFYTGLSASKSKGSSG  479

Query  530   NLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLES  351
             NLK V L   P  Q KRL  R +AL KTVE GRR+F +CSDV+DK    D  D+   LE+
Sbjct  480   NLKEVDLNETPSMQAKRLQLRLQALLKTVETGRRYFPHCSDVVDKFLDCDWSDA-SLLEN  538

Query  350   GTPEEQTNKKRRYMELKEEVMKAFDKDMAQ-NRVGL  246
             GTPEEQ  K+ R+MELKE+V KAF KDMA+ NR GL
Sbjct  539   GTPEEQRLKRARFMELKEDVQKAFYKDMAEKNRSGL  574



>ref|XP_009102905.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X1 
[Brassica rapa]
Length=391

 Score =   452 bits (1163),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 256/389 (66%), Positives = 303/389 (78%), Gaps = 14/389 (4%)
 Frame = +1

Query  2413  NGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGR  2592
             N   +T +R E+LSMVKKHSK LGKT ++E++ SDVEMD  FWH V D+YFV   ESR R
Sbjct  3     NDREETLTRHEILSMVKKHSKSLGKTSLDEQEASDVEMDSNFWHGVFDVYFVRCMESRRR  62

Query  2593  QEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLI  2772
             Q+DDL+FFVRK+S + Y    N +  +PYFVRRW+PKLD LLGE    VDWR+S+YLN++
Sbjct  63    QDDDLLFFVRKLSCKSYGLTDNEDAPAPYFVRRWAPKLDVLLGETLAEVDWRKSFYLNMV  122

Query  2773  AHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPA  2952
             AHT+F+VTVAICS+E LK YQ  KD  LSPIYKVVKTVYASPSR+NFHLDS+KEVETTPA
Sbjct  123   AHTSFTVTVAICSNEALKKYQGSKDTTLSPIYKVVKTVYASPSRVNFHLDSKKEVETTPA  182

Query  2953  YPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPS-------DSSQSETSGG--  3105
             YP+ICFAVDDFDSTFDAVVLT+ DHCYCV+LN++DGAAFPS       DSS S T+    
Sbjct  183   YPEICFAVDDFDSTFDAVVLTEKDHCYCVLLNSHDGAAFPSADVKTDKDSSGSNTNTDPR  242

Query  3106  KTQSSKITIFSGFVSYQMVRDAYDAGRTgf-gsllslhssgKTDRIYMKGPGGRGEVEVA  3282
             + +  K+T+FSGFVSYQMVR+AY+ GR  F   L   H SGK DR+YMKGPGGRGEVEVA
Sbjct  243   RVKDPKVTLFSGFVSYQMVREAYEGGRNRFGSLLSLGHHSGKADRLYMKGPGGRGEVEVA  302

Query  3283  VSGVVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrssDEEMIP  3453
             VSGV+DQS+   G   P   KK +   ++ R+AASVASVAAKHA AAA+A+   D EM P
Sbjct  303   VSGVIDQSQVVLGPVSPMSSKKSIDLGSIFRKAASVASVAAKHAIAAATASYDED-EMFP  361

Query  3454  LKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
             LKCCLMSISLPW+ IAHDLL KGSPPVN+
Sbjct  362   LKCCLMSISLPWDTIAHDLLFKGSPPVNM  390



>gb|ABF48718.1| ankyrin repeat BTB/POZ domain-containing protein [Populus trichocarpa]
Length=679

 Score =   462 bits (1190),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 283/539 (53%), Positives = 365/539 (68%), Gaps = 53/539 (10%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg--kpKFLMTELVPCGWVGY  1551
             DY+DADI VEG  +GV+R IL ARS+FFHE F++ K   +   KPK+ M++L+PCG VGY
Sbjct  62    DYSDADIVVEGTAIGVHRCILGARSKFFHELFRREKGSSEKEGKPKYCMSDLLPCGKVGY  121

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF++FL+Y+YTGK K SP EVSTCVD  C H ACRPAI++AV+LMYAS+ FQ+ ELV L
Sbjct  122   EAFLIFLSYLYTGKLKPSPMEVSTCVDNVCAHDACRPAINFAVELMYASSIFQVPELVSL  181

Query  1370  ------------------------------IQRHLDWLVDIAAIEDVIPILLVGFRCSLA  1281
                                           +QR L   V  A +ED+IPIL+V F C L+
Sbjct  182   FQLVNLENWDPTCFTSFAHGANISNDSFLAVQRRLQNFVGKALVEDMIPILVVAFHCQLS  241

Query  1280  PLVERCVRRVTSSNLDNFTLENELPGAISSDIKARRLNQ-----------QGANEKKIRK  1134
              LV +CV R+  S+LDN ++E ELP  ++ +IK  R                  EK+I++
Sbjct  242   QLVTQCVDRIARSDLDNISIEKELPHDVAVEIKLLRRKSISDEENNTEAVDALREKRIKR  301

Query  1133  ILRALDCNDVELVKLLLEESDITLDDayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARG  954
             I  ALD +DVELVKLLL ESDITLDDA A+HYAA+YC+ KVV+EVL LG  D+NLRN+RG
Sbjct  302   IHMALDSDDVELVKLLLTESDITLDDANALHYAASYCDLKVVSEVLSLGLADVNLRNSRG  361

Query  953   YTVLHVAARRKDPAIIVAILDKSGASIRDATCSNGHTAVTICRRSTRPKDYnktteegee  774
             YTVLH+AA RK+P++IV++L K GAS  D T S+G +AV+ICRR TRPKDY+  TE+G+E
Sbjct  362   YTVLHIAAMRKEPSVIVSMLAK-GASALDLT-SDGQSAVSICRRLTRPKDYHAKTEQGQE  419

Query  773   knNDRLCIDVLEGVMMNGNPVSLPSST---TLENDLVMELYFLENRVALARRLYPREARI  603
              N DRLCID+LE  M   NP++  +S    T+ +DL M+L +LENR A AR  +P EA++
Sbjct  420   ANKDRLCIDILEREMRR-NPMAGSASITSHTMVDDLHMKLLYLENR-AFARLFFPTEAKL  477

Query  602   NMEIAHADSTLEFVGLSGMEGLCGNLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFF  423
              M+IAHA +T EF GL+  +G  GNL+ V L   P  Q KRL  R EAL KT E+GRR+F
Sbjct  478   AMDIAHAATTPEFAGLAASKGSNGNLREVDLNETPIMQNKRLRSRMEALMKT-EMGRRYF  536

Query  422   RNCSDVLDKLTADDVLDSLESLESGTPEEQTNKKRRYMELKEEVMKAFDKDMAQ-NRVG  249
              +CS+VLDK   DD+ D L  LE GTP+EQ  K+ R+MELKE+V +AF KD A+ NR G
Sbjct  537   PSCSEVLDKFMEDDLPD-LFYLEKGTPDEQRIKRTRFMELKEDVHRAFTKDKAEINRTG  594



>gb|KDO44755.1| hypothetical protein CISIN_1g007550mg [Citrus sinensis]
Length=599

 Score =   460 bits (1183),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 294/516 (57%), Positives = 359/516 (70%), Gaps = 28/516 (5%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkka-----kkdcdgkpKFLMTELVPCGW  1560
             DY DADI VEG  V V+R IL+ARSQFFHE FKK          +GKPK+LMTELVP G 
Sbjct  64    DYTDADIVVEGKSVAVHRCILSARSQFFHELFKKGNDNDGSAVSEGKPKYLMTELVPYGK  123

Query  1559  VGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKEL  1380
             VGYEAF V L Y YTGK K SP EVSTCVD++C H AC PAI+YA++LMYASA FQ+KEL
Sbjct  124   VGYEAFNVILYYFYTGKLKPSPSEVSTCVDDACAHDACPPAINYAIELMYASAAFQMKEL  183

Query  1379  VMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGA  1200
             V+L QR L   V+ A +EDVIPIL+  F C L  L   CV+RV  SNLD+  LE ELP  
Sbjct  184   VLLFQRRLLNFVEKALVEDVIPILVAAFHCQLNQLRSHCVQRVVRSNLDDVCLEKELPDE  243

Query  1199  ISSDIKARRLNQQGANE-----------KKIRKILRALDCNDVELVKLLLEESDITLDDa  1053
             +S +IK+ R+      E           K++R+I +ALD +DVEL+KLLL+ES++TLDDA
Sbjct  244   VSGEIKSLRVKSDEECEANIAEVDPMHAKRVRRIHKALDSDDVELLKLLLDESNVTLDDA  303

Query  1052  yavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASI  873
             YA+HYAAAYCN KV  EVL +G  DLNL+NARG+TVLHVAARRK+PA++V +L K   + 
Sbjct  304   YALHYAAAYCNPKVFKEVLNMGLADLNLKNARGHTVLHVAARRKEPAVLVTLLSKGACA-  362

Query  872   RDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVM----MNGNPVSL  705
                T S+G TAV ICRR TR KDY + T++G+E N DRLCIDVLE  M    M+GN ++L
Sbjct  363   -SETTSDGQTAVAICRRMTRRKDYIEATKQGQETNKDRLCIDVLEREMRRNSMSGN-LAL  420

Query  704   PSSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGL--SGMEGLCG  531
              SS  + +D  M+L +LENRVA AR L+P EAR+ M IA AD+T  + GL  S  +G  G
Sbjct  421   -SSEVMADDFQMKLNYLENRVAFARLLFPSEARVAMHIADADATNFYTGLSASKSKGSSG  479

Query  530   NLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLES  351
             NLK V L   P  Q KRL  R +AL KTVE GRR+F +CSDV+DK    D  D+   LE+
Sbjct  480   NLKEVDLNETPSMQAKRLQLRLQALLKTVETGRRYFPHCSDVVDKFLDCDWSDA-SLLEN  538

Query  350   GTPEEQTNKKRRYMELKEEVMKAFDKDMAQ-NRVGL  246
             GTPEEQ  K+ R+MELKE+V KAF KDMA+ NR GL
Sbjct  539   GTPEEQRLKRARFMELKEDVQKAFYKDMAEKNRSGL  574



>ref|XP_004147747.1| PREDICTED: regulatory protein NPR3-like [Cucumis sativus]
Length=585

 Score =   459 bits (1180),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 281/504 (56%), Positives = 349/504 (69%), Gaps = 20/504 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg--kpKFLMTELVPCGWVGY  1551
             DY DA I VEGI VGV+R ILAARSQFFHE FK+         KPK+ M++LV    VG 
Sbjct  62    DYTDAVIVVEGIEVGVHRCILAARSQFFHELFKQEVDSSTEDGKPKYCMSKLVAFRKVGI  121

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF V LNY+YTGK K SPPEVSTCVDE+C H AC PAI+YAV+LMYASATF++KE+V+L
Sbjct  122   EAFKVILNYLYTGKLKPSPPEVSTCVDEACAHDACGPAINYAVELMYASATFKMKEMVLL  181

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
             +QR L   V+ AA+EDVI +L+  F C L  L   C++RV  SNLD  +L  ELP  I+S
Sbjct  182   VQRRLLNFVEKAAVEDVITLLIAAFHCHLDQLHTPCIQRVARSNLDAVSLGRELPDEIAS  241

Query  1190  DIKARRLNQQGAN------------EKKIRKILRALDCNDVELVKLLL-EESDITLDDay  1050
             +IK+ R+  Q               EKKIR++ +ALD +DVEL+ LLL E SDITL+DAY
Sbjct  242   EIKSLRMKSQQETEPDIVEEADLNREKKIRRLHKALDSDDVELLGLLLRESSDITLNDAY  301

Query  1049  avhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIR  870
             A+HYA AYC+ K++ EVL LG  DLN +N RG TVLHVAARRKDP IIVA+LDK GAS  
Sbjct  302   ALHYATAYCDPKIIKEVLNLGLADLNHKNLRGQTVLHVAARRKDPNIIVALLDK-GASAL  360

Query  869   DATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVM-MNGNPVSLPSST  693
             + T ++G TAVTICRR TRP+D+N+TT++G+  N DRLCIDVLE  M  N     +  +T
Sbjct  361   EPT-ADGQTAVTICRRLTRPRDFNETTQKGQVSNKDRLCIDVLEREMRRNSFSSGMEMAT  419

Query  692   TLE-NDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGV  516
              +   D+ + L +LENRVA AR  +P EA++ MEIA A ST+  +G    +G  GNL  V
Sbjct  420   QISATDMHVMLDYLENRVAFARLFFPAEAKVAMEIADAGSTIADIGPVPAKGSSGNLLKV  479

Query  515   GLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEE  336
              L   P    KRL  R +AL KTVE GRR+F +CS+VLD   ADD+ D L  LE+GTPEE
Sbjct  480   DLNETPSVGTKRLQSRMQALMKTVETGRRYFPHCSEVLDNFLADDMPDLL-FLETGTPEE  538

Query  335   QTNKKRRYMELKEEVMKAFDKDMA  264
             Q  KK R+MELK++V KAF KD+A
Sbjct  539   QRKKKARFMELKDDVQKAFCKDLA  562



>ref|XP_004497710.1| PREDICTED: regulatory protein NPR3-like [Cicer arietinum]
Length=595

 Score =   459 bits (1180),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 277/507 (55%), Positives = 357/507 (70%), Gaps = 23/507 (5%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFk----kakkdcdgkpKFLMTELVPCGWV  1557
             DY+DA+I VEGI V V+R +LA+RS+FFHE FK    K     +GK K+ +++L+P G V
Sbjct  63    DYSDAEIVVEGIPVRVHRCVLASRSKFFHELFKRGKDKGSSKNEGKLKYCLSDLLPYGKV  122

Query  1556  GYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELV  1377
             GYEAF++FL+YVY+GK K SP EVSTCV   C H AC PAI++AV++MYAS+ FQI ELV
Sbjct  123   GYEAFIIFLSYVYSGKLKPSPMEVSTCVGNVCAHDACGPAINFAVEVMYASSIFQIPELV  182

Query  1376  MLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAI  1197
              L QR L   V  A +EDVIPIL+V F C L+ LV  CV RV  S+L+  ++E ELP  +
Sbjct  183   SLFQRRLLNFVGKALVEDVIPILMVAFHCQLSQLVALCVDRVARSDLNQISIEKELPCEL  242

Query  1196  SSDIKARRLNQQGANE------------KKIRKILRALDCNDVELVKLLLEESDITLDDa  1053
             S  +K  R + Q  N             K+I +I +ALD +DVELVKLLL ESDITLD+A
Sbjct  243   SEKVKLFRRDLQQQNSGNYAPVVDALSLKRITRIHKALDSDDVELVKLLLNESDITLDEA  302

Query  1052  yavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASI  873
              A+HYAAAYC+ KVV+EVLGLG  ++NLRN+RGYTVLHVAA RK+P+IIV++L  +G   
Sbjct  303   GALHYAAAYCDPKVVSEVLGLGMANVNLRNSRGYTVLHVAAMRKEPSIIVSLL-TNGVCA  361

Query  872   RDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVS---LP  702
              D T  +G +AV+ICRR TRPKDY+  TE+G+E N DR+CIDVLE   M  NP++     
Sbjct  362   SDLTF-DGQSAVSICRRLTRPKDYHTKTEQGKETNKDRICIDVLER-EMRRNPLAGDLSV  419

Query  701   SSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLK  522
             SS T+ +DL M+L +LENRVA AR  +P EA++ M+IA A++T EF GLS  +G  GNL 
Sbjct  420   SSQTVADDLHMKLLYLENRVAFARLFFPLEAKLAMDIARAETTSEFAGLSTSKGSNGNLM  479

Query  521   GVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTP  342
              V L   P  Q KRL+ R EAL KTVE+GRR+F +CS+VLDK   DD+ D L  L+ GT 
Sbjct  480   EVDLNETPIMQNKRLISRMEALMKTVEMGRRYFPHCSEVLDKFMEDDLPD-LFYLKKGTQ  538

Query  341   EEQTNKKRRYMELKEEVMKAFDKDMAQ  261
             EEQ  K+ R++ELKE+V KAF+KD A+
Sbjct  539   EEQRVKRTRFIELKEDVNKAFNKDKAE  565



>gb|AGC39275.1| NPR1-like3 protein [Theobroma cacao]
Length=587

 Score =   458 bits (1179),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 278/510 (55%), Positives = 361/510 (71%), Gaps = 21/510 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkd--cdgkpKFLMTELVPCGWVGY  1551
             D++DADI VE + VGV+R ILA RS+FF+E FKK       +GKP + M+EL+P G +G 
Sbjct  62    DFSDADIVVEDVPVGVHRCILAVRSKFFNELFKKGNGSCEKEGKPSYNMSELLPYGKIGL  121

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF + L+Y+YTGK + SP EVSTCVD  C H ACRPAI++AV+LMYAS+ FQI ELV L
Sbjct  122   EAFRILLHYLYTGKLRPSPMEVSTCVDNVCAHDACRPAINFAVELMYASSIFQIPELVSL  181

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
              QR L   V+ A +ED+I IL+V F C  + LV +CV RV  S+LD+ ++E ELP  ++ 
Sbjct  182   FQRRLLNFVEKALVEDIITILVVAFHCQCSQLVSQCVDRVARSDLDSISIEKELPYEVAE  241

Query  1190  DIKA--RRLNQQGAN---------EKKIRKILRALDCNDVELVKLLLEESDITLDDayav  1044
              I+   R+    G +         EK+IR+I +ALD +DVELVKLLL ESDITLDDA A+
Sbjct  242   SIRLLRRKSPPDGEDNEAVVDPLREKRIRRIHKALDSDDVELVKLLLTESDITLDDAAAL  301

Query  1043  hyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDA  864
             HYAAAYC+ KVV+EVLGL   D+NLRN+RGYTVLH+AA RK+P++I+++L K GAS  + 
Sbjct  302   HYAAAYCDPKVVSEVLGLRLADVNLRNSRGYTVLHIAAMRKEPSVIMSLLAK-GASASEL  360

Query  863   TCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVS---LPSST  693
             T  +G +AV IC+R TRPKDY+  TE+G+E N DR+CIDVLE   M  NP++     +S 
Sbjct  361   TV-DGRSAVNICQRLTRPKDYHAKTEQGKETNKDRICIDVLER-EMRRNPMAGDVSVTSH  418

Query  692   TLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVG  513
             TL +DL M L +LENRVA AR L+P EA++ M+IAHA++T EF GL   +G  GNL+ V 
Sbjct  419   TLADDLHMRLLYLENRVAFARLLFPSEAKLAMDIAHAETTSEFAGLCASKGSNGNLRQVD  478

Query  512   LTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQ  333
             L   P  Q KRL+ R EAL KTVE+GRR+F +CS+VLDK   DD+ D L  LE G+ EEQ
Sbjct  479   LNETPIMQKKRLLARMEALMKTVEMGRRYFPHCSEVLDKFMEDDLPD-LFYLEKGSSEEQ  537

Query  332   TNKKRRYMELKEEVMKAFDKDMAQ-NRVGL  246
               K+ R+ ELK++V KAF KD A+ NR GL
Sbjct  538   KIKRSRFRELKDDVQKAFSKDKAEFNRTGL  567



>gb|AAT57642.1| NIM1-like protein 1 [Helianthus annuus]
Length=591

 Score =   458 bits (1179),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 277/519 (53%), Positives = 358/519 (69%), Gaps = 24/519 (5%)
 Frame = -2

Query  1745  IDPGEYED--YNDADIEVEGILVGVNRGILAARSQFFHEEFkkak--kdcdgkpKFLMTE  1578
              D G   D  Y+DA++ VEGI VG++R ILA RS FF + FKK K   + D KPK+ M++
Sbjct  57    FDSGSESDCNYSDAEVVVEGISVGIHRCILATRSTFFSDLFKKNKGCVEKDSKPKYNMSD  116

Query  1577  LVPCGWVGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASAT  1398
             L+P G VGY+AF+VFL+YVYTGK KASPPEVSTCVD+ C H AC PAI++AV+L YAS+ 
Sbjct  117   LLPYGSVGYDAFLVFLSYVYTGKLKASPPEVSTCVDDGCLHDACWPAINFAVELTYASSV  176

Query  1397  FQIKELVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLE  1218
             FQ+ ELV L QR L   VD A +EDVIPIL+V F C L  ++ RC+ RV  S LD  ++E
Sbjct  177   FQVPELVSLFQRRLLNFVDKALVEDVIPILVVAFHCQLQNVLSRCIDRVVRSKLDTISIE  236

Query  1217  NELPGAISSDIKA-RRLNQQG----------ANEKKIRKILRALDCNDVELVKLLLEESD  1071
              ELP  ++  IK+   + Q+             EK+I+ I +ALDC+DVELVK++L+ES 
Sbjct  237   KELPFEVTQMIKSIDNIIQEDDEHTVESEVVLREKRIKSIHKALDCDDVELVKMILDESK  296

Query  1070  ITLDDayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILD  891
             ITLD+A A+HYA  YCN +V  E+L L + D+NLRN+R YTVLHVAA RK+P++IV+IL 
Sbjct  297   ITLDEACALHYAVMYCNQEVAKEILNLNRADVNLRNSRDYTVLHVAAMRKEPSLIVSILS  356

Query  890   KSGASIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNP-  714
             K GA   D T  +G +AV+ICRR TRPKDY   TE G+E N DR+CIDVLE   +  NP 
Sbjct  357   K-GACASDTTF-DGQSAVSICRRRTRPKDYYVKTEHGQETNKDRICIDVLER-EIKRNPM  413

Query  713   ---VSLPSSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGME  543
                VS+ SS  + +DL M L +LENRVA AR L+P EA++ MEIAHA +T ++ GL   +
Sbjct  414   IGDVSVCSS-AVADDLHMNLLYLENRVAFARLLFPSEAKLAMEIAHAQTTAQYPGLLASK  472

Query  542   GLCGNLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLE  363
             G  GNL+ + L   P  Q KRL+ R EAL +TVE+GRR+F +CS+VLDK   DD+ D L 
Sbjct  473   GSNGNLREMDLNETPLVQNKRLLSRMEALSRTVEMGRRYFPHCSEVLDKFMEDDLQD-LF  531

Query  362   SLESGTPEEQTNKKRRYMELKEEVMKAFDKDMAQNRVGL  246
              LE GT EEQ  K+ R+MELKE+V +AF KD A+   GL
Sbjct  532   ILEKGTEEEQEIKRTRFMELKEDVQRAFTKDKAELHRGL  570



>ref|XP_007024872.1| NPR1-like protein 4 [Theobroma cacao]
 gb|EOY27494.1| NPR1-like protein 4 [Theobroma cacao]
Length=587

 Score =   458 bits (1179),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 278/510 (55%), Positives = 361/510 (71%), Gaps = 21/510 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkd--cdgkpKFLMTELVPCGWVGY  1551
             D++DADI VE + VGV+R ILA RS+FF+E FKK       +GKP + M+EL+P G +G 
Sbjct  62    DFSDADIVVEDVPVGVHRCILAVRSKFFNELFKKGNGSCEKEGKPSYNMSELLPYGKIGL  121

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF + L+Y+YTGK + SP EVSTCVD  C H ACRPAI++AV+LMYAS+ FQI ELV L
Sbjct  122   EAFRILLHYLYTGKLRPSPMEVSTCVDNVCAHDACRPAINFAVELMYASSIFQIPELVSL  181

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
              QR L   V+ A +ED+I IL+V F C  + LV +CV RV  S+LD+ ++E ELP  ++ 
Sbjct  182   FQRRLLNFVEKALVEDIITILVVAFHCQCSQLVSQCVDRVARSDLDSISIEKELPYEVAE  241

Query  1190  DIKA--RRLNQQGAN---------EKKIRKILRALDCNDVELVKLLLEESDITLDDayav  1044
              I+   R+    G +         EK+IR+I +ALD +DVELVKLLL ESDITLDDA A+
Sbjct  242   SIRLLRRKSPPDGEDNEVVVDPLREKRIRRIHKALDSDDVELVKLLLTESDITLDDAAAL  301

Query  1043  hyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDA  864
             HYAAAYC+ KVV+EVLGL   D+NLRN+RGYTVLH+AA RK+P++I+++L K GAS  + 
Sbjct  302   HYAAAYCDPKVVSEVLGLRLADVNLRNSRGYTVLHIAAMRKEPSVIMSLLAK-GASASEL  360

Query  863   TCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVS---LPSST  693
             T  +G +AV IC+R TRPKDY+  TE+G+E N DR+CIDVLE   M  NP++     +S 
Sbjct  361   TV-DGRSAVNICQRLTRPKDYHAKTEQGKETNKDRICIDVLER-EMRRNPMAGDVSVTSH  418

Query  692   TLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVG  513
             TL +DL M L +LENRVA AR L+P EA++ M+IAHA++T EF GL   +G  GNL+ V 
Sbjct  419   TLADDLHMRLLYLENRVAFARLLFPSEAKLAMDIAHAETTSEFAGLCASKGSNGNLRQVD  478

Query  512   LTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQ  333
             L   P  Q KRL+ R EAL KTVE+GRR+F +CS+VLDK   DD+ D L  LE G+ EEQ
Sbjct  479   LNETPIMQKKRLLARMEALMKTVEMGRRYFPHCSEVLDKFMEDDLPD-LFYLEKGSSEEQ  537

Query  332   TNKKRRYMELKEEVMKAFDKDMAQ-NRVGL  246
               K+ R+ ELK++V KAF KD A+ NR GL
Sbjct  538   KIKRSRFRELKDDVQKAFSKDKAEFNRTGL  567



>ref|XP_010414712.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X5 
[Camelina sativa]
Length=353

 Score =   449 bits (1155),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 233/383 (61%), Positives = 277/383 (72%), Gaps = 40/383 (10%)
 Frame = +1

Query  2413  NGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGR  2592
             N G  TPSR E+LSMVKKHSK LG T ++E+D SDVEMD  FWH V D+YF+   ESR R
Sbjct  3     NDGEATPSRHEILSMVKKHSKSLGNTSLDEQDASDVEMDSNFWHGVFDVYFIRCMESRRR  62

Query  2593  QEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLI  2772
             Q+DDL+FFVRK+S + Y    N E  +PYFVRRW+PKLD+LLGE+   VDWR+S+YLN+I
Sbjct  63    QDDDLLFFVRKLSCKSYGLTENDEAPAPYFVRRWAPKLDELLGESLAEVDWRKSFYLNMI  122

Query  2773  AHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPA  2952
             AHT+F+VTVAICS+E LK YQ  KD  LSPIYKVVKTVYASPSR+NFHLDS+KEVETTPA
Sbjct  123   AHTSFTVTVAICSNEALKTYQGSKDTKLSPIYKVVKTVYASPSRVNFHLDSKKEVETTPA  182

Query  2953  YPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPS----DSSQSETSG--GKTQ  3114
             YP+ICFAVDDFDSTFDAVVLT+ DHCYCV+LN++DGAAFPS    DSS S T+      +
Sbjct  183   YPEICFAVDDFDSTFDAVVLTEKDHCYCVLLNSHDGAAFPSANDKDSSDSNTNTEPKSVK  242

Query  3115  SSKITIFSGFVSYQMVRDAYDAGRTgf-gsllslhssgKTDRIYMKGPGGRGEVEVAVSG  3291
               K+T+FSGFVSYQMVR+AY+ GR  F   L   H++GK DR+YM+GPGGRGEVEVAVSG
Sbjct  243   DPKVTLFSGFVSYQMVREAYEGGRNRFGSLLSLGHNTGKADRLYMRGPGGRGEVEVAVSG  302

Query  3292  VVDQSKEEYGHHPPKKGLsfsavvrraasvasvaakhayaaasatrssDEEMIPLKCCLM  3471
             V+ +                                     A+     ++EM PLKCCLM
Sbjct  303   VIAKHAIA---------------------------------AATASYDEDEMFPLKCCLM  329

Query  3472  SISLPWEHIAHDLLLKGSPPVNL  3540
             SISLPW+ IAHDLL K SPPVN+
Sbjct  330   SISLPWDTIAHDLLFKASPPVNM  352



>ref|XP_010093184.1| Regulatory protein [Morus notabilis]
 gb|EXB53672.1| Regulatory protein [Morus notabilis]
Length=598

 Score =   458 bits (1179),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 284/522 (54%), Positives = 371/522 (71%), Gaps = 29/522 (6%)
 Frame = -2

Query  1736  GEYEDYNDADIEVEGILVGVNRGILAARSQFFHEEFkkak--kdcdgkpKFLMTELVPCG  1563
              E+ DY DA+I VEG+ VGV+R ILA+RSQFFHE  +K       +GKP++LM++LVP G
Sbjct  59    AEFADYTDAEIVVEGVPVGVHRCILASRSQFFHELLRKGNPDSVKEGKPRYLMSDLVPYG  118

Query  1562  WVGYEAFMVFLNYVYTG--KTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQI  1389
              VG EAF V LNY+YTG  K KASPPE+STCVDE+C H AC PAI+YAV+LMYASATFQ+
Sbjct  119   KVGREAFDVVLNYLYTGTGKLKASPPEISTCVDENCAHDACPPAINYAVELMYASATFQM  178

Query  1388  KELVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENEL  1209
             KELV+L+QR L   V+ A  EDVIPIL+V + C L+ L+  C++R   SNLD+  LE  L
Sbjct  179   KELVLLVQRRLLNFVEKALAEDVIPILVVAYHCQLSHLLSHCIQRSAKSNLDDVALEKAL  238

Query  1208  PGAISSDIKA-RRLNQQGANE------------KKIRKILRALDCNDVELVKLLLEESDI  1068
             P  +S +IK  R+ +QQ  +E            K++ +I +ALD +DVELVKLLL ESDI
Sbjct  239   PYEVSKEIKLFRQKSQQEDDESNMMGETVQVQDKRVGRIHKALDSDDVELVKLLLNESDI  298

Query  1067  TLDDayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDK  888
             TLDDAYA+HY  AYC+ KVV EVLGL   ++NL+N+RG+TVLHVAARRK+P++IVA+LD+
Sbjct  299   TLDDAYALHYVVAYCDPKVVKEVLGLNLANINLQNSRGHTVLHVAARRKEPSVIVALLDR  358

Query  887   SGASIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVM----MNG  720
               +++   T  +G TAV ICRR TRPKDY++ T++G+E N DR+CIDVLE VM    ++G
Sbjct  359   GASAVE--TTIDGQTAVAICRRLTRPKDYHENTKQGQESNKDRICIDVLERVMRRNSISG  416

Query  719   NPVSLPSSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFV--GLSGM  546
             N +S+ ++  + +DL  +L + ENRVA AR L+P EAR+ ME+A A ST  ++  GLS  
Sbjct  417   N-ISM-ATELVADDLHAKLDYFENRVAFARLLFPAEARLAMEMADAHSTSMYIATGLSRS  474

Query  545   EGLCGNLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDV-LDS  369
              G  GNL+ V L   P  + KRL  R +AL KTVE GR++F +CS+VL+K   D++ +  
Sbjct  475   RGSNGNLREVDLNETPSVRTKRLQARLQALIKTVEKGRQYFPHCSEVLNKFLDDEIDMPD  534

Query  368   LESLESGTPEEQTNKKRRYMELKEEVMKAFDKDMAQ-NRVGL  246
                LE GT EEQ  KK R+MELKEEV KAF KDMA+ NR GL
Sbjct  535   AYVLEKGTTEEQLKKKMRFMELKEEVQKAFSKDMAENNRSGL  576



>ref|XP_010470226.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X1 
[Camelina sativa]
Length=389

 Score =   450 bits (1158),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 252/387 (65%), Positives = 301/387 (78%), Gaps = 12/387 (3%)
 Frame = +1

Query  2413  NGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGR  2592
             N G  TPSR E+LSMVKKHSK LG T ++E+D SDVEMD  FWH + D+YF+   ESR R
Sbjct  3     NDGEATPSRHEILSMVKKHSKSLGSTSLDEQDASDVEMDSNFWHGLFDVYFIRCMESRRR  62

Query  2593  QEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPK-LDDLLGENSVGVDWRRSYYLNL  2769
             Q+DDL+FFVRK+S + Y    N E  +PYFVRRW+PK L++LLGE+   VDWR+S+YLN+
Sbjct  63    QDDDLLFFVRKLSCKSYGLTENDEAPAPYFVRRWAPKQLNELLGESLAEVDWRKSFYLNM  122

Query  2770  IAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTP  2949
             IAHT+F+VTVAICS+E LK YQ  KD  LSPIYKVVKTVYASPSR+NFHLDS+KEVETTP
Sbjct  123   IAHTSFTVTVAICSNEALKTYQGSKDTKLSPIYKVVKTVYASPSRVNFHLDSKKEVETTP  182

Query  2950  AYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDS------SQSETSGGKT  3111
             AYP+ICFAVDDFDSTFDAVVLT+ DHCYCV+LN++DGAAFPS +      S S T     
Sbjct  183   AYPEICFAVDDFDSTFDAVVLTEKDHCYCVLLNSHDGAAFPSANNKDSSDSNSNTEPKSV  242

Query  3112  QSSKITIFSGFVSYQMVRDAYDAGRTgf-gsllslhssgKTDRIYMKGPGGRGEVEVAVS  3288
             +  K+T+FSGFVSYQMVR+AY+ GR  F   L   H++GK DR+YM+GPGGRGEVEVAVS
Sbjct  243   KDPKVTLFSGFVSYQMVREAYEGGRNRFGSLLSLGHNTGKADRLYMRGPGGRGEVEVAVS  302

Query  3289  GVVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrssDEEMIPLK  3459
             GV+DQS+   G   P   KK +   ++ R+AASVASVAAKHA AAA+A+   D EM PLK
Sbjct  303   GVIDQSQVVVGPVSPMSSKKSIDLGSIFRKAASVASVAAKHAIAAATASYDED-EMFPLK  361

Query  3460  CCLMSISLPWEHIAHDLLLKGSPPVNL  3540
             CCLMSISLPW+ IAHDLL K  PPVN+
Sbjct  362   CCLMSISLPWDTIAHDLLFKAFPPVNM  388



>gb|KFK40880.1| hypothetical protein AALP_AA2G054300 [Arabis alpina]
Length=387

 Score =   449 bits (1156),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 252/389 (65%), Positives = 303/389 (78%), Gaps = 18/389 (5%)
 Frame = +1

Query  2413  NGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGR  2592
             N G +TPSR E+LSMVKKHSK LG    +E++ SDVEMD  FWH V D+YF+ G ESR R
Sbjct  3     NNGEETPSRHEILSMVKKHSKSLG----DEQNASDVEMDSNFWHGVFDVYFIRGMESRKR  58

Query  2593  QEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLI  2772
             Q+DDL+FFVRK+S + Y    N E  +PYFVRRW+PKLD+LLGE+   VDWR+S+YLN+I
Sbjct  59    QDDDLLFFVRKLSCKSYGLTENDEAPAPYFVRRWAPKLDELLGESLAEVDWRKSFYLNMI  118

Query  2773  AHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPA  2952
             AHT+F+VTVAICS+E LK YQ  K+  LSPIYKVVKTVYASPSR+NFHLDS+KEVETTPA
Sbjct  119   AHTSFTVTVAICSNEALKKYQGSKETTLSPIYKVVKTVYASPSRVNFHLDSKKEVETTPA  178

Query  2953  YPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDSSQSETSGGK--------  3108
             YP+ICFAVDDFDSTFDAVVLT+ DHCYCV+LN++DGAAFPS + + +             
Sbjct  179   YPEICFAVDDFDSTFDAVVLTEKDHCYCVLLNSHDGAAFPSVNGKIDKDSNDSNASSDSK  238

Query  3109  -TQSSKITIFSGFVSYQMVRDAYDAGRTgf-gsllslhssgKTDRIYMKGPGGRGEVEVA  3282
               +  K+T+FSGFVSYQMVR+AY+ GR  F   L  +H++GK DR+YMKGPGGRGEVEVA
Sbjct  239   CVKDPKVTLFSGFVSYQMVREAYEGGRNRFGSLLSLVHNTGKADRLYMKGPGGRGEVEVA  298

Query  3283  VSGVVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrssDEEMIP  3453
             VSGV+DQS+   G   P   KK +   ++ R+AASVASVAAKHA AAA+A+   D EM P
Sbjct  299   VSGVIDQSQVVLGPVSPMSSKKSIDLGSIFRKAASVASVAAKHAIAAATASYDED-EMFP  357

Query  3454  LKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
             LKCCLMSISLPW+ IAHDLL KGSPPVN+
Sbjct  358   LKCCLMSISLPWDTIAHDLLFKGSPPVNM  386



>emb|CDP17620.1| unnamed protein product [Coffea canephora]
Length=588

 Score =   457 bits (1175),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 266/510 (52%), Positives = 353/510 (69%), Gaps = 21/510 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg--kpKFLMTELVPCGWVGY  1551
             DY+DA+IEVE I +G++R I+AARS+FFH+ F+K K       KPK+ M EL+P G V Y
Sbjct  63    DYSDAEIEVEAISIGIHRCIVAARSKFFHDLFRKEKGYGSKDDKPKYTMEELLPYGKVRY  122

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF++FL Y+YTGK K  P E STCVD  C H ACRPAID+AV+LMYAS+ FQI ELV L
Sbjct  123   EAFLIFLGYLYTGKLKPFPVEASTCVDGMCAHDACRPAIDFAVELMYASSIFQIPELVSL  182

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
              QR L   +  A +EDVIPIL+  + C    L+ +C+ RV+ S++++ +LE E+P  I+ 
Sbjct  183   FQRRLLNFIGKAFVEDVIPILVAAYYCQSNQLLSQCIDRVSRSDIESISLEKEIPCEIAE  242

Query  1190  DIKARRLNQQGA-----------NEKKIRKILRALDCNDVELVKLLLEESDITLDDayav  1044
             +IK+ RL                +EK+IR+I +ALD +D+ELV+LLL ESD+TLD+AYA+
Sbjct  243   NIKSCRLKSDAGEKDNVVLVDHLHEKRIRRIHKALDSDDIELVRLLLTESDVTLDEAYAL  302

Query  1043  hyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDA  864
             HYA AYC+ K+V+E+LGL   D+NL+NARGY+VLH+AA RK+P+IIV++L K GA + + 
Sbjct  303   HYAVAYCDPKIVSELLGLSLADVNLQNARGYSVLHIAAMRKEPSIIVSLLTK-GACVSET  361

Query  863   TCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVSLP---SST  693
             T  +G TAV+ICRR TRPKDY+       E + D++CIDVLE  M+  NPV+     SS 
Sbjct  362   TL-DGRTAVSICRRLTRPKDYHAKINLERESSKDKICIDVLEREMLR-NPVAGDASFSSL  419

Query  692   TLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVG  513
              L +DL M L +LENRVA AR  +P EA++ MEIA+A++T  F GL    G  GNL+ V 
Sbjct  420   ILTDDLQMRLLYLENRVAFARLFFPAEAKLAMEIANAETTSGFAGLLASRGSSGNLREVD  479

Query  512   LTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQ  333
             L   P  Q KRL+ R + L KTVELGRR+F +CS VLDK   DD+ D L  LE G+ +EQ
Sbjct  480   LNETPLVQNKRLLSRIDVLSKTVELGRRYFPHCSQVLDKFMEDDLPD-LFYLEKGSVDEQ  538

Query  332   TNKKRRYMELKEEVMKAFDKDMAQ-NRVGL  246
               KK+R++ELK EV KAF KD A+ +R GL
Sbjct  539   KAKKQRFVELKGEVQKAFSKDKAELHRCGL  568



>ref|XP_010511047.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X5 
[Camelina sativa]
Length=353

 Score =   448 bits (1152),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 232/383 (61%), Positives = 277/383 (72%), Gaps = 40/383 (10%)
 Frame = +1

Query  2413  NGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGR  2592
             N G  TPSR E+LSMVKKHSK LG T ++E+D SDVEMD  FWH V D+YF+   ESR R
Sbjct  3     NDGEATPSRHEILSMVKKHSKSLGNTSLDEQDASDVEMDSNFWHGVFDVYFIRCMESRRR  62

Query  2593  QEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLI  2772
             Q+DDL+FFVRK+S + Y    N +  +PYFVRRW+PKLD+LLGE+   VDWR+S+YLN+I
Sbjct  63    QDDDLLFFVRKLSCKSYGLTENDDAPAPYFVRRWAPKLDELLGESLAEVDWRKSFYLNMI  122

Query  2773  AHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPA  2952
             AHT+F+VTVAICS+E LK YQ  KD  LSPIYKVVKTVYASPSR+NFHLDS+KEVETTPA
Sbjct  123   AHTSFTVTVAICSNEALKTYQGSKDTKLSPIYKVVKTVYASPSRVNFHLDSKKEVETTPA  182

Query  2953  YPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPS----DSSQSETSG--GKTQ  3114
             YP+ICFAVDDFDSTFDAVVL + DHCYCV+LN++DGAAFPS    DSS+S T+      +
Sbjct  183   YPEICFAVDDFDSTFDAVVLNEKDHCYCVLLNSHDGAAFPSENVKDSSESSTNTEPRSVK  242

Query  3115  SSKITIFSGFVSYQMVRDAYDAGRTgf-gsllslhssgKTDRIYMKGPGGRGEVEVAVSG  3291
               K+T+FSGFVSYQMVR+AY+ GR  F   L   H++GK DR+YM+GPGGRGEVEVAVSG
Sbjct  243   DPKVTLFSGFVSYQMVREAYEGGRNRFGSLLSLGHNTGKADRLYMRGPGGRGEVEVAVSG  302

Query  3292  VVDQSKEEYGHHPPKKGLsfsavvrraasvasvaakhayaaasatrssDEEMIPLKCCLM  3471
             V+ +                                     A+     ++EM PLKCCLM
Sbjct  303   VIAKHAIA---------------------------------AATASYDEDEMFPLKCCLM  329

Query  3472  SISLPWEHIAHDLLLKGSPPVNL  3540
             SISLPWE IAHDLL K SPPVN+
Sbjct  330   SISLPWETIAHDLLFKASPPVNM  352



>ref|XP_008229582.1| PREDICTED: regulatory protein NPR3-like [Prunus mume]
Length=589

 Score =   456 bits (1173),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 281/510 (55%), Positives = 359/510 (70%), Gaps = 23/510 (5%)
 Frame = -2

Query  1733  EYEDYNDADIEVEGILVGVNRGILAARSQFFHEEFkkak--kdcdgkpKFLMTELVPCGW  1560
             EY DYNDA+I VEG  VGVNR ILAARSQFF + FK+       +GKPK+LM++LVP G 
Sbjct  61    EY-DYNDAEIIVEGNTVGVNRCILAARSQFFQDLFKQGNDDSIKEGKPKYLMSDLVPNGR  119

Query  1559  VGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKEL  1380
             VGYEAF V LNY+YTGK + SP EVSTCVD+ C H AC PAI+YAV+LMYASATFQ+KEL
Sbjct  120   VGYEAFKVILNYLYTGKLQPSPREVSTCVDDHCAHDACGPAINYAVELMYASATFQMKEL  179

Query  1379  VMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGA  1200
             V L+QR L   V+ A IEDVIPIL+V F C L+ L+  C++ V  S+LD+  +E ELP  
Sbjct  180   VQLVQRRLSNFVEKAFIEDVIPILVVAFHCQLSQLLSHCIQWVARSDLDSVAIEKELPHE  239

Query  1199  ISSDIKARRLNQQGANE-----------KKIRKILRALDCNDVELVKLLLEESDITLDDa  1053
             +S+ IK+  L  Q  +E           K+IR+I +ALD +DVELV+LLL+ESDITLDDA
Sbjct  240   VSNVIKSLHLKSQEKDESSMMEMEPVEDKRIRRIHKALDSDDVELVELLLKESDITLDDA  299

Query  1052  yavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASI  873
             YA+HYA AYC+ KVV EVLGLG   +NL NARG+TVLHVAARRK+PA++V +L++ GAS 
Sbjct  300   YALHYAVAYCDPKVVKEVLGLGLATINLCNARGHTVLHVAARRKNPAVMVPLLNR-GASA  358

Query  872   RDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVM----MNGNPVSL  705
              + T ++G TAV ICRR TRPKD+ + T +G+E N DR+CID+LE  M    M+GN +S+
Sbjct  359   SETT-ADGQTAVAICRRLTRPKDFYENTMQGQESNKDRMCIDLLEREMRRNSMSGN-LSI  416

Query  704   PSSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNL  525
               S  + +DL + L +LENR  +   L      + ME+A A ST    GLS   G  GNL
Sbjct  417   -RSEVIADDLNVRLDYLENR-DIYFELCILILELAMEMADAHSTSVPTGLSASRGSSGNL  474

Query  524   KGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGT  345
             + V L   P  + KRL  R +AL+KTVE+GRRFF +CS+VLDK   D++  +   LE GT
Sbjct  475   REVDLNETPSGRTKRLQARMQALRKTVEMGRRFFPHCSEVLDKFLDDEMDMADFILEKGT  534

Query  344   PEEQTNKKRRYMELKEEVMKAFDKDMAQNR  255
             PEEQ  KK R++ELK++V KAF KDMA+N+
Sbjct  535   PEEQRKKKTRFLELKDDVQKAFCKDMAENK  564



>ref|XP_008342333.1| PREDICTED: regulatory protein NPR3-like [Malus domestica]
Length=585

 Score =   455 bits (1171),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 278/504 (55%), Positives = 351/504 (70%), Gaps = 17/504 (3%)
 Frame = -2

Query  1733  EYEDYNDADIEVEGILVGVNRGILAARSQFFHEEFkkak--kdcdgkpKFLMTELVPCGW  1560
             EY DY+DA+I VE   VGVNR ILA+RSQFF   F+K       +GKP++LM+ELVP G 
Sbjct  63    EY-DYSDAEIVVEXBTVGVNRCILASRSQFFQXLFRKGSDDAKXEGKPRYLMSELVPNGR  121

Query  1559  VGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKEL  1380
             VG EAF VFL Y+YTGK   S  EVSTCVD+ C H AC PAI YAV+LMYAS+TFQ+KEL
Sbjct  122   VGXEAFKVFLXYLYTGKLNPSXGEVSTCVDDRCPHDACGPAISYAVELMYASSTFQMKEL  181

Query  1379  VMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGA  1200
             V L+QRHL   V+ A +EDVIPIL+  F C L  L+  C++RV  S+LDN  +E ELP  
Sbjct  182   VQLVQRHLSNFVEKALVEDVIPILVAAFHCQLDQLLSHCIQRVARSDLDNVAIEKELPHE  241

Query  1199  ISSDIKARRLNQQ---GANEKKIRKILRALDCNDVELVKLLLEESDITLDDayavhyaaa  1029
             +S+DIK  RL  Q      +K+IR I +ALD +DVELV LLL+ESDITLD+AYA+HYA A
Sbjct  242   VSNDIKLIRLKHQEMEPVEDKRIRSIHKALDSDDVELVGLLLKESDITLDEAYALHYAVA  301

Query  1028  YCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDATCSNG  849
             YC+ KVV EVLGLGK + NLRN+RG+TVLHVAARRK P+++V +L K GAS  + T  +G
Sbjct  302   YCDPKVVKEVLGLGKANPNLRNSRGHTVLHVAARRKLPSVLVPLL-KWGASASETTL-DG  359

Query  848   HTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVM----MNGNPVSLPSSTTLEN  681
              T V ICRR TRPKD+ + T+ G+E N DR+CI +LE  M    ++GN   +  S  + +
Sbjct  360   QTPVAICRRLTRPKDFLENTQTGQESNKDRMCIGLLEREMQRNSISGNMSII--SEEIAD  417

Query  680   DLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVGLTGL  501
             DL + L +LE+RVA AR L+P E ++  E+A   ST  + GL+   G  GNL+ V L   
Sbjct  418   DLHVRLDYLEDRVAFARLLFPAETKLAKEMADTHSTSVYSGLTASRGSSGNLREVDLNET  477

Query  500   PPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLES-LESGTPEEQTNK  324
             P  + KRL  R +AL  TVE+GRRFF NCS+VLDK   DD LD  +  LE GTPEEQ  K
Sbjct  478   PSGRTKRLQTRMQALLNTVEMGRRFFPNCSEVLDKFL-DDELDMADFILEKGTPEEQRIK  536

Query  323   KRRYMELKEEVMKAFDKDMA-QNR  255
             + R++ELKE+V +AF KD+A QNR
Sbjct  537   RTRFLELKEDVQQAFYKDVAEQNR  560



>emb|CDY45883.1| BnaC01g28190D [Brassica napus]
Length=398

 Score =   448 bits (1152),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 256/396 (65%), Positives = 305/396 (77%), Gaps = 21/396 (5%)
 Frame = +1

Query  2413  NGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGR  2592
             N   +T +R E+LSMVKKHSK LGKT ++E++ SDVEMD  FWH V D+YFV   ESR R
Sbjct  3     NDREETLTRHEILSMVKKHSKSLGKTSLDEQEASDVEMDSNFWHGVFDVYFVRCMESRRR  62

Query  2593  QEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLI  2772
             Q+DDL+FFVRK+S + Y    N +  +PYFVRRW+PKLD+LLGE+   VDWR+S+YLN++
Sbjct  63    QDDDLLFFVRKLSCKSYALTENEDAPAPYFVRRWAPKLDELLGESLAEVDWRKSFYLNMV  122

Query  2773  AHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRK-------  2931
             AHT+F+VTVAICS+E LK YQ  KD  LSPIYKVVKTVYASPSR+NFHLDS+K       
Sbjct  123   AHTSFTVTVAICSNEALKKYQGSKDTTLSPIYKVVKTVYASPSRVNFHLDSKKASIVVFL  182

Query  2932  EVETTPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPS-------DSSQS  3090
             EVETTPAYP+ICFAVDDFDSTFDAVVLT+ DHCYCV+LN++DGAAFPS       DSS S
Sbjct  183   EVETTPAYPEICFAVDDFDSTFDAVVLTEKDHCYCVLLNSHDGAAFPSADVKTDKDSSGS  242

Query  3091  ETSGG--KTQSSKITIFSGFVSYQMVRDAYDAGRTgf-gsllslhssgKTDRIYMKGPGG  3261
              T+    + +  K+T+FSGFVSYQMVR+AY+ GR  F   L   H SGK DR+YMKGPGG
Sbjct  243   NTNTDPRRVKDPKVTLFSGFVSYQMVREAYEGGRNRFGSLLSLGHHSGKADRLYMKGPGG  302

Query  3262  RGEVEVAVSGVVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrs  3432
             RGEVEVAVSGV+DQS+   G   P   KK +   ++ R+AASVASVAAKHA AAA+A+  
Sbjct  303   RGEVEVAVSGVIDQSQVVLGPVSPMSSKKSIDLGSIFRKAASVASVAAKHAIAAATASYD  362

Query  3433  sDEEMIPLKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
              D EM PLKCCLMSISLPW+ IAHDLL KGSPPVN+
Sbjct  363   ED-EMFPLKCCLMSISLPWDTIAHDLLFKGSPPVNM  397



>ref|XP_006437091.1| hypothetical protein CICLE_v10031020mg [Citrus clementina]
 gb|ESR50331.1| hypothetical protein CICLE_v10031020mg [Citrus clementina]
Length=595

 Score =   455 bits (1170),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 293/520 (56%), Positives = 360/520 (69%), Gaps = 29/520 (6%)
 Frame = -2

Query  1736  GEYEDYNDADIEVEGILVGVNRGILAARSQFFHEEFkka-----kkdcdgkpKFLMTELV  1572
              EY DY DA+I VEG  V ++R IL+ARSQFFHE FKK          +GKPK+LMTELV
Sbjct  61    AEY-DYTDAEIVVEGKSVALHRCILSARSQFFHELFKKGNNNDGSAVSEGKPKYLMTELV  119

Query  1571  PCGWVGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQ  1392
             P G VGYEA  V L Y YTGK K SP EVSTCVD++C H AC PAI+YA++LMYASA FQ
Sbjct  120   PYGKVGYEALNVILYYFYTGKLKPSPSEVSTCVDDACAHDACPPAINYAIELMYASAAFQ  179

Query  1391  IKELVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENE  1212
             +KELV+L QR L   V+ A +EDVIPIL+  F C L  L   CV+RV  SNLD+  LE E
Sbjct  180   MKELVLLFQRRLLNFVEKALVEDVIPILVAAFHCQLNQLRSHCVQRVVRSNLDDVCLEKE  239

Query  1211  LPGAISSDIKARRLNQQGANE-----------KKIRKILRALDCNDVELVKLLLEESDIT  1065
             LP  +S +IK+ R+      E           K++R+I +ALD +DVEL+KLLL+ES++T
Sbjct  240   LPDEVSGEIKSLRVKSDEECEANIAEVDPMHAKRVRRIHKALDSDDVELLKLLLDESNVT  299

Query  1064  LDDayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKS  885
             LDDAYA+HYAAAYCN KV  EVL +G  DLNL+NARG+TVLHVAARRK+PA++V +L K 
Sbjct  300   LDDAYALHYAAAYCNPKVFKEVLNMGLADLNLKNARGHTVLHVAARRKEPAVLVTLLSKG  359

Query  884   GASIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVM----MNGN  717
               +    T S+G TAV ICRR TR KDY + T++G+E N DRLCIDVLE  M    M+GN
Sbjct  360   ACA--SETTSDGQTAVAICRRMTRRKDYIEATKQGQETNKDRLCIDVLEREMRRNSMSGN  417

Query  716   PVSLPSSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGL--SGME  543
              ++L SS  + +D  M+L +LENRVA AR L+P EAR+ M IA AD+T  + GL  S  +
Sbjct  418   -LAL-SSEVMADDFQMKLNYLENRVAFARLLFPSEARVAMHIADADATNFYTGLSASKSK  475

Query  542   GLCGNLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLE  363
             G  GNLK V L   P  Q KRL  R +AL KTVE GRR+F +CSDV+DK    D  D+  
Sbjct  476   GSSGNLKEVDLNETPSMQAKRLQLRLQALLKTVETGRRYFPHCSDVVDKFLDCDWSDA-S  534

Query  362   SLESGTPEEQTNKKRRYMELKEEVMKAFDKDMAQ-NRVGL  246
              LE+GTPEEQ  K+ R+MELKE+V KAF KDMA+ NR GL
Sbjct  535   LLENGTPEEQRLKRARFMELKEDVQKAFYKDMAEKNRSGL  574



>gb|KHG00475.1| Regulatory NPR3 -like protein [Gossypium arboreum]
Length=587

 Score =   454 bits (1168),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 273/509 (54%), Positives = 354/509 (70%), Gaps = 21/509 (4%)
 Frame = -2

Query  1721  YNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg--kpKFLMTELVPCGWVGYE  1548
             ++DADI VEG+ VGV+R ILA RS+FF+E FK+     +   KP + M+EL+P G +G E
Sbjct  63    FSDADIVVEGVAVGVHRCILAVRSKFFNEVFKEGSGSSEKDGKPSYNMSELLPYGKIGLE  122

Query  1547  AFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVMLI  1368
             AF VFL+Y+YTGK K SP EVSTCVD  C H ACRPAI +AV+ MYAS+ FQI ELV L 
Sbjct  123   AFQVFLSYLYTGKLKPSPMEVSTCVDNVCAHDACRPAISFAVESMYASSIFQILELVPLF  182

Query  1367  QRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISSD  1188
             QR L   V+ A +ED++PIL+V F C  + LV +CV RV  S+LD+  +E ELP  ++  
Sbjct  183   QRRLLNFVEKALLEDIMPILVVAFHCQCSQLVSQCVDRVARSDLDSICIEKELPYEVTES  242

Query  1187  IKARRLNQQG-----------ANEKKIRKILRALDCNDVELVKLLLEESDITLDDayavh  1041
             I+  R                  EK+IR+I +ALD +DVELVKLLL ESDITLDDA A+H
Sbjct  243   IRLLRCKSPSDGEGNEAVVDPLREKRIRRIHKALDSDDVELVKLLLTESDITLDDATALH  302

Query  1040  yaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDAT  861
             YAAAYC+ KVV+EVLGL   D+NLRN+RGYTVLH+AA RK+P++I+A+L K GAS    T
Sbjct  303   YAAAYCDPKVVSEVLGLRLADVNLRNSRGYTVLHIAAMRKEPSVIMALLAK-GASASTLT  361

Query  860   CSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVS---LPSSTT  690
               +G +AV ICRR TRPKDY+  TE+G+E N DR+CID+LE   M  NP++     +S  
Sbjct  362   L-DGQSAVNICRRLTRPKDYHAKTEQGKETNKDRICIDILER-EMRRNPMAGDVSVASHA  419

Query  689   LENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVGL  510
             L +DL M L +LENRVALAR L+P EA++ ++IAHA++T E       +G  GNL+ V L
Sbjct  420   LSDDLHMRLLYLENRVALARLLFPSEAKLAIDIAHAETTSELATGFPSKGSNGNLRQVDL  479

Query  509   TGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQT  330
                P  Q +RL+ R +AL KTVE+GRR+F +CS+VLDK   DD+ D L  LE+GTPEEQ 
Sbjct  480   NETPIMQKQRLLARMQALMKTVEMGRRYFPHCSEVLDKFMEDDLPD-LSYLETGTPEEQK  538

Query  329   NKKRRYMELKEEVMKAFDKDMAQ-NRVGL  246
              ++ R+ ELKE+V +AF KD A+ NR GL
Sbjct  539   IERSRFRELKEDVQRAFKKDKAEFNRNGL  567



>ref|XP_008806697.1| PREDICTED: regulatory protein NPR3-like [Phoenix dactylifera]
 ref|XP_008806698.1| PREDICTED: regulatory protein NPR3-like [Phoenix dactylifera]
 ref|XP_008806699.1| PREDICTED: regulatory protein NPR3-like [Phoenix dactylifera]
Length=591

 Score =   454 bits (1167),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 273/504 (54%), Positives = 351/504 (70%), Gaps = 20/504 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkk--akkdcdgkpKFLMTELVPCGWVGY  1551
             D +DA+I VEG  VGV+R ILAARS+FFH+ F     ++   GKP++ M+ELVPCG VG 
Sbjct  66    DCSDAEIVVEGAPVGVHRCILAARSRFFHDLFSGCGGRRQEGGKPRYEMSELVPCGRVGR  125

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAFM FL+Y+YTGK K +PPEVS CVD  C H ACRPAI++ V+L+YAS+ FQI ELV L
Sbjct  126   EAFMNFLSYLYTGKLKPAPPEVSVCVDPMCAHDACRPAINFVVELLYASSVFQISELVSL  185

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
             +QR L   V+ A +EDVIPIL V     L  L   C++RV  S+LD  +LE ELP  ++ 
Sbjct  186   LQRRLLNFVEKALVEDVIPILRVALHSQLNQLRSHCIKRVARSDLDKISLEKELPHEVAE  245

Query  1190  DIKARRLNQQ----------GANEKKIRKILRALDCNDVELVKLLLEESDITLDDayavh  1041
             +IK+ R   Q            +EK+ R+ILRALD +DVELVKLLL ESDITLDDA A+H
Sbjct  246   EIKSIRCKAQPDEPNSLTVDPVHEKRTRRILRALDSDDVELVKLLLSESDITLDDANALH  305

Query  1040  yaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDAT  861
             YAAAYC+SKVV E+L LG  ++NL+N RGYT LHVAA R +PAIIV++L K GAS+ + T
Sbjct  306   YAAAYCDSKVVAELLELGSANVNLKNVRGYTPLHVAAMRMEPAIIVSLLTK-GASVSETT  364

Query  860   CSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVSLPSSTT---  690
              ++G +AV ICRR TR KDYN  T++G+E N DR+CID+LE   M  NP+++  S T   
Sbjct  365   -ADGQSAVMICRRLTRAKDYNAKTQQGQESNKDRICIDILER-EMRRNPMAVEDSVTSPL  422

Query  689   LENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVGL  510
             L +DL M+L +LENRVA AR  +P EA++ MEIA A++T EF GL        NL+ V L
Sbjct  423   LADDLPMKLLYLENRVAFARLFFPAEAKVAMEIAQAETTSEFTGLLTSRS-SSNLREVDL  481

Query  509   TGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQT  330
                P  Q KRL  R +AL KTV+LGRR+F +CS VLDK   +D+ D L  L+ GTP+EQ 
Sbjct  482   NETPTMQNKRLRSRVDALMKTVDLGRRYFPHCSLVLDKFLQEDLPD-LFYLQKGTPDEQQ  540

Query  329   NKKRRYMELKEEVMKAFDKDMAQN  258
              K+ R+ ELKE+V KAF+KD A++
Sbjct  541   IKRMRFCELKEDVRKAFNKDKAES  564



>ref|XP_010414711.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X4 
[Camelina sativa]
Length=354

 Score =   445 bits (1144),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 233/384 (61%), Positives = 277/384 (72%), Gaps = 41/384 (11%)
 Frame = +1

Query  2413  NGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGR  2592
             N G  TPSR E+LSMVKKHSK LG T ++E+D SDVEMD  FWH V D+YF+   ESR R
Sbjct  3     NDGEATPSRHEILSMVKKHSKSLGNTSLDEQDASDVEMDSNFWHGVFDVYFIRCMESRRR  62

Query  2593  QEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPK-LDDLLGENSVGVDWRRSYYLNL  2769
             Q+DDL+FFVRK+S + Y    N E  +PYFVRRW+PK LD+LLGE+   VDWR+S+YLN+
Sbjct  63    QDDDLLFFVRKLSCKSYGLTENDEAPAPYFVRRWAPKQLDELLGESLAEVDWRKSFYLNM  122

Query  2770  IAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTP  2949
             IAHT+F+VTVAICS+E LK YQ  KD  LSPIYKVVKTVYASPSR+NFHLDS+KEVETTP
Sbjct  123   IAHTSFTVTVAICSNEALKTYQGSKDTKLSPIYKVVKTVYASPSRVNFHLDSKKEVETTP  182

Query  2950  AYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPS----DSSQSETSG--GKT  3111
             AYP+ICFAVDDFDSTFDAVVLT+ DHCYCV+LN++DGAAFPS    DSS S T+      
Sbjct  183   AYPEICFAVDDFDSTFDAVVLTEKDHCYCVLLNSHDGAAFPSANDKDSSDSNTNTEPKSV  242

Query  3112  QSSKITIFSGFVSYQMVRDAYDAGRTgf-gsllslhssgKTDRIYMKGPGGRGEVEVAVS  3288
             +  K+T+FSGFVSYQMVR+AY+ GR  F   L   H++GK DR+YM+GPGGRGEVEVAVS
Sbjct  243   KDPKVTLFSGFVSYQMVREAYEGGRNRFGSLLSLGHNTGKADRLYMRGPGGRGEVEVAVS  302

Query  3289  GVVDQSKEEYGHHPPKKGLsfsavvrraasvasvaakhayaaasatrssDEEMIPLKCCL  3468
             GV+ +                                     A+     ++EM PLKCCL
Sbjct  303   GVIAKHAIA---------------------------------AATASYDEDEMFPLKCCL  329

Query  3469  MSISLPWEHIAHDLLLKGSPPVNL  3540
             MSISLPW+ IAHDLL K SPPVN+
Sbjct  330   MSISLPWDTIAHDLLFKASPPVNM  353



>ref|XP_004293735.1| PREDICTED: regulatory protein NPR3-like isoform 2 [Fragaria vesca 
subsp. vesca]
Length=559

 Score =   452 bits (1163),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 277/513 (54%), Positives = 355/513 (69%), Gaps = 24/513 (5%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg-----kpKFLMTELVPCGW  1560
             DY+DA+I VEG  VGV+R ILA+RS+FF E FKK K   +      KPK+ M +L+P G 
Sbjct  31    DYSDAEIIVEGDPVGVHRCILASRSKFFCELFKKEKGYSEKEGKLGKPKYKMKDLLPYGD  90

Query  1559  VGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKEL  1380
             VGYEAF+V+LNYVYTGK K SP EVSTCV   C H +CRPAI++AV+LMYAS+ FQ+ +L
Sbjct  91    VGYEAFLVYLNYVYTGKLKPSPIEVSTCVHNVCAHDSCRPAINFAVELMYASSIFQMPDL  150

Query  1379  VMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGA  1200
             V + QR L   V  A  EDVIPIL+VGF C L+ LV   + RV  S+LD+  ++ ELP  
Sbjct  151   VSVFQRRLLNFVGKAMAEDVIPILVVGFHCHLSELVTHSIERVARSDLDSICIDKELPYE  210

Query  1199  ISSDIKARRLNQQGAN-----------EKKIRKILRALDCNDVELVKLLLEESDITLDDa  1053
             ++  IK  R + Q A+           EK+IR I +ALD +DVELVKLLL ES+ITLD+A
Sbjct  211   VAEKIKLLRRDSQHASELSTPPVDPLREKRIRSIHKALDSDDVELVKLLLSESNITLDEA  270

Query  1052  yavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASI  873
             +A+HYAAAYC+ KVV EVLGLG  D+NLRN RGYTVLH+A  R++P+IIV +L K GA  
Sbjct  271   HALHYAAAYCDPKVVTEVLGLGMADVNLRNPRGYTVLHIAVMRREPSIIVLLLSK-GARA  329

Query  872   RDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPV---SLP  702
              + T S+G +AV+ICRR TR KDY+  T +G+E N DR+CIDVLE   M  NP+   +  
Sbjct  330   SELT-SDGQSAVSICRRLTRAKDYHSKTVQGQETNKDRICIDVLER-EMRKNPMAGDASV  387

Query  701   SSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLK  522
             SS T+ +DL M+L +LENRVA AR  +P EA++ M +A +D+T EF G+S  +G  GNL 
Sbjct  388   SSQTIADDLHMKLLYLENRVAFARLFFPSEAKLAMVVAQSDTTSEFAGISPSKGSSGNLM  447

Query  521   GVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTP  342
              V L   P  Q KRL  R E+L KTV +GR +F +CS+VLDK   DD+ D L  LE+GTP
Sbjct  448   EVDLNETPTVQKKRLHSRLESLMKTVNMGRCYFPHCSEVLDKFMEDDLPD-LFFLETGTP  506

Query  341   EEQTNKKRRYMELKEEVMKAFDKDMAQ-NRVGL  246
             +EQ  K+ R+MELK+EV KAF KD A+ N  GL
Sbjct  507   DEQKIKRMRFMELKDEVQKAFSKDKAELNLSGL  539



>ref|XP_007141442.1| hypothetical protein PHAVU_008G195900g [Phaseolus vulgaris]
 gb|ESW13436.1| hypothetical protein PHAVU_008G195900g [Phaseolus vulgaris]
Length=588

 Score =   453 bits (1165),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 276/508 (54%), Positives = 352/508 (69%), Gaps = 20/508 (4%)
 Frame = -2

Query  1736  GEYEDYNDADIEVEGILVGVNRGILAARSQFFHEEFkkak--kdcdgkpKFLMTELVPCG  1563
              EY DY+DA+I VE I VGV+R ILA+RS FFHE FKK       +GKP++LM+ELVP G
Sbjct  58    AEY-DYSDAEIVVEDISVGVHRCILASRSPFFHELFKKGTDGSGKEGKPRYLMSELVPYG  116

Query  1562  WVGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKE  1383
              VGYEAF VFL Y+YTG+ K SP EV+TCV E+C H ACRPAIDYA++LMYASA F +KE
Sbjct  117   AVGYEAFQVFLYYLYTGRLKDSPTEVTTCVGETCIHDACRPAIDYALELMYASAAFLMKE  176

Query  1382  LVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPG  1203
             LV+L QR L   VD A +EDVIPIL+  F C L  L+ RC+ +V SS+ D+ +LE ELP 
Sbjct  177   LVLLFQRQLLNFVDKALVEDVIPILMAAFNCQLEQLLSRCIHKVASSDFDSISLEKELPH  236

Query  1202  AISSDIKARRLNQQGA-----------NEKKIRKILRALDCNDVELVKLLLEESDITLDD  1056
              + ++IK+ RL+ Q             +EK I +I +ALD +DVEL+KLLL ES +TLDD
Sbjct  237   EVVTEIKSCRLSFQPESAADAMEVEPLSEKSIMRIHKALDSDDVELLKLLLNESRVTLDD  296

Query  1055  ayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGAS  876
             AYA+HYA AY +SKV+ E+LGLG  D+  RN+RGYTVLHVAARRKDP+I+VA+L+K GA 
Sbjct  297   AYALHYACAYSDSKVIQELLGLGMADILRRNSRGYTVLHVAARRKDPSILVALLNK-GAC  355

Query  875   IRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVSLPSS  696
               D T  +G TA++IC+R TR KDY++ T + +E N DRLC+DVLE  M   +     S 
Sbjct  356   ATDTT-PDGQTALSICQRLTRRKDYHEKTVKCKESNKDRLCVDVLEREMRRSSMTVSMSV  414

Query  695   TT--LENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLK  522
             ++    +DL + L +LENRV  AR LYP EA++ +E A ADS+      S +EG  GNLK
Sbjct  415   SSQLTADDLHIRLDYLENRVTFARLLYPAEAKVAIENAEADSSSLHANASALEGANGNLK  474

Query  521   GVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTP  342
              V L   P  + ++L  R  AL KTVE GRRFF +CS+VLDK   DD+ D    LE G+ 
Sbjct  475   -VDLNESPSARTRKLQLRLHALMKTVENGRRFFPHCSEVLDKFLEDDMPDVF-FLEKGSE  532

Query  341   EEQTNKKRRYMELKEEVMKAFDKDMAQN  258
             EEQ  KK R+MELK++V KAF KDMA+N
Sbjct  533   EEQRMKKARFMELKDDVQKAFHKDMAEN  560



>ref|XP_010470230.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X5 
[Camelina sativa]
Length=353

 Score =   444 bits (1142),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 228/383 (60%), Positives = 274/383 (72%), Gaps = 40/383 (10%)
 Frame = +1

Query  2413  NGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGR  2592
             N G  TPSR E+LSMVKKHSK LG T ++E+D SDVEMD  FWH + D+YF+   ESR R
Sbjct  3     NDGEATPSRHEILSMVKKHSKSLGSTSLDEQDASDVEMDSNFWHGLFDVYFIRCMESRRR  62

Query  2593  QEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLI  2772
             Q+DDL+FFVRK+S + Y    N E  +PYFVRRW+PKL++LLGE+   VDWR+S+YLN+I
Sbjct  63    QDDDLLFFVRKLSCKSYGLTENDEAPAPYFVRRWAPKLNELLGESLAEVDWRKSFYLNMI  122

Query  2773  AHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPA  2952
             AHT+F+VTVAICS+E LK YQ  KD  LSPIYKVVKTVYASPSR+NFHLDS+KEVETTPA
Sbjct  123   AHTSFTVTVAICSNEALKTYQGSKDTKLSPIYKVVKTVYASPSRVNFHLDSKKEVETTPA  182

Query  2953  YPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDS------SQSETSGGKTQ  3114
             YP+ICFAVDDFDSTFDAVVLT+ DHCYCV+LN++DGAAFPS +      S S T     +
Sbjct  183   YPEICFAVDDFDSTFDAVVLTEKDHCYCVLLNSHDGAAFPSANNKDSSDSNSNTEPKSVK  242

Query  3115  SSKITIFSGFVSYQMVRDAYDAGRTgf-gsllslhssgKTDRIYMKGPGGRGEVEVAVSG  3291
               K+T+FSGFVSYQMVR+AY+ GR  F   L   H++GK DR+YM+GPGGRGEVEVAVSG
Sbjct  243   DPKVTLFSGFVSYQMVREAYEGGRNRFGSLLSLGHNTGKADRLYMRGPGGRGEVEVAVSG  302

Query  3292  VVDQSKEEYGHHPPKKGLsfsavvrraasvasvaakhayaaasatrssDEEMIPLKCCLM  3471
             V+ +                                     A+     ++EM PLKCCLM
Sbjct  303   VIAKHAIA---------------------------------AATASYDEDEMFPLKCCLM  329

Query  3472  SISLPWEHIAHDLLLKGSPPVNL  3540
             SISLPW+ IAHDLL K  PPVN+
Sbjct  330   SISLPWDTIAHDLLFKAFPPVNM  352



>emb|CDY44552.1| BnaA01g21870D [Brassica napus]
Length=398

 Score =   446 bits (1146),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 256/396 (65%), Positives = 304/396 (77%), Gaps = 21/396 (5%)
 Frame = +1

Query  2413  NGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGR  2592
             N   +T +R E+LSMVKKHSK LGKT ++E++ SDVEMD  FWH V D+YFV   ESR R
Sbjct  3     NDREETLTRHEILSMVKKHSKSLGKTSLDEQEASDVEMDSNFWHGVFDVYFVRCMESRRR  62

Query  2593  QEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLI  2772
             Q+DDL+FFVRK+S + Y    N +  +PYFVRRW+PKLD LLGE+   VDWR+S+YLN++
Sbjct  63    QDDDLLFFVRKLSCKSYGLTDNEDAPAPYFVRRWAPKLDVLLGESLAEVDWRKSFYLNMV  122

Query  2773  AHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRK-------  2931
             AHT+F+VTVAICS+E LK YQ  KD  LSPIYKVVKTVYASPSR+NFHLDS+K       
Sbjct  123   AHTSFTVTVAICSNEALKKYQGSKDTTLSPIYKVVKTVYASPSRVNFHLDSKKASIVVFL  182

Query  2932  EVETTPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPS-------DSSQS  3090
             EVETTPAYP+ICFAVDDFDSTFDAVVLT+ DHCYCV+LN++DGAAFPS       DSS S
Sbjct  183   EVETTPAYPEICFAVDDFDSTFDAVVLTEKDHCYCVLLNSHDGAAFPSADVKTDKDSSGS  242

Query  3091  ETSGG--KTQSSKITIFSGFVSYQMVRDAYDAGRTgf-gsllslhssgKTDRIYMKGPGG  3261
              T+    + +  K+T+FSGFVSYQMVR+AY+ GR  F   L   H SGK DR+YMKGPGG
Sbjct  243   NTNTDPRRVKDPKVTLFSGFVSYQMVREAYEGGRNRFGSLLSLGHHSGKADRLYMKGPGG  302

Query  3262  RGEVEVAVSGVVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrs  3432
             RGEVEVAVSGV+DQS+   G   P   KK +   ++ R+AASVASVAAKHA AAA+A+  
Sbjct  303   RGEVEVAVSGVIDQSQVVLGPVSPMSSKKSIDLGSIFRKAASVASVAAKHAIAAATASYD  362

Query  3433  sDEEMIPLKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
              D EM PLKCCLMSISLPW+ IAHDLL KGSPPVN+
Sbjct  363   ED-EMFPLKCCLMSISLPWDTIAHDLLFKGSPPVNM  397



>ref|XP_010511045.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X3 
[Camelina sativa]
Length=384

 Score =   445 bits (1145),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 252/387 (65%), Positives = 299/387 (77%), Gaps = 17/387 (4%)
 Frame = +1

Query  2413  NGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGR  2592
             N G  TPSR E+LSMVKKHSK LG T ++E+D SDVEMD  FWH V D+YF+   ESR R
Sbjct  3     NDGEATPSRHEILSMVKKHSKSLGNTSLDEQDASDVEMDSNFWHGVFDVYFIRCMESRRR  62

Query  2593  QEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPK-LDDLLGENSVGVDWRRSYYLNL  2769
             Q+DDL+FFVRK+S + Y    N +  +PYFVRRW+PK LD+LLGE+   VDWR+S+YLN+
Sbjct  63    QDDDLLFFVRKLSCKSYGLTENDDAPAPYFVRRWAPKQLDELLGESLAEVDWRKSFYLNM  122

Query  2770  IAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTP  2949
             IAHT+F+VTVAICS+E LK YQ  KD  LSPIYKVVKTVYASPSR+NFHLDS+KEVETTP
Sbjct  123   IAHTSFTVTVAICSNEALKTYQGSKDTKLSPIYKVVKTVYASPSRVNFHLDSKKEVETTP  182

Query  2950  AYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPS----DSSQSETSG--GKT  3111
             AYP+ICFAVDDFDSTFDAVVL + DHCYCV+LN++DGAAFPS    DSS+S T+      
Sbjct  183   AYPEICFAVDDFDSTFDAVVLNEKDHCYCVLLNSHDGAAFPSENVKDSSESSTNTEPRSV  242

Query  3112  QSSKITIFSGFVSYQMVRDAYDAGRTgf-gsllslhssgKTDRIYMKGPGGRGEVEVAVS  3288
             +  K+T+FSGFVSYQMVR+AY+ GR  F   L   H++GK DR+YM+GPGGRGEVEVAVS
Sbjct  243   KDPKVTLFSGFVSYQMVREAYEGGRNRFGSLLSLGHNTGKADRLYMRGPGGRGEVEVAVS  302

Query  3289  GVVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrssDEEMIPLK  3459
             GV+       G   P   KK +   ++ R+AA VASVAAKHA AAA+A+   D EM PLK
Sbjct  303   GVI-----VVGPVSPMSSKKSIDLGSIFRKAAYVASVAAKHAIAAATASYDED-EMFPLK  356

Query  3460  CCLMSISLPWEHIAHDLLLKGSPPVNL  3540
             CCLMSISLPWE IAHDLL K SPPVN+
Sbjct  357   CCLMSISLPWETIAHDLLFKASPPVNM  383



>ref|XP_010414710.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X3 
[Camelina sativa]
Length=384

 Score =   445 bits (1144),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 254/387 (66%), Positives = 300/387 (78%), Gaps = 17/387 (4%)
 Frame = +1

Query  2413  NGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGR  2592
             N G  TPSR E+LSMVKKHSK LG T ++E+D SDVEMD  FWH V D+YF+   ESR R
Sbjct  3     NDGEATPSRHEILSMVKKHSKSLGNTSLDEQDASDVEMDSNFWHGVFDVYFIRCMESRRR  62

Query  2593  QEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPK-LDDLLGENSVGVDWRRSYYLNL  2769
             Q+DDL+FFVRK+S + Y    N E  +PYFVRRW+PK LD+LLGE+   VDWR+S+YLN+
Sbjct  63    QDDDLLFFVRKLSCKSYGLTENDEAPAPYFVRRWAPKQLDELLGESLAEVDWRKSFYLNM  122

Query  2770  IAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTP  2949
             IAHT+F+VTVAICS+E LK YQ  KD  LSPIYKVVKTVYASPSR+NFHLDS+KEVETTP
Sbjct  123   IAHTSFTVTVAICSNEALKTYQGSKDTKLSPIYKVVKTVYASPSRVNFHLDSKKEVETTP  182

Query  2950  AYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPS----DSSQSETSG--GKT  3111
             AYP+ICFAVDDFDSTFDAVVLT+ DHCYCV+LN++DGAAFPS    DSS S T+      
Sbjct  183   AYPEICFAVDDFDSTFDAVVLTEKDHCYCVLLNSHDGAAFPSANDKDSSDSNTNTEPKSV  242

Query  3112  QSSKITIFSGFVSYQMVRDAYDAGRTgf-gsllslhssgKTDRIYMKGPGGRGEVEVAVS  3288
             +  K+T+FSGFVSYQMVR+AY+ GR  F   L   H++GK DR+YM+GPGGRGEVEVAVS
Sbjct  243   KDPKVTLFSGFVSYQMVREAYEGGRNRFGSLLSLGHNTGKADRLYMRGPGGRGEVEVAVS  302

Query  3289  GVVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrssDEEMIPLK  3459
             GV+       G   P   KK +   ++ R+AASVASVAAKHA AAA+A+   D EM PLK
Sbjct  303   GVI-----VVGPVSPMSSKKSIDLGSIFRKAASVASVAAKHAIAAATASYDED-EMFPLK  356

Query  3460  CCLMSISLPWEHIAHDLLLKGSPPVNL  3540
             CCLMSISLPW+ IAHDLL K SPPVN+
Sbjct  357   CCLMSISLPWDTIAHDLLFKASPPVNM  383



>ref|NP_001289241.1| uncharacterized protein LOC103945128 [Pyrus x bretschneideri]
 gb|ACN87218.1| NPR-1 [Pyrus x bretschneideri]
Length=586

 Score =   452 bits (1163),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 280/511 (55%), Positives = 354/511 (69%), Gaps = 23/511 (5%)
 Frame = -2

Query  1745  IDPGEYEDYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdgk--pKFLMTELV  1572
             IDPG   DY+DADI VEGI VGV+R ILA+RS FF E FK+ K     +  PK+ M++ +
Sbjct  56    IDPGC--DYSDADIVVEGIPVGVHRCILASRSGFFRELFKRDKGSSGKEDRPKYCMSDFL  113

Query  1571  PCGWVGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQ  1392
             P G VGYEAF+VFL+YVYTGK K SP EVSTCV   C H ACRPAI++ V+LMYA++ FQ
Sbjct  114   PYGDVGYEAFLVFLSYVYTGKLKPSPVEVSTCVHNVCAHDACRPAINFVVELMYAASIFQ  173

Query  1391  IKELVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENE  1212
             + +LV + +R L   V  A  ++VIPIL+V F C L  L+++C+ RV  S++D+ +LE  
Sbjct  174   MPDLVSIFERRLLNFVGKALSDNVIPILVVAFHCQLNQLIDQCIDRVARSDIDDISLEKG  233

Query  1211  LPGAISSDIKARRLNQQGAN-----------EKKIRKILRALDCNDVELVKLLLEESDIT  1065
             LP  +   IK  R N Q  +           EK+IR+I +ALD +DVELVKLLL ES+IT
Sbjct  234   LPDEVVKKIKILRRNYQQDSDPNLPPADPLLEKRIRRIHKALDSDDVELVKLLLTESNIT  293

Query  1064  LDDayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKS  885
             LD+A A+HYAAAYC+ KVV EVL LG  D+NLRNARGYTVLH+A  RK+P+IIV +L K 
Sbjct  294   LDEANALHYAAAYCDPKVVTEVLALGLADVNLRNARGYTVLHIAVMRKEPSIIVLLLTK-  352

Query  884   GASIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPV--  711
             GA   + T S+G +AV+ICRR TRPKDY+  TE+G+E N DR+CIDVLE   M  NP+  
Sbjct  353   GARASELT-SDGQSAVSICRRLTRPKDYHSKTEQGQEANKDRICIDVLER-EMRRNPMAG  410

Query  710   -SLPSSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLC  534
              +  SS  + +DL MEL  LENRVALAR  +P EA++ M IAHA+++ EF   S  +G  
Sbjct  411   DASISSQIMPDDLHMELLNLENRVALARLFFPAEAKLAMVIAHAETS-EFAAPSSSKGSS  469

Query  533   GNLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLE  354
             GNL  V L   P  Q KRL  R EAL KTV LGR +F +CS+VLDK  ADD+ D L  LE
Sbjct  470   GNLMEVDLNETPTVQNKRLHSRLEALMKTVRLGRCYFPHCSEVLDKFIADDLPD-LFYLE  528

Query  353   SGTPEEQTNKKRRYMELKEEVMKAFDKDMAQ  261
              G+ +EQ  K+RR+MELKEEV KAFDKD A+
Sbjct  529   PGSSDEQKVKRRRFMELKEEVQKAFDKDKAE  559



>ref|XP_010511046.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X4 
[Camelina sativa]
Length=354

 Score =   443 bits (1140),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 232/384 (60%), Positives = 277/384 (72%), Gaps = 41/384 (11%)
 Frame = +1

Query  2413  NGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGR  2592
             N G  TPSR E+LSMVKKHSK LG T ++E+D SDVEMD  FWH V D+YF+   ESR R
Sbjct  3     NDGEATPSRHEILSMVKKHSKSLGNTSLDEQDASDVEMDSNFWHGVFDVYFIRCMESRRR  62

Query  2593  QEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPK-LDDLLGENSVGVDWRRSYYLNL  2769
             Q+DDL+FFVRK+S + Y    N +  +PYFVRRW+PK LD+LLGE+   VDWR+S+YLN+
Sbjct  63    QDDDLLFFVRKLSCKSYGLTENDDAPAPYFVRRWAPKQLDELLGESLAEVDWRKSFYLNM  122

Query  2770  IAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTP  2949
             IAHT+F+VTVAICS+E LK YQ  KD  LSPIYKVVKTVYASPSR+NFHLDS+KEVETTP
Sbjct  123   IAHTSFTVTVAICSNEALKTYQGSKDTKLSPIYKVVKTVYASPSRVNFHLDSKKEVETTP  182

Query  2950  AYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPS----DSSQSETSG--GKT  3111
             AYP+ICFAVDDFDSTFDAVVL + DHCYCV+LN++DGAAFPS    DSS+S T+      
Sbjct  183   AYPEICFAVDDFDSTFDAVVLNEKDHCYCVLLNSHDGAAFPSENVKDSSESSTNTEPRSV  242

Query  3112  QSSKITIFSGFVSYQMVRDAYDAGRTgf-gsllslhssgKTDRIYMKGPGGRGEVEVAVS  3288
             +  K+T+FSGFVSYQMVR+AY+ GR  F   L   H++GK DR+YM+GPGGRGEVEVAVS
Sbjct  243   KDPKVTLFSGFVSYQMVREAYEGGRNRFGSLLSLGHNTGKADRLYMRGPGGRGEVEVAVS  302

Query  3289  GVVDQSKEEYGHHPPKKGLsfsavvrraasvasvaakhayaaasatrssDEEMIPLKCCL  3468
             GV+ +                                     A+     ++EM PLKCCL
Sbjct  303   GVIAKHAIA---------------------------------AATASYDEDEMFPLKCCL  329

Query  3469  MSISLPWEHIAHDLLLKGSPPVNL  3540
             MSISLPWE IAHDLL K SPPVN+
Sbjct  330   MSISLPWETIAHDLLFKASPPVNM  353



>ref|XP_004293734.1| PREDICTED: regulatory protein NPR3-like isoform 1 [Fragaria vesca 
subsp. vesca]
Length=587

 Score =   452 bits (1163),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 277/513 (54%), Positives = 355/513 (69%), Gaps = 24/513 (5%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg-----kpKFLMTELVPCGW  1560
             DY+DA+I VEG  VGV+R ILA+RS+FF E FKK K   +      KPK+ M +L+P G 
Sbjct  59    DYSDAEIIVEGDPVGVHRCILASRSKFFCELFKKEKGYSEKEGKLGKPKYKMKDLLPYGD  118

Query  1559  VGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKEL  1380
             VGYEAF+V+LNYVYTGK K SP EVSTCV   C H +CRPAI++AV+LMYAS+ FQ+ +L
Sbjct  119   VGYEAFLVYLNYVYTGKLKPSPIEVSTCVHNVCAHDSCRPAINFAVELMYASSIFQMPDL  178

Query  1379  VMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGA  1200
             V + QR L   V  A  EDVIPIL+VGF C L+ LV   + RV  S+LD+  ++ ELP  
Sbjct  179   VSVFQRRLLNFVGKAMAEDVIPILVVGFHCHLSELVTHSIERVARSDLDSICIDKELPYE  238

Query  1199  ISSDIKARRLNQQGAN-----------EKKIRKILRALDCNDVELVKLLLEESDITLDDa  1053
             ++  IK  R + Q A+           EK+IR I +ALD +DVELVKLLL ES+ITLD+A
Sbjct  239   VAEKIKLLRRDSQHASELSTPPVDPLREKRIRSIHKALDSDDVELVKLLLSESNITLDEA  298

Query  1052  yavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASI  873
             +A+HYAAAYC+ KVV EVLGLG  D+NLRN RGYTVLH+A  R++P+IIV +L K GA  
Sbjct  299   HALHYAAAYCDPKVVTEVLGLGMADVNLRNPRGYTVLHIAVMRREPSIIVLLLSK-GARA  357

Query  872   RDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPV---SLP  702
              + T S+G +AV+ICRR TR KDY+  T +G+E N DR+CIDVLE   M  NP+   +  
Sbjct  358   SELT-SDGQSAVSICRRLTRAKDYHSKTVQGQETNKDRICIDVLER-EMRKNPMAGDASV  415

Query  701   SSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLK  522
             SS T+ +DL M+L +LENRVA AR  +P EA++ M +A +D+T EF G+S  +G  GNL 
Sbjct  416   SSQTIADDLHMKLLYLENRVAFARLFFPSEAKLAMVVAQSDTTSEFAGISPSKGSSGNLM  475

Query  521   GVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTP  342
              V L   P  Q KRL  R E+L KTV +GR +F +CS+VLDK   DD+ D L  LE+GTP
Sbjct  476   EVDLNETPTVQKKRLHSRLESLMKTVNMGRCYFPHCSEVLDKFMEDDLPD-LFFLETGTP  534

Query  341   EEQTNKKRRYMELKEEVMKAFDKDMAQ-NRVGL  246
             +EQ  K+ R+MELK+EV KAF KD A+ N  GL
Sbjct  535   DEQKIKRMRFMELKDEVQKAFSKDKAELNLSGL  567



>emb|CAN67078.1| hypothetical protein VITISV_004499 [Vitis vinifera]
Length=628

 Score =   453 bits (1165),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 287/552 (52%), Positives = 366/552 (66%), Gaps = 64/552 (12%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg--kpKFLMTELVPCGWVGY  1551
             DY+DA+I VEGI VGV+R ILAARS+FF++ FK+ K   +   KP++ M++ +P G VGY
Sbjct  62    DYSDAEIIVEGIPVGVHRCILAARSRFFYDLFKREKSSSEKDGKPRYCMSDFLPYGKVGY  121

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF++FL+Y+YTGK KASP EVSTCVD  C H ACRPAID++V+LMYASA FQ+ ELV L
Sbjct  122   EAFLIFLSYLYTGKLKASPLEVSTCVDTGCAHDACRPAIDFSVELMYASAIFQVPELVSL  181

Query  1370  IQRHL----------------------DWL------------VDI-------AAIEDVIP  1314
              Q  L                      +W+            VD        A +EDVIP
Sbjct  182   FQVTLWEVLRSGDLQPIDGMGKGKVRVEWMLLCKRCVCRLDEVDKNSYLTFHALLEDVIP  241

Query  1313  ILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISSDIKARRLNQQG--------  1158
             IL+V + C  + LV +CV RV  S+LD+ +LE +LP  +   IK  RL  Q         
Sbjct  242   ILVVAYHCKSSVLVNQCVBRVXRSBLDSISLEKDLPYEVXESIKLLRLKSQPDDECNTVP  301

Query  1157  ---ANEKKIRKILRALDCNDVELVKLLLEESDITLDDayavhyaaaYCNSKVVNEVLGLG  987
                 +EK++R+IL+ALD +DVELVKLLL ES ITLD+AYA+HYAAAYC+ KVV+EVL LG
Sbjct  302   VDPVHEKRVRRILKALDSDDVELVKLLLSESGITLDEAYALHYAAAYCDPKVVSEVLSLG  361

Query  986   KVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDATCSNGHTAVTICRRSTRPK  807
               D+N  N RGYTVLHVAA RK+P+IIV++L K GA   + T S+G +AV+ICRR TRPK
Sbjct  362   LADVNRHNPRGYTVLHVAAMRKEPSIIVSLLTK-GAHASERT-SDGQSAVSICRRLTRPK  419

Query  806   DYnktteegeeknNDRLCIDVLEGVMMNGNP----VSLPSSTTLENDLVMELYFLENRVA  639
             DY+   E+G+E N DR+CIDVLE   M  NP    VS+ SS T+ +DL M+L +LENRVA
Sbjct  420   DYHAKMEQGQETNKDRICIDVLER-EMRRNPLAGDVSI-SSPTMADDLHMKLLYLENRVA  477

Query  638   LARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVGLTGLPPDQVKRLMERREA  459
              AR  +P EA++ MEIAHA++T EF GLS  +   GNL+ V L   P  Q +RL  R  A
Sbjct  478   FARLFFPSEAKLAMEIAHAETTSEFAGLSASKRSSGNLREVDLNETPIMQNQRLRSRMNA  537

Query  458   LKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQTNKKRRYMELKEEVMKAF  279
             L KTVE+GRR+F +CS VLDK   DD+ D L  LE GT +EQ  K+ R+MELKE+V +AF
Sbjct  538   LVKTVEMGRRYFPHCSQVLDKFMEDDLPD-LFYLEKGTLDEQRIKRTRFMELKEDVQRAF  596

Query  278   DKDMAQ-NRVGL  246
              KD A+ NR GL
Sbjct  597   TKDKAEFNRSGL  608



>ref|XP_008225738.1| PREDICTED: regulatory protein NPR3-like [Prunus mume]
Length=591

 Score =   451 bits (1161),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 275/497 (55%), Positives = 347/497 (70%), Gaps = 20/497 (4%)
 Frame = -2

Query  1706  IEVEGILVGVNRGILAARSQFFHEEFkka--kkdcdgkpKFLMTELVPCGWVGYEAFMVF  1533
             I VEG  VGV R ILA+RS FF E FK+A    + +GKPK+ M++L+P G VGYEAF+VF
Sbjct  71    IIVEGKSVGVYRCILASRSSFFGELFKRANGSSENEGKPKYCMSDLLPYGNVGYEAFLVF  130

Query  1532  LNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVMLIQRHLD  1353
             L+YVYTGK K  P EVSTC    C H AC PAI++AV+LMYAS+ FQ+ +LV ++QR L 
Sbjct  131   LSYVYTGKLKPFPMEVSTCAHSVCAHDACGPAINFAVELMYASSVFQMPDLVSILQRRLI  190

Query  1352  WLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISSDIKARR  1173
               V  A  + VIPIL+VGF C L+ L+++C+ RV  S+LD+ +LE ELP  +   IK  R
Sbjct  191   NFVGKALADHVIPILVVGFHCKLSQLIDQCIERVARSDLDSISLEKELPDEVVEKIKIIR  250

Query  1172  LNQQG-----------ANEKKIRKILRALDCNDVELVKLLLEESDITLDDayavhyaaaY  1026
              N Q              EK+IR+I +ALD +DVELVKLLL ESDITLD+A A+HYAAAY
Sbjct  251   HNSQQDCDPNIAAVDPLREKRIRRIHKALDSDDVELVKLLLSESDITLDEANALHYAAAY  310

Query  1025  CNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDATCSNGH  846
             C+ KVV EV+GLG VD+NLRN+RGYTVLH+A  RK+P+IIV +L K GA + + T  +G 
Sbjct  311   CDPKVVTEVIGLGLVDVNLRNSRGYTVLHIAVMRKEPSIIVLLLTK-GARVSELTL-DGE  368

Query  845   TAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVSLP---SSTTLENDL  675
             +AV+ICRR TR KDY+  TE GEE N DR+CIDVLE  M   NP+++    SS  + +DL
Sbjct  369   SAVSICRRLTRAKDYHSKTERGEEANKDRICIDVLEREMQR-NPMAVDASISSQIMPDDL  427

Query  674   VMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVGLTGLPP  495
              M+L  LENRVA AR L+P EA++ M IAHA++T +F GLS ++G  GNL  V L   P 
Sbjct  428   HMQLLNLENRVAFARLLFPTEAKVAMAIAHAETTSQFSGLSSLKGSTGNLMDVDLNETPT  487

Query  494   DQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQTNKKRR  315
              Q KRL  R EAL KTV  GR +F +CS+VLDK   DD+ D L  LE+GTP+EQ  K+ R
Sbjct  488   VQNKRLRSRLEALMKTVSTGRSYFPHCSEVLDKFIKDDLPD-LFFLETGTPDEQKIKRTR  546

Query  314   YMELKEEVMKAFDKDMA  264
             +MELKEEV KAF KD A
Sbjct  547   FMELKEEVQKAFSKDKA  563



>ref|XP_010999904.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X2 
[Populus euphratica]
Length=369

 Score =   442 bits (1138),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 252/396 (64%), Positives = 306/396 (77%), Gaps = 44/396 (11%)
 Frame = +1

Query  2404  LLGNGGGQTPSRFELLSMVKKHSKFLGKTIVE--EEDPSDVEMDPQFWHEVLDLYFVCGK  2577
             +LG+GG +TPSRFELLSMVKKHSK LGKT VE  EED +DVEMD +FWH+VLDLYF+ GK
Sbjct  1     MLGDGG-ETPSRFELLSMVKKHSKLLGKTTVEDEEEDAADVEMDSRFWHDVLDLYFIRGK  59

Query  2578  ESRGRQEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSY  2757
             ESR +Q+DDL+FFVRK S QGY  N + E  +PYFVRRW+PK+D+L+ E+S  VDWRRS+
Sbjct  60    ESRRKQDDDLVFFVRKRSTQGYGFNDSVESAAPYFVRRWAPKMDNLVSESSAEVDWRRSF  119

Query  2758  YLNLIAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEV  2937
             YLNLIAHT+++VTVAICS +VL+N+Q G+D  LSPIYKVVKTVYASPSR+ FHLDS+K  
Sbjct  120   YLNLIAHTSYTVTVAICSQQVLRNHQAGQDTQLSPIYKVVKTVYASPSRVYFHLDSKK--  177

Query  2938  ETTPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSD------------S  3081
                                    VLT+ DHCYCV+LNA+DGAAFPSD            S
Sbjct  178   -----------------------VLTERDHCYCVLLNAHDGAAFPSDKELHDGSSSSNFS  214

Query  3082  SQSETSGGKTQSSKITIFSGFVSYQMVRDAYDAGRTgfgsllslhssgKTDRIYMKGPGG  3261
              +++TS GK ++SK+T+FSGFVSYQMVR+AYDAG++     L   S GKTDR+YMKGPGG
Sbjct  215   QKNDTSSGKEKNSKLTLFSGFVSYQMVREAYDAGKS-RFGSLLGQSPGKTDRLYMKGPGG  273

Query  3262  RGEVEVAVSGVVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrs  3432
             RGEVEVAVSGV DQS+++ G   P   KKG    +V R+AASVASVAAKHA+AAAS++ S
Sbjct  274   RGEVEVAVSGVADQSQQDVGPFSPVTSKKGFGIGSVFRKAASVASVAAKHAFAAASSSIS  333

Query  3433  sDEEMIPLKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
             SD+EM+PLKCCLMSISLPWE+IA+DLL KGSPPVN+
Sbjct  334   SDDEMLPLKCCLMSISLPWEYIAYDLLFKGSPPVNM  369



>ref|XP_009759447.1| PREDICTED: uncharacterized protein LOC104211982 isoform X2 [Nicotiana 
sylvestris]
Length=435

 Score =   445 bits (1144),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 272/389 (70%), Positives = 307/389 (79%), Gaps = 28/389 (7%)
 Frame = +1

Query  2425  QTPSR------------FELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFV  2568
             QTPSR             ELLSMVKKHS+ LGKT V+EED SDVE+DP+FWH+V+DLYF+
Sbjct  7     QTPSRNLCDTYKVAGNWSELLSMVKKHSEMLGKTTVDEEDASDVEVDPRFWHDVMDLYFI  66

Query  2569  CGKESRGRQEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWR  2748
             CGKESRGRQEDDL+FFV+++     ESN   +D+SPYFVRRW+PKLDDL+G NS  VDWR
Sbjct  67    CGKESRGRQEDDLVFFVKRIR---NESNEYVDDDSPYFVRRWAPKLDDLIGGNSSDVDWR  123

Query  2749  RSYYLNLIAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSR  2928
             RS+YLNLI+ T+FSVTV I SH VL +YQ GKD PLSPIYKVVKTVYASPSRI  HLDSR
Sbjct  124   RSFYLNLISQTSFSVTVTIYSHRVLMSYQNGKDGPLSPIYKVVKTVYASPSRIKIHLDSR  183

Query  2929  KEVETTPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDSSQSE-----  3093
             KEVETTPAYP+ICFA+DDFDSTF AVVLTDVDHCYCV+LNA+DGAAFPS+ +  E     
Sbjct  184   KEVETTPAYPEICFAIDDFDSTFGAVVLTDVDHCYCVLLNAHDGAAFPSERALRESSSCD  243

Query  3094  -------TSGGKTQSSKITIFSGFVSYQMVRDAYDAGRTgfgsllslhssgKTDRIYMKG  3252
                    TS GK + S  +  S  + +  +      GR+G GSLLSL+SSGKTDRIYMKG
Sbjct  244   TSSSKSDTSSGKVRRSLSSQASLAMKWSEMHTMVKNGRSGLGSLLSLNSSGKTDRIYMKG  303

Query  3253  PGGRGEVEVAVSGVVDQSKEEYGHHPPKKGLsfsavvrraasvasvaakhayaaasatrs  3432
             PGGRGEVEVAVSGVVDQSK+E GHH   KGLSF  VVRRAASVAS+AAKHAYAAASATR 
Sbjct  304   PGGRGEVEVAVSGVVDQSKQESGHH-STKGLSFGVVVRRAASVASMAAKHAYAAASATRC  362

Query  3433  sDEEMIPLKCCLMSISLPWEHIAHDLLLK  3519
              D  +IPLKCCLMSISLPWEHIAHDLL K
Sbjct  363   PDGGLIPLKCCLMSISLPWEHIAHDLLFK  391



>gb|ABK62792.1| NPR-1 [Pyrus pyrifolia]
Length=586

 Score =   450 bits (1158),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 279/511 (55%), Positives = 353/511 (69%), Gaps = 23/511 (5%)
 Frame = -2

Query  1745  IDPGEYEDYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdgk--pKFLMTELV  1572
             IDPG   DY+DADI VEGI VGV+R ILA+RS FF E FK+ K     +  PK+ M++ +
Sbjct  56    IDPGC--DYSDADIVVEGIPVGVHRCILASRSGFFRELFKRDKGSSGKEDRPKYCMSDFL  113

Query  1571  PCGWVGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQ  1392
             P G VGYEAF+VFL+YVYTGK K SP EVSTCV   C H ACRPAI++ V+LMYA++ FQ
Sbjct  114   PYGDVGYEAFLVFLSYVYTGKLKPSPVEVSTCVHNVCAHDACRPAINFVVELMYAASIFQ  173

Query  1391  IKELVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENE  1212
             + +LV + +R L   V  A  ++VIPIL+V F C L  L+++C+ RV  S++D+ +LE  
Sbjct  174   MPDLVSIFERRLLNFVGKALSDNVIPILVVAFHCQLNQLIDQCIDRVARSDIDDISLEKG  233

Query  1211  LPGAISSDIKARRLNQQGAN-----------EKKIRKILRALDCNDVELVKLLLEESDIT  1065
             LP  +   IK  R N Q  +           EK+IR+I +ALD +DVELVKLLL ES+IT
Sbjct  234   LPDEVVKKIKILRRNYQQDSDPNLPPADPLLEKRIRRIHKALDSDDVELVKLLLTESNIT  293

Query  1064  LDDayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKS  885
             LD+A A+HYAAAYC+ KVV EVL LG  D+NLRNARGYTVLH+A  RK+P+IIV +L K 
Sbjct  294   LDEANALHYAAAYCDPKVVTEVLALGLADVNLRNARGYTVLHIAVMRKEPSIIVLLLTK-  352

Query  884   GASIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPV--  711
             GA   + T S+G +AV+ICRR TRPKDY+  TE+G+E N DR+CIDVLE   M  NP+  
Sbjct  353   GARASELT-SDGQSAVSICRRLTRPKDYHSKTEQGQEANKDRICIDVLER-EMRRNPMAG  410

Query  710   -SLPSSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLC  534
              +  SS  + +DL MEL  LENRVALAR  +P EA++ M IAHA+++ EF   S  +G  
Sbjct  411   DASISSQIMPDDLHMELLNLENRVALARLFFPAEAKLAMVIAHAETS-EFAAPSSSKGSS  469

Query  533   GNLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLE  354
             GNL  V L   P  Q KRL  R EAL KTV LGR +F +CS+VLDK  ADD+ D L  LE
Sbjct  470   GNLMEVDLNETPTVQNKRLHSRLEALMKTVRLGRCYFPHCSEVLDKFIADDLPD-LFYLE  528

Query  353   SGTPEEQTNKKRRYMELKEEVMKAFDKDMAQ  261
              G+ +E   K+RR+MELKEEV KAFDKD A+
Sbjct  529   PGSSDEHKVKRRRFMELKEEVQKAFDKDKAE  559



>gb|KHN45127.1| Hypothetical protein glysoja_031355 [Glycine soja]
Length=378

 Score =   442 bits (1137),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 253/388 (65%), Positives = 297/388 (77%), Gaps = 37/388 (10%)
 Frame = +1

Query  2404  LLGNGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKES  2583
             +LG+GG +TPSR+ELLSMVKKHS  +GKT+VEE+D SD+EMD +FWH+V DLYFVCGKES
Sbjct  1     MLGDGG-ETPSRYELLSMVKKHSNLIGKTVVEEQDASDIEMDMRFWHDVFDLYFVCGKES  59

Query  2584  RGRQEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYL  2763
             RGRQ+DDL+FFVRK+   G  SN  +E   PYFVRRW+PKL DL+ E S+ VDWRRS+YL
Sbjct  60    RGRQDDDLVFFVRKLGSHGSGSNNKTESVDPYFVRRWAPKLSDLVDETSIDVDWRRSFYL  119

Query  2764  NLIAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVET  2943
             NLIAHT+FSVTVAICSH+ L N++ G+D PLSPIY                    KEVET
Sbjct  120   NLIAHTSFSVTVAICSHQDLLNHRAGEDTPLSPIY--------------------KEVET  159

Query  2944  TPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSD------------SSQ  3087
             TPAYPDICFA+DDFDSTFDAVVLT+ DHCYCV+LNA+DGAAFPS+            S Q
Sbjct  160   TPAYPDICFAIDDFDSTFDAVVLTEKDHCYCVVLNAHDGAAFPSEKVSNDCSTSDSSSLQ  219

Query  3088  SETSGGKTQSSKITIFSGFVSYQMVRDAYDAGRTgf-gsllslhssgKTDRIYMKGPGGR  3264
               T   K + +K+T+FSGFVSYQMVRDAYDAGR+ F   L  +HSSGKTDRIYMKGPGGR
Sbjct  220   VHTISAKKKDTKLTLFSGFVSYQMVRDAYDAGRSRFGSLLSVVHSSGKTDRIYMKGPGGR  279

Query  3265  GEVEVAVSGVVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrss  3435
             GEVEVAVSGV DQS E+ G   P   KKG     +VR+AAS ASVAA+HAYAAASA+  +
Sbjct  280   GEVEVAVSGVADQSHEDSGPFSPVISKKGFGLGVIVRKAASAASVAARHAYAAASASSPT  339

Query  3436  DEEMIPLKCCLMSISLPWEHIAHDLLLK  3519
              +E+IPLKC LMSISLPWE+IA+DLL K
Sbjct  340   FDELIPLKCSLMSISLPWEYIAYDLLFK  367



>ref|XP_009102913.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X2 
[Brassica rapa]
Length=356

 Score =   441 bits (1134),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 232/386 (60%), Positives = 276/386 (72%), Gaps = 43/386 (11%)
 Frame = +1

Query  2413  NGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGR  2592
             N   +T +R E+LSMVKKHSK LGKT ++E++ SDVEMD  FWH V D+YFV   ESR R
Sbjct  3     NDREETLTRHEILSMVKKHSKSLGKTSLDEQEASDVEMDSNFWHGVFDVYFVRCMESRRR  62

Query  2593  QEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLI  2772
             Q+DDL+FFVRK+S + Y    N +  +PYFVRRW+PKLD LLGE    VDWR+S+YLN++
Sbjct  63    QDDDLLFFVRKLSCKSYGLTDNEDAPAPYFVRRWAPKLDVLLGETLAEVDWRKSFYLNMV  122

Query  2773  AHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPA  2952
             AHT+F+VTVAICS+E LK YQ  KD  LSPIYKVVKTVYASPSR+NFHLDS+KEVETTPA
Sbjct  123   AHTSFTVTVAICSNEALKKYQGSKDTTLSPIYKVVKTVYASPSRVNFHLDSKKEVETTPA  182

Query  2953  YPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPS-------DSSQSETSGG--  3105
             YP+ICFAVDDFDSTFDAVVLT+ DHCYCV+LN++DGAAFPS       DSS S T+    
Sbjct  183   YPEICFAVDDFDSTFDAVVLTEKDHCYCVLLNSHDGAAFPSADVKTDKDSSGSNTNTDPR  242

Query  3106  KTQSSKITIFSGFVSYQMVRDAYDAGRTgf-gsllslhssgKTDRIYMKGPGGRGEVEVA  3282
             + +  K+T+FSGFVSYQMVR+AY+ GR  F   L   H SGK DR+YMKGPGGRGEVEVA
Sbjct  243   RVKDPKVTLFSGFVSYQMVREAYEGGRNRFGSLLSLGHHSGKADRLYMKGPGGRGEVEVA  302

Query  3283  VSGVVDQSKEEYGHHPPKKGLsfsavvrraasvasvaakhayaaasatrssDEEMIPLKC  3462
             VSGV+ +                                     A+     ++EM PLKC
Sbjct  303   VSGVIAKHAIA---------------------------------AATASYDEDEMFPLKC  329

Query  3463  CLMSISLPWEHIAHDLLLKGSPPVNL  3540
             CLMSISLPW+ IAHDLL KGSPPVN+
Sbjct  330   CLMSISLPWDTIAHDLLFKGSPPVNM  355



>ref|NP_001280793.1| regulatory protein NPR3-like [Malus domestica]
 gb|AGK30592.1| NPR1-like protein [Malus domestica]
Length=586

 Score =   450 bits (1157),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 279/511 (55%), Positives = 352/511 (69%), Gaps = 23/511 (5%)
 Frame = -2

Query  1745  IDPGEYEDYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdgk--pKFLMTELV  1572
             IDPG   DY+DADI VEGI VGV+R ILA+RS FF E FK+ K     +  PK+ M++ +
Sbjct  56    IDPGC--DYSDADIVVEGIPVGVHRCILASRSGFFRELFKREKGSSGKEDRPKYCMSDFL  113

Query  1571  PCGWVGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQ  1392
             P G VGYEAF+VFL+YVYTGK K SP EVSTCV   C H ACRPAI++ V+LMYA++ FQ
Sbjct  114   PYGDVGYEAFLVFLSYVYTGKLKPSPVEVSTCVHNVCAHDACRPAINFVVELMYAASIFQ  173

Query  1391  IKELVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENE  1212
             + +LV + +R L   V  A  ++V+PILLV F C L  L+++CV RV  S++D+ +LE  
Sbjct  174   MPDLVSIFERRLLNFVGKALSDNVVPILLVAFHCQLNQLIDQCVDRVARSDIDDISLEKG  233

Query  1211  LPGAISSDIKARRLNQQ-----------GANEKKIRKILRALDCNDVELVKLLLEESDIT  1065
             LP  +   IK  R N Q             +EK+IR+I +ALD +DVELVKLLL ES+IT
Sbjct  234   LPDEVVKKIKILRRNYQQDSDPNLPPADPLHEKRIRRIHKALDSDDVELVKLLLTESNIT  293

Query  1064  LDDayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKS  885
             LD+A A+HYAAAYC+ KVV EVL LG  D+NLRN+RGYTVLH+A  RK+P+IIV +L K 
Sbjct  294   LDEANALHYAAAYCDPKVVTEVLALGLADVNLRNSRGYTVLHIAVMRKEPSIIVLLLTK-  352

Query  884   GASIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPV--  711
             GA   + T S+G +AV+ICRR TRPKDY+  TE+G+E N DR+CIDVLE  M   NP+  
Sbjct  353   GARASELT-SDGQSAVSICRRLTRPKDYHSKTEQGQEANKDRICIDVLEREMRR-NPMAG  410

Query  710   -SLPSSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLC  534
              +  SS  + +DL MEL  LENRVALAR  +P EA++ M IAHA+++ EF   S  +G  
Sbjct  411   DASISSQIMPDDLHMELLNLENRVALARLFFPAEAKLAMVIAHAETS-EFAAPSSSKGSS  469

Query  533   GNLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLE  354
             GNL  V L   P  Q KRL  R EAL KTV LGR +F +CS+VLDK   DD L  L  LE
Sbjct  470   GNLMEVDLNETPTVQNKRLHSRLEALMKTVRLGRCYFPHCSEVLDKFIDDD-LPHLFYLE  528

Query  353   SGTPEEQTNKKRRYMELKEEVMKAFDKDMAQ  261
              G+ +EQ  K+RR+MELKEEV KAFDKD A+
Sbjct  529   PGSSDEQKVKRRRFMELKEEVQKAFDKDKAE  559



>gb|ACC77697.1| NPR1-like protein [Malus domestica]
Length=586

 Score =   449 bits (1156),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 279/511 (55%), Positives = 352/511 (69%), Gaps = 23/511 (5%)
 Frame = -2

Query  1745  IDPGEYEDYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdgk--pKFLMTELV  1572
             IDPG   DY+DADI VEGI VGV+R ILA+RS FF E FK+ K     +  PK+ M++ +
Sbjct  56    IDPGC--DYSDADIVVEGIPVGVHRCILASRSGFFRELFKREKGSSGKEDRPKYCMSDFL  113

Query  1571  PCGWVGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQ  1392
             P G VGYEAF+VFL+YVYTGK K SP EVSTCV   C H ACRPAI++ V+LMYA++ FQ
Sbjct  114   PYGDVGYEAFLVFLSYVYTGKLKPSPVEVSTCVHNVCAHDACRPAINFVVELMYAASIFQ  173

Query  1391  IKELVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENE  1212
             + +LV + +R L   V  A  ++V+PILLV F C L  L+++CV RV  S++D+ +LE  
Sbjct  174   MPDLVSIFERRLLNFVGKALSDNVVPILLVAFHCQLNQLIDQCVDRVARSDIDDISLEKG  233

Query  1211  LPGAISSDIKARRLNQQ-----------GANEKKIRKILRALDCNDVELVKLLLEESDIT  1065
             LP  +   IK  R N Q             +EK+IR+I +ALD +DVELVKLLL ES+IT
Sbjct  234   LPDEVVKKIKILRRNYQQDSDPNLPPADPLHEKRIRRIHKALDSDDVELVKLLLTESNIT  293

Query  1064  LDDayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKS  885
             LD+A A+HYAAAYC+ KVV EVL LG  D+NLRN+RGYTVLH+A  RK+P+IIV +L K 
Sbjct  294   LDEANALHYAAAYCDPKVVTEVLALGLADVNLRNSRGYTVLHIAVMRKEPSIIVLLLTK-  352

Query  884   GASIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPV--  711
             GA   + T S+G +AV+ICRR TRPKDY+  TE+G+E N DR+CIDVLE   M  NP+  
Sbjct  353   GARASELT-SDGQSAVSICRRLTRPKDYHSKTEQGQEANKDRICIDVLER-EMRRNPMAG  410

Query  710   -SLPSSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLC  534
              +  SS  + +DL MEL  LENRVALAR  +P EA++ M IAHA+++ EF   S  +G  
Sbjct  411   DASISSQIMPDDLHMELLNLENRVALARLFFPAEAKLAMVIAHAETS-EFAAPSSSKGSS  469

Query  533   GNLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLE  354
             GNL  V L   P  Q KRL  R EAL KTV LGR +F +CS+VLDK   DD L  L  LE
Sbjct  470   GNLMEVDLNETPTVQNKRLHSRLEALMKTVRLGRCYFPHCSEVLDKFIDDD-LPHLFYLE  528

Query  353   SGTPEEQTNKKRRYMELKEEVMKAFDKDMAQ  261
              G+ +EQ  K+RR+MELKEEV KAFDKD A+
Sbjct  529   PGSSDEQKVKRRRFMELKEEVQKAFDKDKAE  559



>ref|XP_008225741.1| PREDICTED: regulatory protein NPR3-like [Prunus mume]
Length=587

 Score =   449 bits (1156),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 278/504 (55%), Positives = 351/504 (70%), Gaps = 20/504 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdgkp--KFLMTELVPCGWVGY  1551
             DY+DADI VEGI VGV+R ILA+RS FF + FK+ K     +   K+ M++L+P G VGY
Sbjct  61    DYSDADIIVEGISVGVHRCILASRSSFFCDLFKQKKGSSGKESRPKYCMSDLLPYGDVGY  120

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF+VFL+YVYTGK K SP EVSTCV   C H ACRPAI++ V+LMYAS+ FQ+ +LV +
Sbjct  121   EAFLVFLSYVYTGKLKPSPMEVSTCVHNVCAHDACRPAINFVVELMYASSIFQMPDLVSI  180

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
              QR L   V  A  +DVIPIL+V F C L+ L+ +C+ RV  S++D+ +LE  LP  +  
Sbjct  181   FQRRLLNFVGKALADDVIPILVVAFHCQLSQLIAQCIERVARSDIDSISLEKGLPDEVIE  240

Query  1190  DIKARRLNQQG-----------ANEKKIRKILRALDCNDVELVKLLLEESDITLDDayav  1044
              IK  R N Q             +EK+IR+I +ALD +DVELVKLLL+ES ITLD+A A+
Sbjct  241   KIKILRRNSQQDCDPNMPAVDPLHEKRIRRIHKALDSDDVELVKLLLKESAITLDEANAL  300

Query  1043  hyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDA  864
             HYAAAYC+ KVV EVLGLG  D+NLRN+RGYTVLH+A  RK+P+IIV +L K GA   + 
Sbjct  301   HYAAAYCDPKVVTEVLGLGLADVNLRNSRGYTVLHIAVMRKEPSIIVLLLTK-GARASEL  359

Query  863   TCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNP---VSLPSST  693
             T S+G +AV+ICRR TRPKDY+  TE+G+E N DR+CIDVLE   M  NP   V+  SS 
Sbjct  360   T-SDGQSAVSICRRLTRPKDYHSKTEQGQEANKDRICIDVLER-EMRRNPMAGVTSISSQ  417

Query  692   TLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVG  513
              + +DL M+L  LENRVA AR L+P EA++ M IAHA++T EF G S  +G  GNL  V 
Sbjct  418   IMPDDLHMKLLNLENRVAFARLLFPAEAKLAMVIAHAETTSEFAGRSSSKGSSGNLMEVD  477

Query  512   LTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQ  333
             L   P  Q KRL  R EAL KTV+LGR +F +CS+VLDK   DD+ D L  LE GT +EQ
Sbjct  478   LNETPTVQNKRLHSRLEALMKTVDLGRFYFPHCSEVLDKFIEDDLPD-LFYLEMGTSDEQ  536

Query  332   TNKKRRYMELKEEVMKAFDKDMAQ  261
               K+ R+MELKEEV KAF+KD A+
Sbjct  537   KIKRVRFMELKEEVHKAFNKDKAE  560



>gb|KDO77444.1| hypothetical protein CISIN_1g007849mg [Citrus sinensis]
Length=587

 Score =   449 bits (1155),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 269/510 (53%), Positives = 359/510 (70%), Gaps = 21/510 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg--kpKFLMTELVPCGWVGY  1551
             +Y+DA+I VEGI V V+R ILAARS+FF+E FK+ K   D   KPK+ M+EL+P G VGY
Sbjct  62    EYSDAEIIVEGIPVCVHRCILAARSKFFYELFKREKGSVDKEGKPKYPMSELLPYGKVGY  121

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF++FL+Y Y+GK K  P EVSTCVD  C H ACRPAI++AV++MYAS+ F++ ELV L
Sbjct  122   EAFLIFLSYTYSGKLKPFPMEVSTCVDNICVHDACRPAINFAVEMMYASSIFELPELVSL  181

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
              QR L   V  A  ED+IPILL  F C L+ L+ +CV R+  S+LD  ++E ELP  ++ 
Sbjct  182   FQRRLLNFVGKAVAEDIIPILLAAFHCQLSQLLAQCVDRIVRSDLDTISIEKELPTEVAE  241

Query  1190  DIKARRLNQ-----------QGANEKKIRKILRALDCNDVELVKLLLEESDITLDDayav  1044
             +I+  RL                 EK+I++I +ALD +DVELV+LLL ES+ITLD+A A+
Sbjct  242   EIRMLRLKSFPDDENTAVEVDPLREKRIKRIHKALDSDDVELVRLLLSESEITLDEANAL  301

Query  1043  hyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDA  864
             HYAAAYC+ KV++EVL LG  D+NLR++RGYTVLH+ A RK+P++IV++L K GA   D 
Sbjct  302   HYAAAYCDPKVLSEVLSLGLADVNLRSSRGYTVLHIGAMRKEPSVIVSLLTK-GACASDL  360

Query  863   TCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPV---SLPSST  693
             T  +G +AV+ICRR TRPKDY   TE+G+E N DR+CIDVLEG  M  NP+   +  +S 
Sbjct  361   TL-DGRSAVSICRRLTRPKDYQAKTEQGKETNKDRICIDVLEG-EMRRNPMAGDAFITSH  418

Query  692   TLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVG  513
             TL +DL M+L +LENRVA AR L+P EA++ M+IA+ ++T EF G    +G  GNL+ V 
Sbjct  419   TLSDDLHMKLLYLENRVAFARLLFPTEAKLAMDIANTETTSEFSGFCASKGSSGNLREVD  478

Query  512   LTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQ  333
             L   P  + KRL  R EAL KTVE+G+R+F  CS+VLDK   DD+ D L  LE+GT EEQ
Sbjct  479   LNETPVMRNKRLRPRMEALMKTVEMGQRYFPLCSEVLDKFMEDDLQD-LFFLENGTKEEQ  537

Query  332   TNKKRRYMELKEEVMKAFDKDMAQ-NRVGL  246
               K+ R++ELK++V KAF +D A+ +R GL
Sbjct  538   RVKRMRFIELKDDVQKAFTRDKAEISRSGL  567



>ref|XP_004501505.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X2 
[Cicer arietinum]
Length=374

 Score =   441 bits (1134),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 256/383 (67%), Positives = 305/383 (80%), Gaps = 13/383 (3%)
 Frame = +1

Query  2404  LLGNGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKES  2583
             +LG+GG +TPSR+ELLSMVKKHS  +GKT+VEE+D SDVEMD +FWH+V DLYFV GKES
Sbjct  1     MLGDGG-ETPSRYELLSMVKKHSNLIGKTVVEEQDSSDVEMDMKFWHDVFDLYFVRGKES  59

Query  2584  RGRQEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYL  2763
             RGRQ+DDL+FFVRK+  +   SN +SE   PYFVRRW+P+L +L+ E S+ VDWRRS+YL
Sbjct  60    RGRQDDDLVFFVRKLVSRSSGSNNDSESVDPYFVRRWAPELSNLVDETSIDVDWRRSFYL  119

Query  2764  NLIAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVET  2943
             NLIAHT+FSVTVAICSH+VL+N+Q GKD  LSPIYKVVKTVYASPSR+NF LDS+KEVET
Sbjct  120   NLIAHTSFSVTVAICSHQVLQNHQAGKDTSLSPIYKVVKTVYASPSRVNFQLDSKKEVET  179

Query  2944  TPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDSSQSETSGGKTQSSK  3123
             TPAYPDICFA+DDFDSTFDAV L  +   + ++      A       ++           
Sbjct  180   TPAYPDICFAIDDFDSTFDAVFLMHMMGQHFLLKRCQTIAVLVITPPRNFV--------L  231

Query  3124  ITIFSGFVSYQMVRDAYDAGRTgfgsllslhss-gKTDRIYMKGPGGRGEVEVAVSGVVD  3300
             +T+FSGFVSYQMVRDAYDAG++ FGSLLS     GKTDRIYMKGPGGRGEVEVAVSGV D
Sbjct  232   LTLFSGFVSYQMVRDAYDAGKSRFGSLLSGGHYPGKTDRIYMKGPGGRGEVEVAVSGVSD  291

Query  3301  QSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrssDEEMIPLKCCLM  3471
             QS+++ G   P   KKG     +VRRAASVASVAA+HAYAAASA+ S+ +EMIPLKC LM
Sbjct  292   QSQQDSGPPSPVISKKGFGIGVIVRRAASVASVAARHAYAAASASSSNFDEMIPLKCSLM  351

Query  3472  SISLPWEHIAHDLLLKGSPPVNL  3540
             SISLPWE+IA+DLL KG+PPVN+
Sbjct  352   SISLPWEYIAYDLLFKGAPPVNM  374



>ref|XP_010470229.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X4 
[Camelina sativa]
Length=354

 Score =   440 bits (1131),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 228/384 (59%), Positives = 274/384 (71%), Gaps = 41/384 (11%)
 Frame = +1

Query  2413  NGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGR  2592
             N G  TPSR E+LSMVKKHSK LG T ++E+D SDVEMD  FWH + D+YF+   ESR R
Sbjct  3     NDGEATPSRHEILSMVKKHSKSLGSTSLDEQDASDVEMDSNFWHGLFDVYFIRCMESRRR  62

Query  2593  QEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPK-LDDLLGENSVGVDWRRSYYLNL  2769
             Q+DDL+FFVRK+S + Y    N E  +PYFVRRW+PK L++LLGE+   VDWR+S+YLN+
Sbjct  63    QDDDLLFFVRKLSCKSYGLTENDEAPAPYFVRRWAPKQLNELLGESLAEVDWRKSFYLNM  122

Query  2770  IAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTP  2949
             IAHT+F+VTVAICS+E LK YQ  KD  LSPIYKVVKTVYASPSR+NFHLDS+KEVETTP
Sbjct  123   IAHTSFTVTVAICSNEALKTYQGSKDTKLSPIYKVVKTVYASPSRVNFHLDSKKEVETTP  182

Query  2950  AYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDS------SQSETSGGKT  3111
             AYP+ICFAVDDFDSTFDAVVLT+ DHCYCV+LN++DGAAFPS +      S S T     
Sbjct  183   AYPEICFAVDDFDSTFDAVVLTEKDHCYCVLLNSHDGAAFPSANNKDSSDSNSNTEPKSV  242

Query  3112  QSSKITIFSGFVSYQMVRDAYDAGRTgf-gsllslhssgKTDRIYMKGPGGRGEVEVAVS  3288
             +  K+T+FSGFVSYQMVR+AY+ GR  F   L   H++GK DR+YM+GPGGRGEVEVAVS
Sbjct  243   KDPKVTLFSGFVSYQMVREAYEGGRNRFGSLLSLGHNTGKADRLYMRGPGGRGEVEVAVS  302

Query  3289  GVVDQSKEEYGHHPPKKGLsfsavvrraasvasvaakhayaaasatrssDEEMIPLKCCL  3468
             GV+ +                                     A+     ++EM PLKCCL
Sbjct  303   GVIAKHAIA---------------------------------AATASYDEDEMFPLKCCL  329

Query  3469  MSISLPWEHIAHDLLLKGSPPVNL  3540
             MSISLPW+ IAHDLL K  PPVN+
Sbjct  330   MSISLPWDTIAHDLLFKAFPPVNM  353



>ref|XP_006468441.1| PREDICTED: regulatory protein NPR3-like [Citrus sinensis]
Length=587

 Score =   448 bits (1152),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 268/510 (53%), Positives = 359/510 (70%), Gaps = 21/510 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg--kpKFLMTELVPCGWVGY  1551
             +Y+DA+I VEGI V V+R ILAARS+FF+E FK+ K   D   KPK+ M+EL+P G VGY
Sbjct  62    EYSDAEIIVEGIPVCVHRCILAARSKFFYELFKREKGSVDKEGKPKYPMSELLPYGKVGY  121

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF++FL+Y Y+GK K  P EVSTCVD  C H ACRPAI++AV++MYAS+ F++ ELV L
Sbjct  122   EAFLIFLSYTYSGKLKPFPMEVSTCVDNICVHDACRPAINFAVEMMYASSIFELPELVSL  181

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
              QR L   V  A  ED+IPILL  F C L+ L+ +CV R+  S+LD  +++ ELP  ++ 
Sbjct  182   FQRRLLNFVGKAVAEDIIPILLAAFHCQLSQLLAQCVDRIVRSDLDTISIQKELPTEVAE  241

Query  1190  DIKARRLNQ-----------QGANEKKIRKILRALDCNDVELVKLLLEESDITLDDayav  1044
             +I+  RL                 EK+I++I +ALD +DVELV+LLL ES+ITLD+A A+
Sbjct  242   EIRMLRLKSFPDDENTAVEVDPLREKRIKRIHKALDSDDVELVRLLLSESEITLDEANAL  301

Query  1043  hyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDA  864
             HYAAAYC+ KV++EVL LG  D+NLR++RGYTVLH+ A RK+P++IV++L K GA   D 
Sbjct  302   HYAAAYCDPKVLSEVLSLGLADVNLRSSRGYTVLHIGAMRKEPSVIVSLLTK-GACASDL  360

Query  863   TCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPV---SLPSST  693
             T  +G +AV+ICRR TRPKDY   TE+G+E N DR+CIDVLEG  M  NP+   +  +S 
Sbjct  361   TL-DGRSAVSICRRLTRPKDYQAKTEQGKETNKDRICIDVLEG-EMRRNPMAGDAFITSH  418

Query  692   TLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVG  513
             TL +DL M+L +LENRVA AR L+P EA++ M+IA+ ++T EF G    +G  GNL+ V 
Sbjct  419   TLSDDLHMKLLYLENRVAFARLLFPTEAKLAMDIANTETTSEFSGFCASKGSSGNLREVD  478

Query  512   LTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQ  333
             L   P  + KRL  R EAL KTVE+G+R+F  CS+VLDK   DD+ D L  LE+GT EEQ
Sbjct  479   LNETPVMRNKRLRPRMEALMKTVEMGQRYFPLCSEVLDKFMEDDLQD-LFFLENGTKEEQ  537

Query  332   TNKKRRYMELKEEVMKAFDKDMAQ-NRVGL  246
               K+ R++ELK++V KAF +D A+ +R GL
Sbjct  538   RVKRMRFIELKDDVQKAFTRDKAEISRSGL  567



>ref|XP_009387108.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X1 
[Musa acuminata subsp. malaccensis]
Length=405

 Score =   441 bits (1134),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 238/394 (60%), Positives = 297/394 (75%), Gaps = 17/394 (4%)
 Frame = +1

Query  2410  GNGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRG  2589
             G   G+ PSR ELLSMVKKHS  LG ++ +E+D SDV MD +FWHEVLDLYF+ G+ S+G
Sbjct  12    GFSDGEAPSRCELLSMVKKHSNLLGDSVHDEQDASDVVMDNEFWHEVLDLYFIRGRVSKG  71

Query  2590  RQEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNL  2769
             R+EDDL+FFVRKM+L GY  + + ED SP+FVRRW+P+L+ ++GE+S  VDWRRS YLNL
Sbjct  72    REEDDLVFFVRKMNLHGYGYSDDVEDGSPFFVRRWAPRLEKVVGEDSACVDWRRSIYLNL  131

Query  2770  IAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTP  2949
             IAHT+++VTVAICS + L+  Q+G+D  LSPIYKVVKTVYASPSR++F LD +K  ET P
Sbjct  132   IAHTSYTVTVAICSKQDLEQRQSGQDISLSPIYKVVKTVYASPSRVDFQLDHKKAAETLP  191

Query  2950  AYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDSSQSETSGGK-------  3108
             AYP+ICF+VDDFD TFDAVVL++ +HCYCV+LNA+ G AFP+D    E +  +       
Sbjct  192   AYPNICFSVDDFDDTFDAVVLSERNHCYCVLLNAHGGPAFPTDEDLPECNSSRPVNVHKD  251

Query  3109  ---TQSSKITIFSGFVSYQMVRDAYDAGRTg-fgsllslhssgKTDRIYMKGPGGRGEVE  3276
                 + SK+T+FSGFVSYQMVR+AYDAG++     L   H   KTD+IYM+GPGGRGEVE
Sbjct  252   VEEAKPSKLTLFSGFVSYQMVREAYDAGKSRFGSLLSMGHGHTKTDKIYMRGPGGRGEVE  311

Query  3277  VAVSGVVDQSKEEYGH----HPPKK--GLsfsavvrraasvasvaakhayaaasatrssD  3438
             VAVSG+ DQS +        H  +K  G+    +V RAAS ASV AKHAYAA S  R SD
Sbjct  312   VAVSGIADQSHQNAALSSAVHLSRKGSGIGLGTIVHRAASAASVLAKHAYAATSPNRQSD  371

Query  3439  EEMIPLKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
              E++PLKCCLMSISLPWE+IAHDLL K SPPV++
Sbjct  372   GELLPLKCCLMSISLPWEYIAHDLLFKVSPPVDM  405



>ref|XP_009602190.1| PREDICTED: regulatory protein NPR3-like [Nicotiana tomentosiformis]
Length=580

 Score =   447 bits (1151),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 265/503 (53%), Positives = 353/503 (70%), Gaps = 19/503 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkd--cdgkpKFLMTELVPCGWVGY  1551
             D++DA+I VEG+ +GV+R ILAARS+FF + F+K K     +GKP++ M +++P G VGY
Sbjct  64    DFSDAEIVVEGVSLGVHRCILAARSKFFQDLFRKEKGSCGKEGKPRYSMADILPYGKVGY  123

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF+ FL+Y+Y+GK K  PPEVSTC D  C H +CRPAI ++V+LMYAS+ FQ+ ELV L
Sbjct  124   EAFLTFLSYLYSGKLKHFPPEVSTCTDTICAHDSCRPAISFSVELMYASSVFQVPELVSL  183

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
               R L   V  A +EDVIPIL V F C L+ L+  CV RV  S+L+   +E E+P  ++ 
Sbjct  184   FLRRLINFVGKALVEDVIPILRVAFHCQLSELLTHCVDRVARSDLEIICIEKEVPFEVAE  243

Query  1190  DIKARRLNQQ----------GANEKKIRKILRALDCNDVELVKLLLEESDITLDDayavh  1041
              IK  R   Q            +EK+  +I +ALD +DVELVKLLL ES+I+LD+AYA+H
Sbjct  244   SIKLLRPKCQVDESKVLPVDPLHEKRKNRIYKALDSDDVELVKLLLNESEISLDEAYALH  303

Query  1040  yaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDAT  861
             YA AYC+ KVV EVLGLG  D+NLRN RGYTVLH+AA RK+PAIIV++L K GA + + T
Sbjct  304   YAVAYCDPKVVTEVLGLGVADVNLRNTRGYTVLHIAAMRKEPAIIVSLLTK-GAHVSEIT  362

Query  860   CSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPV---SLPSSTT  690
               +G +AV+ICRR TRPK+Y+  TE+G+E N DR+CIDVLE   M  NP+   +L SS  
Sbjct  363   L-DGQSAVSICRRLTRPKEYHAKTEQGQEANKDRVCIDVLER-EMRRNPMAGDALLSSQM  420

Query  689   LENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVGL  510
             L +DL M+L++LENRVA AR L+P EAR+ M+IA+A++  EF G    +   GNL+ V L
Sbjct  421   LADDLHMKLHYLENRVAFARLLFPLEARLAMQIANAETAAEFAGRLASKSSSGNLREVDL  480

Query  509   TGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQT  330
                P  Q +RL+ R +AL KTVELG+R+F +CS VLDK   DD+ D L  LE GTPEEQ 
Sbjct  481   NETPIKQKERLLSRMQALSKTVELGKRYFPHCSQVLDKFMEDDLPD-LIFLEMGTPEEQK  539

Query  329   NKKRRYMELKEEVMKAFDKDMAQ  261
              K++R+ ELK++V +AF+KD A+
Sbjct  540   IKRKRFKELKDDVQRAFNKDKAE  562



>ref|XP_010908601.1| PREDICTED: regulatory protein NPR3-like [Elaeis guineensis]
 ref|XP_010908602.1| PREDICTED: regulatory protein NPR3-like [Elaeis guineensis]
Length=587

 Score =   447 bits (1150),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 273/503 (54%), Positives = 346/503 (69%), Gaps = 21/503 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkk---akkdcdgkpKFLMTELVPCGWVG  1554
             DY+DA+I VEG  VGV+R ILAARS+FF + F +     +   GKP++ M+ELVPCG VG
Sbjct  63    DYSDAEIVVEGAPVGVHRCILAARSRFFLDLFSRDGGRCRPEGGKPRYQMSELVPCGRVG  122

Query  1553  YEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVM  1374
              EAFM FL+Y+YTGK K +PPEVS CVD  C H AC PA+++ V+LM AS+ FQI E+V 
Sbjct  123   REAFMNFLSYIYTGKLKPAPPEVSVCVDPMCAHDACWPAVNFVVELMNASSVFQIPEMVS  182

Query  1373  LIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAIS  1194
             L+QR L   V+ A +EDVIPILLV F   L+ L+  C++RV  S+LDN +L+ ELP  ++
Sbjct  183   LLQRRLLNFVEKAFVEDVIPILLVAFHSQLSQLLSHCMKRVARSDLDNISLQKELPQEVA  242

Query  1193  SDIKARRLNQQGAN----------EKKIRKILRALDCNDVELVKLLLEESDITLDDayav  1044
              +IK  R   Q             EK+IR+I RALD +DVELVKLLL ESD TLDDA A+
Sbjct  243   EEIKLIRHKAQTDEPNSLTVDPVLEKRIRRIHRALDSDDVELVKLLLSESDTTLDDANAL  302

Query  1043  hyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDA  864
             HYAAAYC+SKVV E+L +G  ++NLRN RGYT LHVAA RK+PA+IV++L K GAS  + 
Sbjct  303   HYAAAYCDSKVVAELLEMGSANVNLRNNRGYTPLHVAAMRKEPAVIVSLLTK-GASASET  361

Query  863   TCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVSLPSSTT--  690
             T ++G  A  ICRR TR KDYN  T++G+E N DR+CID+LE   M  NP++   S T  
Sbjct  362   T-ADGQNAAMICRRLTRAKDYNTNTQQGQESNKDRICIDILER-EMRRNPMAGEDSVTSP  419

Query  689   -LENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVG  513
              L ++L M+L +LENRVA AR  +P EA++ MEIA A++T EF+GL        NL+ V 
Sbjct  420   LLGDNLHMKLLYLENRVAFARLFFPTEAKVAMEIAQAETTSEFMGLLASRN-SSNLREVD  478

Query  512   LTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQ  333
             L   P  Q KRL  R +AL KTVELGRRFF +CS VLDK   +D+ D L  L+ GTP+EQ
Sbjct  479   LNETPIMQNKRLRSRVDALVKTVELGRRFFPHCSQVLDKFLEEDLPDLL-YLQKGTPDEQ  537

Query  332   TNKKRRYMELKEEVMKAFDKDMA  264
               KK RY ELKE+V KAF KD A
Sbjct  538   KIKKMRYCELKEDVRKAFKKDKA  560



>ref|XP_010470228.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X3 
[Camelina sativa]
Length=384

 Score =   439 bits (1130),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 249/387 (64%), Positives = 297/387 (77%), Gaps = 17/387 (4%)
 Frame = +1

Query  2413  NGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGR  2592
             N G  TPSR E+LSMVKKHSK LG T ++E+D SDVEMD  FWH + D+YF+   ESR R
Sbjct  3     NDGEATPSRHEILSMVKKHSKSLGSTSLDEQDASDVEMDSNFWHGLFDVYFIRCMESRRR  62

Query  2593  QEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPK-LDDLLGENSVGVDWRRSYYLNL  2769
             Q+DDL+FFVRK+S + Y    N E  +PYFVRRW+PK L++LLGE+   VDWR+S+YLN+
Sbjct  63    QDDDLLFFVRKLSCKSYGLTENDEAPAPYFVRRWAPKQLNELLGESLAEVDWRKSFYLNM  122

Query  2770  IAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTP  2949
             IAHT+F+VTVAICS+E LK YQ  KD  LSPIYKVVKTVYASPSR+NFHLDS+KEVETTP
Sbjct  123   IAHTSFTVTVAICSNEALKTYQGSKDTKLSPIYKVVKTVYASPSRVNFHLDSKKEVETTP  182

Query  2950  AYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDS------SQSETSGGKT  3111
             AYP+ICFAVDDFDSTFDAVVLT+ DHCYCV+LN++DGAAFPS +      S S T     
Sbjct  183   AYPEICFAVDDFDSTFDAVVLTEKDHCYCVLLNSHDGAAFPSANNKDSSDSNSNTEPKSV  242

Query  3112  QSSKITIFSGFVSYQMVRDAYDAGRTgf-gsllslhssgKTDRIYMKGPGGRGEVEVAVS  3288
             +  K+T+FSGFVSYQMVR+AY+ GR  F   L   H++GK DR+YM+GPGGRGEVEVAVS
Sbjct  243   KDPKVTLFSGFVSYQMVREAYEGGRNRFGSLLSLGHNTGKADRLYMRGPGGRGEVEVAVS  302

Query  3289  GVVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrssDEEMIPLK  3459
             GV+       G   P   KK +   ++ R+AASVASVAAKHA AAA+A+   D EM PLK
Sbjct  303   GVI-----VVGPVSPMSSKKSIDLGSIFRKAASVASVAAKHAIAAATASYDED-EMFPLK  356

Query  3460  CCLMSISLPWEHIAHDLLLKGSPPVNL  3540
             CCLMSISLPW+ IAHDLL K  PPVN+
Sbjct  357   CCLMSISLPWDTIAHDLLFKAFPPVNM  383



>ref|XP_008383328.1| PREDICTED: regulatory protein NPR3-like [Malus domestica]
Length=584

 Score =   447 bits (1149),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 265/510 (52%), Positives = 355/510 (70%), Gaps = 21/510 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkak--kdcdgkpKFLMTELVPCGWVGY  1551
             DY+DA+I VEG+ V V+R ILA+RS+FF + F +     + +GKP++ +++L+P G VGY
Sbjct  59    DYSDAEITVEGVPVAVHRCILASRSEFFAKVFSRENGGSEKEGKPRYFLSDLLPFGHVGY  118

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF+VFL +VYT K KA P EVS+CV   C H ACRPAID+A++LM AS+ F + EL  +
Sbjct  119   EAFVVFLGFVYTAKLKAFPVEVSSCVHIVCGHEACRPAIDFALELMCASSVFGMPELASV  178

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
             +QR L   V  A  +DVIPIL+V F C L+ L+++C+ RV  S+LD+ +LE  LP  + +
Sbjct  179   LQRQLADFVVKAVADDVIPILVVAFNCQLSQLIDQCIERVAHSDLDSISLEKRLPDEVVA  238

Query  1190  DIKARRLNQQG-----------ANEKKIRKILRALDCNDVELVKLLLEESDITLDDayav  1044
              IK  R N Q              EK+IR+I +ALD +DVEL+KLLL ESD+TLD+A A+
Sbjct  239   KIKILRRNSQHYCDPNMPIVDPLREKRIRRIHKALDSDDVELMKLLLTESDVTLDEANAL  298

Query  1043  hyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDA  864
             HYAAAYC+ KVV EVLGLG  D+NLR++RG+TVLH+A  RK+P+II+ +L  +GA   + 
Sbjct  299   HYAAAYCDPKVVTEVLGLGLADVNLRDSRGFTVLHIAVMRKEPSIIILLL-SNGARASEP  357

Query  863   TCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVSLPSSTTLE  684
             T   G +AV+ICRR TRPKDY+  TE G+E N DR+CIDVLE  M+  NP++  +S + +
Sbjct  358   TL-EGESAVSICRRLTRPKDYHTKTERGQEANKDRICIDVLEREMLR-NPMAGEASISSQ  415

Query  683   ---NDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVG  513
                NDL M L  LENRV  AR L+P EA++ M IAHAD+T EF G+S ++G  GNL  V 
Sbjct  416   MTPNDLHMRLLKLENRVTFARLLFPAEAKLAMAIAHADTTSEFAGISSVKGSSGNLMEVD  475

Query  512   LTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQ  333
             L   P  Q KRL+ R E+L KTV +GR +F +CS+VLDKL   D+ D L  LE+GT +EQ
Sbjct  476   LNETPTVQNKRLLSRLESLVKTVSMGRYYFPHCSEVLDKLIQGDLPD-LRFLETGTTDEQ  534

Query  332   TNKKRRYMELKEEVMKAFDKDMA-QNRVGL  246
               K++R++ELKEEV KAFDKD A +N  GL
Sbjct  535   KIKRQRFLELKEEVQKAFDKDKADKNIYGL  564



>ref|XP_002307566.2| hypothetical protein POPTR_0005s22770g [Populus trichocarpa]
 gb|EEE94562.2| hypothetical protein POPTR_0005s22770g [Populus trichocarpa]
Length=586

 Score =   447 bits (1149),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 274/513 (53%), Positives = 355/513 (69%), Gaps = 29/513 (6%)
 Frame = -2

Query  1736  GEYEDYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg--kpKFLMTELVPCG  1563
             GEY DY+DA+I VEGI VGV+R ILAARSQFFHE FKK   +     KP++LM++L+P G
Sbjct  59    GEY-DYSDAEIVVEGIPVGVHRCILAARSQFFHELFKKVDSNSTSGDKPRYLMSDLMPYG  117

Query  1562  WVGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKE  1383
              VGYEAF VFL+Y+YTGK K+SPPEVS CV ++C H ACRPAI+YAV+LMYASATFQ+KE
Sbjct  118   GVGYEAFNVFLHYLYTGKHKSSPPEVSQCVYDACAHDACRPAINYAVELMYASATFQMKE  177

Query  1382  LVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPG  1203
             LV+L QR L   +D A  EDVIPI++  F C L  L+  C+ R+  S+LD+  ++ ELP 
Sbjct  178   LVLLFQRRLLSFIDKALDEDVIPIVMAAFHCQLDQLLSLCIERLVRSDLDSVCIDKELPH  237

Query  1202  AISSDIKARRLNQ-----------QGANEKKIRKILRALDCNDVELVKLLLEESDITLDD  1056
              ISS +K  R                  EK++ +I +AL+ +DVELV+LLL ES+ TLDD
Sbjct  238   EISSKVKLLRKKSLEEAESSVEEVDPMREKRMSRIHKALESDDVELVQLLLSESNFTLDD  297

Query  1055  ayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGAS  876
             AYA+HYA +YC+ KVV EVL LG  DLNLRN+RGYTVLHVAARRK+ +I+VA+L K GA 
Sbjct  298   AYALHYAVSYCDPKVVKEVLALGLADLNLRNSRGYTVLHVAARRKESSILVALLAK-GAR  356

Query  875   IRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVM----MNGNPVS  708
               + T  +G  AV+I R  TRPKDYN  T++G+E N DR+CI++LE  M    M+ N +S
Sbjct  357   ASEITM-DGRNAVSIWRSLTRPKDYNANTKQGQESNKDRICIEILETEMRRTSMSAN-IS  414

Query  707   LPSSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGL--SGMEGLC  534
             + S      DL M+   LE+RVA AR  +P EAR+  ++A+ADST  + GL  S  +G  
Sbjct  415   MISP-----DLNMKPDDLEDRVAFARLFFPAEARLAKDMANADSTSMYTGLPASKSKGSS  469

Query  533   GNLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLE  354
             G+ + V L   P  Q KRL  R + L+KTVE+GR +F +CS+VLDK   DDV D+L  L+
Sbjct  470   GDTREVDLNETPSVQDKRLQLRLQELRKTVEMGRLYFPHCSEVLDKFLDDDVPDAL-YLD  528

Query  353   SGTPEEQTNKKRRYMELKEEVMKAFDKDMAQNR  255
              GTP EQ  KK R++ELKE+V  AF+KDM +NR
Sbjct  529   KGTPAEQKTKKMRFLELKEDVQMAFNKDMEKNR  561



>ref|XP_011032773.1| PREDICTED: regulatory protein NPR3-like [Populus euphratica]
Length=586

 Score =   447 bits (1149),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 268/509 (53%), Positives = 351/509 (69%), Gaps = 21/509 (4%)
 Frame = -2

Query  1736  GEYEDYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg--kpKFLMTELVPCG  1563
             GEY DY+DA+I VEGI VGV+R ILAARSQFFHE F K   +     KP++LM++L+P G
Sbjct  59    GEY-DYSDAEIVVEGIPVGVHRCILAARSQFFHELFMKVDGNSTSGDKPRYLMSDLMPYG  117

Query  1562  WVGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKE  1383
              VGYEAF VFL+Y+YTGK K+SPPEVS CV  +C H ACRPAI+YAV+LMYASATFQ+KE
Sbjct  118   GVGYEAFNVFLHYLYTGKHKSSPPEVSQCVYGACAHDACRPAINYAVELMYASATFQMKE  177

Query  1382  LVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPG  1203
             LV+L QR L   +D A  EDVIPI +  F C L  L+  C+ R+  S+LD+  ++ ELP 
Sbjct  178   LVLLFQRRLLSFIDKALDEDVIPIAMAAFHCQLDQLLSHCIERLVRSDLDSVCIDKELPH  237

Query  1202  AISSDIKARR-----------LNQQGANEKKIRKILRALDCNDVELVKLLLEESDITLDD  1056
              ISS +K  R             +    EK++ +I +AL+ +DVELV+LLL ES+ TLDD
Sbjct  238   EISSKVKLLRKKSLEEAESSVEEEDPVREKRMSRIHKALESDDVELVRLLLSESNFTLDD  297

Query  1055  ayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGAS  876
             A+A+HYA +YC+ KVV EVL LG  DLNLRN+RGYTVLHVAARRK+ +I+VA+L K GA 
Sbjct  298   AHALHYAVSYCDPKVVKEVLALGLADLNLRNSRGYTVLHVAARRKESSILVALLAK-GAR  356

Query  875   IRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVSLPSS  696
               + T  +G  AV+I R  TRPKDYN  T++G+E N DR+CI++LE  M   +  +  + 
Sbjct  357   ASETTM-DGRNAVSIWRSLTRPKDYNANTKQGQESNKDRICIEILEREMRRTSISA--NM  413

Query  695   TTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGL--SGMEGLCGNLK  522
             + +  DL M+   LE+RVA AR  +P EAR+  ++A+ADST  + GL  S  +G  G+ +
Sbjct  414   SMISPDLNMKPDDLEDRVAFARLFFPAEARLAKDMANADSTSTYTGLPASKSKGSSGDTR  473

Query  521   GVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTP  342
              V L      Q KRL  R + L+KTVE+GRR+F +CS+VLDK   DDV D+L  L+ GTP
Sbjct  474   EVDLNETTSAQDKRLQLRLQELRKTVEMGRRYFPHCSEVLDKFLDDDVPDAL-YLDKGTP  532

Query  341   EEQTNKKRRYMELKEEVMKAFDKDMAQNR  255
              EQ  KK R++ELKE+V  AF+KDM +NR
Sbjct  533   AEQKTKKMRFLELKEDVQMAFNKDMEKNR  561



>ref|XP_003617362.1| NPR1-1 protein [Medicago truncatula]
 gb|AET00321.1| NPR1/NIM1-like regulatory protein, putative [Medicago truncatula]
Length=594

 Score =   447 bits (1149),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 271/510 (53%), Positives = 350/510 (69%), Gaps = 29/510 (6%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg----kpKFLMTELVPCGWV  1557
             DY DA+I VE I VG++R ILA+RSQFFHE FKK K         KP++LM ELVP G V
Sbjct  65    DYCDAEILVEEIPVGIHRCILASRSQFFHELFKKGKDGEVKDGKGKPRYLMKELVPYGSV  124

Query  1556  GYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELV  1377
             GYEAF+VFL+Y+YTGK KA PPEV+TCVDE+C H +CRPAI++A++LMYAS+TFQ+KEL 
Sbjct  125   GYEAFIVFLHYLYTGKLKAPPPEVTTCVDEACIHDSCRPAINFALELMYASSTFQMKELA  184

Query  1376  MLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAI  1197
             ++ QR L   VD A +EDVIPIL+    C    L+  C++RV  S+++   LE ELP  +
Sbjct  185   LVFQRCLLNYVDKALVEDVIPILMAAHHCKQDQLLSHCIQRVARSDMEIIYLERELPHEV  244

Query  1196  SSDIKARRLNQQG-------------ANEKKIRKILRALDCNDVELVKLLLEESDITLDD  1056
              ++IK+ R+                  ++K IRKIL+ALD +DVEL+KLLL+ES +TLDD
Sbjct  245   VTEIKSLRVQSLPESTPDSMEVEPVIVSDKSIRKILKALDSDDVELLKLLLDESSVTLDD  304

Query  1055  ayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGAS  876
             AYA+HYA AYC+SKVV EVL LG  D+ L+N RGYTVLHVAARRKDP+I+VA+L K+GA 
Sbjct  305   AYALHYACAYCDSKVVQEVLTLGLADILLKNPRGYTVLHVAARRKDPSILVALL-KNGAC  363

Query  875   IRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVM----MNGNPVS  708
               + T  +G TA++IC+R TR KDY++ T  G+E + DRLC+DVLE  M    M+ N   
Sbjct  364   ASETTL-DGQTALSICQRLTRRKDYHEKTATGKESHKDRLCVDVLEREMRRSSMSVNMEV  422

Query  707   LPSSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGN  528
             L   T   +DL M L +LENRVA A   YP EAR+ +E A ADST  +   + ++   GN
Sbjct  423   LSQLTA--DDLHMRLDYLENRVAFATLFYPAEARVAIENAGADSTPRYASSTALK---GN  477

Query  527   LKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESG  348
             +K V L   P  + ++L  R ++L K VE GRRFF +CS+VLDK   DD+ D    LE G
Sbjct  478   IKEVDLNETPSVRTRKLQLRLQSLLKIVENGRRFFPHCSEVLDKYLDDDMPDVF-VLEKG  536

Query  347   TPEEQTNKKRRYMELKEEVMKAFDKDMAQN  258
             T EEQ  KK R+MELK+EV KAF KDMA+N
Sbjct  537   TEEEQRAKKARFMELKDEVQKAFHKDMAEN  566



>gb|ACU78081.1| NPR1-like protein [Malus hupehensis]
Length=586

 Score =   446 bits (1147),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 278/517 (54%), Positives = 353/517 (68%), Gaps = 24/517 (5%)
 Frame = -2

Query  1745  IDPGEYEDYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdgk--pKFLMTELV  1572
             IDPG   DY+DADI VEGI VGV+R ILA+RS FF E F++ K     +  PK+ M++ +
Sbjct  56    IDPGC--DYSDADIVVEGIPVGVHRCILASRSGFFRELFRREKGSSGKEDRPKYCMSDFL  113

Query  1571  PCGWVGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQ  1392
             P G VGYEAF+VFL+YVYTGK K SP EVSTCV   C H ACRPAI++ V+LMYA++ FQ
Sbjct  114   PYGDVGYEAFLVFLSYVYTGKLKPSPVEVSTCVHNVCAHDACRPAINFVVELMYAASIFQ  173

Query  1391  IKELVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENE  1212
             + +LV + +R L   V  A  ++V+PILLV F C L  L+++CV RV  S++++ +LE  
Sbjct  174   MPDLVSIFERRLLNFVGKALSDNVVPILLVAFHCQLNQLIDQCVDRVARSDINDISLEKG  233

Query  1211  LPGAISSDIKARRLNQQ-----------GANEKKIRKILRALDCNDVELVKLLLEESDIT  1065
             LP  +   IK  R N Q             +EK+IR+I +ALD +DVELVK LL ES+IT
Sbjct  234   LPDEVVKKIKILRRNYQQDSDPNLSPADPLHEKRIRRIHKALDSDDVELVKPLLTESNIT  293

Query  1064  LDDayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKS  885
             LD+A A+HYAAAYC+ KVV EVL LG  D+NLRN+RGYTVLH+A  RK+P+IIV +L K 
Sbjct  294   LDEANALHYAAAYCDPKVVTEVLALGLADVNLRNSRGYTVLHIAVMRKEPSIIVLLLTK-  352

Query  884   GASIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPV--  711
             GA   + T S+G +AV+ICRR TRPKDY+   E+G+E N DR+CIDVLE  M   NP+  
Sbjct  353   GARASELT-SDGQSAVSICRRLTRPKDYHSKAEQGQEANKDRICIDVLEREMRR-NPMAG  410

Query  710   -SLPSSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLC  534
              +  SS  + +DL MEL  LENRVALAR  +P EA++ M IAHA+++ EF   S  +G  
Sbjct  411   DASISSQIMPDDLHMELLNLENRVALARLFFPAEAKLAMVIAHAETS-EFAAPSSSKGSS  469

Query  533   GNLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLE  354
             GNL  V L   P  Q KRL  R EAL KTV LGR +F +CS+VLDK   DD L  L  LE
Sbjct  470   GNLMEVDLNETPTVQSKRLHSRLEALMKTVRLGRCYFPHCSEVLDKFIDDD-LPHLFYLE  528

Query  353   SGTPEEQTNKKRRYMELKEEVMKAFDKDMAQ-NRVGL  246
              G+ +EQ  K+RR+MELKEEV KAFDKD A+ N  GL
Sbjct  529   PGSSDEQKVKRRRFMELKEEVQKAFDKDKAECNLSGL  565



>gb|ABN45747.1| nonexpressor of pathogenesis-related genes 3 [Nicotiana glutinosa]
 gb|ADI52630.1| nonexpressor of pathogenesis-like protein 3 [Nicotiana glutinosa]
Length=588

 Score =   446 bits (1146),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 262/503 (52%), Positives = 354/503 (70%), Gaps = 19/503 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkd--cdgkpKFLMTELVPCGWVGY  1551
             D++DA+I VEG+ +GV+R ILAARS+FF + F+K K     +GKP++ MT+++P G VGY
Sbjct  64    DFSDAEIVVEGVSLGVHRCILAARSKFFQDLFRKEKGSCGKEGKPRYSMTDILPYGKVGY  123

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF+ FL+Y+Y+GK K  PPEVSTC D  C H +CRPAI ++V+LMYAS+ FQ+ ELV L
Sbjct  124   EAFLTFLSYLYSGKLKHFPPEVSTCTDTICAHDSCRPAISFSVELMYASSVFQVPELVSL  183

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
               R L   V  A +EDVIPIL V F C L+ L+  CV RV  S+L+   +E E+P  ++ 
Sbjct  184   FLRRLINFVGKALVEDVIPILRVAFHCQLSELLTHCVDRVARSDLEIICIEKEVPFEVAE  243

Query  1190  DIKARRLNQQ----------GANEKKIRKILRALDCNDVELVKLLLEESDITLDDayavh  1041
              IK+ R   Q            +EK+  +I +ALD +DVELVKLLL+ES+I+LD+AYA+H
Sbjct  244   SIKSLRPKCQVDESKVLPVDPLHEKRKNRIYKALDSDDVELVKLLLDESEISLDEAYALH  303

Query  1040  yaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDAT  861
             YA AYC+ KVV +VLGL   D+NLRN RGYTVLH+AA RK+P IIV++L K GA + + T
Sbjct  304   YAVAYCDPKVVTDVLGLDVADVNLRNTRGYTVLHIAAMRKEPTIIVSLLTK-GAHVSEIT  362

Query  860   CSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPV---SLPSSTT  690
               +G +AV+ICRR TRPK+Y+  TE+G+E N DR+CIDVLE   M+ NP+   +L SS  
Sbjct  363   L-DGQSAVSICRRLTRPKEYHAKTEQGQEANKDRVCIDVLER-EMHHNPMAGDALFSSQM  420

Query  689   LENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVGL  510
             L +DL M+L++LENRVA AR L+P EAR+ M+IA+A++  EF G    +   GNL+ V L
Sbjct  421   LADDLHMKLHYLENRVAFARLLFPLEARLAMQIANAETAAEFAGRLASKSSSGNLREVDL  480

Query  509   TGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQT  330
                P  Q +RL+ R +AL KTVE G+R+F +CS VLDK   DD+ D L  LE GTPEEQ 
Sbjct  481   NETPIKQKERLLSRMQALSKTVEFGKRYFPHCSQVLDKFMEDDLPD-LIFLEMGTPEEQK  539

Query  329   NKKRRYMELKEEVMKAFDKDMAQ  261
              K++R+ ELK++V +AF+KD A+
Sbjct  540   IKRKRFKELKDDVQRAFNKDKAE  562



>ref|XP_004303898.1| PREDICTED: regulatory protein NPR3-like [Fragaria vesca subsp. 
vesca]
Length=591

 Score =   446 bits (1146),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 277/512 (54%), Positives = 351/512 (69%), Gaps = 33/512 (6%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkak--kdcdgkpKFLMTELVPCGWVGY  1551
             DY+DADI VEG+ VGVNR ILAARSQFFHE FKK       +GKP+++M+ELVP G VG 
Sbjct  58    DYSDADIVVEGVPVGVNRCILAARSQFFHEHFKKGNDDSKKEGKPQYMMSELVPYGGVGC  117

Query  1550  EAFMVFLNYVYTGKTKASPPEVST---CVDESCDHYACRPAIDYAVQLMYASATFQIKEL  1380
             EAF V LNY+YTGK K  PPEVST   CVD+ C H +C PAI+YAV+L+YA+ATFQ+KEL
Sbjct  118   EAFKVVLNYLYTGKLKPPPPEVSTVSTCVDDGCAHDSCGPAINYAVELLYAAATFQMKEL  177

Query  1379  VMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGA  1200
             V ++QR L   V+ A +EDVIPIL+  F C    L+  C++RV  S+LDN  LE ELP  
Sbjct  178   VQVVQRRLTNFVEKALVEDVIPILVASFHCKQNQLLSHCIQRVERSDLDNVVLEKELPHK  237

Query  1199  ISSDIKARRLNQQGANE--------------KKIRKILRALDCNDVELVKLLLEES-DIT  1065
             +  +IK+ RL  Q   +              K IR I  ALD +DVELV  LL+ES   T
Sbjct  238   VFINIKSLRLEYQKMADSIMVEMEPVEDKRLKSIRNIHMALDTDDVELVTRLLDESGSST  297

Query  1064  LDDayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKS  885
             LDDA A+HYA AYC+ K+V EVLGL   + NLRNARG+TVLHVAARRKDPA++V +L+ S
Sbjct  298   LDDACALHYAVAYCDPKIVKEVLGLRLGNTNLRNARGHTVLHVAARRKDPAVLVPLLN-S  356

Query  884   GASIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMM-NGNPVS  708
             GAS  + T S+G TAV ICRR TRPKDY + T++GE  N DR+CID+LE  M  N   V+
Sbjct  357   GASALEIT-SDGQTAVAICRRLTRPKDYYENTKQGEVSNKDRICIDLLEREMQRNSMAVN  415

Query  707   LP-SSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGM--EGL  537
             +  +S  + +DL + L + ENRVA AR L+P EA++ ME+A   +T    G +G+  +G 
Sbjct  416   MSNTSYVMADDLPVRLDYFENRVAFARLLFPAEAKLAMEVADHPTT----GYTGLPSKGS  471

Query  536   CGNLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDK-LTADDVLDSLES  360
              GNL+ V L   P  + KRL E+ +AL KTVE+GRRFF  CS+VLDK L A D+ D    
Sbjct  472   SGNLREVDLNETPSVRSKRLQEKLQALIKTVEMGRRFFPQCSEVLDKFLDAMDMADYF--  529

Query  359   LESGTPEEQTNKKRRYMELKEEVMKAFDKDMA  264
             LE GTPEEQ NKK R++ELK++V KAF +D+A
Sbjct  530   LEKGTPEEQKNKKMRFLELKDDVQKAFCRDVA  561



>ref|XP_010655930.1| PREDICTED: regulatory protein NPR3 isoform X2 [Vitis vinifera]
Length=478

 Score =   441 bits (1134),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 259/463 (56%), Positives = 328/463 (71%), Gaps = 21/463 (5%)
 Frame = -2

Query  1586  MTELVPCGWVGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYA  1407
             M++ +P G VGYEAF++FL+Y+YTGK KASP EVSTCVD  C H ACRPAID++V+LMYA
Sbjct  1     MSDFLPYGKVGYEAFLIFLSYLYTGKLKASPLEVSTCVDTGCAHDACRPAIDFSVELMYA  60

Query  1406  SATFQIKELVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNF  1227
             SA FQ+ ELV L QR L   +  A +EDVIPIL+V + C  + LV +CV RV  S+LD+ 
Sbjct  61    SAIFQVPELVSLFQRRLTNFIGKALLEDVIPILVVAYHCKSSVLVNQCVDRVARSDLDSI  120

Query  1226  TLENELPGAISSDIKARRLNQQ-----------GANEKKIRKILRALDCNDVELVKLLLE  1080
             +LE +LP  ++  IK  RL  Q             +EK++R+IL+ALD +DVELVKLLL 
Sbjct  121   SLEKDLPYEVAESIKLLRLKSQPDDECNTVPVDPVHEKRVRRILKALDSDDVELVKLLLS  180

Query  1079  ESDITLDDayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVA  900
             ES ITLD+AYA+HYAAAYC+ KVV+EVL LG  D+N  N RGYTVLHVAA RK+P+IIV+
Sbjct  181   ESGITLDEAYALHYAAAYCDPKVVSEVLSLGLADVNRHNPRGYTVLHVAAMRKEPSIIVS  240

Query  899   ILDKSGASIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNG  720
             +L K GA   + T S+G +AV+ICRR TRPKDY+   E+G+E N DR+CIDVLE   M  
Sbjct  241   LLTK-GAHASERT-SDGQSAVSICRRLTRPKDYHAKMEQGQETNKDRICIDVLER-EMRR  297

Query  719   NP----VSLPSSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLS  552
             NP    VS+ SS T+ +DL M+L +LENRVA AR  +P EA++ MEIAHA++T EF GLS
Sbjct  298   NPLAGDVSI-SSPTMADDLHMKLLYLENRVAFARLFFPSEAKLAMEIAHAETTSEFAGLS  356

Query  551   GMEGLCGNLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLD  372
               +   GNL+ V L   P  Q +RL  R  AL KTVE+GRR+F +CS VLDK   DD+ D
Sbjct  357   ASKRSSGNLREVDLNETPIMQNQRLRSRMNALVKTVEMGRRYFPHCSQVLDKFMEDDLPD  416

Query  371   SLESLESGTPEEQTNKKRRYMELKEEVMKAFDKDMAQ-NRVGL  246
              L  LE GT +EQ  K+ R+MELKE+V +AF KD A+ NR GL
Sbjct  417   -LFYLEKGTLDEQRIKRTRFMELKEDVQRAFTKDKAEFNRSGL  458



>ref|XP_007048936.1| NPR1-like protein 3, putative [Theobroma cacao]
 gb|EOX93093.1| NPR1-like protein 3, putative [Theobroma cacao]
Length=583

 Score =   445 bits (1144),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 278/509 (55%), Positives = 356/509 (70%), Gaps = 37/509 (7%)
 Frame = -2

Query  1724  DYNDADIEVEG-ILVGVNRGILAARSQFFHEEFkk----akkdcdgkpKFLMTELVPCGW  1560
             DY+DA+I VEG I VGVNR ILAARSQ+FHE F+K       + +GKP++LM+ELVP G 
Sbjct  63    DYSDAEIVVEGNIAVGVNRCILAARSQYFHELFRKGRDDNSMNKEGKPQYLMSELVPHGR  122

Query  1559  VGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKEL  1380
             VGYEAF VFLNY+YTGK K SP EVSTC+D++C H AC P I YA++LMYASATFQ+KEL
Sbjct  123   VGYEAFKVFLNYLYTGKVKPSPREVSTCMDDACAHDACGPLITYALELMYASATFQMKEL  182

Query  1379  VMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGA  1200
             V+L+QRHL   V  A +EDVIPIL+  F   L PL+  C++RV +S+LD+  LE ELPG 
Sbjct  183   VLLVQRHLLNSVGKALVEDVIPILVAAFHYKLNPLLYDCIQRVATSDLDDACLEKELPGE  242

Query  1199  ISSDIKARRL--NQQGAN----------EKKIRKILRALDCNDVELVKLLLEESDITLDD  1056
             +  +I++ RL  ++Q A           EK+IR+I +ALD +DVEL++LLL ES++TLDD
Sbjct  243   VYHEIRSVRLKSHKQEAEPGAVELDPMLEKRIRRIHKALDSDDVELLRLLLTESNVTLDD  302

Query  1055  ayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGAS  876
             AYA+HYAAAYC+ KVVNEVL LG  ++NLRN RGYTVL VAARRK+P+++VA+L+K GA 
Sbjct  303   AYALHYAAAYCDPKVVNEVLSLGSANVNLRNPRGYTVLQVAARRKEPSVLVALLNK-GAY  361

Query  875   IRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNG--NPVSLP  702
             + + T  +G TAV ICRR TRPKDYN+  ++GE  N DRLCIDVLE  M N   +     
Sbjct  362   VAETT-PDGQTAVAICRRLTRPKDYNENKKQGELSNKDRLCIDVLEREMRNSVESYNQGV  420

Query  701   SSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLK  522
             SS  + +DL M+L + ENRV+ AR L+P EA++ MEIA ADS               N++
Sbjct  421   SSQVMHDDLHMKLDYYENRVSFARLLFPAEAKLAMEIADADS---------------NIR  465

Query  521   GVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTP  342
              V L   P  Q KRL  R + L +TVE GRR+F  CSDVLDK   DD+ D    +E G+ 
Sbjct  466   EVNLNESPSIQTKRLQLRLQTLLRTVETGRRYFPLCSDVLDKFLVDDMSDP-SLVEEGSS  524

Query  341   EEQTNKKRRYMELKEEVMKAFDKDMAQNR  255
             EEQ  KKRR+ ELKEE+ +AF KD+ Q +
Sbjct  525   EEQRLKKRRFTELKEELQQAFYKDIEQKK  553



>ref|XP_007214668.1| hypothetical protein PRUPE_ppa003290mg [Prunus persica]
 gb|EMJ15867.1| hypothetical protein PRUPE_ppa003290mg [Prunus persica]
Length=587

 Score =   445 bits (1144),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 276/504 (55%), Positives = 350/504 (69%), Gaps = 20/504 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdc--dgkpKFLMTELVPCGWVGY  1551
             DY+DADI VEGI VGV+R ILA+RS FF + FK+ K     + + K+ +++L+P G V Y
Sbjct  61    DYSDADIIVEGISVGVHRCILASRSSFFRDLFKQKKGSSGKESRSKYCISDLLPYGDVRY  120

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF+VFL+YVYTGK K SP EVSTCV   C H ACRPAI++ V+LMYAS+ FQ+ +LV +
Sbjct  121   EAFLVFLSYVYTGKLKPSPMEVSTCVHNVCAHDACRPAINFVVELMYASSIFQMPDLVSI  180

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
              QR L   V  A  +DVIPIL+V   C L+ L+ +C+ RV  S++D+ +LE ELP  +  
Sbjct  181   FQRRLLNFVGKALADDVIPILVVALHCQLSQLITQCIERVARSDIDSISLEKELPDEVIE  240

Query  1190  DIKARRLNQQG-----------ANEKKIRKILRALDCNDVELVKLLLEESDITLDDayav  1044
              IK  R N Q             +EK+IR+I +ALD +DVELVKLLL ES ITLD+A A+
Sbjct  241   KIKILRRNSQQDCDPNMPAVDPLHEKRIRRIHKALDSDDVELVKLLLSESAITLDEANAL  300

Query  1043  hyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDA  864
             HYAAAYC+ KVV EVLGLG  D+NLRN+RGYTVLH+A  RK+P+IIV +L K GA   + 
Sbjct  301   HYAAAYCDPKVVTEVLGLGLADVNLRNSRGYTVLHIAVMRKEPSIIVLLLTK-GACASEL  359

Query  863   TCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNP---VSLPSST  693
             T S+G +AV+ICRR TRPKDY+  TE+G+E N DR+CIDVLE   M  NP   V+  SS 
Sbjct  360   T-SDGQSAVSICRRLTRPKDYHSKTEQGQEANKDRICIDVLER-EMRRNPMAGVTSISSQ  417

Query  692   TLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVG  513
              + +DL M+L  LENRVA AR L+P EA++ M IAHA++T EF G S  +G  GNL  V 
Sbjct  418   IMPDDLHMKLLNLENRVAFARLLFPAEAKLAMVIAHAETTSEFAGRSSSKGSSGNLMEVD  477

Query  512   LTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQ  333
             L   P  Q KRL  R EAL KTV+LGR +F +CS+VLDK   DD+ D L  LE GT +EQ
Sbjct  478   LNETPTVQNKRLHSRLEALMKTVDLGRCYFPHCSEVLDKFIEDDLPD-LFYLEMGTSDEQ  536

Query  332   TNKKRRYMELKEEVMKAFDKDMAQ  261
               K+ R+MELKEEV KAF+KD A+
Sbjct  537   KIKRMRFMELKEEVHKAFNKDKAE  560



>ref|XP_010942675.1| PREDICTED: regulatory protein NPR3-like [Elaeis guineensis]
Length=604

 Score =   445 bits (1145),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 268/508 (53%), Positives = 349/508 (69%), Gaps = 25/508 (5%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg-------kpKFLMTELVPC  1566
             D +DA+I VEG+ VGV+R ILAARS+FFH+ F  A     G       KP++ ++ELVPC
Sbjct  73    DCSDAEIVVEGVPVGVHRCILAARSRFFHDLFSGAGAGAGGGCRQEGGKPRYEISELVPC  132

Query  1565  GWVGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIK  1386
             G VG EAFM FL+Y+YTGK + +PPEVS CVD  C H ACRPAI++ V+L+YAS+ FQI 
Sbjct  133   GRVGREAFMNFLSYLYTGKLRPAPPEVSVCVDPMCAHDACRPAINFVVELLYASSVFQIP  192

Query  1385  ELVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELP  1206
             ELV L+QR L   V+ A +EDVIPILLV     L  L+  C++R+  S+LDN +L+ +LP
Sbjct  193   ELVSLLQRRLLNFVEKALVEDVIPILLVAVHSQLNQLLSHCIKRIARSDLDNISLDKQLP  252

Query  1205  GAISSDIKARRLNQQ----------GANEKKIRKILRALDCNDVELVKLLLEESDITLDD  1056
                + +IK  R   Q            +EK+IR+I RALD +DVELVKLLL ESDITLDD
Sbjct  253   HEAAEEIKLIRRKAQPDEPNSSIVDPIHEKRIRRIHRALDSDDVELVKLLLSESDITLDD  312

Query  1055  ayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGAS  876
             A A+HYAAAYC+SKVV+E+L LG  ++NL+N RGYT LHVAA R++PAIIV++L K GAS
Sbjct  313   ANAIHYAAAYCDSKVVSELLELGSANVNLKNDRGYTPLHVAAMRREPAIIVSLLTK-GAS  371

Query  875   IRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVSLPSS  696
               + T S+G +AV ICRR TR KDYN  T++ +E N DR+CID+LE   M  NP+++  +
Sbjct  372   ASETT-SDGQSAVMICRRLTRAKDYNTKTQQCQESNKDRVCIDILER-EMRRNPMAVEDA  429

Query  695   TT---LENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNL  525
              T   L +DL M+L +LENRVA AR  +P EA++ MEIA A++T E  GL        NL
Sbjct  430   VTSPLLADDLQMKLLYLENRVAFARLFFPTEAKVAMEIAQAETTSELRGLLTSRS-SSNL  488

Query  524   KGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGT  345
             + V L   P  Q KRL  R ++L KTV+LGRR+F +CS VLDK    D+ D L  L+ GT
Sbjct  489   REVDLNETPTMQNKRLRSRVDSLTKTVDLGRRYFPHCSQVLDKFLEQDLPD-LCYLQKGT  547

Query  344   PEEQTNKKRRYMELKEEVMKAFDKDMAQ  261
             P+EQ  K+ R+ ELKE+V KAF+KD A+
Sbjct  548   PDEQKIKRMRFCELKEDVRKAFNKDKAE  575



>gb|KHG09335.1| Regulatory NPR3 -like protein [Gossypium arboreum]
Length=583

 Score =   443 bits (1140),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 276/512 (54%), Positives = 356/512 (70%), Gaps = 25/512 (5%)
 Frame = -2

Query  1721  YNDADIEVEGILVGVNRGILAARSQFFHEEFkkak-----kdcdgkpKFLMTELVPCGWV  1557
             ++DAD+ VEG+ VGV+R ILA RS+FF E F K        + +GKP + M E +P G +
Sbjct  58    FSDADVVVEGVSVGVHRCILAVRSKFFKELFDKKNNNNGCVEKEGKPSYNMNEFLPYGKI  117

Query  1556  GYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELV  1377
             G EAF VFL+Y+YTGK KASP EVSTCVD  C H ACRPAID+AV+LMYAS+ FQI E+V
Sbjct  118   GLEAFQVFLSYLYTGKLKASPMEVSTCVDTHCAHDACRPAIDFAVELMYASSIFQIPEMV  177

Query  1376  MLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAI  1197
              L QR L   VD A +ED+IPIL+V F C  + LV +CV RVT S+LD+ ++E ELP  +
Sbjct  178   SLFQRRLLNFVDKALVEDMIPILVVAFHCQCSQLVSQCVERVTRSDLDSISIEKELPYEV  237

Query  1196  SSDIKARRLNQQGA-----------NEKKIRKILRALDCNDVELVKLLLEESDITLDDay  1050
             +  I+  R                  EK+IR+I +ALD +DVELVKLLL ESD+TLDDA 
Sbjct  238   AESIRLLRCKPPTEAEDSEAVVVPLREKQIRRIQKALDSDDVELVKLLLTESDVTLDDAT  297

Query  1049  avhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIR  870
             A+HYAAAYC+ KVV+E+L L   D+N RN+RGYTVLH+AA RK+P++I+++L K GAS  
Sbjct  298   ALHYAAAYCDPKVVSEILALRLADVNRRNSRGYTVLHIAAMRKEPSVIMSLLAK-GASAS  356

Query  869   DATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVS---LPS  699
             + T  +G +A  IC+R TRPKDY+  TE+G+E N DR+CIDVLE   M  NP++     +
Sbjct  357   ELTL-DGRSAFNICQRLTRPKDYHAKTEQGKETNKDRICIDVLER-EMRRNPMAGDVSVT  414

Query  698   STTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKG  519
             S T+ +D+ M L +LENRVA AR L+P EA++ M+IAHA+ T EF GLS  +G  GNL  
Sbjct  415   SHTMADDMHMRLLYLENRVAFARLLFPSEAKLAMDIAHAERTSEFSGLSS-KGSNGNLSQ  473

Query  518   VGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPE  339
             V L   P  Q KRL+ R EAL KTVE+GRR+F +CS+VLDK   DD+ D L  LE G+ E
Sbjct  474   VDLNETPVMQKKRLLARMEALMKTVEMGRRYFPHCSEVLDKFMEDDLPD-LFYLERGSLE  532

Query  338   EQTNKKRRYMELKEEVMKAFDKDMAQ-NRVGL  246
             EQ  K+ R+ ELKE+V KAF+KD A+ NR GL
Sbjct  533   EQKLKRSRFRELKEDVQKAFNKDKAEFNRNGL  564



>gb|ADP95762.1| npr1 protein [Malus hupehensis]
Length=586

 Score =   443 bits (1139),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 276/511 (54%), Positives = 349/511 (68%), Gaps = 23/511 (5%)
 Frame = -2

Query  1745  IDPGEYEDYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdgk--pKFLMTELV  1572
             IDPG   DY+DADI VEGI VGV+R ILA+RS FF E FK+ K     +  PK+ M++ +
Sbjct  56    IDPGC--DYSDADIVVEGIPVGVHRCILASRSGFFRELFKREKGSSGKEDRPKYCMSDFL  113

Query  1571  PCGWVGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQ  1392
             P G VGYEAF+VFL+YVYTGK K SP EVSTCV   C H ACRPAI++  +L YA++ FQ
Sbjct  114   PYGDVGYEAFLVFLSYVYTGKLKPSPVEVSTCVHNVCAHDACRPAINFVEELTYAASIFQ  173

Query  1391  IKELVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENE  1212
             + +LV + +R L   V  A  ++V+PILLV F C L  L+++CV RV  S++D+ +LE  
Sbjct  174   MPDLVSIFERRLLNFVGKALSDNVVPILLVAFHCQLNQLIDQCVDRVARSDIDDISLEKG  233

Query  1211  LPGAISSDIKARRLNQQ-----------GANEKKIRKILRALDCNDVELVKLLLEESDIT  1065
             LP  +   IK  R N Q             +EK+IR+I +ALD +DVELVKLLL ES+IT
Sbjct  234   LPDEVVKKIKILRRNYQQDSDPNLPPADPLHEKRIRRIHKALDSDDVELVKLLLTESNIT  293

Query  1064  LDDayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKS  885
             LD+A A+HYAAAYC+ KVV EVL LG  D+NLRN+RGYT LH+A  RK+P+IIV +L K 
Sbjct  294   LDEANALHYAAAYCDPKVVTEVLALGLADVNLRNSRGYTALHIAVMRKEPSIIVLLLTK-  352

Query  884   GASIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPV--  711
             GA   + T S+G +AV+ICRR TRPKDY+  TE+G+E N DR+CIDVLE  M   NP+  
Sbjct  353   GARASELT-SDGQSAVSICRRLTRPKDYHSKTEQGQEANKDRICIDVLEREMRR-NPMAG  410

Query  710   -SLPSSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLC  534
              +  SS  + +DL MEL  LENRVALAR  +P EA++ M IAHA+++ EF   S  +G  
Sbjct  411   DASISSQIMPDDLHMELLNLENRVALARLFFPAEAKLAMVIAHAETS-EFAAPSSSKGSS  469

Query  533   GNLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLE  354
             GNL  V L   P  Q KRL  R EAL KTV LGR +F +CS+VLDK   DD L  L  LE
Sbjct  470   GNLMEVDLNETPTVQNKRLHSRLEALMKTVRLGRCYFPHCSEVLDKFIDDD-LPHLFYLE  528

Query  353   SGTPEEQTNKKRRYMELKEEVMKAFDKDMAQ  261
              G+ +EQ  K+RR+MELKEEV KAFDKD A+
Sbjct  529   PGSSDEQKVKRRRFMELKEEVQKAFDKDKAE  559



>ref|XP_009341186.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Pyrus x bretschneideri]
Length=580

 Score =   441 bits (1135),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 262/503 (52%), Positives = 351/503 (70%), Gaps = 20/503 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkak--kdcdgkpKFLMTELVPCGWVGY  1551
             DY+DA+I VEG+ V V+R ILA+RS+FF E F++     + +GKPK+ M++L+P G VGY
Sbjct  57    DYSDAEITVEGVPVAVHRCILASRSEFFAELFRRENGDSEKEGKPKYCMSDLLPFGHVGY  116

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF+VFL++VYT K +  P EVS+CV   C H ACRPAI++A++LM AS+ F + +LV +
Sbjct  117   EAFLVFLSFVYTAKVRDFPVEVSSCVHNVCGHEACRPAIEFALELMCASSVFGMPDLVSI  176

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
             +QR L   V  A  +DVIPIL+V F C L+ L+++C+ RV  S+LD+ +LE  LP  ++ 
Sbjct  177   LQRQLIDFVVKALADDVIPILVVAFHCQLSQLIDQCIERVAHSDLDSISLEKTLPDEVAE  236

Query  1190  DIKARRLNQQGA-----------NEKKIRKILRALDCNDVELVKLLLEESDITLDDayav  1044
              IK  R N Q              EK+IR+I +ALD +DVEL+KLLL ESD+TLD+A A+
Sbjct  237   KIKILRRNSQHCCDPNMPAVDPLREKRIRRIHKALDSDDVELMKLLLTESDVTLDEANAL  296

Query  1043  hyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDA  864
             HYAAAYC+ KVV EVLGLG  D+NLR++RGYTVLH+A  RK+P+II+ +L  +GA   + 
Sbjct  297   HYAAAYCDPKVVAEVLGLGLADVNLRDSRGYTVLHIAMMRKEPSIIILLL-SNGARASEP  355

Query  863   TCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVSLPSSTTLE  684
             T   G +AV+ICRR TRPKDY+  TE G+E N DR+CIDVLE  M   NP++  +S + +
Sbjct  356   TL-EGESAVSICRRLTRPKDYHTKTERGQEANKDRICIDVLEREMQR-NPMAGEASISSQ  413

Query  683   ---NDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVG  513
                NDL M L  LENRVA AR L+P EA++ M I+ AD+T EF G+S ++G  GNL  V 
Sbjct  414   ITPNDLHMRLLKLENRVAFARLLFPAEAKLAMAISQADTTPEFAGISSLKGSSGNLMEVD  473

Query  512   LTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQ  333
             L   P  Q KRL+ R E+L KTV +GR +F +CS+VLDK    D+ D L  LE+GT +EQ
Sbjct  474   LNETPTVQNKRLLSRLESLVKTVSMGRHYFPHCSEVLDKFLQVDLPD-LCVLETGTTDEQ  532

Query  332   TNKKRRYMELKEEVMKAFDKDMA  264
               K+RR++ELKEEV KAFDKD A
Sbjct  533   KIKRRRFLELKEEVQKAFDKDKA  555



>ref|XP_009357280.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Pyrus x bretschneideri]
Length=580

 Score =   440 bits (1132),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 262/503 (52%), Positives = 350/503 (70%), Gaps = 20/503 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkak--kdcdgkpKFLMTELVPCGWVGY  1551
             DY+DA+I VEG+ V V+R ILA+RS+FF E F++     + +GKPK+ M++L+P G VGY
Sbjct  57    DYSDAEITVEGVPVAVHRCILASRSEFFAELFRRENGDSEKEGKPKYCMSDLLPFGHVGY  116

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF+VFL++VYT K +  P EVS+CV   C H ACRPAI++A++LM AS+ F + +LV +
Sbjct  117   EAFLVFLSFVYTAKVRDFPVEVSSCVHNVCGHEACRPAIEFALELMCASSVFGMPDLVSI  176

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
             +QR L   V  A  +DVIPIL+V F C L+ L+++C+ RV  S+LD+ +LE  LP  +  
Sbjct  177   LQRQLIDFVVKALADDVIPILVVAFHCQLSQLIDQCIERVAHSDLDSISLEKTLPDEVVE  236

Query  1190  DIKARRLNQQGA-----------NEKKIRKILRALDCNDVELVKLLLEESDITLDDayav  1044
              IK  R N Q              EK+IR+I +ALD +DVEL+KLLL ESD+TLD+A A+
Sbjct  237   KIKILRRNSQHCCDPNMPAVDPLREKRIRRIHKALDSDDVELMKLLLTESDVTLDEANAL  296

Query  1043  hyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDA  864
             HYAAAYC+ KVV EVLGLG  D+NLR++RGYTVLH+A  RK+P+II+ +L  +GA   + 
Sbjct  297   HYAAAYCDPKVVAEVLGLGLADVNLRDSRGYTVLHIAMMRKEPSIIILLL-SNGARASEP  355

Query  863   TCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVSLPSSTTLE  684
             T   G +AV+ICRR TRPKDY+  TE G+E N DR+CIDVLE  M   NP++  +S + +
Sbjct  356   TL-EGESAVSICRRLTRPKDYHTKTERGQEANKDRICIDVLEREMQR-NPMAGEASISSQ  413

Query  683   ---NDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVG  513
                NDL M L  LENRVA AR L+P EA++ M I+ AD+T EF G+S ++G  GNL  V 
Sbjct  414   ITPNDLHMRLLKLENRVAFARLLFPAEAKLAMAISQADTTPEFAGISSLKGSSGNLMEVD  473

Query  512   LTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQ  333
             L   P  Q KRL+ R E+L KTV +GR +F +CS+VLDK    D+ D L  LE+GT +EQ
Sbjct  474   LNETPTVQNKRLLSRLESLVKTVSMGRHYFPHCSEVLDKFLQVDLPD-LCVLETGTTDEQ  532

Query  332   TNKKRRYMELKEEVMKAFDKDMA  264
               K+RR++ELKEEV KAFDKD A
Sbjct  533   KIKRRRFLELKEEVQKAFDKDKA  555



>ref|XP_006857089.1| hypothetical protein AMTR_s00065p00106950 [Amborella trichopoda]
 gb|ERN18556.1| hypothetical protein AMTR_s00065p00106950 [Amborella trichopoda]
Length=411

 Score =   433 bits (1113),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 242/394 (61%), Positives = 307/394 (78%), Gaps = 20/394 (5%)
 Frame = +1

Query  2404  LLGNGG--GQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGK  2577
             + GN    G++PSR ELLS+V+KHSK LGKT V++ED SD EMD +FW ++ D+Y + G+
Sbjct  1     MFGNDSITGESPSRHELLSIVRKHSKLLGKTTVDDEDASDPEMDARFWQKMFDMYCIQGR  60

Query  2578  ESRGRQEDDLIFFVRKMSL-QGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRS  2754
             E + RQ+DDLIFFVR M L  GY  N + E+  PYFVRRW+P+L+ ++GE S  VDWRRS
Sbjct  61    EFKARQDDDLIFFVRHMGLYHGYGFNDSMEEVPPYFVRRWAPELEKVVGEKSAEVDWRRS  120

Query  2755  YYLNLIAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKE  2934
              YLNLIAHT+++VTVAICS + L+++Q G D PLSP+YKV KTVYASPSR++F LDSRK+
Sbjct  121   VYLNLIAHTSYTVTVAICSIQALRSHQKGADTPLSPVYKVTKTVYASPSRVDFQLDSRKD  180

Query  2935  VETTPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFP----------SDSS  3084
             VET PAYP+ICFAVDDFD+TFDAVVL++ +HCYCV+LNA+DGAAFP          SD S
Sbjct  181   VETLPAYPNICFAVDDFDATFDAVVLSEFEHCYCVLLNAHDGAAFPNEKATEGSCSSDIS  240

Query  3085  QSETSGGKTQSSKITIFSGFVSYQMVRDAYDAGRTgfgsllslhss-gKTDRIYMKGPGG  3261
               +   GK ++SK+T+FSGFVSY+MVR+AYDAG++ FGSLLS+ +   K +R+YM+GPGG
Sbjct  241   NHDKDSGKPKTSKLTLFSGFVSYEMVREAYDAGKSRFGSLLSIGNLPAKVERLYMRGPGG  300

Query  3262  RGEVEVAVSGVVDQSKEEYGHHPP----KKGLs--fsavvrraasvasvaakhayaaasa  3423
             RGEVEVAVSG+ DQS +  G   P    K+GL      +VR+AA+VASVAAK AYAAAS+
Sbjct  301   RGEVEVAVSGIADQSAQMSGPPSPVQMSKRGLHIGIGTMVRKAATVASVAAKQAYAAASS  360

Query  3424  trssDEEMIPLKCCLMSISLPWEHIAHDLLLKGS  3525
             T+ SD  M+PLKCCLMSISLPWE++AHDLL K S
Sbjct  361   TKKSDHGMLPLKCCLMSISLPWENLAHDLLFKVS  394



>ref|XP_010273453.1| PREDICTED: uncharacterized protein LOC104608979 isoform X2 [Nelumbo 
nucifera]
Length=369

 Score =   431 bits (1107),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 245/395 (62%), Positives = 298/395 (75%), Gaps = 42/395 (11%)
 Frame = +1

Query  2404  LLGNGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKES  2583
             +LG+GG +TPSR+ELLSMV+KHS  LGKT V+E+D +D+EMD  FWH+ LDLYF+  +ES
Sbjct  1     MLGDGG-ETPSRYELLSMVRKHSNLLGKTSVDEDDGTDIEMDAGFWHDFLDLYFIRSRES  59

Query  2584  RGRQEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYL  2763
             RGRQ+DDL+FFVRKM+L GY  N N E+  PYFVRRW+PKL+ +LGEN V VDWRRS+YL
Sbjct  60    RGRQDDDLVFFVRKMNLHGYGFNDNMEELPPYFVRRWAPKLEKVLGENPVEVDWRRSFYL  119

Query  2764  NLIAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVET  2943
             NLIAHT+F+VTVAICS + L N+Q   D PLSPIYKVVKTVYASPSR+NFHLDS+K    
Sbjct  120   NLIAHTSFTVTVAICSIQALHNHQNEADTPLSPIYKVVKTVYASPSRVNFHLDSKK----  175

Query  2944  TPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDSSQS-----------  3090
                                  VLT+ DHCYCV+LNA+DGAAFP++               
Sbjct  176   ---------------------VLTETDHCYCVLLNAHDGAAFPTEKEVDGSSSSNKSSLT  214

Query  3091  -ETSGGKTQSSKITIFSGFVSYQMVRDAYDAGRTgfgsllslhssgKTDRIYMKGPGGRG  3267
              +T  G+ + SK+T+FSGFVSYQMVRDAY+AG++ FGSLLS+    K DR+YMKGPGGRG
Sbjct  215   IDTDSGRVKKSKLTLFSGFVSYQMVRDAYEAGKSRFGSLLSIGHIPKPDRLYMKGPGGRG  274

Query  3268  EVEVAVSGVVDQSKEEYGHHPP----KKGLsfsavvrraasvasvaakhayaaasatrss  3435
             EVEVAVSGV DQS++  G H P    ++G    ++VRRAAS ASVAAKHAYAAA+AT   
Sbjct  275   EVEVAVSGVADQSQQFSGPHSPLQISQRGFGIGSIVRRAASAASVAAKHAYAAAAATMRP  334

Query  3436  DEEMIPLKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
             D+EM+PLKCCLMSISLPWEHIA+DLL KG+PPV+L
Sbjct  335   DDEMLPLKCCLMSISLPWEHIAYDLLFKGNPPVSL  369



>ref|XP_008787319.1| PREDICTED: regulatory protein NPR3-like [Phoenix dactylifera]
Length=585

 Score =   439 bits (1128),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 270/505 (53%), Positives = 341/505 (68%), Gaps = 25/505 (5%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkk---akkdcdgkpKFLMTELVPCGWVG  1554
             D +DA++ VEG  VG++R ILAARS+FFH+ F +     +   GKP++ M ELVPCG VG
Sbjct  61    DCSDAEVVVEGAPVGIHRCILAARSRFFHDLFSRGGGRYRPEGGKPRYQMGELVPCGRVG  120

Query  1553  YEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVM  1374
             YEAF+ FL+Y+YTGK K +P E S C D  C H ACRPA+++AV+LMYAS+ FQI ELV 
Sbjct  121   YEAFINFLSYIYTGKLKPAPQEASVCADPMCAHDACRPAVNFAVELMYASSVFQIPELVS  180

Query  1373  LIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAIS  1194
             L+QR L   V+ A +EDVIPILLV F   L  L+  C++RV  S LDN +LE ELP  ++
Sbjct  181   LLQRRLLNFVEKALVEDVIPILLVAFHSHLNQLLGHCMKRVARSYLDNISLEKELPHDVA  240

Query  1193  SDIKARRLNQQGAN----------EKKIRKILRALDCNDVELVKLLLEESDITLDDayav  1044
              +IK  R   Q             EK+IR I +ALD +DVELVKLLL ESDITLDDA A+
Sbjct  241   EEIKLIRHKAQPDEPNSLTVDPVLEKRIRGIHKALDSDDVELVKLLLSESDITLDDANAL  300

Query  1043  hyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDA  864
             HYAAAYC+SKVV E+L LG  ++NL+N RGYT LHVAA RK+PA+IV++L K GAS  + 
Sbjct  301   HYAAAYCDSKVVAELLELGSANVNLKNDRGYTPLHVAAMRKEPAVIVSLLTK-GASASET  359

Query  863   TCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVM----MNG-NPVSLPS  699
             T ++G +A  ICRR TR KDYN  T++G E N DR+CID+LE  M    M G + V LP 
Sbjct  360   T-ADGQSAAMICRRLTRAKDYNTKTQQGHESNKDRICIDILEREMRRNPMGGEDSVMLP-  417

Query  698   STTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKG  519
                L +DL M+L +LENRV  AR  +P EA++ MEI  A++T EF G         NL+ 
Sbjct  418   --LLADDLHMKLLYLENRVVFARLFFPTEAKVAMEITQAETTSEFTGHLASRS-SSNLRE  474

Query  518   VGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPE  339
             V L   P  Q KRL  R +AL KTVELGR FF +CS VLDK   +D+ D L  L+ GTP+
Sbjct  475   VDLNETPIMQNKRLCSRVDALAKTVELGRCFFPHCSQVLDKFIEEDLPDLL-YLQKGTPD  533

Query  338   EQTNKKRRYMELKEEVMKAFDKDMA  264
             EQ  K+RR+ ELKE+V KAF+KD A
Sbjct  534   EQKIKQRRFCELKEDVQKAFNKDKA  558



>gb|KHN04424.1| Hypothetical protein glysoja_019511 [Glycine soja]
Length=378

 Score =   431 bits (1108),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 245/388 (63%), Positives = 294/388 (76%), Gaps = 37/388 (10%)
 Frame = +1

Query  2404  LLGNGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKES  2583
             +LG+GG + PSR+ELLSMVKKHS  +GKT+VEE+D SD+EMD +FWH+V DLYFVCGKES
Sbjct  1     MLGDGG-EIPSRYELLSMVKKHSNLIGKTVVEEQDASDIEMDMRFWHDVFDLYFVCGKES  59

Query  2584  RGRQEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYL  2763
             RGRQ+DDL+FFVRK+   G  SN  +E   PYFVRRW+PKL +L+ E S+ V+WRRS+YL
Sbjct  60    RGRQDDDLVFFVRKLGSHGSGSNNKTESVDPYFVRRWAPKLSNLVDETSIDVNWRRSFYL  119

Query  2764  NLIAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVET  2943
             NLIAHT+FSVTVAICSH+ L N++ G+D PLSPIY                    KEVET
Sbjct  120   NLIAHTSFSVTVAICSHQDLLNHRAGQDTPLSPIY--------------------KEVET  159

Query  2944  TPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDSSQSETS--------  3099
             TPAYPDICFA+DDFDSTFDAVVLT+ DHCYCV+LNA+DGAAFPS+   ++ S        
Sbjct  160   TPAYPDICFAIDDFDSTFDAVVLTEKDHCYCVVLNAHDGAAFPSEKVANDCSTSDSSSLP  219

Query  3100  ----GGKTQSSKITIFSGFVSYQMVRDAYDAGRTgf-gsllslhssgKTDRIYMKGPGGR  3264
                   K +++K+T+ SGFVSYQMVRDAYDAGR+ F   L   HSSGKTDRIYMKGPGGR
Sbjct  220   VHSSSAKKRNTKLTLLSGFVSYQMVRDAYDAGRSRFGSLLSVGHSSGKTDRIYMKGPGGR  279

Query  3265  GEVEVAVSGVVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrss  3435
             GEVEVAVSGV DQS+++ G   P   KKG     +V +AAS ASVAA+HAYAAASA+  +
Sbjct  280   GEVEVAVSGVADQSQQDSGPFSPVISKKGFGLGVIVHKAASAASVAARHAYAAASASSPN  339

Query  3436  DEEMIPLKCCLMSISLPWEHIAHDLLLK  3519
              +E+IPLKC LMSISLPWE IA+DLL K
Sbjct  340   FDELIPLKCSLMSISLPWEFIAYDLLFK  367



>gb|ACJ04030.1| NPR1-like protein [Musa ABB Group]
 gb|ACJ04031.1| NPR1-like protein [Musa ABB Group]
Length=595

 Score =   438 bits (1127),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 263/502 (52%), Positives = 343/502 (68%), Gaps = 20/502 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakk---dcdgkpKFLMTELVPCGWVG  1554
             D  DA+I VEG  VG++R ILAARS+FF + F +        +GKP+++M ELVP G +G
Sbjct  71    DCTDAEIAVEGTPVGIHRCILAARSRFFRDLFSREGSGGNRQEGKPRYVMNELVPGGRIG  130

Query  1553  YEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVM  1374
              EA MVFL+Y+YTGK +A+P +VS CVD  C H ACRPAI +AV+L+YAS+ FQI ELV 
Sbjct  131   REALMVFLSYLYTGKLRAAPQDVSICVDRFCAHDACRPAIGFAVELLYASSVFQIAELVS  190

Query  1373  LIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAIS  1194
             L+QR L   VD A +EDVIPIL V     L  L+  CV+RV  S+LD+ +LE ELP  ++
Sbjct  191   LLQRRLLNFVDKAMVEDVIPILQVASHSKLNQLLSHCVQRVARSDLDDVSLEKELPQEVA  250

Query  1193  SDIKARRLNQQGAN---------EKKIRKILRALDCNDVELVKLLLEESDITLDDayavh  1041
              +I+  R   Q            EK+I++I RALD +DVELVKLLL ES +TLDDAYA+H
Sbjct  251   EEIRLLRRESQPKESTATVDPMLEKRIKRIHRALDSDDVELVKLLLSESGVTLDDAYALH  310

Query  1040  yaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDAT  861
             YAAAYC+SKVV E+L LG  ++NL+N RGYT LH+AA R++PA+IV++L K  +++   T
Sbjct  311   YAAAYCDSKVVAELLDLGSANVNLKNDRGYTPLHLAAMRREPAVIVSLLTKGASALE--T  368

Query  860   CSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVSLPSSTT---  690
              ++G  AV ICRR TR KDY   TE+G+E N +++CID+LE  MM  NP++   S T   
Sbjct  369   TADGQNAVRICRRLTRAKDYFTRTEQGQESNKNKICIDILEREMMR-NPLAAEDSATSPL  427

Query  689   LENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVGL  510
             L +DL M+L +LENRVA AR  +P EA++ MEIAHA++T EF G++       NL+ V L
Sbjct  428   LADDLHMKLLYLENRVAFARLFFPAEAKLAMEIAHANTTSEFTGIAKSRS-SSNLRDVDL  486

Query  509   TGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQT  330
                P  Q KRL  R +AL KTVELGRR+F +CS VLDK   DD+ D    L+ GTP+EQ 
Sbjct  487   NETPVVQNKRLRSRVDALSKTVELGRRYFPHCSQVLDKFLEDDLPDVF-YLQKGTPDEQK  545

Query  329   NKKRRYMELKEEVMKAFDKDMA  264
              KK R+ ELKE+V KAF KD A
Sbjct  546   VKKLRFCELKEDVRKAFSKDKA  567



>gb|KEH35839.1| CW7 protein, putative [Medicago truncatula]
Length=313

 Score =   426 bits (1096),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 216/310 (70%), Positives = 255/310 (82%), Gaps = 14/310 (5%)
 Frame = +1

Query  2404  LLGNGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKES  2583
             +LG+GG +TPSR+ELL MVKKHS  +GKT+VEE+D  DVEMD +FWH+V DLYFV GKES
Sbjct  1     MLGDGG-ETPSRYELLCMVKKHSNLIGKTVVEEQDAPDVEMDMKFWHDVFDLYFVRGKES  59

Query  2584  RGRQEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYL  2763
             RGRQ+DDL+FFVRK+  +   SN + E   PYFVRRW+P+L +L+ E S+ VDWRRS+YL
Sbjct  60    RGRQDDDLVFFVRKLVSRVSGSNNDPESVDPYFVRRWAPELSNLVDETSIDVDWRRSFYL  119

Query  2764  NLIAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVET  2943
             NLIAHT+FSVTVAICS +VL+N+Q G+D  LSPIYKVVKTVYASPSR+NF LDS KEVET
Sbjct  120   NLIAHTSFSVTVAICSQQVLQNHQAGRDTSLSPIYKVVKTVYASPSRVNFQLDSTKEVET  179

Query  2944  TPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDSSQSE----------  3093
             TPAYPDICFA+DDFDSTFDAVVLT+ DHCYCV+LNA+DGAAFPSD   ++          
Sbjct  180   TPAYPDICFAIDDFDSTFDAVVLTERDHCYCVVLNAHDGAAFPSDKVSNDCSTSDDSSPE  239

Query  3094  --TSGGKTQSSKITIFSGFVSYQMVRDAYDAGRTgfgsllslhss-gKTDRIYMKGPGGR  3264
               TS    + +K+T+FSGFVSYQMVRDAYDAG++ FGSLLS+    GKTDRIYMKGPGGR
Sbjct  240   VCTSSTTKKDTKLTLFSGFVSYQMVRDAYDAGKSRFGSLLSVGHFPGKTDRIYMKGPGGR  299

Query  3265  GEVEVAVSGV  3294
             GEVEVAVSGV
Sbjct  300   GEVEVAVSGV  309



>ref|XP_009341187.1| PREDICTED: regulatory protein NPR3-like isoform X2 [Pyrus x bretschneideri]
Length=578

 Score =   436 bits (1121),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 261/503 (52%), Positives = 353/503 (70%), Gaps = 22/503 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkak--kdcdgkpKFLMTELVPCGWVGY  1551
             DY+DA+I VEG+ V V+R ILA+RS+FF E F++     + +GKPK+ M++L+P G VGY
Sbjct  57    DYSDAEITVEGVPVAVHRCILASRSEFFAELFRRENGDSEKEGKPKYCMSDLLPFGHVGY  116

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF+VFL++VYT K +  P EVS+CV   C H ACRPAI++A++LM AS+ F + +LV +
Sbjct  117   EAFLVFLSFVYTAKVRDFPVEVSSCVHNVCGHEACRPAIEFALELMCASSVFGMPDLVSI  176

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
             +Q  +D++V   A +DVIPIL+V F C L+ L+++C+ RV  S+LD+ +LE  LP  ++ 
Sbjct  177   LQL-IDFVVKALA-DDVIPILVVAFHCQLSQLIDQCIERVAHSDLDSISLEKTLPDEVAE  234

Query  1190  DIKARRLNQQGA-----------NEKKIRKILRALDCNDVELVKLLLEESDITLDDayav  1044
              IK  R N Q              EK+IR+I +ALD +DVEL+KLLL ESD+TLD+A A+
Sbjct  235   KIKILRRNSQHCCDPNMPAVDPLREKRIRRIHKALDSDDVELMKLLLTESDVTLDEANAL  294

Query  1043  hyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDA  864
             HYAAAYC+ KVV EVLGLG  D+NLR++RGYTVLH+A  RK+P+II+ +L  +GA   + 
Sbjct  295   HYAAAYCDPKVVAEVLGLGLADVNLRDSRGYTVLHIAMMRKEPSIIILLL-SNGARASEP  353

Query  863   TCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVSLPSSTTLE  684
             T   G +AV+ICRR TRPKDY+  TE G+E N DR+CIDVLE  M   NP++  +S + +
Sbjct  354   TL-EGESAVSICRRLTRPKDYHTKTERGQEANKDRICIDVLEREMQR-NPMAGEASISSQ  411

Query  683   ---NDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVG  513
                NDL M L  LENRVA AR L+P EA++ M I+ AD+T EF G+S ++G  GNL  V 
Sbjct  412   ITPNDLHMRLLKLENRVAFARLLFPAEAKLAMAISQADTTPEFAGISSLKGSSGNLMEVD  471

Query  512   LTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQ  333
             L   P  Q KRL+ R E+L KTV +GR +F +CS+VLDK    D+ D L  LE+GT +EQ
Sbjct  472   LNETPTVQNKRLLSRLESLVKTVSMGRHYFPHCSEVLDKFLQVDLPD-LCVLETGTTDEQ  530

Query  332   TNKKRRYMELKEEVMKAFDKDMA  264
               K+RR++ELKEEV KAFDKD A
Sbjct  531   KIKRRRFLELKEEVQKAFDKDKA  553



>ref|XP_009397343.1| PREDICTED: regulatory protein NPR3-like [Musa acuminata subsp. 
malaccensis]
Length=595

 Score =   436 bits (1121),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 262/502 (52%), Positives = 342/502 (68%), Gaps = 20/502 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakk---dcdgkpKFLMTELVPCGWVG  1554
             D  DA+I VEG  VG++R ILAARS+FF + F +        +GKP+++M ELVP G +G
Sbjct  71    DCTDAEIAVEGAPVGIHRCILAARSRFFRDLFSREGSGGNRQEGKPRYVMNELVPGGRIG  130

Query  1553  YEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVM  1374
              EAFMVFL+Y+YTGK +A+P +VS CVD  C H ACRPAI +AV+L+YAS+ FQI ELV 
Sbjct  131   REAFMVFLSYLYTGKLRAAPQDVSICVDRFCAHDACRPAIGFAVELLYASSVFQIAELVS  190

Query  1373  LIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAIS  1194
             L+QR L   VD A +EDVIPIL V     L  L+  CV+RV  S+LD+  LE ELP  ++
Sbjct  191   LLQRRLLNFVDKAMVEDVIPILQVASHSKLNQLLSHCVQRVARSDLDDIALEKELPQEVA  250

Query  1193  SDIKARRLNQQGAN---------EKKIRKILRALDCNDVELVKLLLEESDITLDDayavh  1041
              +I+  R   Q            EK+I++I RALD +DVELVKLLL ES +TLDDAYA+H
Sbjct  251   EEIRLLRRESQPKESTATVDPMLEKRIKRIHRALDSDDVELVKLLLSESGVTLDDAYALH  310

Query  1040  yaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDAT  861
             YAAAY +SKVV E+L LG  ++NL+N RGYT LH+AA R++PA+IV++L K  +++   T
Sbjct  311   YAAAYSDSKVVAELLDLGSANVNLKNDRGYTALHLAAMRREPAVIVSLLTKGASALE--T  368

Query  860   CSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVSLPSSTT---  690
              ++G  AV ICRR TR KDY   TE+G+E N +++CID+LE  +M  NP++   S T   
Sbjct  369   TADGQNAVRICRRLTRAKDYFTRTEQGQESNKNKICIDILEREIMR-NPLAAEDSATSPL  427

Query  689   LENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVGL  510
             L +DL M+L +LENRVA AR  +P EA++ MEIAHA++T EF G++       NL+ V L
Sbjct  428   LADDLHMKLLYLENRVAFARLFFPAEAKLAMEIAHANTTSEFTGIAKSRS-SSNLRDVDL  486

Query  509   TGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQT  330
                P  Q KRL  R +AL KTVELGRR+F +CS VLDK   DD+ D    L+ GTP+EQ 
Sbjct  487   NETPVVQNKRLRSRVDALSKTVELGRRYFPHCSQVLDKFLEDDLPDVF-YLQKGTPDEQK  545

Query  329   NKKRRYMELKEEVMKAFDKDMA  264
              KK R+ ELKE+V KAF KD A
Sbjct  546   VKKLRFCELKEDVRKAFSKDKA  567



>ref|XP_009357282.1| PREDICTED: regulatory protein NPR3-like isoform X2 [Pyrus x bretschneideri]
Length=578

 Score =   435 bits (1118),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 261/503 (52%), Positives = 352/503 (70%), Gaps = 22/503 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkak--kdcdgkpKFLMTELVPCGWVGY  1551
             DY+DA+I VEG+ V V+R ILA+RS+FF E F++     + +GKPK+ M++L+P G VGY
Sbjct  57    DYSDAEITVEGVPVAVHRCILASRSEFFAELFRRENGDSEKEGKPKYCMSDLLPFGHVGY  116

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF+VFL++VYT K +  P EVS+CV   C H ACRPAI++A++LM AS+ F + +LV +
Sbjct  117   EAFLVFLSFVYTAKVRDFPVEVSSCVHNVCGHEACRPAIEFALELMCASSVFGMPDLVSI  176

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
             +Q  +D++V   A +DVIPIL+V F C L+ L+++C+ RV  S+LD+ +LE  LP  +  
Sbjct  177   LQL-IDFVVKALA-DDVIPILVVAFHCQLSQLIDQCIERVAHSDLDSISLEKTLPDEVVE  234

Query  1190  DIKARRLNQQGA-----------NEKKIRKILRALDCNDVELVKLLLEESDITLDDayav  1044
              IK  R N Q              EK+IR+I +ALD +DVEL+KLLL ESD+TLD+A A+
Sbjct  235   KIKILRRNSQHCCDPNMPAVDPLREKRIRRIHKALDSDDVELMKLLLTESDVTLDEANAL  294

Query  1043  hyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDA  864
             HYAAAYC+ KVV EVLGLG  D+NLR++RGYTVLH+A  RK+P+II+ +L  +GA   + 
Sbjct  295   HYAAAYCDPKVVAEVLGLGLADVNLRDSRGYTVLHIAMMRKEPSIIILLL-SNGARASEP  353

Query  863   TCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVSLPSSTTLE  684
             T   G +AV+ICRR TRPKDY+  TE G+E N DR+CIDVLE  M   NP++  +S + +
Sbjct  354   TL-EGESAVSICRRLTRPKDYHTKTERGQEANKDRICIDVLEREMQR-NPMAGEASISSQ  411

Query  683   ---NDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVG  513
                NDL M L  LENRVA AR L+P EA++ M I+ AD+T EF G+S ++G  GNL  V 
Sbjct  412   ITPNDLHMRLLKLENRVAFARLLFPAEAKLAMAISQADTTPEFAGISSLKGSSGNLMEVD  471

Query  512   LTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQ  333
             L   P  Q KRL+ R E+L KTV +GR +F +CS+VLDK    D+ D L  LE+GT +EQ
Sbjct  472   LNETPTVQNKRLLSRLESLVKTVSMGRHYFPHCSEVLDKFLQVDLPD-LCVLETGTTDEQ  530

Query  332   TNKKRRYMELKEEVMKAFDKDMA  264
               K+RR++ELKEEV KAFDKD A
Sbjct  531   KIKRRRFLELKEEVQKAFDKDKA  553



>ref|XP_009776511.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Nicotiana 
sylvestris]
Length=588

 Score =   435 bits (1118),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 260/503 (52%), Positives = 353/503 (70%), Gaps = 19/503 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkd--cdgkpKFLMTELVPCGWVGY  1551
             D+ DA+I VEG+ +GV+R ILAARS+FF + F+K K     +GKP++ MT+++P G VGY
Sbjct  64    DFTDAEIVVEGVSLGVHRCILAARSKFFQDLFRKEKGSCGKEGKPRYSMTDILPYGKVGY  123

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF+ FL+Y+Y+GK K  PPEVSTC+D  C H +CRPAI+++V+LMYAS+ FQ+ ELV L
Sbjct  124   EAFVTFLSYLYSGKLKHFPPEVSTCMDTICAHDSCRPAINFSVELMYASSMFQVPELVSL  183

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
               R L   V  A +EDVIPIL V F C L+ L+   V RV  S+L+   +E E+P  ++ 
Sbjct  184   FLRRLINFVGKALVEDVIPILRVAFHCQLSELLTHSVDRVARSDLEITCIEKEVPFEVAE  243

Query  1190  DIK----------ARRLNQQGANEKKIRKILRALDCNDVELVKLLLEESDITLDDayavh  1041
             +IK          ++ L     +EK+  +I +ALD +DVELVKLLL ES+I+LD+AYA+H
Sbjct  244   NIKLLWPKCQVDESKVLPVDPLHEKRKNRIYKALDSDDVELVKLLLSESNISLDEAYALH  303

Query  1040  yaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDAT  861
             YA AYC+ KVV EVLGLG  D+NLRN RGYTVLH+A+ RK+PA+IV++L K GA   + T
Sbjct  304   YAVAYCDPKVVTEVLGLGVADVNLRNTRGYTVLHIASMRKEPAVIVSLLTK-GARASETT  362

Query  860   CSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPV---SLPSSTT  690
               +G +AV+ICRR TRPK+Y+  TE+G+E N DR+CIDVLE  M   NP+   +L SS  
Sbjct  363   L-DGQSAVSICRRLTRPKEYHAKTEQGQEANKDRVCIDVLEREMRR-NPMAGDALFSSPM  420

Query  689   LENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVGL  510
             L +DL M+L++LENRVA AR L+P EAR+ M+IA+A++  E       +   GNL+ V L
Sbjct  421   LADDLHMKLHYLENRVAFARLLFPLEARLAMQIANAETAAEVAVRLASKSTSGNLREVDL  480

Query  509   TGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQT  330
                P  Q +RL+ R +AL KTVELG+R+F +CS VLDK   DD+ D L  LE GTPEEQ 
Sbjct  481   NETPIKQKERLLSRMQALSKTVELGKRYFPHCSQVLDKFMEDDLPD-LIFLEMGTPEEQK  539

Query  329   NKKRRYMELKEEVMKAFDKDMAQ  261
              K++R+ ELK++V +AF+KD A+
Sbjct  540   IKRKRFKELKDDVQRAFNKDKAE  562



>gb|EYU43699.1| hypothetical protein MIMGU_mgv1a003483mg [Erythranthe guttata]
Length=582

 Score =   434 bits (1117),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 270/504 (54%), Positives = 337/504 (67%), Gaps = 23/504 (5%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg--kpKFLMTELVPCGWVGY  1551
             D+ DADI VE   VGV+R ILAARS+FF E  +K K       KPK+ M +L+P G VGY
Sbjct  62    DFTDADIVVEETSVGVHRCILAARSKFFDELLRKDKGSVGKEGKPKYCMVDLLPYGKVGY  121

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF++FLNY+YTGK + SP EVSTCV+  C H +CRPAID+ V+LMYAS  FQ+ ELV L
Sbjct  122   EAFVIFLNYLYTGKLRPSPLEVSTCVNCVCPHDSCRPAIDFVVELMYASTIFQVSELVSL  181

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
              QR L  LV  A +EDV+PI+ V F C L+ L+  CV RV  S+ +  ++E ELP  ++ 
Sbjct  182   FQRRLLNLVGKAIVEDVVPIIKVAFDCQLSQLLNECVHRVARSDFEAISIEKELPPIVAQ  241

Query  1190  DIKARRLNQQGA-----------NEKKIRKILRALDCNDVELVKLLLEESDITLDDayav  1044
             DI +  L  Q             +EK++++I +ALD  DVELV+LLL ESDITLD+AYA+
Sbjct  242   DIASLCLKSQSEQENKTGPVSPLHEKRVKRIHKALDSEDVELVRLLLTESDITLDEAYAL  301

Query  1043  hyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDA  864
             HYA AYC+ K V EVL LG  D+NLRN RGYTVLHVAARRK+P+IIV++L K GA   D 
Sbjct  302   HYAVAYCDPKTVTEVLSLGLADVNLRNNRGYTVLHVAARRKEPSIIVSLLTK-GACAADP  360

Query  863   TCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVSLP---SST  693
             T   G  AVTICR  TRPKDY    E+G+E N DR+CIDVLE   M  NP+S+    SS 
Sbjct  361   T-FEGRNAVTICRSLTRPKDYQMQREKGQEANKDRICIDVLER-EMRRNPISMDVSISSI  418

Query  692   TLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVG  513
              + +DL M+  +LE+RVA AR  +P EA++ MEIAHA++T    GL       GNL  V 
Sbjct  419   AMVDDLHMKSLYLEDRVAFARMFFPTEAKLAMEIAHAEATSSLAGLLSSS---GNLMEVD  475

Query  512   LTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQ  333
             L   P  Q KRL+ R E L +TVELGRR+F NCS VLDK   DD+ D+   LE GT EEQ
Sbjct  476   LNESPITQNKRLLARIETLSRTVELGRRYFPNCSQVLDKFMEDDLPDAF-YLEKGTLEEQ  534

Query  332   TNKKRRYMELKEEVMKAFDKDMAQ  261
               K+ R+MELK EV KAF+KD A+
Sbjct  535   RMKRVRFMELKGEVHKAFNKDKAK  558



>gb|AHF20180.1| ankyrin-repeat protein [Musa acuminata AAA Group]
Length=595

 Score =   435 bits (1118),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 262/502 (52%), Positives = 342/502 (68%), Gaps = 20/502 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakk---dcdgkpKFLMTELVPCGWVG  1554
             D  DA+I VEG  VG++R ILAARS+FF + F +        +GKP+++M ELVP G +G
Sbjct  71    DCTDAEIAVEGAPVGIHRCILAARSRFFRDLFSREGSGGNRQEGKPRYVMNELVPGGRIG  130

Query  1553  YEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVM  1374
              EAFMVFL+Y+YTGK +A+P +VS CVD  C H ACRPAI +AV+L+YAS+ FQI ELV 
Sbjct  131   REAFMVFLSYLYTGKLRAAPQDVSICVDRFCAHDACRPAIGFAVELLYASSVFQIAELVS  190

Query  1373  LIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAIS  1194
             L+QR L   VD A +EDVIPIL V     L  L+  CV+RV  S+LD+  LE ELP  ++
Sbjct  191   LLQRRLLNFVDKAMVEDVIPILQVASHSKLNQLLSHCVQRVARSDLDDIALEKELPQEVA  250

Query  1193  SDIKARRLNQQGAN---------EKKIRKILRALDCNDVELVKLLLEESDITLDDayavh  1041
              +I+  R   Q            EK+I++I RALD +DVELVKLLL ES +TLDDAYA+H
Sbjct  251   EEIRLLRRESQPKESTATVDPMLEKRIKRIHRALDSDDVELVKLLLSESGVTLDDAYALH  310

Query  1040  yaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDAT  861
             YAAAY +SKVV E+L LG  ++NL+N RGYT LH+AA R++PA+IV++L K  +++   T
Sbjct  311   YAAAYSDSKVVAELLDLGSANVNLKNDRGYTPLHLAAMRREPAVIVSLLTKGASALE--T  368

Query  860   CSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVSLPSSTT---  690
              ++G  AV ICRR TR KDY   TE+G+E N +++CID+LE  +M  NP++   S T   
Sbjct  369   TADGQNAVRICRRLTRAKDYFTRTEQGQESNKNKICIDILEREIMR-NPLAAEDSATSPL  427

Query  689   LENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVGL  510
             L +DL M+L +LENRVA AR  +P EA++ MEIAHA++T EF G++       NL+ V L
Sbjct  428   LADDLHMKLLYLENRVAFARLFFPAEAKLAMEIAHANTTSEFTGIAKSRS-SSNLRDVDL  486

Query  509   TGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQT  330
                P  Q KRL  R +AL KTVELGRR+F +CS VLDK   DD+ D    L+ GTP+EQ 
Sbjct  487   NETPVVQNKRLRSRVDALSKTVELGRRYFPHCSQVLDKFLEDDLPDVF-YLQKGTPDEQK  545

Query  329   NKKRRYMELKEEVMKAFDKDMA  264
              KK R+ ELKE+V KAF KD A
Sbjct  546   VKKLRFCELKEDVRKAFSKDKA  567



>ref|XP_008371834.1| PREDICTED: regulatory protein NPR3 isoform X1 [Malus domestica]
Length=580

 Score =   434 bits (1117),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 259/503 (51%), Positives = 349/503 (69%), Gaps = 20/503 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkak--kdcdgkpKFLMTELVPCGWVGY  1551
             DY+DA+I VEG+ V V+R ILA+RS+FF E F++     + +GKPK+ M++L+P G VGY
Sbjct  57    DYSDAEITVEGVPVAVHRCILASRSEFFAELFRRENGDSEQEGKPKYCMSDLLPFGHVGY  116

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF+VFL++VYT K +  P EVS+CV   C H ACRPAI+++++LM AS+ F + +LV +
Sbjct  117   EAFLVFLSFVYTAKVRDFPVEVSSCVHNVCGHEACRPAIEFSLELMCASSVFGMPDLVSI  176

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
             +QR L   V  A  +DVIPIL+V F C L+ L+++C+ RV  S+LD+ +LE  LP  +  
Sbjct  177   LQRQLIDFVLKALADDVIPILVVAFHCQLSQLIDQCIERVAHSDLDSISLEKALPDEVVE  236

Query  1190  DIKARRLNQQGA-----------NEKKIRKILRALDCNDVELVKLLLEESDITLDDayav  1044
              IK  R N Q              EK+IR+I +ALD +DVEL+KLLL ESD+TLD+A A+
Sbjct  237   KIKILRRNSQHCCDPNMPAVDPLREKRIRRIHKALDSDDVELMKLLLTESDVTLDEANAL  296

Query  1043  hyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDA  864
             HYAAAYC+ KVV EVLGLG  D+NLR++RGYTVLH+A  RK+P+II+ +L  +GA   + 
Sbjct  297   HYAAAYCDPKVVAEVLGLGLADVNLRDSRGYTVLHIAVXRKEPSIIILLL-SNGARASEP  355

Query  863   TCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVSLPSSTTLE  684
             T   G +AV+ICRR TR KDY+  TE G+E N DR+CIDVLE  M   NP++  +S + +
Sbjct  356   TL-EGESAVSICRRLTRQKDYHTKTERGQEANKDRICIDVLEREMQR-NPMAGEASISSQ  413

Query  683   ---NDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVG  513
                NDL M L  LENRVA AR L+P EA++ M I+ AD+T EF G+S ++G  GNL  V 
Sbjct  414   ITPNDLHMRLLKLENRVAFARLLFPAEAKLAMAISQADTTPEFAGISSLKGSSGNLMEVD  473

Query  512   LTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQ  333
             L   P  Q KRL+ R E+L KTV +GR +F +CS+VLDK    D+ D L  LE+GT +EQ
Sbjct  474   LNETPTVQNKRLLSRLESLVKTVSMGRHYFPHCSEVLDKFLQVDLPD-LCVLETGTTDEQ  532

Query  332   TNKKRRYMELKEEVMKAFDKDMA  264
               K++R++ELKEEV KAFDKD A
Sbjct  533   KIKRQRFLELKEEVQKAFDKDKA  555



>ref|XP_009357279.1| PREDICTED: regulatory protein NPR3-like [Pyrus x bretschneideri]
Length=586

 Score =   433 bits (1113),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 273/511 (53%), Positives = 348/511 (68%), Gaps = 22/511 (4%)
 Frame = -2

Query  1745  IDPGEYEDYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdgk--pKFLMTELV  1572
             +DPG   D++DADI VEGI VGV+R ILA+RS+FF E FK+ K     +  P++ M++L+
Sbjct  56    VDPGC--DFSDADIVVEGIPVGVHRCILASRSRFFRELFKREKGSSGKEGRPRYSMSDLL  113

Query  1571  PCGWVGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQ  1392
             P G VGYEAF+VFL+YVYTGK K SP EVSTCV   C H ACRPAI++ V+LMYA++ FQ
Sbjct  114   PYGDVGYEAFLVFLSYVYTGKLKPSPMEVSTCVHNGCAHDACRPAINFVVELMYAASVFQ  173

Query  1391  IKELVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENE  1212
             + +LV + +R L   V  A  ++VIPIL+V F C L  L+   + RV  S++D+ ++E  
Sbjct  174   MPDLVSIFERRLLNFVGKALPDNVIPILVVAFHCQLNQLIAEGIERVARSDIDDISIEKG  233

Query  1211  LPGAISSDIKARRLNQQG-----------ANEKKIRKILRALDCNDVELVKLLLEESDIT  1065
             LP  +   IK  R   Q              EK+IR+I +ALD +DVELVKLLL ES+IT
Sbjct  234   LPDEVVKKIKVLRCKTQQDCVSNLPPVDPLREKRIRRIHKALDSDDVELVKLLLTESNIT  293

Query  1064  LDDayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKS  885
             LD+A A+HYAAAYC+ KVV EVL LG  D+NLRN+RGYTVLH+A  RK+P+IIV +L K 
Sbjct  294   LDEANALHYAAAYCDPKVVTEVLDLGLADVNLRNSRGYTVLHIAVMRKEPSIIVLLLTK-  352

Query  884   GASIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPV--  711
             GA   + T S+G  AV+ICRR TRPKDY+  TE+G+E N DR+CIDVLE   M  NP+  
Sbjct  353   GARASELT-SDGQNAVSICRRLTRPKDYHSKTEQGQEANKDRICIDVLER-EMRRNPMAG  410

Query  710   -SLPSSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLC  534
              +  SS  + +DL MEL  LENRVA+AR L+P EA++ M IAH ++T EF   S  +G  
Sbjct  411   DTSISSQIMPDDLHMELLNLENRVAIARLLFPAEAKLAMVIAHTETTPEFPKPSSSKGSS  470

Query  533   GNLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLE  354
             GNL  V L   P  Q KRL  R EAL KTV LGR +F +CS+VLDK   DD L  L  LE
Sbjct  471   GNLMEVDLNETPTVQNKRLHSRLEALMKTVRLGRCYFPHCSEVLDKFIEDD-LPELFFLE  529

Query  353   SGTPEEQTNKKRRYMELKEEVMKAFDKDMAQ  261
             SG+ +EQ  K+RR+MELKEEV KAF KD A+
Sbjct  530   SGSSDEQRVKRRRFMELKEEVQKAFTKDKAE  560



>gb|AAT57641.1| NIM1-like protein 1 [Nicotiana tabacum]
Length=588

 Score =   433 bits (1113),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 259/503 (51%), Positives = 352/503 (70%), Gaps = 19/503 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkd--cdgkpKFLMTELVPCGWVGY  1551
             D+ DA+I VEG+ +GV+R ILAARS+FF + F+K K     +GKP++ MT+++P G VGY
Sbjct  64    DFTDAEIVVEGVSLGVHRCILAARSKFFQDLFRKEKGSCGKEGKPRYSMTDILPYGKVGY  123

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF+ FL+Y+Y+GK K  PPEVSTC+D  C H +CRPAI+++V+LMYAS+ FQ+ ELV L
Sbjct  124   EAFVTFLSYLYSGKLKHFPPEVSTCMDTICAHDSCRPAINFSVELMYASSMFQVPELVSL  183

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
               R L   V  A +EDVIPIL V F C L+ L+   V RV  S+L+   +E E+P  ++ 
Sbjct  184   FLRRLINFVGKALVEDVIPILRVAFHCQLSELLTHSVDRVARSDLEITCIEKEVPFEVAE  243

Query  1190  DIK----------ARRLNQQGANEKKIRKILRALDCNDVELVKLLLEESDITLDDayavh  1041
             +IK          ++ L     +EK+  +I +ALD +DVELVKLLL ES+I+LD+AYA+H
Sbjct  244   NIKLLWPKCQVDESKVLPVDPLHEKRKNRIYKALDSDDVELVKLLLSESNISLDEAYALH  303

Query  1040  yaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDAT  861
             YA AYC+ KVV EVLGLG  D+NLRN RGYTVLH+A+ RK+PA+IV++L K GA   + T
Sbjct  304   YAVAYCDPKVVTEVLGLGVADVNLRNTRGYTVLHIASMRKEPAVIVSLLTK-GARASETT  362

Query  860   CSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPV---SLPSSTT  690
               +G +AV+ICRR TRPK+Y+  TE+G+E N DR+CIDVLE  M   NP+   +L SS  
Sbjct  363   L-DGQSAVSICRRLTRPKEYHAKTEQGQEANKDRVCIDVLEREMRR-NPMAGDALFSSPM  420

Query  689   LENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVGL  510
             L +DL M+L++LENRVA AR L+P EAR+ M+IA+A++  E       +   GNL+ V L
Sbjct  421   LADDLHMKLHYLENRVAFARLLFPLEARLAMQIANAETAAEVAVRLASKSTSGNLREVDL  480

Query  509   TGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQT  330
                P  Q +RL+ R +AL KTVELG+R+F +CS VLDK   DD+ D L  LE G PEEQ 
Sbjct  481   NETPIKQKERLLSRMQALSKTVELGKRYFPHCSQVLDKFMEDDLPD-LIFLEMGPPEEQK  539

Query  329   NKKRRYMELKEEVMKAFDKDMAQ  261
              K++R+ ELK++V +AF+KD A+
Sbjct  540   IKRKRFKELKDDVXRAFNKDKAE  562



>gb|KHN38349.1| Regulatory protein NPR3 [Glycine soja]
Length=492

 Score =   428 bits (1101),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 249/466 (53%), Positives = 317/466 (68%), Gaps = 25/466 (5%)
 Frame = -2

Query  1586  MTELVPCGWVGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYA  1407
             M++LVP G VGYEAF VFL Y+YTG+ KASP EV+TCVDE+C H ACRPAI+YA++LMYA
Sbjct  1     MSDLVPYGTVGYEAFQVFLYYLYTGRLKASPTEVTTCVDETCTHDACRPAINYALELMYA  60

Query  1406  SATFQIKELVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNF  1227
             SATFQ+KELV+L QRHL   V+ A +EDVIPIL+  F C L  L+ +C+RRV  S+ DN 
Sbjct  61    SATFQMKELVLLFQRHLLNFVEKALVEDVIPILMAAFNCQLDQLLSQCIRRVARSDFDNT  120

Query  1226  TLENELPGAISSDIKARRLNQQ-----------GANEKKIRKILRALDCNDVELVKLLLE  1080
             +LE ELP  + ++IK  RL  Q             NEK IR+I +ALD +DVEL+KLLL 
Sbjct  121   SLEKELPREVVTEIKLLRLPFQPESTPNAMEVESLNEKSIRRIHKALDSDDVELLKLLLN  180

Query  1079  ESDITLDDayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVA  900
             ES +TLDDA+A+HYA AY +SKV+ EVL LG  D+  RN+RGYTVLHVAARRKDP+I+VA
Sbjct  181   ESSVTLDDAHALHYACAYSDSKVIQEVLSLGMADILRRNSRGYTVLHVAARRKDPSILVA  240

Query  899   ILDKSGASIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVM-MN  723
             +L+K GA   D T  +G TA+ IC+R TR KDY + T + +E N DRLC+DVLE  M  N
Sbjct  241   LLNK-GACASDTT-PDGQTALAICQRLTRYKDYQEQTVQCKESNKDRLCVDVLEREMRRN  298

Query  722   GNPVSLPSSTTLE-NDLVMELYFLENRV----------ALARRLYPREARINMEIAHADS  576
                V++  S+ L  NDL M L +LE+RV           L    +P EAR+ +E A ADS
Sbjct  299   SMTVNMSVSSQLTANDLHMRLDYLEDRVYGHHLIKMLHMLQWLFFPAEARVAIENAEADS  358

Query  575   TLEFVGLSGMEGLCGNLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDK  396
             +  +   S ++G  GNLK V L   P    ++L  R  AL KTVE GRRFF +CS+VLDK
Sbjct  359   SSMYANSSALKGTNGNLKQVDLNESPSAHTRKLQLRLHALMKTVENGRRFFPHCSEVLDK  418

Query  395   LTADDVLDSLESLESGTPEEQTNKKRRYMELKEEVMKAFDKDMAQN  258
                DD +  +  LE G+ +EQ  KK R+MELK++V KAF KDMA+N
Sbjct  419   FLEDDDMPDVFFLEKGSEDEQRIKKARFMELKDDVQKAFHKDMAEN  464



>gb|ACE86413.1| NPR1-like protein [Musa ABB Group]
Length=574

 Score =   431 bits (1108),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 259/502 (52%), Positives = 340/502 (68%), Gaps = 20/502 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakk---dcdgkpKFLMTELVPCGWVG  1554
             D  DA+I VEG  VG++R ILAARS+FF + F +        +GKP+++M ELVP G +G
Sbjct  50    DCTDAEIAVEGTPVGIHRCILAARSRFFRDLFSREGSGGNRQEGKPRYVMNELVPGGRIG  109

Query  1553  YEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVM  1374
              EA MVFL+Y+YTGK +A+P +VS CVD  C H ACRPAI +AV+L+YAS+ FQI ELV 
Sbjct  110   REALMVFLSYLYTGKLRAAPQDVSICVDRFCAHDACRPAIGFAVELLYASSVFQIAELVS  169

Query  1373  LIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAIS  1194
             L+QR L   VD A +EDVIPIL V     L  L+  CV+RV  S+LD+  LE EL   ++
Sbjct  170   LLQRRLLNFVDKAMVEDVIPILQVASHSKLNQLLSHCVQRVARSDLDDIALEKELLQEVA  229

Query  1193  SDIKARRLNQQGAN---------EKKIRKILRALDCNDVELVKLLLEESDITLDDayavh  1041
              +I+  R   Q            EK+I++I RALD +DVELVKLLL ES +TLDD YA+H
Sbjct  230   EEIRLLRRESQPKESTATVDPMLEKRIKRIHRALDSDDVELVKLLLNESGVTLDDTYALH  289

Query  1040  yaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDAT  861
             YAAAYC+SKV+ E+L LG  ++NL+N RGYT LH+AA R++PA+IV++L K  +++   T
Sbjct  290   YAAAYCDSKVIAELLDLGSANVNLKNDRGYTPLHLAAMRREPAVIVSLLTKGASALE--T  347

Query  860   CSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVSLPSSTT---  690
              ++G  AV ICRR TR KDY   TE+G+E N +++CID+LE  MM  NP++   S T   
Sbjct  348   TADGQNAVRICRRLTRAKDYFTRTEQGQESNKNKICIDILEREMMR-NPLAAEDSATSPL  406

Query  689   LENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVGL  510
             L +DL M+L +LENRVA AR  +P EA++ MEIAHA++T EF G++       NL+ V L
Sbjct  407   LADDLHMKLLYLENRVAFARLFFPAEAKLAMEIAHANTTSEFTGIAKSRS-SSNLRDVDL  465

Query  509   TGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQT  330
                P  Q KRL  R +AL KTVELG+R+F +CS VLDK   DD+ D    L+ GTP+EQ 
Sbjct  466   NETPVVQNKRLRSRVDALSKTVELGQRYFPHCSQVLDKFLEDDLPDVF-YLQKGTPDEQK  524

Query  329   NKKRRYMELKEEVMKAFDKDMA  264
              KK R+ ELKE+V KAF KD A
Sbjct  525   VKKLRFCELKEDVRKAFSKDKA  546



>ref|XP_006353069.1| PREDICTED: regulatory protein NPR3-like [Solanum tuberosum]
Length=581

 Score =   430 bits (1105),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 260/502 (52%), Positives = 342/502 (68%), Gaps = 26/502 (5%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkd--cdgkpKFLMTELVPCGWVGY  1551
             +++DA+I VEG  +GV+R ILAARS FF + F+    +   +GKP + M +++PCG VGY
Sbjct  64    EFSDAEIVVEGDSLGVHRCILAARSSFFRDLFRNENGNCGKEGKPSYSMIDILPCGKVGY  123

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF  FL+Y+Y+GK K  PPE STCVD  C H  CRPAI++ V+LMYAS  FQ+ ELV L
Sbjct  124   EAFRTFLSYLYSGKLKHFPPEASTCVDSLCSHDFCRPAINFHVELMYASFVFQVPELVSL  183

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
               R L   V  A +EDVIPIL V F C L+ L+  CV RV  S+L++  +E E+P  ++ 
Sbjct  184   FLRRLISFVGKAVLEDVIPILGVAFHCQLSELLTHCVDRVARSDLESTCIEKEVPFKVAE  243

Query  1190  DIKARRLNQQG----------ANEKKIRKILRALDCNDVELVKLLLEESDITLDDayavh  1041
              IK  +L  QG           +EK+  +I +ALD +DVELVKLLL ESDI+LD AYA+H
Sbjct  244   SIKLSQLKCQGDESKVLPVDPLHEKRKNRIYKALDSDDVELVKLLLNESDISLDGAYALH  303

Query  1040  yaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDAT  861
             YA AYC+ KVV EVLGLG  ++NLRN RGYTVLH+AA RK+P+IIV++L K GA   + T
Sbjct  304   YAVAYCDPKVVTEVLGLGVANVNLRNTRGYTVLHIAAMRKEPSIIVSLLTK-GAHASEIT  362

Query  860   CSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVS---LPSSTT  690
               +G +AV+ICRR TRPK+Y+  TE+G+E N DR+CIDVLE  M   NP++   L SS  
Sbjct  363   L-DGQSAVSICRRLTRPKEYHAKTEQGQEANKDRVCIDVLEREMRR-NPMTRDALFSSPM  420

Query  689   LENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVGL  510
             L +DL M+L +LENRVA AR L+P EA++ MEIA A++T EF      +G  GNL+ V L
Sbjct  421   LADDLPMKLLYLENRVAFARLLFPLEAKLAMEIATAETTAEFADHLASKGSSGNLREVDL  480

Query  509   TGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQT  330
                P       + ++E L KTVELG+R+F +CS VLDK   DD+ D +  LE GTPEEQ 
Sbjct  481   NETP-------IMQKERLSKTVELGKRYFPHCSQVLDKFMEDDLPDFI-FLEKGTPEEQK  532

Query  329   NKKRRYMELKEEVMKAFDKDMA  264
              K+RR+ ELK++V +AF+KD A
Sbjct  533   IKRRRFKELKDDVQRAFNKDKA  554



>ref|XP_009375133.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X2 
[Pyrus x bretschneideri]
 ref|XP_009350339.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X2 
[Pyrus x bretschneideri]
Length=374

 Score =   422 bits (1084),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 245/396 (62%), Positives = 299/396 (76%), Gaps = 44/396 (11%)
 Frame = +1

Query  2404  LLGNGGGQTPSRFELLSMVKKHSKFLGKTIV--EEEDPSDVEMDPQFWHEVLDLYFVCGK  2577
             +LG+G   TPSRFELLSMVKKHS  LGKT++  +E+D SDVE+D +FWH+VLDLYFV GK
Sbjct  6     MLGHGE-DTPSRFELLSMVKKHSSLLGKTVIVADEDDTSDVELDHRFWHDVLDLYFVRGK  64

Query  2578  ESRGRQEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSY  2757
             +SRGRQ+DDL+FFVRK+S  GY  N   E  SPYFVRRW+PKLD+L+GE++V VDWRRS+
Sbjct  65    DSRGRQDDDLVFFVRKLSSYGYGFNDGKEGVSPYFVRRWAPKLDNLIGESNVDVDWRRSF  124

Query  2758  YLNLIAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEV  2937
             YLNLIAHT+F+VTVAICSH+ L+N+Q  +  PLSPIYKVVKTVYASPSR+NF LDS+K  
Sbjct  125   YLNLIAHTSFTVTVAICSHQDLRNHQAEQRIPLSPIYKVVKTVYASPSRVNFQLDSKK--  182

Query  2938  ETTPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDSS-----------  3084
                                    VLT+ DHCYCVILNA+DGAAFP +             
Sbjct  183   -----------------------VLTETDHCYCVILNAHDGAAFPREKESNDCSSSDSSS  219

Query  3085  -QSETSGGKTQSSKITIFSGFVSYQMVRDAYDAGRTgfgsllslhssgKTDRIYMKGPGG  3261
              + ET+  K +++K+T+FSGFVSYQMVRDAYDAG++     L  HS GKTD++YMKGPGG
Sbjct  220   LRVETNSAKMKNTKLTLFSGFVSYQMVRDAYDAGKS-RFGNLLGHSPGKTDKLYMKGPGG  278

Query  3262  RGEVEVAVSGVVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrs  3432
             RGEVEVAVS V DQS+++ G   P   K+G    ++VR+AASVASVAAK+AYAAAS+T S
Sbjct  279   RGEVEVAVSRVADQSQQDLGPFSPVISKRGFGIGSIVRKAASVASVAAKNAYAAASSTHS  338

Query  3433  sDEEMIPLKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
              D+EM+PLKCCLMSISLPWE IA+DLL KG+PPV L
Sbjct  339   FDDEMVPLKCCLMSISLPWEQIAYDLLFKGTPPVTL  374



>ref|XP_009361062.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X4 
[Pyrus x bretschneideri]
Length=371

 Score =   421 bits (1083),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 245/396 (62%), Positives = 300/396 (76%), Gaps = 44/396 (11%)
 Frame = +1

Query  2404  LLGNGGGQTPSRFELLSMVKKHSKFLGKTIV--EEEDPSDVEMDPQFWHEVLDLYFVCGK  2577
             +LG+G  +TP+RFELLSMVKKHS  LGKT++  +E+D SDVE+D +FWH++LDLYFV GK
Sbjct  3     MLGHGE-ETPTRFELLSMVKKHSSLLGKTVIVADEDDTSDVELDHRFWHDMLDLYFVRGK  61

Query  2578  ESRGRQEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSY  2757
             +SRGRQ+DDL+FFVRK+S  GY  N   E  SPYFVRRW+ KLDDL+GE++V VDWRRS+
Sbjct  62    DSRGRQDDDLVFFVRKLSSYGYGFNDGKEGVSPYFVRRWAHKLDDLIGESNVDVDWRRSF  121

Query  2758  YLNLIAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEV  2937
             YLNLIAHT+F+VTVAICSH+ L+N+Q  +  PLSPIYKVVKTVYASPSR+NF LDS K  
Sbjct  122   YLNLIAHTSFTVTVAICSHQDLRNHQADQGIPLSPIYKVVKTVYASPSRVNFQLDSEK--  179

Query  2938  ETTPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFP------------SDS  3081
                                    VLT+ D+CYCVILNA+DGAAFP            S S
Sbjct  180   -----------------------VLTETDNCYCVILNAHDGAAFPRVKESDECSSGDSSS  216

Query  3082  SQSETSGGKTQSSKITIFSGFVSYQMVRDAYDAGRTgfgsllslhssgKTDRIYMKGPGG  3261
              + ET+  KT+++K+T+FSGFVSYQMVRDAYDAG++     L  HS GKTD++YMKGPGG
Sbjct  217   LRIETNSAKTKNTKLTLFSGFVSYQMVRDAYDAGKS-RFGNLLGHSPGKTDKLYMKGPGG  275

Query  3262  RGEVEVAVSGVVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrs  3432
             RGEVE+AVSGV DQS+++ G   P   K G    ++VR+AASVASVAAK+AYAAAS+T S
Sbjct  276   RGEVEIAVSGVADQSQQDLGPFSPVISKTGFGIGSIVRKAASVASVAAKNAYAAASSTHS  335

Query  3433  sDEEMIPLKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
              D+EM+PLKCCLMSISLPWE IA+DLL KG+PPV L
Sbjct  336   FDDEMVPLKCCLMSISLPWEQIAYDLLFKGTPPVTL  371



>ref|NP_001234562.1| NIM1-like protein 1 [Solanum lycopersicum]
 gb|AAT57638.1| NIM1-like protein 1 [Solanum lycopersicum]
Length=581

 Score =   429 bits (1103),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 259/502 (52%), Positives = 346/502 (69%), Gaps = 26/502 (5%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkd--cdgkpKFLMTELVPCGWVGY  1551
             +++DA+I VEG+ +GV+R ILAARS FF + F+K   +   +GKP + M +++PCG VGY
Sbjct  64    EFSDAEIVVEGVSLGVHRCILAARSSFFRDLFRKRNGNCGKEGKPSYSMIDILPCGKVGY  123

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF+ FL+Y+Y+GK K  PPE STCV+  C H +CRPAI++ V+LMYAS  FQ+ ELV L
Sbjct  124   EAFLTFLSYLYSGKLKHFPPEASTCVNSLCSHDSCRPAINFHVELMYASFVFQVPELVSL  183

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
               RHL   V  A +EDVIPIL V F C ++ L+  CV RV  S+L++  +E E+P  ++ 
Sbjct  184   FLRHLFSFVGKALVEDVIPILGVAFHCQMSELLTHCVDRVARSDLESTCIEKEVPFKVAE  243

Query  1190  DIKARRLNQQG----------ANEKKIRKILRALDCNDVELVKLLLEESDITLDDayavh  1041
              IK  RL  QG           +EK+  +I +ALD +DVELVKLLL ESDI+LD AYA+H
Sbjct  244   SIKLSRLKCQGDESMVLTVDPLHEKRKNRIYKALDSDDVELVKLLLNESDISLDGAYALH  303

Query  1040  yaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDAT  861
             YA AYC+ KVV EVLGLG  ++NLRNARGYTVLH+AA RK+P+IIV++L K GA   + T
Sbjct  304   YAVAYCDPKVVAEVLGLGVANVNLRNARGYTVLHIAAMRKEPSIIVSLLTK-GAHASEIT  362

Query  860   CSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVS---LPSSTT  690
               +G +AV++CRR TRPK+Y+  TE+G+E N DR+CIDVLE  M   NP++   L SS  
Sbjct  363   L-DGQSAVSLCRRLTRPKEYHAKTEQGQEANKDRVCIDVLEREMRR-NPMTGDALFSSPM  420

Query  689   LENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVGL  510
             L +DL M+L +LENRVA AR L+P EA++ MEIA A++T EF      +   G L+ V L
Sbjct  421   LADDLPMKLLYLENRVAFARLLFPLEAKLAMEIATAETTAEFADHLASKASSGILREVDL  480

Query  509   TGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQT  330
                P       + ++E L KTVELG+ +F +CS+VLDK   DD+ D L  LE GTPEEQ 
Sbjct  481   NETP-------IMQKERLSKTVELGKCYFPHCSEVLDKFMEDDLPD-LFFLEKGTPEEQK  532

Query  329   NKKRRYMELKEEVMKAFDKDMA  264
              K+RR+ ELK++V +AF+KD A
Sbjct  533   IKRRRFKELKDDVQRAFNKDKA  554



>dbj|BAB82429.1| hypothetical protein [Arabidopsis thaliana]
Length=328

 Score =   419 bits (1076),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 213/314 (68%), Positives = 249/314 (79%), Gaps = 7/314 (2%)
 Frame = +1

Query  2413  NGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGR  2592
             N G  TPSR E+LSMVKKHSK LGKT ++E+D SDVEMD  FWH V D+YFV   ESR R
Sbjct  3     NDGEVTPSRHEILSMVKKHSKSLGKTSLDEQDASDVEMDSNFWHGVFDVYFVRCMESRRR  62

Query  2593  QEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLI  2772
             Q+DDL+FFVRK+S + Y    N +  +PYFVRRW+PKLD+LLGE+   VDWR+S+YLN+I
Sbjct  63    QDDDLLFFVRKLSCKSYGLTENEDAPAPYFVRRWAPKLDELLGESLAEVDWRKSFYLNMI  122

Query  2773  AHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPA  2952
             AHT+F+VTVAICS+E LK YQ  KD  LSPIYKVVKTVYASPSR+NFHLDS+KEVETTPA
Sbjct  123   AHTSFTVTVAICSNEALKTYQGSKDTKLSPIYKVVKTVYASPSRVNFHLDSKKEVETTPA  182

Query  2953  YPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPS----DSSQSETSGG--KTQ  3114
             YP+ICFAVDDFDSTFDAVVLTD DHCYCV+LN++DGAAFPS    DSS S T+      +
Sbjct  183   YPEICFAVDDFDSTFDAVVLTDKDHCYCVLLNSHDGAAFPSATVKDSSDSNTNADPRTVK  242

Query  3115  SSKITIFSGFVSYQMVRDAYDAGRTgf-gsllslhssgKTDRIYMKGPGGRGEVEVAVSG  3291
               K+T+FSGFVSYQMVR+AY+ GR  F   L   H +GK DR+YM+GPGGRGEVEVAVSG
Sbjct  243   DPKVTLFSGFVSYQMVREAYEGGRNRFGSLLSLGHITGKADRLYMRGPGGRGEVEVAVSG  302

Query  3292  VVDQSKEEYGHHPP  3333
             VVDQS+   G   P
Sbjct  303   VVDQSQVVLGPVSP  316



>ref|XP_008371836.1| PREDICTED: regulatory protein NPR3 isoform X2 [Malus domestica]
Length=578

 Score =   428 bits (1100),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 257/503 (51%), Positives = 351/503 (70%), Gaps = 22/503 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkak--kdcdgkpKFLMTELVPCGWVGY  1551
             DY+DA+I VEG+ V V+R ILA+RS+FF E F++     + +GKPK+ M++L+P G VGY
Sbjct  57    DYSDAEITVEGVPVAVHRCILASRSEFFAELFRRENGDSEQEGKPKYCMSDLLPFGHVGY  116

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF+VFL++VYT K +  P EVS+CV   C H ACRPAI+++++LM AS+ F + +LV +
Sbjct  117   EAFLVFLSFVYTAKVRDFPVEVSSCVHNVCGHEACRPAIEFSLELMCASSVFGMPDLVSI  176

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
             +Q  +D+++   A +DVIPIL+V F C L+ L+++C+ RV  S+LD+ +LE  LP  +  
Sbjct  177   LQL-IDFVLKALA-DDVIPILVVAFHCQLSQLIDQCIERVAHSDLDSISLEKALPDEVVE  234

Query  1190  DIKARRLNQQGA-----------NEKKIRKILRALDCNDVELVKLLLEESDITLDDayav  1044
              IK  R N Q              EK+IR+I +ALD +DVEL+KLLL ESD+TLD+A A+
Sbjct  235   KIKILRRNSQHCCDPNMPAVDPLREKRIRRIHKALDSDDVELMKLLLTESDVTLDEANAL  294

Query  1043  hyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDA  864
             HYAAAYC+ KVV EVLGLG  D+NLR++RGYTVLH+A  RK+P+II+ +L  +GA   + 
Sbjct  295   HYAAAYCDPKVVAEVLGLGLADVNLRDSRGYTVLHIAVXRKEPSIIILLL-SNGARASEP  353

Query  863   TCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVSLPSSTTLE  684
             T   G +AV+ICRR TR KDY+  TE G+E N DR+CIDVLE  M   NP++  +S + +
Sbjct  354   TL-EGESAVSICRRLTRQKDYHTKTERGQEANKDRICIDVLEREMQR-NPMAGEASISSQ  411

Query  683   ---NDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVG  513
                NDL M L  LENRVA AR L+P EA++ M I+ AD+T EF G+S ++G  GNL  V 
Sbjct  412   ITPNDLHMRLLKLENRVAFARLLFPAEAKLAMAISQADTTPEFAGISSLKGSSGNLMEVD  471

Query  512   LTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQ  333
             L   P  Q KRL+ R E+L KTV +GR +F +CS+VLDK    D+ D L  LE+GT +EQ
Sbjct  472   LNETPTVQNKRLLSRLESLVKTVSMGRHYFPHCSEVLDKFLQVDLPD-LCVLETGTTDEQ  530

Query  332   TNKKRRYMELKEEVMKAFDKDMA  264
               K++R++ELKEEV KAFDKD A
Sbjct  531   KIKRQRFLELKEEVQKAFDKDKA  553



>ref|XP_009399066.1| PREDICTED: regulatory protein NPR3-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=584

 Score =   427 bits (1098),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 262/504 (52%), Positives = 337/504 (67%), Gaps = 24/504 (5%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakk---dcdgkpKFLMTELVPCGWVG  1554
             D  DA+I VEG  VGV+R ILAARS+FF E F +        +GKP+F M ELVP G VG
Sbjct  70    DCTDAEIMVEGAPVGVHRCILAARSRFFRELFSREGSGGAPREGKPRFDMDELVPGGRVG  129

Query  1553  YEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVM  1374
              EAFMVFL+Y+YTGK K +P +VS CVD  C H +C PAI +AV+LMYAS+ FQI ELV 
Sbjct  130   REAFMVFLSYLYTGKLKPAPQDVSICVDRFCAHDSCPPAIGFAVELMYASSVFQIAELVS  189

Query  1373  LIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAIS  1194
             L+QR L   V+ A +EDVIPIL V     L  L+  CV+RV  S+LD+  LE +LP  ++
Sbjct  190   LLQRRLLNFVEKALVEDVIPILQVASHSKLNQLLTHCVQRVARSDLDDIALEKKLPQEVT  249

Query  1193  SDIKARRLNQQ---------GANEKKIRKILRALDCNDVELVKLLLEESDITLDDayavh  1041
              +I++ R   Q           +EK+I++I RALD +DVELVKLLL ES +TLDD YA+H
Sbjct  250   DEIRSLRRKSQPKESNVTVDPVHEKRIKRIHRALDSDDVELVKLLLSESGVTLDDTYALH  309

Query  1040  yaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDAT  861
             YAAAYC+SKV+ E+L LG  ++NL+N +GYT LHVAA R++P +IV++L K  +++   T
Sbjct  310   YAAAYCDSKVIAELLDLGSANVNLKNDKGYTPLHVAAMRREPKVIVSLLTKGASALE--T  367

Query  860   CSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLE-----GVMMNGNPVSLPSS  696
              ++G  AV ICRR TR KDY   TE+G+E N ++LCID+LE       M+  + V+ P  
Sbjct  368   TADGQNAVRICRRLTRAKDYFTKTEQGQESNKNKLCIDILEREVRRNPMVGEDAVTSP--  425

Query  695   TTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGV  516
               L +DL M+L +LENRVA AR  +P EA++ MEIAHAD+T EF GL        NL+ V
Sbjct  426   -LLADDLHMKLLYLENRVAFARLFFPAEAKVAMEIAHADTTSEFTGLYKSRS-SSNLRDV  483

Query  515   GLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEE  336
              L   P  Q KRL  R + L KTVELGRR+F NCS VLDK   DD+ D L  L+ G+P+E
Sbjct  484   DLNETPVVQNKRLRTRVDTLMKTVELGRRYFPNCSQVLDKFLDDDLPD-LFYLQKGSPDE  542

Query  335   QTNKKRRYMELKEEVMKAFDKDMA  264
             Q  KK R+ ELKE+V KAF KD A
Sbjct  543   QKIKKLRFCELKEDVRKAFSKDKA  566



>gb|AHF20181.1| ankyrin-repeat protein, partial [Musa acuminata AAA Group]
Length=584

 Score =   427 bits (1098),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 263/504 (52%), Positives = 339/504 (67%), Gaps = 24/504 (5%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakk---dcdgkpKFLMTELVPCGWVG  1554
             D  DA+I VEG  VGV+R ILAARS+FF E F +        +GKP+F M ELVP G VG
Sbjct  70    DCTDAEIMVEGAPVGVHRCILAARSRFFRELFSREGSGGAPREGKPRFDMDELVPGGRVG  129

Query  1553  YEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVM  1374
              EAFMVFL+Y+YTGK K +P +VS CVD  C H +C PAI +AV+LMYAS+ FQI ELV 
Sbjct  130   REAFMVFLSYLYTGKLKPAPQDVSICVDRFCAHDSCPPAIGFAVELMYASSVFQIAELVS  189

Query  1373  LIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAIS  1194
             L+QR L   V+ A +EDVIPIL V     L  L+  CV+RV  S+LD+  LE +LP  ++
Sbjct  190   LLQRRLLNFVEKALVEDVIPILQVASHSKLNQLLTHCVQRVARSDLDDIALEKKLPQEVT  249

Query  1193  SDIKARRLNQQ--GAN-------EKKIRKILRALDCNDVELVKLLLEESDITLDDayavh  1041
              +I++ R   Q  G+N       EK+I++I RALD +DVELVKLLL ES +TLDD YA+H
Sbjct  250   DEIRSLRRKSQPKGSNVTVDPVHEKRIKRIHRALDSDDVELVKLLLNESGVTLDDTYALH  309

Query  1040  yaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDAT  861
             YAAAYC+SKV+ E+L LG  ++NL+N +GYT LHVAA R++P +IV++L K  +++   T
Sbjct  310   YAAAYCDSKVIAELLDLGSANVNLKNDKGYTPLHVAAMRREPKVIVSLLTKGASALE--T  367

Query  860   CSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLE-----GVMMNGNPVSLPSS  696
              ++G  AV ICRR TR KDY   TE+G+E N ++LCID+LE       M+  + V+ P  
Sbjct  368   TADGQNAVRICRRLTRAKDYFTKTEQGQESNKNKLCIDILEREVRRNPMVGEDAVTSP--  425

Query  695   TTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGV  516
               L +D+ M+L +LENRVA AR  +P EA++ MEIAHAD+T EF GL        NL+ V
Sbjct  426   -LLADDIHMKLLYLENRVAFARLFFPAEAKVAMEIAHADTTSEFTGLYKSRS-SSNLRDV  483

Query  515   GLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEE  336
              L   P  Q KRL  R + L KTVELGRR+F NCS VLDK   DD+ D L  L+ G+P+E
Sbjct  484   DLNETPVVQNKRLRTRVDTLMKTVELGRRYFPNCSQVLDKFLEDDLPD-LFYLQKGSPDE  542

Query  335   QTNKKRRYMELKEEVMKAFDKDMA  264
             Q  KK R+ ELKE+V KAF KD A
Sbjct  543   QKIKKLRFCELKEDVRKAFSKDKA  566



>gb|AFO10948.1| non-expressor of PR1-like protein, partial [Gossypium barbadense]
Length=512

 Score =   424 bits (1091),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 266/498 (53%), Positives = 344/498 (69%), Gaps = 26/498 (5%)
 Frame = -2

Query  1679  VNRGILAARSQFFHEEFkkakkdcdg--kpKFLMTELVPCGWVGYEAFMVFLNYVYTGKT  1506
             V+R ILA RS+FF+E FK+     +   KP + M+EL+P G +G EAF VFL+Y+YTGK 
Sbjct  1     VHRCILAVRSKFFNEVFKEGSGSSEKDGKPSYNMSELLPYGKIGLEAFQVFLSYLYTGKL  60

Query  1505  KASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML-IQRHLDWLVDIAAI  1329
             K SP EVSTCVD  C H ACRPAI +AV+LMYAS+ FQI ELV L +QR L   V+ A +
Sbjct  61    KPSPMEVSTCVDNVCAHDACRPAISFAVELMYASSIFQILELVPLYLQRRLLNFVEKALL  120

Query  1328  EDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISSDIKARRLNQ----Q  1161
             ED+IPIL+V F C  + L    V RV  S+LD+  +E ELP  ++  I+  R       +
Sbjct  121   EDIIPILVVAFHCQCSQLGSPFVDRVARSDLDSICIEKELPYEVTESIRLLRRKSPSDGE  180

Query  1160  GAN-------EKKIRKILRALDCNDVELVKLLLEESDITLDDayavhyaaaYCNSKVVNE  1002
             G+        EK+IR+I +ALD +DVELVKLLL ESDITLDDA A+HYAAAYC+ KVV+E
Sbjct  181   GSEAVVDPLREKRIRRIHKALDSDDVELVKLLLTESDITLDDATALHYAAAYCDPKVVSE  240

Query  1001  VLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDATCSNGHTAVTICRR  822
             VLGL   D+NLRN+RGYTVLH+AA RK+P++I+A+L K GAS    T  +G +AV ICRR
Sbjct  241   VLGLRLADVNLRNSRGYTVLHIAAMRKEPSVIMALLAK-GASASTLTL-DGQSAVNICRR  298

Query  821   STRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVS---LPSSTTLENDLVMELYFLE  651
              TRPKDY+  TE+G+E N DR+CID+LE  M   NP++     +S  L +DL M L +LE
Sbjct  299   LTRPKDYHAKTEQGKETNKDRICIDILEREMRR-NPMAGDVSVASHALSDDLHMRLLYLE  357

Query  650   NRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLC--GNLKGVGLTGLPPDQVKRL  477
             NRVALAR L+P EA++ ++IAHA++T E    +G    C  GNL+ V L   P  Q +RL
Sbjct  358   NRVALARLLFPSEAKLAIDIAHAETTSELA--TGFPSKCSNGNLRQVDLNETPIMQKQRL  415

Query  476   MERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQTNKKRRYMELKE  297
             + R +AL KTVE+GRR+F +CS+VLDK   DD  D L  LE+GTPEEQ  ++ R+ ELKE
Sbjct  416   LARMQALMKTVEMGRRYFPHCSEVLDKFMEDDPPD-LSYLETGTPEEQRIERSRFRELKE  474

Query  296   EVMKAFDKDMAQ-NRVGL  246
             +V +AF KD A+ NR GL
Sbjct  475   DVQRAFKKDKAEFNRNGL  492



>gb|KHG02161.1| hypothetical protein F383_23944 [Gossypium arboreum]
Length=345

 Score =   416 bits (1068),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 239/379 (63%), Positives = 284/379 (75%), Gaps = 43/379 (11%)
 Frame = +1

Query  2419  GGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGRQE  2598
             G +TPSRF+LLSMVKKHS  LGKT+VEEED SDVEMD QFWH+V DLYFV GKES+ RQ+
Sbjct  5     GEETPSRFDLLSMVKKHSNLLGKTVVEEEDASDVEMDGQFWHDVFDLYFVRGKESKRRQD  64

Query  2599  DDLIFFVRKMSLQGY-ESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLIA  2775
             DDL+FFVRK    G+ + NG +    PYFVRRW+ +LD L+GE+   VDWRRS+YLN+IA
Sbjct  65    DDLLFFVRKWREHGFNDKNGVA----PYFVRRWALELDKLVGESFSEVDWRRSFYLNMIA  120

Query  2776  HTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPAY  2955
             H ++SVTVAICS +VL+N Q G+D PLS IYK+VKTVYASPSR         EVETTPAY
Sbjct  121   HISYSVTVAICSQQVLRNRQVGQDTPLSSIYKIVKTVYASPSR---------EVETTPAY  171

Query  2956  PDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDSSQSET-SGGKTQSSKITI  3132
             PDICFA+DDFDSTFDAVVLTD D CYCV+LNA DGA FPS++ ++++ S G ++      
Sbjct  172   PDICFAIDDFDSTFDAVVLTDTDLCYCVLLNALDGAGFPSETDKNDSCSNGHSR------  225

Query  3133  FSGFVSYQMVRDAYDAGRTgfgsllslhssgKTDRIYMKGPGGRGEVEVAVSGVVDQSKE  3312
             F  F+S       + +G              KTDR+YMKGPGGRGEVEVAVSGV DQSK+
Sbjct  226   FGSFLSV-----GHSSG--------------KTDRLYMKGPGGRGEVEVAVSGVADQSKQ  266

Query  3313  EYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatrssDEEMIPLKCCLMSISL  3483
               G   P   K+GL   ++ R+AASV S+AAKH YAAA+AT +SDEEMIPLKCCLMSI+L
Sbjct  267   YSGPFSPIKSKRGLRLGSMFRKAASVVSLAAKHVYAAAAATSTSDEEMIPLKCCLMSITL  326

Query  3484  PWEHIAHDLLLKGSPPVNL  3540
             PWEHIAHDLL K SPPVNL
Sbjct  327   PWEHIAHDLLFKRSPPVNL  345



>ref|NP_849827.1| protein CW7 [Arabidopsis thaliana]
 gb|AEE33581.1| protein CW7 [Arabidopsis thaliana]
Length=319

 Score =   410 bits (1055),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 208/302 (69%), Positives = 243/302 (80%), Gaps = 7/302 (2%)
 Frame = +1

Query  2413  NGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGR  2592
             N G  TPSR E+LSMVKKHSK LGKT ++E+D SDVEMD  FWH V D+YFV   ESR R
Sbjct  3     NDGEVTPSRHEILSMVKKHSKSLGKTSLDEQDASDVEMDSNFWHGVFDVYFVRCMESRRR  62

Query  2593  QEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLI  2772
             Q+DDL+FFVRK+S + Y    N +  +PYFVRRW+PKLD+LLGE+   VDWR+S+YLN+I
Sbjct  63    QDDDLLFFVRKLSCKSYGLTENEDAPAPYFVRRWAPKLDELLGESLAEVDWRKSFYLNMI  122

Query  2773  AHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPA  2952
             AHT+F+VTVAICS+E LK YQ  KD  LSPIYKVVKTVYASPSR+NFHLDS+KEVETTPA
Sbjct  123   AHTSFTVTVAICSNEALKTYQGSKDTKLSPIYKVVKTVYASPSRVNFHLDSKKEVETTPA  182

Query  2953  YPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPS----DSSQSETSGG--KTQ  3114
             YP+ICFAVDDFDSTFDAVVLTD DHCYCV+LN++DGAAFPS    DSS S T+      +
Sbjct  183   YPEICFAVDDFDSTFDAVVLTDKDHCYCVLLNSHDGAAFPSATVKDSSDSNTNADPRTVK  242

Query  3115  SSKITIFSGFVSYQMVRDAYDAGRTgf-gsllslhssgKTDRIYMKGPGGRGEVEVAVSG  3291
               K+T+FSGFVSYQMVR+AY+ GR  F   L   H +GK DR+YM+GPGGRGEVEVAVSG
Sbjct  243   DPKVTLFSGFVSYQMVREAYEGGRNRFGSLLSLGHITGKADRLYMRGPGGRGEVEVAVSG  302

Query  3292  VV  3297
             VV
Sbjct  303   VV  304



>ref|XP_009361056.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X3 
[Pyrus x bretschneideri]
Length=383

 Score =   413 bits (1061),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 245/408 (60%), Positives = 300/408 (74%), Gaps = 56/408 (14%)
 Frame = +1

Query  2404  LLGNGGGQTPSRFELLSMVKKHSKFLGKTIV--EEEDPSDVEMDPQFWHEVLDLYFVCGK  2577
             +LG+G  +TP+RFELLSMVKKHS  LGKT++  +E+D SDVE+D +FWH++LDLYFV GK
Sbjct  3     MLGHGE-ETPTRFELLSMVKKHSSLLGKTVIVADEDDTSDVELDHRFWHDMLDLYFVRGK  61

Query  2578  ESRGRQEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSY  2757
             +SRGRQ+DDL+FFVRK+S  GY  N   E  SPYFVRRW+ KLDDL+GE++V VDWRRS+
Sbjct  62    DSRGRQDDDLVFFVRKLSSYGYGFNDGKEGVSPYFVRRWAHKLDDLIGESNVDVDWRRSF  121

Query  2758  YLNLIAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYK------------VVKTVYASPS  2901
             YLNLIAHT+F+VTVAICSH+ L+N+Q  +  PLSPIYK            VVKTVYASPS
Sbjct  122   YLNLIAHTSFTVTVAICSHQDLRNHQADQGIPLSPIYKSMFSIRLVAPLQVVKTVYASPS  181

Query  2902  RINFHLDSRKEVETTPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFP---  3072
             R+NF LDS K                         VLT+ D+CYCVILNA+DGAAFP   
Sbjct  182   RVNFQLDSEK-------------------------VLTETDNCYCVILNAHDGAAFPRVK  216

Query  3073  ---------SDSSQSETSGGKTQSSKITIFSGFVSYQMVRDAYDAGRTgfgsllslhssg  3225
                      S S + ET+  KT+++K+T+FSGFVSYQMVRDAYDAG++     L  HS G
Sbjct  217   ESDECSSGDSSSLRIETNSAKTKNTKLTLFSGFVSYQMVRDAYDAGKS-RFGNLLGHSPG  275

Query  3226  KTDRIYMKGPGGRGEVEVAVSGVVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaa  3396
             KTD++YMKGPGGRGEVE+AVSGV DQS+++ G   P   K G    ++VR+AASVASVAA
Sbjct  276   KTDKLYMKGPGGRGEVEIAVSGVADQSQQDLGPFSPVISKTGFGIGSIVRKAASVASVAA  335

Query  3397  khayaaasatrssDEEMIPLKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
             K+AYAAAS+T S D+EM+PLKCCLMSISLPWE IA+DLL KG+PPV L
Sbjct  336   KNAYAAASSTHSFDDEMVPLKCCLMSISLPWEQIAYDLLFKGTPPVTL  383



>gb|AGI38074.1| nonexpressor of pathogenesis-related protein 1 [Arachis pusilla]
 gb|AGI38083.1| nonexpressor of pathogenesis-related protein 1 [Arachis pusilla]
Length=481

 Score =   416 bits (1070),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 242/457 (53%), Positives = 316/457 (69%), Gaps = 17/457 (4%)
 Frame = -2

Query  1586  MTELVPCGWVGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYA  1407
             M+ELVP G VG+E+F+VFL+Y+YTG  KASPPEV+TCVDE+C H ACRPAIDYA++LMYA
Sbjct  1     MSELVPYGKVGHESFLVFLHYLYTGTLKASPPEVTTCVDETCVHDACRPAIDYALELMYA  60

Query  1406  SATFQIKELVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNF  1227
             SATFQ+KELV+L QR L   V+ A +EDVIP+L+  F C L+ L  +C +RV  S+LD  
Sbjct  61    SATFQMKELVLLFQRRLLNFVEKAVVEDVIPVLMAAFHCQLSQLRLQCTQRVARSDLDTT  120

Query  1226  TLENELPGAISSDIKARR-----------LNQQGANEKKIRKILRALDCNDVELVKLLLE  1080
             +LE E P  +  +IK+ R           +  +  NEK IR+I +A+D +DVEL+KLLL 
Sbjct  121   SLEKEFPQEVVDEIKSLRAQSVLESTPAEMEVETLNEKSIRRIHKAMDSDDVELLKLLLN  180

Query  1079  ESDITLDDayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVA  900
             ES +TLDDAYA+HYA AY +SKV+ EVL LG  D+NLRN RGYTVLHVAARRKDP+I+VA
Sbjct  181   ESKVTLDDAYALHYACAYSDSKVIQEVLNLGLADINLRNPRGYTVLHVAARRKDPSILVA  240

Query  899   ILDKSGASIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVM-MN  723
             +L K GA+  D T  +G TA+ IC+R TR KDY++ T + +E N DRLC+DVLE  M  N
Sbjct  241   LL-KKGANASDTT-PDGQTALVICQRLTRRKDYHEETVQCKESNKDRLCVDVLEREMRRN  298

Query  722   GNPVSLP-SSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGM  546
                V++  SS T  +DL M+L + ENRVA AR L+P EAR+ +E A  DS       S +
Sbjct  299   FKCVTMSDSSETTADDLHMKLDYFENRVAFARLLFPAEARVAIENAEVDSASLDTTSSAL  358

Query  545   EGLCGNLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSL  366
             +    N + V L   P  + K++  R ++L+KTVE GRRFF +CS+VLD    D + D  
Sbjct  359   KRAGAN-REVDLNETPAVRTKKMQLRLQSLQKTVENGRRFFPHCSEVLDNFLEDLIPDVF  417

Query  365   ESLESGTPEEQTNKKRRYMELKEEVMKAFDKDMAQNR  255
               LE G+ EEQ  KK R+MELK++V KAF  DMA+N+
Sbjct  418   -FLEKGSEEEQRIKKARFMELKDDVQKAFHMDMAENK  453



>ref|NP_001052185.1| Os04g0183100 [Oryza sativa Japonica Group]
 emb|CAE04395.2| OSJNBb0006L01.7 [Oryza sativa Japonica Group]
 dbj|BAF14099.1| Os04g0183100 [Oryza sativa Japonica Group]
Length=405

 Score =   414 bits (1063),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 236/389 (61%), Positives = 291/389 (75%), Gaps = 17/389 (4%)
 Frame = +1

Query  2413  NGGGQTPSRFELLSMVKKHSKFLGKTIVEEE-DPSDVEMDPQFWHEVLDLYFVCGKESRG  2589
             +G G + SR +LLSMVKKHS  +G T+++ E D SDVEMD +FWHE+LDL+FV G+ S+G
Sbjct  21    SGSGASSSRNKLLSMVKKHSDLIGWTVIDAEADASDVEMDDKFWHEILDLFFVHGRVSKG  80

Query  2590  RQEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNL  2769
             R+EDDL+FFV  M L GY S+ N E+  P+FVRRW+PKL+ +   N   V+W RS+YLNL
Sbjct  81    REEDDLVFFVNNMKLNGYRSSDNMENPPPFFVRRWAPKLEKITNINLADVNWERSFYLNL  140

Query  2770  IAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTP  2949
             IAHT++SVTVAICS   L N +  K KPLSP+YKV KTVYASPSR+NFHLD RK VET P
Sbjct  141   IAHTSYSVTVAICSIMDLCN-RAEKSKPLSPVYKVTKTVYASPSRVNFHLDRRKAVETVP  199

Query  2950  AYPDICFAVDDFDSTFDAV-VLTDVDHCYCVILNANDGAAFPSDS-----SQSETSGGKT  3111
             AYP+ICF++DDFD TFDAV VL+D +HCYCVILNA+DGAAFP ++     S +  SG  T
Sbjct  200   AYPNICFSIDDFDDTFDAVQVLSDPEHCYCVILNAHDGAAFPENTESKNPSSNVLSGVNT  259

Query  3112  QSS-----KITIFSGFVSYQMVRDAYDAGRTgfgsllsl-hssgKTDRIYMKGPGGRGEV  3273
              S      K T+FSG+VSYQ VR+AYDAGR+ F SL SL H   K D++YM+GP GRGEV
Sbjct  260   GSKQEKPPKRTLFSGYVSYQNVREAYDAGRSKFESLFSLGHDRTKLDKLYMRGPEGRGEV  319

Query  3274  EVAVSGVVDQSKEEYGHHPPKKGLsfsavvrraasvasvaakhayaaasatrssDEEMIP  3453
             EVAVSG+ DQS E     P   G SF A+V  AAS AS  AKHAY AAS  +  D+E++P
Sbjct  320   EVAVSGIADQSHERSKKDP---GNSFRALVHSAASTASKLAKHAYEAASTNKRFDDELLP  376

Query  3454  LKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
             LKCCLMS+SLPW++IAHDLL K +PP++L
Sbjct  377   LKCCLMSVSLPWDYIAHDLLHKETPPLDL  405



>emb|CAH65852.1| OSIGBa0140C02.4 [Oryza sativa Indica Group]
Length=405

 Score =   412 bits (1060),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 236/389 (61%), Positives = 291/389 (75%), Gaps = 17/389 (4%)
 Frame = +1

Query  2413  NGGGQTPSRFELLSMVKKHSKFLGKTIVEEE-DPSDVEMDPQFWHEVLDLYFVCGKESRG  2589
             +G G + SR +LLSMVKKHS  +G T+++ E D SDVEMD +FWHE+LDL+FV G+ S+G
Sbjct  21    SGSGASSSRNKLLSMVKKHSDLIGWTVIDAEADASDVEMDDKFWHEILDLFFVHGRVSKG  80

Query  2590  RQEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNL  2769
             R+EDDL+FFV  M L GY S+ N E+  P+FVRRW+PKL+ +   N   V+W RS+YLNL
Sbjct  81    REEDDLVFFVNNMKLNGYRSSDNMENPPPFFVRRWAPKLEKITNINLADVNWERSFYLNL  140

Query  2770  IAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTP  2949
             IAHT++SVTVAICS   L N +  K KPLSP+YKV KTVYASPSR+NFHLD RK VET P
Sbjct  141   IAHTSYSVTVAICSIMDLCN-RAEKSKPLSPVYKVTKTVYASPSRVNFHLDRRKAVETVP  199

Query  2950  AYPDICFAVDDFDSTFDA-VVLTDVDHCYCVILNANDGAAFPSDS-----SQSETSGGKT  3111
             AYP+ICF++DDFD TFDA VVL+D +HCYCVILNA+DGAAFP ++     S +  SG  T
Sbjct  200   AYPNICFSIDDFDDTFDAVVVLSDPEHCYCVILNAHDGAAFPENTESKNPSSNVLSGVNT  259

Query  3112  QSS-----KITIFSGFVSYQMVRDAYDAGRTgfgsllsl-hssgKTDRIYMKGPGGRGEV  3273
              S      K T+FSG+VSYQ VR+AYDAGR+ F SL SL H   K D++YM+GP GRGEV
Sbjct  260   GSKQEKPPKRTLFSGYVSYQNVREAYDAGRSKFESLFSLGHDRTKLDKLYMRGPEGRGEV  319

Query  3274  EVAVSGVVDQSKEEYGHHPPKKGLsfsavvrraasvasvaakhayaaasatrssDEEMIP  3453
             EVAVSG+ DQS E     P   G SF A+V  AAS AS  AKHAY AAS  +  D+E++P
Sbjct  320   EVAVSGIADQSHERSKKDP---GDSFRALVHSAASTASKLAKHAYEAASTNKRFDDELLP  376

Query  3454  LKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
             LKCCLMS+SLPW++IAHDLL K +PP++L
Sbjct  377   LKCCLMSVSLPWDYIAHDLLHKETPPLDL  405



>gb|AGI38062.1| nonexpressor of pathogenesis-related protein 1 [Arachis glabrata]
 gb|AGI38073.1| nonexpressor of pathogenesis-related protein 1 [Arachis correntina]
 gb|AGI38079.1| nonexpressor of pathogenesis-related protein 1 [Arachis glabrata]
 gb|AGI38082.1| nonexpressor of pathogenesis-related protein 1 [Arachis correntina]
Length=481

 Score =   415 bits (1066),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 244/457 (53%), Positives = 319/457 (70%), Gaps = 17/457 (4%)
 Frame = -2

Query  1586  MTELVPCGWVGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYA  1407
             M+ELVP G VG+E+F+VFL+Y+YTG  KASPPEV+TCVDE+C H ACRPAIDYA++LMYA
Sbjct  1     MSELVPYGKVGHESFLVFLHYLYTGTLKASPPEVTTCVDETCVHDACRPAIDYALELMYA  60

Query  1406  SATFQIKELVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNF  1227
             SATFQ+KELV+L QR L   V+ A +EDVIP+L+  F C L+ L  +C +RV  S+LD  
Sbjct  61    SATFQMKELVLLFQRRLLNFVEKAVVEDVIPVLMAAFHCQLSQLRLQCTQRVARSDLDTT  120

Query  1226  TLENELPGAISSDIKARR-----------LNQQGANEKKIRKILRALDCNDVELVKLLLE  1080
             +LE E P  +  +IK+ R           +  +  NEK IR+I +A+D +DVEL+KLLL 
Sbjct  121   SLEKEFPQEVVDEIKSLRAQSVLEPTPAEMEVETLNEKSIRRIHKAMDSDDVELLKLLLN  180

Query  1079  ESDITLDDayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVA  900
             ES +TL+DAYA+HYA AY +SKV+ EVL LG  D+NLRN RGYTVLHVAARRKDP+I+VA
Sbjct  181   ESKVTLNDAYALHYACAYSDSKVIQEVLNLGLADINLRNPRGYTVLHVAARRKDPSILVA  240

Query  899   ILDKSGASIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVM-MN  723
             +L K GA+  D T  +G TA+ IC+R TR KDY++ T +G+E N DRLC+DVLE  M  N
Sbjct  241   LL-KKGANASDTT-PDGQTALVICQRLTRRKDYHEETVQGKESNKDRLCVDVLEREMRRN  298

Query  722   GNPVSLP-SSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGM  546
                V++  SS T  +DL M+L +LENRVA AR L+P EAR+ +E A ADS       S +
Sbjct  299   FMCVTMSDSSETTADDLHMKLDYLENRVAFARLLFPAEARVAIENAEADSASLDTTSSPL  358

Query  545   EGLCGNLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSL  366
             +    N + V L   P  + K++  R ++L+KTVE GRRFF +CS+VLD    D + D  
Sbjct  359   KRAGAN-REVDLNETPAVRTKKMQLRLQSLQKTVENGRRFFPHCSEVLDNFLEDLIPDVF  417

Query  365   ESLESGTPEEQTNKKRRYMELKEEVMKAFDKDMAQNR  255
               LE G+ EEQ  KK R+MELK++V KAF  DMA+N+
Sbjct  418   -FLEKGSEEEQRIKKARFMELKDDVQKAFHMDMAENK  453



>gb|AGI38064.1| nonexpressor of pathogenesis-related protein 1 [Arachis triseminata]
 gb|AGI38076.1| nonexpressor of pathogenesis-related protein 1 [Arachis paraguariensis]
 gb|AGI38078.1| nonexpressor of pathogenesis-related protein 1 [Arachis triseminata]
 gb|AGI38085.1| nonexpressor of pathogenesis-related protein 1 [Arachis paraguariensis]
Length=481

 Score =   415 bits (1066),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 244/457 (53%), Positives = 319/457 (70%), Gaps = 17/457 (4%)
 Frame = -2

Query  1586  MTELVPCGWVGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYA  1407
             M+ELVP G VG+E+F+VFL+Y+YTG  KASPPEV+TCVDE+C H ACRPAIDYA++LMYA
Sbjct  1     MSELVPYGKVGHESFLVFLHYLYTGTLKASPPEVTTCVDETCVHDACRPAIDYALELMYA  60

Query  1406  SATFQIKELVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNF  1227
             SATFQ+KELV+L QR L   V+ A +EDVIP+L+  F C L+ L  +C +RV  S+LD  
Sbjct  61    SATFQMKELVLLFQRRLLNFVEKAVVEDVIPVLMAAFHCQLSQLRLQCTQRVARSDLDTT  120

Query  1226  TLENELPGAISSDIKARR-----------LNQQGANEKKIRKILRALDCNDVELVKLLLE  1080
             +LE E P  +  +IK+ R           +  +  NEK IR+I +A+D +DVEL+KLLL 
Sbjct  121   SLEKEFPQEVVDEIKSLRAQSVLESTPAEMEVETLNEKSIRRIHKAMDSDDVELLKLLLN  180

Query  1079  ESDITLDDayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVA  900
             ES +TL+DAYA+HYA AY +SKV+ EVL LG  D+NLRN RGYTVLHVAARRKDP+I+VA
Sbjct  181   ESKVTLNDAYALHYACAYSDSKVIQEVLNLGLADINLRNPRGYTVLHVAARRKDPSILVA  240

Query  899   ILDKSGASIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVM-MN  723
             +L K GA+  D T  +G TA+ IC+R TR KDY++ T +G+E N DRLC+DVLE  M  N
Sbjct  241   LL-KKGANASDTT-PDGQTALVICQRLTRRKDYHEETVQGKESNKDRLCVDVLEREMRRN  298

Query  722   GNPVSLP-SSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGM  546
                V++  SS T  +DL M+L +LENRVA AR L+P EAR+ +E A ADS       S +
Sbjct  299   FMCVTMSDSSETTADDLHMKLDYLENRVAFARLLFPAEARVAIENAEADSASLDTTSSPL  358

Query  545   EGLCGNLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSL  366
             +    N + V L   P  + K++  R ++L+KTVE GRRFF +CS+VLD    D + D  
Sbjct  359   KRAGAN-REVDLNETPAVRTKKMQLRLQSLQKTVENGRRFFPHCSEVLDNFLEDLIPDVF  417

Query  365   ESLESGTPEEQTNKKRRYMELKEEVMKAFDKDMAQNR  255
               LE G+ EEQ  KK R+MELK++V KAF  DMA+N+
Sbjct  418   -FLEKGSEEEQRIKKARFMELKDDVQKAFHMDMAENK  453



>gb|AGI38060.1| nonexpressor of pathogenesis-related protein 1 [Arachis hypogaea]
Length=481

 Score =   414 bits (1065),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 241/457 (53%), Positives = 316/457 (69%), Gaps = 17/457 (4%)
 Frame = -2

Query  1586  MTELVPCGWVGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYA  1407
             M+ELVP G VG+E+F+VFL+Y+YTG  KASPPEV+TCVDE+C H ACRPAIDYA++LMYA
Sbjct  1     MSELVPYGKVGHESFLVFLHYLYTGTLKASPPEVTTCVDETCVHDACRPAIDYALELMYA  60

Query  1406  SATFQIKELVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNF  1227
             SATFQ+KELV+L QR L   V+ A +EDVIP+L+  F C L+ L  +C +RV  S+LD  
Sbjct  61    SATFQMKELVLLFQRRLLNFVEKAVVEDVIPVLMAAFHCQLSQLRLQCTQRVARSDLDTT  120

Query  1226  TLENELPGAISSDIKARR-----------LNQQGANEKKIRKILRALDCNDVELVKLLLE  1080
             +LE E P  +  +IK+ R           +  +  NEK IR+I +A+D +DVEL+KLLL 
Sbjct  121   SLEKEFPQEVVDEIKSLRAQSVLESTPEEMEVETLNEKSIRRIHKAMDSDDVELLKLLLN  180

Query  1079  ESDITLDDayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVA  900
             ES +TL+DAYA+HYA AY +SKV+ EVL LG  D+NLRN RGYTVLHVAARRKDP+I+VA
Sbjct  181   ESKVTLNDAYALHYACAYSDSKVIQEVLNLGLADINLRNPRGYTVLHVAARRKDPSILVA  240

Query  899   ILDKSGASIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVM-MN  723
             +L K GA+  D T  +G TA+ IC+R TR KDY++ T + +E N DRLC+DVLE  M  N
Sbjct  241   LL-KKGANASDTT-PDGQTALVICQRLTRRKDYHEETVQCKESNKDRLCVDVLEREMRRN  298

Query  722   GNPVSLP-SSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGM  546
                V++  SS T  +DL M+L + ENRVA AR L+P EAR+ +E A  DS       S +
Sbjct  299   FKCVTMSDSSETTADDLHMKLDYFENRVAFARLLFPAEARVAIENAEVDSASLDTTSSAL  358

Query  545   EGLCGNLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSL  366
             +    N + V L   P  + K++  R ++L+KTVE GRRFF +CS+VLD    D + D  
Sbjct  359   KRAGAN-REVDLNETPAVRTKKMQLRLQSLQKTVENGRRFFPHCSEVLDNFLEDLIPDVF  417

Query  365   ESLESGTPEEQTNKKRRYMELKEEVMKAFDKDMAQNR  255
               LE G+ EEQ  KK R+MELK++V KAF  DMA+N+
Sbjct  418   -FLEKGSEEEQRIKKARFMELKDDVQKAFHMDMAENK  453



>gb|AGI38063.1| nonexpressor of pathogenesis-related protein 1 [Arachis appressipila]
 gb|AGI38080.1| nonexpressor of pathogenesis-related protein 1 [Arachis appressipila]
Length=481

 Score =   414 bits (1065),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 241/457 (53%), Positives = 316/457 (69%), Gaps = 17/457 (4%)
 Frame = -2

Query  1586  MTELVPCGWVGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYA  1407
             M+ELVP G VG+E+F+VFL+Y+YTG  KASPPEV+TCVDE+C H ACRPAIDYA++LMYA
Sbjct  1     MSELVPYGKVGHESFLVFLHYLYTGTLKASPPEVTTCVDETCVHDACRPAIDYALELMYA  60

Query  1406  SATFQIKELVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNF  1227
             SATFQ+KELV+L QR L   V+ A +EDVIP+L+  F C L+ L  +C +RV  S+LD  
Sbjct  61    SATFQMKELVLLFQRRLLNFVEKAVVEDVIPVLMAAFHCQLSQLRLQCTQRVARSDLDTT  120

Query  1226  TLENELPGAISSDIKARR-----------LNQQGANEKKIRKILRALDCNDVELVKLLLE  1080
             +LE E P  +  +IK+ R           +  +  NEK IR+I +A+D +DVEL+KLLL 
Sbjct  121   SLEKEFPQEVVDEIKSLRAQSVLESTPEEMEVETLNEKSIRRIHKAMDSDDVELLKLLLN  180

Query  1079  ESDITLDDayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVA  900
             ES +TL+DAYA+HYA AY +SKV+ EVL LG  D+NLRN RGYTVLHVAARRKDP+I+VA
Sbjct  181   ESKVTLNDAYALHYACAYSDSKVIQEVLNLGLADINLRNPRGYTVLHVAARRKDPSILVA  240

Query  899   ILDKSGASIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVM-MN  723
             +L K GA+  D T  +G TA+ IC+R TR KDY++ T + +E N DRLC+DVLE  M  N
Sbjct  241   LL-KKGANASDTT-PDGQTALVICQRLTRRKDYHEETVQCKESNKDRLCVDVLEREMRRN  298

Query  722   GNPVSLP-SSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGM  546
                V++  SS T  +DL M+L + ENRVA AR L+P EAR+ +E A  DS       S +
Sbjct  299   FKCVTMSDSSETTADDLHMKLDYFENRVAFARLLFPAEARVAIEDAEVDSASLDTTSSAL  358

Query  545   EGLCGNLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSL  366
             +    N + V L   P  + K++  R ++L+KTVE GRRFF +CS+VLD    D + D  
Sbjct  359   KRAGAN-REVDLNETPAVRTKKMQLRLQSLQKTVENGRRFFPHCSEVLDNFLEDLIPDVF  417

Query  365   ESLESGTPEEQTNKKRRYMELKEEVMKAFDKDMAQNR  255
               LE G+ EEQ  KK R+MELK++V KAF  DMA+N+
Sbjct  418   -FLEKGSEEEQRIKKARFMELKDDVQKAFHMDMAENK  453



>gb|AGI38071.1| nonexpressor of pathogenesis-related protein 1 [Arachis hypogaea]
 gb|AGI38093.1| nonexpressor of pathogenesis-related protein 1 [Arachis hypogaea]
Length=481

 Score =   414 bits (1064),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 242/457 (53%), Positives = 318/457 (70%), Gaps = 17/457 (4%)
 Frame = -2

Query  1586  MTELVPCGWVGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYA  1407
             M+ELVP G VG+E+F+VFL+Y+YTG  KASPPEV+TCVDE+C H ACRPAIDYA++LMYA
Sbjct  1     MSELVPYGKVGHESFLVFLHYLYTGTLKASPPEVTTCVDETCVHDACRPAIDYALELMYA  60

Query  1406  SATFQIKELVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNF  1227
             SATFQ+KELV+L QR L  LV+ A +EDVIP+L+  F C L+ L  +C +RV  S+LD  
Sbjct  61    SATFQMKELVLLFQRRLLNLVEKAVVEDVIPVLMAAFHCQLSQLRLQCTQRVARSDLDTT  120

Query  1226  TLENELPGAISSDIKARR-----------LNQQGANEKKIRKILRALDCNDVELVKLLLE  1080
             +LE E P  +  +IK+ R           +  +  NEK IR+I +A+D +DVEL+KLLL 
Sbjct  121   SLEKEFPQEVVDEIKSLRAQSVLESTPAEMEVETLNEKSIRRIHKAMDSDDVELLKLLLN  180

Query  1079  ESDITLDDayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVA  900
             ES +TL+DAYA+HYA AY +SKV+ EVL LG  D+NLRN RGY+VLHVAARRKDP+I+VA
Sbjct  181   ESKVTLNDAYALHYACAYSDSKVIQEVLNLGLADINLRNPRGYSVLHVAARRKDPSILVA  240

Query  899   ILDKSGASIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVM-MN  723
             +L K GA+  D T  +G TA+ IC+R TR KDY++ T +G+E N DRLC+DVLE  M  N
Sbjct  241   LL-KKGANASDTT-PDGQTALVICQRLTRRKDYHEETVQGKESNKDRLCVDVLEREMRRN  298

Query  722   GNPVSLP-SSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGM  546
                V++  SS T  +DL M+L + ENRVA AR L+P EAR+ +E A  DS       S +
Sbjct  299   FKCVTMSDSSETTADDLHMKLDYFENRVAFARLLFPAEARVAIENAEVDSASLDTTSSTL  358

Query  545   EGLCGNLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSL  366
             +    N + V L   P  + K++  R ++L+KTVE GRRFF +CS+VLD    D + D  
Sbjct  359   KRAGAN-REVDLNETPAVRTKKMQLRLQSLQKTVENGRRFFPHCSEVLDNFLEDLIPDVF  417

Query  365   ESLESGTPEEQTNKKRRYMELKEEVMKAFDKDMAQNR  255
               LE G+ EEQ  KK R+MELK++V KAF  DMA+N+
Sbjct  418   -FLEKGSEEEQRIKKARFMELKDDVQKAFHMDMAENK  453



>gb|AGI38075.1| nonexpressor of pathogenesis-related protein 1 [Arachis appressipila]
 gb|AGI38084.1| nonexpressor of pathogenesis-related protein 1 [Arachis appressipila]
Length=481

 Score =   414 bits (1063),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 243/457 (53%), Positives = 319/457 (70%), Gaps = 17/457 (4%)
 Frame = -2

Query  1586  MTELVPCGWVGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYA  1407
             M+ELVP G VG+E+F+VFL+Y+YTG  KASPPEV+TCVDE+C H ACRPAIDYA++LMYA
Sbjct  1     MSELVPYGKVGHESFLVFLHYLYTGTLKASPPEVTTCVDETCVHDACRPAIDYALELMYA  60

Query  1406  SATFQIKELVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNF  1227
             SATFQ+KELV+L QR L   V+ A +EDVIP+L+  F C L+ L  +C +RV  S+LD  
Sbjct  61    SATFQMKELVLLFQRRLLNFVEKAVVEDVIPVLMAAFHCQLSQLRLQCTQRVARSDLDTT  120

Query  1226  TLENELPGAISSDIKARR-----------LNQQGANEKKIRKILRALDCNDVELVKLLLE  1080
             +LE E P  +  +IK+ R           +  +  NEK IR+I +A+D +DVEL+KLLL 
Sbjct  121   SLEKEFPQEVVDEIKSLRAQSVLESTPAEMEVETLNEKSIRRIHKAMDSDDVELLKLLLN  180

Query  1079  ESDITLDDayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVA  900
             ES +TL+DAYA+HYA AY +SKV+ EVL LG  D+NLRN RGYTVLHVAARRKDP+I+VA
Sbjct  181   ESKVTLNDAYALHYACAYSDSKVIQEVLNLGLADINLRNPRGYTVLHVAARRKDPSILVA  240

Query  899   ILDKSGASIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVM-MN  723
             +L K GA+  D T  +G TA+ IC+R TR +DY++ T +G+E N DRLC+DVLE  M  N
Sbjct  241   LL-KKGANASDTT-PDGQTALVICQRLTRRRDYHEETVQGKESNKDRLCVDVLEREMRRN  298

Query  722   GNPVSLP-SSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGM  546
                V++  SS T  +DL M+L +LENRVA AR L+P EAR+ +E A ADS       S +
Sbjct  299   FMCVTMSDSSETTADDLHMKLDYLENRVAFARLLFPAEARVAIENAEADSASLDTTSSPL  358

Query  545   EGLCGNLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSL  366
             +    N + V L   P  + K++  R ++L+KTVE GRRFF +CS+VLD    D + D  
Sbjct  359   KRAGAN-REVDLNETPAVRTKKMQLRLQSLQKTVENGRRFFPHCSEVLDNFLEDLIPDVF  417

Query  365   ESLESGTPEEQTNKKRRYMELKEEVMKAFDKDMAQNR  255
               LE G+ EEQ  KK R+MELK++V KAF  DMA+N+
Sbjct  418   -FLEKGSEEEQRIKKARFMELKDDVQKAFHMDMAENK  453



>ref|XP_004491374.1| PREDICTED: regulatory protein NPR3-like [Cicer arietinum]
Length=571

 Score =   417 bits (1072),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 262/508 (52%), Positives = 330/508 (65%), Gaps = 48/508 (9%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakk--dcdgkpKFLMTELVPCGWVGY  1551
             DY DA+I VE I VG++R ILA+RSQFFHE FKK K     +GKP++ M ELVP G VGY
Sbjct  65    DYCDAEILVEEIPVGIHRCILASRSQFFHEHFKKGKDGGVKEGKPRYFMKELVPYGNVGY  124

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF+ FL+Y+YTGK KASP EV+TCVDESC H ACRPAI+YA++LMYAS  FQ+KELV+L
Sbjct  125   EAFLAFLHYLYTGKLKASPLEVTTCVDESCIHDACRPAINYALELMYASVAFQMKELVLL  184

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
              QR+L   VD A +EDVIPIL+    C L  L+ +C++RV  S+LD  +LE ELP    +
Sbjct  185   FQRYLLNFVDKALVEDVIPILMTAHHCQLDQLLSQCIQRVARSDLDIISLEKELPHDAVT  244

Query  1190  DIKARRLNQ-----------QGANEKKIRKILRALDCNDVELVKLLLEESDITLDDayav  1044
             +IK  R+             +   +K IRKIL+ALD +DVEL+KLLL+ES +TLDDAYA+
Sbjct  245   EIKLIRVQSLPELAPDAMEVEPVKDKSIRKILKALDSDDVELLKLLLDESSVTLDDAYAL  304

Query  1043  hyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDA  864
             HYA AYC+SKVV EVL LG  D+ L+N RGYTVLHVAARRKDP+I+VA+L K GA   + 
Sbjct  305   HYACAYCDSKVVQEVLSLGLADILLKNPRGYTVLHVAARRKDPSILVALL-KKGACASET  363

Query  863   TCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVSLPS--STT  690
             T  +G T+                       + DRLC+DVLE  M   + V   S  S  
Sbjct  364   TL-DGQTS-----------------------HKDRLCVDVLEREMRRNSMVVNMSVLSQL  399

Query  689   LENDLVMELYFLENR----VALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLK  522
               +DL M L +LENR    +      +P EAR+ +E A ADST  +   S ++   GN+K
Sbjct  400   TADDLFMRLDYLENRGRTLLVYCIWFFPAEARVAIENAEADSTSLYATSSALK---GNIK  456

Query  521   GVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTP  342
              V L   P  + ++L  R ++L KTVE GRRFF +CS+VLDK   DD  D    LE GT 
Sbjct  457   EVDLNETPSVRTRKLQLRLQSLVKTVENGRRFFPHCSEVLDKYLEDDTPDVF-VLEKGTE  515

Query  341   EEQTNKKRRYMELKEEVMKAFDKDMAQN  258
             EEQ  KK R+MELK+EV KAF KDMA+N
Sbjct  516   EEQRTKKARFMELKDEVQKAFHKDMAEN  543



>ref|XP_009399065.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=599

 Score =   417 bits (1072),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 262/519 (50%), Positives = 337/519 (65%), Gaps = 39/519 (8%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakk---dcdgkpKFLMTELVPCGWVG  1554
             D  DA+I VEG  VGV+R ILAARS+FF E F +        +GKP+F M ELVP G VG
Sbjct  70    DCTDAEIMVEGAPVGVHRCILAARSRFFRELFSREGSGGAPREGKPRFDMDELVPGGRVG  129

Query  1553  YEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVM  1374
              EAFMVFL+Y+YTGK K +P +VS CVD  C H +C PAI +AV+LMYAS+ FQI ELV 
Sbjct  130   REAFMVFLSYLYTGKLKPAPQDVSICVDRFCAHDSCPPAIGFAVELMYASSVFQIAELVS  189

Query  1373  LIQ---------------RHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSN  1239
             L+Q               R L   V+ A +EDVIPIL V     L  L+  CV+RV  S+
Sbjct  190   LLQFTAAEPTCSSFCNAQRRLLNFVEKALVEDVIPILQVASHSKLNQLLTHCVQRVARSD  249

Query  1238  LDNFTLENELPGAISSDIKARRLNQQG---------ANEKKIRKILRALDCNDVELVKLL  1086
             LD+  LE +LP  ++ +I++ R   Q           +EK+I++I RALD +DVELVKLL
Sbjct  250   LDDIALEKKLPQEVTDEIRSLRRKSQPKESNVTVDPVHEKRIKRIHRALDSDDVELVKLL  309

Query  1085  LEESDITLDDayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAII  906
             L ES +TLDD YA+HYAAAYC+SKV+ E+L LG  ++NL+N +GYT LHVAA R++P +I
Sbjct  310   LSESGVTLDDTYALHYAAAYCDSKVIAELLDLGSANVNLKNDKGYTPLHVAAMRREPKVI  369

Query  905   VAILDKSGASIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLE----  738
             V++L K  +++   T ++G  AV ICRR TR KDY   TE+G+E N ++LCID+LE    
Sbjct  370   VSLLTKGASALE--TTADGQNAVRICRRLTRAKDYFTKTEQGQESNKNKLCIDILEREVR  427

Query  737   -GVMMNGNPVSLPSSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFV  561
                M+  + V+ P    L +DL M+L +LENRVA AR  +P EA++ MEIAHAD+T EF 
Sbjct  428   RNPMVGEDAVTSP---LLADDLHMKLLYLENRVAFARLFFPAEAKVAMEIAHADTTSEFT  484

Query  560   GLSGMEGLCGNLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADD  381
             GL        NL+ V L   P  Q KRL  R + L KTVELGRR+F NCS VLDK   DD
Sbjct  485   GLYKSRS-SSNLRDVDLNETPVVQNKRLRTRVDTLMKTVELGRRYFPNCSQVLDKFLDDD  543

Query  380   VLDSLESLESGTPEEQTNKKRRYMELKEEVMKAFDKDMA  264
             + D L  L+ G+P+EQ  KK R+ ELKE+V KAF KD A
Sbjct  544   LPD-LFYLQKGSPDEQKIKKLRFCELKEDVRKAFSKDKA  581



>gb|AGI38061.1| nonexpressor of pathogenesis-related protein 1 [Arachis hypogaea]
 gb|AGI38067.1| nonexpressor of pathogenesis-related protein 1 [Arachis hypogaea]
 gb|AGI38072.1| nonexpressor of pathogenesis-related protein 1 [Arachis duranensis]
 gb|AGI38081.1| nonexpressor of pathogenesis-related protein 1 [Arachis duranensis]
 gb|AGI38089.1| nonexpressor of pathogenesis-related protein 1 [Arachis hypogaea]
Length=481

 Score =   412 bits (1060),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 241/457 (53%), Positives = 317/457 (69%), Gaps = 17/457 (4%)
 Frame = -2

Query  1586  MTELVPCGWVGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYA  1407
             M+ELVP G VG+E+F+VFL+Y+YTG  KASPPEV+TCVDE+C H ACRPAIDYA++LMYA
Sbjct  1     MSELVPYGKVGHESFLVFLHYLYTGTLKASPPEVTTCVDETCVHDACRPAIDYALELMYA  60

Query  1406  SATFQIKELVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNF  1227
             SATFQ+KELV+L QR L   V+ A +EDVIP+L+  F C L+ L  +C +RV  S+LD  
Sbjct  61    SATFQMKELVLLFQRRLLNFVEKAVVEDVIPVLMAAFHCQLSQLRLQCTQRVARSDLDTT  120

Query  1226  TLENELPGAISSDIKARR-----------LNQQGANEKKIRKILRALDCNDVELVKLLLE  1080
             +LE E P  +  +IK+ R           +  +  NEK IR+I +A+D +DVEL+KLLL 
Sbjct  121   SLEKEFPQEVVDEIKSLRAQSVLESTPAEMEVETLNEKSIRRIHKAMDSDDVELLKLLLN  180

Query  1079  ESDITLDDayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVA  900
             ES +TL+DAYA+HYA AY +SKV+ EVL LG  D+NLRN RGY+VLHVAARRKDP+I+VA
Sbjct  181   ESKVTLNDAYALHYACAYSDSKVIQEVLNLGLADINLRNPRGYSVLHVAARRKDPSILVA  240

Query  899   ILDKSGASIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVM-MN  723
             +L K GA+  D T  +G TA+ IC+R TR KDY++ T +G+E N DRLC+DVLE  M  N
Sbjct  241   LL-KKGANASDTT-PDGQTALVICQRLTRRKDYHEETVQGKESNKDRLCVDVLEREMRRN  298

Query  722   GNPVSLP-SSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGM  546
                V++  SS T  +DL M+L + ENRVA AR L+P EAR+ +E A  DS       S +
Sbjct  299   FKCVTMSDSSETTADDLHMKLDYFENRVAFARLLFPAEARVAIENAEVDSASLDTTSSTL  358

Query  545   EGLCGNLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSL  366
             +    N + V L   P  + K++  R ++L+KTVE GRRFF +CS+VLD    D + D  
Sbjct  359   KRAGAN-REVDLNETPAVRTKKMQLRLQSLQKTVENGRRFFPHCSEVLDNFLEDLIPDVF  417

Query  365   ESLESGTPEEQTNKKRRYMELKEEVMKAFDKDMAQNR  255
               LE G+ EEQ  KK R+MELK++V KAF  DMA+N+
Sbjct  418   -FLEKGSEEEQRIKKARFMELKDDVQKAFHMDMAENK  453



>gb|AGI38077.1| nonexpressor of pathogenesis-related protein 1 [Arachis rigonii]
 gb|AGI38086.1| nonexpressor of pathogenesis-related protein 1 [Arachis rigonii]
Length=481

 Score =   412 bits (1059),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 243/457 (53%), Positives = 318/457 (70%), Gaps = 17/457 (4%)
 Frame = -2

Query  1586  MTELVPCGWVGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYA  1407
             M+ELVP G VG+E+F+VFL+Y+YTG  KASPPEV+TCVDE+C H ACRPAIDYA++LM A
Sbjct  1     MSELVPYGKVGHESFLVFLHYLYTGTLKASPPEVTTCVDETCVHDACRPAIDYALELMCA  60

Query  1406  SATFQIKELVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNF  1227
             SATFQ+KELV+L QR L   V+ A +EDVIP+L+  F C L+ L  +C +RV  S+LD  
Sbjct  61    SATFQMKELVLLFQRRLLNFVEKAVVEDVIPVLMAAFHCQLSQLRLQCAQRVARSDLDTT  120

Query  1226  TLENELPGAISSDIKARR-----------LNQQGANEKKIRKILRALDCNDVELVKLLLE  1080
             +LE E P  +  +IK+ R           +  +  NEK IR+I +A+D +DVEL+KLLL 
Sbjct  121   SLEKEFPQEVVDEIKSLRAQSMLESTPAEMEVETLNEKSIRRIHKAMDSDDVELLKLLLN  180

Query  1079  ESDITLDDayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVA  900
             ES +TL+DAYA+HYA AY +SKV+ EVL LG  D+NLRN RGYTVLHVAARRKDP+I+VA
Sbjct  181   ESKVTLNDAYALHYACAYSDSKVIQEVLNLGLADINLRNPRGYTVLHVAARRKDPSILVA  240

Query  899   ILDKSGASIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVM-MN  723
             +L K GA+  D T  +G TA+ IC+R TR KDY++ T +G+E N DRLC+DVLE  M  N
Sbjct  241   LL-KKGANASDTT-PDGQTALVICQRLTRRKDYHEETVQGKESNKDRLCVDVLEREMRRN  298

Query  722   GNPVSLP-SSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGM  546
                V++  SS T  +DL M+L +LENRVA AR L+P EAR+ +E A ADS       S +
Sbjct  299   FMCVTMSDSSETTADDLHMKLDYLENRVAFARLLFPAEARVAIENAEADSVSLDTTTSAL  358

Query  545   EGLCGNLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSL  366
             +    N + V L   P  + K++  R ++L+KTVE GRRFF +CS+VLD    D + D  
Sbjct  359   KRAGAN-REVDLNETPAVRTKKMQLRLQSLQKTVENGRRFFPHCSEVLDNFLEDLIPDVF  417

Query  365   ESLESGTPEEQTNKKRRYMELKEEVMKAFDKDMAQNR  255
               LE G+ EEQ  KK R+MELK++V KAF  DMA+N+
Sbjct  418   -FLEKGSEEEQRIKKARFMELKDDVQKAFHMDMAENK  453



>gb|AGI38065.1| nonexpressor of pathogenesis-related protein 1 [Arachis hypogaea]
 gb|AGI38087.1| nonexpressor of pathogenesis-related protein 1 [Arachis hypogaea]
Length=481

 Score =   411 bits (1057),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 241/457 (53%), Positives = 316/457 (69%), Gaps = 17/457 (4%)
 Frame = -2

Query  1586  MTELVPCGWVGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYA  1407
             M+ELVP G VG+E+F+VFL+Y+YTG  KASPPEV+TCVDE+C H ACRPAIDYA++LMYA
Sbjct  1     MSELVPYGKVGHESFLVFLHYLYTGTLKASPPEVTTCVDETCVHDACRPAIDYALELMYA  60

Query  1406  SATFQIKELVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNF  1227
             SATFQ+KELV+L QR L   V+ A +EDVIP+L+  F C L+ L  +C +RV  S+LD  
Sbjct  61    SATFQMKELVLLFQRRLLNFVEKAVVEDVIPVLMAAFHCQLSQLRLQCTQRVARSDLDTT  120

Query  1226  TLENELPGAISSDIKARR-----------LNQQGANEKKIRKILRALDCNDVELVKLLLE  1080
             +LE E P  +  +IK+ R           +  +  NEK IR+I +A+D +DVEL+KLLL 
Sbjct  121   SLEKEFPQEVVDEIKSLRAQSVLESTPAEMEVETLNEKSIRRIHKAMDSDDVELLKLLLN  180

Query  1079  ESDITLDDayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVA  900
             ES +TLDDAYA+HYA AY +SKV+ EVL LG  D+NLRN RGY+VLHVAARRKDP+I+VA
Sbjct  181   ESKVTLDDAYALHYACAYSDSKVIQEVLNLGLADINLRNPRGYSVLHVAARRKDPSILVA  240

Query  899   ILDKSGASIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVM-MN  723
             +L K GA+  D T  +G TA+ IC+R TR KDY++ T +G+E N DRLC+DVLE  M  N
Sbjct  241   LL-KKGANASDTT-PDGQTALVICQRLTRRKDYHEETVQGKESNKDRLCVDVLEREMRRN  298

Query  722   GNPVSLP-SSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGM  546
                V++  SS T  +DL M+L + ENRVA AR L+P EAR+ +E A  DS       S +
Sbjct  299   FKCVTMSDSSETTADDLHMKLDYFENRVAFARLLFPAEARVAIENAEVDSASLDTTSSTL  358

Query  545   EGLCGNLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSL  366
             +    N + V L   P  + K++  R ++ +KTVE GRRFF +CS+VLD    D + D  
Sbjct  359   KRAGAN-REVDLNETPAVRTKKMQLRLQSPQKTVENGRRFFPHCSEVLDNFLEDLIPDVF  417

Query  365   ESLESGTPEEQTNKKRRYMELKEEVMKAFDKDMAQNR  255
               LE G+ EEQ  KK R+MELK++V KAF  DMA+N+
Sbjct  418   -FLEKGSEEEQRIKKARFMELKDDVQKAFHMDMAENK  453



>gb|ACJ45014.1| NPR1-2 protein [Glycine max]
Length=502

 Score =   411 bits (1057),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 248/444 (56%), Positives = 311/444 (70%), Gaps = 21/444 (5%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg--kpKFLMTELVPCGWVGY  1551
             DY+DADI VEGI V V+R ILA+RS+FFHE FK+ K   +   K K+ M++L+P G VGY
Sbjct  62    DYSDADIVVEGISVSVHRCILASRSKFFHELFKREKGSSEKEGKLKYNMSDLLPYGKVGY  121

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF++FL YVYTGK K SP EVSTCVD  C H ACRPAI++AV+LMYAS  FQI E V L
Sbjct  122   EAFLIFLGYVYTGKLKPSPMEVSTCVDSVCAHDACRPAINFAVELMYASYIFQIPEFVSL  181

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
              QR L   +  A +EDVIPIL V F C L+ LV +C+ RV  S+LD  +++ ELP  +S 
Sbjct  182   FQRRLLNFIGKALVEDVIPILTVAFHCQLSQLVNQCIDRVARSDLDQISIDQELPNELSQ  241

Query  1190  DIKARRLNQQGANE-----------KKIRKILRALDCNDVELVKLLLEESDITLDDayav  1044
              +K  R N Q   E           K+I +I +ALD +DVELVKLLL ESDITLD+A A+
Sbjct  242   KVKLLRRNPQRDVENDASIVDALSLKRITRIHKALDSDDVELVKLLLNESDITLDEANAL  301

Query  1043  hyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDA  864
             HYAAAYC+ KVV+EVLGLG  ++NLRN+RGYTVLH+AA RK+P+IIV++L K GA   D 
Sbjct  302   HYAAAYCDPKVVSEVLGLGLANVNLRNSRGYTVLHIAAMRKEPSIIVSLLTK-GACASDL  360

Query  863   TCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPV---SLPSST  693
             T  +G +AV+ICRR TRPKDY+  TE+G+E N DR+CIDVLE  M   NP+   +  SS 
Sbjct  361   TF-DGQSAVSICRRLTRPKDYHAKTEQGKETNKDRICIDVLEREMWR-NPLAGDACMSSH  418

Query  692   TLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSG--MEGLCGNLKG  519
             T+ +DL M+L +LENRVA AR  +P EA++ M+IAHA++T EF GLS    +G  GNL+ 
Sbjct  419   TMADDLHMKLLYLENRVAFARLFFPSEAKLAMDIAHAETTSEFAGLSASNSKGSNGNLRE  478

Query  518   VGLTGLPPDQVKRLMERREALKKT  447
             V L   P  Q KRL  R EAL KT
Sbjct  479   VDLNETPIVQSKRLFSRMEALMKT  502



>gb|AGI38066.1| nonexpressor of pathogenesis-related protein 1 [Arachis hypogaea]
 gb|AGI38088.1| nonexpressor of pathogenesis-related protein 1 [Arachis hypogaea]
Length=481

 Score =   410 bits (1055),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 241/457 (53%), Positives = 316/457 (69%), Gaps = 17/457 (4%)
 Frame = -2

Query  1586  MTELVPCGWVGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYA  1407
             M+ELVP G VG+E+F+VFL+Y+YTG  KASPPEV+TCVDE+C H ACRPAIDYA++LMYA
Sbjct  1     MSELVPYGKVGHESFLVFLHYLYTGTLKASPPEVTTCVDETCVHDACRPAIDYALELMYA  60

Query  1406  SATFQIKELVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNF  1227
             SATFQ+KELV+L QR L   V+ A +EDVIP+L+  F C L+ L  +C +RV  S+LD  
Sbjct  61    SATFQMKELVLLFQRRLLNFVEKAVVEDVIPVLMAAFHCQLSQLRLQCTQRVARSDLDTT  120

Query  1226  TLENELPGAISSDIKARR-----------LNQQGANEKKIRKILRALDCNDVELVKLLLE  1080
             +LE E P  +  +IK+ R           +  +  NEK IR+I +A+D +DVEL+KLLL 
Sbjct  121   SLEKEFPQEVVDEIKSLRAQSVLESTPAEMEVETLNEKSIRRIHKAMDSDDVELLKLLLN  180

Query  1079  ESDITLDDayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVA  900
             ES +TL+DAYA+HYA AY +SKV+ EVL LG  D+NLRN RGY+VLHVAARRKDP+I+VA
Sbjct  181   ESKVTLNDAYALHYACAYSDSKVIQEVLNLGLADINLRNPRGYSVLHVAARRKDPSILVA  240

Query  899   ILDKSGASIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVM-MN  723
             +L K GA+  D T  +G TA+ IC+R TR KDY++ T +G+E N DRLC+DVLE  M  N
Sbjct  241   LL-KKGANASDTT-PDGQTALVICQRLTRRKDYHEETVQGKESNKDRLCVDVLEREMRRN  298

Query  722   GNPVSLP-SSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGM  546
                V++  SS T  +DL M+L + ENRVA AR L+P EAR+ +E A  DS       S +
Sbjct  299   FKCVTMSDSSETTADDLHMKLDYFENRVAFARLLFPAEARVAIENAEVDSASLDTTSSTL  358

Query  545   EGLCGNLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSL  366
             +    N + V L   P  + K++  R ++L+KTVE GRRFF  CS+VLD    D + D  
Sbjct  359   KRAGAN-REVDLNETPAVRTKKMQLRLQSLQKTVENGRRFFPLCSEVLDNFLEDLIPDVF  417

Query  365   ESLESGTPEEQTNKKRRYMELKEEVMKAFDKDMAQNR  255
               LE G+ EEQ  KK R+MELK++V KAF  DMA+N+
Sbjct  418   -FLEKGSEEEQRIKKARFMELKDDVQKAFHMDMAENK  453



>ref|XP_010536418.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010536426.1| PREDICTED: regulatory protein NPR3-like isoform X1 [Tarenaya 
hassleriana]
Length=587

 Score =   413 bits (1061),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 252/502 (50%), Positives = 333/502 (66%), Gaps = 20/502 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdgkpKFLMTELVPCGWVGYEA  1545
             DY+DA+I ++G+ VGV+R ILAARS+FF E FKK      GK K+ M +L+P G VG+EA
Sbjct  61    DYSDAEIFIDGVSVGVHRCILAARSKFFVELFKKENNGATGKSKYHMKDLLPYGKVGHEA  120

Query  1544  FMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVMLIQ  1365
             F+ FLNY+YTG+ K  P EVSTCVD  C H +C+PAID+AV+LMYAS+ FQ+ ELV   Q
Sbjct  121   FLHFLNYIYTGRLKPFPMEVSTCVDTVCAHDSCKPAIDFAVELMYASSVFQLPELVSSFQ  180

Query  1364  RHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISSDI  1185
             R L   V+ + +E+V+PILLV F C L  L+++CV RV  S+LD F +E ELP  +S  I
Sbjct  181   RRLCNFVEKSLVENVLPILLVAFHCKLTQLLDQCVERVARSDLDRFCIEKELPLEVSEKI  240

Query  1184  K---ARRLNQQGAN-------EKKIRKILRALDCNDVELVKLLLEESDITLDDayavhya  1035
             K    R    + +        +K I  I +ALD +DVELVKLLL ES++TLD A A+HYA
Sbjct  241   KQLQGRSPQDEDSTSDVSEKWQKSIGTIHKALDSDDVELVKLLLTESNVTLDQANALHYA  300

Query  1034  aaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDATCS  855
              AYC+SKVV  +L L   D+N RN RGYTVLH AA RK+P+II+++L K GA   D T  
Sbjct  301   VAYCDSKVVAGILSLDMADVNFRNYRGYTVLHFAAMRKEPSIIISLL-KKGAFASDLTF-  358

Query  854   NGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVS--LPS-STTLE  684
             +G +AV ICRR TRPKDY+   E+G+E N  R+CID+LE  +   NP++   P+ S ++ 
Sbjct  359   DGRSAVNICRRLTRPKDYHTKMEKGQESNKGRICIDILEREIRR-NPLAGDTPTCSHSMP  417

Query  683   NDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGL-SGMEGLCGNLKGVGLT  507
              DL M L +LE RV LA   +P EA++ M+IA+ + TLEF GL    +G  GNL  V L 
Sbjct  418   EDLQMRLLYLEKRVGLALSFFPTEAKVAMDIANVEETLEFTGLPPPSKGSTGNLTQVDLN  477

Query  506   GLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLT---ADDVLDSLESLESGTPEE  336
               P  Q KRL  R EAL KTVE G R+F +CS+VLDK      D+ +  +  LE G+ +E
Sbjct  478   ETPHMQTKRLRARMEALMKTVETGWRYFPHCSEVLDKYMDECMDEDMSDVLHLERGSLQE  537

Query  335   QTNKKRRYMELKEEVMKAFDKD  270
             +  K+ RY ELKE+V KA++KD
Sbjct  538   RRLKRMRYKELKEDVQKAYNKD  559



>ref|XP_004983490.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X1 
[Setaria italica]
Length=408

 Score =   406 bits (1043),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 229/386 (59%), Positives = 283/386 (73%), Gaps = 16/386 (4%)
 Frame = +1

Query  2419  GGQTPSRFELLSMVKKHSKFLGKTIVE-EEDPSDVEMDPQFWHEVLDLYFVCGKESRGRQ  2595
                +PSR ELLSMVKKHS  +G TIV+ E+D SDV MD +FWHE+LDL+FV G +S+  +
Sbjct  27    ASSSPSRTELLSMVKKHSHLIGWTIVDAEDDASDVGMDDKFWHEMLDLFFVRGGKSKRSE  86

Query  2596  EDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLIA  2775
             EDDL+FFV  M L GY  N N ED  P+FVRRW+P L+ ++  N++ VDW RS+YLNLIA
Sbjct  87    EDDLVFFVNNMKLHGYGFNDNMEDPPPFFVRRWAPTLEKVINVNTLEVDWERSFYLNLIA  146

Query  2776  HTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPAY  2955
             HT+++VTVAI S   L+N +  K K LSP+YKV KTVYASPSR+NFHLD RK VET PAY
Sbjct  147   HTSYTVTVAIFSIGDLRN-RAAKSKQLSPVYKVTKTVYASPSRVNFHLDRRKAVETVPAY  205

Query  2956  PDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDSS--------QSETSGGKT  3111
             P+I F+VDDFD TFDAVVL+D +HCYCVILNA+DGAAFP ++         Q E S G  
Sbjct  206   PNIYFSVDDFDDTFDAVVLSDPEHCYCVILNAHDGAAFPEETESKNPGSNVQPELSSGSA  265

Query  3112  QSS--KITIFSGFVSYQMVRDAYDAGRTg-fgsllslhssgKTDRIYMKGPGGRGEVEVA  3282
             Q    K T+FSG+VSYQ VR+AYDAGR+     L   H   K DR+YM+GP GRGEVEVA
Sbjct  266   QEKPPKRTLFSGYVSYQNVREAYDAGRSKFGSLLSLGHDHTKLDRLYMRGPEGRGEVEVA  325

Query  3283  VSGVVDQSKEEYGHHPPKKGLsfsavvrraasvasvaakhayaaasatrssDEEMIPLKC  3462
             VSG+ DQS+E+    P   G SF  +V RAAS AS  AKHAY +ASA +  D+E++PLKC
Sbjct  326   VSGIADQSREKSKKDP---GDSFRVLVHRAASAASKLAKHAYESASANKRMDDELVPLKC  382

Query  3463  CLMSISLPWEHIAHDLLLKGSPPVNL  3540
             CLMS+SLPW++IAHDLL K +PP++ 
Sbjct  383   CLMSVSLPWDYIAHDLLHKDTPPLDF  408



>ref|NP_001059288.1| Os07g0248800 [Oryza sativa Japonica Group]
 dbj|BAC80050.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD30658.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF21202.1| Os07g0248800 [Oryza sativa Japonica Group]
Length=411

 Score =   406 bits (1043),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 228/381 (60%), Positives = 281/381 (74%), Gaps = 14/381 (4%)
 Frame = +1

Query  2428  TPSRFELLSMVKKHSKFLGKTIVE-EEDPSDVEMDPQFWHEVLDLYFVCGKESRGRQEDD  2604
              PSR ELL+MVKKHS  +G T+V+ E+D SDV MD +FWHE+LDL+FV G+ S+ R+EDD
Sbjct  35    APSRNELLTMVKKHSHLIGWTVVDAEDDASDVGMDDRFWHEMLDLFFVRGRVSKRREEDD  94

Query  2605  LIFFVRK-MSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLIAHT  2781
             L+FFV   M + G+  N N ED  P+FVRRW+P L+ +   NS GVDW RS+YLNLIAHT
Sbjct  95    LVFFVNNNMKMHGHGFNDNMEDPPPFFVRRWAPMLEKISNINSAGVDWERSFYLNLIAHT  154

Query  2782  TFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPAYPD  2961
             +++VTVAICS   L++ +  K KPLSP+YKV KTVYASPSR+NFHLD RK VET PAYP+
Sbjct  155   SYTVTVAICSVRDLRS-RVEKSKPLSPVYKVTKTVYASPSRVNFHLDRRKAVETVPAYPN  213

Query  2962  ICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSD-------SSQSETSGGKTQSS  3120
             ICF+VDDFD TFDAVVL+D +HCYCVILNA+DGAAFP D       S+   T   + +  
Sbjct  214   ICFSVDDFDDTFDAVVLSDPEHCYCVILNAHDGAAFPEDTESKNASSNLLNTGSNQEKPP  273

Query  3121  KITIFSGFVSYQMVRDAYDAGRTgf-gsllslhssgKTDRIYMKGPGGRGEVEVAVSGVV  3297
             K T+FSG+VSYQ VR+AY+AGR+ F   L   H   K D++YM+GP GRGEVEVAVSG+ 
Sbjct  274   KRTLFSGYVSYQNVREAYNAGRSQFGSLLSLGHDQTKLDKLYMRGPEGRGEVEVAVSGIA  333

Query  3298  DQSKEEYGHHPPKKGLsfsavvrraasvasvaakhayaaasatrssDEEMIPLKCCLMSI  3477
             DQS E     P   G SF   V RAAS AS  AKHAY AAS  +  D E++PLKCCLMS+
Sbjct  334   DQSHERSKKDP---GDSFRVFVHRAASAASKLAKHAYEAASTNKRFDHELLPLKCCLMSV  390

Query  3478  SLPWEHIAHDLLLKGSPPVNL  3540
             SLPW++IAHDLL K +PP++L
Sbjct  391   SLPWDYIAHDLLHKETPPLDL  411



>gb|EEC81801.1| hypothetical protein OsI_25521 [Oryza sativa Indica Group]
Length=412

 Score =   406 bits (1043),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 228/381 (60%), Positives = 281/381 (74%), Gaps = 14/381 (4%)
 Frame = +1

Query  2428  TPSRFELLSMVKKHSKFLGKTIVE-EEDPSDVEMDPQFWHEVLDLYFVCGKESRGRQEDD  2604
              PSR ELL+MVKKHS  +G T+V+ E+D SDV MD +FWHE+LDL+FV G+ S+ R+EDD
Sbjct  36    APSRNELLTMVKKHSHLIGWTVVDAEDDASDVGMDDRFWHEMLDLFFVRGRVSKRREEDD  95

Query  2605  LIFFVRK-MSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLIAHT  2781
             L+FFV   M + G+  N N ED  P+FVRRW+P L+ +   NS GVDW RS+YLNLIAHT
Sbjct  96    LVFFVNNNMKMHGHGFNDNMEDPPPFFVRRWAPMLEKISNINSAGVDWERSFYLNLIAHT  155

Query  2782  TFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPAYPD  2961
             +++VTVAICS   L++ +  K KPLSP+YKV KTVYASPSR+NFHLD RK VET PAYP+
Sbjct  156   SYTVTVAICSVRDLRS-RVEKSKPLSPVYKVTKTVYASPSRVNFHLDRRKAVETVPAYPN  214

Query  2962  ICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSD-------SSQSETSGGKTQSS  3120
             ICF+VDDFD TFDAVVL+D +HCYCVILNA+DGAAFP D       S+   T   + +  
Sbjct  215   ICFSVDDFDDTFDAVVLSDPEHCYCVILNAHDGAAFPEDTESKNASSNLLNTGSNQEKPP  274

Query  3121  KITIFSGFVSYQMVRDAYDAGRTgf-gsllslhssgKTDRIYMKGPGGRGEVEVAVSGVV  3297
             K T+FSG+VSYQ VR+AY+AGR+ F   L   H   K D++YM+GP GRGEVEVAVSG+ 
Sbjct  275   KRTLFSGYVSYQNVREAYNAGRSQFGSLLSLGHDQTKLDKLYMRGPEGRGEVEVAVSGIA  334

Query  3298  DQSKEEYGHHPPKKGLsfsavvrraasvasvaakhayaaasatrssDEEMIPLKCCLMSI  3477
             DQS E     P   G SF   V RAAS AS  AKHAY AAS  +  D E++PLKCCLMS+
Sbjct  335   DQSHERSKKDP---GDSFRVFVHRAASAASKLAKHAYEAASTNKRFDHELLPLKCCLMSV  391

Query  3478  SLPWEHIAHDLLLKGSPPVNL  3540
             SLPW++IAHDLL K +PP++L
Sbjct  392   SLPWDYIAHDLLHKETPPLDL  412



>ref|XP_006652114.1| PREDICTED: uncharacterized protein KIAA0930 homolog [Oryza brachyantha]
Length=406

 Score =   405 bits (1042),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 230/385 (60%), Positives = 284/385 (74%), Gaps = 16/385 (4%)
 Frame = +1

Query  2422  GQTPSRFELLSMVKKHSKFLGKTIVE-EEDPSDVEMDPQFWHEVLDLYFVCGKESRGRQE  2598
                PSR ELLSMVKKHS  +G T+V+ E+D SDV MD +FW E+LDL+FV G+ S  R+E
Sbjct  26    AAAPSRDELLSMVKKHSHLIGWTVVDAEDDSSDVGMDDKFWLEMLDLFFVRGRVSNRREE  85

Query  2599  DDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLIAH  2778
             DDL+FFV  M L G   NGN ED  P+FVRRW+P L+ ++  NS  VDW RS+YLN++AH
Sbjct  86    DDLVFFVNNMKLYGNGFNGNMEDPPPFFVRRWAPMLERIININSAEVDWERSFYLNIVAH  145

Query  2779  TTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPAYP  2958
             T+++VTVAICS   L+N +  K KPLSPIYKV KTV+ASPSR+NFHLD RK VETTPAYP
Sbjct  146   TSYTVTVAICSIRDLRN-RVEKSKPLSPIYKVTKTVFASPSRVNFHLDRRKAVETTPAYP  204

Query  2959  DICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDSSQSET-----SGGKTQSS-  3120
             +ICF+VDDFD TFDAVVL+D +HCYCV+LNA+DGAAFP ++    T     SG  + S+ 
Sbjct  205   NICFSVDDFDDTFDAVVLSDPEHCYCVVLNAHDGAAFPEETELKNTISNVPSGVNSGSNE  264

Query  3121  ----KITIFSGFVSYQMVRDAYDAGRTgf-gsllslhssgKTDRIYMKGPGGRGEVEVAV  3285
                 K T+FSG+VSYQ VR+AYDAGR+ F   L   H   K D++YM+GP GRGEVEVAV
Sbjct  265   EKPPKRTLFSGYVSYQNVREAYDAGRSKFGSFLSLGHDHTKLDKLYMRGPEGRGEVEVAV  324

Query  3286  SGVVDQSKEEYGHHPPKKGLsfsavvrraasvasvaakhayaaasatrssDEEMIPLKCC  3465
             SG+ DQS E     P   G SF  +V RAAS AS  AKHAY AAS  +  D+E++PLKCC
Sbjct  325   SGIADQSHERLKKDP---GDSFRILVHRAASAASKLAKHAYEAASTNKQFDDELLPLKCC  381

Query  3466  LMSISLPWEHIAHDLLLKGSPPVNL  3540
             LMS+SLPW++IAHDLL K +PP++L
Sbjct  382   LMSVSLPWDYIAHDLLHKETPPLDL  406



>gb|AGI38059.1| nonexpressor of pathogenesis-related protein 1 [Arachis hypogaea]
Length=481

 Score =   408 bits (1049),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 240/457 (53%), Positives = 315/457 (69%), Gaps = 17/457 (4%)
 Frame = -2

Query  1586  MTELVPCGWVGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYA  1407
             M+ELVP G VG+E+ +VFL+Y+YTG  KASPPEV+TCVDE+C H ACRPAIDYA++LMYA
Sbjct  1     MSELVPYGKVGHESLLVFLHYLYTGTLKASPPEVTTCVDETCVHDACRPAIDYALELMYA  60

Query  1406  SATFQIKELVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNF  1227
             SATFQ+KELV L QR L   V+ A +EDVIP+L+  F C L+ L  +C +RV  S+LD  
Sbjct  61    SATFQMKELVSLFQRRLLNFVEKAVVEDVIPVLMAAFHCQLSQLRLQCTQRVARSDLDTT  120

Query  1226  TLENELPGAISSDIKARR-----------LNQQGANEKKIRKILRALDCNDVELVKLLLE  1080
             +LE E P  +  +IK+ R           +  +  NEK IR+I +A+D +DVEL+KLLL 
Sbjct  121   SLEKEFPQEVVDEIKSLRAQSVLESTPAEMEVETLNEKSIRRIHKAMDSDDVELLKLLLN  180

Query  1079  ESDITLDDayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVA  900
             ES +TL+DAYA+HYA AY +SKV+ EVL LG  D+NLRN RGY+VLHVAARRKDP+I+VA
Sbjct  181   ESKVTLNDAYALHYACAYSDSKVIQEVLNLGLADINLRNPRGYSVLHVAARRKDPSILVA  240

Query  899   ILDKSGASIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVM-MN  723
             +L K GA+  D T  +G TA+ IC+R TR KDY++ T +G+E N DRLC+DVLE  M  N
Sbjct  241   LL-KKGANASDTT-PDGQTALVICQRLTRRKDYHEETVQGKESNKDRLCVDVLEREMRRN  298

Query  722   GNPVSLP-SSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGM  546
                V++  SS T  +DL M+L + ENRVA AR L+P EAR+ +E A  DS       S +
Sbjct  299   FKCVTMSDSSETTADDLHMKLDYFENRVAFARLLFPAEARVVIENAEVDSASLDTTSSTL  358

Query  545   EGLCGNLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSL  366
             +    N + V L   P  + K++  R ++L+KTVE GRRFF +CS+VLD    D + D  
Sbjct  359   KRAGAN-REVDLNETPAVRTKKMQLRLQSLQKTVENGRRFFPHCSEVLDNFLEDLIPDVF  417

Query  365   ESLESGTPEEQTNKKRRYMELKEEVMKAFDKDMAQNR  255
               LE G+ EEQ  KK R+MELK++V KAF  DMA+N+
Sbjct  418   -FLEKGSEEEQRIKKARFMELKDDVQKAFHMDMAENK  453



>gb|KFK41854.1| hypothetical protein AALP_AA2G179400 [Arabis alpina]
Length=587

 Score =   411 bits (1057),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 246/506 (49%), Positives = 329/506 (65%), Gaps = 27/506 (5%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdgkp-KFLMTELVPCGWVGYE  1548
             DY+DA+I V G+ V V+R ILAARS+FF E FKK KK+   +  K+ + +++P G V YE
Sbjct  58    DYSDAEIIVGGVSVSVHRCILAARSKFFQELFKKEKKNSKTEKPKYHLKDMLPYGVVAYE  117

Query  1547  AFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVMLI  1368
             AF  FL+Y+YTG+ K  P +VSTCVD  C H +CRPAID+ V+LMYAS+  Q+ EL    
Sbjct  118   AFCYFLSYIYTGRLKPFPSDVSTCVDSVCAHDSCRPAIDFVVELMYASSVLQVPELASSF  177

Query  1367  QRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISSD  1188
             QR L   V+ + +E+VIPILLV F C L  L+++C+ RV  S+LD F +E E+P  ++  
Sbjct  178   QRRLCNFVEKSLVENVIPILLVAFNCKLTELLDQCIERVARSDLDKFCIEKEVPFEVAEK  237

Query  1187  IKARRLNQQGANE----------KKIRKILRALDCNDVELVKLLLEESDITLDDayavhy  1038
             IK  RL      E          ++I KILRALD +DVELVKLLL ESDITLD+A  +HY
Sbjct  238   IKQLRLKSPQDEENNPKVSDKFLERIGKILRALDSDDVELVKLLLTESDITLDEANGLHY  297

Query  1037  aaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDATC  858
             + AY + KVV E+L L   D+N RN+RGYTVLH AA RK+P+IIV+++ K GA++ D TC
Sbjct  298   SVAYSDPKVVTEILALDMGDVNFRNSRGYTVLHFAAMRKEPSIIVSLIGK-GANVSDFTC  356

Query  857   SNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLE-----GVMMNGNPVSLPSST  693
              +G +AV ICRR T PKDY   T +G E +  R+CID+LE       M+   P+  P   
Sbjct  357   -DGRSAVNICRRLTTPKDYQTRTGKGPESSKSRICIDLLEREIRRNPMVADTPMCSP---  412

Query  692   TLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGL-SGMEGLCGNLKGV  516
              +  DL M L +LE RV LA+  +P EA++ M+IA+ + T EF GL     GL GNL  V
Sbjct  413   YMPEDLQMRLLYLEKRVGLAQLFFPTEAKVAMDIANVEGTSEFTGLPPPSNGLTGNLSEV  472

Query  515   GLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTAD----DVLDSLESLESG  348
              L   P  Q KRL+ R EAL +TV+ GRR+F  CS+VLDK   +    D+LD + S E G
Sbjct  473   DLNETPHMQTKRLLTRMEALMETVKTGRRYFPCCSEVLDKYMDEYIDADILDDVHS-EKG  531

Query  347   TPEEQTNKKRRYMELKEEVMKAFDKD  270
             +P+E+  K+ RY ELK++V KA+ KD
Sbjct  532   SPQERKLKRMRYRELKDDVQKAYSKD  557



>gb|AAK62787.1|AC027036_8 unknown protein [Arabidopsis thaliana]
Length=749

 Score =   417 bits (1071),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 245/397 (62%), Positives = 288/397 (73%), Gaps = 33/397 (8%)
 Frame = +1

Query  2380  N*RTTYTMLLGNGGGQTPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDL  2559
             N R    ML  N G  TPSR E+LSMVKKHSK LGKT ++E+D SDVEMD  FWH V D+
Sbjct  375   NHRRVEKML--NDGEVTPSRHEILSMVKKHSKSLGKTSLDEQDASDVEMDSNFWHGVFDV  432

Query  2560  YFVCGKESRGRQEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGV  2739
             YFV   ESR RQ+DDL+FFVRK+S + Y    N +  +PYFVRRW+PKLD+LLGE+   V
Sbjct  433   YFVRCMESRRRQDDDLLFFVRKLSCKSYGLTENEDAPAPYFVRRWAPKLDELLGESLAEV  492

Query  2740  DWRRSYYLNLIAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHL  2919
             DWR+S+YLN+IAHT+F+VTVAICS+E LK YQ  KD  LSPIY                 
Sbjct  493   DWRKSFYLNMIAHTSFTVTVAICSNEALKTYQGSKDTKLSPIY-----------------  535

Query  2920  DSRKEVETTPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPS----DSSQ  3087
                KEVETTPAYP+ICFAVDDFDSTFDAVVLTD DHCYCV+LN++DGAAFPS    DSS 
Sbjct  536   ---KEVETTPAYPEICFAVDDFDSTFDAVVLTDKDHCYCVLLNSHDGAAFPSATVKDSSD  592

Query  3088  SETSGG--KTQSSKITIFSGFVSYQMVRDAYDAGRTgf-gsllslhssgKTDRIYMKGPG  3258
             S T+      +  K+T+FSGFVSYQMVR+AY+ GR  F   L   H +GK DR+YM+GPG
Sbjct  593   SNTNADPRTVKDPKVTLFSGFVSYQMVREAYEGGRNRFGSLLSLGHITGKADRLYMRGPG  652

Query  3259  GRGEVEVAVSGVVDQSKEEYGHHPP---KKGLsfsavvrraasvasvaakhayaaasatr  3429
             GRGEVEVAVSGVVDQS+   G   P   KK +   ++ R+AASVASVAAKHA AAA+A+ 
Sbjct  653   GRGEVEVAVSGVVDQSQVVLGPVSPMSSKKSIDLGSIFRKAASVASVAAKHAIAAATASY  712

Query  3430  ssDEEMIPLKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
               D EM PLKCCLMSISLPW+ IAHDLL K +PPVN+
Sbjct  713   DED-EMFPLKCCLMSISLPWDTIAHDLLFKATPPVNM  748



>gb|AGI38068.1| nonexpressor of pathogenesis-related protein 1 [Arachis hypogaea]
 gb|AGI38090.1| nonexpressor of pathogenesis-related protein 1 [Arachis hypogaea]
Length=481

 Score =   407 bits (1046),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 239/457 (52%), Positives = 315/457 (69%), Gaps = 17/457 (4%)
 Frame = -2

Query  1586  MTELVPCGWVGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYA  1407
             M+ELVP G VG+E+F+VFL+Y+YT   KASPPEV+TCVDE+C H ACRPAIDYA++LMYA
Sbjct  1     MSELVPYGKVGHESFLVFLHYLYTRTLKASPPEVTTCVDETCVHDACRPAIDYALELMYA  60

Query  1406  SATFQIKELVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNF  1227
             SATFQ+KELV+L QR L   V+ A +EDVIP+L+  F C L+ L  +C +RV  S+LD  
Sbjct  61    SATFQMKELVLLFQRRLLNFVERAVVEDVIPVLMAAFHCQLSQLRLQCTQRVARSDLDTT  120

Query  1226  TLENELPGAISSDIKARR-----------LNQQGANEKKIRKILRALDCNDVELVKLLLE  1080
             +LE E P  +  +IK+ R           +  +  NEK IR+I +A+D +DVEL+KLLL 
Sbjct  121   SLEKEFPQEVVDEIKSLRAQSVLESTPAEMEVETLNEKSIRRIHKAMDSDDVELLKLLLN  180

Query  1079  ESDITLDDayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVA  900
             ES +TL+DAYA+HYA AY +SKV+ EVL LG  D+NLRN RGY+VLHVAARRKDP+I+VA
Sbjct  181   ESKVTLNDAYALHYARAYSDSKVIQEVLNLGLADINLRNPRGYSVLHVAARRKDPSILVA  240

Query  899   ILDKSGASIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVM-MN  723
             +L K GA+  D T  +G TA+ IC+R TR KDY++ T +G+E N DRLC+DVLE  M  N
Sbjct  241   LL-KKGANASDTT-PDGQTALVICQRLTRRKDYHEETVQGKESNKDRLCVDVLEREMRRN  298

Query  722   GNPVSLP-SSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGM  546
                V++  SS T  +DL M+L + ENRVA AR L+P EAR+ +E A  DS       S +
Sbjct  299   FKCVTMSDSSETTADDLHMKLDYFENRVAFARLLFPAEARVAIENAEVDSASLDTTSSTL  358

Query  545   EGLCGNLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSL  366
             +    N + V L   P  + K++  R ++L+KTVE GRRFF +CS+V D    D + D  
Sbjct  359   KRAGAN-REVDLNETPAVRTKKMQLRLQSLQKTVENGRRFFPHCSEVPDNFLEDLIPDVF  417

Query  365   ESLESGTPEEQTNKKRRYMELKEEVMKAFDKDMAQNR  255
               LE G+ EEQ  KK R+MELK++V KAF  DMA+N+
Sbjct  418   -FLEKGSEEEQRIKKARFMELKDDVQKAFHMDMAENK  453



>ref|XP_010538609.1| PREDICTED: regulatory protein NPR3-like [Tarenaya hassleriana]
Length=588

 Score =   411 bits (1056),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 253/503 (50%), Positives = 328/503 (65%), Gaps = 22/503 (4%)
 Frame = -2

Query  1721  YNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdg-kpKFLMTELVPCGWVGYEA  1545
             Y+DA+I + G+ VGV+R ILAARS+FF E FKK  K     KP + M EL+P G VG E 
Sbjct  62    YSDAEIIINGVSVGVHRCILAARSKFFLELFKKENKGAASGKPNYHMKELLPFGHVGQET  121

Query  1544  FMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVMLIQ  1365
             F+ FLNY+YTG+ K  P EVSTCVD  C H +CRPAID+AV+LMYAS+ FQ+ ELV   Q
Sbjct  122   FLHFLNYIYTGRLKPFPMEVSTCVDTVCAHDSCRPAIDFAVELMYASSVFQVPELVSSFQ  181

Query  1364  RHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISSDI  1185
             R L   V+ + +E+V+PILLV F C LA L+++CV RV  S+LD F +E ELP  +S  I
Sbjct  182   RRLCNFVEKSLVENVLPILLVAFNCKLALLLDQCVERVARSDLDRFCIEKELPFEVSEKI  241

Query  1184  KARRLNQQGANE-----------KKIRKILRALDCNDVELVKLLLEESDITLDDayavhy  1038
             K  +L      E           KKI  I +ALD +DVELVKLL  ESDI+LD A A+HY
Sbjct  242   KQLQLKSPHDEEDNTPEVSEKLLKKIGAIHKALDSDDVELVKLLSSESDISLDQANALHY  301

Query  1037  aaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDATC  858
             A AYC+ KVV  +L L   D+NLRN+RGYTVLH AA RK+P+II+++L K GA+  D T 
Sbjct  302   AVAYCDPKVVAGILSLDMADVNLRNSRGYTVLHFAAMRKEPSIIISLL-KKGANASDLTL  360

Query  857   SNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVS--LPS-STTL  687
              +G  AV ICRR TRPKDY+   E+G+E + DR+CID++E  +   NP++  +P+ S ++
Sbjct  361   -DGRNAVNICRRLTRPKDYHVKLEKGQESHKDRICIDIMEREIRR-NPMAGDIPTCSHSM  418

Query  686   ENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGL-SGMEGLCGNLKGVGL  510
               DL M L +LE RV LA+  +P EA++ M+IA+ + T +F GL    +G  GNL  V L
Sbjct  419   PEDLQMRLLYLEKRVGLAQSFFPAEAKVAMDIANVEGTFKFTGLPPSSKGSTGNLTQVDL  478

Query  509   TGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVL---DKLTADDVLDSLESLESGTPE  339
                P  Q KRL  R EAL KTVE GRR+F  CS+VL        DD    +  LE G+P 
Sbjct  479   NETPHMQTKRLRARMEALMKTVETGRRYFPYCSEVLDKYMDDYMDDDFTEMLHLEKGSPR  538

Query  338   EQTNKKRRYMELKEEVMKAFDKD  270
             E+  K+ RY ELKE+V KA+ KD
Sbjct  539   ERRLKRMRYKELKEDVQKAYKKD  561



>gb|AIM54370.1| nonexpressor of pathogenesis-related protein 1 [Gladiolus hybrid 
cultivar]
Length=588

 Score =   410 bits (1055),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 254/510 (50%), Positives = 336/510 (66%), Gaps = 28/510 (5%)
 Frame = -2

Query  1721  YNDADIEVEGIL-VGVNRGILAARSQFFHEEFkkakkdcdgkpK--------FLMTELVP  1569
             + DAD+ ++G   VGV+R ILAARS+ F + F +       +          + + EL+P
Sbjct  57    FIDADVALDGGADVGVHRCILAARSRVFRDLFSRPSNGGPQQSVGPAGGRPRYRVAELLP  116

Query  1568  CGW-VGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQ  1392
              G  +G EAFMVFL Y+YTGK + +P + +TCVD  C H AC PA+ +AV+LMYA++ F 
Sbjct  117   PGARLGREAFMVFLGYLYTGKLRQAPLDAATCVDPVCAHDACSPAVSFAVELMYAASVFD  176

Query  1391  IKELVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENE  1212
             I EL  L QR L   V+   +EDVIPILLV F   L  L+  CV+RV  SNLDN +LE E
Sbjct  177   IPELGSLFQRRLLNFVEKTLVEDVIPILLVAFHSQLNQLLRTCVQRVARSNLDNISLEKE  236

Query  1211  LPGAISSDIKARRLNQQ----------GANEKKIRKILRALDCNDVELVKLLLEESDITL  1062
             LP  + ++IK+ R + Q            +EK+IR+I  ALD +DVELVKLLL+ESD+TL
Sbjct  237   LPSEVVAEIKSVRRSFQVNDCDVPSVDTVHEKRIRRIHGALDSDDVELVKLLLKESDVTL  296

Query  1061  DDayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSG  882
             DDA A+HYAAAYC+SKVV EVL L   ++NL+N RGYT LHVAA R++PA+IV++LDK G
Sbjct  297   DDATALHYAAAYCDSKVVAEVLELDLANVNLKNERGYTPLHVAAMRREPAVIVSLLDK-G  355

Query  881   ASIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVSLP  702
             AS  +AT S+G  AV+ICRR TR KDY   T + +E N DR+CID+LE  M   NP++  
Sbjct  356   ASASEAT-SDGQDAVSICRRLTRAKDYYAKTMQCQESNKDRICIDILEREMRR-NPMAGE  413

Query  701   SSTT---LENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCG  531
              S T   L ++L  +L +LENRV  AR L+P EA++ MEIAHA+   EF   +      G
Sbjct  414   DSVTSVLLADNLQAKLLYLENRVGFARLLFPTEAKLAMEIAHAEPYSEFTSRNASRS-SG  472

Query  530   NLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLES  351
             NL+ V L   P  Q KRL  R +AL KTVELGRR+F +CS VLD+L +D+  D L  L++
Sbjct  473   NLREVDLNETPSVQSKRLRSRVDALTKTVELGRRYFPHCSQVLDRLMSDESSD-LFYLQN  531

Query  350   GTPEEQTNKKRRYMELKEEVMKAFDKDMAQ  261
             GTP+EQ  K+ R+ E+KE+V KAF KD A+
Sbjct  532   GTPDEQKIKRMRFCEVKEDVRKAFSKDKAE  561



>gb|AGI38069.1| nonexpressor of pathogenesis-related protein 1 [Arachis hypogaea]
 gb|AGI38091.1| nonexpressor of pathogenesis-related protein 1 [Arachis hypogaea]
Length=481

 Score =   407 bits (1045),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 239/457 (52%), Positives = 315/457 (69%), Gaps = 17/457 (4%)
 Frame = -2

Query  1586  MTELVPCGWVGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYA  1407
             M+ELVP G VG+E+F+VFL+Y+YTG  KASPPEV+TCVDE+C H ACRPAIDYA++LMYA
Sbjct  1     MSELVPYGKVGHESFLVFLHYLYTGTLKASPPEVTTCVDETCVHDACRPAIDYALELMYA  60

Query  1406  SATFQIKELVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNF  1227
             SATFQ+KELV+L QR L   V+ A +EDVIP+L+  F C L+ L  +C +RV  S+LD  
Sbjct  61    SATFQMKELVLLFQRRLLNFVEKAVVEDVIPVLMAAFHCQLSQLRLQCTQRVARSDLDTT  120

Query  1226  TLENELPGAISSDIKARR-----------LNQQGANEKKIRKILRALDCNDVELVKLLLE  1080
             +LE E P  +  +IK+ R           +  +  NEK IR+I +A+D +DVEL+KLLL 
Sbjct  121   SLEKEFPQEVVDEIKSLRAQSVLESTPEEMEVETLNEKSIRRIHKAMDSDDVELLKLLLN  180

Query  1079  ESDITLDDayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVA  900
             ES +TL+DAYA+HYA AY +SKV+ EVL LG  D+NLRN RGY+VLHVAARRKDP+I+VA
Sbjct  181   ESKVTLNDAYALHYACAYSDSKVIQEVLNLGLADINLRNPRGYSVLHVAARRKDPSILVA  240

Query  899   ILDKSGASIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVM-MN  723
             +L K GA+  D T  +G TA+ IC+R TR KDY++ T +G+E N DRLC+DV E  M  N
Sbjct  241   LL-KKGANASDTT-PDGQTALVICQRLTRRKDYHEETVQGKESNKDRLCVDVPEREMRRN  298

Query  722   GNPVSLP-SSTTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGM  546
                V++  SS T  +DL M+L + ENRVA AR L+P EAR+ +E A  DS       S +
Sbjct  299   FKCVTMSDSSETTADDLHMKLDYFENRVAFARLLFPAEARVAIENAEVDSASLDTTSSTL  358

Query  545   EGLCGNLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSL  366
             +    N + V     P  + K++  R ++L+KTVE GRRFF +CS+VLD    D + D  
Sbjct  359   KRAGAN-REVDPNETPAVRTKKMQLRLQSLQKTVENGRRFFPHCSEVLDNFLEDLIPDVF  417

Query  365   ESLESGTPEEQTNKKRRYMELKEEVMKAFDKDMAQNR  255
               LE G+ EEQ  KK R+MELK++V KAF  DMA+N+
Sbjct  418   -FLEKGSEEEQRIKKARFMELKDDVQKAFHMDMAENK  453



>gb|EEC71545.1| hypothetical protein OsI_03882 [Oryza sativa Indica Group]
Length=568

 Score =   409 bits (1052),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 252/522 (48%), Positives = 334/522 (64%), Gaps = 37/522 (7%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdgkpK----------------  1593
             DY D D+   G  V V+R ILAARS FF   F    +  DG                   
Sbjct  30    DYADVDVADGGPPVPVHRCILAARSTFFENLFAARGRGGDGAAGGGGGGGGGGGERTGGR  89

Query  1592  --FLMTELVPCGWVGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQ  1419
               + M ELVP G VG +AF+  L Y+YTGK + +P +V +C D  C H +C PAI + V+
Sbjct  90    PRYKMEELVPGGRVGRDAFLSLLGYLYTGKLRPAPDDVVSCADPMCPHDSCPPAIRFNVE  149

Query  1418  LMYASATFQIKELVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSN  1239
              MYA+  F+I EL+ L QR L   VD   +EDV+PIL V F   L P++E+C+RR+  SN
Sbjct  150   QMYAAWAFKITELISLFQRRLLNFVDKTLVEDVLPILQVAFHSELTPVLEKCIRRIARSN  209

Query  1238  LDNFTLENELPGAISSDIKARRLNQQ----------GANEKKIRKILRALDCNDVELVKL  1089
             LDN +L+ ELP  ++  IK  R   Q            +EK++R+I RALD +DVELVKL
Sbjct  210   LDNVSLDKELPPEVAVQIKEIRQKSQPNEGDTVISDPVHEKRVRRIHRALDSDDVELVKL  269

Query  1088  LLEESDITLDDayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAI  909
             LL ES+ITLDDA A+HYAAAYC+SKVV+E+L L   +LNL+N+RGYT LH+AA R++PAI
Sbjct  270   LLNESEITLDDANALHYAAAYCDSKVVSELLDLRLANLNLKNSRGYTALHLAAMRREPAI  329

Query  908   IVAILDKSGASIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVM  729
             I+ +L+K GA++   T ++G +A++ICRR TR KDYN   E+G+E N DRLCID+L+  M
Sbjct  330   IMCLLNK-GAAVSQLT-ADGQSAMSICRRLTRLKDYNTKMEQGQESNKDRLCIDILDREM  387

Query  728   MNGNPVSLPSSTT---LENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVG  558
             +   P+++  S T   L +DL M+L +LENRVA AR  +P EA++ M+IA AD+T EF G
Sbjct  388   IR-KPMAVEDSVTSPLLADDLHMKLLYLENRVAFARLFFPAEAKVAMQIAQADTTPEF-G  445

Query  557   LSGMEGLCGNLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDV  378
             +       G LK V L   P  Q KRL  R +AL KTVELGRR+F NCS VLDK   DD+
Sbjct  446   IVPAASTSGKLKEVDLNETPVTQNKRLRSRVDALMKTVELGRRYFPNCSQVLDKFLEDDL  505

Query  377   LDSLES--LESGTPEEQTNKKRRYMELKEEVMKAFDKDMAQN  258
              DS ++  L++GT +EQ  K+ R+ ELKE+V KAF KD A N
Sbjct  506   PDSPDALDLQNGTSDEQNVKRMRFCELKEDVRKAFSKDRADN  547



>gb|EEE66887.1| hypothetical protein OsJ_23709 [Oryza sativa Japonica Group]
Length=411

 Score =   404 bits (1037),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 228/381 (60%), Positives = 280/381 (73%), Gaps = 14/381 (4%)
 Frame = +1

Query  2428  TPSRFELLSMVKKHSKFLGKTIVE-EEDPSDVEMDPQFWHEVLDLYFVCGKESRGRQEDD  2604
              PSR ELL+MVKKHS  +G T+V+ E+D SDV MD +FWHE+LDL+FV G+ S+ R+EDD
Sbjct  35    APSRNELLTMVKKHSHLIGWTVVDAEDDASDVGMDDRFWHEMLDLFFVRGRVSKRREEDD  94

Query  2605  LIFFVRK-MSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLIAHT  2781
             L+FFV   M + G+  N N ED  P+FVRRW+P L+ +   NS GVDW RS+YLNLIAHT
Sbjct  95    LVFFVNNNMKMHGHGFNDNMEDPPPFFVRRWAPMLEKISNINSAGVDWERSFYLNLIAHT  154

Query  2782  TFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPAYPD  2961
             +++VTVAICS   L + +  K KPLSP+YKV KTVYASPSR+NFHLD RK VET PAYP+
Sbjct  155   SYTVTVAICSVRDLCS-RAEKSKPLSPVYKVTKTVYASPSRVNFHLDRRKAVETVPAYPN  213

Query  2962  ICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSD-------SSQSETSGGKTQSS  3120
             ICF+VDDFD TFDAVVL+D +HCYCVILNA+DGAAFP D       S+   T   + +  
Sbjct  214   ICFSVDDFDDTFDAVVLSDPEHCYCVILNAHDGAAFPEDTESKNASSNLLNTGSNQEKPP  273

Query  3121  KITIFSGFVSYQMVRDAYDAGRTgf-gsllslhssgKTDRIYMKGPGGRGEVEVAVSGVV  3297
             K T+FSG+VSYQ VR+AY+AGR+ F   L   H   K D++YM+GP GRGEVEVAVSG+ 
Sbjct  274   KRTLFSGYVSYQNVREAYNAGRSQFGSLLSLGHDQTKLDKLYMRGPEGRGEVEVAVSGIA  333

Query  3298  DQSKEEYGHHPPKKGLsfsavvrraasvasvaakhayaaasatrssDEEMIPLKCCLMSI  3477
             DQS E     P   G SF   V RAAS AS  AKHAY AAS  +  D E++PLKCCLMS+
Sbjct  334   DQSHERSKKDP---GDSFRVFVHRAASAASKLAKHAYEAASTNKRFDHELLPLKCCLMSV  390

Query  3478  SLPWEHIAHDLLLKGSPPVNL  3540
             SLPW++IAHDLL K +PP++L
Sbjct  391   SLPWDYIAHDLLHKETPPLDL  411



>ref|XP_010936179.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X2 
[Elaeis guineensis]
Length=338

 Score =   400 bits (1029),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 192/307 (63%), Positives = 237/307 (77%), Gaps = 11/307 (4%)
 Frame = +1

Query  2428  TPSRFELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFVCGKESRGRQEDDL  2607
              PSR+ELLSMV+KHS  +G+T V+E+D SD+ MD QFWH++LDLYF+ G+ S+GRQEDDL
Sbjct  18    NPSRYELLSMVRKHSNLVGETAVDEQDASDIGMDAQFWHKMLDLYFIHGRISKGRQEDDL  77

Query  2608  IFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLIAHTTF  2787
             IFFVR MSL GY  N   E + P+FVRRW+P+L+ ++GEN   VDWRRS+YLNLIAHT+F
Sbjct  78    IFFVRNMSLHGYGFNDTMEGHPPFFVRRWAPQLEKVVGENCADVDWRRSFYLNLIAHTSF  137

Query  2788  SVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPAYPDIC  2967
             +VTVAICS + L  +Q G+   LSPIYKVVKTVYASPSR+NFHLD +K VET PAYP+IC
Sbjct  138   TVTVAICSIQDLHKHQNGEVTSLSPIYKVVKTVYASPSRVNFHLDHKKAVETLPAYPNIC  197

Query  2968  FAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDSSQS----------ETSGGKTQS  3117
             FAVDDFD TFDAVVL++ DHCYCV+LNA+ GAAFP++  Q           E    + +S
Sbjct  198   FAVDDFDDTFDAVVLSETDHCYCVLLNAHGGAAFPAEEDQPDCDSSVSLRLENDPERARS  257

Query  3118  SKITIFSGFVSYQMVRDAYDAGRTg-fgsllslhssgKTDRIYMKGPGGRGEVEVAVSGV  3294
             SK+T+FSGFVSYQMVR+AYDAG++     L   H   KTDR+YM+GPGGRGEVEVAVSG+
Sbjct  258   SKLTLFSGFVSYQMVREAYDAGKSRFGSLLSIGHVQAKTDRLYMRGPGGRGEVEVAVSGI  317

Query  3295  VDQSKEE  3315
               +   E
Sbjct  318   AGKPSSE  324



>ref|XP_009759452.1| PREDICTED: uncharacterized protein LOC104211982 isoform X7 [Nicotiana 
sylvestris]
Length=395

 Score =   402 bits (1034),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 258/389 (66%), Positives = 287/389 (74%), Gaps = 68/389 (17%)
 Frame = +1

Query  2425  QTPSR------------FELLSMVKKHSKFLGKTIVEEEDPSDVEMDPQFWHEVLDLYFV  2568
             QTPSR             ELLSMVKKHS+ LGKT V+EED SDVE+DP+FWH+V+DLYF+
Sbjct  7     QTPSRNLCDTYKVAGNWSELLSMVKKHSEMLGKTTVDEEDASDVEVDPRFWHDVMDLYFI  66

Query  2569  CGKESRGRQEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWR  2748
             CGKESRGRQEDDL+FFV+++     ESN   +D+SPYFVR                    
Sbjct  67    CGKESRGRQEDDLVFFVKRIR---NESNEYVDDDSPYFVR--------------------  103

Query  2749  RSYYLNLIAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSR  2928
                                 SH VL +YQ GKD PLSPIYKVVKTVYASPSRI  HLDSR
Sbjct  104   --------------------SHRVLMSYQNGKDGPLSPIYKVVKTVYASPSRIKIHLDSR  143

Query  2929  KEVETTPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGAAFPSDSSQSE-----  3093
             KEVETTPAYP+ICFA+DDFDSTF AVVLTDVDHCYCV+LNA+DGAAFPS+ +  E     
Sbjct  144   KEVETTPAYPEICFAIDDFDSTFGAVVLTDVDHCYCVLLNAHDGAAFPSERALRESSSCD  203

Query  3094  -------TSGGKTQSSKITIFSGFVSYQMVRDAYDAGRTgfgsllslhssgKTDRIYMKG  3252
                    TS GK + SKIT+FSGF+SY+MVRDAYD GR+G GSLLSL+SSGKTDRIYMKG
Sbjct  204   TSSSKSDTSSGKVRRSKITLFSGFISYEMVRDAYDDGRSGLGSLLSLNSSGKTDRIYMKG  263

Query  3253  PGGRGEVEVAVSGVVDQSKEEYGHHPPKKGLsfsavvrraasvasvaakhayaaasatrs  3432
             PGGRGEVEVAVSGVVDQSK+E GHH   KGLSF  VVRRAASVAS+AAKHAYAAASATR 
Sbjct  264   PGGRGEVEVAVSGVVDQSKQESGHH-STKGLSFGVVVRRAASVASMAAKHAYAAASATRC  322

Query  3433  sDEEMIPLKCCLMSISLPWEHIAHDLLLK  3519
              D  +IPLKCCLMSISLPWEHIAHDLL K
Sbjct  323   PDGGLIPLKCCLMSISLPWEHIAHDLLFK  351



>ref|XP_004983491.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X2 
[Setaria italica]
Length=409

 Score =   401 bits (1031),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 229/387 (59%), Positives = 283/387 (73%), Gaps = 17/387 (4%)
 Frame = +1

Query  2419  GGQTPSRFELLSMVKKHSKFLGKTIVE-EEDPSDVEMDPQFWHEVLDLYFVCGKESRGRQ  2595
                +PSR ELLSMVKKHS  +G TIV+ E+D SDV MD +FWHE+LDL+FV G +S+  +
Sbjct  27    ASSSPSRTELLSMVKKHSHLIGWTIVDAEDDASDVGMDDKFWHEMLDLFFVRGGKSKRSE  86

Query  2596  EDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPKLDDLLGENSVGVDWRRSYYLNLIA  2775
             EDDL+FFV  M L GY  N N ED  P+FVRRW+P L+ ++  N++ VDW RS+YLNLIA
Sbjct  87    EDDLVFFVNNMKLHGYGFNDNMEDPPPFFVRRWAPTLEKVINVNTLEVDWERSFYLNLIA  146

Query  2776  HTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKTVYASPSRINFHLDSRKEVETTPAY  2955
             HT+++VTVAI S   L+N +  K K LSP+YKV KTVYASPSR+NFHLD RK VET PAY
Sbjct  147   HTSYTVTVAIFSIGDLRN-RAAKSKQLSPVYKVTKTVYASPSRVNFHLDRRKAVETVPAY  205

Query  2956  PDICFAVDDFDSTFDAV-VLTDVDHCYCVILNANDGAAFPSDSS--------QSETSGGK  3108
             P+I F+VDDFD TFDAV VL+D +HCYCVILNA+DGAAFP ++         Q E S G 
Sbjct  206   PNIYFSVDDFDDTFDAVQVLSDPEHCYCVILNAHDGAAFPEETESKNPGSNVQPELSSGS  265

Query  3109  TQSS--KITIFSGFVSYQMVRDAYDAGRTg-fgsllslhssgKTDRIYMKGPGGRGEVEV  3279
              Q    K T+FSG+VSYQ VR+AYDAGR+     L   H   K DR+YM+GP GRGEVEV
Sbjct  266   AQEKPPKRTLFSGYVSYQNVREAYDAGRSKFGSLLSLGHDHTKLDRLYMRGPEGRGEVEV  325

Query  3280  AVSGVVDQSKEEYGHHPPKKGLsfsavvrraasvasvaakhayaaasatrssDEEMIPLK  3459
             AVSG+ DQS+E+    P   G SF  +V RAAS AS  AKHAY +ASA +  D+E++PLK
Sbjct  326   AVSGIADQSREKSKKDP---GDSFRVLVHRAASAASKLAKHAYESASANKRMDDELVPLK  382

Query  3460  CCLMSISLPWEHIAHDLLLKGSPPVNL  3540
             CCLMS+SLPW++IAHDLL K +PP++ 
Sbjct  383   CCLMSVSLPWDYIAHDLLHKDTPPLDF  409



>ref|NP_001044363.1| Os01g0767900 [Oryza sativa Japonica Group]
 gb|ABE11615.1| ankyrin-repeat protein [Oryza sativa Japonica Group]
 gb|ABE11616.1| ankyrin-repeat protein [Oryza sativa Japonica Group]
 dbj|BAF06277.1| Os01g0767900 [Oryza sativa Japonica Group]
 dbj|BAG90312.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AEF30409.1| putative NPR1-like protein 1 [Oryza sativa Japonica Group]
Length=635

 Score =   409 bits (1051),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 253/524 (48%), Positives = 338/524 (65%), Gaps = 39/524 (7%)
 Frame = -2

Query  1724  DYNDADIEVE--GILVGVNRGILAARSQFFHEEFkkakkdcdgkpK--------------  1593
             D +DAD++V   G  V V+R ILAARS FF+  F    +  DG                 
Sbjct  95    DCSDADVDVADGGPPVPVHRCILAARSTFFYNLFAARGRGGDGAAGGGGGGGGGGGERTG  154

Query  1592  ----FLMTELVPCGWVGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYA  1425
                 + M ELVP G VG +AF+  L Y+YTGK + +P +V +C D  C H +C PAI + 
Sbjct  155   GRPRYKMEELVPGGRVGRDAFLSLLGYLYTGKLRPAPDDVVSCADPMCPHDSCPPAIRFN  214

Query  1424  VQLMYASATFQIKELVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTS  1245
             V+ MYA+  F+I EL+ L QR L   VD   +EDV+PIL V F   L P++E+C+RR+  
Sbjct  215   VEQMYAAWAFKITELISLFQRRLLNFVDKTLVEDVLPILQVAFHSELTPVLEKCIRRIAR  274

Query  1244  SNLDNFTLENELPGAISSDIKARRLNQQ----------GANEKKIRKILRALDCNDVELV  1095
             SNLDN +L+ ELP  ++  IK  R   Q            +EK++R+I RALD +DVELV
Sbjct  275   SNLDNVSLDKELPPEVAVQIKEIRQKSQPNEGDTVISDPVHEKRVRRIHRALDSDDVELV  334

Query  1094  KLLLEESDITLDDayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDP  915
             KLLL ES+ITLDDA A+HYAAAYC+SKVV+E+L L   +LNL+N+RGYT LH+AA R++P
Sbjct  335   KLLLNESEITLDDANALHYAAAYCDSKVVSELLDLRLANLNLKNSRGYTALHLAAMRREP  394

Query  914   AIIVAILDKSGASIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEG  735
             AII+ +L+K GA++   T ++G +A++ICRR TR KDYN   E+G+E N DRLCID+L+ 
Sbjct  395   AIIMCLLNK-GAAVSQLT-ADGQSAMSICRRLTRMKDYNTKMEQGQESNKDRLCIDILDR  452

Query  734   VMMNGNPVSLPSSTT---LENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEF  564
              M+   P+++  S T   L +DL M+L +LENRVA AR  +P EA++ M+IA AD+T EF
Sbjct  453   EMIR-KPMAVEDSVTSPLLADDLHMKLLYLENRVAFARLFFPAEAKVAMQIAQADTTPEF  511

Query  563   VGLSGMEGLCGNLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTAD  384
              G+       G LK V L   P  Q KRL  R +AL KTVELGRR+F NCS VLDK   D
Sbjct  512   -GIVPAASTSGKLKEVDLNETPVTQNKRLRSRVDALMKTVELGRRYFPNCSQVLDKFLED  570

Query  383   DVLDSLES--LESGTPEEQTNKKRRYMELKEEVMKAFDKDMAQN  258
             D+ DS ++  L++GT +EQ  K+ R+ ELKE+V KAF KD A N
Sbjct  571   DLPDSPDALDLQNGTSDEQNVKRMRFCELKEDVRKAFSKDRADN  614



>ref|XP_009387109.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X2 
[Musa acuminata subsp. malaccensis]
Length=356

 Score =   399 bits (1025),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 216/356 (61%), Positives = 270/356 (76%), Gaps = 17/356 (5%)
 Frame = +1

Query  2524  MDPQFWHEVLDLYFVCGKESRGRQEDDLIFFVRKMSLQGYESNGNSEDNSPYFVRRWSPK  2703
             MD +FWHEVLDLYF+ G+ S+GR+EDDL+FFVRKM+L GY  + + ED SP+FVRRW+P+
Sbjct  1     MDNEFWHEVLDLYFIRGRVSKGREEDDLVFFVRKMNLHGYGYSDDVEDGSPFFVRRWAPR  60

Query  2704  LDDLLGENSVGVDWRRSYYLNLIAHTTFSVTVAICSHEVLKNYQTGKDKPLSPIYKVVKT  2883
             L+ ++GE+S  VDWRRS YLNLIAHT+++VTVAICS + L+  Q+G+D  LSPIYKVVKT
Sbjct  61    LEKVVGEDSACVDWRRSIYLNLIAHTSYTVTVAICSKQDLEQRQSGQDISLSPIYKVVKT  120

Query  2884  VYASPSRINFHLDSRKEVETTPAYPDICFAVDDFDSTFDAVVLTDVDHCYCVILNANDGA  3063
             VYASPSR++F LD +K  ET PAYP+ICF+VDDFD TFDAVVL++ +HCYCV+LNA+ G 
Sbjct  121   VYASPSRVDFQLDHKKAAETLPAYPNICFSVDDFDDTFDAVVLSERNHCYCVLLNAHGGP  180

Query  3064  AFPSDSSQSETSGGK----------TQSSKITIFSGFVSYQMVRDAYDAGRTg-fgslls  3210
             AFP+D    E +  +           + SK+T+FSGFVSYQMVR+AYDAG++     L  
Sbjct  181   AFPTDEDLPECNSSRPVNVHKDVEEAKPSKLTLFSGFVSYQMVREAYDAGKSRFGSLLSM  240

Query  3211  lhssgKTDRIYMKGPGGRGEVEVAVSGVVDQSKEEYGH----HPPKK--GLsfsavvrra  3372
              H   KTD+IYM+GPGGRGEVEVAVSG+ DQS +        H  +K  G+    +V RA
Sbjct  241   GHGHTKTDKIYMRGPGGRGEVEVAVSGIADQSHQNAALSSAVHLSRKGSGIGLGTIVHRA  300

Query  3373  asvasvaakhayaaasatrssDEEMIPLKCCLMSISLPWEHIAHDLLLKGSPPVNL  3540
             AS ASV AKHAYAA S  R SD E++PLKCCLMSISLPWE+IAHDLL K SPPV++
Sbjct  301   ASAASVLAKHAYAATSPNRQSDGELLPLKCCLMSISLPWEYIAHDLLFKVSPPVDM  356



>dbj|BAD53355.1| putative NPR1 [Oryza sativa Japonica Group]
 dbj|BAD53329.1| putative NPR1 [Oryza sativa Japonica Group]
Length=624

 Score =   409 bits (1050),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 253/524 (48%), Positives = 338/524 (65%), Gaps = 39/524 (7%)
 Frame = -2

Query  1724  DYNDADIEVE--GILVGVNRGILAARSQFFHEEFkkakkdcdgkpK--------------  1593
             D +DAD++V   G  V V+R ILAARS FF+  F    +  DG                 
Sbjct  84    DCSDADVDVADGGPPVPVHRCILAARSTFFYNLFAARGRGGDGAAGGGGGGGGGGGERTG  143

Query  1592  ----FLMTELVPCGWVGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYA  1425
                 + M ELVP G VG +AF+  L Y+YTGK + +P +V +C D  C H +C PAI + 
Sbjct  144   GRPRYKMEELVPGGRVGRDAFLSLLGYLYTGKLRPAPDDVVSCADPMCPHDSCPPAIRFN  203

Query  1424  VQLMYASATFQIKELVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTS  1245
             V+ MYA+  F+I EL+ L QR L   VD   +EDV+PIL V F   L P++E+C+RR+  
Sbjct  204   VEQMYAAWAFKITELISLFQRRLLNFVDKTLVEDVLPILQVAFHSELTPVLEKCIRRIAR  263

Query  1244  SNLDNFTLENELPGAISSDIKARRLNQQ----------GANEKKIRKILRALDCNDVELV  1095
             SNLDN +L+ ELP  ++  IK  R   Q            +EK++R+I RALD +DVELV
Sbjct  264   SNLDNVSLDKELPPEVAVQIKEIRQKSQPNEGDTVISDPVHEKRVRRIHRALDSDDVELV  323

Query  1094  KLLLEESDITLDDayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDP  915
             KLLL ES+ITLDDA A+HYAAAYC+SKVV+E+L L   +LNL+N+RGYT LH+AA R++P
Sbjct  324   KLLLNESEITLDDANALHYAAAYCDSKVVSELLDLRLANLNLKNSRGYTALHLAAMRREP  383

Query  914   AIIVAILDKSGASIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEG  735
             AII+ +L+K GA++   T ++G +A++ICRR TR KDYN   E+G+E N DRLCID+L+ 
Sbjct  384   AIIMCLLNK-GAAVSQLT-ADGQSAMSICRRLTRMKDYNTKMEQGQESNKDRLCIDILDR  441

Query  734   VMMNGNPVSLPSSTT---LENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEF  564
              M+   P+++  S T   L +DL M+L +LENRVA AR  +P EA++ M+IA AD+T EF
Sbjct  442   EMIR-KPMAVEDSVTSPLLADDLHMKLLYLENRVAFARLFFPAEAKVAMQIAQADTTPEF  500

Query  563   VGLSGMEGLCGNLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTAD  384
              G+       G LK V L   P  Q KRL  R +AL KTVELGRR+F NCS VLDK   D
Sbjct  501   -GIVPAASTSGKLKEVDLNETPVTQNKRLRSRVDALMKTVELGRRYFPNCSQVLDKFLED  559

Query  383   DVLDSLES--LESGTPEEQTNKKRRYMELKEEVMKAFDKDMAQN  258
             D+ DS ++  L++GT +EQ  K+ R+ ELKE+V KAF KD A N
Sbjct  560   DLPDSPDALDLQNGTSDEQNVKRMRFCELKEDVRKAFSKDRADN  603



>ref|XP_006280229.1| hypothetical protein CARUB_v10026146mg [Capsella rubella]
 gb|EOA13127.1| hypothetical protein CARUB_v10026146mg [Capsella rubella]
Length=579

 Score =   406 bits (1044),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 245/502 (49%), Positives = 329/502 (66%), Gaps = 20/502 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdgkp-KFLMTELVPCGWVGYE  1548
             DY+DA+I V+G+ VGV+R ILAARS+FF E FKK KK+   +  K+ + E++P G VG+E
Sbjct  58    DYSDAEIIVDGVPVGVHRCILAARSKFFQELFKKEKKNSKTEKPKYQLKEMLPYGAVGHE  117

Query  1547  AFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVMLI  1368
             AF+ FL+Y+YTG+ K  P EVSTCVD  C H +CRPAID+ VQLMYAS+  Q+ ELV   
Sbjct  118   AFLYFLSYIYTGRLKPFPLEVSTCVDPVCAHDSCRPAIDFVVQLMYASSVLQVPELVSSF  177

Query  1367  QRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISSD  1188
             QR L   V+   +E+V+PIL+V F C L  L+++C+ RV  S+L  F +E ELP  ++  
Sbjct  178   QRRLCNFVEKTLVENVLPILMVAFNCKLNDLLDQCIERVARSDLYRFCIEKELPSEVAEK  237

Query  1187  IKARRLN--QQGANEK-------KIRKILRALDCNDVELVKLLLEESDITLDDayavhya  1035
             IK  RL   Q G   K       +IRKIL+ALD +DVELVKLLL ESDITLD+A  +HY+
Sbjct  238   IKQIRLKSPQDGGESKVSEKLLERIRKILKALDSDDVELVKLLLNESDITLDEANGLHYS  297

Query  1034  aaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDATCS  855
               Y + KVV E+L LG  D+N RN+RGYTVLH AA R++P+II+++++K GA+  + T S
Sbjct  298   VVYSDPKVVAEILNLGMGDVNFRNSRGYTVLHFAAMRREPSIIISLIEK-GANASELT-S  355

Query  854   NGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVSLPS---STTLE  684
             +G  AV I RR T PKDY+    +G E +  RLCID+LE   +  NP+ L S   S ++ 
Sbjct  356   DGRGAVNILRRLTNPKDYHTKAAKGRESSKARLCIDILER-QIRKNPMVLDSPMCSLSMP  414

Query  683   NDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGL-SGMEGLCGNLKGVGLT  507
              DL M L +LE RV LA+  +P EA++ M+I + + T EF GL   + GL GNL  V L 
Sbjct  415   EDLQMRLLYLEKRVGLAQLFFPTEAKVAMDIGNVEGTSEFTGLPPPLNGLTGNLSQVDLN  474

Query  506   GLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTAD---DVLDSLESLESGTPEE  336
               P    KRL+ R EAL KTVE GRRFF   S+VLDK   +   D +     +E G+ +E
Sbjct  475   ETPQMLTKRLLTRMEALMKTVETGRRFFPYGSEVLDKYMDEYIDDDILDDLRIEKGSSQE  534

Query  335   QTNKKRRYMELKEEVMKAFDKD  270
             +  K+ RY ELK++V KA+ KD
Sbjct  535   RRLKRMRYRELKDDVQKAYSKD  556



>gb|AFW84951.1| regulatory protein NPR1 [Zea mays]
Length=621

 Score =   406 bits (1043),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 248/524 (47%), Positives = 336/524 (64%), Gaps = 39/524 (7%)
 Frame = -2

Query  1724  DYNDADIEVE--GILVGVNRGILAARSQFFHEEFkkakkdcdgkpK--------------  1593
             D +DAD++V   G  V ++R ILAARS FF++ F    +    +                
Sbjct  79    DCSDADVDVPDGGPPVPIHRCILAARSDFFYDLFAARGRAGAARGDAAAGAGVAAEGAAS  138

Query  1592  ----FLMTELVPCGWVGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYA  1425
                 + M +LVP G VG EAF  FL Y+YTGK + +P +V +C D  C H +C PAI  A
Sbjct  139   GRPRYKMEDLVPAGRVGREAFQAFLGYLYTGKLRPAPVDVVSCADPVCHHDSCPPAIRSA  198

Query  1424  VQLMYASATFQIKELVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTS  1245
             V+LMYA+ TF+I EL  L QR L   VD   +EDVIPIL V     L  ++++C++R+  
Sbjct  199   VELMYAACTFKIPELTSLFQRRLLNFVDKTLVEDVIPILEVASHSGLTQVIDKCIQRIAR  258

Query  1244  SNLDNFTLENELPGAISSDIKARRLNQQGAN----------EKKIRKILRALDCNDVELV  1095
             S+LD+ +L+ ELP     +IK  R   Q A+          EK++R+I RALD +DVELV
Sbjct  259   SDLDDISLDKELPPEAVDEIKNLRKKSQTADGDTFISDPVHEKRVRRIHRALDSDDVELV  318

Query  1094  KLLLEESDITLDDayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDP  915
             KLLL ESDITLDDA A+HYAA+YC+ KVV+E+L L   +LNL+N+RGYT LH+AA R++P
Sbjct  319   KLLLNESDITLDDANALHYAASYCDPKVVSELLDLAMANLNLKNSRGYTALHLAAMRREP  378

Query  914   AIIVAILDKSGASIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEG  735
             AII+ +L+K GA++   T ++G +A+ ICRR TR KDYN   E+G+E N DRLCID+LE 
Sbjct  379   AIIMCLLNK-GANVSQLT-ADGRSAIGICRRLTRAKDYNTKMEQGQESNKDRLCIDILER  436

Query  734   VMMNGNPVSLPSSTT---LENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEF  564
              MM  NP+++  + T   L +DL M+L +LENRVA AR  +P EA++ M+IA AD+T EF
Sbjct  437   EMMR-NPMAVEDAVTSPLLADDLHMKLLYLENRVAFARLFFPAEAKVAMQIAQADTTEEF  495

Query  563   VGLSGMEG-LCGNLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTA  387
              G+  +     G L+ V L   P  Q KRL  R +AL KTVELGRR+F NCS VLDK   
Sbjct  496   GGIVAVAASTSGKLREVDLNETPVTQNKRLRSRVDALMKTVELGRRYFPNCSQVLDKFLE  555

Query  386   DDVLDSLES--LESGTPEEQTNKKRRYMELKEEVMKAFDKDMAQ  261
             DD+ + L+   L+ GT +EQ  K+ R+ ELKE+V+KAF KD A+
Sbjct  556   DDLPEGLDQFYLQRGTADEQKVKRMRFCELKEDVLKAFSKDKAE  599



>ref|NP_001147587.1| regulatory protein NPR1 [Zea mays]
 gb|ACG28002.1| regulatory protein NPR1 [Zea mays]
Length=621

 Score =   405 bits (1042),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 248/524 (47%), Positives = 336/524 (64%), Gaps = 39/524 (7%)
 Frame = -2

Query  1724  DYNDADIEVE--GILVGVNRGILAARSQFFHEEFkkakkdcdgkpK--------------  1593
             D +DAD++V   G  V ++R ILAARS FF++ F    +    +                
Sbjct  79    DCSDADVDVPDGGPPVPIHRCILAARSDFFYDLFAARGRAGAARGDAAAGAGVAAEGAAS  138

Query  1592  ----FLMTELVPCGWVGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYA  1425
                 + M +LVP G VG EAF  FL Y+YTGK + +P +V +C D  C H +C PAI  A
Sbjct  139   GRPRYKMEDLVPAGRVGREAFQAFLGYLYTGKLRPAPVDVVSCADPVCHHDSCPPAIRSA  198

Query  1424  VQLMYASATFQIKELVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTS  1245
             V+LMYA+ TF+I EL  L QR L   VD   +EDVIPIL V     L  ++++C++R+  
Sbjct  199   VELMYAACTFKIPELTSLFQRRLLNFVDKTLVEDVIPILEVASHSGLTQVIDKCIQRIAR  258

Query  1244  SNLDNFTLENELPGAISSDIKARRLNQQGAN----------EKKIRKILRALDCNDVELV  1095
             S+LD+ +L+ ELP     +IK  R   Q A+          EK++R+I RALD +DVELV
Sbjct  259   SDLDDISLDKELPPEAVDEIKNLRKKSQTADGDTFISDPVHEKRVRRIHRALDSDDVELV  318

Query  1094  KLLLEESDITLDDayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDP  915
             KLLL ESDITLDDA A+HYAA+YC+ KVV+E+L L   +LNL+N+RGYT LH+AA R++P
Sbjct  319   KLLLNESDITLDDANALHYAASYCDPKVVSELLDLAMANLNLKNSRGYTALHLAAMRREP  378

Query  914   AIIVAILDKSGASIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEG  735
             AII+ +L+K GA++   T ++G +A+ ICRR TR KDYN   E+G+E N DRLCID+LE 
Sbjct  379   AIIMCLLNK-GANVSQLT-ADGSSAIGICRRLTRAKDYNTKMEQGQESNKDRLCIDILER  436

Query  734   VMMNGNPVSLPSSTT---LENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEF  564
              MM  NP+++  + T   L +DL M+L +LENRVA AR  +P EA++ M+IA AD+T EF
Sbjct  437   EMMR-NPMAVEDAVTSPLLADDLHMKLLYLENRVAFARLFFPAEAKVAMQIAQADTTEEF  495

Query  563   VGLSGMEG-LCGNLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTA  387
              G+  +     G L+ V L   P  Q KRL  R +AL KTVELGRR+F NCS VLDK   
Sbjct  496   GGIVAVAASTSGKLREVDLNETPVTQNKRLRSRVDALMKTVELGRRYFPNCSQVLDKFLE  555

Query  386   DDVLDSLES--LESGTPEEQTNKKRRYMELKEEVMKAFDKDMAQ  261
             DD+ + L+   L+ GT +EQ  K+ R+ ELKE+V+KAF KD A+
Sbjct  556   DDLPEGLDQFYLQRGTADEQKVKRMRFCELKEDVLKAFSKDKAE  599



>ref|XP_006644769.1| PREDICTED: LOW QUALITY PROTEIN: regulatory protein NPR3-like 
[Oryza brachyantha]
Length=626

 Score =   405 bits (1042),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 253/522 (48%), Positives = 333/522 (64%), Gaps = 40/522 (8%)
 Frame = -2

Query  1715  DADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdgkpK----------------FLM  1584
             D D+   G  V V+R ILAARS FF+  F    +   G                   + M
Sbjct  88    DVDVADGGPPVPVHRCILAARSTFFYNLFAARGRGGRGDGAAGAGGGGGGERSGRPLYKM  147

Query  1583  TELVPCGWVGYEAFMVFLNYV-----YTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQ  1419
              ELVP G VG +AF+  L  V     YTGK + +P +V +C D  C H +C PAI   V+
Sbjct  148   EELVPVGRVGRDAFLSLLGPVHGQALYTGKLQPAPVDVVSCADPVCPHDSCPPAIRSVVE  207

Query  1418  LMYASATFQIKELVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSN  1239
             LMYA+ TF+I EL+ + QR L   VD   +EDV+PILLV F   L P++ERCVRR+  S+
Sbjct  208   LMYAAWTFKIPELISMFQRRLLNFVDKTMVEDVLPILLVAFHSELTPVLERCVRRIARSD  267

Query  1238  LDNFTLENELPGAISSDIKARRLNQQ----------GANEKKIRKILRALDCNDVELVKL  1089
             LDN +L+ ELP  +S  IK  R   Q            +EK++R+I RALD +DVELVKL
Sbjct  268   LDNISLDKELPPEVSVQIKETRQKSQTNEGDTVISDPVHEKRVRRIHRALDSDDVELVKL  327

Query  1088  LLEESDITLDDayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAI  909
             LL ES+ITLDDA A+HYAAAYC+SKVV E+L LG  +LNL+N+RGYT LH+AA R++PAI
Sbjct  328   LLNESEITLDDANALHYAAAYCDSKVVTELLDLGLANLNLKNSRGYTALHLAAMRREPAI  387

Query  908   IVAILDKSGASIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVM  729
             I+ +L+K GA++   T ++G +A++ICRR TR KDYN   E+G+E N DRLCID+LE  M
Sbjct  388   IMCLLNK-GAAVSQLT-ADGQSAISICRRLTRLKDYNTKMEQGQESNKDRLCIDMLEREM  445

Query  728   MNGNPVSLPSSTT---LENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVG  558
             +  NP+++  S T   L +DL M+L +LENRV+ AR  +P EA++ M+IA AD+T EF G
Sbjct  446   IR-NPMAVEDSVTSPLLADDLHMKLLYLENRVSFARLFFPVEAKVAMQIAQADTTTEFGG  504

Query  557   LSGMEGLCGNLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDV  378
             ++      G LK V L   P  Q KRL  R +AL KTVELGRR+F NCS VLDK   +D+
Sbjct  505   IAA-ASTSGKLKEVDLNETPVTQNKRLRSRVDALMKTVELGRRYFPNCSQVLDKFLEEDL  563

Query  377   LDSLES--LESGTPEEQTNKKRRYMELKEEVMKAFDKDMAQN  258
              DS ++  L++GT  EQ  K+ R+ ELKE+V KAF  D A N
Sbjct  564   PDSPDALYLQNGTSGEQNVKRMRFCELKEDVRKAFSIDRADN  605



>emb|CDX99350.1| BnaC01g12020D [Brassica napus]
Length=588

 Score =   404 bits (1037),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 246/506 (49%), Positives = 324/506 (64%), Gaps = 24/506 (5%)
 Frame = -2

Query  1724  DYNDADIEVEG--ILVGVNRGILAARSQFFHEEFkk-akkdcdgkpKFLMTELVPCGWVG  1554
             DY DA+I  EG    VGV+R +LAARS+FF + FKK  + +   KPK+ + +L+P G VG
Sbjct  58    DYTDAEITFEGETHAVGVHRCVLAARSKFFFDLFKKDRESEEKKKPKYHIKDLLPHGHVG  117

Query  1553  YEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVM  1374
              EAF+ FLNY+YTGK K  P EVSTCVD  C H +C+PAID+AV+LMYAS TF+I ELV 
Sbjct  118   REAFLHFLNYIYTGKLKPFPVEVSTCVDTGCAHDSCKPAIDFAVELMYASYTFKITELVS  177

Query  1373  LIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAIS  1194
               QR L   V+ + +E+V+PILLV F C L  L+++CV RV  S+LD F +E ELP  +S
Sbjct  178   SFQRRLCNYVEKSLVENVLPILLVAFHCDLTQLLDQCVERVARSDLDRFYIEKELPLEVS  237

Query  1193  SDIKARRLNQQGANE------KKIRKILRALDCNDVELVKLLLEESDITLDDayavhyaa  1032
               IK  R+     +E      ++  K+L+ALD +DVELVKLLL ESD TLD A  +HY  
Sbjct  238   EKIKKLRVKSTNTDEVADKLIERTGKVLKALDSDDVELVKLLLTESDTTLDQANGLHYVV  297

Query  1031  aYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDATCSN  852
             AY + KVV EVL L   D+N RN+RGYTVLH AA R++P+II+++L K GA+  D T  +
Sbjct  298   AYSDPKVVAEVLALDMADVNYRNSRGYTVLHYAAMRREPSIIISLL-KKGANASDFTF-D  355

Query  851   GHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLE-----GVMMNGNPVSLPSSTTL  687
             G +AV ICRR TRPKDY     +G+E + DRLCID+LE       + +G   +   S ++
Sbjct  356   GRSAVNICRRMTRPKDYYTKNAKGDEASKDRLCIDILEREIRRNPLASGGGDTPTCSHSM  415

Query  686   ENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGL---SGMEGLCGNLKGV  516
               DL M   +LE RV LA+  +P EA + M+IA+ + T EF G        G  GNL  V
Sbjct  416   PEDLQMRFLYLEKRVGLAQLFFPTEADVAMDIANVEGTSEFTGFPVPPPSNGATGNLTQV  475

Query  515   GLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDS----LESLESG  348
              L   P  Q KRL+ R EAL KTVE GRR+F +CS+VLDK   DD +D     +   E G
Sbjct  476   DLNETPYMQTKRLLTRMEALMKTVETGRRYFPSCSEVLDKYM-DDYMDEDIPDMSHPEKG  534

Query  347   TPEEQTNKKRRYMELKEEVMKAFDKD  270
             + +E+  K+ RY ELK +V KA++KD
Sbjct  535   SVKERRWKRMRYKELKNDVKKAYNKD  560



>ref|XP_003569900.1| PREDICTED: regulatory protein NPR3-like [Brachypodium distachyon]
Length=622

 Score =   405 bits (1040),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 254/523 (49%), Positives = 336/523 (64%), Gaps = 40/523 (8%)
 Frame = -2

Query  1724  DYNDADIEVE--GILVGVNRGILAARSQFFHEEFkk-------------------akkdc  1608
             D +DAD+++   G LV V+R ILAARS FFHE F                        + 
Sbjct  78    DCSDADVDMADGGPLVPVHRCILAARSPFFHEFFAARGRGNSGDGPPSASAAGVGGGGEG  137

Query  1607  dgkpKFLMTELVPCGWVGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDY  1428
              G+P++ M ELVP G VG EAF+ F+ Y+YTGK + +PP+V +CVD  C H +C PAI +
Sbjct  138   TGRPRYKMEELVPGGRVGREAFLGFMRYLYTGKLRPAPPDVVSCVDPVCPHDSCPPAIRF  197

Query  1427  AVQLMYASATFQIKELVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVT  1248
             AV+LMYA++TF I EL+ L QR L   VD   +EDV+PIL V +   L  ++E+CV+R+ 
Sbjct  198   AVELMYAASTFNIPELISLFQRRLLNFVDKTLVEDVLPILQVAYDSDLGQVLEKCVQRIV  257

Query  1247  SSNLDNFTLENELPGAISSDIKARRLNQ----------QGANEKKIRKILRALDCNDVEL  1098
              S+LDN +L+ E+   ++  IK  R                +EK++R+I RALD +DVEL
Sbjct  258   RSDLDNISLDKEVCPEVADKIKKIRQKSPPDDGDTVILDPVHEKRVRRIHRALDSDDVEL  317

Query  1097  VKLLLEESDITLDDayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKD  918
             VKLLL ES+ITLDDA A+HYAAAYC+SKVV+E+L LG  +LNL+N RGYT LH+AA R++
Sbjct  318   VKLLLNESEITLDDANALHYAAAYCDSKVVSELLDLGLANLNLKNNRGYTALHLAAMRRE  377

Query  917   PAIIVAILDKSGASIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLE  738
             P II+ +L+K GA     TC +G  A +ICRR TR KDYN   E+G+E N D++CID+LE
Sbjct  378   PTIIMCLLNK-GAVASQLTC-DGRLASSICRRLTRAKDYNTKMEQGQESNKDKMCIDMLE  435

Query  737   GVMMNGNPVSLPSSTT---LENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLE  567
               M   NP+ +  S T   L +DL M+L +LE RVA AR  +P EA++ M+IA AD T E
Sbjct  436   REMRR-NPMPVEDSVTSPLLADDLHMKLNYLEIRVAFARLFFPAEAKVAMQIAQADITPE  494

Query  566   FVGLSGMEGLCGNLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTA  387
               G+S      G LK V L   P  Q KRL  R +AL KTVELGRR+F +CS+VLDK   
Sbjct  495   VTGVSAA-STSGKLKEVDLNETPVTQNKRLRSRVDALVKTVELGRRYFPSCSEVLDKYLE  553

Query  386   DDVLDSLESL--ESGTPEEQTNKKRRYMELKEEVMKAFDKDMA  264
             DD+ D L+    +SGTP+EQ  KK R+ E+KE+V KAF KD A
Sbjct  554   DDLPDGLDIFHQQSGTPDEQKVKKMRFCEVKEDVRKAFSKDTA  596



>ref|XP_002865280.1| hypothetical protein ARALYDRAFT_494469 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41539.1| hypothetical protein ARALYDRAFT_494469 [Arabidopsis lyrata subsp. 
lyrata]
Length=586

 Score =   403 bits (1035),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 243/504 (48%), Positives = 327/504 (65%), Gaps = 23/504 (5%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdgkp-KFLMTELVPCGWVGYE  1548
             DY+DA+I V+G+ VGV+R ILAARS+FF E FKK KK    +  K+ + E++P G VG+E
Sbjct  58    DYSDAEIIVDGVPVGVHRCILAARSKFFQELFKKEKKISKTEKPKYQLKEMLPYGAVGHE  117

Query  1547  AFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVMLI  1368
             AF+ FL+Y+YTG+ K  P EVSTCVD  C H +CRPAID+ VQLMYAS+  Q+ ELV   
Sbjct  118   AFLYFLSYIYTGRLKPFPLEVSTCVDPVCAHDSCRPAIDFVVQLMYASSVLQVPELVSSF  177

Query  1367  QRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISSD  1188
             QR L   V+   +E+V+PIL+V F C L  L+++C+ RV  S+L  F +E E+P  ++  
Sbjct  178   QRRLCNFVEKTLVENVLPILMVAFNCKLTQLLDQCIERVARSDLYRFCIEKEVPSEVAEK  237

Query  1187  IKARRLNQQGANE----------KKIRKILRALDCNDVELVKLLLEESDITLDDayavhy  1038
             IK  RL      E          ++I KIL+ALD +DVELVKLLL ESDITLD A  +HY
Sbjct  238   IKQLRLMSPQDEETSPKISEKLLERISKILKALDSDDVELVKLLLTESDITLDQANGLHY  297

Query  1037  aaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDATC  858
             +  Y + KVV E+L L   D+N RN+RGYTVLH AA R++P+II++++D+ GA+  + T 
Sbjct  298   SVVYSDPKVVAEILALDMGDVNFRNSRGYTVLHFAAMRREPSIIISLIDE-GANASEFT-  355

Query  857   SNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVSLPS---STTL  687
             S+G +AV I RR T PKDY+  T +G E +  RLCID+LE   +  NP+ L +   S ++
Sbjct  356   SDGRSAVNILRRLTNPKDYHTKTAKGRESSKARLCIDILER-EIRKNPMVLDTPMCSLSM  414

Query  686   ENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGL-SGMEGLCGNLKGVGL  510
               DL M L +LE RV LA+  +P EA++ M+I + + T EF GL     GL GNL  V L
Sbjct  415   PEDLQMRLMYLEKRVGLAQLFFPTEAKVAMDIGNVEGTSEFTGLPPPSNGLTGNLNQVDL  474

Query  509   TGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTA----DDVLDSLESLESGTP  342
                P  Q KRL+ R EAL KTV+ GRRFF   S VLD+  A    +D+LD L   E G+ 
Sbjct  475   NETPDMQTKRLLTRMEALMKTVDTGRRFFPYGSAVLDRYMAEYIDEDILDDLR-FEKGST  533

Query  341   EEQTNKKRRYMELKEEVMKAFDKD  270
              E+  K+ RY ELK++V KA+ KD
Sbjct  534   HERRLKRMRYRELKDDVQKAYSKD  557



>gb|KEH37013.1| regulatory protein NPR1 [Medicago truncatula]
Length=509

 Score =   399 bits (1024),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 240/443 (54%), Positives = 307/443 (69%), Gaps = 19/443 (4%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdgkp----KFLMTELVPCGWV  1557
             DY DADI VEGI V ++R IL +RS+FFHE FK++K     K     K+ +++L+P G V
Sbjct  62    DYGDADIIVEGIPVRIHRCILGSRSKFFHEIFKRSKDKGLSKNEGRLKYCLSDLLPYGKV  121

Query  1556  GYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELV  1377
             GYEAF++FL+YVY+GK K SP EVSTCVD  C H AC PAI++AV+LMYAS+ FQI ELV
Sbjct  122   GYEAFLIFLSYVYSGKLKPSPMEVSTCVDNVCAHDACGPAINFAVELMYASSIFQIPELV  181

Query  1376  MLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAI  1197
              L QR L   V  A +EDVI IL+  F C L  L  +CV RV  S+LD  ++E ELP  +
Sbjct  182   SLFQRRLLNFVGKALVEDVISILMASFHCQLNQLAAQCVDRVARSDLDQISIEKELPHEL  241

Query  1196  SSDIKA--RRLNQQGANE---------KKIRKILRALDCNDVELVKLLLEESDITLDDay  1050
             S  +K   R L+Q   N+         K+I +I +ALD +DVELVKLLL ESDITLD+A 
Sbjct  242   SEKVKLLRRDLHQNDENDAPVVDTLSLKRITRIHKALDSDDVELVKLLLNESDITLDEAG  301

Query  1049  avhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIR  870
             A+HYA A+C+ KVV+EVLGLG  ++NLRN+RGYTVLH+AA RK+P+IIV++L K GA   
Sbjct  302   ALHYAVAHCDPKVVSEVLGLGLANVNLRNSRGYTVLHIAAMRKEPSIIVSLLTK-GACAS  360

Query  869   DATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVSLP--SS  696
             D T  +G +AV+ICRR TRPKDY+  TE+G+E N DR+CIDVLE  M      + P  SS
Sbjct  361   DLTF-DGQSAVSICRRLTRPKDYHTKTEQGKETNKDRICIDVLEREMRRNPLATDPSVSS  419

Query  695   TTLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGV  516
              T+ +DL M+L +LENRVA AR  +P EA++ M+IA A++T EF GLS  +G  GNL+ V
Sbjct  420   HTVADDLHMKLLYLENRVAFARLFFPLEAKLAMDIARAETTSEFAGLSASKGSNGNLREV  479

Query  515   GLTGLPPDQVKRLMERREALKKT  447
              L   P  Q KRL+ R EAL KT
Sbjct  480   DLNETPIMQNKRLISRMEALMKT  502



>ref|XP_004970097.1| PREDICTED: regulatory protein NPR3-like [Setaria italica]
Length=629

 Score =   402 bits (1034),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 255/533 (48%), Positives = 338/533 (63%), Gaps = 47/533 (9%)
 Frame = -2

Query  1724  DYNDADIEVE--GILVGVNRGILAARSQFFHEEFkkakkdcdgkpK--------------  1593
             D +DADIEV   G  V V+R ILA RS FF++ F    +    +                
Sbjct  79    DCSDADIEVPDGGPPVPVHRCILAVRSPFFYDIFAARGRGGAARGDAAAGARGAGEGAAS  138

Query  1592  ----FLMTELVPCGWVGYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYA  1425
                 + M ELVP G VG EAF  FL Y+YTGK + +P +V +C D  C H +C PAI +A
Sbjct  139   GRPRYKMEELVPGGRVGREAFQAFLGYLYTGKLRPAPLDVVSCADPVCPHDSCPPAIRFA  198

Query  1424  VQLMYASATFQIKELVMLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTS  1245
             V+LMYA+ TF+I EL+ L QR L   VD   +EDVIPIL V     L  ++++C++R+  
Sbjct  199   VELMYAAWTFKIPELISLFQRRLLNFVDKTLVEDVIPILQVASHSELTQVLDKCIQRIAR  258

Query  1244  SNLDNFTLENELPGAISSDIKARRLNQQGAN----------EKKIRKILRALDCNDVELV  1095
             SNLD+ +L+ EL   +  +IK  R   Q A+          EK++R+I RALD +DVELV
Sbjct  259   SNLDDISLDKELSPEVVEEIKKIRKKLQTADDDASISDPVHEKRVRRIHRALDSDDVELV  318

Query  1094  KLLLEESDITLDDayavhyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDP  915
             KLLL ES+ITLDDA A+HYAA+YC+SKVV+E+L LG  +LNL+N+RGYT LH+AA R++P
Sbjct  319   KLLLNESEITLDDANALHYAASYCDSKVVSELLELGLANLNLKNSRGYTALHLAAMRREP  378

Query  914   AIIVAILDKSGASIRDATCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEG  735
             AII+ +L+K GA++   T ++G +A+ ICRR TR KDYN   E+G+E N DRLCID+LE 
Sbjct  379   AIIMCLLNK-GATVSQLT-ADGRSAIGICRRLTRAKDYNTKMEQGQESNKDRLCIDILER  436

Query  734   VMMNGNPVSLPSSTT---LENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEF  564
              MM  NP+S+  + T   L +DL M+L +LENRVALA   +P EA++ M+IA AD+T EF
Sbjct  437   EMMR-NPMSVEDAVTSPLLADDLHMKLLYLENRVALAILFFPAEAKVAMQIAQADTTEEF  495

Query  563   VGLSG----MEGLCGNLKGVGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLD-  399
              G++          G L+ V L   P  Q KRL  R +AL KTVELGRR+F NCS VLD 
Sbjct  496   GGITAPGTTAPSTSGKLREVDLNETPAIQNKRLRSRVDALMKTVELGRRYFPNCSQVLDK  555

Query  398   ----KLTADDVLDSLES--LESGTPEEQTNKKRRYMELKEEVMKAFDKDMAQN  258
                 K    D+ D L+   L+ GTP+EQ  K+ R+ ELKE+V KAF KD A N
Sbjct  556   YLEYKYLEYDLPDGLDQFYLQRGTPDEQKVKRMRFCELKEDVRKAFTKDKADN  608



>emb|CDX78955.1| BnaA01g10220D [Brassica napus]
Length=588

 Score =   401 bits (1030),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 246/507 (49%), Positives = 325/507 (64%), Gaps = 25/507 (5%)
 Frame = -2

Query  1724  DYNDADIEVEGIL--VGVNRGILAARSQFFHEEFkka--kkdcdgkpKFLMTELVPCGWV  1557
             DY DA+I  EG    VGV+R +LAARS+FF + FKK    ++   KPK+ + +L+P G V
Sbjct  58    DYTDAEITFEGETRAVGVHRCLLAARSKFFLDLFKKDRGSEEEKKKPKYHIKDLLPHGHV  117

Query  1556  GYEAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELV  1377
             G EAF+ FLNY+YTGK K  P EVSTCVD  C H +C+PAID+AV+LMYAS TF+I ELV
Sbjct  118   GREAFLHFLNYIYTGKLKPFPVEVSTCVDTGCVHDSCKPAIDFAVELMYASYTFKITELV  177

Query  1376  MLIQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAI  1197
                QR L   V+ + +E+V+PILLV F C L  L+++C+ RV  S+LD F +E ELP  +
Sbjct  178   SSFQRRLCNYVEKSLVENVLPILLVAFHCDLTQLLDQCIERVARSDLDRFYIEKELPLEV  237

Query  1196  SSDIKARRLNQQGANE------KKIRKILRALDCNDVELVKLLLEESDITLDDayavhya  1035
             S  IK  R+     +E      ++  K+L+ALD +DVELVKLLL ESD TLD A  +HY 
Sbjct  238   SEKIKKLRVKSMNTDEVADKLIERTGKVLKALDSDDVELVKLLLTESDTTLDQANGLHYV  297

Query  1034  aaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDATCS  855
              AY + KVV EVL L   D+N RN+RGYTVLH AA R++P+II+++L K GA+  D T  
Sbjct  298   VAYSDPKVVAEVLALDMADVNYRNSRGYTVLHYAAMRREPSIIISLL-KKGANASDFTF-  355

Query  854   NGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLE-----GVMMNGNPVSLPSSTT  690
             +G +AV ICRR TRPKDY     +G+E + DRLCID+LE       + +G   +   S +
Sbjct  356   DGRSAVNICRRMTRPKDYYTKNAKGDEASKDRLCIDILEREIRRNPLASGGGDAPTCSHS  415

Query  689   LENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGL---SGMEGLCGNLKG  519
             +  DL M L +LE RV LA+  +P EA + M+IA+ + T EF G        G  GNL  
Sbjct  416   MPEDLQMRLLYLEKRVGLAQLFFPTEADVAMDIANVEGTSEFTGFPVPPPSNGATGNLTQ  475

Query  518   VGLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDS----LESLES  351
             V L   P  Q KRL+ R EAL KTVE GRR+F +CS+VLDK   DD +D     +   E 
Sbjct  476   VDLNETPYMQTKRLLTRMEALMKTVETGRRYFPSCSEVLDKYM-DDYMDEDIPDMSHPER  534

Query  350   GTPEEQTNKKRRYMELKEEVMKAFDKD  270
             G+ +E+  K+ RY ELK +V KA++KD
Sbjct  535   GSVKERRWKRMRYKELKNDVKKAYNKD  561



>ref|XP_006853358.1| hypothetical protein AMTR_s00032p00112510 [Amborella trichopoda]
 gb|ERN14825.1| hypothetical protein AMTR_s00032p00112510 [Amborella trichopoda]
Length=595

 Score =   401 bits (1030),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 239/500 (48%), Positives = 330/500 (66%), Gaps = 17/500 (3%)
 Frame = -2

Query  1730  YEDYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdgkpKFLMTELVPCGWVGY  1551
             Y  ++DA+IEVEG+ +GV+R ILAARS  F E F + KK       + + ELVP G VGY
Sbjct  71    YNGFSDAEIEVEGVPIGVHRCILAARSSVFREVFSREKKHEGKPK-YSIEELVPSGKVGY  129

Query  1550  EAFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVML  1371
             EAF + LNY+YTG+ K++PPEVSTCV++ C H  CRPA+D+AV+++ ASA FQI+EL  +
Sbjct  130   EAFRIVLNYLYTGRLKSAPPEVSTCVEKVCAHDDCRPAVDFAVEVVRASAVFQIQELGSV  189

Query  1370  IQRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISS  1191
              QR L   V+ A +EDVIPILLV   C L+PL   C++R+  S+LD+ +LE      I  
Sbjct  190   WQRRLLSYVEKAQVEDVIPILLVASSCHLSPLDTHCIQRMARSDLDDISLEKSFSREIVE  249

Query  1190  DIKARRLNQQGANE-----------KKIRKILRALDCNDVELVKLLLEESDITLDDayav  1044
             +I + RL  +  +E           K  ++I +ALD +D+ELVK+LL E + TLDDA A+
Sbjct  250   EILSLRLKSRIDDEPLSPKKDPLQLKNFKRIHKALDSDDLELVKMLLMEGNTTLDDAEAL  309

Query  1043  hyaaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDA  864
             HYAAAYC+SKVV E+L LG  D+N RN+RGYTVLHVAA R++PA++VA+L K   +    
Sbjct  310   HYAAAYCDSKVVAELLELGGADVNKRNSRGYTVLHVAAMRQEPAVLVALLSKEARACE--  367

Query  863   TCSNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLEGVMMNGNPVSLPSSTTL-  687
               S+G +   ICRR T PKDYN  TE+G+E   +++CID+LE        V   S++ + 
Sbjct  368   LTSDGRSGARICRRLTTPKDYNTHTEQGQESRKEKMCIDILEREERRNPLVENVSASAMV  427

Query  686   -ENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGLSGMEGLCGNLKGVGL  510
                +L M+L +LENRVA AR L+P EA++ M+ A A +T EF G S      G L  V L
Sbjct  428   SPEELHMKLLYLENRVAFARVLFPTEAKLAMDNAQAGATTEFAGHSPSTSSRGTLGPVDL  487

Query  509   TGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTADDVLDSLESLESGTPEEQT  330
                P   +K++  R  AL++TV++GRR+F +CS+VLDKL  DD+ D L  LE+GT EEQ 
Sbjct  488   NETPTSVIKKMYSRMAALQRTVDMGRRYFPHCSEVLDKLMEDDMSDLL-FLENGTLEEQR  546

Query  329   NKKRRYMELKEEVMKAFDKD  270
              K++R+ E+K++V KAF KD
Sbjct  547   VKRQRFNEVKDDVQKAFTKD  566



>ref|XP_006398160.1| hypothetical protein EUTSA_v10000824mg [Eutrema salsugineum]
 gb|ESQ39613.1| hypothetical protein EUTSA_v10000824mg [Eutrema salsugineum]
Length=588

 Score =   400 bits (1029),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 245/506 (48%), Positives = 329/506 (65%), Gaps = 27/506 (5%)
 Frame = -2

Query  1724  DYNDADIEVEGILVGVNRGILAARSQFFHEEFkkakkdcdgkp-KFLMTELVPCGWVGYE  1548
             DY DA+I V+G+ VGV+R ILAARS+FF E FKK KK    +  K+ + EL P G VG+E
Sbjct  58    DYTDAEIIVDGVPVGVHRCILAARSKFFLELFKKEKKSSKLEKPKYHLKELFPYGAVGHE  117

Query  1547  AFMVFLNYVYTGKTKASPPEVSTCVDESCDHYACRPAIDYAVQLMYASATFQIKELVMLI  1368
             AF+ FL+Y+YTG+ K  P EVSTCVD  C H +CRPAID+ V+L+YAS+  QI ELV   
Sbjct  118   AFLYFLSYIYTGRLKPFPLEVSTCVDSVCAHDSCRPAIDFVVELLYASSVLQIPELVSSF  177

Query  1367  QRHLDWLVDIAAIEDVIPILLVGFRCSLAPLVERCVRRVTSSNLDNFTLENELPGAISSD  1188
             QR L   V+ + +E+V+PILLV F C L  L+++C+ RV  S+L  F +E E+P  ++  
Sbjct  178   QRRLCNFVEKSLVENVLPILLVAFNCKLTQLLDQCIERVARSDLYRFCIEKEVPLEVAER  237

Query  1187  IKARRL-------NQQGANEK---KIRKILRALDCNDVELVKLLLEESDITLDDayavhy  1038
             IK  RL       N    ++K   +I KIL+ALD +D+ELVKLLL ESDITLD A  +HY
Sbjct  238   IKQIRLKSPRDEDNTLKVSDKMVERIGKILKALDSDDIELVKLLLTESDITLDQANGLHY  297

Query  1037  aaaYCNSKVVNEVLGLGKVDLNLRNARGYTVLHVAARRKDPAIIVAILDKSGASIRDATC  858
             +  Y + KVV E+L L   D+N RN+RGYTVLH+AA R++P+II+++L K GA+  D TC
Sbjct  298   SVVYSDPKVVAEILTLDMGDVNYRNSRGYTVLHLAAMRREPSIIISLL-KKGANASDFTC  356

Query  857   SNGHTAVTICRRSTRPKDYnktteegeeknNDRLCIDVLE-----GVMMNGNPVSLPSST  693
              +G +AV ICRR T PKDY+    +G E +  RLCID+LE       M+   P+    S 
Sbjct  357   -DGRSAVNICRRLTTPKDYHTKAAKGREASKARLCIDLLEREIRRNPMVADTPM---CSL  412

Query  692   TLENDLVMELYFLENRVALARRLYPREARINMEIAHADSTLEFVGL-SGMEGLCGNLKGV  516
             ++  DL M L +LE RV LA+  +P EA++ M+IA+ + T EF GL     GL GNL  V
Sbjct  413   SMPEDLQMRLLYLEKRVGLAQLFFPTEAKVAMDIANVEGTSEFTGLPPPSNGLSGNLSQV  472

Query  515   GLTGLPPDQVKRLMERREALKKTVELGRRFFRNCSDVLDKLTA----DDVLDSLESLESG  348
              L   P  Q KRL+ R EAL KTVE GRR+F   S+VLDK       +D+LD +  +  G
Sbjct  473   DLNETPHMQTKRLLTRMEALMKTVETGRRYFPYGSEVLDKYMEEYIDEDLLDDVH-IAKG  531

Query  347   TPEEQTNKKRRYMELKEEVMKAFDKD  270
             +P+E+  K+ RY ELK++V KA+ KD
Sbjct  532   SPQERRLKRMRYRELKDDVQKAYSKD  557



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 12717125127042