BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24198_g3_i1 len=703 path=[4769:0-561 5331:562-586 3699:587-615
3728:616-702]

Length=703
                                                                      Score     E

ref|XP_009764318.1|  PREDICTED: BTB/POZ domain-containing protein...    373   2e-122   
ref|XP_011088062.1|  PREDICTED: BTB/POZ domain-containing protein...    372   5e-122   
ref|XP_004230705.1|  PREDICTED: BTB/POZ domain-containing protein...    370   4e-121   
ref|XP_009625190.1|  PREDICTED: BTB/POZ domain-containing protein...    368   1e-120   
ref|XP_006346315.1|  PREDICTED: BTB/POZ domain-containing protein...    367   5e-120   
gb|EYU37575.1|  hypothetical protein MIMGU_mgv1a002858mg                364   6e-119   
ref|XP_006353967.1|  PREDICTED: BTB/POZ domain-containing protein...    358   5e-117   
emb|CDO97269.1|  unnamed protein product                                356   8e-116   
ref|XP_009626485.1|  PREDICTED: BTB/POZ domain-containing protein...    352   2e-114   
gb|KDO57872.1|  hypothetical protein CISIN_1g007080mg                   352   4e-114   
ref|XP_009347119.1|  PREDICTED: BTB/POZ domain-containing protein...    352   4e-114   
ref|XP_006486926.1|  PREDICTED: BTB/POZ domain-containing protein...    351   4e-114   
ref|XP_008366255.1|  PREDICTED: BTB/POZ domain-containing protein...    351   6e-114   
ref|XP_004248766.1|  PREDICTED: BTB/POZ domain-containing protein...    351   7e-114   
ref|XP_008236444.1|  PREDICTED: BTB/POZ domain-containing protein...    351   7e-114   
ref|XP_002525260.1|  signal transducer, putative                        347   9e-114   Ricinus communis
ref|XP_007201732.1|  hypothetical protein PRUPE_ppa002913mg             351   9e-114   
ref|XP_010272331.1|  PREDICTED: BTB/POZ domain-containing protein...    351   9e-114   
ref|XP_002264153.1|  PREDICTED: BTB/POZ domain-containing protein...    350   1e-113   Vitis vinifera
gb|KHG02234.1|  BTB/POZ domain-containing NPY2 -like protein            350   2e-113   
ref|XP_006422840.1|  hypothetical protein CICLE_v10028033mg             350   2e-113   
ref|XP_004511848.1|  PREDICTED: BTB/POZ domain-containing protein...    349   4e-113   
ref|XP_010277066.1|  PREDICTED: BTB/POZ domain-containing protein...    349   4e-113   
ref|XP_007042621.1|  Phototropic-responsive NPH3 family protein i...    348   9e-113   
ref|XP_002313906.1|  phototropic-responsive NPH3 family protein         348   9e-113   Populus trichocarpa [western balsam poplar]
ref|XP_007042620.1|  Phototropic-responsive NPH3 family protein i...    348   9e-113   
gb|KHG12565.1|  BTB/POZ domain-containing NPY2 -like protein            347   1e-112   
ref|XP_007143108.1|  hypothetical protein PHAVU_007G044300g             346   4e-112   
ref|XP_003555987.1|  PREDICTED: BTB/POZ domain-containing protein...    346   6e-112   
gb|KHN42319.1|  BTB/POZ domain-containing protein NPY2                  346   7e-112   
ref|XP_009776135.1|  PREDICTED: BTB/POZ domain-containing protein...    345   8e-112   
ref|XP_007047500.1|  Phototropic-responsive NPH3 family protein i...    345   9e-112   
ref|XP_008346361.1|  PREDICTED: BTB/POZ domain-containing protein...    345   2e-111   
ref|XP_011092513.1|  PREDICTED: BTB/POZ domain-containing protein...    345   2e-111   
ref|XP_006579940.1|  PREDICTED: BTB/POZ domain-containing protein...    344   4e-111   
ref|XP_003536583.1|  PREDICTED: BTB/POZ domain-containing protein...    343   6e-111   
ref|XP_007155836.1|  hypothetical protein PHAVU_003G235700g             343   6e-111   
ref|XP_010086948.1|  BTB/POZ domain-containing protein NPY2             343   6e-111   
ref|XP_011001843.1|  PREDICTED: BTB/POZ domain-containing protein...    343   6e-111   
ref|XP_006426078.1|  hypothetical protein CICLE_v10027450mg             343   9e-111   
gb|KHN23238.1|  BTB/POZ domain-containing protein NPY2                  343   1e-110   
gb|KDO78947.1|  hypothetical protein CISIN_1g041399mg                   343   1e-110   
ref|XP_008440372.1|  PREDICTED: BTB/POZ domain-containing protein...    343   1e-110   
ref|XP_004152268.1|  PREDICTED: BTB/POZ domain-containing protein...    343   1e-110   
ref|XP_003550011.1|  PREDICTED: BTB/POZ domain-containing protein...    343   1e-110   
gb|KHF97345.1|  BTB/POZ domain-containing NPY5 -like protein            340   1e-110   
ref|XP_006466475.1|  PREDICTED: BTB/POZ domain-containing protein...    342   2e-110   
gb|KDP32062.1|  hypothetical protein JCGZ_12523                         342   3e-110   
emb|CBI33702.3|  unnamed protein product                                340   3e-110   
ref|XP_011030353.1|  PREDICTED: BTB/POZ domain-containing protein...    341   5e-110   
gb|KHN06014.1|  BTB/POZ domain-containing protein NPY2                  341   6e-110   
ref|XP_004496882.1|  PREDICTED: BTB/POZ domain-containing protein...    340   6e-110   
ref|XP_004156852.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    341   6e-110   
ref|XP_011092512.1|  PREDICTED: BTB/POZ domain-containing protein...    340   1e-109   
ref|XP_003611607.1|  BTB/POZ domain-containing protein                  340   1e-109   
ref|XP_002284345.1|  PREDICTED: BTB/POZ domain-containing protein...    340   1e-109   Vitis vinifera
ref|XP_004289798.1|  PREDICTED: BTB/POZ domain-containing protein...    340   1e-109   
ref|XP_004141870.1|  PREDICTED: BTB/POZ domain-containing protein...    340   2e-109   
ref|XP_006579937.1|  PREDICTED: BTB/POZ domain-containing protein...    339   3e-109   
ref|XP_008454387.1|  PREDICTED: BTB/POZ domain-containing protein...    338   4e-109   
ref|XP_002300262.2|  hypothetical protein POPTR_0001s30270g             337   8e-109   Populus trichocarpa [western balsam poplar]
ref|XP_009335385.1|  PREDICTED: BTB/POZ domain-containing protein...    338   9e-109   
ref|XP_010907392.1|  PREDICTED: BTB/POZ domain-containing protein...    337   3e-108   
ref|XP_008792560.1|  PREDICTED: BTB/POZ domain-containing protein...    335   1e-107   
ref|XP_009772494.1|  PREDICTED: BTB/POZ domain-containing protein...    335   1e-107   
ref|XP_003592479.1|  BTB/POZ domain-containing protein                  334   2e-107   
ref|XP_002464238.1|  hypothetical protein SORBIDRAFT_01g014760          335   2e-107   Sorghum bicolor [broomcorn]
ref|XP_006600918.1|  PREDICTED: BTB/POZ domain-containing protein...    334   2e-107   
ref|XP_009631537.1|  PREDICTED: BTB/POZ domain-containing protein...    334   4e-107   
ref|XP_004982439.1|  PREDICTED: BTB/POZ domain-containing protein...    333   7e-107   
ref|XP_009388923.1|  PREDICTED: BTB/POZ domain-containing protein...    333   8e-107   
ref|XP_008341028.1|  PREDICTED: BTB/POZ domain-containing protein...    333   1e-106   
ref|XP_004288238.1|  PREDICTED: BTB/POZ domain-containing protein...    332   1e-106   
ref|XP_006339807.1|  PREDICTED: BTB/POZ domain-containing protein...    332   1e-106   
ref|XP_006339810.1|  PREDICTED: BTB/POZ domain-containing protein...    332   2e-106   
ref|XP_004231915.1|  PREDICTED: BTB/POZ domain-containing protein...    332   2e-106   
gb|KHG04716.1|  BTB/POZ domain-containing NPY2 -like protein            332   2e-106   
emb|CDP02592.1|  unnamed protein product                                332   2e-106   
ref|XP_010099608.1|  BTB/POZ domain-containing protein NPY2             331   3e-106   
ref|XP_009629742.1|  PREDICTED: BTB/POZ domain-containing protein...    331   4e-106   
ref|XP_010065907.1|  PREDICTED: BTB/POZ domain-containing protein...    331   4e-106   
tpg|DAA50449.1|  TPA: putative phototropic-responsive NPH3 family...    322   8e-106   
ref|XP_010687361.1|  PREDICTED: BTB/POZ domain-containing protein...    330   1e-105   
ref|XP_010687360.1|  PREDICTED: BTB/POZ domain-containing protein...    330   1e-105   
ref|XP_008787168.1|  PREDICTED: BTB/POZ domain-containing protein...    329   2e-105   
ref|XP_007204979.1|  hypothetical protein PRUPE_ppa002844mg             329   2e-105   
ref|XP_010687359.1|  PREDICTED: BTB/POZ domain-containing protein...    330   3e-105   
ref|XP_009776107.1|  PREDICTED: BTB/POZ domain-containing protein...    328   5e-105   
ref|XP_010070650.1|  PREDICTED: BTB/POZ domain-containing protein...    328   5e-105   
ref|XP_011011590.1|  PREDICTED: BTB/POZ domain-containing protein...    328   6e-105   
ref|XP_002306504.2|  hypothetical protein POPTR_0005s19010g             328   9e-105   Populus trichocarpa [western balsam poplar]
ref|XP_008238083.1|  PREDICTED: BTB/POZ domain-containing protein...    325   6e-104   
ref|XP_002527501.1|  signal transducer, putative                        325   6e-104   Ricinus communis
ref|NP_001067147.1|  Os12g0583500                                       325   7e-104   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ21022.1|  hypothetical protein OsJ_36671                          325   8e-104   Oryza sativa Japonica Group [Japonica rice]
gb|EAY83679.1|  hypothetical protein OsI_38903                          325   8e-104   Oryza sativa Indica Group [Indian rice]
ref|XP_010942827.1|  PREDICTED: BTB/POZ domain-containing protein...    325   8e-104   
gb|EMT18058.1|  Coleoptile phototropism protein 1                       328   1e-103   
ref|XP_010679621.1|  PREDICTED: BTB/POZ domain-containing protein...    325   1e-103   
ref|NP_001146578.1|  uncharacterized protein LOC100280174               325   1e-103   Zea mays [maize]
ref|XP_008777297.1|  PREDICTED: BTB/POZ domain-containing protein...    323   3e-103   
ref|XP_010939136.1|  PREDICTED: BTB/POZ domain-containing protein...    322   7e-103   
gb|KDP44480.1|  hypothetical protein JCGZ_16313                         322   7e-103   
ref|XP_006664149.1|  PREDICTED: BTB/POZ domain-containing protein...    323   8e-103   
ref|NP_001278721.1|  putative phototropic-resoponsive NPH3 family...    323   9e-103   
ref|XP_009379321.1|  PREDICTED: BTB/POZ domain-containing protein...    322   1e-102   
gb|ADL36611.1|  BZIP domain class transcription factor                  322   1e-102   
ref|XP_011099362.1|  PREDICTED: BTB/POZ domain-containing protein...    321   2e-102   
ref|XP_008338429.1|  PREDICTED: BTB/POZ domain-containing protein...    320   1e-101   
ref|XP_008352545.1|  PREDICTED: BTB/POZ domain-containing protein...    319   1e-101   
ref|XP_011073694.1|  PREDICTED: BTB/POZ domain-containing protein...    319   1e-101   
dbj|BAJ87350.1|  predicted protein                                      319   2e-101   
ref|XP_010530706.1|  PREDICTED: BTB/POZ domain-containing protein...    318   4e-101   
gb|EMT08606.1|  Coleoptile phototropism protein 1                       318   5e-101   
ref|XP_003578395.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    318   7e-101   
ref|XP_006650278.1|  PREDICTED: BTB/POZ domain-containing protein...    318   8e-101   
ref|XP_004234653.1|  PREDICTED: BTB/POZ domain-containing protein...    316   3e-100   
ref|XP_006343206.1|  PREDICTED: BTB/POZ domain-containing protein...    316   3e-100   
ref|XP_009396038.1|  PREDICTED: BTB/POZ domain-containing protein...    313   1e-99    
emb|CDY29566.1|  BnaA03g54110D                                          313   1e-99    
gb|EMS51026.1|  Root phototropism protein 3                             313   2e-99    
ref|XP_002468311.1|  hypothetical protein SORBIDRAFT_01g043540          313   3e-99    Sorghum bicolor [broomcorn]
ref|XP_004985278.1|  PREDICTED: BTB/POZ domain-containing protein...    313   3e-99    
ref|XP_007042623.1|  Phototropic-responsive NPH3 family protein i...    307   4e-99    
emb|CAN66911.1|  hypothetical protein VITISV_035422                     313   4e-99    Vitis vinifera
gb|EMT10822.1|  Root phototropism protein 3                             312   5e-99    
ref|XP_010232704.1|  PREDICTED: BTB/POZ domain-containing protein...    313   5e-99    
ref|XP_010548457.1|  PREDICTED: BTB/POZ domain-containing protein...    311   5e-99    
ref|XP_010232705.1|  PREDICTED: BTB/POZ domain-containing protein...    312   5e-99    
ref|XP_004963018.1|  PREDICTED: BTB/POZ domain-containing protein...    313   5e-99    
ref|XP_006282580.1|  hypothetical protein CARUB_v10004449mg             311   6e-99    
gb|EAY90980.1|  hypothetical protein OsI_12589                          313   6e-99    Oryza sativa Indica Group [Indian rice]
ref|XP_010275834.1|  PREDICTED: BTB/POZ domain-containing protein...    312   8e-99    
ref|NP_001146294.1|  uncharacterized protein LOC100279869               312   1e-98    Zea mays [maize]
ref|XP_004963017.1|  PREDICTED: BTB/POZ domain-containing protein...    313   1e-98    
ref|XP_009138500.1|  PREDICTED: BTB/POZ domain-containing protein...    310   2e-98    
ref|NP_001146461.1|  putative phototropic-responsive NPH3 family ...    311   2e-98    Zea mays [maize]
ref|XP_010526711.1|  PREDICTED: BTB/POZ domain-containing protein...    309   3e-98    
ref|NP_001050649.1|  Os03g0609800                                       311   3e-98    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001151545.1|  transposon protein Mutator sub-class               310   5e-98    Zea mays [maize]
ref|XP_002443443.1|  hypothetical protein SORBIDRAFT_08g019560          311   7e-98    Sorghum bicolor [broomcorn]
emb|CDY37223.1|  BnaA09g08440D                                          309   9e-98    
ref|XP_009123215.1|  PREDICTED: BTB/POZ domain-containing protein...    309   1e-97    
ref|XP_006411871.1|  hypothetical protein EUTSA_v10024767mg             308   1e-97    
emb|CDX72639.1|  BnaC07g46610D                                          308   1e-97    
gb|EYU29635.1|  hypothetical protein MIMGU_mgv1a003178mg                308   2e-97    
ref|XP_008679715.1|  PREDICTED: transposon protein Mutator sub-cl...    308   2e-97    
emb|CDX81462.1|  BnaC09g08730D                                          307   3e-97    
ref|XP_010432046.1|  PREDICTED: BTB/POZ domain-containing protein...    306   3e-97    
ref|XP_010437207.1|  PREDICTED: BTB/POZ domain-containing protein...    306   4e-97    
ref|NP_568030.1|  protein NAKED PINS IN YUC MUTANTS 5                   306   4e-97    Arabidopsis thaliana [mouse-ear cress]
dbj|BAF02155.1|  hypothetical protein                                   306   5e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009411058.1|  PREDICTED: BTB/POZ domain-containing protein...    307   5e-97    
ref|XP_010446647.1|  PREDICTED: BTB/POZ domain-containing protein...    306   7e-97    
emb|CBI21142.3|  unnamed protein product                                306   7e-97    
ref|XP_002285522.2|  PREDICTED: BTB/POZ domain-containing protein...    306   1e-96    Vitis vinifera
emb|CDP07841.1|  unnamed protein product                                306   1e-96    
ref|XP_010547549.1|  PREDICTED: BTB/POZ domain-containing protein...    305   1e-96    
gb|AAK96859.1|  putative protein                                        305   2e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003558549.1|  PREDICTED: BTB/POZ domain-containing protein...    305   2e-96    
gb|ABF94545.1|  transposon protein, putative, Mutator sub-class, ...    301   2e-96    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009399110.1|  PREDICTED: BTB/POZ domain-containing protein...    305   4e-96    
ref|XP_006280223.1|  hypothetical protein CARUB_v10026140mg             304   5e-96    
ref|XP_006409633.1|  hypothetical protein EUTSA_v10023006mg             305   6e-96    
ref|XP_009421103.1|  PREDICTED: BTB/POZ domain-containing protein...    303   1e-95    
ref|XP_009604823.1|  PREDICTED: BTB/POZ domain-containing protein...    302   4e-95    
gb|EEC74723.1|  hypothetical protein OsI_10448                          302   4e-95    Oryza sativa Indica Group [Indian rice]
ref|NP_001049315.2|  Os03g0205700                                       302   5e-95    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010467261.1|  PREDICTED: BTB/POZ domain-containing protein...    302   7e-95    
ref|XP_003550246.1|  PREDICTED: BTB/POZ domain-containing protein...    300   2e-94    
ref|XP_008794358.1|  PREDICTED: BTB/POZ domain-containing protein...    300   2e-94    
ref|XP_010467259.1|  PREDICTED: BTB/POZ domain-containing protein...    303   3e-94    
ref|XP_006297197.1|  hypothetical protein CARUB_v10013204mg             300   3e-94    
gb|KDO67444.1|  hypothetical protein CISIN_1g007148mg                   295   3e-94    
ref|XP_002324913.2|  hypothetical protein POPTR_0018s02590g             299   4e-94    Populus trichocarpa [western balsam poplar]
ref|XP_007222020.1|  hypothetical protein PRUPE_ppa002969mg             299   6e-94    
ref|XP_010464031.1|  PREDICTED: BTB/POZ domain-containing protein...    298   7e-94    
gb|KHN37088.1|  BTB/POZ domain-containing protein NPY1                  299   7e-94    
ref|XP_002515424.1|  protein binding protein, putative                  299   1e-93    Ricinus communis
ref|XP_010484495.1|  PREDICTED: BTB/POZ domain-containing protein...    298   1e-93    
ref|XP_003588859.1|  BTB/POZ domain-containing protein                  298   2e-93    
ref|XP_009390548.1|  PREDICTED: BTB/POZ domain-containing protein...    297   2e-93    
emb|CDY44035.1|  BnaA08g15710D                                          296   3e-93    
ref|XP_010265570.1|  PREDICTED: BTB/POZ domain-containing protein...    297   3e-93    
ref|XP_010488917.1|  PREDICTED: BTB/POZ domain-containing protein...    298   3e-93    
ref|XP_009109382.1|  PREDICTED: BTB/POZ domain-containing protein...    296   4e-93    
ref|XP_010444645.1|  PREDICTED: BTB/POZ domain-containing protein...    296   4e-93    
ref|XP_006600919.1|  PREDICTED: BTB/POZ domain-containing protein...    297   4e-93    
ref|XP_007161085.1|  hypothetical protein PHAVU_001G041700g             297   5e-93    
ref|XP_007011711.1|  Phototropic-responsive NPH3 family protein i...    296   7e-93    
ref|XP_011036689.1|  PREDICTED: BTB/POZ domain-containing protein...    296   1e-92    
ref|XP_006450279.1|  hypothetical protein CICLE_v10007764mg             296   1e-92    
ref|XP_004498809.1|  PREDICTED: BTB/POZ domain-containing protein...    295   2e-92    
ref|XP_007011710.1|  Phototropic-responsive NPH3 family protein i...    296   2e-92    
ref|XP_009797504.1|  PREDICTED: BTB/POZ domain-containing protein...    295   2e-92    
ref|XP_009629746.1|  PREDICTED: BTB/POZ domain-containing protein...    295   2e-92    
ref|XP_004244531.1|  PREDICTED: BTB/POZ domain-containing protein...    295   2e-92    
ref|XP_010929164.1|  PREDICTED: BTB/POZ domain-containing protein...    295   3e-92    
ref|XP_010670801.1|  PREDICTED: BTB/POZ domain-containing protein...    295   3e-92    
ref|NP_179089.1|  BTB/POZ domain-containing protein NPY2                295   3e-92    Arabidopsis thaliana [mouse-ear cress]
emb|CDX81314.1|  BnaC09g07250D                                          292   4e-92    
gb|KHG11360.1|  BTB/POZ domain-containing NPY1 -like protein            294   4e-92    
ref|NP_001063200.1|  Os09g0420900                                       294   6e-92    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003544563.1|  PREDICTED: BTB/POZ domain-containing protein...    294   7e-92    
ref|XP_004138701.1|  PREDICTED: BTB/POZ domain-containing protein...    294   7e-92    
emb|CDY22422.1|  BnaC03g61350D                                          292   1e-91    
ref|XP_006649594.1|  PREDICTED: BTB/POZ domain-containing protein...    293   1e-91    
ref|XP_009347295.1|  PREDICTED: BTB/POZ domain-containing protein...    293   1e-91    
gb|EAZ09128.1|  hypothetical protein OsI_31397                          293   2e-91    Oryza sativa Indica Group [Indian rice]
gb|KHN29631.1|  BTB/POZ domain-containing protein NPY1                  293   2e-91    
ref|XP_009776109.1|  PREDICTED: BTB/POZ domain-containing protein...    293   2e-91    
ref|XP_006857240.1|  hypothetical protein AMTR_s00065p00211770          292   2e-91    
ref|XP_003522372.1|  PREDICTED: BTB/POZ domain-containing protein...    292   3e-91    
ref|XP_009394935.1|  PREDICTED: BTB/POZ domain-containing protein...    292   3e-91    
ref|XP_010048297.1|  PREDICTED: BTB/POZ domain-containing protein...    292   4e-91    
ref|XP_006660633.1|  PREDICTED: BTB/POZ domain-containing protein...    292   4e-91    
ref|XP_010101025.1|  BTB/POZ domain-containing protein NPY1             292   5e-91    
ref|XP_010942829.1|  PREDICTED: BTB/POZ domain-containing protein...    291   5e-91    
ref|XP_006362513.1|  PREDICTED: BTB/POZ domain-containing protein...    291   6e-91    
gb|KHG03398.1|  BTB/POZ domain-containing NPY1 -like protein            291   6e-91    
tpg|DAA61508.1|  TPA: putative phototropic-responsive NPH3 family...    286   7e-91    
ref|XP_008803708.1|  PREDICTED: BTB/POZ domain-containing protein...    291   7e-91    
gb|EYU21991.1|  hypothetical protein MIMGU_mgv1a003050mg                291   8e-91    
ref|XP_011081969.1|  PREDICTED: BTB/POZ domain-containing protein...    291   9e-91    
ref|NP_201545.1|  MAB4/ENP/NPY1-LIKE 2                                  290   1e-90    Arabidopsis thaliana [mouse-ear cress]
gb|AAK96885.1|  photoreceptor-interacting protein-like                  290   1e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002462390.1|  hypothetical protein SORBIDRAFT_02g024890          290   1e-90    Sorghum bicolor [broomcorn]
ref|XP_003526168.1|  PREDICTED: BTB/POZ domain-containing protein...    290   2e-90    
ref|XP_007136940.1|  hypothetical protein PHAVU_009G086900g             290   3e-90    
emb|CDY18660.1|  BnaA09g07350D                                          287   4e-90    
ref|XP_009363621.1|  PREDICTED: BTB/POZ domain-containing protein...    289   4e-90    
emb|CBI22467.3|  unnamed protein product                                286   6e-90    
ref|XP_009112216.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    287   7e-90    
ref|XP_008379044.1|  PREDICTED: BTB/POZ domain-containing protein...    288   2e-89    
ref|XP_008652721.1|  PREDICTED: BTB/POZ domain-containing protein...    287   2e-89    
ref|XP_008445264.1|  PREDICTED: BTB/POZ domain-containing protein...    287   3e-89    
gb|EPS65621.1|  hypothetical protein M569_09155                         286   4e-89    
gb|EMT16012.1|  BTB/POZ domain-containing protein                       286   4e-89    
ref|XP_010942083.1|  PREDICTED: BTB/POZ domain-containing protein...    286   4e-89    
ref|XP_006393947.1|  hypothetical protein EUTSA_v10003889mg             285   6e-89    
ref|NP_001147935.1|  signal transducer                                  286   8e-89    Zea mays [maize]
ref|XP_002437972.1|  hypothetical protein SORBIDRAFT_10g005710          286   8e-89    Sorghum bicolor [broomcorn]
ref|XP_010517747.1|  PREDICTED: BTB/POZ domain-containing protein...    285   1e-88    
gb|KHG00066.1|  BTB/POZ domain-containing protein NPY1                  292   1e-88    
ref|XP_008365065.1|  PREDICTED: BTB/POZ domain-containing protein...    280   2e-88    
ref|XP_008220672.1|  PREDICTED: BTB/POZ domain-containing protein...    285   2e-88    
ref|XP_006404771.1|  hypothetical protein EUTSA_v10000147mg             281   3e-88    
gb|AFW85546.1|  putative phototropic-responsive NPH3 family protein     283   3e-88    
gb|KHG00065.1|  BTB/POZ domain-containing protein NPY1                  292   3e-88    
ref|XP_010317781.1|  PREDICTED: BTB/POZ domain-containing protein...    284   3e-88    
ref|XP_009103410.1|  PREDICTED: BTB/POZ domain-containing protein...    282   6e-88    
ref|XP_003578134.1|  PREDICTED: BTB/POZ domain-containing protein...    283   8e-88    
gb|KFK32774.1|  hypothetical protein AALP_AA6G286900                    280   8e-88    
ref|XP_004964658.1|  PREDICTED: BTB/POZ domain-containing protein...    283   2e-87    
ref|XP_008658464.1|  PREDICTED: uncharacterized protein LOC100279...    283   2e-87    
ref|XP_004291961.1|  PREDICTED: BTB/POZ domain-containing protein...    282   2e-87    
ref|XP_002309676.1|  hypothetical protein POPTR_0006s28010g             281   3e-87    Populus trichocarpa [western balsam poplar]
ref|XP_006339811.1|  PREDICTED: BTB/POZ domain-containing protein...    281   5e-87    
ref|XP_009631542.1|  PREDICTED: BTB/POZ domain-containing protein...    281   6e-87    
ref|XP_011031448.1|  PREDICTED: BTB/POZ domain-containing protein...    281   6e-87    
ref|XP_010437988.1|  PREDICTED: BTB/POZ domain-containing protein...    280   6e-87    
emb|CDY69095.1|  BnaAnng29310D                                          279   8e-87    
ref|NP_194910.2|  BTB/POZ domain-containing protein NPY1                279   1e-86    Arabidopsis thaliana [mouse-ear cress]
gb|AAM13843.1|  unknown protein                                         279   1e-86    Arabidopsis thaliana [mouse-ear cress]
gb|AFW68229.1|  putative phototropic-responsive NPH3 family protein     267   2e-86    
ref|XP_006826702.1|  hypothetical protein AMTR_s00137p00096710          280   3e-86    
ref|XP_010447547.1|  PREDICTED: BTB/POZ domain-containing protein...    277   6e-86    
ref|XP_010432811.1|  PREDICTED: BTB/POZ domain-containing protein...    277   7e-86    
ref|XP_009140445.1|  PREDICTED: BTB/POZ domain-containing protein...    274   9e-86    
ref|XP_004490272.1|  PREDICTED: BTB/POZ domain-containing protein...    264   1e-85    
ref|XP_006283419.1|  hypothetical protein CARUB_v10004469mg             271   2e-85    
ref|XP_006655857.1|  PREDICTED: BTB/POZ domain-containing protein...    277   2e-85    
ref|NP_001182914.1|  putative phototropic-resoponsive NPH3 family...    276   3e-85    
ref|XP_010429248.1|  PREDICTED: BTB/POZ domain-containing protein...    272   7e-85    
ref|XP_006412550.1|  hypothetical protein EUTSA_v10024768mg             275   9e-85    
ref|XP_010417060.1|  PREDICTED: BTB/POZ domain-containing protein...    271   2e-84    
ref|XP_010525901.1|  PREDICTED: BTB/POZ domain-containing protein...    273   2e-84    
ref|XP_006283420.1|  hypothetical protein CARUB_v10004469mg             273   3e-84    
ref|XP_004490273.1|  PREDICTED: BTB/POZ domain-containing protein...    260   3e-84    
ref|XP_006295878.1|  hypothetical protein CARUB_v10025008mg             270   4e-84    
ref|XP_010472303.1|  PREDICTED: BTB/POZ domain-containing protein...    270   4e-84    
ref|XP_009126615.1|  PREDICTED: BTB/POZ domain-containing protein...    273   5e-84    
gb|EMS64627.1|  Coleoptile phototropism protein 1                       275   5e-84    
emb|CDY38923.1|  BnaA04g13440D                                          270   5e-84    
tpg|DAA47265.1|  TPA: putative phototropic-responsive NPH3 family...    274   6e-84    
emb|CDX89539.1|  BnaC04g35580D                                          268   1e-83    
gb|EMS54071.1|  Coleoptile phototropism protein 1                       270   2e-83    
emb|CAB38298.1|  putative protein                                       271   3e-83    
gb|EAY99934.1|  hypothetical protein OsI_21936                          271   8e-83    
ref|XP_011099363.1|  PREDICTED: BTB/POZ domain-containing protein...    268   2e-82    
ref|NP_001056994.1|  Os06g0184500                                       269   3e-82    
emb|CDX68790.1|  BnaC01g06630D                                          267   5e-82    
dbj|BAK04631.1|  predicted protein                                      269   5e-82    
ref|NP_179887.1|  BTB/POZ domain-containing protein NPY4                264   7e-82    
ref|XP_010317782.1|  PREDICTED: BTB/POZ domain-containing protein...    267   7e-82    
ref|XP_004169099.1|  PREDICTED: BTB/POZ domain-containing protein...    263   3e-80    
emb|CAN82247.1|  hypothetical protein VITISV_036489                     266   4e-80    
gb|KHN23237.1|  BTB/POZ domain-containing protein NPY2                  262   7e-80    
emb|CDY12846.1|  BnaC07g15870D                                          261   1e-79    
ref|XP_010316013.1|  PREDICTED: BTB/POZ domain-containing protein...    259   1e-78    
gb|KFK29782.1|  hypothetical protein AALP_AA7G178600                    258   3e-78    
ref|XP_006578114.1|  PREDICTED: BTB/POZ domain-containing protein...    258   4e-78    
ref|XP_006578113.1|  PREDICTED: BTB/POZ domain-containing protein...    257   8e-78    
gb|EMT21458.1|  BTB/POZ domain-containing protein                       253   1e-77    
ref|XP_008658463.1|  PREDICTED: uncharacterized protein LOC100279...    254   1e-76    
ref|XP_008357265.1|  PREDICTED: BTB/POZ domain-containing protein...    253   2e-76    
gb|EMS59346.1|  Coleoptile phototropism protein 1                       250   1e-75    
ref|XP_003564193.1|  PREDICTED: BTB/POZ domain-containing protein...    251   4e-75    
ref|XP_011031451.1|  PREDICTED: BTB/POZ domain-containing protein...    248   1e-74    
ref|XP_010907394.1|  PREDICTED: BTB/POZ domain-containing protein...    244   5e-73    
gb|EPS69982.1|  hypothetical protein M569_04781                         239   2e-71    
ref|NP_001119515.1|  MAB4/ENP/NPY1-LIKE 2                               225   3e-66    
gb|KDO82222.1|  hypothetical protein CISIN_1g006846mg                   221   2e-65    
gb|KHG04804.1|  hypothetical protein F383_28791                         223   1e-64    
ref|XP_006438255.1|  hypothetical protein CICLE_v10030958mg             221   3e-64    
ref|XP_006483950.1|  PREDICTED: BTB/POZ domain-containing protein...    221   3e-64    
gb|KDO82220.1|  hypothetical protein CISIN_1g006846mg                   221   4e-64    
ref|XP_009770852.1|  PREDICTED: BTB/POZ domain-containing protein...    220   8e-64    
ref|XP_002282444.2|  PREDICTED: BTB/POZ domain-containing protein...    219   2e-63    
ref|XP_009614413.1|  PREDICTED: BTB/POZ domain-containing protein...    218   6e-63    
ref|XP_006852352.1|  hypothetical protein AMTR_s00049p00216130          219   9e-63    
emb|CAN63893.1|  hypothetical protein VITISV_019664                     217   1e-62    
ref|XP_006357600.1|  PREDICTED: BTB/POZ domain-containing protein...    217   2e-62    
ref|XP_010100409.1|  BTB/POZ domain-containing protein                  216   3e-62    
ref|XP_003552044.1|  PREDICTED: BTB/POZ domain-containing protein...    216   6e-62    
ref|XP_009105081.1|  PREDICTED: BTB/POZ domain-containing protein...    215   6e-62    
ref|XP_010646247.1|  PREDICTED: BTB/POZ domain-containing protein...    215   6e-62    
ref|XP_007153783.1|  hypothetical protein PHAVU_003G064600g             215   6e-62    
ref|XP_010531578.1|  PREDICTED: BTB/POZ domain-containing protein...    215   7e-62    
gb|KHG05824.1|  hypothetical protein F383_32639                         215   7e-62    
ref|XP_004172442.1|  PREDICTED: BTB/POZ domain-containing protein...    214   1e-61    
ref|XP_010470729.1|  PREDICTED: BTB/POZ domain-containing protein...    214   2e-61    
ref|XP_003531985.1|  PREDICTED: BTB/POZ domain-containing protein...    214   3e-61    
gb|KGN51751.1|  hypothetical protein Csa_5G598100                       213   3e-61    
ref|XP_006300867.1|  hypothetical protein CARUB_v10019960mg             213   4e-61    
ref|NP_176957.1|  phototropic-responsive NPH3 family protein            213   5e-61    
ref|XP_004135274.1|  PREDICTED: BTB/POZ domain-containing protein...    213   5e-61    
ref|XP_010511760.1|  PREDICTED: BTB/POZ domain-containing protein...    213   5e-61    
ref|XP_008446157.1|  PREDICTED: BTB/POZ domain-containing protein...    213   6e-61    
ref|XP_006391205.1|  hypothetical protein EUTSA_v10019709mg             212   1e-60    
ref|XP_010415392.1|  PREDICTED: BTB/POZ domain-containing protein...    212   1e-60    
ref|XP_010251055.1|  PREDICTED: BTB/POZ domain-containing protein...    211   4e-60    
gb|KHN22636.1|  BTB/POZ domain-containing protein                       210   5e-60    
ref|XP_010646238.1|  PREDICTED: BTB/POZ domain-containing protein...    210   5e-60    
ref|XP_008221906.1|  PREDICTED: BTB/POZ domain-containing protein...    210   9e-60    
ref|XP_010252837.1|  PREDICTED: BTB/POZ domain-containing protein...    208   1e-59    
ref|XP_010248658.1|  PREDICTED: BTB/POZ domain-containing protein...    209   2e-59    
ref|XP_010556221.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    208   2e-59    
emb|CDY72257.1|  BnaCnng76750D                                          206   2e-59    
gb|KDP26695.1|  hypothetical protein JCGZ_17853                         208   3e-59    
ref|XP_006467218.1|  PREDICTED: BTB/POZ domain-containing protein...    207   5e-59    
ref|XP_006449993.1|  hypothetical protein CICLE_v10014681mg             207   5e-59    
emb|CDP13229.1|  unnamed protein product                                207   9e-59    
emb|CDY72267.1|  BnaAnng40470D                                          204   9e-59    
emb|CBI16786.3|  unnamed protein product                                203   2e-58    
ref|XP_009374833.1|  PREDICTED: BTB/POZ domain-containing protein...    201   3e-58    
gb|KHN35451.1|  BTB/POZ domain-containing protein                       205   4e-58    
ref|XP_011040135.1|  PREDICTED: BTB/POZ domain-containing protein...    204   4e-58    
ref|XP_002525040.1|  Root phototropism protein, putative                204   5e-58    
ref|XP_002323131.2|  hypothetical protein POPTR_0016s00530g             204   6e-58    
ref|XP_006378242.1|  hypothetical protein POPTR_0010s05690g             204   7e-58    
ref|XP_004489774.1|  PREDICTED: BTB/POZ domain-containing protein...    204   7e-58    
ref|XP_006378241.1|  hypothetical protein POPTR_0010s05690g             204   8e-58    
ref|XP_002530034.1|  signal transducer, putative                        204   1e-57    
gb|EYU27638.1|  hypothetical protein MIMGU_mgv1a003699mg                202   2e-57    
ref|XP_007044812.1|  Phototropic-responsive NPH3 family protein         204   2e-57    
ref|XP_004293414.1|  PREDICTED: BTB/POZ domain-containing protein...    203   2e-57    
ref|XP_011045253.1|  PREDICTED: BTB/POZ domain-containing protein...    203   2e-57    
ref|XP_011045254.1|  PREDICTED: BTB/POZ domain-containing protein...    203   2e-57    
ref|XP_010432812.1|  PREDICTED: BTB/POZ domain-containing protein...    201   3e-57    
gb|KCW59744.1|  hypothetical protein EUGRSUZ_H02493                     201   3e-57    
ref|XP_006467216.1|  PREDICTED: BTB/POZ domain-containing protein...    202   3e-57    
ref|XP_004239131.1|  PREDICTED: BTB/POZ domain-containing protein...    202   4e-57    
ref|XP_009358099.1|  PREDICTED: BTB/POZ domain-containing protein...    202   5e-57    
ref|XP_002311763.1|  phototropic-responsive NPH3 family protein         202   5e-57    
ref|XP_007026409.1|  Root phototropism protein, putative isoform 3      201   6e-57    
ref|XP_009374827.1|  PREDICTED: BTB/POZ domain-containing protein...    201   9e-57    
ref|XP_010023464.1|  PREDICTED: BTB/POZ domain-containing protein...    201   1e-56    
gb|KHG09801.1|  hypothetical protein F383_02074                         200   1e-56    
ref|XP_007211380.1|  hypothetical protein PRUPE_ppa002800mg             201   2e-56    
ref|XP_004509676.1|  PREDICTED: BTB/POZ domain-containing protein...    200   2e-56    
ref|XP_003613103.1|  BTB/POZ domain-containing protein                  201   2e-56    
ref|XP_003550464.1|  PREDICTED: BTB/POZ domain-containing protein...    200   2e-56    
gb|KHN03557.1|  BTB/POZ domain-containing protein                       200   2e-56    
ref|XP_008224648.1|  PREDICTED: BTB/POZ domain-containing protein...    200   3e-56    
ref|XP_011095883.1|  PREDICTED: BTB/POZ domain-containing protein...    198   3e-56    
ref|XP_011005754.1|  PREDICTED: BTB/POZ domain-containing protein...    199   3e-56    
ref|XP_011040125.1|  PREDICTED: BTB/POZ domain-containing protein...    199   3e-56    
gb|KDO67445.1|  hypothetical protein CISIN_1g007148mg                   198   5e-56    
ref|XP_003628937.1|  BTB/POZ domain-containing protein                  199   5e-56    
ref|XP_010245016.1|  PREDICTED: BTB/POZ domain-containing protein...    199   5e-56    
gb|AET03413.2|  phototropic-responsive NPH3 family protein              199   6e-56    
ref|XP_003637604.1|  BTB/POZ domain-containing protein                  199   7e-56    
ref|XP_007026407.1|  Root phototropism protein, putative isoform 1      198   1e-55    
ref|XP_009786908.1|  PREDICTED: BTB/POZ domain-containing protein...    198   1e-55    
gb|EPS63042.1|  hypothetical protein M569_11744                         197   2e-55    
ref|XP_010682456.1|  PREDICTED: BTB/POZ domain-containing protein...    197   2e-55    
ref|XP_011086648.1|  PREDICTED: BTB/POZ domain-containing protein...    197   3e-55    
ref|XP_002988207.1|  hypothetical protein SELMODRAFT_183709             197   4e-55    
gb|KHG03539.1|  hypothetical protein F383_27138                         197   4e-55    
ref|XP_002963496.1|  hypothetical protein SELMODRAFT_166345             197   4e-55    
ref|XP_007221979.1|  hypothetical protein PRUPE_ppa002809mg             197   6e-55    
ref|XP_008440966.1|  PREDICTED: BTB/POZ domain-containing protein...    196   6e-55    
ref|XP_011071147.1|  PREDICTED: BTB/POZ domain-containing protein...    196   6e-55    
ref|XP_006600279.1|  PREDICTED: BTB/POZ domain-containing protein...    195   1e-54    
ref|XP_003529682.1|  PREDICTED: BTB/POZ domain-containing protein...    195   2e-54    
gb|KHN40229.1|  BTB/POZ domain-containing protein                       195   2e-54    
ref|XP_004134813.1|  PREDICTED: BTB/POZ domain-containing protein...    195   2e-54    
ref|XP_004158832.1|  PREDICTED: BTB/POZ domain-containing protein...    195   2e-54    
ref|XP_011095882.1|  PREDICTED: BTB/POZ domain-containing protein...    193   2e-54    
ref|XP_004299219.1|  PREDICTED: BTB/POZ domain-containing protein...    195   3e-54    
ref|XP_011005734.1|  PREDICTED: BTB/POZ domain-containing protein...    194   3e-54    
gb|KDO42274.1|  hypothetical protein CISIN_1g005842mg                   192   3e-54    
ref|XP_009630313.1|  PREDICTED: BTB/POZ domain-containing protein...    194   4e-54    
ref|XP_009391906.1|  PREDICTED: BTB/POZ domain-containing protein...    193   4e-54    
ref|XP_002308748.2|  hypothetical protein POPTR_0006s00490g             193   4e-54    
gb|KDP35543.1|  hypothetical protein JCGZ_08981                         193   5e-54    
ref|XP_007047503.1|  Phototropic-responsive NPH3 family protein i...    192   5e-54    
ref|XP_011086288.1|  PREDICTED: BTB/POZ domain-containing protein...    194   6e-54    
ref|XP_007026408.1|  Root phototropism protein, putative isoform 2      193   8e-54    
ref|XP_008389720.1|  PREDICTED: BTB/POZ domain-containing protein...    193   1e-53    
ref|XP_010096492.1|  BTB/POZ domain-containing protein                  194   1e-53    
ref|NP_001148012.1|  protein binding protein                            192   1e-53    
ref|XP_008340094.1|  PREDICTED: BTB/POZ domain-containing protein...    193   1e-53    
ref|XP_007158393.1|  hypothetical protein PHAVU_002G149400g             193   2e-53    
gb|KHN14527.1|  BTB/POZ domain-containing protein                       192   2e-53    
gb|KDO42273.1|  hypothetical protein CISIN_1g005842mg                   193   2e-53    
ref|XP_006494598.1|  PREDICTED: root phototropism protein 3-like ...    193   2e-53    
ref|XP_006420844.1|  hypothetical protein CICLE_v10004479mg             193   2e-53    
ref|XP_004499337.1|  PREDICTED: BTB/POZ domain-containing protein...    192   2e-53    
ref|XP_009359209.1|  PREDICTED: BTB/POZ domain-containing protein...    192   3e-53    
ref|XP_010929904.1|  PREDICTED: BTB/POZ domain-containing protein...    192   3e-53    
ref|XP_011034060.1|  PREDICTED: BTB/POZ domain-containing protein...    191   6e-53    
ref|XP_002522618.1|  hypothetical protein RCOM_0884570                  191   7e-53    
gb|KHN00400.1|  BTB/POZ domain-containing protein                       191   7e-53    
emb|CAB40752.1|  putative protein                                       189   7e-53    
ref|XP_003519715.1|  PREDICTED: BTB/POZ domain-containing protein...    191   7e-53    
ref|XP_006584110.1|  PREDICTED: BTB/POZ domain-containing protein...    190   1e-52    
ref|XP_010530083.1|  PREDICTED: BTB/POZ domain-containing protein...    189   1e-52    
ref|XP_009392311.1|  PREDICTED: BTB/POZ domain-containing protein...    189   2e-52    
emb|CDY17704.1|  BnaA06g35230D                                          189   2e-52    
ref|XP_009101384.1|  PREDICTED: BTB/POZ domain-containing protein...    189   2e-52    
gb|KDP40950.1|  hypothetical protein JCGZ_24949                         190   2e-52    
ref|XP_008778389.1|  PREDICTED: BTB/POZ domain-containing protein...    189   3e-52    
emb|CDX77798.1|  BnaC07g20520D                                          188   3e-52    
ref|XP_011086287.1|  PREDICTED: BTB/POZ domain-containing protein...    189   3e-52    
ref|XP_011086289.1|  PREDICTED: BTB/POZ domain-containing protein...    188   5e-52    
ref|XP_008783002.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    187   6e-52    
ref|XP_008797736.1|  PREDICTED: BTB/POZ domain-containing protein...    187   8e-52    
ref|XP_006281573.1|  hypothetical protein CARUB_v10027680mg             187   8e-52    
ref|XP_009368293.1|  PREDICTED: root phototropism protein 3-like        188   1e-51    
emb|CDO97399.1|  unnamed protein product                                188   1e-51    
ref|XP_008358392.1|  PREDICTED: root phototropism protein 3-like        188   1e-51    
ref|XP_010942558.1|  PREDICTED: BTB/POZ domain-containing protein...    187   1e-51    
ref|XP_006583767.1|  PREDICTED: root phototropism protein 3-like ...    187   1e-51    
ref|XP_002269380.1|  PREDICTED: root phototropism protein 3             188   1e-51    
ref|XP_010528100.1|  PREDICTED: BTB/POZ domain-containing protein...    187   1e-51    
ref|XP_010052491.1|  PREDICTED: BTB/POZ domain-containing protein...    187   1e-51    
emb|CAN60915.1|  hypothetical protein VITISV_002200                     188   1e-51    
gb|EMT26515.1|  BTB/POZ domain-containing protein                       187   1e-51    
ref|XP_003594335.1|  BTB/POZ domain-containing protein                  186   2e-51    
dbj|BAJ89954.1|  predicted protein                                      187   2e-51    
ref|XP_008373205.1|  PREDICTED: root phototropism protein 3             187   2e-51    
emb|CDP04549.1|  unnamed protein product                                186   2e-51    
gb|KHN09117.1|  Root phototropism protein 3                             186   3e-51    
ref|XP_009631478.1|  PREDICTED: root phototropism protein 3-like        187   3e-51    
ref|XP_010929030.1|  PREDICTED: BTB/POZ domain-containing protein...    186   3e-51    
ref|XP_003528390.2|  PREDICTED: root phototropism protein 3-like ...    187   4e-51    
ref|XP_009392307.1|  PREDICTED: BTB/POZ domain-containing protein...    185   5e-51    
ref|XP_008787171.1|  PREDICTED: BTB/POZ domain-containing protein...    184   5e-51    
ref|XP_002314596.2|  hypothetical protein POPTR_0010s05690g             186   5e-51    
ref|XP_010094827.1|  Root phototropism protein 3                        186   5e-51    
ref|XP_009766095.1|  PREDICTED: root phototropism protein 3-like ...    184   5e-51    
ref|XP_002310495.1|  hypothetical protein POPTR_0007s03550g             186   8e-51    
ref|XP_009608450.1|  PREDICTED: root phototropism protein 3 isofo...    183   8e-51    
ref|XP_007042874.1|  Phototropic-responsive NPH3 family protein i...    185   8e-51    
gb|KEH31205.1|  phototropic-responsive NPH3 family protein              184   9e-51    
ref|XP_006398482.1|  hypothetical protein EUTSA_v10000839mg             184   9e-51    
dbj|BAJ34459.1|  unnamed protein product                                184   1e-50    
ref|XP_004486375.1|  PREDICTED: BTB/POZ domain-containing protein...    184   1e-50    
ref|XP_009366303.1|  PREDICTED: root phototropism protein 3             185   1e-50    
ref|XP_003547299.1|  PREDICTED: BTB/POZ domain-containing protein...    184   1e-50    
dbj|BAK03079.1|  predicted protein                                      185   1e-50    
ref|XP_011087936.1|  PREDICTED: root phototropism protein 3-like        185   1e-50    
ref|XP_006595174.1|  PREDICTED: root phototropism protein 3-like ...    183   1e-50    
ref|XP_006595180.1|  PREDICTED: root phototropism protein 3-like ...    183   1e-50    
ref|XP_003534987.1|  PREDICTED: BTB/POZ domain-containing protein...    184   2e-50    
ref|XP_003608415.1|  Root phototropism protein                          184   2e-50    
gb|KHN40773.1|  BTB/POZ domain-containing protein                       184   2e-50    
ref|XP_007159131.1|  hypothetical protein PHAVU_002G211400g             184   2e-50    
gb|KHN31896.1|  Root phototropism protein 3                             182   3e-50    
ref|XP_009766094.1|  PREDICTED: root phototropism protein 3-like ...    184   3e-50    
ref|XP_009348533.1|  PREDICTED: root phototropism protein 3-like        184   3e-50    
ref|XP_010481373.1|  PREDICTED: BTB/POZ domain-containing protein...    182   3e-50    
ref|XP_006584970.1|  PREDICTED: root phototropism protein 3-like        184   4e-50    
ref|XP_003593245.1|  Root phototropism protein                          184   4e-50    
ref|XP_003545709.1|  PREDICTED: root phototropism protein 3-like        184   4e-50    
gb|KHN46271.1|  Root phototropism protein 3                             184   4e-50    
ref|XP_009608443.1|  PREDICTED: root phototropism protein 3 isofo...    184   4e-50    
ref|XP_010481372.1|  PREDICTED: BTB/POZ domain-containing protein...    182   5e-50    



>ref|XP_009764318.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
sylvestris]
 ref|XP_009764381.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
sylvestris]
 ref|XP_009764456.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
sylvestris]
 ref|XP_009764516.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
sylvestris]
Length=624

 Score =   373 bits (957),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 174/215 (81%), Positives = 194/215 (90%), Gaps = 1/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQS+GNN+RYVASELASDI +++GDVKFYLHKFPLLSKS  LQKLV N
Sbjct  1    MKFMKLGSKPDTFQSDGNNIRYVASELASDITVNVGDVKFYLHKFPLLSKSTSLQKLVAN  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            ++E N DEVHI DIPGG TAFEICAKFCYGMTVTLNAYN+IAARCAAEYL M+E +EKGN
Sbjct  61   ASEANCDEVHIHDIPGGPTAFEICAKFCYGMTVTLNAYNVIAARCAAEYLGMHEAIEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFLNSSI +SWKDSIIVLQTTKS   +CEELKL+ HC++AIAS+ASIDV++VDW
Sbjct  121  LIYKIDVFLNSSIFRSWKDSIIVLQTTKSQSRLCEELKLISHCIDAIASKASIDVNRVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRKK+ EEN D DPN +G RSRMVPKDWWVE
Sbjct  181  SYTYNRKKLPEENGD-DPNLNGIRSRMVPKDWWVE  214



>ref|XP_011088062.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Sesamum indicum]
Length=624

 Score =   372 bits (955),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 165/215 (77%), Positives = 198/215 (92%), Gaps = 1/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++GNN+RYVASELA+D+I+H+GDVKFYLHKFPLLSKSA LQKLV++
Sbjct  1    MKFMKLGSKPDTFQTDGNNIRYVASELATDVIVHVGDVKFYLHKFPLLSKSARLQKLVSS  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NEGNGDE+++ DIPGG +AFE+CAKFCYGMTVTLNAYN++A RCAAEYLEM E VEKGN
Sbjct  61   ANEGNGDEINVHDIPGGSSAFEVCAKFCYGMTVTLNAYNVVATRCAAEYLEMYETVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYK+DVFLNSSI +SWKDSII+LQTTK+ LP+ EELKL+ HC++AIAS+AS+DVSKVDW
Sbjct  121  LIYKVDVFLNSSIFRSWKDSIIILQTTKAFLPLSEELKLISHCIDAIASKASVDVSKVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRKKI E+N + DP+++  RSRM+P DWWVE
Sbjct  181  SYTYNRKKIPEDNGN-DPSWNSVRSRMIPNDWWVE  214



>ref|XP_004230705.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Solanum lycopersicum]
 ref|XP_010315185.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Solanum lycopersicum]
 ref|XP_010315186.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Solanum lycopersicum]
 ref|XP_010315187.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Solanum lycopersicum]
 ref|XP_010315188.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Solanum lycopersicum]
 ref|XP_010315189.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Solanum lycopersicum]
Length=626

 Score =   370 bits (949),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 172/215 (80%), Positives = 194/215 (90%), Gaps = 1/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++GNN+RYVASELASDI I++GDVKFYLHKFPLLSKSA LQKLV+N
Sbjct  1    MKFMKLGSKPDNFQTDGNNVRYVASELASDIAINVGDVKFYLHKFPLLSKSATLQKLVSN  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            ++EGN DEV I DIPGG +AFEICAKFCYGMTVTLNAYN+I+ RCAAEYL MNE++EKGN
Sbjct  61   ASEGNSDEVDIHDIPGGPSAFEICAKFCYGMTVTLNAYNVISTRCAAEYLGMNESLEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFLNSSI +SWKDSIIVLQTTKS   MCEELKL  HC++A+ASRAS+DVS+VDW
Sbjct  121  LIYKIDVFLNSSIFRSWKDSIIVLQTTKSQSRMCEELKLTSHCIDAVASRASVDVSRVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRKK+ EEN + DPN +G R RMVPKDWWVE
Sbjct  181  SYTYNRKKLPEENGN-DPNLNGIRCRMVPKDWWVE  214



>ref|XP_009625190.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
tomentosiformis]
 ref|XP_009625197.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
tomentosiformis]
 ref|XP_009625203.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
tomentosiformis]
 ref|XP_009625209.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
tomentosiformis]
 ref|XP_009625213.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
tomentosiformis]
 ref|XP_009625220.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
tomentosiformis]
Length=624

 Score =   368 bits (945),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 171/215 (80%), Positives = 192/215 (89%), Gaps = 1/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQS+GNN+RYVASELASDI +++GDVKFYLHKFPLLSKS  LQKLV N
Sbjct  1    MKFMKLGSKPDTFQSDGNNIRYVASELASDITVNVGDVKFYLHKFPLLSKSTSLQKLVAN  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            ++E N D+VHI DIPGG TAFEICAKFCYGMTVTLNAYN+I ARCAAEYL M+E +EKGN
Sbjct  61   ASEANCDDVHIHDIPGGPTAFEICAKFCYGMTVTLNAYNVIVARCAAEYLGMHETIEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFLNSSI +SWKDSIIVLQTTKS   +CEELKL+ HC++AIAS+ASIDV +VDW
Sbjct  121  LIYKIDVFLNSSIFRSWKDSIIVLQTTKSQSRLCEELKLISHCIDAIASKASIDVDRVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRKK+ EEN + DPN +G RSRMVPKDWWVE
Sbjct  181  SYTYNRKKLPEENGN-DPNLNGIRSRMVPKDWWVE  214



>ref|XP_006346315.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006346316.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006346317.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X3 [Solanum tuberosum]
 ref|XP_006346318.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X4 [Solanum tuberosum]
 ref|XP_006346319.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X5 [Solanum tuberosum]
 ref|XP_006346320.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X6 [Solanum tuberosum]
Length=626

 Score =   367 bits (942),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 171/215 (80%), Positives = 195/215 (91%), Gaps = 1/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++GNN+RYVASELASDI I++GDVKFYLHKFPLLSKSA LQKLV+N
Sbjct  1    MKFMKLGSKPDAFQTDGNNVRYVASELASDIAINVGDVKFYLHKFPLLSKSATLQKLVSN  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            ++EGN +EV I DIPGG +AFEICAKFCYGMTVTLNAYN+I+ARCAAEYL MNE++EKGN
Sbjct  61   ASEGNCNEVDIHDIPGGPSAFEICAKFCYGMTVTLNAYNVISARCAAEYLGMNESLEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            L+YKIDVFLNSSI +SWKDSIIVLQTTKS   MCEELKL  HC++A+ASRAS+DVS+VDW
Sbjct  121  LVYKIDVFLNSSIFRSWKDSIIVLQTTKSQSRMCEELKLTSHCIDAVASRASVDVSRVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRKK+ EEN + DPN +G RSRMV KDWWVE
Sbjct  181  SYTYNRKKLPEENGN-DPNLNGIRSRMVLKDWWVE  214



>gb|EYU37575.1| hypothetical protein MIMGU_mgv1a002858mg [Erythranthe guttata]
Length=630

 Score =   364 bits (935),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 167/215 (78%), Positives = 194/215 (90%), Gaps = 1/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ +GNN+RYVASELA+D+++ +GDVKFYLHKFPLLSKSA LQKLV++
Sbjct  1    MKFMKLGSKPDTFQIDGNNIRYVASELATDVVVQVGDVKFYLHKFPLLSKSARLQKLVSS  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            SNEGN DE++I DIPGG TAFEICAKFCYGMTVTLNAYN+IA RCAAEYL+M+E +EKGN
Sbjct  61   SNEGNSDEINIHDIPGGPTAFEICAKFCYGMTVTLNAYNVIATRCAAEYLQMHEAIEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFLNSS+ +SWKDSIIVLQT+KS LP+ EELKL+ HC+EA+ASRAS+DVSKVDW
Sbjct  121  LIYKIDVFLNSSLFRSWKDSIIVLQTSKSLLPLSEELKLITHCIEAVASRASVDVSKVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRKK+ EEN   DP++ G R+R VP DWWVE
Sbjct  181  SYTYNRKKLVEENL-TDPSWHGVRTREVPSDWWVE  214



>ref|XP_006353967.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Solanum 
tuberosum]
Length=610

 Score =   358 bits (920),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 166/215 (77%), Positives = 189/215 (88%), Gaps = 1/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQS+G N+RYVASEL SDI++ +GDVKF+LHKFPLLSKSAHLQKLVTN
Sbjct  1    MKFMKLGSKPDTFQSDGKNVRYVASELDSDIVVSVGDVKFHLHKFPLLSKSAHLQKLVTN  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            S+EG+GDEVHI D+PGG TAFE+C KFCYGMTVTLNAYN+IAARCAAEYL M+E VEKGN
Sbjct  61   SSEGDGDEVHIHDVPGGPTAFEMCVKFCYGMTVTLNAYNVIAARCAAEYLGMDETVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL+S+I +SWKDSII LQTTKS L +CEE+KL+ HC +AIAS+ SIDV KVDW
Sbjct  121  LIYKIDVFLHSTIFRSWKDSIIFLQTTKSRLHLCEEVKLISHCTDAIASKTSIDVRKVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNR KI EEN    PN +G RSR+VP DWWV+
Sbjct  181  SYTYNRTKIQEENGS-GPNSNGIRSRVVPNDWWVD  214



>emb|CDO97269.1| unnamed protein product [Coffea canephora]
Length=622

 Score =   356 bits (913),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 165/215 (77%), Positives = 195/215 (91%), Gaps = 2/215 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++GNN+RYVASELA+DI++++GD+KFYLHKFPLLSKS+HLQKLV +
Sbjct  1    MKFMKLGSKPDSFQTDGNNVRYVASELATDIVVNVGDIKFYLHKFPLLSKSSHLQKLVAS  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +++GN DEV+I DIPGG  AFEICAKFCYGMTVTLNAYN++AARCAAEYL M+E VEKGN
Sbjct  61   ADDGN-DEVNIHDIPGGPVAFEICAKFCYGMTVTLNAYNVVAARCAAEYLGMHETVEKGN  119

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYK++VFLNSSI +SWKDSIIVLQTTKS LP+ EELKL  HC++AI+S+AS DVSKVDW
Sbjct  120  LIYKVEVFLNSSIFRSWKDSIIVLQTTKSLLPLSEELKLSSHCIDAISSKASGDVSKVDW  179

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRKK+ EEN + DP ++G RSR VPKDWWVE
Sbjct  180  SYTYNRKKLLEENGN-DPTWNGIRSRTVPKDWWVE  213



>ref|XP_009626485.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
tomentosiformis]
Length=614

 Score =   352 bits (904),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 167/216 (77%), Positives = 191/216 (88%), Gaps = 5/216 (2%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQS+G N+RYVASELASDII++IGDVKFYLHKFPL+SKSA LQKLV +
Sbjct  1    MKFMKLGSKPDTFQSDGKNIRYVASELASDIIVNIGDVKFYLHKFPLMSKSACLQKLVVS  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            ++EGNGDEV+I DIPGG +AFEICAKFCYGMTVTLNAYN+IAARCAAEYLEM+E VEKGN
Sbjct  61   TSEGNGDEVYIHDIPGGPSAFEICAKFCYGMTVTLNAYNVIAARCAAEYLEMHETVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTK-SHLPMCEELKLVGHCVEAIASRASIDVSKVD  109
            LIYK+DVFL+SSI +SWKDSII+LQTTK S L MCEE+KL+ HC++AIAS+  IDV KVD
Sbjct  121  LIYKVDVFLHSSIFRSWKDSIILLQTTKSSRLHMCEEVKLISHCIDAIASKTCIDVRKVD  180

Query  108  WSYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            WSYTYNR KI EEN     N +G RSR+VP DWWV+
Sbjct  181  WSYTYNRTKIPEENG----NSNGIRSRVVPNDWWVD  212



>gb|KDO57872.1| hypothetical protein CISIN_1g007080mg [Citrus sinensis]
Length=619

 Score =   352 bits (902),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 161/215 (75%), Positives = 191/215 (89%), Gaps = 1/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++GNN+RYVASELA+D+I+ + D+KF+LHKFPLLSKSA LQKLV  
Sbjct  1    MKFMKLGSKPDSFQADGNNVRYVASELATDVIVVVDDIKFHLHKFPLLSKSACLQKLVAT  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N +EV I DIPGG +AFE CAKFCYGMTVTLNAYN++AARCAAEYL M+E+VEKGN
Sbjct  61   ANEANNNEVDISDIPGGPSAFETCAKFCYGMTVTLNAYNVVAARCAAEYLGMHESVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
             +YKIDVF++SSIL+SWKDSIIVLQTTKS LPM EELK+  HC+EAIA++A +DVSKVDW
Sbjct  121  FVYKIDVFISSSILRSWKDSIIVLQTTKSLLPMSEELKVASHCIEAIATKACVDVSKVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRKK+ EEN + DPN++G R+R VPKDWWVE
Sbjct  181  SYTYNRKKLPEENGN-DPNWNGVRTRAVPKDWWVE  214



>ref|XP_009347119.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Pyrus 
x bretschneideri]
Length=626

 Score =   352 bits (902),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 161/215 (75%), Positives = 192/215 (89%), Gaps = 1/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++GNN+RYVA++LA+DII+++GD KFYLHKFPLLSKSA LQKLV N
Sbjct  1    MKFMKLGSKPDSFQTDGNNVRYVATDLATDIIVNVGDSKFYLHKFPLLSKSARLQKLVAN  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N  E++I DIPGG  AFEICAKFCYGMTVTLNAYN++ +RCAAEYL M+E++EKGN
Sbjct  61   TNESNTGEIYISDIPGGPAAFEICAKFCYGMTVTLNAYNVVVSRCAAEYLGMHESIEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL+SSI +SWKDSIIVLQTTKS LP+ EELKLV HC+++IA++A +DVSKVDW
Sbjct  121  LIYKIDVFLSSSIFRSWKDSIIVLQTTKSLLPISEELKLVSHCIDSIATKACMDVSKVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRKKI EEN +  PN++G R+R VPKDWWVE
Sbjct  181  SYTYNRKKIQEENGNA-PNWNGVRNRPVPKDWWVE  214



>ref|XP_006486926.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Citrus sinensis]
 ref|XP_006486927.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Citrus sinensis]
 ref|XP_006486928.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X3 [Citrus sinensis]
Length=619

 Score =   351 bits (901),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 161/215 (75%), Positives = 191/215 (89%), Gaps = 1/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++GNN+RYVASELA+D+I+ + D+KF+LHKFPLLSKSA LQKLV  
Sbjct  1    MKFMKLGSKPDSFQADGNNVRYVASELATDVIVVVDDIKFHLHKFPLLSKSACLQKLVAT  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N +EV I DIPGG +AFE CAKFCYGMTVTLNAYN++AARCAAEYL M+E+VEKGN
Sbjct  61   ANEANNNEVDISDIPGGPSAFETCAKFCYGMTVTLNAYNVVAARCAAEYLGMHESVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
             +YKIDVF++SSIL+SWKDSIIVLQTTKS LPM EELK+  HC+EAIA++A +DVSKVDW
Sbjct  121  FVYKIDVFISSSILRSWKDSIIVLQTTKSLLPMSEELKVASHCIEAIATKACVDVSKVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRKK+ EEN + DPN++G R+R VPKDWWVE
Sbjct  181  SYTYNRKKLPEENGN-DPNWNGVRTRAVPKDWWVE  214



>ref|XP_008366255.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Malus domestica]
Length=626

 Score =   351 bits (901),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 192/215 (89%), Gaps = 1/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++GNN+RYVA++LA+DII+++ D KFYLHKFPLLSKSA LQKLV N
Sbjct  1    MKFMKLGSKPDSFQTDGNNVRYVATDLATDIIVNVADSKFYLHKFPLLSKSARLQKLVAN  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N  E++I DIPGG  AFEICAKFCYGMTVTLNAYN++ +RCAAEYL M+E++EKGN
Sbjct  61   TNETNTGEIYISDIPGGPAAFEICAKFCYGMTVTLNAYNVVVSRCAAEYLGMHESIEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL+SSI +SWKDSIIVLQTTKS LP+ EELKLV HC++++A++A +DVSKVDW
Sbjct  121  LIYKIDVFLSSSIFRSWKDSIIVLQTTKSLLPISEELKLVSHCIDSVATKACMDVSKVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRKKI EEN + DPN++G R+R VPKDWWVE
Sbjct  181  SYTYNRKKIQEENGN-DPNWNGVRNRPVPKDWWVE  214



>ref|XP_004248766.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Solanum 
lycopersicum]
Length=611

 Score =   351 bits (900),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 186/215 (87%), Gaps = 1/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQS+G N+RY ASEL SDI++ +GDVKF+LHKFPLLSKSA LQK+VTN
Sbjct  1    MKFMKLGSKPDTFQSDGKNIRYAASELDSDIVVSVGDVKFHLHKFPLLSKSARLQKMVTN  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            S+EG  DEVHI D+PGG TAFE+C KFCYGMTVTLNAYN+IAARCAAEYL M+E VEKGN
Sbjct  61   SSEGGSDEVHIHDVPGGPTAFEMCVKFCYGMTVTLNAYNVIAARCAAEYLGMDETVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL+S+I +SWKDSII LQTTKS LP+ EE+KL+ HC +AIAS+ SIDV KVDW
Sbjct  121  LIYKIDVFLHSTIFRSWKDSIIFLQTTKSRLPLSEEVKLISHCTDAIASKTSIDVHKVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNR KI EEN +  PN +G RSR+VP DWWV+
Sbjct  181  SYTYNRTKIPEENGN-GPNSNGLRSRVVPNDWWVD  214



>ref|XP_008236444.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Prunus 
mume]
Length=626

 Score =   351 bits (900),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 192/215 (89%), Gaps = 1/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++GNN+RYVA++LA+DII+++GD KFYLHKFPLLSKSA LQKLV N
Sbjct  1    MKFMKLGSKPDSFQTDGNNVRYVATDLATDIIVNVGDSKFYLHKFPLLSKSARLQKLVAN  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N  E++I DIPGG  AFEICAKFCYGMTVTLNAYN++ +RCAAEYL M+E++EKGN
Sbjct  61   TNESNTGEIYISDIPGGPAAFEICAKFCYGMTVTLNAYNVVVSRCAAEYLGMHESIEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL+SSI +SWKDSIIVLQTTKS LP+ EELKLV  C+++IA++A +DVS+VDW
Sbjct  121  LIYKIDVFLSSSIFRSWKDSIIVLQTTKSLLPISEELKLVSQCIDSIATKACVDVSQVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRKKI EEN + DPN++G R+R VPKDWWVE
Sbjct  181  SYTYNRKKIPEENGN-DPNWNGVRNRPVPKDWWVE  214



>ref|XP_002525260.1| signal transducer, putative [Ricinus communis]
 gb|EEF37088.1| signal transducer, putative [Ricinus communis]
Length=488

 Score =   347 bits (889),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 163/216 (75%), Positives = 190/216 (88%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G+N+RYVA+ELA+DI+I++GDVKFYLHKFPLLSKSA LQKLV N
Sbjct  1    MKFMKLGSKPDSFQADGDNIRYVATELATDIVINVGDVKFYLHKFPLLSKSARLQKLVAN  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +N+ N DE+HI+DIPGG  AFEICAKFCYGMTVTLNAYN+IAARCAAEYLEM E VEKGN
Sbjct  61   TNDENSDEIHIQDIPGGPAAFEICAKFCYGMTVTLNAYNVIAARCAAEYLEMYETVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VFLNSSI +SWKDSIIVLQTTKS LP  EELKLV HC+++IAS+A ID SKV+W
Sbjct  121  LIYKIEVFLNSSIFRSWKDSIIVLQTTKSLLPWAEELKLVNHCLDSIASKACIDTSKVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGAR-SRMVPKDWWVE  1
            SYTYN+KK+  EN   DP ++G R  ++VP DWWVE
Sbjct  181  SYTYNKKKLPSENGK-DPMWNGVRKPQIVPNDWWVE  215



>ref|XP_007201732.1| hypothetical protein PRUPE_ppa002913mg [Prunus persica]
 gb|EMJ02931.1| hypothetical protein PRUPE_ppa002913mg [Prunus persica]
Length=622

 Score =   351 bits (900),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 192/215 (89%), Gaps = 1/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++GNN+RYVA++LA+DII+++GD KFYLHKFPLLSKSA LQKLV N
Sbjct  1    MKFMKLGSKPDSFQTDGNNVRYVATDLATDIIVNVGDSKFYLHKFPLLSKSARLQKLVAN  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N  E++I DIPGG  AFEICAKFCYGMTVTLNAYN++ +RCAAEYL M+E++EKGN
Sbjct  61   TNESNTGEIYISDIPGGPAAFEICAKFCYGMTVTLNAYNVVVSRCAAEYLGMHESIEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL+SSI +SWKDSIIVLQTTKS LP+ EELKLV  C+++IA++A +DVS+VDW
Sbjct  121  LIYKIDVFLSSSIFRSWKDSIIVLQTTKSLLPISEELKLVSQCIDSIATKACVDVSQVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRKKI EEN + DPN++G R+R VPKDWWVE
Sbjct  181  SYTYNRKKIPEENGN-DPNWNGVRNRPVPKDWWVE  214



>ref|XP_010272331.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nelumbo 
nucifera]
 ref|XP_010272334.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nelumbo 
nucifera]
Length=629

 Score =   351 bits (900),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 162/216 (75%), Positives = 188/216 (87%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ+EGNN+RYVA+ELA+DII+++GDVKFYLHKFPLLSKSA LQKLV+ 
Sbjct  1    MKFMKLGSKPDSFQTEGNNVRYVATELATDIIVNVGDVKFYLHKFPLLSKSARLQKLVST  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N DE+HI DIPGG  AFE+CAKFCYGMTVTLNAYN++A RCAAEYLEM E +EKGN
Sbjct  61   TNEDNTDEIHIPDIPGGPVAFEVCAKFCYGMTVTLNAYNVVAGRCAAEYLEMYETIEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL SSI +SWKDSII LQTTKS LP CEELK+V HC+++IAS+A ID SKV+W
Sbjct  121  LIYKIDVFLTSSIFRSWKDSIIALQTTKSLLPWCEELKVVSHCIDSIASKALIDTSKVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARS-RMVPKDWWVE  1
            SYTYNRKK+  EN   DP+++G R  + VPKDWWVE
Sbjct  181  SYTYNRKKLPSENG-TDPHWNGIRKLQTVPKDWWVE  215



>ref|XP_002264153.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Vitis vinifera]
 ref|XP_010647924.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Vitis vinifera]
 ref|XP_010647925.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Vitis vinifera]
Length=626

 Score =   350 bits (898),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/216 (75%), Positives = 194/216 (90%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++GN++RYVASELA+DI++++G+VKFYLHKFPLLSKS  LQKLV  
Sbjct  1    MKFMKLGSKPDSFQTDGNSVRYVASELATDIVVNVGEVKFYLHKFPLLSKSECLQKLVAA  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +N+GN DEVHI DIPGG +AFEICAKFCYGMTVTLNAYN++AARCAAEYL M+E +EKGN
Sbjct  61   TNDGNSDEVHIPDIPGGPSAFEICAKFCYGMTVTLNAYNVVAARCAAEYLGMHETIEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFLNSSI +SWKDSIIVLQTTKS LP+ E+LK++ HC+++IAS+ASIDVS+VDW
Sbjct  121  LIYKIDVFLNSSIFRSWKDSIIVLQTTKSLLPLSEDLKVISHCIDSIASKASIDVSRVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSR-MVPKDWWVE  1
            SYTYNRKK+ EEN   DP ++G  +R +VPKDWWVE
Sbjct  181  SYTYNRKKLPEENG-TDPKWNGVGNRPVVPKDWWVE  215



>gb|KHG02234.1| BTB/POZ domain-containing NPY2 -like protein [Gossypium arboreum]
Length=624

 Score =   350 bits (898),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 165/215 (77%), Positives = 188/215 (87%), Gaps = 1/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQS+GNN RYVASELA+DI + +GDVKFYLHKFPLLSKSA+LQKLV +
Sbjct  1    MKFMKLGSKPDTFQSDGNNARYVASELATDITVTVGDVKFYLHKFPLLSKSAYLQKLVAS  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
             NE N DE+ I DIPGG  AFEICAKFCYGMTVTLNAYN++AARCAAEYL M+E +EKGN
Sbjct  61   GNEENNDEIQISDIPGGPVAFEICAKFCYGMTVTLNAYNVVAARCAAEYLGMHETIEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFLNSSI  SWKDSIIVLQT+KS LP+ EELK+VG C++AIA++A IDVSKVDW
Sbjct  121  LIYKIDVFLNSSIFHSWKDSIIVLQTSKSMLPLSEELKVVGLCIDAIATKACIDVSKVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNR+K+ EEN + D N +G R+R VPKDWWVE
Sbjct  181  SYTYNRRKVPEENGN-DLNCNGFRNRPVPKDWWVE  214



>ref|XP_006422840.1| hypothetical protein CICLE_v10028033mg [Citrus clementina]
 gb|ESR36080.1| hypothetical protein CICLE_v10028033mg [Citrus clementina]
Length=619

 Score =   350 bits (897),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 190/215 (88%), Gaps = 1/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++GNN+RY ASELA+D+I+ + D+KF+LHKFPLLSKSA LQKLV  
Sbjct  1    MKFMKLGSKPDSFQADGNNVRYAASELATDVIVVVDDIKFHLHKFPLLSKSACLQKLVAT  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N +EV I DIPGG +AFE CAKFCYGMTVTLNAYN++AARCAAEYL M+E+VEKGN
Sbjct  61   ANEANNNEVDISDIPGGPSAFETCAKFCYGMTVTLNAYNVVAARCAAEYLGMHESVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
             +YKIDVF++SSIL+SWKDSIIVLQTTKS LPM EELK+  HC+EAIA++A +DVSKVDW
Sbjct  121  FVYKIDVFISSSILRSWKDSIIVLQTTKSLLPMSEELKVASHCIEAIATKACVDVSKVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRKK+ EEN + DPN++G R+R VPKDWWVE
Sbjct  181  SYTYNRKKLPEENGN-DPNWNGVRTRAVPKDWWVE  214



>ref|XP_004511848.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Cicer 
arietinum]
Length=627

 Score =   349 bits (896),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 164/216 (76%), Positives = 193/216 (89%), Gaps = 3/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G+N+RYVA+ELASDI+I++GDVKFYLHKFPLLSKS  LQKLV+N
Sbjct  1    MKFMKLGSKPDSFQTDGDNVRYVATELASDIVINVGDVKFYLHKFPLLSKSLRLQKLVSN  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N DEVHI DIPGG  AFEICAKFCYGM VTLNAYN++AARCAAEYLEM E VEKGN
Sbjct  61   TNEEN-DEVHIHDIPGGPVAFEICAKFCYGMVVTLNAYNVVAARCAAEYLEMYETVEKGN  119

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VFLNSSI +SWKDSIIVLQTTKS LP+ EELK+V HC+E+IA++AS+D S+V+W
Sbjct  120  LIYKIEVFLNSSIFRSWKDSIIVLQTTKSLLPLSEELKVVSHCIESIATKASMDTSRVEW  179

Query  105  SYTYNRKKIHEENNDIDPNFDGARSR-MVPKDWWVE  1
            SYTYNRKK+  EN + DP+++G R + MVPKDWWVE
Sbjct  180  SYTYNRKKLPSENGN-DPHWNGVRKQLMVPKDWWVE  214



>ref|XP_010277066.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Nelumbo nucifera]
 ref|XP_010277067.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Nelumbo nucifera]
Length=630

 Score =   349 bits (896),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 161/216 (75%), Positives = 192/216 (89%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKP+ FQ+EG+N+RYVA+ELA+DII+++GD+KFYLHKFPLLSKSA LQKLV+N
Sbjct  1    MKFMKLGSKPNSFQTEGSNVRYVATELATDIIVNVGDMKFYLHKFPLLSKSARLQKLVSN  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N DE+HI DIPGG  AFEICAKFCYGMTVTLNAYN++AARCAAEYLEM+E +EKGN
Sbjct  61   TNEENNDEIHIPDIPGGPAAFEICAKFCYGMTVTLNAYNVVAARCAAEYLEMHETIEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            L+YKIDVFL SSI +SWKDSII LQTTKS LP CEELK+V HC+++IAS+ASID S+V+W
Sbjct  121  LVYKIDVFLTSSIFRSWKDSIITLQTTKSLLPWCEELKVVSHCIDSIASKASIDTSRVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARS-RMVPKDWWVE  1
            SYTYNRKK+  EN   DP++ G R  ++VPKDWWVE
Sbjct  181  SYTYNRKKLPSENW-TDPDWKGVRKYQVVPKDWWVE  215



>ref|XP_007042621.1| Phototropic-responsive NPH3 family protein isoform 2 [Theobroma 
cacao]
 ref|XP_007042622.1| Phototropic-responsive NPH3 family protein isoform 2 [Theobroma 
cacao]
 gb|EOX98452.1| Phototropic-responsive NPH3 family protein isoform 2 [Theobroma 
cacao]
 gb|EOX98453.1| Phototropic-responsive NPH3 family protein isoform 2 [Theobroma 
cacao]
Length=624

 Score =   348 bits (893),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 161/215 (75%), Positives = 187/215 (87%), Gaps = 1/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQS+GNN+RYVASELA+DI + +GDVKFYLHKFPLLSKS+ LQKLV +
Sbjct  1    MKFMKLGSKPDTFQSDGNNVRYVASELATDITVIVGDVKFYLHKFPLLSKSSCLQKLVAS  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            SNE   DEV I DIPGG  AFE+CAKFCY MTVTLNAYN++AARCAAEYL M+E +EKGN
Sbjct  61   SNEEKSDEVQISDIPGGPVAFEMCAKFCYAMTVTLNAYNVVAARCAAEYLGMHETIEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYK+DVFLNSSI +SWKDSIIVLQTTKS LP+ EELK+V  C++A+A +A +DVS VDW
Sbjct  121  LIYKVDVFLNSSIFRSWKDSIIVLQTTKSMLPLSEELKVVSLCIDAVAIKACVDVSNVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNR+K+ EEN + DPN++G RSR VPKDWWVE
Sbjct  181  SYTYNRRKLPEENGN-DPNYNGVRSRPVPKDWWVE  214



>ref|XP_002313906.1| phototropic-responsive NPH3 family protein [Populus trichocarpa]
 gb|EEE87861.1| phototropic-responsive NPH3 family protein [Populus trichocarpa]
Length=613

 Score =   348 bits (892),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 157/215 (73%), Positives = 191/215 (89%), Gaps = 1/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ+EGN++RYVA+ELA+DII+++GD+KFYLHKFPLLSKSAHLQ LVT 
Sbjct  1    MKFMKLGSKPDSFQAEGNSIRYVATELATDIIVNVGDIKFYLHKFPLLSKSAHLQNLVTI  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +N  N DEV I DIPGG +AFEICAK+CYGMTVTLNAYN+++ARCAAEYL M+E +EKGN
Sbjct  61   ANGENSDEVEISDIPGGPSAFEICAKYCYGMTVTLNAYNVVSARCAAEYLGMHETIEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL+SSI  SWKDSIIVLQTT+S LP+ EELK+  HC+ A+A++A +DVSKV+W
Sbjct  121  LIYKIDVFLSSSIFHSWKDSIIVLQTTRSLLPLSEELKVTSHCIHAVATKACVDVSKVNW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SY+YNR+K+ EEN + DPN +G R+R+VPKDWWVE
Sbjct  181  SYSYNRRKLPEENGN-DPNLNGLRNRLVPKDWWVE  214



>ref|XP_007042620.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
 gb|EOX98451.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
Length=640

 Score =   348 bits (894),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 161/218 (74%), Positives = 187/218 (86%), Gaps = 1/218 (0%)
 Frame = -2

Query  654  FGRMKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKL  475
               MKFMKLGSKPD FQS+GNN+RYVASELA+DI + +GDVKFYLHKFPLLSKS+ LQKL
Sbjct  14   LANMKFMKLGSKPDTFQSDGNNVRYVASELATDITVIVGDVKFYLHKFPLLSKSSCLQKL  73

Query  474  VTNSNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVE  295
            V +SNE   DEV I DIPGG  AFE+CAKFCY MTVTLNAYN++AARCAAEYL M+E +E
Sbjct  74   VASSNEEKSDEVQISDIPGGPVAFEMCAKFCYAMTVTLNAYNVVAARCAAEYLGMHETIE  133

Query  294  KGNLIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSK  115
            KGNLIYK+DVFLNSSI +SWKDSIIVLQTTKS LP+ EELK+V  C++A+A +A +DVS 
Sbjct  134  KGNLIYKVDVFLNSSIFRSWKDSIIVLQTTKSMLPLSEELKVVSLCIDAVAIKACVDVSN  193

Query  114  VDWSYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            VDWSYTYNR+K+ EEN + DPN++G RSR VPKDWWVE
Sbjct  194  VDWSYTYNRRKLPEENGN-DPNYNGVRSRPVPKDWWVE  230



>gb|KHG12565.1| BTB/POZ domain-containing NPY2 -like protein [Gossypium arboreum]
Length=619

 Score =   347 bits (891),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 162/216 (75%), Positives = 190/216 (88%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G  +R+VASELA+D+++++GDVKFYLHKFPLLSKSA LQKLV  
Sbjct  1    MKFMKLGSKPDSFQTDGGYIRFVASELATDMVVNVGDVKFYLHKFPLLSKSARLQKLVAA  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +N+ NGDE+HI+DIPGG  AFE+CAKFCYGMTVTLNAYN++AARCAAEYLEM E VEKGN
Sbjct  61   TNDANGDEIHIQDIPGGPAAFEVCAKFCYGMTVTLNAYNVVAARCAAEYLEMYETVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFLNSSI +SWKDSIIVLQTTKS LP  EELK+V HC+++IAS+ASID SKV+W
Sbjct  121  LIYKIDVFLNSSIFRSWKDSIIVLQTTKSLLPWSEELKVVSHCLDSIASKASIDTSKVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGAR-SRMVPKDWWVE  1
            SYTYNRKKI  EN +  P ++ AR  +MVPKDWWVE
Sbjct  181  SYTYNRKKIASENGN-SPQWNDARKPQMVPKDWWVE  215



>ref|XP_007143108.1| hypothetical protein PHAVU_007G044300g [Phaseolus vulgaris]
 gb|ESW15102.1| hypothetical protein PHAVU_007G044300g [Phaseolus vulgaris]
Length=624

 Score =   346 bits (888),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 158/215 (73%), Positives = 190/215 (88%), Gaps = 1/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++GNN RYVASELASDI++ +GD+KFYLHKFPLLSKS+HLQ L++ 
Sbjct  1    MKFMKLGSKPDTFQTDGNNARYVASELASDIVVSVGDIKFYLHKFPLLSKSSHLQTLISL  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N DEV I DIPGG + FEICAKFCYGMTVTLNAYN+IA RCAAEYL M+E +EKGN
Sbjct  61   NNEENLDEVQISDIPGGASTFEICAKFCYGMTVTLNAYNVIATRCAAEYLGMHETIEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            L+YKIDVFL+SSI +SWKDSII+LQT+KS LP+ E+LK+V HCV++IA++A +DVSKVDW
Sbjct  121  LVYKIDVFLSSSIFRSWKDSIILLQTSKSMLPLVEDLKVVSHCVDSIANKACVDVSKVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRKK+ EEN  I+ N +G R+R+VPKDWWVE
Sbjct  181  SYTYNRKKLPEENG-IESNQNGLRTRLVPKDWWVE  214



>ref|XP_003555987.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Glycine max]
 ref|XP_006605997.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Glycine max]
Length=623

 Score =   346 bits (887),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 158/215 (73%), Positives = 190/215 (88%), Gaps = 1/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++GNN+RYVASELASDI++ +GD+KFYLHKFPLLSKS+H+Q L++ 
Sbjct  1    MKFMKLGSKPDTFQTDGNNVRYVASELASDIVVSVGDIKFYLHKFPLLSKSSHIQTLISL  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N DEV I DIPGG   FEICAKFCYGMTVTLNAYN+IA RCAAEYL M+E +EKGN
Sbjct  61   NNEENVDEVQISDIPGGANTFEICAKFCYGMTVTLNAYNVIATRCAAEYLGMHEAIEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL+SSI +SWKDSII+LQT+KS LP+ E+LK+V HC+E+IA++A +DVSKVDW
Sbjct  121  LIYKIDVFLSSSIFRSWKDSIILLQTSKSMLPLVEDLKVVSHCIESIANKACVDVSKVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRKK+ EEN  I+ N +G R+R+VPKDWWVE
Sbjct  181  SYTYNRKKLPEENG-IESNQNGLRTRLVPKDWWVE  214



>gb|KHN42319.1| BTB/POZ domain-containing protein NPY2 [Glycine soja]
Length=623

 Score =   346 bits (887),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 158/215 (73%), Positives = 190/215 (88%), Gaps = 1/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++GNN+RYVASELASDI++ +GD+KFYLHKFPLLSKS+H+Q L++ 
Sbjct  1    MKFMKLGSKPDTFQTDGNNVRYVASELASDIVVSVGDIKFYLHKFPLLSKSSHIQTLISL  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N DEV I DIPGG   FEICAKFCYGMTVTLNAYN+IA RCAAEYL M+E +EKGN
Sbjct  61   NNEENVDEVQISDIPGGANTFEICAKFCYGMTVTLNAYNVIATRCAAEYLGMHEAIEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL+SSI +SWKDSII+LQT+KS LP+ E+LK+V HC+E+IA++A +DVSKVDW
Sbjct  121  LIYKIDVFLSSSIFRSWKDSIILLQTSKSMLPLVEDLKVVSHCIESIANKACVDVSKVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRKK+ EEN  I+ N +G R+R+VPKDWWVE
Sbjct  181  SYTYNRKKLPEENG-IESNQNGLRTRLVPKDWWVE  214



>ref|XP_009776135.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Nicotiana 
sylvestris]
Length=614

 Score =   345 bits (886),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 163/216 (75%), Positives = 190/216 (88%), Gaps = 5/216 (2%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQS+G N+RYVASELASDI+++IGDVKFYLHKFPL+SKSA LQKLV +
Sbjct  1    MKFMKLGSKPDTFQSDGKNIRYVASELASDIVVNIGDVKFYLHKFPLMSKSACLQKLVAS  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            ++EGNGDEV+I DIPGG +AFEICAKFCY MTVTLNAYN+IAARCAAEYLEM+E VEKGN
Sbjct  61   TSEGNGDEVYIHDIPGGPSAFEICAKFCYSMTVTLNAYNVIAARCAAEYLEMHETVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTK-SHLPMCEELKLVGHCVEAIASRASIDVSKVD  109
            LIYK+DVFL+SSI +SWKDSII+LQTTK S L MCEE+KL+ +C++AIAS+  IDV KVD
Sbjct  121  LIYKVDVFLHSSIFRSWKDSIILLQTTKSSRLHMCEEVKLISYCIDAIASKTCIDVRKVD  180

Query  108  WSYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            WSYTYNR KI +EN     N +G RSR+VP DWWV+
Sbjct  181  WSYTYNRTKIPDENG----NSNGIRSRVVPNDWWVD  212



>ref|XP_007047500.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007047501.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007047502.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
 gb|EOX91657.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
 gb|EOX91658.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
 gb|EOX91659.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
Length=622

 Score =   345 bits (886),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 161/216 (75%), Positives = 190/216 (88%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G+N+RYVA+ELA+D++++IGDVKFYLHKFPLLSKSA LQKLV  
Sbjct  1    MKFMKLGSKPDSFQTDGDNIRYVATELATDLVVNIGDVKFYLHKFPLLSKSARLQKLVAT  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            S++ N DE+HI+DIPGG  AFEICAKFCYGMTVTLNAYN++AARCAAEYLEM E VEKGN
Sbjct  61   SSDENSDEIHIQDIPGGPAAFEICAKFCYGMTVTLNAYNVVAARCAAEYLEMYETVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFLN SI +SWKDSIIVLQTTKS LP  EE+K+V HC+++IAS+ASID SKV+W
Sbjct  121  LIYKIDVFLNLSIFRSWKDSIIVLQTTKSLLPWSEEIKVVSHCLDSIASKASIDTSKVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGAR-SRMVPKDWWVE  1
            SYTYNRKK+  EN +  P ++G R  +MVPKDWWVE
Sbjct  181  SYTYNRKKLPSENGN-SPQWNGVRKPQMVPKDWWVE  215



>ref|XP_008346361.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Malus 
domestica]
 ref|XP_008346362.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Malus 
domestica]
Length=626

 Score =   345 bits (885),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 190/215 (88%), Gaps = 1/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++ NN+RYVA++LA+DII+++GD KFYLHKFPLLSKSA LQK V N
Sbjct  1    MKFMKLGSKPDSFQTDXNNVRYVATDLATDIIVNVGDSKFYLHKFPLLSKSARLQKWVAN  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            SNE N  E++I DIPGG  AFEICAKFCYGMTVTLNAYN++ +RCAAEYL M+E++EKGN
Sbjct  61   SNESNTGEIYISDIPGGPAAFEICAKFCYGMTVTLNAYNVVVSRCAAEYLGMHESIEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL+SSI +SWKDSIIVLQTTKS LP+ EELKLV H +++IA++A +D+SKVDW
Sbjct  121  LIYKIDVFLSSSIFRSWKDSIIVLQTTKSLLPISEELKLVSHGIDSIATKACMDISKVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRKKI EEN + DPN++G R+R VPKDWWVE
Sbjct  181  SYTYNRKKIQEENGN-DPNWNGVRNRPVPKDWWVE  214



>ref|XP_011092513.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Sesamum indicum]
Length=623

 Score =   345 bits (884),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 156/215 (73%), Positives = 188/215 (87%), Gaps = 1/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPDCFQ +GNN RYVA+E+ +D ++H+ DVKF+LHKFPLLSK A LQKLV++
Sbjct  1    MKFMKLGSKPDCFQGDGNNRRYVATEMETDFVVHVADVKFHLHKFPLLSKCACLQKLVSS  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NEGN DEVHI DIPGG +AFEICAKFCYGMTV +NAYN+++ RCAAEYLEMNE +EKGN
Sbjct  61   ANEGNSDEVHIPDIPGGPSAFEICAKFCYGMTVNVNAYNVVSVRCAAEYLEMNEMIEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVF+NS+IL+SWKDSII LQTTKS LP+ EELKL+   ++AIAS+AS+D+S VDW
Sbjct  121  LIYKIDVFINSTILRSWKDSIIALQTTKSSLPLSEELKLISRFIDAIASKASVDISDVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNR+K  EEN + DP+++G RSR VP DWWVE
Sbjct  181  SYTYNRRKNVEENGN-DPSWNGVRSRTVPNDWWVE  214



>ref|XP_006579940.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Glycine max]
 ref|XP_006579941.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Glycine max]
Length=624

 Score =   344 bits (882),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 160/216 (74%), Positives = 191/216 (88%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G+N+RYVA+ELA+DI++++G+VKFYLHKFPLLS+S   QKL+TN
Sbjct  1    MKFMKLGSKPDSFQNDGDNIRYVATELATDIVVNVGNVKFYLHKFPLLSRSTCFQKLITN  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N DEVHI DIPGG  AFEICAKFCYGMTVTLNAYN++AARCAAEYLEM E VEKGN
Sbjct  61   ANEENNDEVHIHDIPGGPAAFEICAKFCYGMTVTLNAYNVVAARCAAEYLEMYETVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VFLNSSI +SWKDSIIVLQTTKS LP  EELKLV H +++IA++ASID SKV+W
Sbjct  121  LIYKIEVFLNSSIFRSWKDSIIVLQTTKSLLPWSEELKLVSHGIDSIATKASIDTSKVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGAR-SRMVPKDWWVE  1
            SYTYNRKK+  EN++ DP+F+  R  ++VPKDWWVE
Sbjct  181  SYTYNRKKLPSENSN-DPHFNSVRKQQLVPKDWWVE  215



>ref|XP_003536583.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Glycine max]
 ref|XP_006589617.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Glycine max]
 ref|XP_006589618.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X3 [Glycine max]
 ref|XP_006589619.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X4 [Glycine max]
 gb|KHN06801.1| BTB/POZ domain-containing protein NPY2 [Glycine soja]
Length=624

 Score =   343 bits (881),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 158/215 (73%), Positives = 190/215 (88%), Gaps = 1/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++GNN+RYVASELASDI++++GD+KFYLHKFPLLSKS+ LQ L++ 
Sbjct  1    MKFMKLGSKPDTFQTDGNNVRYVASELASDIVVNVGDIKFYLHKFPLLSKSSRLQTLISL  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N DEV I DIPGG   FEICAKFCYGMTVTLNAYN+IA RCAAEYL M+E +EKGN
Sbjct  61   NNEENVDEVQIFDIPGGANTFEICAKFCYGMTVTLNAYNVIATRCAAEYLGMHEAIEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL+SSI +SWKDSII+LQT+KS LP+ E+LK+V HC+E+IA++A +DVSKVDW
Sbjct  121  LIYKIDVFLSSSIFRSWKDSIILLQTSKSMLPLVEDLKVVSHCIESIANKACVDVSKVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRKK+ EEN  I+ N +G R+R+VPKDWWVE
Sbjct  181  SYTYNRKKLPEENG-IESNQNGLRTRLVPKDWWVE  214



>ref|XP_007155836.1| hypothetical protein PHAVU_003G235700g [Phaseolus vulgaris]
 ref|XP_007155837.1| hypothetical protein PHAVU_003G235700g [Phaseolus vulgaris]
 gb|ESW27830.1| hypothetical protein PHAVU_003G235700g [Phaseolus vulgaris]
 gb|ESW27831.1| hypothetical protein PHAVU_003G235700g [Phaseolus vulgaris]
Length=628

 Score =   343 bits (881),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 157/216 (73%), Positives = 194/216 (90%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G+N+RYVA+ELA+DI++++G+VKFYLHKFPLLSKSA +QK++TN
Sbjct  1    MKFMKLGSKPDSFQNDGDNIRYVATELATDIVVNVGNVKFYLHKFPLLSKSARIQKVITN  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            ++E N DEVHI+DIPGG  AFEICAKFCYGMTVTLNAYN++AARCAAEYLEM+E VEKGN
Sbjct  61   TSEENNDEVHIQDIPGGPAAFEICAKFCYGMTVTLNAYNVVAARCAAEYLEMHETVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VFLNSSI +SWKDSIIVLQTT S LP  EELK+V H ++++A++ASID SKV+W
Sbjct  121  LIYKIEVFLNSSIFRSWKDSIIVLQTTMSLLPWSEELKVVSHAIDSVATKASIDTSKVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGAR-SRMVPKDWWVE  1
            SYTYNRKK+  EN++ DP+F+  R  ++VPKDWWVE
Sbjct  181  SYTYNRKKLPSENSN-DPHFNNVRKQQLVPKDWWVE  215



>ref|XP_010086948.1| BTB/POZ domain-containing protein NPY2 [Morus notabilis]
 gb|EXB25084.1| BTB/POZ domain-containing protein NPY2 [Morus notabilis]
Length=630

 Score =   343 bits (881),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 163/216 (75%), Positives = 187/216 (87%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G+N RYVASELA+DI++++G VKFYLHKFPLLSKSA LQKLV+N
Sbjct  1    MKFMKLGSKPDSFQTDGDNSRYVASELATDIVVNVGSVKFYLHKFPLLSKSARLQKLVSN  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            SNE N DE++I DIPGG  AFEIC+KFCYGMTVTLNAYN++AARCAAEYLEM E VEKGN
Sbjct  61   SNEENTDEINIHDIPGGPAAFEICSKFCYGMTVTLNAYNVVAARCAAEYLEMYETVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFLNSSI +SWKDSIIVLQTTKS  P  EELK+V HC+++IAS+ASID SKV+W
Sbjct  121  LIYKIDVFLNSSIFRSWKDSIIVLQTTKSLFPWSEELKVVSHCLDSIASKASIDTSKVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARS-RMVPKDWWVE  1
            SYTYNRKK+  EN   DP ++G R    VPKDWWVE
Sbjct  181  SYTYNRKKLPSENG-TDPLWNGVRKLPTVPKDWWVE  215



>ref|XP_011001843.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Populus 
euphratica]
 ref|XP_011001851.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Populus 
euphratica]
 ref|XP_011001854.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Populus 
euphratica]
Length=613

 Score =   343 bits (880),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 155/215 (72%), Positives = 190/215 (88%), Gaps = 1/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ+E N++RYVA+ELA+DII+++GD+KFYLHKFPLLSKSA+LQ LVT 
Sbjct  1    MKFMKLGSKPDSFQAEANSIRYVATELATDIIVNVGDIKFYLHKFPLLSKSAYLQNLVTI  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +N  N DEV I DIPGG +AFEICAK+CYGMTVTLNAYN++AARCAAEYL M+E +EKGN
Sbjct  61   ANGENSDEVEISDIPGGPSAFEICAKYCYGMTVTLNAYNVVAARCAAEYLGMHETIEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL+SSI  SWKDSIIVLQTT+S LP+ EELK+  HC+ A+A++A +DVSKV+W
Sbjct  121  LIYKIDVFLSSSIFHSWKDSIIVLQTTRSLLPLSEELKVTSHCIHAVATKACVDVSKVNW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            +Y+YNR+K+ EEN + DPN +G R+R+VPKDWWVE
Sbjct  181  AYSYNRRKLPEENGN-DPNLNGLRNRLVPKDWWVE  214



>ref|XP_006426078.1| hypothetical protein CICLE_v10027450mg [Citrus clementina]
 gb|ESR39318.1| hypothetical protein CICLE_v10027450mg [Citrus clementina]
Length=628

 Score =   343 bits (880),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 160/216 (74%), Positives = 190/216 (88%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ+EGNN+RYVA+ELA+DI+ ++GDVKFYLHKFPLLSKSA LQKLV  
Sbjct  1    MKFMKLGSKPDSFQTEGNNIRYVATELATDIVFNVGDVKFYLHKFPLLSKSARLQKLVAA  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +N+ N DE+ I+DIPGG  AFEICAKFCYGMTVTLNAYN++AARCAAEYLEM E VEKGN
Sbjct  61   TNDDNSDEMPIQDIPGGPAAFEICAKFCYGMTVTLNAYNVVAARCAAEYLEMYETVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VFLN+SI +SWKDSIIVLQTT+S LP  EELK+V HC+++IA++ASID SKV+W
Sbjct  121  LIYKIEVFLNTSIFRSWKDSIIVLQTTRSLLPWSEELKVVSHCLDSIATKASIDTSKVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGAR-SRMVPKDWWVE  1
            SYTYNRKK+  EN + DP+++G R  + VPKDWWVE
Sbjct  181  SYTYNRKKLPSENGN-DPHWNGMRKPQSVPKDWWVE  215



>gb|KHN23238.1| BTB/POZ domain-containing protein NPY2 [Glycine soja]
Length=629

 Score =   343 bits (880),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/216 (74%), Positives = 190/216 (88%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G+N+RYVA+ELA+DI++++G+VKFYLHKFPLLSKSA  QKL+TN
Sbjct  1    MKFMKLGSKPDSFQNDGDNIRYVATELATDIVVNVGNVKFYLHKFPLLSKSAGFQKLITN  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N DEVHI DIPGG  AFEIC KFCYGMTVTLNAYN++AARCAAEYLEM E VEKGN
Sbjct  61   TNEENNDEVHIHDIPGGPAAFEICVKFCYGMTVTLNAYNVVAARCAAEYLEMYETVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VFL+SSI +SWKDSIIVLQTTKS LP  EELKLV H +++IA++ASID SKV+W
Sbjct  121  LIYKIEVFLDSSIFRSWKDSIIVLQTTKSLLPWSEELKLVSHGIDSIATKASIDTSKVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGAR-SRMVPKDWWVE  1
            SYTYNRKK+  EN++ DP+F   R  ++VPKDWWVE
Sbjct  181  SYTYNRKKLPSENSN-DPHFSSVRKQQLVPKDWWVE  215



>gb|KDO78947.1| hypothetical protein CISIN_1g041399mg [Citrus sinensis]
Length=617

 Score =   343 bits (879),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 159/216 (74%), Positives = 190/216 (88%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ+EGNN+RYVA+ELA+DI+ ++GDVKFYLHKFPLLSKSA LQKLV  
Sbjct  1    MKFMKLGSKPDSFQTEGNNIRYVATELATDIVFNVGDVKFYLHKFPLLSKSARLQKLVAA  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +N+ N DE+ I+DIPGG  AFEICAKFCYGMTVTLNAYN++AARCAAEYLEM E VEKGN
Sbjct  61   TNDDNSDEMPIQDIPGGPAAFEICAKFCYGMTVTLNAYNVVAARCAAEYLEMYETVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VFLN+SI +SWKDSIIVLQTT+S LP  EELK+V HC+++IA++ASID SKV+W
Sbjct  121  LIYKIEVFLNTSIFRSWKDSIIVLQTTRSLLPWSEELKVVSHCLDSIATKASIDTSKVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGAR-SRMVPKDWWVE  1
            SYTYNR+K+  EN + DP+++G R  + VPKDWWVE
Sbjct  181  SYTYNRRKLPSENGN-DPHWNGMRKPQSVPKDWWVE  215



>ref|XP_008440372.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Cucumis melo]
 ref|XP_008440373.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Cucumis melo]
 ref|XP_008440374.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Cucumis melo]
 ref|XP_008440375.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Cucumis melo]
 ref|XP_008440376.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Cucumis melo]
 ref|XP_008440377.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Cucumis melo]
 ref|XP_008440378.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Cucumis melo]
 ref|XP_008440379.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Cucumis melo]
 ref|XP_008440380.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Cucumis melo]
Length=626

 Score =   343 bits (879),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 161/216 (75%), Positives = 190/216 (88%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G+ +RYVA+ELA+DI++++GDVKFYLHKFPLLSKSA LQKLV+ 
Sbjct  1    MKFMKLGSKPDAFQTDGDKIRYVATELATDIVVNVGDVKFYLHKFPLLSKSARLQKLVSL  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            SNE N DE+HI DIPGG  AFEICAKFCYGM VTLNAYN+IAARCAAEYLEM E +EKGN
Sbjct  61   SNEENSDEIHILDIPGGAAAFEICAKFCYGMIVTLNAYNVIAARCAAEYLEMYETIEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VFLNSSI +SWKDSIIVLQTTKS LP  EELK+V HC+++IAS+A ID SKV+W
Sbjct  121  LIYKIEVFLNSSIFRSWKDSIIVLQTTKSLLPWSEELKVVNHCLDSIASKACIDTSKVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARS-RMVPKDWWVE  1
            SYTYNRKK+  EN D D +++G R+ ++VPKDWWVE
Sbjct  181  SYTYNRKKLPSENGD-DSHWNGVRTQKLVPKDWWVE  215



>ref|XP_004152268.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Cucumis 
sativus]
 gb|KGN52773.1| hypothetical protein Csa_4G000910 [Cucumis sativus]
Length=626

 Score =   343 bits (879),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/215 (73%), Positives = 188/215 (87%), Gaps = 1/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPDCFQ++G N+RYV SELA+DI + +GDVKFYLHKFPLLSKSAHLQ+LVT 
Sbjct  1    MKFMKLGSKPDCFQTDGTNVRYVVSELATDITVIVGDVKFYLHKFPLLSKSAHLQQLVTA  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
                + DEV+I +IPGG  AFEICAKFCYGMTVTLNAYN++AARCAAEYL M+E +EKGN
Sbjct  61   GTGEHNDEVYIPEIPGGSAAFEICAKFCYGMTVTLNAYNVVAARCAAEYLGMHETIEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            L YKIDVFL+SSI +SWKDSIIVLQ+TKS +P+ EELKLV +C+E+IA +AS D+SKVDW
Sbjct  121  LTYKIDVFLSSSIFRSWKDSIIVLQSTKSLMPLSEELKLVSNCLESIAVKASADISKVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRKK+ EEN + +PN++G R+R VPKDWWVE
Sbjct  181  SYTYNRKKLPEENGN-NPNWNGVRNRSVPKDWWVE  214



>ref|XP_003550011.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Glycine max]
 ref|XP_006600917.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Glycine max]
Length=629

 Score =   343 bits (879),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/216 (74%), Positives = 190/216 (88%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G+N+RYVA+ELA+DI++++G+VKFYLHKFPLLSKSA  QKL+TN
Sbjct  1    MKFMKLGSKPDSFQNDGDNIRYVATELATDIVVNVGNVKFYLHKFPLLSKSAGFQKLITN  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N DEVHI DIPGG  AFEIC KFCYGMTVTLNAYN++AARCAAEYLEM E VEKGN
Sbjct  61   TNEENNDEVHIHDIPGGPAAFEICVKFCYGMTVTLNAYNVVAARCAAEYLEMYETVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VFL+SSI +SWKDSIIVLQTTKS LP  EELKLV H +++IA++ASID SKV+W
Sbjct  121  LIYKIEVFLDSSIFRSWKDSIIVLQTTKSLLPWSEELKLVSHGIDSIATKASIDTSKVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGAR-SRMVPKDWWVE  1
            SYTYNRKK+  EN++ DP F+  R  ++VPKDWWVE
Sbjct  181  SYTYNRKKLPSENSN-DPPFNSVRKQQLVPKDWWVE  215



>gb|KHF97345.1| BTB/POZ domain-containing NPY5 -like protein [Gossypium arboreum]
Length=549

 Score =   340 bits (873),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 183/215 (85%), Gaps = 1/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD F+S+GNN+RYVASELA+DI++ +GD KFYLHKFPLLSKSA LQKLV +
Sbjct  1    MKFMKLGSKPDTFRSDGNNVRYVASELATDIVVTVGDFKFYLHKFPLLSKSACLQKLVAS  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
             NE N DEV I DIPGG   FEICAKFCYGMTV LNAYN+ + RCAAEYL M E +EKGN
Sbjct  61   GNEQNCDEVQISDIPGGSVVFEICAKFCYGMTVNLNAYNIFSTRCAAEYLGMYETIEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKID+FLNSSI+ SWKDSIIVLQTTKS  P+ +ELK+ G CV+A+A+ A IDVSKVDW
Sbjct  121  LIYKIDIFLNSSIVHSWKDSIIVLQTTKSLSPLSDELKVAGLCVDAVATNACIDVSKVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRKK+ EEN + DPNF+G +SR VPKDWWVE
Sbjct  181  SYTYNRKKLPEENGN-DPNFNGVKSRPVPKDWWVE  214



>ref|XP_006466475.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Citrus sinensis]
 ref|XP_006466476.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Citrus sinensis]
Length=628

 Score =   342 bits (877),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/216 (74%), Positives = 190/216 (88%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ+EGNN+RYVA+ELA+DI+ ++GDVKFYLHKFPLLSKSA LQKLV  
Sbjct  1    MKFMKLGSKPDSFQTEGNNIRYVATELATDIVFNVGDVKFYLHKFPLLSKSARLQKLVAA  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +N+ N DE+ I+DIPGG  AFEICAKFCYGMTVTLNAYN++AARCAAEYLEM E VEKGN
Sbjct  61   TNDDNSDEMLIQDIPGGPAAFEICAKFCYGMTVTLNAYNVVAARCAAEYLEMYETVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VFLN+SI +SWKDSIIVLQTT+S LP  EELK+V HC+++IA++ASID SKV+W
Sbjct  121  LIYKIEVFLNTSIFRSWKDSIIVLQTTRSLLPWSEELKVVSHCLDSIATKASIDTSKVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGAR-SRMVPKDWWVE  1
            SYTYNR+K+  EN + DP+++G R  + VPKDWWVE
Sbjct  181  SYTYNRRKLPSENGN-DPHWNGMRKPQSVPKDWWVE  215



>gb|KDP32062.1| hypothetical protein JCGZ_12523 [Jatropha curcas]
Length=623

 Score =   342 bits (876),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 159/216 (74%), Positives = 189/216 (88%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++ +N+RYVA+ELA+DI+I++ DVKFYLHKFPLLSKSA LQKLV N
Sbjct  1    MKFMKLGSKPDSFQADEDNIRYVATELATDIVINVRDVKFYLHKFPLLSKSARLQKLVAN  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +N+ N DE+HI+DIPGG  AFEICAKFCYGMTVTLNAYN++AARCAAEYLEM E VEKGN
Sbjct  61   TNDDNSDEIHIQDIPGGPAAFEICAKFCYGMTVTLNAYNVVAARCAAEYLEMYETVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL+SSI +SWKDSIIVLQTTKS LP+ EELK+V HC+++IAS+A +D SKV+W
Sbjct  121  LIYKIDVFLSSSIFRSWKDSIIVLQTTKSLLPLAEELKVVSHCLDSIASKACMDTSKVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGAR-SRMVPKDWWVE  1
            SYTYNR+K+  EN   DP ++G R  + VPKDWWVE
Sbjct  181  SYTYNRRKLPSENGK-DPIWNGVRKPQTVPKDWWVE  215



>emb|CBI33702.3| unnamed protein product [Vitis vinifera]
Length=586

 Score =   340 bits (873),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 156/216 (72%), Positives = 192/216 (89%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G+N+RYVA+ELA+DI++++GDVKFYLHKFPLLS+SA LQKLV N
Sbjct  1    MKFMKLGSKPDSFQADGDNIRYVATELATDIVVNVGDVKFYLHKFPLLSRSARLQKLVAN  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N DE++I+DIPGG  AFE+CAKFCY MTVTLNAYN++AARCAAEYLEM E VEKGN
Sbjct  61   TNEENNDEIYIQDIPGGPAAFEVCAKFCYSMTVTLNAYNVVAARCAAEYLEMYETVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VFLN+SI +SWKDSIIVLQTTKS LP  EE+K+V HC+++IAS+ASID SKV+W
Sbjct  121  LIYKIEVFLNTSIFRSWKDSIIVLQTTKSLLPWSEEIKVVSHCLDSIASKASIDTSKVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARS-RMVPKDWWVE  1
            SYTYNRKK+  EN + DP+++  +  +MVP+DWWVE
Sbjct  181  SYTYNRKKLPSENGN-DPHWNEVKKHQMVPRDWWVE  215



>ref|XP_011030353.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Populus 
euphratica]
 ref|XP_011030354.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Populus 
euphratica]
 ref|XP_011030355.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Populus 
euphratica]
 ref|XP_011030356.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Populus 
euphratica]
Length=614

 Score =   341 bits (874),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 153/215 (71%), Positives = 188/215 (87%), Gaps = 1/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSK D FQ++GN++RY+A+ELA+DI +++GD+KFYLHKFPLLSKSA LQKLVT 
Sbjct  1    MKFMKLGSKSDSFQADGNSVRYLATELATDITVNVGDIKFYLHKFPLLSKSAQLQKLVTT  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +N  N DEV I DIPGG +AFEICAKFCYGMTVT+NAYN++AARCAAEYL M+E +EKGN
Sbjct  61   ANGENSDEVDISDIPGGRSAFEICAKFCYGMTVTINAYNVVAARCAAEYLGMHETIEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VFL+SSI +SWKDSIIVLQTT+S LP+ EELK++ HC++AIA++A +DVSKVDW
Sbjct  121  LIYKIEVFLSSSIFRSWKDSIIVLQTTRSLLPLSEELKVISHCIDAIAAKACVDVSKVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SY+YNRK + EEN  +  N +G R+R VPKDWWVE
Sbjct  181  SYSYNRKNLPEENGTVS-NLNGLRNRSVPKDWWVE  214



>gb|KHN06014.1| BTB/POZ domain-containing protein NPY2 [Glycine soja]
Length=625

 Score =   341 bits (874),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 161/217 (74%), Positives = 192/217 (88%), Gaps = 3/217 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G+N+RYVA+ELA+DI++++G+VKFYLHKFPLLS+SA  QKL+TN
Sbjct  1    MKFMKLGSKPDSFQNDGDNIRYVATELATDIVVNVGNVKFYLHKFPLLSRSACFQKLITN  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N DEVHI DIPGG  AFEICAKFCYGMTVTLNAYN++AARCAAEYLEM E VEKGN
Sbjct  61   ANEENNDEVHIHDIPGGPAAFEICAKFCYGMTVTLNAYNVVAARCAAEYLEMYETVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VFLNSSI +SWKDSIIVLQTTKS LP  EELKLV H +++IA++ASID SKV+W
Sbjct  121  LIYKIEVFLNSSIFRSWKDSIIVLQTTKSLLPWSEELKLVSHGIDSIATKASIDTSKVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGAR-SRMVPK-DWWVE  1
            SYTYNRKK+  EN++ DP+F+  R  ++VPK DWWVE
Sbjct  181  SYTYNRKKLPSENSN-DPHFNSVRKQQLVPKDDWWVE  216



>ref|XP_004496882.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Cicer arietinum]
 ref|XP_004496883.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Cicer arietinum]
 ref|XP_004496884.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X3 [Cicer arietinum]
Length=611

 Score =   340 bits (873),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 158/215 (73%), Positives = 187/215 (87%), Gaps = 1/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++GNN+RYVASELASDII+ +GD+KFYLHKFPL+SKS+HLQKL++ 
Sbjct  1    MKFMKLGSKPDTFQTDGNNVRYVASELASDIIVSLGDMKFYLHKFPLISKSSHLQKLISL  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            SNE N DE+ I DIPGG +AFEICAKFCYGMTVTLNAYN+IA RCAAEYLEM+E +EKGN
Sbjct  61   SNEENIDEIQISDIPGGASAFEICAKFCYGMTVTLNAYNVIATRCAAEYLEMHETIEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            L+YKIDVFL+SSI + WKDSII+LQTTKS L M EE K+V HC+E+IA++A +DVS VDW
Sbjct  121  LLYKIDVFLSSSIFRGWKDSIILLQTTKSMLSMNEEQKVVNHCIESIANKACVDVSNVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRKK+ EEN   +   +G R+R VPKDWWVE
Sbjct  181  SYTYNRKKLPEENGG-ELKQNGVRTRNVPKDWWVE  214



>ref|XP_004156852.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
NPY2-like [Cucumis sativus]
Length=626

 Score =   341 bits (874),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 157/215 (73%), Positives = 187/215 (87%), Gaps = 1/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPDCFQ++G N+RYV SELA+DI + +GDVKFYLHKFPLLSKSAHLQ+LVT 
Sbjct  1    MKFMKLGSKPDCFQTDGTNVRYVVSELATDITVIVGDVKFYLHKFPLLSKSAHLQQLVTA  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
                + DEV+I +IPGG  AFEICAKFCYGMTVTLNAYN++AARCAAEYL M+E +EKGN
Sbjct  61   GTGEHNDEVYIPEIPGGSAAFEICAKFCYGMTVTLNAYNVVAARCAAEYLGMHETIEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            L YKID FL+SSI +SWKDSIIVLQ+TKS +P+ EELKLV +C+E+IA +AS D+SKVDW
Sbjct  121  LTYKIDXFLSSSIFRSWKDSIIVLQSTKSLMPLSEELKLVSNCLESIAVKASADISKVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRKK+ EEN + +PN++G R+R VPKDWWVE
Sbjct  181  SYTYNRKKLPEENGN-NPNWNGVRNRSVPKDWWVE  214



>ref|XP_011092512.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Sesamum indicum]
Length=624

 Score =   340 bits (873),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 156/216 (72%), Positives = 188/216 (87%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNL-RYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVT  469
            MKFMKLGSKPDCFQ +GNN  RYVA+E+ +D ++H+ DVKF+LHKFPLLSK A LQKLV+
Sbjct  1    MKFMKLGSKPDCFQGDGNNRSRYVATEMETDFVVHVADVKFHLHKFPLLSKCACLQKLVS  60

Query  468  NSNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKG  289
            ++NEGN DEVHI DIPGG +AFEICAKFCYGMTV +NAYN+++ RCAAEYLEMNE +EKG
Sbjct  61   SANEGNSDEVHIPDIPGGPSAFEICAKFCYGMTVNVNAYNVVSVRCAAEYLEMNEMIEKG  120

Query  288  NLIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVD  109
            NLIYKIDVF+NS+IL+SWKDSII LQTTKS LP+ EELKL+   ++AIAS+AS+D+S VD
Sbjct  121  NLIYKIDVFINSTILRSWKDSIIALQTTKSSLPLSEELKLISRFIDAIASKASVDISDVD  180

Query  108  WSYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            WSYTYNR+K  EEN + DP+++G RSR VP DWWVE
Sbjct  181  WSYTYNRRKNVEENGN-DPSWNGVRSRTVPNDWWVE  215



>ref|XP_003611607.1| BTB/POZ domain-containing protein [Medicago truncatula]
 gb|AES94565.1| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=630

 Score =   340 bits (873),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 160/216 (74%), Positives = 191/216 (88%), Gaps = 3/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G+N+RYVA+ELASDI++++GDVKFYLHKFPLLSKS  LQKLV+N
Sbjct  1    MKFMKLGSKPDSFQNDGDNVRYVATELASDIVVNVGDVKFYLHKFPLLSKSLRLQKLVSN  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            ++E N DE+HI DIPGG  AFEICAKFCYGM VTLNAYN++AARCAAEYLEM E +EKGN
Sbjct  61   TDEEN-DEIHIHDIPGGPVAFEICAKFCYGMVVTLNAYNVVAARCAAEYLEMYETIEKGN  119

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VFLNSSI +SWKDSIIVLQTTKS LP  EELK+V HC+E+IA++AS+D SKV+W
Sbjct  120  LIYKIEVFLNSSIFRSWKDSIIVLQTTKSLLPWSEELKIVSHCIESIATKASMDPSKVEW  179

Query  105  SYTYNRKKIHEENNDIDPNFDGARSR-MVPKDWWVE  1
            SYTYNRKK+  EN + D +++G R + MVPKDWWVE
Sbjct  180  SYTYNRKKLPSENGN-DAHWNGVRKQLMVPKDWWVE  214



>ref|XP_002284345.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Vitis vinifera]
 ref|XP_010652712.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Vitis vinifera]
 ref|XP_010652713.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Vitis vinifera]
 ref|XP_010652714.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Vitis vinifera]
 ref|XP_010652715.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Vitis vinifera]
 ref|XP_010652716.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Vitis vinifera]
Length=629

 Score =   340 bits (872),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 156/216 (72%), Positives = 192/216 (89%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G+N+RYVA+ELA+DI++++GDVKFYLHKFPLLS+SA LQKLV N
Sbjct  1    MKFMKLGSKPDSFQADGDNIRYVATELATDIVVNVGDVKFYLHKFPLLSRSARLQKLVAN  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N DE++I+DIPGG  AFE+CAKFCY MTVTLNAYN++AARCAAEYLEM E VEKGN
Sbjct  61   TNEENNDEIYIQDIPGGPAAFEVCAKFCYSMTVTLNAYNVVAARCAAEYLEMYETVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VFLN+SI +SWKDSIIVLQTTKS LP  EE+K+V HC+++IAS+ASID SKV+W
Sbjct  121  LIYKIEVFLNTSIFRSWKDSIIVLQTTKSLLPWSEEIKVVSHCLDSIASKASIDTSKVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARS-RMVPKDWWVE  1
            SYTYNRKK+  EN + DP+++  +  +MVP+DWWVE
Sbjct  181  SYTYNRKKLPSENGN-DPHWNEVKKHQMVPRDWWVE  215



>ref|XP_004289798.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Fragaria 
vesca subsp. vesca]
Length=621

 Score =   340 bits (871),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 157/215 (73%), Positives = 188/215 (87%), Gaps = 2/215 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++GNN+RYVA++L +DII ++GD KF+LHKFPLLSKSA LQKL  N
Sbjct  1    MKFMKLGSKPDSFQTDGNNVRYVAADLETDIIFNVGDSKFHLHKFPLLSKSARLQKL-AN  59

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE    E+HI DIPGG  AFEICAKFCYGMTVTLNAYN++ +RCAAEYL M+E++EKGN
Sbjct  60   TNESKPLEIHISDIPGGPAAFEICAKFCYGMTVTLNAYNVVVSRCAAEYLGMHESIEKGN  119

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFLNSSI +SWKDSIIVLQTTKS LP+ E+LKLV  C+++IA++A +DVSKVDW
Sbjct  120  LIYKIDVFLNSSIFRSWKDSIIVLQTTKSLLPVSEDLKLVSQCIDSIATKACVDVSKVDW  179

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRKK+ EEN + DPN++G R+R VPKDWWVE
Sbjct  180  SYTYNRKKLAEENGN-DPNWNGVRNRQVPKDWWVE  213



>ref|XP_004141870.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Cucumis 
sativus]
 ref|XP_004166812.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Cucumis 
sativus]
 gb|KGN48602.1| hypothetical protein Csa_6G495070 [Cucumis sativus]
Length=626

 Score =   340 bits (871),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 161/216 (75%), Positives = 189/216 (88%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ +G+ +RYVA+ELA+DI +++GDVKFYLHKFPLLSKSA LQKLV+ 
Sbjct  1    MKFMKLGSKPDAFQIDGDKIRYVATELATDIAVNVGDVKFYLHKFPLLSKSARLQKLVSL  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            SNE N DE+HI DIPGG +AFEICAKFCYGM VTLNAYN+IAARCAAEYLEM E +EKGN
Sbjct  61   SNEENSDEIHILDIPGGASAFEICAKFCYGMIVTLNAYNVIAARCAAEYLEMYETIEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VFLNSSI +SWKDSIIVLQTTKS LP  EELK+V HC+++IAS+A ID SKV+W
Sbjct  121  LIYKIEVFLNSSIFRSWKDSIIVLQTTKSLLPWSEELKVVNHCLDSIASKACIDTSKVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARS-RMVPKDWWVE  1
            SYTYNRKK+  EN D D +++G R+ ++VPKDWWVE
Sbjct  181  SYTYNRKKLPSENGD-DSHWNGVRTQKLVPKDWWVE  215



>ref|XP_006579937.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Glycine max]
 ref|XP_006579938.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Glycine max]
 ref|XP_006579939.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X3 [Glycine max]
 gb|KHN06013.1| BTB/POZ domain-containing protein NPY2 [Glycine soja]
Length=628

 Score =   339 bits (870),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 160/216 (74%), Positives = 189/216 (88%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQSEG+N+RYVA+ELA+DI+I++G+VKF+LHKFPLLSKSA  QKL+TN
Sbjct  1    MKFMKLGSKPDSFQSEGDNIRYVAAELATDIVINVGNVKFHLHKFPLLSKSARFQKLITN  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N DEVHI DIPGG  AFEICAKFCYGMTVTLNAYN++AARCAAEYLEM E VEKGN
Sbjct  61   TNEENIDEVHIHDIPGGPAAFEICAKFCYGMTVTLNAYNVVAARCAAEYLEMYETVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VFLNSSI +SWKDSIIVLQTTKS L   EELK+V H +++IA++AS+D  KV+W
Sbjct  121  LIYKIEVFLNSSIFRSWKDSIIVLQTTKSLLKWSEELKVVSHGIDSIATKASLDTLKVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGAR-SRMVPKDWWVE  1
            SYTYNRKK+  EN++ DP+F   R  ++VPKDWWVE
Sbjct  181  SYTYNRKKLPSENSN-DPHFSSVRKQQLVPKDWWVE  215



>ref|XP_008454387.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Cucumis melo]
 ref|XP_008454388.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Cucumis melo]
Length=623

 Score =   338 bits (868),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 157/215 (73%), Positives = 188/215 (87%), Gaps = 4/215 (2%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPDCFQ++G N+RYV SELA+DI + +GDVKFYLHKFPLLSKSAHLQKLVT 
Sbjct  1    MKFMKLGSKPDCFQTDGTNVRYVVSELATDITVIVGDVKFYLHKFPLLSKSAHLQKLVTG  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
             +    DE++I +IPGG  AFEICAKFCYGMTVTLNAYN++AARCAAEYL M+E +EKGN
Sbjct  61   EHN---DEIYIPEIPGGSAAFEICAKFCYGMTVTLNAYNVVAARCAAEYLGMHETIEKGN  117

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            L YKIDVFL+SSI +SWKDSIIVLQ+TK+ +P+ EELKLV +C+E+IA +AS D+SKVDW
Sbjct  118  LTYKIDVFLSSSIFRSWKDSIIVLQSTKALMPLSEELKLVSNCLESIAVKASADISKVDW  177

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRKK+ EEN + +PN++G R+R VPKDWWVE
Sbjct  178  SYTYNRKKLPEENGN-NPNWNGVRNRSVPKDWWVE  211



>ref|XP_002300262.2| hypothetical protein POPTR_0001s30270g [Populus trichocarpa]
 gb|EEE85067.2| hypothetical protein POPTR_0001s30270g [Populus trichocarpa]
Length=599

 Score =   337 bits (865),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 152/215 (71%), Positives = 189/215 (88%), Gaps = 1/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSK D FQ++GN++RYVA+ELA+DI +++GD+KF+LHKFPLLSKSA LQKLVT 
Sbjct  1    MKFMKLGSKSDSFQTDGNSIRYVATELATDITVNVGDIKFHLHKFPLLSKSAQLQKLVTT  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +N  N DEV I DIPGG +AFEICAKFCYGMTVT+NAYN++AARCAAEYL M+E +EKGN
Sbjct  61   ANGENSDEVDISDIPGGPSAFEICAKFCYGMTVTINAYNVVAARCAAEYLGMHETIEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VFL+SSI +SWKDSIIVLQTT+S LP+ EELK++ HC++AIA++A +DVSKV+W
Sbjct  121  LIYKIEVFLSSSIFRSWKDSIIVLQTTRSLLPLSEELKVISHCIDAIAAKACVDVSKVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SY+YNRK + EEN   + N +G R+R+VPKDWWVE
Sbjct  181  SYSYNRKNLPEENG-TESNLNGLRNRLVPKDWWVE  214



>ref|XP_009335385.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Pyrus 
x bretschneideri]
 ref|XP_009335386.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Pyrus 
x bretschneideri]
Length=617

 Score =   338 bits (866),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 155/215 (72%), Positives = 186/215 (87%), Gaps = 6/215 (3%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++GNN+RYVA++LA+DI++++GD KFY+HKFPLLSKSA LQKLV N
Sbjct  1    MKFMKLGSKPDSFQTDGNNVRYVATDLATDIVVNVGDSKFYVHKFPLLSKSARLQKLVAN  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            SNE N  E++I DIPGG  AFEICAKFCYGMTVTLNAYN++ +RCAAEYL M+E++EKGN
Sbjct  61   SNEPNTGEIYISDIPGGPAAFEICAKFCYGMTVTLNAYNVVVSRCAAEYLGMHESIEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL+SSI +SWKDSIIVLQTTKS LP+ EELKLV H +++I ++A +D+SKVDW
Sbjct  121  LIYKIDVFLSSSIFRSWKDSIIVLQTTKSLLPISEELKLVSHGIDSITTKACMDISKVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRKKI EEN       +G R+R VPKDWWVE
Sbjct  181  SYTYNRKKIQEENG------NGVRNRPVPKDWWVE  209



>ref|XP_010907392.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010907393.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like isoform 
X1 [Elaeis guineensis]
Length=630

 Score =   337 bits (863),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 155/216 (72%), Positives = 190/216 (88%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MK+MKLGSKPD FQ+EGNN+R+VA+ELA+DII+++GDVKFYLHKFPLLSKS+ +QKLV  
Sbjct  1    MKYMKLGSKPDVFQTEGNNIRFVATELATDIIVNVGDVKFYLHKFPLLSKSSRMQKLVAV  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N DE+ + DIPGG  AFEICAKFCYGM VTLNAYN++AARCAAEYLEM+EN+EKGN
Sbjct  61   ANEENNDEIDLPDIPGGPAAFEICAKFCYGMIVTLNAYNVVAARCAAEYLEMHENIEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VFLNSSI +SWKDSIIVLQTTK  LP+ E+LK+V HC+++IA +ASID S+V+W
Sbjct  121  LIYKIEVFLNSSIFRSWKDSIIVLQTTKLLLPLSEDLKVVSHCIDSIAFKASIDPSEVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGAR-SRMVPKDWWVE  1
            SYTYNRKK+  EN  +DP+++G R  + VPKDWWVE
Sbjct  181  SYTYNRKKLPSENG-LDPHWNGVRKQQTVPKDWWVE  215



>ref|XP_008792560.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Phoenix 
dactylifera]
 ref|XP_008792561.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Phoenix 
dactylifera]
 ref|XP_008792562.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Phoenix 
dactylifera]
Length=630

 Score =   335 bits (860),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 154/216 (71%), Positives = 190/216 (88%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MK+MKLGSKPD FQ+EGNN+R+VA+ELA+DII+++GDVKFYLHKFPLLSKS+ +QKLV  
Sbjct  1    MKYMKLGSKPDVFQTEGNNIRFVATELATDIIVNVGDVKFYLHKFPLLSKSSRMQKLVAA  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N DE+ + DIPGG  AFEICAKFCYGM VTLNAYN++AARCAAEYLEM+EN+E+GN
Sbjct  61   ANEENNDEIDLTDIPGGLAAFEICAKFCYGMIVTLNAYNVVAARCAAEYLEMHENMERGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VFLNSSI +SWKDSIIVLQTTK  LP+ E+LK+V HC+++IAS+ASID S+V+W
Sbjct  121  LIYKIEVFLNSSIFRSWKDSIIVLQTTKLLLPLSEDLKVVSHCIDSIASKASIDPSEVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGAR-SRMVPKDWWVE  1
            SYTYNRKK+  EN  +D +++G R  + VPKDWWVE
Sbjct  181  SYTYNRKKLPSENG-LDAHWNGVRKQQTVPKDWWVE  215



>ref|XP_009772494.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Nicotiana 
sylvestris]
Length=626

 Score =   335 bits (859),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/216 (73%), Positives = 188/216 (87%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ+EG+N+RYVA+ELA+D++I++GDVKFYLHKFPLLSKS  LQKLV  
Sbjct  1    MKFMKLGSKPDQFQTEGDNIRYVATELATDMVINVGDVKFYLHKFPLLSKSYRLQKLVAC  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N DE++I DIPGG  AFE+CAKFCYGMTVTLNAYN++AARCAAEYLEM E VEKGN
Sbjct  61   TNEENNDEINIHDIPGGPAAFEVCAKFCYGMTVTLNAYNVVAARCAAEYLEMYETVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL SSI +SWKDSIIVLQTTK+ LP CEELK+V HC++++AS+ASID SKVDW
Sbjct  121  LIYKIDVFLTSSIFRSWKDSIIVLQTTKAFLPWCEELKVVSHCLDSVASKASIDTSKVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGA-RSRMVPKDWWVE  1
            SYTYN KK+  E N+ID + D   + ++VP+DWWVE
Sbjct  181  SYTYNHKKLLSE-NEIDLHCDVVNKQQLVPEDWWVE  215



>ref|XP_003592479.1| BTB/POZ domain-containing protein [Medicago truncatula]
 gb|AES62730.1| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=625

 Score =   334 bits (857),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 157/216 (73%), Positives = 188/216 (87%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNN-LRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVT  469
            MKFMKLGSKPD FQ++GNN +RYVASELASDII+ IGD KFYLHKFPL+SKS+HLQKL++
Sbjct  1    MKFMKLGSKPDTFQTDGNNNVRYVASELASDIIVSIGDTKFYLHKFPLISKSSHLQKLIS  60

Query  468  NSNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKG  289
             +NE N +E+ I DIPGG +AFEICAKFCYGMTVTLNAYN+IA RCAAEYL M+EN+EKG
Sbjct  61   LNNEENINEIQISDIPGGASAFEICAKFCYGMTVTLNAYNVIATRCAAEYLGMHENIEKG  120

Query  288  NLIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVD  109
            NL++KIDVFL+SSI +SWKDSII+LQTTKS  P+ EE K+V  C+E+IA++A +DVSKVD
Sbjct  121  NLLFKIDVFLSSSIFRSWKDSIILLQTTKSMSPLDEEQKVVNRCIESIANKACVDVSKVD  180

Query  108  WSYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            WSYTYNRKK+ EEN   + N +G R+R VPKDWWVE
Sbjct  181  WSYTYNRKKLPEENG-FESNQNGVRTRNVPKDWWVE  215



>ref|XP_002464238.1| hypothetical protein SORBIDRAFT_01g014760 [Sorghum bicolor]
 gb|EER91236.1| hypothetical protein SORBIDRAFT_01g014760 [Sorghum bicolor]
Length=633

 Score =   335 bits (858),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/216 (72%), Positives = 187/216 (87%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MK+MKLGSKPD FQ+EG+N+R+VA+ELA+DI+I IGDVKFYLHKFPLLSKS+ LQ+LV +
Sbjct  1    MKYMKLGSKPDVFQTEGSNIRFVATELATDIVISIGDVKFYLHKFPLLSKSSRLQRLVAS  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            SNE   DEV I DIPGG +AFEICAKFCYGM VTLNAYN++AARCAAEYLEM E +EKGN
Sbjct  61   SNEEKNDEVDISDIPGGPSAFEICAKFCYGMIVTLNAYNVLAARCAAEYLEMFETIEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL SS+ ++WKDSIIVLQ+TKS LP CE LK++ HC+++IAS+ASID S+V+W
Sbjct  121  LIYKIDVFLTSSVFRTWKDSIIVLQSTKSLLPWCENLKVINHCIDSIASKASIDPSEVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSR-MVPKDWWVE  1
            SYTYNRKK+  EN  ID +++G R + MVP DWWVE
Sbjct  181  SYTYNRKKLPSENG-IDSHWNGVRKQPMVPSDWWVE  215



>ref|XP_006600918.1| PREDICTED: BTB/POZ domain-containing protein NPY2 isoform X1 
[Glycine max]
Length=630

 Score =   334 bits (857),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 187/215 (87%), Gaps = 3/215 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEG-NNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVT  469
            MKFMKLGSKPD FQSEG NN+RYVA+ELA+DI+I++G+VKF+LHKFPLLSKSA  QKL+T
Sbjct  1    MKFMKLGSKPDSFQSEGDNNIRYVAAELATDIVINVGNVKFHLHKFPLLSKSARFQKLIT  60

Query  468  NSNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKG  289
            NSNE N DEVHI DIPGG  AFEIC KFCYGMTVTLNAYN++AARCAAEYLEM E VEKG
Sbjct  61   NSNEENNDEVHIHDIPGGSAAFEICTKFCYGMTVTLNAYNVVAARCAAEYLEMYETVEKG  120

Query  288  NLIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVD  109
            NLIYKI+VFLNSSI +SWKDSIIVLQTTKS L   EELK+V H +++IA++AS+D SKV+
Sbjct  121  NLIYKIEVFLNSSIFRSWKDSIIVLQTTKSLLKWSEELKVVSHGIDSIATKASLDTSKVE  180

Query  108  WSYTYNRKKIHEENNDIDPNFDGAR-SRMVPKDWW  7
            WSYTYNRKK+  EN++ DP  + AR  ++VPKDWW
Sbjct  181  WSYTYNRKKLPSENSN-DPQSNNARKQQLVPKDWW  214



>ref|XP_009631537.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009631538.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009631539.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009631540.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009631541.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like isoform 
X1 [Nicotiana tomentosiformis]
Length=627

 Score =   334 bits (856),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 156/216 (72%), Positives = 186/216 (86%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ+EG+N+RYVA+ELA+D++IH+GDVKFYLHKFPLLSKS  LQKLV  
Sbjct  1    MKFMKLGSKPDQFQTEGDNIRYVATELATDMVIHVGDVKFYLHKFPLLSKSYRLQKLVAC  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE NGDE++I DIPGG  AF++CAKFCYGMTVTLNAYN++AARCAAEYLEM E VEKGN
Sbjct  61   TNEENGDEINIHDIPGGPAAFDVCAKFCYGMTVTLNAYNVVAARCAAEYLEMYETVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VFL SSI +SWKDSIIVLQTTK   P CEELK+V HC++++AS+AS D SKVDW
Sbjct  121  LIYKIEVFLTSSIFRSWKDSIIVLQTTKGFFPWCEELKIVSHCLDSVASKASTDTSKVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGA-RSRMVPKDWWVE  1
            SYTYN KK+  E N+ID + D   + ++VP+DWWVE
Sbjct  181  SYTYNHKKLLSE-NEIDLHCDVVNKQQLVPEDWWVE  215



>ref|XP_004982439.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Setaria 
italica]
Length=635

 Score =   333 bits (854),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 153/216 (71%), Positives = 187/216 (87%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MK+MKLGSKPD FQ+EG+N+R+VA+ELA+DI+I IGDVKFYLHKFPLLSKS+ LQ+LV +
Sbjct  1    MKYMKLGSKPDAFQTEGSNIRFVATELATDIVISIGDVKFYLHKFPLLSKSSRLQRLVAS  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            SNE   DEV I DIPGGH+AFEICAKFCYGM VTLNAYN++AARCAAEYLEM E ++KGN
Sbjct  61   SNEEKNDEVDISDIPGGHSAFEICAKFCYGMIVTLNAYNVLAARCAAEYLEMFETIDKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL SS+ ++WKDSIIVLQ+TKS LP CE LK++ HC+++IAS+ASID S+V+W
Sbjct  121  LIYKIDVFLTSSVFRTWKDSIIVLQSTKSLLPWCENLKVINHCIDSIASKASIDPSEVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSR-MVPKDWWVE  1
            SYTYNR+K+  EN  ID +++G R +  VP DWWVE
Sbjct  181  SYTYNRRKLPSENG-IDSHWNGVRKQPTVPNDWWVE  215



>ref|XP_009388923.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009388924.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Musa 
acuminata subsp. malaccensis]
Length=631

 Score =   333 bits (854),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 155/216 (72%), Positives = 188/216 (87%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MK+MKLGSKPD FQ++GNN+R+VA+ELA+DI+I++GDVKFYLHKFPLLSKS  LQKLV  
Sbjct  1    MKYMKLGSKPDAFQADGNNIRFVATELATDIVINVGDVKFYLHKFPLLSKSPRLQKLVAA  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N DE+ I DIPGG  AFEICAKFCYGM VTLNAYN++AARCAAEYLEM+E +EKGN
Sbjct  61   TNEENSDEIDIPDIPGGPAAFEICAKFCYGMIVTLNAYNVVAARCAAEYLEMHETIEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFLNSSIL++WKDSIIVLQTTKS LP  E+LK+V +C+++IAS+ASID S V+W
Sbjct  121  LIYKIDVFLNSSILRAWKDSIIVLQTTKSLLPWAEDLKVVSNCIDSIASKASIDPSDVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRM-VPKDWWVE  1
            SYTYNR+K+  EN  +D +++G R +  VPKDWWVE
Sbjct  181  SYTYNRRKLPSENG-LDSHWNGVRKQQSVPKDWWVE  215



>ref|XP_008341028.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Malus 
domestica]
 ref|XP_008341035.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Malus 
domestica]
Length=627

 Score =   333 bits (853),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/216 (71%), Positives = 188/216 (87%), Gaps = 3/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G+N+RYVA+ELA+D+ +++GDVKFYLHKFPLLSKSA LQKLV  
Sbjct  1    MKFMKLGSKPDFFQTDGDNIRYVATELATDVAVNVGDVKFYLHKFPLLSKSARLQKLVAT  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N DE+HI DIPGG  AFEICAKFCYGMTVTLNAYN++A RCAAEYLEM E ++KGN
Sbjct  61   TNE-NSDEIHIHDIPGGPAAFEICAKFCYGMTVTLNAYNVVATRCAAEYLEMYETIDKGN  119

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            L+YK++VFLNSSI +SWKDSIIVLQTTKS LP  EE+K+V HC+++IAS+A+ID SKV+W
Sbjct  120  LVYKVEVFLNSSIFRSWKDSIIVLQTTKSLLPWSEEVKVVSHCLDSIASKATIDTSKVEW  179

Query  105  SYTYNRKKIHEENNDIDPNFDG-ARSRMVPKDWWVE  1
            SYTYN KK+   N D D +++G A+ +MVPKDWWVE
Sbjct  180  SYTYNHKKLXSNNGD-DSHWNGVAKQQMVPKDWWVE  214



>ref|XP_004288238.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Fragaria 
vesca subsp. vesca]
Length=625

 Score =   332 bits (852),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 153/216 (71%), Positives = 186/216 (86%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ+EG+N+RYVA+EL +D+ I++GDVKFYLHKFPLLSKSA LQKLV  
Sbjct  1    MKFMKLGSKPDFFQTEGDNIRYVATELGTDVAINVGDVKFYLHKFPLLSKSARLQKLVAT  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +N+ N DE+HI DIPGG  AFEICAKFCYGMTVTLNAYN++A  CAAEYLEM E VEKGN
Sbjct  61   TNDDNSDEIHIHDIPGGPAAFEICAKFCYGMTVTLNAYNVVATLCAAEYLEMYETVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            L+YK++VFL+SSI +SWKDSIIVLQTT+S LP  EELK+V HC+++IAS+A+ID SKV+W
Sbjct  121  LVYKVEVFLSSSIFRSWKDSIIVLQTTRSLLPWAEELKVVSHCLDSIASKATIDTSKVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDG-ARSRMVPKDWWVE  1
            SY+YN KK+  EN + DP ++G  + +MVPKDWWVE
Sbjct  181  SYSYNHKKLPSENGN-DPLWNGVGKQQMVPKDWWVE  215



>ref|XP_006339807.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006339808.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006339809.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X3 [Solanum tuberosum]
Length=634

 Score =   332 bits (852),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/216 (71%), Positives = 185/216 (86%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G+N+RYVA+ELA+D++I++GDVKFYLHKFPLLSKS  LQKL  N
Sbjct  1    MKFMKLGSKPDQFQTKGDNIRYVATELATDMVINVGDVKFYLHKFPLLSKSFRLQKLTAN  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N DE++I DIPGG  AFEICAKFCYGMTVTLNAYN++AARCAAEYLEM E VEKGN
Sbjct  61   TNEENNDEINIDDIPGGPAAFEICAKFCYGMTVTLNAYNVVAARCAAEYLEMYETVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            +IYK++VFL SSI +SWKDSIIVLQTTK  LP  EELK+V HC++++AS+A ID SKVDW
Sbjct  121  IIYKLEVFLTSSIFRSWKDSIIVLQTTKVFLPWSEELKIVSHCLDSVASKAYIDTSKVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGA-RSRMVPKDWWVE  1
            SYTYNRKK+  EN   DP ++G  + + VP+DWWVE
Sbjct  181  SYTYNRKKLPSENGS-DPLWNGVQKQQYVPRDWWVE  215



>ref|XP_006339810.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X4 [Solanum tuberosum]
Length=628

 Score =   332 bits (851),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/216 (71%), Positives = 185/216 (86%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G+N+RYVA+ELA+D++I++GDVKFYLHKFPLLSKS  LQKL  N
Sbjct  1    MKFMKLGSKPDQFQTKGDNIRYVATELATDMVINVGDVKFYLHKFPLLSKSFRLQKLTAN  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N DE++I DIPGG  AFEICAKFCYGMTVTLNAYN++AARCAAEYLEM E VEKGN
Sbjct  61   TNEENNDEINIDDIPGGPAAFEICAKFCYGMTVTLNAYNVVAARCAAEYLEMYETVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            +IYK++VFL SSI +SWKDSIIVLQTTK  LP  EELK+V HC++++AS+A ID SKVDW
Sbjct  121  IIYKLEVFLTSSIFRSWKDSIIVLQTTKVFLPWSEELKIVSHCLDSVASKAYIDTSKVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGA-RSRMVPKDWWVE  1
            SYTYNRKK+  EN   DP ++G  + + VP+DWWVE
Sbjct  181  SYTYNRKKLPSENGS-DPLWNGVQKQQYVPRDWWVE  215



>ref|XP_004231915.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like isoform 
X1 [Solanum lycopersicum]
 ref|XP_010316010.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like isoform 
X1 [Solanum lycopersicum]
 ref|XP_010316011.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like isoform 
X1 [Solanum lycopersicum]
 ref|XP_010316012.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like isoform 
X1 [Solanum lycopersicum]
Length=628

 Score =   332 bits (851),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 153/216 (71%), Positives = 185/216 (86%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G+N+RYVA+ELA+D++I++GDVKFYLHKFPLLSKS  LQKL  N
Sbjct  1    MKFMKLGSKPDQFQTKGDNIRYVATELATDMVINVGDVKFYLHKFPLLSKSFRLQKLTAN  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N DE++I DIPGG  AFEICAKFCYGMTVTLNAYN++ ARCAAEYLEM E VEKGN
Sbjct  61   TNEENNDEINIDDIPGGPAAFEICAKFCYGMTVTLNAYNVVVARCAAEYLEMYETVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            +IYK++VFL SSI +SWKDSIIVLQTTK+ LP  EELK+V HC++++AS+A ID SKVDW
Sbjct  121  IIYKLEVFLKSSIFRSWKDSIIVLQTTKAFLPWSEELKIVSHCLDSVASKAYIDTSKVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGA-RSRMVPKDWWVE  1
            SYTYNRKK+  EN   DP ++G  + + VP+DWWVE
Sbjct  181  SYTYNRKKLPSENGS-DPLWNGVQKQQYVPRDWWVE  215



>gb|KHG04716.1| BTB/POZ domain-containing NPY2 -like protein [Gossypium arboreum]
Length=615

 Score =   332 bits (850),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/216 (72%), Positives = 185/216 (86%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G+++RYVA+ELA+DI++++GDVKFY HKFPLLSKSA LQKLV  
Sbjct  1    MKFMKLGSKPDSFQTDGDHIRYVATELATDIVVNVGDVKFYCHKFPLLSKSARLQKLVAT  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            SN+ NGDE+HI+DIPGG  AFEICAKFCY MTVTLNAYN++AARCAAEYLEM E VEKGN
Sbjct  61   SNDENGDELHIQDIPGGPGAFEICAKFCYCMTVTLNAYNVVAARCAAEYLEMYETVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFLNSSI +SWKDSI VLQ+TKS LP  EELK+V   +++IAS+ASID S V+W
Sbjct  121  LIYKIDVFLNSSIFRSWKDSITVLQSTKSLLPWSEELKVVSRSLDSIASKASIDTSMVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGAR-SRMVPKDWWVE  1
            SYTYNRKK+  EN +  P ++G R  + VPKDWWVE
Sbjct  181  SYTYNRKKLPSENGN-SPQWNGVRKQQTVPKDWWVE  215



>emb|CDP02592.1| unnamed protein product [Coffea canephora]
Length=623

 Score =   332 bits (850),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 155/216 (72%), Positives = 188/216 (87%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G+N+RYVA+ELA+D++I +G+VKFYLHKFPLLSKS+ LQKL  N
Sbjct  1    MKFMKLGSKPDQFQTDGDNIRYVATELATDMVITVGEVKFYLHKFPLLSKSSRLQKLAAN  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            SNE N D+++I DIPGG  AFEICAKFCYGM VTLNAYN++AARCAA+YLEM+E VEKGN
Sbjct  61   SNEENSDDINIDDIPGGPAAFEICAKFCYGMIVTLNAYNVVAARCAAQYLEMHETVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL SSI +SWKDSIIVLQTTKS  P  E+LK+V HC+++IAS+ASID SKV+W
Sbjct  121  LIYKIDVFLTSSIFRSWKDSIIVLQTTKSLNPWSEDLKIVSHCLDSIASKASIDASKVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGAR-SRMVPKDWWVE  1
            SYTYNRKK+  EN + D +++G R  ++VPKDWWVE
Sbjct  181  SYTYNRKKLPSENGN-DTHWNGVRKQQLVPKDWWVE  215



>ref|XP_010099608.1| BTB/POZ domain-containing protein NPY2 [Morus notabilis]
 gb|EXB80039.1| BTB/POZ domain-containing protein NPY2 [Morus notabilis]
Length=627

 Score =   331 bits (849),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 154/215 (72%), Positives = 182/215 (85%), Gaps = 0/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G N+RYVASELASDI + +GDVKFYLHKFPLLSKSAHLQKLV+ 
Sbjct  1    MKFMKLGSKPDSFQTDGKNVRYVASELASDITVIVGDVKFYLHKFPLLSKSAHLQKLVST  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            + + + D V+I DIPGG  AFEIC KFCYGMTVTLNA+N++  RCAAEYL M+E +EKGN
Sbjct  61   ATDEHSDGVYISDIPGGPEAFEICVKFCYGMTVTLNAHNVVVVRCAAEYLGMHETIEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL+SSI +SWKDSIIVL+TT S   M +ELKLVG CVE+IA++A +DVSKVDW
Sbjct  121  LIYKIDVFLSSSIFRSWKDSIIVLETTNSLTSMPKELKLVGRCVESIATKACVDVSKVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SY+Y RKK+ EEN + DPN++G   R VPKDWWVE
Sbjct  181  SYSYYRKKLPEENGNNDPNWNGVVKRSVPKDWWVE  215



>ref|XP_009629742.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009629743.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009629744.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like isoform 
X1 [Nicotiana tomentosiformis]
Length=627

 Score =   331 bits (849),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 153/216 (71%), Positives = 185/216 (86%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ+EG+N+RYVA+ELA+D++I++GDVKFY+HKFPLLSKS  LQKL  +
Sbjct  1    MKFMKLGSKPDQFQTEGDNIRYVATELATDMVINVGDVKFYVHKFPLLSKSGSLQKLAAH  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE + DE++I D+PGG  AFEICAKFCYGMTVTLNAYN++AARCAAEYLEM E VEKGN
Sbjct  61   TNEESNDEINIHDVPGGPAAFEICAKFCYGMTVTLNAYNVVAARCAAEYLEMYETVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VFL SSI +SWKDSIIVLQTTKS LP  EELK+V HC++++AS+A ID SKVDW
Sbjct  121  LIYKIEVFLTSSIFRSWKDSIIVLQTTKSFLPWSEELKIVSHCLDSVASKAYIDTSKVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGAR-SRMVPKDWWVE  1
            SYTYNRK +  EN   DP ++G +  + VP+DWWVE
Sbjct  181  SYTYNRKNLPSENGS-DPLWNGMKMQQFVPRDWWVE  215



>ref|XP_010065907.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Eucalyptus 
grandis]
 ref|XP_010065908.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Eucalyptus 
grandis]
 ref|XP_010065909.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Eucalyptus 
grandis]
 ref|XP_010065910.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Eucalyptus 
grandis]
 ref|XP_010065911.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Eucalyptus 
grandis]
 ref|XP_010065912.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Eucalyptus 
grandis]
 gb|KCW63621.1| hypothetical protein EUGRSUZ_G01249 [Eucalyptus grandis]
Length=625

 Score =   331 bits (849),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 157/215 (73%), Positives = 183/215 (85%), Gaps = 3/215 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ+EG+N+RYV+SELA+DI + IG VKFYLHKFPLLSKSA LQKLV  
Sbjct  1    MKFMKLGSKPDSFQNEGDNVRYVSSELATDITVSIGSVKFYLHKFPLLSKSALLQKLVAA  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +N  +G+EV+I DIPGG  +FE+CAKFCYGMTVTLNAYN++AARCAAEYLEM E VEKGN
Sbjct  61   TNNDDGNEVNISDIPGGPASFEVCAKFCYGMTVTLNAYNVVAARCAAEYLEMYETVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VFL+SSI +SWKDSIIVLQTT S LP  EELKLV   +E+IA +A +D+SKVDW
Sbjct  121  LIYKIEVFLSSSIFRSWKDSIIVLQTTTSLLPRSEELKLVNQSIESIAVKACVDISKVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SY+YNRKK+ EEN   D N  G R+R+VPKDWWVE
Sbjct  181  SYSYNRKKLAEENG-TDSN--GVRTRVVPKDWWVE  212



>tpg|DAA50449.1| TPA: putative phototropic-responsive NPH3 family protein [Zea 
mays]
 gb|AIB05795.1| orphans transcription factor, partial [Zea mays]
Length=362

 Score =   322 bits (825),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 186/216 (86%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MK+MKLGSKPD  Q+EG+N+R+VA++LA+D++I IGDVKFYLHKFPLLSKS+ LQ+LV +
Sbjct  1    MKYMKLGSKPDVLQTEGSNIRFVATDLATDVVILIGDVKFYLHKFPLLSKSSRLQRLVAS  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
             NE   DEV I DIPGG +AFEICAKFCYGM VTLNAYN++AARCAAEYLEM E ++KGN
Sbjct  61   INEEKNDEVDISDIPGGPSAFEICAKFCYGMIVTLNAYNVLAARCAAEYLEMFETIDKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL SS+ ++WKDSIIVLQ+T+S +P CE+LK++ HC+++IAS+ASID S+V+W
Sbjct  121  LIYKIDVFLTSSVFRTWKDSIIVLQSTRSLVPWCEDLKVISHCIDSIASKASIDPSEVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSR-MVPKDWWVE  1
            SYTYNRKK+  EN  ID +++G R + MVP DWWVE
Sbjct  181  SYTYNRKKLPSENG-IDSHWNGVRMQPMVPTDWWVE  215



>ref|XP_010687361.1| PREDICTED: BTB/POZ domain-containing protein NPY2 isoform X3 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010687362.1| PREDICTED: BTB/POZ domain-containing protein NPY2 isoform X3 
[Beta vulgaris subsp. vulgaris]
Length=621

 Score =   330 bits (845),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 156/216 (72%), Positives = 184/216 (85%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQSE  ++RYVASELASDI++++ DVKFYLHKFPLLSKS+ LQKLV+ 
Sbjct  1    MKFMKLGSKPDTFQSEDKHVRYVASELASDIVVNVADVKFYLHKFPLLSKSSQLQKLVST  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE + D+V I D+PGG  AFEICAK+CYGM VTLNA+N+IAARCAAEYL M+E +EKGN
Sbjct  61   ANEQSSDDVIITDMPGGPAAFEICAKYCYGMVVTLNAHNVIAARCAAEYLGMHETMEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            L YKIDVFLNS I +SWKDSIIVLQTT S LP  E+LKL+ HCVE+IASRA +D SKVDW
Sbjct  121  LAYKIDVFLNSVIFRSWKDSIIVLQTTMSMLPWSEDLKLISHCVESIASRAVVDTSKVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARS-RMVPKDWWVE  1
            SYTYNRKK+ EEN   DPN++G R+ ++VP DWWVE
Sbjct  181  SYTYNRKKLPEENG-TDPNWNGVRNYKVVPNDWWVE  215



>ref|XP_010687360.1| PREDICTED: BTB/POZ domain-containing protein NPY2 isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=651

 Score =   330 bits (847),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 156/217 (72%), Positives = 185/217 (85%), Gaps = 2/217 (1%)
 Frame = -2

Query  648  RMKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVT  469
            +MKFMKLGSKPD FQSE  ++RYVASELASDI++++ DVKFYLHKFPLLSKS+ LQKLV+
Sbjct  30   KMKFMKLGSKPDTFQSEDKHVRYVASELASDIVVNVADVKFYLHKFPLLSKSSQLQKLVS  89

Query  468  NSNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKG  289
             +NE + D+V I D+PGG  AFEICAK+CYGM VTLNA+N+IAARCAAEYL M+E +EKG
Sbjct  90   TANEQSSDDVIITDMPGGPAAFEICAKYCYGMVVTLNAHNVIAARCAAEYLGMHETMEKG  149

Query  288  NLIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVD  109
            NL YKIDVFLNS I +SWKDSIIVLQTT S LP  E+LKL+ HCVE+IASRA +D SKVD
Sbjct  150  NLAYKIDVFLNSVIFRSWKDSIIVLQTTMSMLPWSEDLKLISHCVESIASRAVVDTSKVD  209

Query  108  WSYTYNRKKIHEENNDIDPNFDGARS-RMVPKDWWVE  1
            WSYTYNRKK+ EEN   DPN++G R+ ++VP DWWVE
Sbjct  210  WSYTYNRKKLPEENG-TDPNWNGVRNYKVVPNDWWVE  245



>ref|XP_008787168.1| PREDICTED: BTB/POZ domain-containing protein NPY4 isoform X1 
[Phoenix dactylifera]
 ref|XP_008787170.1| PREDICTED: BTB/POZ domain-containing protein NPY4 isoform X1 
[Phoenix dactylifera]
Length=620

 Score =   329 bits (844),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 152/216 (70%), Positives = 189/216 (88%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++GNN+R+VA+ELA+DII+H+G+VKF+LHKFPLLSKSA LQKLV  
Sbjct  1    MKFMKLGSKPDSFQTDGNNVRFVATELATDIIVHVGEVKFHLHKFPLLSKSARLQKLVAA  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +N+ + +E+HI ++PGG  AFEICAKFCYGMTV LNAYN++AARCAAEYLEM+E+VEKGN
Sbjct  61   TNDESNNEIHILNVPGGPAAFEICAKFCYGMTVILNAYNVVAARCAAEYLEMHESVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VFL++SI +SWKDSIIVLQTTKS LP  E+LKLV HC+++IAS+ASID S V+W
Sbjct  121  LIYKIEVFLDTSIFRSWKDSIIVLQTTKSLLPWSEDLKLVSHCIDSIASKASIDASMVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRM-VPKDWWVE  1
            SYTYNRKK+  EN  +D  ++G + +  VPKDWWVE
Sbjct  181  SYTYNRKKLPSENG-LDTQWNGVKKQQSVPKDWWVE  215



>ref|XP_007204979.1| hypothetical protein PRUPE_ppa002844mg [Prunus persica]
 gb|EMJ06178.1| hypothetical protein PRUPE_ppa002844mg [Prunus persica]
Length=628

 Score =   329 bits (844),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 153/215 (71%), Positives = 186/215 (87%), Gaps = 2/215 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G+N+RYVA+ELA+D+++++GDVKFYLHKFPLLSKSA LQKLV  
Sbjct  1    MKFMKLGSKPDFFQTDGDNIRYVATELATDLVVNVGDVKFYLHKFPLLSKSARLQKLVAT  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N DE+HI DIPGG  AFEICAKFCYGMTVTLNAYN++A RCAAEYLEM E VEKGN
Sbjct  61   TNE-NSDEIHIHDIPGGPAAFEICAKFCYGMTVTLNAYNVVATRCAAEYLEMYETVEKGN  119

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            L+YK++VFLNSSI +SWKDSIIVLQTT+S LP  EE+K+V HC+++IAS+ASID SKV+W
Sbjct  120  LVYKVEVFLNSSIFRSWKDSIIVLQTTRSLLPWSEEVKVVSHCLDSIASKASIDTSKVEW  179

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYN KK+  +N +   N  G + ++VPKDWWVE
Sbjct  180  SYTYNLKKLPSDNGNEHWNGVG-KQQVVPKDWWVE  213



>ref|XP_010687359.1| PREDICTED: BTB/POZ domain-containing protein NPY2 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=672

 Score =   330 bits (846),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 156/217 (72%), Positives = 185/217 (85%), Gaps = 2/217 (1%)
 Frame = -2

Query  648  RMKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVT  469
            +MKFMKLGSKPD FQSE  ++RYVASELASDI++++ DVKFYLHKFPLLSKS+ LQKLV+
Sbjct  51   KMKFMKLGSKPDTFQSEDKHVRYVASELASDIVVNVADVKFYLHKFPLLSKSSQLQKLVS  110

Query  468  NSNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKG  289
             +NE + D+V I D+PGG  AFEICAK+CYGM VTLNA+N+IAARCAAEYL M+E +EKG
Sbjct  111  TANEQSSDDVIITDMPGGPAAFEICAKYCYGMVVTLNAHNVIAARCAAEYLGMHETMEKG  170

Query  288  NLIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVD  109
            NL YKIDVFLNS I +SWKDSIIVLQTT S LP  E+LKL+ HCVE+IASRA +D SKVD
Sbjct  171  NLAYKIDVFLNSVIFRSWKDSIIVLQTTMSMLPWSEDLKLISHCVESIASRAVVDTSKVD  230

Query  108  WSYTYNRKKIHEENNDIDPNFDGARS-RMVPKDWWVE  1
            WSYTYNRKK+ EEN   DPN++G R+ ++VP DWWVE
Sbjct  231  WSYTYNRKKLPEENG-TDPNWNGVRNYKVVPNDWWVE  266



>ref|XP_009776107.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009776108.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like isoform 
X1 [Nicotiana sylvestris]
Length=627

 Score =   328 bits (842),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 152/216 (70%), Positives = 183/216 (85%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ+EG+N+RYVA+ELA+D++IH+GDVKF +HKFPLLSKS  LQKL  +
Sbjct  1    MKFMKLGSKPDQFQTEGDNIRYVATELATDMVIHVGDVKFNVHKFPLLSKSGRLQKLAAH  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE + DE++I D+PGG  AFEICAKFCYGM VTLNAYN++AARCAAEYLEM E VEKGN
Sbjct  61   TNEESNDEINIHDVPGGPAAFEICAKFCYGMAVTLNAYNVVAARCAAEYLEMYETVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VFL SSI +SWKDSIIVLQTTKS LP  EELK+V HC++++AS+A ID SKVDW
Sbjct  121  LIYKIEVFLTSSIFRSWKDSIIVLQTTKSFLPWSEELKIVSHCLDSVASKAYIDTSKVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGAR-SRMVPKDWWVE  1
            SYTYNRK +  EN   DP ++G +  + VP+DWWVE
Sbjct  181  SYTYNRKNLPAENGS-DPLWNGVKMQQFVPRDWWVE  215



>ref|XP_010070650.1| PREDICTED: BTB/POZ domain-containing protein NPY5-like [Eucalyptus 
grandis]
 ref|XP_010070651.1| PREDICTED: BTB/POZ domain-containing protein NPY5-like [Eucalyptus 
grandis]
 gb|KCW59544.1| hypothetical protein EUGRSUZ_H02298 [Eucalyptus grandis]
Length=626

 Score =   328 bits (841),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 155/216 (72%), Positives = 182/216 (84%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ +G N+RYVA+ELA+DI+I IGD+KFYLHKFPLLSKSA LQKLV +
Sbjct  1    MKFMKLGSKPDSFQGDGENIRYVATELATDIVISIGDIKFYLHKFPLLSKSARLQKLVAS  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +N+ N DE+ I DIPGG  AFEIC KFCYGMTVTLNAYN++AARCAAEYLEM E +EKGN
Sbjct  61   ANDDNSDEIQIGDIPGGPAAFEICVKFCYGMTVTLNAYNVVAARCAAEYLEMYETIEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VF NSSI +SWKDSIIVLQTTKS  P  EELK+V  C+++I+S+A ID SKVDW
Sbjct  121  LIYKIEVFFNSSIFRSWKDSIIVLQTTKSLHPWVEELKVVSRCLDSISSKALIDTSKVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGAR-SRMVPKDWWVE  1
            SYTYNRKK+  EN   D +++G R  ++VPKDWWVE
Sbjct  181  SYTYNRKKLPSENGS-DSHWNGVRKQQVVPKDWWVE  215



>ref|XP_011011590.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Populus 
euphratica]
Length=623

 Score =   328 bits (840),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 152/216 (70%), Positives = 191/216 (88%), Gaps = 3/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G+N+RYVA+E+A+D++I+IGDVKFYLHKFPLLSKS HLQKLV +
Sbjct  1    MKFMKLGSKPDSFQADGDNIRYVATEVATDMVINIGDVKFYLHKFPLLSKSEHLQKLVAS  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +++ +GDE+ I +IPGG  AFEICAKFCYGMTVTLNAYN++AARCAAE+LEM E+VEKGN
Sbjct  61   TSD-DGDEILIPEIPGGPAAFEICAKFCYGMTVTLNAYNVVAARCAAEFLEMYESVEKGN  119

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            L+YKID+FLNSSI +SWKDSII+LQTTKS LP  EELKLV +C+++IAS+A +D +KV+W
Sbjct  120  LVYKIDIFLNSSIFRSWKDSIIILQTTKSLLPWAEELKLVSYCLDSIASKACMDTTKVEW  179

Query  105  SYTYNRKKIHEENNDIDPNFDGA-RSRMVPKDWWVE  1
            SYTYNRKK+  E+   DP ++G  R ++VPKDWWVE
Sbjct  180  SYTYNRKKLPSESGK-DPLWNGVRRPQVVPKDWWVE  214



>ref|XP_002306504.2| hypothetical protein POPTR_0005s19010g [Populus trichocarpa]
 gb|EEE93500.2| hypothetical protein POPTR_0005s19010g [Populus trichocarpa]
Length=626

 Score =   328 bits (840),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 153/216 (71%), Positives = 188/216 (87%), Gaps = 3/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G+N+RYVA+ELA+DI+I IG VKF LHKFPLLSKS HLQKLV +
Sbjct  1    MKFMKLGSKPDSFQADGDNIRYVATELATDIVIDIGGVKFSLHKFPLLSKSEHLQKLVAS  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +++ +GDE+ I++IPGG  AFEICAKFCYGMTVTLNAYN++AARCAAEYLEM E+VEKGN
Sbjct  61   TSD-DGDEILIQEIPGGPAAFEICAKFCYGMTVTLNAYNVVAARCAAEYLEMYESVEKGN  119

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            L+YKID+FLNSSI +SWKDSII+LQTTKS LP  EEL LV HC+++IAS+A +D +KV+W
Sbjct  120  LVYKIDIFLNSSIFRSWKDSIIILQTTKSLLPWAEELNLVSHCLDSIASKACMDTTKVEW  179

Query  105  SYTYNRKKIHEENNDIDPNFDGA-RSRMVPKDWWVE  1
            +YTYNRKK+  EN   DP ++G  R ++VPKDWWVE
Sbjct  180  TYTYNRKKLPSENGK-DPLWNGVRRPQVVPKDWWVE  214



>ref|XP_008238083.1| PREDICTED: BTB/POZ domain-containing protein NPY5-like [Prunus 
mume]
Length=628

 Score =   325 bits (834),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 152/215 (71%), Positives = 185/215 (86%), Gaps = 2/215 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G+N+RYVA+ELA+D+++++GDVKFYLHKFPLLSKSA LQKLV  
Sbjct  1    MKFMKLGSKPDFFQTDGDNIRYVATELATDLVVNVGDVKFYLHKFPLLSKSARLQKLVAT  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N DE+HI DIPGG  AFEICAKFCYGMTVTLNAYN++A RCAAEYLEM E VEKGN
Sbjct  61   TNE-NSDEIHIHDIPGGPAAFEICAKFCYGMTVTLNAYNVVATRCAAEYLEMYETVEKGN  119

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            L+YK++VFLNSSI  SWKDSIIVLQTT+S LP  EE+K+V HC+++IAS+ASID SKV+W
Sbjct  120  LVYKVEVFLNSSIFHSWKDSIIVLQTTRSLLPWSEEVKVVSHCLDSIASKASIDTSKVEW  179

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTY+ KK+  +N +   N  G + ++VPKDWWVE
Sbjct  180  SYTYSLKKLPSDNGNEHWNGVG-KQQVVPKDWWVE  213



>ref|XP_002527501.1| signal transducer, putative [Ricinus communis]
 gb|EEF34899.1| signal transducer, putative [Ricinus communis]
Length=621

 Score =   325 bits (834),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 150/215 (70%), Positives = 184/215 (86%), Gaps = 1/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++ NN+R VA++LA+D II++GDVKFYLHKFPLL+KSA LQK  T 
Sbjct  1    MKFMKLGSKPDSFQTDVNNVRSVANDLATDFIINVGDVKFYLHKFPLLAKSARLQKSATT  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +N  N DEV I DIPGG  AFEICAKFCYGM VTLNA+N++AARCA+EYL M+E +EKGN
Sbjct  61   ANGDNCDEVDISDIPGGPAAFEICAKFCYGMIVTLNAFNVVAARCASEYLGMHETIEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL++SI +SWKDSIIVLQTT+S LP+ +ELK+V +CV+A+A++A  D+SKVDW
Sbjct  121  LIYKIDVFLSASIFRSWKDSIIVLQTTRSVLPLIDELKVVSNCVDAVATKACFDISKVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SY+YNRKK+ EEN + DPN +  R+R VPKDWWVE
Sbjct  181  SYSYNRKKLPEENGN-DPNVNSIRNRSVPKDWWVE  214



>ref|NP_001067147.1| Os12g0583500 [Oryza sativa Japonica Group]
 gb|ABA99702.1| transposon protein, putative, Mutator sub-class, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF30166.1| Os12g0583500 [Oryza sativa Japonica Group]
Length=638

 Score =   325 bits (834),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 150/216 (69%), Positives = 187/216 (87%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MK+MKLGSKPD FQ+EGNN+R+VA+ELA+DI+I +G+VKFYLHKFPLLSKS+ LQ LV +
Sbjct  1    MKYMKLGSKPDVFQTEGNNIRFVATELATDIVIIVGEVKFYLHKFPLLSKSSRLQTLVAS  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE + DE+ I DIPGG  AFEICAKFCYGM VTLNAYN++AARCAAEYLEM E ++KGN
Sbjct  61   TNEESNDEIDISDIPGGPAAFEICAKFCYGMIVTLNAYNVLAARCAAEYLEMFETIDKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL+SSI ++WKDSIIVLQTTKS LP  E LK++ HCV++IA++ASID S+V+W
Sbjct  121  LIYKIDVFLSSSIFRTWKDSIIVLQTTKSLLPWSENLKVINHCVDSIATKASIDPSEVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGAR-SRMVPKDWWVE  1
            SYTYNR+K+  EN  +D +++G R  +MVP+DWWVE
Sbjct  181  SYTYNRRKLPSENG-LDSHWNGVRKQQMVPRDWWVE  215



>gb|EAZ21022.1| hypothetical protein OsJ_36671 [Oryza sativa Japonica Group]
Length=638

 Score =   325 bits (834),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 150/216 (69%), Positives = 187/216 (87%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MK+MKLGSKPD FQ+EGNN+R+VA+ELA+DI+I +G+VKFYLHKFPLLSKS+ LQ LV +
Sbjct  1    MKYMKLGSKPDVFQTEGNNIRFVATELATDIVIIVGEVKFYLHKFPLLSKSSRLQTLVAS  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE + DE+ I DIPGG  AFEICAKFCYGM VTLNAYN++AARCAAEYLEM E ++KGN
Sbjct  61   TNEESNDEIDISDIPGGPAAFEICAKFCYGMIVTLNAYNVLAARCAAEYLEMFETIDKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL+SSI ++WKDSIIVLQTTKS LP  E LK++ HCV++IA++ASID S+V+W
Sbjct  121  LIYKIDVFLSSSIFRTWKDSIIVLQTTKSLLPWSENLKVINHCVDSIATKASIDPSEVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGAR-SRMVPKDWWVE  1
            SYTYNR+K+  EN  +D +++G R  +MVP+DWWVE
Sbjct  181  SYTYNRRKLPSENG-LDSHWNGVRKQQMVPRDWWVE  215



>gb|EAY83679.1| hypothetical protein OsI_38903 [Oryza sativa Indica Group]
Length=638

 Score =   325 bits (834),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 150/216 (69%), Positives = 187/216 (87%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MK+MKLGSKPD FQ+EGNN+R+VA+ELA+DI+I +G+VKFYLHKFPLLSKS+ LQ LV +
Sbjct  1    MKYMKLGSKPDVFQTEGNNIRFVATELATDIVIIVGEVKFYLHKFPLLSKSSRLQTLVAS  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE + DE+ I DIPGG  AFEICAKFCYGM VTLNAYN++AARCAAEYLEM E ++KGN
Sbjct  61   TNEESNDEIDISDIPGGPAAFEICAKFCYGMIVTLNAYNVLAARCAAEYLEMFETIDKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL+SSI ++WKDSIIVLQTTKS LP  E LK++ HCV++IA++ASID S+V+W
Sbjct  121  LIYKIDVFLSSSIFRTWKDSIIVLQTTKSLLPWSENLKVINHCVDSIATKASIDPSEVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGAR-SRMVPKDWWVE  1
            SYTYNR+K+  EN  +D +++G R  +MVP+DWWVE
Sbjct  181  SYTYNRRKLPSENG-LDSHWNGVRKQQMVPRDWWVE  215



>ref|XP_010942827.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010942828.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like isoform 
X1 [Elaeis guineensis]
Length=621

 Score =   325 bits (833),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 151/216 (70%), Positives = 188/216 (87%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ+  NN+R+VA+ELA+DIIIH+G+VKF+LHKFPLLSKSA LQKLV  
Sbjct  1    MKFMKLGSKPDSFQTNANNVRFVATELATDIIIHVGEVKFHLHKFPLLSKSARLQKLVAA  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +N+ + +E+HI +IPGG  AFEICAKFCYGMTVTLNAYN++AARCAA +LEM+E+VEKGN
Sbjct  61   TNDESNNEIHILNIPGGPAAFEICAKFCYGMTVTLNAYNVVAARCAAAFLEMHESVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VFL++SI +SWKDSIIVLQTTKS LP  E+LKLV HC+++IAS+ASID S V+W
Sbjct  121  LIYKIEVFLDTSIFRSWKDSIIVLQTTKSLLPWSEDLKLVSHCIDSIASKASIDASMVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRM-VPKDWWVE  1
            SYTYNRKK+  EN  +D +++G + +  VPKDWWV+
Sbjct  181  SYTYNRKKLPSENG-LDTHWNGVKKQQSVPKDWWVD  215



>gb|EMT18058.1| Coleoptile phototropism protein 1 [Aegilops tauschii]
Length=733

 Score =   328 bits (840),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 152/216 (70%), Positives = 188/216 (87%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MK MKLGSKPD FQ+EG+N+R+VA+ELA+DI+I IGDVKFYLHKFPLLSKS+ LQ+LV +
Sbjct  1    MKHMKLGSKPDVFQTEGSNIRFVATELATDIVISIGDVKFYLHKFPLLSKSSRLQRLVAS  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            SN+ + DEV+I DIPGG +AFEICAKFCYGM VTLNAYN++AARCAAEYLEM E ++KGN
Sbjct  61   SNQESDDEVNISDIPGGASAFEICAKFCYGMIVTLNAYNVLAARCAAEYLEMFETIDKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL SSI ++WKDSIIVLQ+TKS LP  E LK++ HC+++IAS+ASID S+V+W
Sbjct  121  LIYKIDVFLTSSIFRTWKDSIIVLQSTKSLLPWSENLKVINHCIDSIASKASIDPSEVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGAR-SRMVPKDWWVE  1
            SYTYNRKK+  +N  +D +++G R  +MVPKDWWVE
Sbjct  181  SYTYNRKKLQSKNG-VDSHWNGVRMQQMVPKDWWVE  215



>ref|XP_010679621.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010679622.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Beta vulgaris 
subsp. vulgaris]
Length=625

 Score =   325 bits (832),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/216 (71%), Positives = 182/216 (84%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSK D FQS+G+N+RYVA+EL++DI++++ DVKFYLHKFPLLSKSA LQKLV  
Sbjct  1    MKFMKLGSKADSFQSDGDNIRYVATELSTDIVVNVVDVKFYLHKFPLLSKSARLQKLVAM  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +N  + DE+ I DIPGG  AFE+C K+CYGMTVTLNAYN++AARCAAEYLEM + VEKGN
Sbjct  61   ANHESQDEISIEDIPGGPAAFEVCVKYCYGMTVTLNAYNVVAARCAAEYLEMYDTVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFLNSSI + WKDSIIVLQTTKS LP  EELK+V HC++AIAS+ASID SKV+W
Sbjct  121  LIYKIDVFLNSSIFRGWKDSIIVLQTTKSLLPWSEELKIVSHCLDAIASKASIDTSKVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRM-VPKDWWVE  1
            SYTYNRKK+  EN   +  ++G R  + VPKDWWVE
Sbjct  181  SYTYNRKKLPSENGS-EQLYNGVRKHLTVPKDWWVE  215



>ref|NP_001146578.1| uncharacterized protein LOC100280174 [Zea mays]
 gb|ACL54319.1| unknown [Zea mays]
Length=635

 Score =   325 bits (832),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 186/216 (86%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MK+MKLGSKPD  Q+EG+N+R+VA++LA+D++I IGDVKFYLHKFPLLSKS+ LQ+LV +
Sbjct  1    MKYMKLGSKPDVLQTEGSNIRFVATDLATDVVILIGDVKFYLHKFPLLSKSSRLQRLVAS  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
             NE   DEV I DIPGG +AFEICAKFCYGM VTLNAYN++AARCAAEYLEM E ++KGN
Sbjct  61   INEEKNDEVDISDIPGGPSAFEICAKFCYGMIVTLNAYNVLAARCAAEYLEMFETIDKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL SS+ ++WKDSIIVLQ+T+S +P CE+LK++ HC+++IAS+ASID S+V+W
Sbjct  121  LIYKIDVFLTSSVFRTWKDSIIVLQSTRSLVPWCEDLKVISHCIDSIASKASIDPSEVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSR-MVPKDWWVE  1
            SYTYNRKK+  EN  ID +++G R + MVP DWWVE
Sbjct  181  SYTYNRKKLPSENG-IDSHWNGVRMQPMVPTDWWVE  215



>ref|XP_008777297.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Phoenix 
dactylifera]
 ref|XP_008777298.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Phoenix 
dactylifera]
 ref|XP_008777299.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Phoenix 
dactylifera]
Length=620

 Score =   323 bits (829),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 183/216 (85%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPDCFQ++GN +R+VA+ELA+D+++H+G+VKF LHKFPLLSKS+ LQKLV  
Sbjct  1    MKFMKLGSKPDCFQTDGNGVRFVATELATDMVVHVGNVKFRLHKFPLLSKSSRLQKLVAA  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +N+ + DE+HI DIPGG  AFEICAKFCYGMTVTLNAYN++A RCAAEYLEM+E VEKGN
Sbjct  61   TNDESNDEIHIPDIPGGPAAFEICAKFCYGMTVTLNAYNVVATRCAAEYLEMHEAVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VFL +SI +SWKDSIIVLQTTKS LP  E+LKLV HC+++I  +ASID  KV+W
Sbjct  121  LIYKIEVFLKTSIFRSWKDSIIVLQTTKSLLPWSEDLKLVSHCIDSITFKASIDACKVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSR-MVPKDWWVE  1
            SYTYNRK +  EN  +DP++   + +  VPKDWWVE
Sbjct  181  SYTYNRKNLLSENG-LDPHWHAVKKQPSVPKDWWVE  215



>ref|XP_010939136.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Elaeis 
guineensis]
Length=620

 Score =   322 bits (826),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 186/216 (86%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++GNN+R+VA+ELA+D+++H+G+VKF+LHKFPLLSKS+ LQKLV  
Sbjct  1    MKFMKLGSKPDSFQTDGNNIRFVATELATDMVVHVGNVKFHLHKFPLLSKSSRLQKLVAA  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            + + + +E+HI D PGG  AFEICAKFCYGMTVTLNAYN++AARCAAEYLEM+E VEKGN
Sbjct  61   TTDESHNEIHIPDTPGGPAAFEICAKFCYGMTVTLNAYNVVAARCAAEYLEMHEAVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VFLN+SI +SWKDSIIVLQTTK+ LP  E+LKLV HC+++IAS+AS D  KV+W
Sbjct  121  LIYKIEVFLNTSIFRSWKDSIIVLQTTKTLLPWPEDLKLVSHCIDSIASKASTDACKVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRM-VPKDWWVE  1
            SYTYNRK +  EN  +DP+++  + +  VPKDWWVE
Sbjct  181  SYTYNRKNLLSENG-LDPHWNAIKKQQSVPKDWWVE  215



>gb|KDP44480.1| hypothetical protein JCGZ_16313 [Jatropha curcas]
Length=623

 Score =   322 bits (826),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 151/215 (70%), Positives = 180/215 (84%), Gaps = 1/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++ NN RYVA+ELA+D II++GD KF LHKFPLLSKSA LQK    
Sbjct  1    MKFMKLGSKPDSFQTDVNNTRYVANELATDFIINVGDAKFLLHKFPLLSKSARLQKSAAT  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +N  N +EV I DIPGG  AFEICAKFCYGM VTLNAYN++AARCAAEYL M+E +EKGN
Sbjct  61   ANGKNINEVDISDIPGGPAAFEICAKFCYGMIVTLNAYNVVAARCAAEYLGMHETIEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LI+KIDVFL+SSI  SWKDSIIVLQTTKS  P+CEELK++  CV+++A++A +D SKVDW
Sbjct  121  LIHKIDVFLSSSIFHSWKDSIIVLQTTKSLFPLCEELKVMSTCVDSVATKACVDTSKVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SY+YNRKK+ EEN + DP+ +G R+R VPKDWWVE
Sbjct  181  SYSYNRKKLPEENGN-DPDANGIRNRSVPKDWWVE  214



>ref|XP_006664149.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Oryza 
brachyantha]
Length=659

 Score =   323 bits (829),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 186/216 (86%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MK+MKLGSKPD FQ+EGNN+R+VA+ELA+DI+I +G+VKFYLHKFPLLSKS+ LQ LV +
Sbjct  1    MKYMKLGSKPDVFQTEGNNIRFVATELATDIVITVGEVKFYLHKFPLLSKSSRLQTLVAS  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE + DE+ I DIPGG  AFEICAKFCYGM VTLNAYN++AARCAAEYLEM E ++KGN
Sbjct  61   TNEESNDEIDISDIPGGPAAFEICAKFCYGMIVTLNAYNVLAARCAAEYLEMFETIDKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL+SSI ++WKDSIIVLQTTKS LP  E LK++ HCV++IA++ASID S+V+W
Sbjct  121  LIYKIDVFLSSSIFRTWKDSIIVLQTTKSLLPWSENLKVINHCVDSIATKASIDPSEVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGAR-SRMVPKDWWVE  1
            SYTYNR+K+  EN  +D +++G R  + VP+DWWVE
Sbjct  181  SYTYNRRKLPSENG-LDAHWNGVRKQQTVPRDWWVE  215



>ref|NP_001278721.1| putative phototropic-resoponsive NPH3 family protein [Zea mays]
 ref|XP_008643409.1| PREDICTED: putative phototropic-resoponsive NPH3 family protein 
isoform X1 [Zea mays]
 ref|XP_008643410.1| PREDICTED: putative phototropic-resoponsive NPH3 family protein 
isoform X1 [Zea mays]
 gb|ACN27618.1| unknown [Zea mays]
 gb|AFW68230.1| putative phototropic-responsive NPH3 family protein [Zea mays]
Length=643

 Score =   323 bits (827),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 185/216 (86%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MK+MKLGSKPD FQ+EG+N+R+VA+ELA+DI+I +GD KFYLHKFPLLSKS+ LQ+LV +
Sbjct  1    MKYMKLGSKPDVFQTEGSNIRFVATELATDIVISVGDAKFYLHKFPLLSKSSLLQRLVAS  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            SN+   DEV I DIPGG +AFEICAKFCYG+ VTLNAYN++AARCAAEYLEM E+++KGN
Sbjct  61   SNDEKNDEVDISDIPGGPSAFEICAKFCYGVIVTLNAYNVLAARCAAEYLEMFESIDKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL SS+ ++WKDSIIVLQ+TKS  P CE LK++ HC++ IAS+ASID S+V+W
Sbjct  121  LIYKIDVFLTSSVFRTWKDSIIVLQSTKSLQPWCENLKVINHCIDCIASKASIDPSEVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSR-MVPKDWWVE  1
            SYTYNRKK+  EN  ID +++G R + MVP DWWVE
Sbjct  181  SYTYNRKKLPSENG-IDSHWNGVRKQPMVPSDWWVE  215



>ref|XP_009379321.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Pyrus 
x bretschneideri]
 ref|XP_009379322.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Pyrus 
x bretschneideri]
 ref|XP_009379324.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Pyrus 
x bretschneideri]
Length=626

 Score =   322 bits (825),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 151/216 (70%), Positives = 185/216 (86%), Gaps = 4/216 (2%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G+N+RYV +ELA+D+ +++GDVKFYLHKFPLLSKSA LQKLV  
Sbjct  1    MKFMKLGSKPDFFQTDGDNIRYVTTELATDVAVNVGDVKFYLHKFPLLSKSARLQKLVAI  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N DE+HI DIPGG  AFEICAKFCYGMTVTLNAYN++A RCAAEYLEM E +EKGN
Sbjct  61   TNEDN-DEIHIHDIPGGPAAFEICAKFCYGMTVTLNAYNVVATRCAAEYLEMYETIEKGN  119

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            L YK++VFLNSSI +SWKDSIIVLQTT+S LP  EE+K+V HC+++IAS+A+ID SKV+W
Sbjct  120  LFYKVEVFLNSSIFRSWKDSIIVLQTTRSLLPWSEEVKVVSHCLDSIASKATIDTSKVEW  179

Query  105  SYTYNRKKIHEENNDIDPNFDG-ARSRMVPKDWWVE  1
            SY YN KK+   +N  D +++G A+ +MVPKDWWVE
Sbjct  180  SYMYNHKKL--PSNGDDSHWNGVAKQQMVPKDWWVE  213



>gb|ADL36611.1| BZIP domain class transcription factor [Malus domestica]
Length=626

 Score =   322 bits (825),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 184/216 (85%), Gaps = 4/216 (2%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G+ +RYV +ELA+DI +++GDVKFYLHKFPLLSKSA LQKLV  
Sbjct  1    MKFMKLGSKPDFFQTDGDTIRYVTTELATDIAVNVGDVKFYLHKFPLLSKSARLQKLVAT  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N DE+HI DIPGG  AFEICAKFCYGMTVTLNAYN++A RCAAEYLEM E +EKGN
Sbjct  61   TNE-NSDEIHIHDIPGGPAAFEICAKFCYGMTVTLNAYNVVATRCAAEYLEMYETIEKGN  119

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            L+YK++VFLNSS+ +SWKDSIIVLQTT+S +P  EE+K+V HC+++IAS+A+ID SKV+W
Sbjct  120  LVYKVEVFLNSSVFRSWKDSIIVLQTTRSLVPWSEEVKVVSHCLDSIASKATIDTSKVEW  179

Query  105  SYTYNRKKIHEENNDIDPNFDG-ARSRMVPKDWWVE  1
            SY YN KK+    N  D +++G A+ +MVPKDWWVE
Sbjct  180  SYMYNHKKLPSNGN--DSHWNGVAKQQMVPKDWWVE  213



>ref|XP_011099362.1| PREDICTED: BTB/POZ domain-containing protein NPY5 isoform X1 
[Sesamum indicum]
Length=613

 Score =   321 bits (823),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 152/216 (70%), Positives = 182/216 (84%), Gaps = 3/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ+EG N+RYVA+ELA+D++I +GDVKFYLHKFPLLSKS+HLQKLV +
Sbjct  1    MKFMKLGSKPDQFQTEGENIRYVAAELATDMVISVGDVKFYLHKFPLLSKSSHLQKLVAS  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +++ N +E+ I DIPGG  AFEICAKFCYG+ VTLNAYN++AARCAAEYLEM E V+KGN
Sbjct  61   ASDEN-EEIRIHDIPGGPAAFEICAKFCYGIVVTLNAYNVVAARCAAEYLEMYETVDKGN  119

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL S I +SWKDSIIVLQTTK+ LP  EELK+V  C+++IAS+AS D SKVDW
Sbjct  120  LIYKIDVFLTSCIFRSWKDSIIVLQTTKALLPWSEELKVVSRCLDSIASKASTDPSKVDW  179

Query  105  SYTYNRKKIHEENNDIDPNFDGA-RSRMVPKDWWVE  1
            SYTYNRKK+  EN   DP ++   + + VPKDWWVE
Sbjct  180  SYTYNRKKLPSENGH-DPLWNAVKKQQTVPKDWWVE  214



>ref|XP_008338429.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Malus 
domestica]
 ref|XP_008338430.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Malus 
domestica]
 ref|XP_008338431.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Malus 
domestica]
 ref|XP_008338432.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Malus 
domestica]
Length=626

 Score =   320 bits (819),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 184/216 (85%), Gaps = 4/216 (2%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G+ +RYV +ELA+DI +++GDVKFYLHKFPLLSKSA LQKLV  
Sbjct  1    MKFMKLGSKPDFFQTDGDXIRYVTTELATDIAVNVGDVKFYLHKFPLLSKSARLQKLVAT  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE + DE+HI DIPGG  AFEICAKFCYGMTVTLNAYN++A RCAAEYLEM E +EKGN
Sbjct  61   TNEXS-DEIHIHDIPGGPAAFEICAKFCYGMTVTLNAYNVVATRCAAEYLEMYETIEKGN  119

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            L+YK++VFLNSS+ +SWKDSIIVLQTT+S +P  EE+K+V HC+++IAS+A+ID SKV+W
Sbjct  120  LVYKVEVFLNSSVFRSWKDSIIVLQTTRSLVPWSEEVKVVSHCLDSIASKATIDTSKVEW  179

Query  105  SYTYNRKKIHEENNDIDPNFDG-ARSRMVPKDWWVE  1
            SY YN KK+    N  D +++G A+ +MVPKDWWVE
Sbjct  180  SYMYNHKKLPSNGN--DSHWNGVAKQQMVPKDWWVE  213



>ref|XP_008352545.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Malus 
domestica]
 ref|XP_008352546.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Malus 
domestica]
 ref|XP_008352547.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Malus 
domestica]
 ref|XP_008352548.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Malus 
domestica]
 ref|XP_008352549.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Malus 
domestica]
 ref|XP_008352550.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Malus 
domestica]
 ref|XP_008352551.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Malus 
domestica]
Length=626

 Score =   319 bits (818),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 184/216 (85%), Gaps = 4/216 (2%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G+ +RYV +ELA+DI +++GDVKFYLHKFPLLSKSA LQKLV  
Sbjct  1    MKFMKLGSKPDFFQTDGDXIRYVTTELATDIAVNVGDVKFYLHKFPLLSKSARLQKLVAT  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE + DE+HI DIPGG  AFEICAKFCYGMTVTLNAYN++A RCAAEYLEM E +EKGN
Sbjct  61   TNEXS-DEIHIHDIPGGPAAFEICAKFCYGMTVTLNAYNVVATRCAAEYLEMYETIEKGN  119

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            L+YK++VFLNSS+ +SWKDSIIVLQTT+S +P  EE+K+V HC+++IAS+A+ID SKV+W
Sbjct  120  LVYKVEVFLNSSVFRSWKDSIIVLQTTRSLVPWSEEVKVVSHCLDSIASKATIDTSKVEW  179

Query  105  SYTYNRKKIHEENNDIDPNFDG-ARSRMVPKDWWVE  1
            SY YN KK+    N  D +++G A+ +MVPKDWWVE
Sbjct  180  SYMYNHKKLPSNGN--DSHWNGVAKQQMVPKDWWVE  213



>ref|XP_011073694.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Sesamum 
indicum]
 ref|XP_011073695.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Sesamum 
indicum]
Length=634

 Score =   319 bits (818),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 151/216 (70%), Positives = 182/216 (84%), Gaps = 4/216 (2%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G+ +RYVA+ELA+D++I +GDVKFY+HKFPLLSKS+ LQKLV  
Sbjct  1    MKFMKLGSKPDQFQTDGDTIRYVATELATDLVITVGDVKFYVHKFPLLSKSSQLQKLVAG  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            ++  + DE+ I DIPGG  AFEICAKFCYGM VTLNAYN++AARCAAEYLEM E VEKGN
Sbjct  61   TS--DNDEIDIHDIPGGPAAFEICAKFCYGMVVTLNAYNVVAARCAAEYLEMFEIVEKGN  118

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL SSI +SWKDSIIVLQTTKS LP  EELK+V HC+++IA++AS D SKVDW
Sbjct  119  LIYKIDVFLTSSIFRSWKDSIIVLQTTKSFLPWSEELKIVSHCLDSIATKASTDPSKVDW  178

Query  105  SYTYNRKKIHEENNDIDPNFDG-ARSRMVPKDWWVE  1
            SYTYNR K+  EN   DP+++G  + + VP+DWWVE
Sbjct  179  SYTYNRDKLPSENGH-DPHWNGMKKQQTVPQDWWVE  213



>dbj|BAJ87350.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=630

 Score =   319 bits (818),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 187/216 (87%), Gaps = 3/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MK+MKLG+KPD FQ+EGN +R+VA+ELA+DI+I +GDVKFYLHKFPLLSKS+ LQ LV +
Sbjct  1    MKYMKLGAKPDVFQTEGN-IRFVATELATDIVITVGDVKFYLHKFPLLSKSSRLQTLVAS  59

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            ++E   DEV I DIPGG ++FEICAKFCYGMTVTLNAYN++AARCAAE+LEM E ++KGN
Sbjct  60   TDEEGNDEVDISDIPGGPSSFEICAKFCYGMTVTLNAYNVLAARCAAEFLEMFETIDKGN  119

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL+SSI ++WKDSIIVLQTTKS LP  E LK++ HCV++IA++ASID S+VDW
Sbjct  120  LIYKIDVFLSSSIFRTWKDSIIVLQTTKSLLPWSENLKVINHCVDSIAAKASIDPSEVDW  179

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRM-VPKDWWVE  1
            SYTYNRKK+  E +D D +++G R ++ VP+DWWVE
Sbjct  180  SYTYNRKKLPSE-SDPDSHWNGVRKQLTVPRDWWVE  214



>ref|XP_010530706.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Tarenaya hassleriana]
 ref|XP_010530707.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Tarenaya hassleriana]
 ref|XP_010530708.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Tarenaya hassleriana]
Length=642

 Score =   318 bits (816),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 146/218 (67%), Positives = 183/218 (84%), Gaps = 3/218 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMK+GSKPD F+++GNN+RYV +ELA+DIII++   KFYLHKFPLLSK   LQKLV++
Sbjct  1    MKFMKIGSKPDSFKTDGNNVRYVENELAADIIINVDGSKFYLHKFPLLSKCGWLQKLVSS  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +++ + DEV + DIPGG TAFE CAKFCYGMTVTL+AYN++A RCAAEYL M E VEKGN
Sbjct  61   ADKNSTDEVDLSDIPGGPTAFETCAKFCYGMTVTLSAYNVVATRCAAEYLGMQETVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI++F NSSI +SWKDSIIVLQTTK  LP+ E+LKLV  C++AIA++A  DVS+V+W
Sbjct  121  LIYKIEIFQNSSIFRSWKDSIIVLQTTKPFLPLSEDLKLVSLCIDAIAAKACTDVSRVEW  180

Query  105  SYTYNRKKIHEENN---DIDPNFDGARSRMVPKDWWVE  1
            SYTYNRKK+ EEN    D +P+++G R+R VP+DWWVE
Sbjct  181  SYTYNRKKLPEENRNKCDPNPSYNGIRAREVPQDWWVE  218



>gb|EMT08606.1| Coleoptile phototropism protein 1 [Aegilops tauschii]
Length=622

 Score =   318 bits (814),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 187/216 (87%), Gaps = 3/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MK+MKLG+KPD FQ+EGN +R+VA+ELA+DI+I +GDVKFYLHKFPLLSKS+ LQ LV +
Sbjct  1    MKYMKLGAKPDVFQTEGN-IRFVATELATDIVITVGDVKFYLHKFPLLSKSSRLQTLVAS  59

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            ++E   DEV I DIPGG +AFEICAKFCYGMTVTLNAYN++AARCAAE+LEM E ++KGN
Sbjct  60   TDEEGNDEVDISDIPGGPSAFEICAKFCYGMTVTLNAYNVLAARCAAEFLEMFETIDKGN  119

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL+SSI ++WKDSIIVLQTTKS LP  E LK++ HCV++IA++ASID S+V+W
Sbjct  120  LIYKIDVFLSSSIFRTWKDSIIVLQTTKSLLPWSENLKVINHCVDSIAAKASIDPSEVNW  179

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRM-VPKDWWVE  1
            SYTYNRKK+  E +D D +++G R ++ VP+DWWVE
Sbjct  180  SYTYNRKKLPSE-SDPDSHWNGVRKQLTVPRDWWVE  214



>ref|XP_003578395.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
NPY4-like [Brachypodium distachyon]
Length=640

 Score =   318 bits (814),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 185/216 (86%), Gaps = 3/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MK+MKLGSKPD FQ+EGN +R+VA+ELA+DI+I +GDVKFYLHKFPLLSKS+ LQ LV +
Sbjct  1    MKYMKLGSKPDVFQTEGN-IRFVATELATDIVITVGDVKFYLHKFPLLSKSSRLQTLVAS  59

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +N+   DEV I DIPGG + FEICAKFCYGMTVTLNAYN++AARCAAE+LEM E ++KGN
Sbjct  60   TNDEGNDEVDISDIPGGPSGFEICAKFCYGMTVTLNAYNVLAARCAAEFLEMFETIDKGN  119

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL++SI ++WKDSIIVLQTTKS LP  E LK++ HCV++IAS+ASID S+V+W
Sbjct  120  LIYKIDVFLSASIFRTWKDSIIVLQTTKSLLPWSENLKVINHCVDSIASKASIDPSEVEW  179

Query  105  SYTYNRKKIHEENNDIDPNFDGARSR-MVPKDWWVE  1
            SYTYNRKK+  E+   D +++G R + MVP+DWWVE
Sbjct  180  SYTYNRKKLPSESGS-DSHWNGVRKQPMVPRDWWVE  214



>ref|XP_006650278.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Oryza 
brachyantha]
Length=634

 Score =   318 bits (814),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 184/216 (85%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MK MKLGSKPD FQ+EG N+R+VA+ELA+DI+I +GDVKFYLHKFPLLSKS+ LQ+LV +
Sbjct  1    MKHMKLGSKPDLFQTEGGNIRFVATELATDIVISVGDVKFYLHKFPLLSKSSRLQRLVAS  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            SNE + +E+ I DIPGG +AFEICAKFCYGM VTLNAYN++AARCAAEYLEM E ++KGN
Sbjct  61   SNEESNNELDISDIPGGPSAFEICAKFCYGMIVTLNAYNVLAARCAAEYLEMFETIDKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL SSI ++WKDSIIVLQ+TKS +P  E LK++ HC+++IAS+A ID S+V+W
Sbjct  121  LIYKIDVFLTSSIFRAWKDSIIVLQSTKSLVPWSENLKVINHCIDSIASKALIDPSEVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRM-VPKDWWVE  1
            SYTYNRKK+  EN   D +++G R ++ VPKDWWVE
Sbjct  181  SYTYNRKKLPSENGH-DSHWNGVRKQLIVPKDWWVE  215



>ref|XP_004234653.1| PREDICTED: BTB/POZ domain-containing protein NPY4 isoform X1 
[Solanum lycopersicum]
 ref|XP_010317780.1| PREDICTED: BTB/POZ domain-containing protein NPY4 isoform X1 
[Solanum lycopersicum]
Length=630

 Score =   316 bits (809),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 150/216 (69%), Positives = 184/216 (85%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MK+MKLGSKPD FQ++G+++RYVA+ELA+D+II++GDVKFYLHKFPLL KS  LQKL+  
Sbjct  1    MKYMKLGSKPDQFQTQGDSIRYVAAELATDMIINVGDVKFYLHKFPLLLKSYRLQKLIAC  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N DE++I DIPGG  AFE+CAKFCY MTVTLNAYN++AARCAAEYLEM E+VEKGN
Sbjct  61   TNEENIDEINIHDIPGGPAAFEVCAKFCYNMTVTLNAYNVVAARCAAEYLEMYESVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VFL SSI +SWKDSIIVLQTTK+ LP  EELK+V HC+E++AS+AS+D SKVDW
Sbjct  121  LIYKIEVFLTSSIFRSWKDSIIVLQTTKAFLPWSEELKIVSHCLESVASKASVDTSKVDW  180

Query  105  SYTYNRKKIHEEN-NDIDPNFDGARSRMVPKDWWVE  1
            SYTYN KK+  EN +D+  N    + ++VP DWWVE
Sbjct  181  SYTYNHKKLPSENGSDLHCNAISCQ-QLVPIDWWVE  215



>ref|XP_006343206.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006343207.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Solanum tuberosum]
Length=627

 Score =   316 bits (809),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 184/216 (85%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MK+MKLGSKPD FQ+EG+++RYVA+ELA+D++I++GDVKFYLHKFPLL KS  LQKL+  
Sbjct  1    MKYMKLGSKPDQFQTEGDSIRYVAAELATDMVINVGDVKFYLHKFPLLLKSYRLQKLIAC  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N D+++I DIPGG  AFE+CAKFCY MTVTLNAYN++AARCAAEYLEM E+VEKGN
Sbjct  61   TNEENSDKINIHDIPGGPAAFEVCAKFCYNMTVTLNAYNVVAARCAAEYLEMYESVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VFL SSI +SWKDSIIVLQTTK+ LP  EELK+V HC+E++AS+AS+D SKVDW
Sbjct  121  LIYKIEVFLTSSIFRSWKDSIIVLQTTKAFLPWSEELKIVSHCLESVASKASVDTSKVDW  180

Query  105  SYTYNRKKIHEEN-NDIDPNFDGARSRMVPKDWWVE  1
            SYTYN KK+  EN +D+  N    + ++VP DWWVE
Sbjct  181  SYTYNHKKLPSENGSDLHCNAVSWQ-QLVPIDWWVE  215



>ref|XP_009396038.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Musa 
acuminata subsp. malaccensis]
Length=585

 Score =   313 bits (803),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/216 (67%), Positives = 180/216 (83%), Gaps = 1/216 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD F+S+G ++R+VA++LA+DIIIH+G++KF+LHKFPLLSKS ++QKL+  
Sbjct  1    MKFMKLGSKPDSFKSDGKDIRFVATDLAADIIIHVGNIKFHLHKFPLLSKSYYMQKLLMT  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +N    DE+ I DIPGG  AFEICAKFCYGMTVTLNA+N+IAARCAAEYLEM+E VEKGN
Sbjct  61   TNNEATDEICISDIPGGVAAFEICAKFCYGMTVTLNAHNVIAARCAAEYLEMHETVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VFL +SI   WKDSIIVLQTT+S LP  E+LKL+ HC++++AS+AS D SKV+W
Sbjct  121  LIYKIEVFLRASIFHGWKDSIIVLQTTRSLLPWAEDLKLISHCIDSVASKASTDASKVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSR-MVPKDWWVE  1
            SYTYNRKK+  EN   +  ++G R    VPKDWWVE
Sbjct  181  SYTYNRKKLPSENGPNEQQWNGVRKENSVPKDWWVE  216



>emb|CDY29566.1| BnaA03g54110D [Brassica napus]
Length=578

 Score =   313 bits (801),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/224 (68%), Positives = 181/224 (81%), Gaps = 19/224 (8%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLV--  472
            MKFMKLGSKPD FQSEG+N+RYV+S+LA+D+I+ IGDVKFYLHKFPLLSKSA LQKL+  
Sbjct  1    MKFMKLGSKPDSFQSEGDNVRYVSSDLATDVIVTIGDVKFYLHKFPLLSKSARLQKLIAA  60

Query  471  TNSNEGNG-----DEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMN  307
            T+SNE N      DE+ I +IPGG  +FEICAKFCYGMTVTLNAYN++AARCAAE+LEM+
Sbjct  61   TSSNEDNEIHQEEDEIVIPEIPGGAASFEICAKFCYGMTVTLNAYNVVAARCAAEFLEMH  120

Query  306  ENVEKGNLIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASI  127
            E VEKGNL+YKI+VFLNSSIL+SWKDSII LQTT++  P  EELKL G C+E+IASRA I
Sbjct  121  ETVEKGNLVYKIEVFLNSSILQSWKDSIITLQTTRALSPHAEELKLTGRCLESIASRACI  180

Query  126  DVSKVDWSYTYNRKKIHEENNDIDPNFDGA--RSRMVPKDWWVE  1
            D S+V+WSYTY++KK          N D    R + VP+DWWVE
Sbjct  181  DTSRVEWSYTYSKKK----------NLDNGLRRPQAVPRDWWVE  214



>gb|EMS51026.1| Root phototropism protein 3 [Triticum urartu]
Length=606

 Score =   313 bits (802),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/216 (68%), Positives = 177/216 (82%), Gaps = 3/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGS PD FQ +G+ +R V +EL SDI + +G+ KFYLHKFPLLSK A  QKL+  
Sbjct  1    MKFMKLGSNPDTFQDDGSEVRIVETELVSDITVRLGNTKFYLHKFPLLSKCARFQKLIPT  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            + + N D +HI DIPGG  AFEICAKFCYGM VTLNAYN++AARCAAEYLEMNE V+KGN
Sbjct  61   TGDENID-IHIHDIPGGPKAFEICAKFCYGMVVTLNAYNVVAARCAAEYLEMNETVDKGN  119

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL+SSI +SWKDSIIVL TTK+HLP  E+LKLV HC+++IAS+AS+D SKV+W
Sbjct  120  LIYKIDVFLSSSIFRSWKDSIIVLGTTKAHLPWSEDLKLVSHCIDSIASKASVDTSKVEW  179

Query  105  SYTYNRKKIHEENNDIDPNFDGARSR-MVPKDWWVE  1
            SYTYNRKK+  E ND+D  ++G + +  VPKDWWVE
Sbjct  180  SYTYNRKKLSAE-NDLDMQWNGVKKQPAVPKDWWVE  214



>ref|XP_002468311.1| hypothetical protein SORBIDRAFT_01g043540 [Sorghum bicolor]
 gb|EER95309.1| hypothetical protein SORBIDRAFT_01g043540 [Sorghum bicolor]
Length=609

 Score =   313 bits (801),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 148/215 (69%), Positives = 171/215 (80%), Gaps = 1/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGS PD FQ +GN +   ASEL SDI + IG  KFYLHKFPLLSK A  QKL+  
Sbjct  1    MKFMKLGSNPDTFQDDGNEVSIAASELVSDITVRIGTTKFYLHKFPLLSKCARFQKLIPT  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            + + N  E+HI DIPGG  AFEICAKFCYGM VTLNAYN+IAARCAAEYLEMNE V+KGN
Sbjct  61   TGDEN-IEIHIHDIPGGAKAFEICAKFCYGMIVTLNAYNVIAARCAAEYLEMNETVDKGN  119

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKID+FL+SSI +SWKDSIIVL TTK+HLP  E+LKLV HC++++AS+ASIDVSKV+W
Sbjct  120  LIYKIDIFLSSSIFRSWKDSIIVLGTTKAHLPWAEDLKLVSHCIDSVASKASIDVSKVEW  179

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRKK+  EN    P     + + VPKDWWVE
Sbjct  180  SYTYNRKKLPTENGHDSPWNGVKQQQFVPKDWWVE  214



>ref|XP_004985278.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Setaria italica]
 ref|XP_004985279.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Setaria italica]
 ref|XP_004985280.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X3 [Setaria italica]
 ref|XP_004985281.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X4 [Setaria italica]
Length=609

 Score =   313 bits (801),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 148/215 (69%), Positives = 173/215 (80%), Gaps = 1/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGS PD FQ +GN +  VASEL SDI + IG  KFYLHKFPLLSK A  QKL+  
Sbjct  1    MKFMKLGSNPDTFQGDGNEVSIVASELVSDITVRIGTTKFYLHKFPLLSKCARFQKLIPT  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            + + N D + I DIPGG  AFEICAKFCYGM VTLNAYN+IAARCAAEYLEMNE V+KGN
Sbjct  61   TGDENID-IQIHDIPGGAKAFEICAKFCYGMIVTLNAYNVIAARCAAEYLEMNETVDKGN  119

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL+SSI +SWKDSIIVL TTK+HLP  E+LKLV HC++++AS+ASIDVSKV+W
Sbjct  120  LIYKIDVFLSSSIFRSWKDSIIVLGTTKAHLPWAEDLKLVSHCIDSVASKASIDVSKVEW  179

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRKK+  E+ +  P     + ++VPKDWWVE
Sbjct  180  SYTYNRKKLPTESGNDSPWNGVKQQQLVPKDWWVE  214



>ref|XP_007042623.1| Phototropic-responsive NPH3 family protein isoform 4, partial 
[Theobroma cacao]
 gb|EOX98454.1| Phototropic-responsive NPH3 family protein isoform 4, partial 
[Theobroma cacao]
Length=442

 Score =   307 bits (787),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 143/197 (73%), Positives = 168/197 (85%), Gaps = 1/197 (1%)
 Frame = -2

Query  591  NLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTNSNEGNGDEVHIRDIPGGH  412
             + YVASELA+DI + +GDVKFYLHKFPLLSKS+ LQKLV +SNE   DEV I DIPGG 
Sbjct  2    GIMYVASELATDITVIVGDVKFYLHKFPLLSKSSCLQKLVASSNEEKSDEVQISDIPGGP  61

Query  411  TAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGNLIYKIDVFLNSSILKSWK  232
             AFE+CAKFCY MTVTLNAYN++AARCAAEYL M+E +EKGNLIYK+DVFLNSSI +SWK
Sbjct  62   VAFEMCAKFCYAMTVTLNAYNVVAARCAAEYLGMHETIEKGNLIYKVDVFLNSSIFRSWK  121

Query  231  DSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDWSYTYNRKKIHEENNDIDP  52
            DSIIVLQTTKS LP+ EELK+V  C++A+A +A +DVS VDWSYTYNR+K+ EEN + DP
Sbjct  122  DSIIVLQTTKSMLPLSEELKVVSLCIDAVAIKACVDVSNVDWSYTYNRRKLPEENGN-DP  180

Query  51   NFDGARSRMVPKDWWVE  1
            N++G RSR VPKDWWVE
Sbjct  181  NYNGVRSRPVPKDWWVE  197



>emb|CAN66911.1| hypothetical protein VITISV_035422 [Vitis vinifera]
Length=621

 Score =   313 bits (801),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 174/195 (89%), Gaps = 2/195 (1%)
 Frame = -2

Query  582  YVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTNSNEGNGDEVHIRDIPGGHTAF  403
            YVASELA+DI++++G+VKFYLHKFPLLSKS  LQKLV  +N+GN DEVHI DIPGG +AF
Sbjct  17   YVASELATDIVVNVGEVKFYLHKFPLLSKSECLQKLVAATNDGNSDEVHIPDIPGGPSAF  76

Query  402  EICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGNLIYKIDVFLNSSILKSWKDSI  223
            EICAKFCYGMTVTLNAYN++AARCAAEYL M+E +EKGNLIYKIDVFLNSSI +SWKDSI
Sbjct  77   EICAKFCYGMTVTLNAYNVVAARCAAEYLGMHETIEKGNLIYKIDVFLNSSIFRSWKDSI  136

Query  222  IVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDWSYTYNRKKIHEENNDIDPNFD  43
            IVLQTTKS LP+ E+LK++ HC+++IAS+ASIDVS+VDWSYTYNRKK+ EEN   DP ++
Sbjct  137  IVLQTTKSLLPLSEDLKVISHCIDSIASKASIDVSRVDWSYTYNRKKLPEENG-TDPKWN  195

Query  42   GARSR-MVPKDWWVE  1
            G  +R +VPKDWWVE
Sbjct  196  GVGNRPVVPKDWWVE  210



>gb|EMT10822.1| Root phototropism protein 3 [Aegilops tauschii]
Length=606

 Score =   312 bits (800),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 147/216 (68%), Positives = 177/216 (82%), Gaps = 3/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGS PD FQ +G+ +R V +EL SDI + +G+ KFYLHKFPLLSK A  QKL+  
Sbjct  1    MKFMKLGSNPDTFQDDGSEVRIVETELVSDITVRLGNTKFYLHKFPLLSKCARFQKLIPT  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            + + N D +HI DIPGG  AFEICAKFCYGM VTLNAYN++AARCAAEYLEMNE V+KGN
Sbjct  61   TGDENID-IHIHDIPGGPKAFEICAKFCYGMVVTLNAYNVVAARCAAEYLEMNETVDKGN  119

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL+SSI +SWKDSIIVL TTK+HLP  E+LKLV HC+++IAS+AS+D SKV+W
Sbjct  120  LIYKIDVFLSSSIFRSWKDSIIVLGTTKAHLPWSEDLKLVSHCIDSIASKASVDTSKVEW  179

Query  105  SYTYNRKKIHEENNDIDPNFDGARSR-MVPKDWWVE  1
            SYTYNRKK+  E ND+D  ++G + +  VPKDWWVE
Sbjct  180  SYTYNRKKLSTE-NDLDMQWNGVKKQPSVPKDWWVE  214



>ref|XP_010232704.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like isoform 
X1 [Brachypodium distachyon]
Length=634

 Score =   313 bits (801),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 147/216 (68%), Positives = 181/216 (84%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MK MKLGSK D FQ+EG+N+R+VA+EL +DIII IGDVKFYLHKFPLLSKS+ LQ+LV +
Sbjct  1    MKHMKLGSKADVFQTEGSNIRFVATELVTDIIISIGDVKFYLHKFPLLSKSSRLQRLVAS  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            SNE N DEV I DIPGG +AFEICAKFCYGM VTLNAYN+++ARCAAEYLEM E ++KGN
Sbjct  61   SNEENNDEVDISDIPGGPSAFEICAKFCYGMIVTLNAYNVLSARCAAEYLEMFETIDKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL SS+  +WKDSI+VLQ+TKS  P  E  K++ HC+++IAS+ASID S+V+W
Sbjct  121  LIYKIDVFLTSSVFHAWKDSIVVLQSTKSLQPWTENSKVINHCIDSIASKASIDSSEVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGAR-SRMVPKDWWVE  1
            SYTYNRKK+  EN  +  +++G R  ++VPKDWWVE
Sbjct  181  SYTYNRKKLLSENG-VGSHWNGVRMQQIVPKDWWVE  215



>ref|XP_010548457.1| PREDICTED: BTB/POZ domain-containing protein NPY5-like [Tarenaya 
hassleriana]
 ref|XP_010548458.1| PREDICTED: BTB/POZ domain-containing protein NPY5-like [Tarenaya 
hassleriana]
 ref|XP_010548459.1| PREDICTED: BTB/POZ domain-containing protein NPY5-like [Tarenaya 
hassleriana]
 ref|XP_010548461.1| PREDICTED: BTB/POZ domain-containing protein NPY5-like [Tarenaya 
hassleriana]
 ref|XP_010548462.1| PREDICTED: BTB/POZ domain-containing protein NPY5-like [Tarenaya 
hassleriana]
Length=575

 Score =   311 bits (797),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 149/217 (69%), Positives = 179/217 (82%), Gaps = 8/217 (4%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ EG+N+RYVA+ELA+D+++ IGDVKFYLHKFPL+SKSA LQKL+T 
Sbjct  1    MKFMKLGSKPDSFQCEGDNIRYVATELATDVLVVIGDVKFYLHKFPLMSKSARLQKLITT  60

Query  465  -SNEGNG-DEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEK  292
             SNE +  DE+H+ DI GG  AFEICAKFCYGMTVTLN YN++AARCAAE+LEM+E VEK
Sbjct  61   TSNEDSQHDEIHLADIHGGPAAFEICAKFCYGMTVTLNPYNVVAARCAAEFLEMHETVEK  120

Query  291  GNLIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKV  112
             NL+YKI+VFL+SSI  SWKDSIIVLQTT+S  P  EELKLVG C+++IAS+AS+D SKV
Sbjct  121  SNLVYKIEVFLSSSIFHSWKDSIIVLQTTRSLFPHAEELKLVGRCIDSIASKASMDTSKV  180

Query  111  DWSYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            +WSYTYNRKK+   +N I         + VP+DWWVE
Sbjct  181  EWSYTYNRKKLENGSNGIRIQ------QAVPRDWWVE  211



>ref|XP_010232705.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Brachypodium distachyon]
Length=610

 Score =   312 bits (800),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 147/216 (68%), Positives = 181/216 (84%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MK MKLGSK D FQ+EG+N+R+VA+EL +DIII IGDVKFYLHKFPLLSKS+ LQ+LV +
Sbjct  1    MKHMKLGSKADVFQTEGSNIRFVATELVTDIIISIGDVKFYLHKFPLLSKSSRLQRLVAS  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            SNE N DEV I DIPGG +AFEICAKFCYGM VTLNAYN+++ARCAAEYLEM E ++KGN
Sbjct  61   SNEENNDEVDISDIPGGPSAFEICAKFCYGMIVTLNAYNVLSARCAAEYLEMFETIDKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL SS+  +WKDSI+VLQ+TKS  P  E  K++ HC+++IAS+ASID S+V+W
Sbjct  121  LIYKIDVFLTSSVFHAWKDSIVVLQSTKSLQPWTENSKVINHCIDSIASKASIDSSEVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGAR-SRMVPKDWWVE  1
            SYTYNRKK+  EN  +  +++G R  ++VPKDWWVE
Sbjct  181  SYTYNRKKLLSENG-VGSHWNGVRMQQIVPKDWWVE  215



>ref|XP_004963018.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Setaria italica]
Length=634

 Score =   313 bits (801),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 144/216 (67%), Positives = 183/216 (85%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MK+MKLGSKPD FQ++GN++R+V +ELA+DI+I +GDVKFYLHKFPLLSKS+ LQ LV +
Sbjct  1    MKYMKLGSKPDVFQTDGNSIRFVTTELATDIVITVGDVKFYLHKFPLLSKSSRLQTLVAS  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +N+ + DEV I DIPGG  AFEICAKFCYGM VTLNAYN++AARCAAEYLEM E ++KGN
Sbjct  61   TNDESNDEVDISDIPGGPAAFEICAKFCYGMIVTLNAYNVLAARCAAEYLEMFETIDKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL++SI ++WKDSIIVLQ+TKS     E LK++ HCV++IAS+AS+D S+VDW
Sbjct  121  LIYKIDVFLSASIFRTWKDSIIVLQSTKSLQQWTENLKVINHCVDSIASKASMDPSEVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGAR-SRMVPKDWWVE  1
            SYTYNRKK+  E+  +D +++G R  + VP+DWWVE
Sbjct  181  SYTYNRKKLPSESG-LDSHWNGVRKQQTVPRDWWVE  215



>ref|XP_006282580.1| hypothetical protein CARUB_v10004449mg [Capsella rubella]
 gb|EOA15478.1| hypothetical protein CARUB_v10004449mg [Capsella rubella]
Length=581

 Score =   311 bits (797),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 155/227 (68%), Positives = 180/227 (79%), Gaps = 22/227 (10%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQSEG+N RYVASELA+D+I+ IGDVKFYLHKFPLLSKSA LQKL+T 
Sbjct  1    MKFMKLGSKPDSFQSEGDNARYVASELATDVIVIIGDVKFYLHKFPLLSKSARLQKLITT  60

Query  465  S-----NEGNG-----DEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYL  316
            S     NE +      DE+ I DIPGG  +FEICAKFCYGMTVTLNAYN++AARCAAE+L
Sbjct  61   SSSSSSNEDDQIHHHEDEIEITDIPGGPASFEICAKFCYGMTVTLNAYNVVAARCAAEFL  120

Query  315  EMNENVEKGNLIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASR  136
            EM E VEKGNL+YKI+VFLNSSIL+SWKDSIIVLQTT++  P  EELKL G C+++IASR
Sbjct  121  EMYETVEKGNLVYKIEVFLNSSILQSWKDSIIVLQTTRALSPYSEELKLTGRCLDSIASR  180

Query  135  ASIDVSKVDWSYTYNRKKIHEENNDIDPNFDGA--RSRMVPKDWWVE  1
            ASID SKV+WSYTY++KK          N D    + + VP+DWWVE
Sbjct  181  ASIDTSKVEWSYTYSKKK----------NLDNGMRKPQAVPRDWWVE  217



>gb|EAY90980.1| hypothetical protein OsI_12589 [Oryza sativa Indica Group]
Length=634

 Score =   313 bits (801),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 181/216 (84%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MK MKLGSKPD FQ+EG N+R+VA+ELA+DI+I IGDVKF LHKFPLLSKS+ LQ+LV +
Sbjct  1    MKHMKLGSKPDLFQTEGGNIRFVATELATDIVISIGDVKFCLHKFPLLSKSSCLQRLVAS  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            SN    +E+ I DIPGG +AFEICAKFCYGM VTLNAYN++AARCAAEYLEM E +EKGN
Sbjct  61   SNVEGNEELDISDIPGGPSAFEICAKFCYGMIVTLNAYNVLAARCAAEYLEMFETIEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL SSI ++WKDSIIVLQ+TKS LP  E LK++ HC+++IAS+A ID S+V+W
Sbjct  121  LIYKIDVFLTSSIFRAWKDSIIVLQSTKSLLPWSENLKVINHCIDSIASKALIDPSEVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRM-VPKDWWVE  1
            SYTYNRKK+  EN   D +++G R ++ VPKDWWVE
Sbjct  181  SYTYNRKKLPSENGH-DSHWNGVRKQLIVPKDWWVE  215



>ref|XP_010275834.1| PREDICTED: BTB/POZ domain-containing protein NPY1-like [Nelumbo 
nucifera]
Length=612

 Score =   312 bits (799),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 148/219 (68%), Positives = 177/219 (81%), Gaps = 9/219 (4%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++GN +RYVASEL +DI+I++GD+KFYLHKFPLLSKS  LQKLV  
Sbjct  1    MKFMKLGSKPDAFQADGNCIRYVASELTTDIVINVGDIKFYLHKFPLLSKSNRLQKLVLK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N DEVHI D PGG  AFEICAKFCYGM VTLNAYN++AARCAAEYLEM E+ ++GN
Sbjct  61   ANEENTDEVHIVDFPGGPKAFEICAKFCYGMIVTLNAYNVVAARCAAEYLEMTEDADRGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LI+KI+VFLNSS+ +SWKDSIIVLQTTKS LP  EELK+VG C+++IAS+ S+D S V+W
Sbjct  121  LIFKIEVFLNSSVFRSWKDSIIVLQTTKSLLPWAEELKVVGRCIDSIASKTSVDPSSVNW  180

Query  105  SYTYNRK----KIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRK    +I E    +       R + VPKDWW+E
Sbjct  181  SYTYNRKLAVGEITEHGTRLQ-----QRIQSVPKDWWIE  214



>ref|NP_001146294.1| uncharacterized protein LOC100279869 [Zea mays]
 ref|XP_008672921.1| PREDICTED: uncharacterized protein LOC100279869 isoform X1 [Zea 
mays]
 ref|XP_008672927.1| PREDICTED: uncharacterized protein LOC100279869 isoform X1 [Zea 
mays]
 gb|ACL53641.1| unknown [Zea mays]
 tpg|DAA47266.1| TPA: putative phototropic-responsive NPH3 family protein isoform 
1 [Zea mays]
 tpg|DAA47267.1| TPA: putative phototropic-responsive NPH3 family protein isoform 
2 [Zea mays]
Length=641

 Score =   312 bits (799),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 177/216 (82%), Gaps = 1/216 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MK+MKLGSKPD FQ+EGN++R VA+ELA DI++ +GDVKFYLHKFPLLSKS+ LQ LV +
Sbjct  1    MKYMKLGSKPDAFQTEGNSIRSVATELAVDIVVTVGDVKFYLHKFPLLSKSSRLQTLVAS  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            ++E   DEV I DIPGG  AFE+CAKFCYGM VTLNAYN++AARCAAEYLEM+E VEKGN
Sbjct  61   TSEEGSDEVDISDIPGGPAAFEVCAKFCYGMVVTLNAYNVLAARCAAEYLEMSETVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            L+YKIDVFL++SI ++WKDSIIVLQ+T+      + LK+V HCV+AIASRAS D S+VDW
Sbjct  121  LVYKIDVFLSASIFRAWKDSIIVLQSTRPLQRWTDSLKVVNHCVDAIASRASTDPSEVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRM-VPKDWWVE  1
            SYTY+R+K+  E +     ++G R R  VP+DWWVE
Sbjct  181  SYTYSRRKLPSETDGDARGWNGVRKRQAVPRDWWVE  216



>ref|XP_004963017.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Setaria italica]
Length=667

 Score =   313 bits (801),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 144/216 (67%), Positives = 183/216 (85%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MK+MKLGSKPD FQ++GN++R+V +ELA+DI+I +GDVKFYLHKFPLLSKS+ LQ LV +
Sbjct  1    MKYMKLGSKPDVFQTDGNSIRFVTTELATDIVITVGDVKFYLHKFPLLSKSSRLQTLVAS  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +N+ + DEV I DIPGG  AFEICAKFCYGM VTLNAYN++AARCAAEYLEM E ++KGN
Sbjct  61   TNDESNDEVDISDIPGGPAAFEICAKFCYGMIVTLNAYNVLAARCAAEYLEMFETIDKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL++SI ++WKDSIIVLQ+TKS     E LK++ HCV++IAS+AS+D S+VDW
Sbjct  121  LIYKIDVFLSASIFRTWKDSIIVLQSTKSLQQWTENLKVINHCVDSIASKASMDPSEVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGAR-SRMVPKDWWVE  1
            SYTYNRKK+  E+  +D +++G R  + VP+DWWVE
Sbjct  181  SYTYNRKKLPSESG-LDSHWNGVRKQQTVPRDWWVE  215



>ref|XP_009138500.1| PREDICTED: BTB/POZ domain-containing protein NPY5 [Brassica rapa]
Length=578

 Score =   310 bits (794),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/224 (67%), Positives = 180/224 (80%), Gaps = 19/224 (8%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLV--  472
            MKFMKLGSKPD FQSEG+N+RYV+S+LA+D+I+ IGDVKFYLHKFPLLSKSA LQKL+  
Sbjct  1    MKFMKLGSKPDSFQSEGDNVRYVSSDLATDVIVTIGDVKFYLHKFPLLSKSARLQKLIAA  60

Query  471  TNSNEGNG-----DEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMN  307
            T+SNE N      DE+ I +IPGG  +FEICAKFCYGMTVTLNAYN++AARCAAE+LEM+
Sbjct  61   TSSNEDNEIHQEEDEIVIPEIPGGAASFEICAKFCYGMTVTLNAYNVVAARCAAEFLEMH  120

Query  306  ENVEKGNLIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASI  127
            E VEKGNL+YKI+VFLNSSIL+SWKDSII LQTT++  P  EELKL G C+E+IASRA I
Sbjct  121  ETVEKGNLVYKIEVFLNSSILQSWKDSIITLQTTRALSPHAEELKLTGRCLESIASRACI  180

Query  126  DVSKVDWSYTYNRKKIHEENNDIDPNFDGA--RSRMVPKDWWVE  1
            D S+V+WSYTY++KK          N D    R + VP+ WWVE
Sbjct  181  DTSRVEWSYTYSKKK----------NLDNGLRRPQAVPRGWWVE  214



>ref|NP_001146461.1| putative phototropic-responsive NPH3 family protein isoform 1 
[Zea mays]
 ref|XP_008658516.1| PREDICTED: putative phototropic-responsive NPH3 family protein 
isoform 1 isoform X1 [Zea mays]
 gb|ACN31846.1| unknown [Zea mays]
 gb|ACN32003.1| unknown [Zea mays]
 gb|AFW89291.1| putative phototropic-responsive NPH3 family protein isoform 1 
[Zea mays]
 gb|AFW89292.1| putative phototropic-responsive NPH3 family protein isoform 2 
[Zea mays]
 gb|AFW89293.1| putative phototropic-responsive NPH3 family protein isoform 3 
[Zea mays]
 gb|AIB05808.1| orphans transcription factor, partial [Zea mays]
Length=624

 Score =   311 bits (797),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/215 (69%), Positives = 171/215 (80%), Gaps = 1/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGS PD FQ +GN +   ASEL SDI + IG  KFYLHKFPLLSK A  QKL+  
Sbjct  1    MKFMKLGSNPDTFQGDGNEVSIAASELVSDITVRIGTTKFYLHKFPLLSKCARFQKLIPT  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            + + N  E+HI DIPGG  AFEICAKFCYGM VTLNAYN+IAARCAAEYLEMNE V+KGN
Sbjct  61   TGDEN-IEIHIHDIPGGAKAFEICAKFCYGMIVTLNAYNVIAARCAAEYLEMNETVDKGN  119

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKID+FL+SSI +SWKDSIIVL TTK+HLP  E+LKLV HC++++AS+ASIDVSKV+W
Sbjct  120  LIYKIDIFLSSSIHRSWKDSIIVLGTTKAHLPWAEDLKLVSHCIDSVASKASIDVSKVEW  179

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRKK+  EN    P     + + VPKDWWVE
Sbjct  180  SYTYNRKKLTVENGHDSPWNGVKQQQFVPKDWWVE  214



>ref|XP_010526711.1| PREDICTED: BTB/POZ domain-containing protein NPY5-like [Tarenaya 
hassleriana]
 ref|XP_010526712.1| PREDICTED: BTB/POZ domain-containing protein NPY5-like [Tarenaya 
hassleriana]
 ref|XP_010526713.1| PREDICTED: BTB/POZ domain-containing protein NPY5-like [Tarenaya 
hassleriana]
Length=572

 Score =   309 bits (792),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 179/216 (83%), Gaps = 7/216 (3%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQSEG+N RYVA+ELA+D+++ IGDVKFYLHKFPLLSKSA LQKLVT 
Sbjct  1    MKFMKLGSKPDSFQSEGDNTRYVATELATDLVVVIGDVKFYLHKFPLLSKSARLQKLVTI  60

Query  465  SN-EGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKG  289
            S+ E + DE+++ DIPGG  AFEIC+KFCYGMTVTLNAYN++AARCAAE+L M E V+K 
Sbjct  61   SDDEEHRDEIYMPDIPGGPAAFEICSKFCYGMTVTLNAYNVVAARCAAEFLGMYETVDKS  120

Query  288  NLIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVD  109
            NLIYKI+VFLNSSI  SWKDSIIVLQTT+S  P  EELKLV  C+++IAS+AS+D S+V+
Sbjct  121  NLIYKIEVFLNSSIFHSWKDSIIVLQTTRSLSPYSEELKLVSRCLDSIASKASMDASRVE  180

Query  108  WSYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            WSYTYNRKK+ +  N +       + + VP+DWWVE
Sbjct  181  WSYTYNRKKLEKGGNGV------RKPQAVPRDWWVE  210



>ref|NP_001050649.1| Os03g0609800 [Oryza sativa Japonica Group]
 gb|AAR00589.1| putative NPH3 family protein [Oryza sativa Japonica Group]
 gb|AAR87349.1| transposon protein, putative, mutator sub-class [Oryza sativa 
Japonica Group]
 gb|AAX95837.1| transposon protein, putative, mutator sub-class [Oryza sativa 
Japonica Group]
 gb|ABF97571.1| transposon protein, putative, Mutator sub-class, expressed [Oryza 
sativa Japonica Group]
 gb|ABF97572.1| transposon protein, putative, Mutator sub-class, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF12563.1| Os03g0609800 [Oryza sativa Japonica Group]
 gb|EAZ27761.1| hypothetical protein OsJ_11706 [Oryza sativa Japonica Group]
 dbj|BAG89762.1| unnamed protein product [Oryza sativa Japonica Group]
Length=634

 Score =   311 bits (796),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 180/216 (83%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MK MKLGSKPD FQ+EG N+R+VA+ELA+DI+I IGDVKF LHKFPLLSKS+ LQ+L  +
Sbjct  1    MKHMKLGSKPDLFQTEGGNIRFVATELATDIVISIGDVKFCLHKFPLLSKSSCLQRLAAS  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            SN    +E+ I DIPGG +AFEICAKFCYGM VTLNAYN++AARCAAEYLEM E +EKGN
Sbjct  61   SNVEGNEELDISDIPGGPSAFEICAKFCYGMIVTLNAYNVLAARCAAEYLEMFETIEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL SSI ++WKDSIIVLQ+TKS LP  E LK++ HC+++IAS+A ID S+V+W
Sbjct  121  LIYKIDVFLTSSIFRAWKDSIIVLQSTKSLLPWSENLKVINHCIDSIASKALIDPSEVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRM-VPKDWWVE  1
            SYTYNRKK+  EN   D +++G R ++ VPKDWWVE
Sbjct  181  SYTYNRKKLPSENGH-DSHWNGVRKQLIVPKDWWVE  215



>ref|NP_001151545.1| transposon protein Mutator sub-class [Zea mays]
 gb|ACG43260.1| transposon protein Mutator sub-class [Zea mays]
Length=608

 Score =   310 bits (793),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 172/216 (80%), Gaps = 3/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGS PD FQ +GN +   ASEL SDI + IG  KFYLHKFPLLSK A  QKL+  
Sbjct  1    MKFMKLGSNPDTFQDDGNEVSIAASELVSDITVRIGTTKFYLHKFPLLSKCARFQKLIPT  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            + E N  E+HI DIPGG  AF +CAKFCYGM VTLNAYN+IAARCAAEYLEMNE V+KGN
Sbjct  61   TGEEN-IEIHIHDIPGGAKAFGVCAKFCYGMIVTLNAYNVIAARCAAEYLEMNETVDKGN  119

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL+SSI +SWKDSIIVL TTK+HLP  E+LKLV  C++++AS+ASIDVSKV+W
Sbjct  120  LIYKIDVFLSSSIFRSWKDSIIVLGTTKAHLPWAEDLKLVSQCIDSVASKASIDVSKVEW  179

Query  105  SYTYNRKKIHEENNDIDPNFDGARSR-MVPKDWWVE  1
            SYTYNRKK+  EN    P ++G   R +VPKDWWVE
Sbjct  180  SYTYNRKKLPTENGHDSP-WNGVNQRQVVPKDWWVE  214



>ref|XP_002443443.1| hypothetical protein SORBIDRAFT_08g019560 [Sorghum bicolor]
 gb|EES17281.1| hypothetical protein SORBIDRAFT_08g019560 [Sorghum bicolor]
Length=672

 Score =   311 bits (797),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 147/219 (67%), Positives = 181/219 (83%), Gaps = 4/219 (2%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MK+MKLGSKPD FQ+EGN++R+V +ELA+DI+I +GDVKFYLHKFPLLSKS+ LQ LV +
Sbjct  1    MKYMKLGSKPDAFQTEGNSIRFVTTELATDIVITVGDVKFYLHKFPLLSKSSRLQTLVAS  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            ++E + DEV I DIPGG  AFEICAKFCYGM VTLNAYN++AARCAAEYLEM E V+KGN
Sbjct  61   TSEESNDEVDISDIPGGPAAFEICAKFCYGMVVTLNAYNVLAARCAAEYLEMFETVDKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL++SI ++WKDSIIVLQ+TKS     E LK+V HCV+AIA+RAS+D S+VDW
Sbjct  121  LIYKIDVFLSASIFRTWKDSIIVLQSTKSLHQWTENLKVVNHCVDAIATRASMDPSEVDW  180

Query  105  SYTYNRKKIHEENNDIDPN---FDGARSRM-VPKDWWVE  1
            SYTYNR+K+  EN     +   ++G R +  VP+DWWVE
Sbjct  181  SYTYNRRKLPSENGGGGGDAHTWNGVRKQQAVPRDWWVE  219



>emb|CDY37223.1| BnaA09g08440D [Brassica napus]
Length=603

 Score =   309 bits (791),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 145/215 (67%), Positives = 176/215 (82%), Gaps = 4/215 (2%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMK+GSKPD  +++GNN+RYV +ELASDI I++   +F LHKFPLLSKSA LQKL+++
Sbjct  1    MKFMKIGSKPDSIKTDGNNVRYVENELASDITINVDGSRFCLHKFPLLSKSACLQKLLSS  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +++ N DEV I  IPGG TAFE CAKFCYGMTVTL+AYN++A RCAAEYL M+E  EKGN
Sbjct  61   TDKNNADEVDISGIPGGPTAFETCAKFCYGMTVTLSAYNVVATRCAAEYLGMHETAEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFLNSS+ +SWKDSIIVLQTTK+  P+ E+LKLV  C++AIAS+A +DVS V+W
Sbjct  121  LIYKIDVFLNSSLFRSWKDSIIVLQTTKTFSPLSEDLKLVSLCIDAIASKACVDVSHVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRKK+ EENN      D  R+R VP DWWVE
Sbjct  181  SYTYNRKKLAEENN----GADQVRAREVPHDWWVE  211



>ref|XP_009123215.1| PREDICTED: BTB/POZ domain-containing protein NPY2 [Brassica rapa]
Length=627

 Score =   309 bits (792),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/215 (68%), Positives = 175/215 (81%), Gaps = 4/215 (2%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMK+GSKPD  +++GNN+RYV +ELASDI I++   KF LHKFPLLSKSA LQKL++ 
Sbjct  1    MKFMKIGSKPDSIKTDGNNVRYVENELASDITINVDGSKFCLHKFPLLSKSACLQKLLSR  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +++ N DEV I  IPGG TAFE CAKFCYGMTVTL+AYN++A RCAAEYL M+E  EKGN
Sbjct  61   TDKNNADEVDISGIPGGPTAFETCAKFCYGMTVTLSAYNVVATRCAAEYLGMHETAEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFLNSS+ +SWKDSIIVLQTTK+  P+ E+LKLV  C++AIAS+A +DVS V+W
Sbjct  121  LIYKIDVFLNSSLFRSWKDSIIVLQTTKTFSPLSEDLKLVSLCIDAIASKACVDVSHVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRKK+ EENN      D  R+R VP DWWVE
Sbjct  181  SYTYNRKKLAEENN----GADQVRAREVPHDWWVE  211



>ref|XP_006411871.1| hypothetical protein EUTSA_v10024767mg [Eutrema salsugineum]
 ref|XP_006411872.1| hypothetical protein EUTSA_v10024767mg [Eutrema salsugineum]
 gb|ESQ53324.1| hypothetical protein EUTSA_v10024767mg [Eutrema salsugineum]
 gb|ESQ53325.1| hypothetical protein EUTSA_v10024767mg [Eutrema salsugineum]
Length=579

 Score =   308 bits (789),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/225 (66%), Positives = 177/225 (79%), Gaps = 20/225 (9%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQSEG+N RYV+S+LA+D+I+ IGDVKFYLHKFPLLSKSA LQKL+  
Sbjct  1    MKFMKLGSKPDSFQSEGDNARYVSSDLATDVIVVIGDVKFYLHKFPLLSKSARLQKLIAA  60

Query  465  SNEGNGD--------EVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEM  310
            ++  N D        E+ I +IPGG  +FEICAKFCYGMTVTLNAYN++AARCAAE+LEM
Sbjct  61   TSSTNDDNQIHHQEDEIEIAEIPGGPASFEICAKFCYGMTVTLNAYNVVAARCAAEFLEM  120

Query  309  NENVEKGNLIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRAS  130
             E VEKGNL+YKI+VFLNSSIL++WKDSIIVLQTT++  P  EELKL G C+++IASRAS
Sbjct  121  YETVEKGNLVYKIEVFLNSSILQTWKDSIIVLQTTRALSPYAEELKLTGRCLDSIASRAS  180

Query  129  IDVSKVDWSYTYNRKKIHEENNDIDPNFDGA--RSRMVPKDWWVE  1
            ID SKV+WSYTYN+KK          N D    + + VP DWWVE
Sbjct  181  IDTSKVEWSYTYNKKK----------NLDNGLRKPQAVPVDWWVE  215



>emb|CDX72639.1| BnaC07g46610D [Brassica napus]
Length=578

 Score =   308 bits (788),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/225 (67%), Positives = 180/225 (80%), Gaps = 18/225 (8%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQSEG+N+RYV+S+LA+D+I+ IGDVKFYLHKFPLLSKSA LQKL+  
Sbjct  1    MKFMKLGSKPDSFQSEGDNVRYVSSDLATDVIVTIGDVKFYLHKFPLLSKSARLQKLIAT  60

Query  465  S-----NEGNG-----DEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYL  316
            +     NE N      DE+ I +IPGG  +FEICAKFCYGMTVTLNAYN++AARCAAE+L
Sbjct  61   TSSSSSNEDNEIHQEEDEIVIPEIPGGPASFEICAKFCYGMTVTLNAYNVVAARCAAEFL  120

Query  315  EMNENVEKGNLIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASR  136
            EM+E VEKGNL+YKI+VFLNSSIL+SWKDSII LQTT++  P  EELKL G C+E+IASR
Sbjct  121  EMHETVEKGNLVYKIEVFLNSSILQSWKDSIITLQTTRALSPHAEELKLTGRCLESIASR  180

Query  135  ASIDVSKVDWSYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            A ID S+V+WSYTY++KK      D+D      R + VP+DWWVE
Sbjct  181  ACIDTSRVEWSYTYSKKK------DLDNGL--RRPQAVPRDWWVE  217



>gb|EYU29635.1| hypothetical protein MIMGU_mgv1a003178mg [Erythranthe guttata]
Length=602

 Score =   308 bits (789),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 142/216 (66%), Positives = 179/216 (83%), Gaps = 4/216 (2%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G+++RYVA+ELA+D+++ +GDVKFY+HKFPLLSKS+HLQKLV  
Sbjct  1    MKFMKLGSKPDQFQTDGDSIRYVATELATDMVVSVGDVKFYVHKFPLLSKSSHLQKLVAT  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            S++   +E+ I DIPGG  AFEICAKFCYGM VTLNAYN++AARCAAEYLEM E +EKGN
Sbjct  61   SSDDISEEIDIHDIPGGPAAFEICAKFCYGMVVTLNAYNVVAARCAAEYLEMYETLEKGN  120

Query  285  LIYKIDVFLNSSILKS-WKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVD  109
            L+YKIDVF+ SSI +S WKDSIIVLQTTKS LP  EELK+V HC+++IA+RAS++  +VD
Sbjct  121  LVYKIDVFITSSIFRSTWKDSIIVLQTTKSLLPWSEELKIVSHCLDSIATRASVEPLRVD  180

Query  108  WSYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            WSY+YN +K     N  DP++     + VP+DWWVE
Sbjct  181  WSYSYNNRKTE---NGSDPHWKTGGVKKVPRDWWVE  213



>ref|XP_008679715.1| PREDICTED: transposon protein Mutator sub-class isoform X1 [Zea 
mays]
 ref|XP_008679722.1| PREDICTED: transposon protein Mutator sub-class isoform X1 [Zea 
mays]
 ref|XP_008679727.1| PREDICTED: transposon protein Mutator sub-class isoform X1 [Zea 
mays]
 ref|XP_008679737.1| PREDICTED: transposon protein Mutator sub-class isoform X1 [Zea 
mays]
 ref|XP_008679743.1| PREDICTED: transposon protein Mutator sub-class isoform X1 [Zea 
mays]
 ref|XP_008679747.1| PREDICTED: transposon protein Mutator sub-class isoform X1 [Zea 
mays]
 tpg|DAA43905.1| TPA: putative phototropic-responsive NPH3 family protein [Zea 
mays]
Length=613

 Score =   308 bits (789),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 172/216 (80%), Gaps = 3/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGS PD FQ +GN +   ASEL SDI + IG  KFYLHKFPLLSK A  QKL+  
Sbjct  1    MKFMKLGSNPDTFQDDGNEVSIAASELVSDITVRIGTTKFYLHKFPLLSKCARFQKLIPT  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            + + N  E+HI DIPGG  AF +CAKFCYGM VTLNAYN+IAARCAAEYLEMNE V+KGN
Sbjct  61   TGDEN-IEIHIHDIPGGAKAFGVCAKFCYGMIVTLNAYNVIAARCAAEYLEMNETVDKGN  119

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL+SSI +SWKDSIIVL TTK+HLP  E+LKLV  C++++AS+ASIDVSKV+W
Sbjct  120  LIYKIDVFLSSSIFRSWKDSIIVLGTTKAHLPWAEDLKLVSQCIDSVASKASIDVSKVEW  179

Query  105  SYTYNRKKIHEENNDIDPNFDGARSR-MVPKDWWVE  1
            SYTYNRKK+  EN    P ++G   R +VPKDWWVE
Sbjct  180  SYTYNRKKLPTENGHDSP-WNGVNQRQVVPKDWWVE  214



>emb|CDX81462.1| BnaC09g08730D [Brassica napus]
Length=603

 Score =   307 bits (787),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 145/215 (67%), Positives = 176/215 (82%), Gaps = 4/215 (2%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMK+GSKPD  +++GNN+RYV +ELASDI I++   KF LHKFPLLSKSA LQKL+++
Sbjct  1    MKFMKIGSKPDSIKTDGNNVRYVENELASDITINVDGSKFCLHKFPLLSKSACLQKLLSS  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +++ N DEV I  IPGG TAFE CAKFCYGMTVTL+AYN++A RCAAEYL M+E  EKGN
Sbjct  61   TDKNNADEVDISGIPGGPTAFETCAKFCYGMTVTLSAYNVVATRCAAEYLGMHETAEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFLNSS+ +SWKDSIIVLQTTK+  P+ E+LKLV  C++AIAS+A ++VS V+W
Sbjct  121  LIYKIDVFLNSSLFRSWKDSIIVLQTTKTFSPLSEDLKLVSLCIDAIASKACVNVSHVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRKK+ EENN      D  R+R VP DWWVE
Sbjct  181  SYTYNRKKLAEENN----GADQVRAREVPHDWWVE  211



>ref|XP_010432046.1| PREDICTED: BTB/POZ domain-containing protein NPY5 [Camelina sativa]
Length=582

 Score =   306 bits (785),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 153/228 (67%), Positives = 180/228 (79%), Gaps = 23/228 (10%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQSEG+N RYVAS+LA+D+I+ IGDVKFYLHKFPLLSKSA LQKL+T 
Sbjct  1    MKFMKLGSKPDSFQSEGDNARYVASDLATDVIVIIGDVKFYLHKFPLLSKSARLQKLITT  60

Query  465  S-----NEGNG------DEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEY  319
            +     NE +       DE+ I DIPGG  +FEICAKFCYGMTVTLNAYN++AARCAAE+
Sbjct  61   TTSSSSNEDDQIHHHHEDEIEIADIPGGPASFEICAKFCYGMTVTLNAYNVVAARCAAEF  120

Query  318  LEMNENVEKGNLIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIAS  139
            LEM E VEKGNL+YKI+VFLNSSIL+SWKDSIIVLQTT++  P  EELKL G C+++IAS
Sbjct  121  LEMYETVEKGNLVYKIEVFLNSSILQSWKDSIIVLQTTRALSPYAEELKLTGRCLDSIAS  180

Query  138  RASIDVSKVDWSYTYNRKKIHEENNDIDPNFDGA--RSRMVPKDWWVE  1
            RASID SKV+WSYTY++KK          N D    + + VP+DWWVE
Sbjct  181  RASIDTSKVEWSYTYSKKK----------NLDNGLRKPQAVPRDWWVE  218



>ref|XP_010437207.1| PREDICTED: BTB/POZ domain-containing protein NPY5-like [Camelina 
sativa]
Length=582

 Score =   306 bits (785),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 153/229 (67%), Positives = 180/229 (79%), Gaps = 24/229 (10%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQSEG+N RYVAS+LA+D+I+ IGDVKFYLHKFPLLSKSA LQKL+T 
Sbjct  1    MKFMKLGSKPDSFQSEGDNARYVASDLATDVIVIIGDVKFYLHKFPLLSKSARLQKLITT  60

Query  465  S------NEGNG------DEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAE  322
            +      NE +       DE+ I DIPGG  +FEICAKFCYGMTVTLNAYN++AARCAAE
Sbjct  61   TTTSSSSNEDDQIHHHHEDEIEIADIPGGPASFEICAKFCYGMTVTLNAYNVVAARCAAE  120

Query  321  YLEMNENVEKGNLIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIA  142
            +LEM E VEKGNL+YKI+VFLNSSIL+SWKDSIIVLQTT++  P  EELKL G C+++IA
Sbjct  121  FLEMYETVEKGNLVYKIEVFLNSSILQSWKDSIIVLQTTRALSPYSEELKLTGRCLDSIA  180

Query  141  SRASIDVSKVDWSYTYNRKKIHEENNDIDPNFDGA--RSRMVPKDWWVE  1
            SRASID SKV+WSYTY++KK          N D    + + VP+DWWVE
Sbjct  181  SRASIDTSKVEWSYTYSKKK----------NLDNGLRKPQAVPRDWWVE  219



>ref|NP_568030.1| protein NAKED PINS IN YUC MUTANTS 5 [Arabidopsis thaliana]
 sp|Q0WL52.2|NPY5_ARATH RecName: Full=BTB/POZ domain-containing protein NPY5; AltName: 
Full=Protein NAKED PINS IN YUC MUTANTS 5 [Arabidopsis thaliana]
 gb|AEE86814.1| phototropic-responsive NPH3 family protein [Arabidopsis thaliana]
Length=580

 Score =   306 bits (784),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 150/228 (66%), Positives = 178/228 (78%), Gaps = 23/228 (10%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQSEG+N+RYV+SELA+D+I+ IGDVKFYLHKFPLLSKSA LQKL+T 
Sbjct  1    MKFMKLGSKPDSFQSEGDNVRYVSSELATDVIVIIGDVKFYLHKFPLLSKSARLQKLITT  60

Query  465  SNEGNGDEVHIR-----------DIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEY  319
            S   + +E  I            +IPGG  +FEICAKFCYGMTVTLNAYN++AARCAAE+
Sbjct  61   STSSSNEENQIHHHHHEDEIEIAEIPGGPASFEICAKFCYGMTVTLNAYNVVAARCAAEF  120

Query  318  LEMNENVEKGNLIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIAS  139
            LEM E VEKGNL+YKI+VFLNSSIL+SWKDSIIVLQTT++  P  EELKL G C+++IAS
Sbjct  121  LEMYETVEKGNLVYKIEVFLNSSILQSWKDSIIVLQTTRALSPYSEELKLTGRCLDSIAS  180

Query  138  RASIDVSKVDWSYTYNRKKIHEENNDIDPNFDGA--RSRMVPKDWWVE  1
            RASID SKV+WSYTY++KK          N D    + + VP+DWWVE
Sbjct  181  RASIDTSKVEWSYTYSKKK----------NLDNGLRKPQAVPRDWWVE  218



>dbj|BAF02155.1| hypothetical protein [Arabidopsis thaliana]
Length=580

 Score =   306 bits (784),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 150/228 (66%), Positives = 178/228 (78%), Gaps = 23/228 (10%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQSEG+N+RYV+SELA+D+I+ IGDVKFYLHKFPLLSKSA LQKL+T 
Sbjct  1    MKFMKLGSKPDSFQSEGDNVRYVSSELATDVIVIIGDVKFYLHKFPLLSKSARLQKLITT  60

Query  465  SNEGNGDEVHIR-----------DIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEY  319
            S   + +E  I            +IPGG  +FEICAKFCYGMTVTLNAYN++AARCAAE+
Sbjct  61   STSSSNEENQIHHHHHEDEIEIAEIPGGPASFEICAKFCYGMTVTLNAYNVVAARCAAEF  120

Query  318  LEMNENVEKGNLIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIAS  139
            LEM E VEKGNL+YKI+VFLNSSIL+SWKDSIIVLQTT++  P  EELKL G C+++IAS
Sbjct  121  LEMYETVEKGNLVYKIEVFLNSSILQSWKDSIIVLQTTRALSPYSEELKLTGRCLDSIAS  180

Query  138  RASIDVSKVDWSYTYNRKKIHEENNDIDPNFDGA--RSRMVPKDWWVE  1
            RASID SKV+WSYTY++KK          N D    + + VP+DWWVE
Sbjct  181  RASIDTSKVEWSYTYSKKK----------NLDNGLRKPQAVPRDWWVE  218



>ref|XP_009411058.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009411059.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like [Musa 
acuminata subsp. malaccensis]
Length=617

 Score =   307 bits (787),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 180/216 (83%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQS+G ++R+VA++LA+DIII +G+VKF+LHKFPLLSKS  LQKL+T 
Sbjct  1    MKFMKLGSKPDSFQSDGKDIRFVATDLAADIIIRVGNVKFHLHKFPLLSKSFRLQKLITI  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +N    DE+ I DIPGG  AFEICAKFCYGMTVTLNA+N+  ARCAAEYL+M+E VEKGN
Sbjct  61   TNNEKTDEICISDIPGGAAAFEICAKFCYGMTVTLNAHNVTTARCAAEYLQMHETVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VFL +SIL+SWKDSIIVLQTT+S LP  E+LKL+ HC+E+IAS+AS D SKV+W
Sbjct  121  LIYKIEVFLRTSILRSWKDSIIVLQTTRSLLPWSEDLKLIDHCIESIASKASTDSSKVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSR-MVPKDWWVE  1
            SYT NRKK+  EN  ++ ++ G R    VPKDWWVE
Sbjct  181  SYTDNRKKLPSENC-LETHWKGIRKENSVPKDWWVE  215



>ref|XP_010446647.1| PREDICTED: BTB/POZ domain-containing protein NPY5-like [Camelina 
sativa]
 ref|XP_010446648.1| PREDICTED: BTB/POZ domain-containing protein NPY5-like [Camelina 
sativa]
Length=583

 Score =   306 bits (783),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 152/228 (67%), Positives = 180/228 (79%), Gaps = 23/228 (10%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQSEG+N RYVAS+LA+D+++ IGDVKFYLHKFPLLSKSA LQKL+T 
Sbjct  1    MKFMKLGSKPDSFQSEGDNARYVASDLATDVVVIIGDVKFYLHKFPLLSKSARLQKLITT  60

Query  465  S-----NEGNG------DEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEY  319
            +     NE +       DE+ I DIPGG  +FEICAKFCYGMTVTLNAYN++AARCAAE+
Sbjct  61   TTSSSSNEDDQIHHHHEDEIEIADIPGGPASFEICAKFCYGMTVTLNAYNVVAARCAAEF  120

Query  318  LEMNENVEKGNLIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIAS  139
            LEM E VEKGNL+YKI+VFLNSSIL+SWKDSIIVLQTT++  P  EELKL G C+++IAS
Sbjct  121  LEMYETVEKGNLVYKIEVFLNSSILQSWKDSIIVLQTTRALSPYSEELKLTGRCLDSIAS  180

Query  138  RASIDVSKVDWSYTYNRKKIHEENNDIDPNFDGA--RSRMVPKDWWVE  1
            RASID SKV+WSYTY++KK          N D    + + VP+DWWVE
Sbjct  181  RASIDTSKVEWSYTYSKKK----------NLDNGLRKPQAVPRDWWVE  218



>emb|CBI21142.3| unnamed protein product [Vitis vinifera]
Length=597

 Score =   306 bits (784),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 143/220 (65%), Positives = 177/220 (80%), Gaps = 10/220 (5%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++GN++RYV+SELA+D+II +G VKFYLHKFPLLSKS  LQKLV  
Sbjct  1    MKFMKLGSKPDAFQADGNSVRYVSSELATDVIIIVGGVKFYLHKFPLLSKSNRLQKLVVK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            ++E N DE+ + D PGG  AFEICAKFCYGMTVTLNAYN++AARCAAEYLEM E+V++GN
Sbjct  61   ASEENSDEIRLVDFPGGPKAFEICAKFCYGMTVTLNAYNVVAARCAAEYLEMTEDVDRGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LI+KI+VFLNSS+ +SWKDSIIVLQTTKS LP  E+LK++G C+++IAS+ S+D + + W
Sbjct  121  LIFKIEVFLNSSVFRSWKDSIIVLQTTKSLLPWSEDLKVIGRCIDSIASKTSVDPANISW  180

Query  105  SYTYNRK-----KIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRK     KI E+   +    +      VPKDWWVE
Sbjct  181  SYTYNRKLAVPDKIIEDGMKLQERIES-----VPKDWWVE  215



>ref|XP_002285522.2| PREDICTED: BTB/POZ domain-containing protein NPY1 [Vitis vinifera]
Length=620

 Score =   306 bits (784),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/220 (65%), Positives = 177/220 (80%), Gaps = 10/220 (5%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++GN++RYV+SELA+D+II +G VKFYLHKFPLLSKS  LQKLV  
Sbjct  1    MKFMKLGSKPDAFQADGNSVRYVSSELATDVIIIVGGVKFYLHKFPLLSKSNRLQKLVVK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            ++E N DE+ + D PGG  AFEICAKFCYGMTVTLNAYN++AARCAAEYLEM E+V++GN
Sbjct  61   ASEENSDEIRLVDFPGGPKAFEICAKFCYGMTVTLNAYNVVAARCAAEYLEMTEDVDRGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LI+KI+VFLNSS+ +SWKDSIIVLQTTKS LP  E+LK++G C+++IAS+ S+D + + W
Sbjct  121  LIFKIEVFLNSSVFRSWKDSIIVLQTTKSLLPWSEDLKVIGRCIDSIASKTSVDPANISW  180

Query  105  SYTYNRK-----KIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRK     KI E+   +    +      VPKDWWVE
Sbjct  181  SYTYNRKLAVPDKIIEDGMKLQERIES-----VPKDWWVE  215



>emb|CDP07841.1| unnamed protein product [Coffea canephora]
Length=618

 Score =   306 bits (784),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/215 (65%), Positives = 174/215 (81%), Gaps = 0/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ+EGN++RYV+SELA+D+I+ +G++KFYLHKFPLLSKS HLQKLV+ 
Sbjct  1    MKFMKLGSKPDAFQAEGNSIRYVSSELATDVIVTVGEIKFYLHKFPLLSKSNHLQKLVSR  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
             NE N DE+ + + PGG  AFEICAKFCYGMTVTL+ YN++AARCAAEYLEM E+V++GN
Sbjct  61   GNEENVDEIQLINFPGGPKAFEICAKFCYGMTVTLSPYNVVAARCAAEYLEMTEDVDRGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LI+KI+VFLN+S+ + WKDSIIVLQTTKS LP  E+LK+VG C+++IAS+ S+D S + W
Sbjct  121  LIFKIEVFLNTSVFRGWKDSIIVLQTTKSLLPWSEDLKIVGRCIDSIASKTSVDPSNITW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRK    E    D      +   VPKDWW+E
Sbjct  181  SYTYNRKLAATEKKFDDGLKIPGKLESVPKDWWIE  215



>ref|XP_010547549.1| PREDICTED: BTB/POZ domain-containing protein NPY3 [Tarenaya hassleriana]
Length=590

 Score =   305 bits (782),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/219 (65%), Positives = 182/219 (83%), Gaps = 14/219 (6%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEG-NNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVT  469
            MKFMKLGSKPD FQS G NN+RYVA+ELA+D+++++G+VKF+LHKFPLLSKSA LQKL++
Sbjct  1    MKFMKLGSKPDSFQSNGDNNIRYVATELATDVVVNVGEVKFHLHKFPLLSKSARLQKLIS  60

Query  468  NSNE--GNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVE  295
             ++E   N DE+HI DIPGG  AFEICAKFCYGMTVTLNAYN++AARC+AEYLEM E+++
Sbjct  61   TASEDSSNEDEIHIPDIPGGPAAFEICAKFCYGMTVTLNAYNVVAARCSAEYLEMYESLD  120

Query  294  KGNLIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSK  115
            KGNL+YKI+VFLNSS+L+SWKDSIIVLQTT+   P  EELK++G C++ IAS+A++D ++
Sbjct  121  KGNLVYKIEVFLNSSVLRSWKDSIIVLQTTRQFHPWSEELKIIGRCIQFIASKAAMDPAR  180

Query  114  VDWSYTYNRKKIH-EENNDIDPNFDGARSRMVPKDWWVE  1
            V+WSYTYN+KK   EE   I          +VP+DWWVE
Sbjct  181  VEWSYTYNQKKFPVEEEGRI----------VVPRDWWVE  209



>gb|AAK96859.1| putative protein [Arabidopsis thaliana]
 gb|AAM10059.1| putative protein [Arabidopsis thaliana]
Length=580

 Score =   305 bits (780),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/228 (65%), Positives = 178/228 (78%), Gaps = 23/228 (10%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQSEG+N+RYV+S+LA+D+I+ IGDVKFYLHKFPLLSKSA LQKL+T 
Sbjct  1    MKFMKLGSKPDSFQSEGDNVRYVSSDLATDVIVIIGDVKFYLHKFPLLSKSARLQKLITT  60

Query  465  SNEGNGDEVHIR-----------DIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEY  319
            S   + +E  I            +IPGG  +FEICAKFCYGMTVTLNAYN++AARCAAE+
Sbjct  61   STSSSNEENQIHHHHHEDEIEIAEIPGGPASFEICAKFCYGMTVTLNAYNVVAARCAAEF  120

Query  318  LEMNENVEKGNLIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIAS  139
            LEM E VEKGNL+YKI+VFLNSSIL+SWKDSIIVLQTT++  P  EELKL G C+++IAS
Sbjct  121  LEMYETVEKGNLVYKIEVFLNSSILQSWKDSIIVLQTTRALSPYSEELKLTGRCLDSIAS  180

Query  138  RASIDVSKVDWSYTYNRKKIHEENNDIDPNFDGA--RSRMVPKDWWVE  1
            RASID SKV+WSYTY++KK          N D    + + VP+DWWVE
Sbjct  181  RASIDTSKVEWSYTYSKKK----------NLDNGLRKPQAVPRDWWVE  218



>ref|XP_003558549.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Brachypodium 
distachyon]
 ref|XP_010229003.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Brachypodium 
distachyon]
Length=605

 Score =   305 bits (782),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/216 (68%), Positives = 174/216 (81%), Gaps = 3/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGS PD FQ +G+ +  V SEL SDI + IG  KFYLHKFPLLSK A  QKL+  
Sbjct  1    MKFMKLGSNPDTFQDDGSEVSIVESELVSDITVRIGSTKFYLHKFPLLSKCARFQKLIPT  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            + + N  EV I DIPGG  AFEICAKFCYG+ VTLNAYN+IA+RCAAEYLEMNENV+KGN
Sbjct  61   TGDEN-IEVPIHDIPGGPKAFEICAKFCYGIVVTLNAYNVIASRCAAEYLEMNENVDKGN  119

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VFL+SSI +SWKDSIIVL TTK+HLP  E+LKLV HC+++IAS+AS D SKV+W
Sbjct  120  LIYKIEVFLSSSIFRSWKDSIIVLGTTKAHLPWSEDLKLVSHCIDSIASKASADTSKVEW  179

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRM-VPKDWWVE  1
            SYTYNRKK+  E ND+D  ++G + +  VPKDWWVE
Sbjct  180  SYTYNRKKLPTE-NDLDLQWNGVKKQQSVPKDWWVE  214



>gb|ABF94545.1| transposon protein, putative, Mutator sub-class, expressed [Oryza 
sativa Japonica Group]
 dbj|BAG97228.1| unnamed protein product [Oryza sativa Japonica Group]
Length=453

 Score =   301 bits (770),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 173/216 (80%), Gaps = 3/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGS PD FQ +GN +  VA+EL SD+ + IG  KFYLHKFPLLSK A  QK++  
Sbjct  1    MKFMKLGSNPDTFQDDGNEVSIVATELVSDVTVRIGTTKFYLHKFPLLSKCARFQKMIPT  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            + + N  E+HI DIPGG  AFEICAKFCYGM VTLNAYN+IAARCAAEYLEM+E V+KGN
Sbjct  61   TGDEN-IEIHIHDIPGGAKAFEICAKFCYGMIVTLNAYNVIAARCAAEYLEMHETVDKGN  119

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VFL+SSI +SWKDSIIVL TTK+HLP  E+LKLV HC+++IAS+AS D SKV+W
Sbjct  120  LIYKIEVFLSSSIFRSWKDSIIVLGTTKAHLPWSEDLKLVSHCIDSIASKASTDTSKVEW  179

Query  105  SYTYNRKKIHEENNDIDPNFDGA-RSRMVPKDWWVE  1
            SY+YNRKK+  EN  +D  ++G  + + VP DWWVE
Sbjct  180  SYSYNRKKLPTENG-LDLEWNGVKKQQFVPHDWWVE  214



>ref|XP_009399110.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009399111.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like [Musa 
acuminata subsp. malaccensis]
Length=631

 Score =   305 bits (782),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 151/216 (70%), Positives = 184/216 (85%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MK+MKLGSKPD FQS+GNN+R+VA+ELA+DI++++GDVKF+LHKFPLLSKS  LQKLV  
Sbjct  1    MKYMKLGSKPDAFQSDGNNIRFVATELATDIVVNVGDVKFHLHKFPLLSKSPRLQKLVVA  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            + E   +E+ I DIPGG  AFEICAKFCYGM VTLNAYN +AARCAAEYLEM+E VEKGN
Sbjct  61   TGEEEDEEIDIPDIPGGPAAFEICAKFCYGMIVTLNAYNAVAARCAAEYLEMHEAVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VFL+SSIL++WKDSIIVL TT+S LP  E+LKLV  C ++IAS+AS+D S+VDW
Sbjct  121  LIYKIEVFLSSSILRAWKDSIIVLHTTRSLLPWAEDLKLVVRCTDSIASKASVDPSEVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRM-VPKDWWVE  1
            SYTYNRKK+  EN  +DP+++G R +  VPKDWWVE
Sbjct  181  SYTYNRKKLPSENG-LDPHWNGVRKQQSVPKDWWVE  215



>ref|XP_006280223.1| hypothetical protein CARUB_v10026140mg [Capsella rubella]
 gb|EOA13121.1| hypothetical protein CARUB_v10026140mg [Capsella rubella]
Length=585

 Score =   304 bits (778),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 142/219 (65%), Positives = 180/219 (82%), Gaps = 15/219 (7%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLV--  472
            MKFMKLGSKPD FQS+ +++RYVA+ELA+D+++++GDVKFYLHKFPLLSKSA LQKL+  
Sbjct  1    MKFMKLGSKPDSFQSDEDSIRYVATELATDVVVNVGDVKFYLHKFPLLSKSARLQKLIAT  60

Query  471  TNSNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEK  292
            T S+E + DE+ I DIPGG  AFEICAKFCYGMTVTLNAYN++A RCAAEYLEM E++E 
Sbjct  61   TTSDEQSDDEIRIPDIPGGPPAFEICAKFCYGMTVTLNAYNVVAVRCAAEYLEMYESIES  120

Query  291  GNLIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKV  112
            GNL+YKI+VFLNSS+L+SWKDSIIVLQTT+S  P  E++K+   C+E+IAS+A+ID ++V
Sbjct  121  GNLVYKIEVFLNSSVLRSWKDSIIVLQTTRSFYPWSEDVKINVRCLESIASKAAIDSARV  180

Query  111  DWSYTYNRKKIH--EENNDIDPNFDGARSRMVPKDWWVE  1
            DWSYTYNR+K+   E NN+            VP+DWW+E
Sbjct  181  DWSYTYNRRKLRPPEINNN-----------GVPRDWWIE  208



>ref|XP_006409633.1| hypothetical protein EUTSA_v10023006mg [Eutrema salsugineum]
 gb|ESQ51086.1| hypothetical protein EUTSA_v10023006mg [Eutrema salsugineum]
Length=633

 Score =   305 bits (781),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 143/215 (67%), Positives = 176/215 (82%), Gaps = 4/215 (2%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMK+GSKPD  +++GNN+RYV +ELASDI +++   +F LHKFPLLSK A LQKL+++
Sbjct  1    MKFMKIGSKPDSIKTDGNNVRYVENELASDITVNVEGSRFCLHKFPLLSKCACLQKLLSS  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +++ N DEV I  IPGG TAFE CAKFCYGMTVTL+AYN++A RCAAEYL M+E VEKGN
Sbjct  61   TDKTNTDEVDISGIPGGPTAFETCAKFCYGMTVTLSAYNVVATRCAAEYLGMHETVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFLNSS+ +SWKDSIIVLQTTK  LP+ E+LKL+  C++AIAS+A +DVS V+W
Sbjct  121  LIYKIDVFLNSSLFRSWKDSIIVLQTTKPFLPLSEDLKLISLCIDAIASKACVDVSHVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRKK+ EEN+      D  R+R VP DWWVE
Sbjct  181  SYTYNRKKLGEENS----GADQIRTREVPNDWWVE  211



>ref|XP_009421103.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009421104.1| PREDICTED: BTB/POZ domain-containing protein NPY4 [Musa acuminata 
subsp. malaccensis]
Length=603

 Score =   303 bits (777),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 179/216 (83%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQS+G N+R+V SEL  DII+ +GDV F+LHKFPLLSKS+ +QKLVT 
Sbjct  1    MKFMKLGSKPDSFQSKGQNIRFVQSELEIDIIVKVGDVIFHLHKFPLLSKSSRMQKLVTT  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +N+ N  E+HI DIPGG  AFEIC KFCYGMTV LNAYN+++ARCAAEYLEM+E VEKGN
Sbjct  61   NNDDNLGEIHIPDIPGGPAAFEICVKFCYGMTVILNAYNVVSARCAAEYLEMHETVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+V L+SSI  +WKDSII L+T KS LP  E+LKLV +C+++IAS+AS++ SKV+W
Sbjct  121  LIYKIEVLLSSSIFHAWKDSIIALRTMKSLLPWSEDLKLVSNCIDSIASKASVNPSKVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDG-ARSRMVPKDWWVE  1
            SYTYN+KK+  EN+ +DP ++G  + + VP DWWVE
Sbjct  181  SYTYNQKKVPSENS-LDPLWNGIVKEQSVPMDWWVE  215



>ref|XP_009604823.1| PREDICTED: BTB/POZ domain-containing protein NPY1 [Nicotiana 
tomentosiformis]
Length=612

 Score =   302 bits (774),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 142/220 (65%), Positives = 173/220 (79%), Gaps = 10/220 (5%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ +G  +RYV+SELA+D+ + IG+VKFYLHKFPLLSKS  LQ+LV+ 
Sbjct  1    MKFMKLGSKPDTFQDQGKGVRYVSSELATDVTVVIGEVKFYLHKFPLLSKSNRLQRLVSK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE + DE+ + D PGG  AFEICAKFCYGMTVTLN YN++AARCAAEYLEM E+V++GN
Sbjct  61   ANEEDSDEIQLVDFPGGPKAFEICAKFCYGMTVTLNPYNVVAARCAAEYLEMTEDVDRGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LI+KI+VFLNSS+ +SWKDSIIVLQTTKS LP  E+LK+VG C+++IAS+ S+D S + W
Sbjct  121  LIFKIEVFLNSSVFRSWKDSIIVLQTTKSLLPWSEDLKVVGRCIDSIASKTSMDPSTIAW  180

Query  105  SYTYNRK-----KIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRK     KI E       N +      VPKDWWVE
Sbjct  181  SYTYNRKVAVLDKITEVGIKFPVNLES-----VPKDWWVE  215



>gb|EEC74723.1| hypothetical protein OsI_10448 [Oryza sativa Indica Group]
Length=605

 Score =   302 bits (773),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 173/216 (80%), Gaps = 3/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGS PD FQ +GN +  VA+EL SD+ + IG  KFYLHKFPLLSK A  QK++  
Sbjct  1    MKFMKLGSNPDTFQDDGNEVSIVATELVSDVTVRIGTTKFYLHKFPLLSKCARFQKMIPT  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            + + N  E+HI DIPGG  AFEICAKFCYGM VTLNAYN+IAARCAAEYLEM+E V+KGN
Sbjct  61   TGDEN-IEIHIHDIPGGAKAFEICAKFCYGMIVTLNAYNVIAARCAAEYLEMHETVDKGN  119

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VFL+SSI +SWKDSIIVL TTK+HLP  E+LKLV HC+++IAS+AS D SKV+W
Sbjct  120  LIYKIEVFLSSSIFRSWKDSIIVLGTTKAHLPWSEDLKLVSHCIDSIASKASTDTSKVEW  179

Query  105  SYTYNRKKIHEENNDIDPNFDGA-RSRMVPKDWWVE  1
            SY+YNRKK+  EN  +D  ++G  + + VP DWWVE
Sbjct  180  SYSYNRKKLPTENG-LDLEWNGVKKQQFVPHDWWVE  214



>ref|NP_001049315.2| Os03g0205700 [Oryza sativa Japonica Group]
 gb|ABF94544.1| transposon protein, putative, Mutator sub-class, expressed [Oryza 
sativa Japonica Group]
 gb|EEE58543.1| hypothetical protein OsJ_09839 [Oryza sativa Japonica Group]
 dbj|BAF11229.2| Os03g0205700 [Oryza sativa Japonica Group]
Length=605

 Score =   302 bits (773),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 173/216 (80%), Gaps = 3/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGS PD FQ +GN +  VA+EL SD+ + IG  KFYLHKFPLLSK A  QK++  
Sbjct  1    MKFMKLGSNPDTFQDDGNEVSIVATELVSDVTVRIGTTKFYLHKFPLLSKCARFQKMIPT  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            + + N  E+HI DIPGG  AFEICAKFCYGM VTLNAYN+IAARCAAEYLEM+E V+KGN
Sbjct  61   TGDEN-IEIHIHDIPGGAKAFEICAKFCYGMIVTLNAYNVIAARCAAEYLEMHETVDKGN  119

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VFL+SSI +SWKDSIIVL TTK+HLP  E+LKLV HC+++IAS+AS D SKV+W
Sbjct  120  LIYKIEVFLSSSIFRSWKDSIIVLGTTKAHLPWSEDLKLVSHCIDSIASKASTDTSKVEW  179

Query  105  SYTYNRKKIHEENNDIDPNFDGA-RSRMVPKDWWVE  1
            SY+YNRKK+  EN  +D  ++G  + + VP DWWVE
Sbjct  180  SYSYNRKKLPTENG-LDLEWNGVKKQQFVPHDWWVE  214



>ref|XP_010467261.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Camelina sativa]
 ref|XP_010467262.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Camelina sativa]
 ref|XP_010467263.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X2 [Camelina sativa]
Length=637

 Score =   302 bits (774),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 143/215 (67%), Positives = 175/215 (81%), Gaps = 4/215 (2%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMK+GSKPD F+++GNN RYV +ELASDI +++   +F LHKFPLLSK A LQKL+++
Sbjct  1    MKFMKIGSKPDSFKTDGNNARYVENELASDISVNVDGSRFCLHKFPLLSKCACLQKLLSS  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +++ N DEV I  IPGG TAFE CAKFCYGMTVTL+AYN++A RCAAEYL M+E VEKGN
Sbjct  61   TDKNNSDEVDISGIPGGPTAFETCAKFCYGMTVTLSAYNVVATRCAAEYLGMHETVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFLNSS+ +SWKDSIIVLQTTK  LP+ E+LKLV  C++AIAS+A +DVS V+W
Sbjct  121  LIYKIDVFLNSSLFRSWKDSIIVLQTTKPFLPLSEDLKLVSLCIDAIASKACVDVSHVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRKK+ EE +      D  ++R VP DWWVE
Sbjct  181  SYTYNRKKLPEEIS----GADQIKAREVPHDWWVE  211



>ref|XP_003550246.1| PREDICTED: BTB/POZ domain-containing protein NPY1-like [Glycine 
max]
Length=616

 Score =   300 bits (769),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/220 (65%), Positives = 177/220 (80%), Gaps = 10/220 (5%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD  QS+G ++RY++SELA+DIII +G+VKF+LHKFPLLSKS  LQKL++ 
Sbjct  1    MKFMKLGSKPDALQSDGKSIRYISSELATDIIITVGEVKFHLHKFPLLSKSNSLQKLLSK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N DE+ + D PGG  AFEICAKFCYGMTVTLNAYN++AARCAAEYLEM E++++GN
Sbjct  61   ANEENADEIQLDDFPGGPKAFEICAKFCYGMTVTLNAYNVVAARCAAEYLEMTEDIDRGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LI+KI+VFL SSI +SWKDSIIVLQTTKS LP  E+LK+VG C+++IAS+ S+D + + W
Sbjct  121  LIFKIEVFLTSSIFRSWKDSIIVLQTTKSLLPWAEDLKIVGRCIDSIASKTSVDPANITW  180

Query  105  SYTYNRK-----KIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRK     KI E+   I P     +   VPKDWWVE
Sbjct  181  SYTYNRKLSELDKIVEDK--ITPQ---EKIEPVPKDWWVE  215



>ref|XP_008794358.1| PREDICTED: BTB/POZ domain-containing protein NPY1-like [Phoenix 
dactylifera]
Length=611

 Score =   300 bits (769),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 176/216 (81%), Gaps = 5/216 (2%)
 Frame = -2

Query  645  MKFMKLGSKP-DCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVT  469
            MKFMKLGSKP D FQS+G+++RYV SELA+D+IIH+G+V+FYLHKFPLLSKS  LQ L+ 
Sbjct  1    MKFMKLGSKPADAFQSDGSDVRYVVSELATDVIIHVGEVRFYLHKFPLLSKSNWLQGLIL  60

Query  468  NSNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKG  289
             +NE N DEV + D PGG  AFEICAKFCYGM V LNAYN++AARCAAEYLEM E+VEKG
Sbjct  61   KANEDNTDEVFVHDFPGGPKAFEICAKFCYGMVVILNAYNVVAARCAAEYLEMTEDVEKG  120

Query  288  NLIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVD  109
            NLI+KI+VFLNSS+ +SWKDSIIVLQTTKS LP  EELK+VG C+++IAS+ S+D + V 
Sbjct  121  NLIFKIEVFLNSSVFRSWKDSIIVLQTTKSLLPWSEELKVVGRCIDSIASKTSVDPANVH  180

Query  108  WSYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            WSYTY+ KK+   +  ++      R R+VPKDWW+E
Sbjct  181  WSYTYS-KKLAASDEIVESQ---QRMRIVPKDWWIE  212



>ref|XP_010467259.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like isoform 
X1 [Camelina sativa]
Length=713

 Score =   303 bits (775),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 176/216 (81%), Gaps = 4/216 (2%)
 Frame = -2

Query  648  RMKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVT  469
            +MKFMK+GSKPD F+++GNN RYV +ELASDI +++   +F LHKFPLLSK A LQKL++
Sbjct  76   KMKFMKIGSKPDSFKTDGNNARYVENELASDISVNVDGSRFCLHKFPLLSKCACLQKLLS  135

Query  468  NSNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKG  289
            ++++ N DEV I  IPGG TAFE CAKFCYGMTVTL+AYN++A RCAAEYL M+E VEKG
Sbjct  136  STDKNNSDEVDISGIPGGPTAFETCAKFCYGMTVTLSAYNVVATRCAAEYLGMHETVEKG  195

Query  288  NLIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVD  109
            NLIYKIDVFLNSS+ +SWKDSIIVLQTTK  LP+ E+LKLV  C++AIAS+A +DVS V+
Sbjct  196  NLIYKIDVFLNSSLFRSWKDSIIVLQTTKPFLPLSEDLKLVSLCIDAIASKACVDVSHVE  255

Query  108  WSYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            WSYTYNRKK+ EE +      D  ++R VP DWWVE
Sbjct  256  WSYTYNRKKLPEEIS----GADQIKAREVPHDWWVE  287



>ref|XP_006297197.1| hypothetical protein CARUB_v10013204mg [Capsella rubella]
 gb|EOA30095.1| hypothetical protein CARUB_v10013204mg [Capsella rubella]
Length=631

 Score =   300 bits (769),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/215 (66%), Positives = 176/215 (82%), Gaps = 4/215 (2%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMK+GSKPD F+++GNN+R+V +ELASDI + +   +F LHKFPLLSK A LQKL+++
Sbjct  1    MKFMKIGSKPDSFKTDGNNVRFVENELASDISVDVDGSRFCLHKFPLLSKCACLQKLLSS  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +++ N DEV I  IPGG TAFE CAKFCYGMTVTL+AYN++A RCAAEYL M+E VEKGN
Sbjct  61   TDKNNSDEVDISGIPGGPTAFETCAKFCYGMTVTLSAYNVVATRCAAEYLGMHETVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFLNSS+ +SWKDSIIVLQTTK  LP+ E+LKLV  C++AIA++A ++VS V+W
Sbjct  121  LIYKIDVFLNSSLFRSWKDSIIVLQTTKPFLPLSEDLKLVSLCIDAIANKACVNVSHVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRKK+ EEN+      D  ++R VP DWWVE
Sbjct  181  SYTYNRKKLPEENS----GADQIKAREVPHDWWVE  211



>gb|KDO67444.1| hypothetical protein CISIN_1g007148mg [Citrus sinensis]
Length=437

 Score =   295 bits (754),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/215 (65%), Positives = 173/215 (80%), Gaps = 1/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G  +RYV SELA+D+II++G+VKFYLHKFPLLSKS  L +LV  
Sbjct  1    MKFMKLGSKPDTFQTDGKCIRYVTSELATDVIINVGEVKFYLHKFPLLSKSNRLHRLVLK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            ++E N DE++I D PGG  AFEICAKFCYGMTVT +AYN++AARCAAEYLEM E+V+K N
Sbjct  61   ASEENSDEMNIVDFPGGPKAFEICAKFCYGMTVTFSAYNVVAARCAAEYLEMTEDVDKKN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LI+K++VFLNSSI +SWKDSIIVLQTTKS LP  E+LK++G  V++IAS+ S+D + V W
Sbjct  121  LIFKLEVFLNSSIFRSWKDSIIVLQTTKSLLPWSEDLKIIGRSVDSIASKTSVDPANVTW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNR K+   +  ++    G R   VPKDWWVE
Sbjct  181  SYTYNR-KLSAPDRIVEEGVFGERIESVPKDWWVE  214



>ref|XP_002324913.2| hypothetical protein POPTR_0018s02590g [Populus trichocarpa]
 gb|EEF03478.2| hypothetical protein POPTR_0018s02590g [Populus trichocarpa]
Length=594

 Score =   299 bits (766),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 145/220 (66%), Positives = 176/220 (80%), Gaps = 11/220 (5%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G +LRYVASELA+D+II++G+VKF LHKFPLLSKS  LQKLV+ 
Sbjct  1    MKFMKLGSKPDAFQADGKSLRYVASELAADVIINVGEVKFNLHKFPLLSKSNRLQKLVSK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            + E N DE+ + D PGG  AFEICAKFCYGM VTLNAYN++AARCAAEYLEM E+V++GN
Sbjct  61   AGE-NSDEIDMVDFPGGPKAFEICAKFCYGMIVTLNAYNVVAARCAAEYLEMTEDVDRGN  119

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LI+KI+VFLNSSI +SWKDSIIVLQTTKS LP  E+LK+VG C+++IAS+ S+D + + W
Sbjct  120  LIFKIEVFLNSSIFRSWKDSIIVLQTTKSLLPWSEDLKIVGRCIDSIASKTSVDPASITW  179

Query  105  SYTYNRK-----KIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRK     KI EE  +     +      VPKDWWVE
Sbjct  180  SYTYNRKLSVPDKIVEEGINFREKIES-----VPKDWWVE  214



>ref|XP_007222020.1| hypothetical protein PRUPE_ppa002969mg [Prunus persica]
 gb|EMJ23219.1| hypothetical protein PRUPE_ppa002969mg [Prunus persica]
Length=616

 Score =   299 bits (766),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 138/215 (64%), Positives = 178/215 (83%), Gaps = 2/215 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G ++RYV+SELA+D+II++G+VKFYLHKFPLLSKS  LQKLV+ 
Sbjct  1    MKFMKLGSKPDAFQADGKSIRYVSSELATDVIINVGEVKFYLHKFPLLSKSNRLQKLVSK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N +EV++ D PGG  +FEICAKFCYGMTVTLNAYN++AARCAAEYLEM E+V++ N
Sbjct  61   ANEENSEEVYMVDFPGGPKSFEICAKFCYGMTVTLNAYNVVAARCAAEYLEMTEDVDRSN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            L++KI+VFLNSSI +SWKDSIIVLQTTK  L   E+LK+VG C+++IAS+ S+D + + W
Sbjct  121  LVFKIEVFLNSSIFRSWKDSIIVLQTTKPLLSWAEDLKIVGRCIDSIASKTSVDPANISW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNR K+ E +  ++   +  R   VP+DWWVE
Sbjct  181  SYTYNR-KLAETDKIVEEGMN-YRVEKVPRDWWVE  213



>ref|XP_010464031.1| PREDICTED: BTB/POZ domain-containing protein NPY3 [Camelina sativa]
 ref|XP_010464037.1| PREDICTED: BTB/POZ domain-containing protein NPY3 [Camelina sativa]
Length=590

 Score =   298 bits (764),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 138/218 (63%), Positives = 176/218 (81%), Gaps = 12/218 (6%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLV--  472
            MKFMKLGSKPD FQS+ +++RYVA+ELA+D+++++GDVKF+LHKFPLLSKSA LQKL+  
Sbjct  1    MKFMKLGSKPDSFQSDEDSIRYVATELATDVVVNVGDVKFFLHKFPLLSKSARLQKLIAT  60

Query  471  -TNSNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVE  295
             T   + + DE+HI DIPGG  AFEICAKFCYGMTVTLNAYN++A RCAAEYLEM E++E
Sbjct  61   TTTDEQSSDDEIHIPDIPGGPPAFEICAKFCYGMTVTLNAYNVVAVRCAAEYLEMYESIE  120

Query  294  KGNLIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSK  115
             GNL+YKI+VFLNSSIL+SWKDSIIVLQTT+S  P  E++KL   C+E+IA + +ID ++
Sbjct  121  SGNLVYKIEVFLNSSILRSWKDSIIVLQTTRSFYPWSEDVKLDVRCLESIALKTAIDPAR  180

Query  114  VDWSYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            VDWSYTYNR+K+      + P  +      VP+DWW+E
Sbjct  181  VDWSYTYNRRKL------LPPEIN---KNGVPRDWWIE  209



>gb|KHN37088.1| BTB/POZ domain-containing protein NPY1 [Glycine soja]
Length=616

 Score =   299 bits (765),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 142/220 (65%), Positives = 177/220 (80%), Gaps = 10/220 (5%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD  QS+G ++RY++SELA+DIII +G+VKF+LHKFPLLSKS  LQKL++ 
Sbjct  1    MKFMKLGSKPDALQSDGKSIRYISSELATDIIITVGEVKFHLHKFPLLSKSNSLQKLLSK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N DE+ + D PGG  AFEICAKFCYGMTVTLNAYN++AARCAAEYLEM E++++GN
Sbjct  61   ANEENADEIQLDDFPGGPKAFEICAKFCYGMTVTLNAYNVVAARCAAEYLEMTEDIDRGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LI+KI+VFL SSI +SWKDSIIVLQTTKS LP  E+LK+VG C+++IAS+ S+D + + W
Sbjct  121  LIFKIEVFLTSSIFRSWKDSIIVLQTTKSLLPWAEDLKIVGRCIDSIASKTSVDPANITW  180

Query  105  SYTYNRK-----KIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRK     KI E+   I P     +   VPK+WWVE
Sbjct  181  SYTYNRKLSELDKIVEDK--ITPQ---EKIEPVPKEWWVE  215



>ref|XP_002515424.1| protein binding protein, putative [Ricinus communis]
 gb|EEF46873.1| protein binding protein, putative [Ricinus communis]
Length=617

 Score =   299 bits (765),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/220 (65%), Positives = 176/220 (80%), Gaps = 10/220 (5%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ+EG ++RYV+SELA+D+ I++G+VKFYLHKFPLLSK   L KLV+ 
Sbjct  1    MKFMKLGSKPDVFQAEGKSIRYVSSELATDVTINVGEVKFYLHKFPLLSKCNRLHKLVSK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            ++E N DE+++ D PGG  AFEICAKFCYGMTVTLNAY+++AARCAAEYLEM E+V+KGN
Sbjct  61   ASEENPDEINMVDFPGGPKAFEICAKFCYGMTVTLNAYSVVAARCAAEYLEMTEDVDKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LI+KI+VFLNSSI +SWKDSIIVLQTTKS LP  E+LK+VG C+++IAS+ S+D + + W
Sbjct  121  LIFKIEVFLNSSIFRSWKDSIIVLQTTKSLLPWSEDLKIVGRCIDSIASKTSVDPANITW  180

Query  105  SYTYNRK-----KIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRK     KI E+        +      VPKDWWVE
Sbjct  181  SYTYNRKLSVPDKIVEDGMKFHEKIES-----VPKDWWVE  215



>ref|XP_010484495.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like [Camelina 
sativa]
 ref|XP_010484496.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like [Camelina 
sativa]
Length=588

 Score =   298 bits (762),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/218 (63%), Positives = 178/218 (82%), Gaps = 11/218 (5%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLV--  472
            MKFMKLGSKPD FQS+ +++RYVA+ELA+D+++++GDVKFYLHKFPLLSKSA LQKL+  
Sbjct  1    MKFMKLGSKPDSFQSDEDSIRYVATELATDVVVNVGDVKFYLHKFPLLSKSARLQKLIAT  60

Query  471  -TNSNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVE  295
             T   + + DE+ I DIPGG  AFEICAKFCYGMTVTLNAYN++A RCAAEYLEM E++E
Sbjct  61   TTTDEQSSDDEIRIPDIPGGPPAFEICAKFCYGMTVTLNAYNVVAVRCAAEYLEMYESIE  120

Query  294  KGNLIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSK  115
             GNL+YKI+VFLNSS+L+SWKDSIIVLQTT+S  P  E++K+   C+E+IA +A+ID ++
Sbjct  121  SGNLVYKIEVFLNSSVLRSWKDSIIVLQTTRSFYPWSEDVKIDVRCLESIALKAAIDPAR  180

Query  114  VDWSYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            VDWSYTYNR+K+      + P  +  ++  VP+DWW+E
Sbjct  181  VDWSYTYNRRKL------LPPEIN--KNGGVPRDWWIE  210



>ref|XP_003588859.1| BTB/POZ domain-containing protein [Medicago truncatula]
 gb|AES59110.1| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=617

 Score =   298 bits (763),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/215 (66%), Positives = 171/215 (80%), Gaps = 0/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD  QS+G  +RY++SELA+DIII IG+VKF LHKFPLLSKS  LQKLV+ 
Sbjct  1    MKFMKLGSKPDALQSDGKFVRYISSELATDIIIAIGEVKFDLHKFPLLSKSNCLQKLVSK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N DE+++ D PGG  AFEICAKFCYGMTVTLNAYN++AARCAAEYLEM E+++KGN
Sbjct  61   ANEDNSDEIYLDDFPGGPKAFEICAKFCYGMTVTLNAYNVVAARCAAEYLEMTEDIDKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LI+KIDVFL SSI +SWKDSIIVLQT KS LP  E+LK++G C+++IAS+ S+D + + W
Sbjct  121  LIFKIDVFLTSSIFRSWKDSIIVLQTAKSLLPWSEDLKIIGRCIDSIASKTSVDPADITW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRK    +    D      +   VPKDWWVE
Sbjct  181  SYTYNRKLTQVDKIVEDKITLKEKIESVPKDWWVE  215



>ref|XP_009390548.1| PREDICTED: BTB/POZ domain-containing protein NPY1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=602

 Score =   297 bits (761),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/215 (63%), Positives = 168/215 (78%), Gaps = 4/215 (2%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQS+G N+R+V SEL +D+I+ +G+V+F+LHKFPLLSKS  LQ LV  
Sbjct  1    MKFMKLGSKPDAFQSDGGNIRFVVSELPTDVIVRVGEVRFFLHKFPLLSKSNRLQGLVLK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            + EG  DE+++ D PGG   FEIC+KFCYGMTVTLNAYN++A+RCAAEYLEM E+VEKGN
Sbjct  61   AGEGGTDEIYLHDFPGGPKTFEICSKFCYGMTVTLNAYNVVASRCAAEYLEMTEDVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VFLNSS+L+SWKDSIIVLQTTKS LP  EELK+VG C++ I S+ S++ + V W
Sbjct  121  LIYKIEVFLNSSVLRSWKDSIIVLQTTKSMLPWSEELKVVGRCIDCITSKTSVEPAAVTW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTY+RK    +    D      R   VP DWW+E
Sbjct  181  SYTYDRKLTASD----DITETQKRMHQVPNDWWIE  211



>emb|CDY44035.1| BnaA08g15710D [Brassica napus]
Length=575

 Score =   296 bits (759),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 145/224 (65%), Positives = 175/224 (78%), Gaps = 19/224 (8%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQSEG N+RYV S+LA+D+I+ IGD KFYLHKFPLLSKSA LQKL+  
Sbjct  1    MKFMKLGSKPDSFQSEGENVRYVPSDLATDVIVIIGDFKFYLHKFPLLSKSARLQKLIAT  60

Query  465  SNEGNGD-------EVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMN  307
            ++  N D       E+ I + PGG  +FEICAKFCYGMTVTLNAYN++AARCAAE+LEM+
Sbjct  61   TSSSNEDNEIHEEDEIEIAEFPGGPASFEICAKFCYGMTVTLNAYNVVAARCAAEFLEMH  120

Query  306  ENVEKGNLIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASI  127
            E VEKGNL+YKI+VFLNSSIL++WKDSIIVLQTT++  P  EELKL G C+++IAS+ASI
Sbjct  121  ETVEKGNLVYKIEVFLNSSILQTWKDSIIVLQTTRALSPYAEELKLTGRCLDSIASKASI  180

Query  126  DVSKVDWSYTYNRKKIHEENNDIDPNFDGA--RSRMVPKDWWVE  1
            D SKV+WSYTY++KK          N D    +   VP+DWWVE
Sbjct  181  DTSKVEWSYTYSKKK----------NLDNGLRKPHAVPRDWWVE  214



>ref|XP_010265570.1| PREDICTED: BTB/POZ domain-containing protein NPY1-like [Nelumbo 
nucifera]
Length=601

 Score =   297 bits (760),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 143/215 (67%), Positives = 176/215 (82%), Gaps = 2/215 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD F+++GN +RYV SELA+DI++++G+VKF+LHKFPLLSKS  LQKLV  
Sbjct  1    MKFMKLGSKPDVFKADGNCIRYVESELATDIVLNVGEVKFFLHKFPLLSKSHRLQKLVQK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N +EVHI + PGG  AFEICAKFCYGM VTLNAYN++AARCAAEYLEM E+V++GN
Sbjct  61   ANE-NSEEVHIANFPGGPKAFEICAKFCYGMIVTLNAYNVVAARCAAEYLEMTEDVDRGN  119

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LI+KI+VFLNSSI +SWKDSIIVLQTTKS LP  EELK+VG C+++IAS+ S+D + V+W
Sbjct  120  LIFKIEVFLNSSIFRSWKDSIIVLQTTKSLLPWAEELKVVGRCIDSIASKTSVDPTNVNW  179

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRK    E  + D      + + VP DWWVE
Sbjct  180  SYTYNRKLAVGEIIEHDTKVQ-QKMQSVPIDWWVE  213



>ref|XP_010488917.1| PREDICTED: BTB/POZ domain-containing protein NPY2 isoform X1 
[Camelina sativa]
 ref|XP_010488918.1| PREDICTED: BTB/POZ domain-containing protein NPY2 isoform X2 
[Camelina sativa]
 ref|XP_010488919.1| PREDICTED: BTB/POZ domain-containing protein NPY2 isoform X1 
[Camelina sativa]
 ref|XP_010488920.1| PREDICTED: BTB/POZ domain-containing protein NPY2 isoform X1 
[Camelina sativa]
 ref|XP_010488921.1| PREDICTED: BTB/POZ domain-containing protein NPY2 isoform X1 
[Camelina sativa]
 ref|XP_010488922.1| PREDICTED: BTB/POZ domain-containing protein NPY2 isoform X1 
[Camelina sativa]
 ref|XP_010488923.1| PREDICTED: BTB/POZ domain-containing protein NPY2 isoform X1 
[Camelina sativa]
Length=634

 Score =   298 bits (762),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/215 (66%), Positives = 173/215 (80%), Gaps = 4/215 (2%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMK+GSKPD F+++GNN RYV +ELASDI +++   +F LHKFPLLSK A LQKL+++
Sbjct  1    MKFMKIGSKPDSFKTDGNNARYVENELASDISVNVDGSRFCLHKFPLLSKCACLQKLLSS  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +++ N DEV I  IPGG TAFE CAKFCYGMTVTL+AYN++A RCAAEYL M+E VEKGN
Sbjct  61   TDKNNSDEVDISGIPGGPTAFETCAKFCYGMTVTLSAYNVVATRCAAEYLGMHETVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFLNSS+ +SWKDSIIVL TTK  LP+ E+LKLV  C++AIAS+A +D S V+W
Sbjct  121  LIYKIDVFLNSSLFRSWKDSIIVLHTTKPFLPLSEDLKLVSLCIDAIASKACVDASHVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRKK+ EE +      D  ++R VP DWWVE
Sbjct  181  SYTYNRKKLPEEIS----GADQIKAREVPHDWWVE  211



>ref|XP_009109382.1| PREDICTED: BTB/POZ domain-containing protein NPY5 [Brassica rapa]
 ref|XP_009109383.1| PREDICTED: BTB/POZ domain-containing protein NPY5 [Brassica rapa]
Length=575

 Score =   296 bits (758),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 145/224 (65%), Positives = 175/224 (78%), Gaps = 19/224 (8%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQSEG N+RYV S+LA+D+I+ IGD KFYLHKFPLLSKSA LQKL+  
Sbjct  1    MKFMKLGSKPDSFQSEGENVRYVPSDLATDVIVIIGDFKFYLHKFPLLSKSARLQKLIAT  60

Query  465  SNEGNGD-------EVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMN  307
            ++  N D       E+ I + PGG  +FEICAKFCYGMTVTLNAYN++AARCAAE+LEM+
Sbjct  61   TSSSNEDNEIHEEDEIEIAEFPGGPASFEICAKFCYGMTVTLNAYNVVAARCAAEFLEMH  120

Query  306  ENVEKGNLIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASI  127
            E VEKGNL+YKI+VFLNSSIL++WKDSIIVLQTT++  P  EELKL G C+++IAS+ASI
Sbjct  121  ETVEKGNLVYKIEVFLNSSILQTWKDSIIVLQTTRALSPYAEELKLTGRCLDSIASKASI  180

Query  126  DVSKVDWSYTYNRKKIHEENNDIDPNFDGA--RSRMVPKDWWVE  1
            D SKV+WSYTY++KK          N D    +   VP+DWWVE
Sbjct  181  DTSKVEWSYTYSKKK----------NLDNGLRKPHAVPRDWWVE  214



>ref|XP_010444645.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like [Camelina 
sativa]
 ref|XP_010444646.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like [Camelina 
sativa]
Length=583

 Score =   296 bits (758),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 138/218 (63%), Positives = 175/218 (80%), Gaps = 12/218 (6%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLV--  472
            MKFMKLGSKPD FQS+ +++RYVA+ELA+D+++++GDVKFYLHKFPLLSKSA LQKL+  
Sbjct  1    MKFMKLGSKPDSFQSDEDSVRYVATELATDVVVNVGDVKFYLHKFPLLSKSARLQKLIAT  60

Query  471  -TNSNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVE  295
             T   + + DE+ I DIPGG  AFEICAKFCYGMTVTLNAYN++A RCAAEYLEM E++E
Sbjct  61   TTTDEQSSDDEIRIPDIPGGPPAFEICAKFCYGMTVTLNAYNVVAVRCAAEYLEMYESIE  120

Query  294  KGNLIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSK  115
             GNL+YKI+VFLNSS+L+SWKDSIIVLQTT+S  P  E++KL   C+E+IA +A+ID ++
Sbjct  121  SGNLVYKIEVFLNSSVLRSWKDSIIVLQTTRSFYPWSEDVKLDVRCLESIALKAAIDPAR  180

Query  114  VDWSYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            VDWSYTYNR+K+      + P  +      VP DWW+E
Sbjct  181  VDWSYTYNRRKL------LPPEIN---KNGVPVDWWIE  209



>ref|XP_006600919.1| PREDICTED: BTB/POZ domain-containing protein NPY2 isoform X2 
[Glycine max]
Length=614

 Score =   297 bits (760),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 167/193 (87%), Gaps = 2/193 (1%)
 Frame = -2

Query  582  YVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTNSNEGNGDEVHIRDIPGGHTAF  403
            YVA+ELA+DI+I++G+VKF+LHKFPLLSKSA  QKL+TNSNE N DEVHI DIPGG  AF
Sbjct  7    YVAAELATDIVINVGNVKFHLHKFPLLSKSARFQKLITNSNEENNDEVHIHDIPGGSAAF  66

Query  402  EICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGNLIYKIDVFLNSSILKSWKDSI  223
            EIC KFCYGMTVTLNAYN++AARCAAEYLEM E VEKGNLIYKI+VFLNSSI +SWKDSI
Sbjct  67   EICTKFCYGMTVTLNAYNVVAARCAAEYLEMYETVEKGNLIYKIEVFLNSSIFRSWKDSI  126

Query  222  IVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDWSYTYNRKKIHEENNDIDPNFD  43
            IVLQTTKS L   EELK+V H +++IA++AS+D SKV+WSYTYNRKK+  EN++ DP  +
Sbjct  127  IVLQTTKSLLKWSEELKVVSHGIDSIATKASLDTSKVEWSYTYNRKKLPSENSN-DPQSN  185

Query  42   GAR-SRMVPKDWW  7
             AR  ++VPKDWW
Sbjct  186  NARKQQLVPKDWW  198



>ref|XP_007161085.1| hypothetical protein PHAVU_001G041700g [Phaseolus vulgaris]
 gb|ESW33079.1| hypothetical protein PHAVU_001G041700g [Phaseolus vulgaris]
Length=617

 Score =   297 bits (760),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 138/215 (64%), Positives = 170/215 (79%), Gaps = 0/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD  Q++G ++RY++SELA+DIII +G+VKF+LHKFPLLSKS  LQKL+  
Sbjct  1    MKFMKLGSKPDVLQADGKSIRYISSELATDIIITVGEVKFHLHKFPLLSKSNRLQKLLAR  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE   DEV + D PGG  AFEICAKFCYGMTVTLNAYN++AARC AEYLEM E++EKGN
Sbjct  61   ANEEYSDEVQLDDFPGGSKAFEICAKFCYGMTVTLNAYNVVAARCGAEYLEMTEDIEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            L++KI+VFL SSI +SWKDSIIVLQTTKS LP  E+LK+VG C+++IAS+ S+D + + W
Sbjct  121  LVFKIEVFLTSSIFRSWKDSIIVLQTTKSLLPWSEDLKIVGRCIDSIASKTSVDPANITW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRK    +    D      +   VPKDWWVE
Sbjct  181  SYTYNRKLSELDKIVEDKTAPQDKIEPVPKDWWVE  215



>ref|XP_007011711.1| Phototropic-responsive NPH3 family protein isoform 2 [Theobroma 
cacao]
 ref|XP_007011712.1| Phototropic-responsive NPH3 family protein isoform 2 [Theobroma 
cacao]
 ref|XP_007011713.1| Phototropic-responsive NPH3 family protein isoform 2 [Theobroma 
cacao]
 gb|EOY29330.1| Phototropic-responsive NPH3 family protein isoform 2 [Theobroma 
cacao]
 gb|EOY29331.1| Phototropic-responsive NPH3 family protein isoform 2 [Theobroma 
cacao]
 gb|EOY29332.1| Phototropic-responsive NPH3 family protein isoform 2 [Theobroma 
cacao]
Length=615

 Score =   296 bits (759),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 141/219 (64%), Positives = 176/219 (80%), Gaps = 8/219 (4%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G  +RYV S+LA+D+ I +G+VKFYLHKFPLLSKS  LQKLV  
Sbjct  1    MKFMKLGSKPDAFQADGKCIRYVTSDLATDVTITVGEVKFYLHKFPLLSKSNRLQKLVLK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            ++E N DE+++ D PGG  AFEIC+KFCYGMTVTLNAYN++AARCAAEYLEM E+V++GN
Sbjct  61   ASEENCDEINMVDFPGGPKAFEICSKFCYGMTVTLNAYNVVAARCAAEYLEMTEDVDRGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LI+KI+VFLNSSI +SWKDSIIVLQTTKS +P  E LK+VG C+++IAS+ S+D + + W
Sbjct  121  LIFKIEVFLNSSIFRSWKDSIIVLQTTKSLIPWSENLKIVGRCIDSIASKTSVDPANITW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSR----MVPKDWWVE  1
            SYTYNR K+   +  +D   DG + R     VPKDWWVE
Sbjct  181  SYTYNR-KLSVPDKIVD---DGMKFREKVESVPKDWWVE  215



>ref|XP_011036689.1| PREDICTED: BTB/POZ domain-containing protein NPY1-like [Populus 
euphratica]
Length=612

 Score =   296 bits (757),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 143/220 (65%), Positives = 174/220 (79%), Gaps = 11/220 (5%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ +G ++RYVASELA+D+ I++G+VKF LHKFPLLSKS  LQKLV+ 
Sbjct  1    MKFMKLGSKPDAFQGDGKSVRYVASELATDVTINVGEVKFNLHKFPLLSKSNRLQKLVSK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            + E N DE+ + D PGG  AFEICAKFCYGM VTLNAYN++AARCAAEYLEM E+V++GN
Sbjct  61   AGE-NSDEIDMVDFPGGPKAFEICAKFCYGMIVTLNAYNVVAARCAAEYLEMTEDVDRGN  119

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LI+KI+VFLNSSI +SWKDSIIVLQTTKS LP  E+LK+VG C+++IAS+ S+D + + W
Sbjct  120  LIFKIEVFLNSSIFRSWKDSIIVLQTTKSLLPWSEDLKIVGRCIDSIASKTSVDPASITW  179

Query  105  SYTYNRK-----KIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRK     KI EE  +     +      VPKDWWVE
Sbjct  180  SYTYNRKLSVPDKIVEEGINFREKIES-----VPKDWWVE  214



>ref|XP_006450279.1| hypothetical protein CICLE_v10007764mg [Citrus clementina]
 ref|XP_006483482.1| PREDICTED: BTB/POZ domain-containing protein NPY1-like [Citrus 
sinensis]
 gb|ESR63519.1| hypothetical protein CICLE_v10007764mg [Citrus clementina]
 gb|KDO67443.1| hypothetical protein CISIN_1g007148mg [Citrus sinensis]
Length=616

 Score =   296 bits (757),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/215 (65%), Positives = 173/215 (80%), Gaps = 1/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G  +RYV SELA+D+II++G+VKFYLHKFPLLSKS  L +LV  
Sbjct  1    MKFMKLGSKPDTFQTDGKCIRYVTSELATDVIINVGEVKFYLHKFPLLSKSNRLHRLVLK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            ++E N DE++I D PGG  AFEICAKFCYGMTVT +AYN++AARCAAEYLEM E+V+K N
Sbjct  61   ASEENSDEMNIVDFPGGPKAFEICAKFCYGMTVTFSAYNVVAARCAAEYLEMTEDVDKKN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LI+K++VFLNSSI +SWKDSIIVLQTTKS LP  E+LK++G  V++IAS+ S+D + V W
Sbjct  121  LIFKLEVFLNSSIFRSWKDSIIVLQTTKSLLPWSEDLKIIGRSVDSIASKTSVDPANVTW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNR K+   +  ++    G R   VPKDWWVE
Sbjct  181  SYTYNR-KLSAPDRIVEEGVFGERIESVPKDWWVE  214



>ref|XP_004498809.1| PREDICTED: BTB/POZ domain-containing protein NPY1-like [Cicer 
arietinum]
Length=616

 Score =   295 bits (756),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/215 (64%), Positives = 169/215 (79%), Gaps = 0/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD  QS+G  +RY++SELA+DIII +G+VKF LHKFPLL KS  LQKLV+ 
Sbjct  1    MKFMKLGSKPDSLQSDGKFVRYISSELATDIIITVGEVKFDLHKFPLLLKSNRLQKLVSK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N DE+++ D PGG  AFEICAKFCYGMTVTLNAYN++AARCA+EYLEM E+V++GN
Sbjct  61   ANEDNSDEIYLDDFPGGPKAFEICAKFCYGMTVTLNAYNVVAARCASEYLEMTEDVDRGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LI+KIDVFL SSI +SWKDSIIVLQT KS LP  E+LK++G C+++IAS+ S+D   + W
Sbjct  121  LIFKIDVFLTSSIFRSWKDSIIVLQTAKSLLPWSEDLKIIGRCIDSIASKTSVDPMNITW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRK    +    D      +   VPKDWWVE
Sbjct  181  SYTYNRKLTQADKIAEDKISLKEKIEPVPKDWWVE  215



>ref|XP_007011710.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
 gb|EOY29329.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
Length=645

 Score =   296 bits (758),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/219 (64%), Positives = 176/219 (80%), Gaps = 8/219 (4%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G  +RYV S+LA+D+ I +G+VKFYLHKFPLLSKS  LQKLV  
Sbjct  1    MKFMKLGSKPDAFQADGKCIRYVTSDLATDVTITVGEVKFYLHKFPLLSKSNRLQKLVLK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            ++E N DE+++ D PGG  AFEIC+KFCYGMTVTLNAYN++AARCAAEYLEM E+V++GN
Sbjct  61   ASEENCDEINMVDFPGGPKAFEICSKFCYGMTVTLNAYNVVAARCAAEYLEMTEDVDRGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LI+KI+VFLNSSI +SWKDSIIVLQTTKS +P  E LK+VG C+++IAS+ S+D + + W
Sbjct  121  LIFKIEVFLNSSIFRSWKDSIIVLQTTKSLIPWSENLKIVGRCIDSIASKTSVDPANITW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSR----MVPKDWWVE  1
            SYTYNR K+   +  +D   DG + R     VPKDWWVE
Sbjct  181  SYTYNR-KLSVPDKIVD---DGMKFREKVESVPKDWWVE  215



>ref|XP_009797504.1| PREDICTED: BTB/POZ domain-containing protein NPY1 [Nicotiana 
sylvestris]
Length=614

 Score =   295 bits (756),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/220 (63%), Positives = 170/220 (77%), Gaps = 10/220 (5%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ +G  +RYV+SELA+D+ I IG+VKFYLHKFPLLSKS  LQ+LV+ 
Sbjct  1    MKFMKLGSKPDTFQDQGKGVRYVSSELATDVTIIIGEVKFYLHKFPLLSKSNRLQRLVSK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE +  E+ + D PGG  AFEICAKFCYGMTVTLN YN++AARCAAEYLEM E+ ++GN
Sbjct  61   ANEEDSGEMQLVDFPGGPKAFEICAKFCYGMTVTLNPYNVVAARCAAEYLEMTEDADRGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LI+KI+VFLNSS+ +SWKDSIIVLQTTKS LP  E+LK+VG C+++IAS+ S+D S + W
Sbjct  121  LIFKIEVFLNSSVFRSWKDSIIVLQTTKSLLPWSEDLKVVGRCIDSIASKTSMDPSTITW  180

Query  105  SYTYNRK-----KIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRK     +I E       N +      VPKDWW E
Sbjct  181  SYTYNRKVAVSDRITEVGVKFPVNLES-----VPKDWWAE  215



>ref|XP_009629746.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like isoform 
X2 [Nicotiana tomentosiformis]
Length=620

 Score =   295 bits (756),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/197 (70%), Positives = 167/197 (85%), Gaps = 2/197 (1%)
 Frame = -2

Query  588  LRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTNSNEGNGDEVHIRDIPGGHT  409
            +RYVA+ELA+D++I++GDVKFY+HKFPLLSKS  LQKL  ++NE + DE++I D+PGG  
Sbjct  13   IRYVATELATDMVINVGDVKFYVHKFPLLSKSGSLQKLAAHTNEESNDEINIHDVPGGPA  72

Query  408  AFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGNLIYKIDVFLNSSILKSWKD  229
            AFEICAKFCYGMTVTLNAYN++AARCAAEYLEM E VEKGNLIYKI+VFL SSI +SWKD
Sbjct  73   AFEICAKFCYGMTVTLNAYNVVAARCAAEYLEMYETVEKGNLIYKIEVFLTSSIFRSWKD  132

Query  228  SIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDWSYTYNRKKIHEENNDIDPN  49
            SIIVLQTTKS LP  EELK+V HC++++AS+A ID SKVDWSYTYNRK +  EN   DP 
Sbjct  133  SIIVLQTTKSFLPWSEELKIVSHCLDSVASKAYIDTSKVDWSYTYNRKNLPSENGS-DPL  191

Query  48   FDGAR-SRMVPKDWWVE  1
            ++G +  + VP+DWWVE
Sbjct  192  WNGMKMQQFVPRDWWVE  208



>ref|XP_004244531.1| PREDICTED: BTB/POZ domain-containing protein NPY1 [Solanum lycopersicum]
Length=615

 Score =   295 bits (755),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 171/216 (79%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ +G  +RYV+SELA+D+ I +G+V FYLHKFPLLS S  LQKLV+ 
Sbjct  1    MKFMKLGSKPDTFQDQGKGVRYVSSELATDVTIIVGEVIFYLHKFPLLSMSNKLQKLVSK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N D + + D PGG  AFEICAKFCYGMTVTLN YN++AARCAAEYLEM E V++GN
Sbjct  61   ANEENSDVIQLVDFPGGPRAFEICAKFCYGMTVTLNPYNVVAARCAAEYLEMAEEVDRGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LI+KI+VFLNSS+ +SWKDSIIVLQTTKS  P  E+LK+VG C+++IAS+ S+D S + W
Sbjct  121  LIFKIEVFLNSSVFRSWKDSIIVLQTTKSLRPWSEDLKVVGRCIDSIASKTSMDPSSITW  180

Query  105  SYTYNRK-KIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRK  + ++  ++   F G +   VPKDWWVE
Sbjct  181  SYTYNRKVAVSDKITEVGMKFPG-KLESVPKDWWVE  215



>ref|XP_010929164.1| PREDICTED: BTB/POZ domain-containing protein NPY1-like [Elaeis 
guineensis]
Length=614

 Score =   295 bits (755),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 140/215 (65%), Positives = 174/215 (81%), Gaps = 4/215 (2%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSK D FQS+G+++RYV SELA+D+IIH+G+V+FYLHKFPLLSKS  LQ L+  
Sbjct  1    MKFMKLGSKLDAFQSDGSDVRYVESELATDVIIHVGEVRFYLHKFPLLSKSNRLQGLILK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            ++E + DEV I D PGG  AFEICAKFCYGMTV LNAYN++AARCAAEYLEM E+VEKGN
Sbjct  61   ASEDSTDEVFIHDFPGGPKAFEICAKFCYGMTVILNAYNVVAARCAAEYLEMTEDVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LI+KI+VFLNSS+ +SWKDSIIVLQTTKS LP  EELK+VG C+++IAS+ S+D + V+W
Sbjct  121  LIFKIEVFLNSSVFRSWKDSIIVLQTTKSLLPWSEELKVVGRCIDSIASKTSVDPANVNW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTY+ K +   +  ++      R   VPKDWW+E
Sbjct  181  SYTYS-KNLAASHEIVESQ---QRMHNVPKDWWIE  211



>ref|XP_010670801.1| PREDICTED: BTB/POZ domain-containing protein NPY1 [Beta vulgaris 
subsp. vulgaris]
Length=615

 Score =   295 bits (754),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 136/215 (63%), Positives = 173/215 (80%), Gaps = 5/215 (2%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQS+G+ +RYV+S+LA+D+ ++IG+VKFYLHKFPLLSKS+ LQKL+  
Sbjct  1    MKFMKLGSKPDTFQSDGSCIRYVSSDLATDVAVNIGEVKFYLHKFPLLSKSSRLQKLIVK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            ++E   DEV + D PGG  AF+ICAKFCYGMTVTLNAYN++AARCAAEYL M E+V++GN
Sbjct  61   ADEEKSDEVDLADFPGGPKAFDICAKFCYGMTVTLNAYNVVAARCAAEYLGMTEDVDRGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            L+YKI+VFLNSSI ++WKDSIIVLQT KS LP  E+LK+VG C+++IAS+ S+D +K+ W
Sbjct  121  LVYKIEVFLNSSIFRTWKDSIIVLQTAKSLLPWSEDLKIVGRCIDSIASKTSVDPTKITW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYT+NRK   +     D   +      VPKDWWVE
Sbjct  181  SYTHNRKLAMQ-----DRIIEHDTMESVPKDWWVE  210



>ref|NP_179089.1| BTB/POZ domain-containing protein NPY2 [Arabidopsis thaliana]
 sp|O80970.1|NPY2_ARATH RecName: Full=BTB/POZ domain-containing protein NPY2; AltName: 
Full=Protein NAKED PINS IN YUC MUTANTS 2 [Arabidopsis thaliana]
 gb|AAC24177.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC06336.1| BTB/POZ domain-containing protein NPY2 [Arabidopsis thaliana]
Length=634

 Score =   295 bits (755),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 139/215 (65%), Positives = 175/215 (81%), Gaps = 4/215 (2%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMK+GSK D F+++GNN+RYV +ELASDI + +   +F LHKFPLLSK A LQKL+++
Sbjct  1    MKFMKIGSKLDSFKTDGNNVRYVENELASDISVDVEGSRFCLHKFPLLSKCACLQKLLSS  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +++ N D++ I  IPGG TAFE CAKFCYGMTVTL+AYN++A RCAAEYL M+E VEKGN
Sbjct  61   TDKNNIDDIDISGIPGGPTAFETCAKFCYGMTVTLSAYNVVATRCAAEYLGMHETVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL+SS+ +SWKDSIIVLQTTK  LP+ E+LKLV  C++AIA++A +DVS V+W
Sbjct  121  LIYKIDVFLSSSLFRSWKDSIIVLQTTKPFLPLSEDLKLVSLCIDAIATKACVDVSHVEW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYN+KK+ EENN      D  ++R VP DWWVE
Sbjct  181  SYTYNKKKLAEENN----GADSIKARDVPHDWWVE  211



>emb|CDX81314.1| BnaC09g07250D [Brassica napus]
Length=526

 Score =   292 bits (747),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 140/218 (64%), Positives = 172/218 (79%), Gaps = 18/218 (8%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVT-  469
            MKFMKLGSKPD FQSE + +RYVAS+LA+D+++++GDVKFYLHKFPLLSKSA LQKL+  
Sbjct  1    MKFMKLGSKPDSFQSEEDCIRYVASDLATDVVVNVGDVKFYLHKFPLLSKSARLQKLIAA  60

Query  468  --NSNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVE  295
              N  +   DE+ I DIPGG  AFEICAKFCYGMTVTLNAYN++AARCAAEYLEM E+VE
Sbjct  61   TINEQQQPDDEISIPDIPGGPQAFEICAKFCYGMTVTLNAYNVVAARCAAEYLEMYESVE  120

Query  294  KGNLIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSK  115
             GNL+YKI+VFLNSS+L+SWKDSIIVLQTT+S  P   + K+   C+E+IAS+A++D ++
Sbjct  121  TGNLVYKIEVFLNSSVLRSWKDSIIVLQTTRSFHPWSGDAKIDARCLESIASKAAVDPAR  180

Query  114  VDWSYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            VDWSYTYNR+K+   NN             VP DWWV+
Sbjct  181  VDWSYTYNRRKL---NNG------------VPIDWWVD  203



>gb|KHG11360.1| BTB/POZ domain-containing NPY1 -like protein [Gossypium arboreum]
Length=608

 Score =   294 bits (753),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 140/219 (64%), Positives = 174/219 (79%), Gaps = 8/219 (4%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G  +RYV S+LA+D+ I++G+VKFYLHKFPLLSKS+ L+KLV  
Sbjct  1    MKFMKLGSKPDAFQADGKCIRYVTSDLATDVTINVGEVKFYLHKFPLLSKSSRLRKLVLK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            ++EG  DE+++ D PGG  AF ICAKFCYGMTVTLNAYN++AARCAAEYLEM E+V++GN
Sbjct  61   ASEGCCDEINMVDFPGGPKAFGICAKFCYGMTVTLNAYNVVAARCAAEYLEMTEDVDRGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LI+KI+VFLNSSI +SWKDSIIVLQTTKS LP  E LK+VG C+++IAS+ S+D + + W
Sbjct  121  LIFKIEVFLNSSIFRSWKDSIIVLQTTKSVLPWSENLKIVGRCIDSIASKTSVDPANITW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSR----MVPKDWWVE  1
            SYTYNRK    +        DG + R     VPKDWWVE
Sbjct  181  SYTYNRKLSVSDKT----AGDGMKFREKIISVPKDWWVE  215



>ref|NP_001063200.1| Os09g0420900 [Oryza sativa Japonica Group]
 dbj|BAD33499.1| putative RPT2 [Oryza sativa Japonica Group]
 dbj|BAD33627.1| putative RPT2 [Oryza sativa Japonica Group]
 dbj|BAF25114.1| Os09g0420900 [Oryza sativa Japonica Group]
 gb|EAZ44764.1| hypothetical protein OsJ_29396 [Oryza sativa Japonica Group]
Length=618

 Score =   294 bits (753),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 136/215 (63%), Positives = 174/215 (81%), Gaps = 4/215 (2%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQS+G ++RYV S+LA+D+I+H+ +VKFYLHKFPLLSKS+ LQ+LV  
Sbjct  1    MKFMKLGSKPDAFQSDGADVRYVISDLATDVIVHVSEVKFYLHKFPLLSKSSKLQRLVIK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            + E   DEVHI   PGG TAFEICAKFCYGM VTL+ +N++AARCAAEYLEM E+V+KGN
Sbjct  61   ATEEGTDEVHIDGFPGGVTAFEICAKFCYGMVVTLSPHNVVAARCAAEYLEMTEDVDKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LI+KIDVF+NSSIL+SWKDSIIVLQ+TK+ LP  EELK++G C++AIAS+ S+D + V W
Sbjct  121  LIFKIDVFINSSILRSWKDSIIVLQSTKALLPWSEELKVIGRCIDAIASKTSVDPANVTW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SY+++RK +    +  +      R+ + PKDWWVE
Sbjct  181  SYSHSRKGM----SCTEIVESTGRTSIAPKDWWVE  211



>ref|XP_003544563.1| PREDICTED: BTB/POZ domain-containing protein NPY1-like [Glycine 
max]
 gb|KHN35522.1| BTB/POZ domain-containing protein NPY1 [Glycine soja]
Length=615

 Score =   294 bits (752),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 175/220 (80%), Gaps = 10/220 (5%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD  QS+  ++RY++SEL +DIII +G+VKF+LHKFPLLSKS  LQKL++ 
Sbjct  1    MKFMKLGSKPDALQSDEKSIRYISSELVTDIIITVGEVKFHLHKFPLLSKSNRLQKLLSK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N DE+ + D PGG  AFEICAKFCYGMTVTLNAYN++AARCAAEYLEM E++++GN
Sbjct  61   ANEENADEIQLDDFPGGPKAFEICAKFCYGMTVTLNAYNVVAARCAAEYLEMTEDIDRGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LI+KI+VFL SSI +SWKDSIIVLQTTKS LP  E+LK+VG C+++IAS+ S+D + + W
Sbjct  121  LIFKIEVFLTSSIFRSWKDSIIVLQTTKSLLPWSEDLKIVGRCIDSIASKTSVDPANITW  180

Query  105  SYTYNRK-----KIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRK     KI E+   I P     +   VPK+WWVE
Sbjct  181  SYTYNRKLSELDKIVEDK--ITPQ---EKIEPVPKEWWVE  215



>ref|XP_004138701.1| PREDICTED: BTB/POZ domain-containing protein NPY1-like [Cucumis 
sativus]
 gb|KGN62995.1| hypothetical protein Csa_2G382680 [Cucumis sativus]
Length=612

 Score =   294 bits (752),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 170/215 (79%), Gaps = 0/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD F ++G   RYV+SEL +D+ I +G+VKF +HKFPLLSKS  LQKLV+ 
Sbjct  1    MKFMKLGSKPDAFLADGKTTRYVSSELPTDVTIFVGEVKFLVHKFPLLSKSNCLQKLVSK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N +E+H+ D PGG  AFEICAKFCYGMTVTLNAYN++AARCAAE+LEM E++E+GN
Sbjct  61   ANEENSEEIHLIDFPGGPKAFEICAKFCYGMTVTLNAYNVVAARCAAEFLEMTEDIERGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            L++KI+VFLNSSI +SWKDSIIVLQT KS LP  E+LK+VG C+++IAS+ S+D + + W
Sbjct  121  LVFKIEVFLNSSIFRSWKDSIIVLQTAKSLLPWSEDLKIVGRCIDSIASKTSVDPANITW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRK    +    D N    ++  VP DWWVE
Sbjct  181  SYTYNRKLAEVDRIVEDGNKYQKKTDCVPNDWWVE  215



>emb|CDY22422.1| BnaC03g61350D [Brassica napus]
Length=575

 Score =   292 bits (748),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 144/224 (64%), Positives = 176/224 (79%), Gaps = 19/224 (8%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQSEG+++RYV S+LA+D+I+ IGDVKFYLHKFPLLSKSA LQKL+  
Sbjct  1    MKFMKLGSKPDSFQSEGDSIRYVPSDLATDVIVIIGDVKFYLHKFPLLSKSACLQKLIAT  60

Query  465  SNEGNGD-------EVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMN  307
            ++  N D       E+ I + PGG  +FEICAKFCYGMTVTLNAYN++AARCAAE+LEM+
Sbjct  61   TSSSNEDNEIHEEDEIEIAEFPGGPASFEICAKFCYGMTVTLNAYNVVAARCAAEFLEMH  120

Query  306  ENVEKGNLIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASI  127
            E VEKGNL+YKI VFLNSSIL++WKDSIIVLQTT++     EELKL G C+++IAS+ASI
Sbjct  121  ETVEKGNLVYKIKVFLNSSILQTWKDSIIVLQTTRALSTYAEELKLTGRCLDSIASKASI  180

Query  126  DVSKVDWSYTYNRKKIHEENNDIDPNFDGA--RSRMVPKDWWVE  1
            D SKV+WSYTY++KK          N D    + + VP+DWWVE
Sbjct  181  DTSKVEWSYTYSKKK----------NLDNGLRKPQAVPRDWWVE  214



>ref|XP_006649594.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Oryza 
brachyantha]
Length=604

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 167/216 (77%), Gaps = 3/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGS PD FQ +GN +   A+EL SD+ + IG  +FYLHKFPLLSK A  QK++  
Sbjct  1    MKFMKLGSNPDTFQDDGNEVSIAATELVSDVTVRIGTTRFYLHKFPLLSKCARFQKMIPT  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            + + N  E+   DIPGG  AFEICAKFCYGM VTLNAYN+ AARCAAEYLEM+E V+KGN
Sbjct  61   TGDEN-IEIQTHDIPGGAKAFEICAKFCYGMIVTLNAYNVTAARCAAEYLEMHETVDKGN  119

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFL SSI +SWKDSIIVL TTK+HLP  E+LKLV HC+++IAS+AS D SKV+W
Sbjct  120  LIYKIDVFLGSSIFRSWKDSIIVLGTTKAHLPWSEDLKLVSHCIDSIASKASTDTSKVEW  179

Query  105  SYTYNRKKIHEENNDIDPNFDGA-RSRMVPKDWWVE  1
            SY+YNRKK+  EN  +D  ++G  + + VP DWW E
Sbjct  180  SYSYNRKKLPTENG-LDLEWNGVKKQQFVPHDWWAE  214



>ref|XP_009347295.1| PREDICTED: BTB/POZ domain-containing protein NPY1-like [Pyrus 
x bretschneideri]
Length=606

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 177/216 (82%), Gaps = 3/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G ++RYV+S+L +D++I++G+VKFYLHKFPLLSKS  LQKLV+ 
Sbjct  1    MKFMKLGSKPDAFQADGKSIRYVSSDLQTDVVINVGEVKFYLHKFPLLSKSNRLQKLVSK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +N+ + +EV + D PGG  +FEICAKFCYGMTVTLNAYN++AARCAAEYLEM E+V++ N
Sbjct  61   AND-DSEEVDMVDFPGGPKSFEICAKFCYGMTVTLNAYNVVAARCAAEYLEMTEDVDRSN  119

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFLNSSI +SWKDSIIVLQTTKS L   E+LK+VG C+++IAS+ S+D + + W
Sbjct  120  LIYKIDVFLNSSIFRSWKDSIIVLQTTKSLLSWSEDLKIVGRCIDSIASKTSVDPTNITW  179

Query  105  SYTYNRKKIHEENNDIDPNFD-GARSRMVPKDWWVE  1
            SYTYNR K+ E +  I+   +   +   VP+DWWVE
Sbjct  180  SYTYNR-KLAEPDKIIEEGMNYREKIEKVPRDWWVE  214



>gb|EAZ09128.1| hypothetical protein OsI_31397 [Oryza sativa Indica Group]
Length=618

 Score =   293 bits (750),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/215 (63%), Positives = 173/215 (80%), Gaps = 4/215 (2%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQS+G ++RYV S+LA+D+I+H+ +VKFYLHKFPLLSKS+ LQ+LV  
Sbjct  1    MKFMKLGSKPDAFQSDGADVRYVISDLATDVIVHVSEVKFYLHKFPLLSKSSKLQRLVIK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            + E   DEVHI   PGG TAFEICAKFCYGM VTL+ +N++AARCAAEYLEM E+V+KGN
Sbjct  61   ATEEGTDEVHIDGFPGGVTAFEICAKFCYGMVVTLSPHNVVAARCAAEYLEMTEDVDKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LI+KIDVF+NSSIL+SWKDSIIVLQ+TK  LP  EELK++G C++AIAS+ S+D + V W
Sbjct  121  LIFKIDVFINSSILRSWKDSIIVLQSTKVLLPWSEELKVIGRCIDAIASKTSVDPANVTW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SY+++RK +    +  +      R+ + PKDWWVE
Sbjct  181  SYSHSRKGM----SCTEIVESTGRTSIAPKDWWVE  211



>gb|KHN29631.1| BTB/POZ domain-containing protein NPY1 [Glycine soja]
Length=618

 Score =   293 bits (749),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/215 (63%), Positives = 172/215 (80%), Gaps = 0/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD  Q++GN++RY++SELA+D+ +++GDVKFYLHKFPLLSKS  LQKLV+ 
Sbjct  1    MKFMKLGSKPDALQADGNSIRYISSELATDVTVNVGDVKFYLHKFPLLSKSNQLQKLVSK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N  ++++ D PGG  AFEICAKFCYGMTVTLNAYN++AARCAAEYLEM E+V++GN
Sbjct  61   ANEENSHDIYLDDFPGGPKAFEICAKFCYGMTVTLNAYNVVAARCAAEYLEMTEDVDRGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LI KI+VFLNSSI   WKDSIIVLQT+KS LP  E+LK+VG C+++IAS+ S+D + + W
Sbjct  121  LILKIEVFLNSSIFCRWKDSIIVLQTSKSLLPWSEDLKIVGRCIDSIASKTSVDPAYITW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRK    +    D      +   VP+DWWVE
Sbjct  181  SYTYNRKLTEPDKIVEDKMTFLEKIESVPEDWWVE  215



>ref|XP_009776109.1| PREDICTED: BTB/POZ domain-containing protein NPY3-like isoform 
X2 [Nicotiana sylvestris]
Length=620

 Score =   293 bits (749),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/197 (69%), Positives = 165/197 (84%), Gaps = 2/197 (1%)
 Frame = -2

Query  588  LRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTNSNEGNGDEVHIRDIPGGHT  409
            +RYVA+ELA+D++IH+GDVKF +HKFPLLSKS  LQKL  ++NE + DE++I D+PGG  
Sbjct  13   IRYVATELATDMVIHVGDVKFNVHKFPLLSKSGRLQKLAAHTNEESNDEINIHDVPGGPA  72

Query  408  AFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGNLIYKIDVFLNSSILKSWKD  229
            AFEICAKFCYGM VTLNAYN++AARCAAEYLEM E VEKGNLIYKI+VFL SSI +SWKD
Sbjct  73   AFEICAKFCYGMAVTLNAYNVVAARCAAEYLEMYETVEKGNLIYKIEVFLTSSIFRSWKD  132

Query  228  SIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDWSYTYNRKKIHEENNDIDPN  49
            SIIVLQTTKS LP  EELK+V HC++++AS+A ID SKVDWSYTYNRK +  EN   DP 
Sbjct  133  SIIVLQTTKSFLPWSEELKIVSHCLDSVASKAYIDTSKVDWSYTYNRKNLPAENGS-DPL  191

Query  48   FDGAR-SRMVPKDWWVE  1
            ++G +  + VP+DWWVE
Sbjct  192  WNGVKMQQFVPRDWWVE  208



>ref|XP_006857240.1| hypothetical protein AMTR_s00065p00211770 [Amborella trichopoda]
 gb|ERN18707.1| hypothetical protein AMTR_s00065p00211770 [Amborella trichopoda]
Length=610

 Score =   292 bits (748),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 142/217 (65%), Positives = 172/217 (79%), Gaps = 6/217 (3%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPDCF+ +GNN RYVASELA+DI I + +VKFYLHKFPLLSKS  LQKLV+ 
Sbjct  1    MKFMKLGSKPDCFRGDGNNTRYVASELATDITIFVEEVKFYLHKFPLLSKSGLLQKLVSK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +N+ N DEV + D PGG  AFEICAKFCYGM VTLNAYN++AARCAA++LEM E +E+GN
Sbjct  61   ANKENIDEVRLFDFPGGPKAFEICAKFCYGMIVTLNAYNVVAARCAADHLEMTETIERGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            L YKI+VFL+SSI +SWKDSI+VLQTTKS LP  E+LK++G C+++IAS+ S+D SKVDW
Sbjct  121  LNYKIEVFLSSSIFRSWKDSILVLQTTKSLLPWSEDLKIIGRCIDSIASKTSVDPSKVDW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARS--RMVPKDWWVE  1
            SYT    K     N ++ N  G R   +  PKDWWVE
Sbjct  181  SYTC---KWRNSENPVE-NVAGFRQGVKSAPKDWWVE  213



>ref|XP_003522372.1| PREDICTED: BTB/POZ domain-containing protein NPY1-like isoform 
X1 [Glycine max]
Length=618

 Score =   292 bits (748),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 172/215 (80%), Gaps = 0/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD  Q++GN++RY++SELA+D+ +++GDVKFYLHKFPLLSKS  LQKLV+ 
Sbjct  1    MKFMKLGSKPDALQADGNSIRYISSELATDVTVNVGDVKFYLHKFPLLSKSNQLQKLVSK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N  ++++ D PGG  AFEICAKFCYGMTVTLNAYN++AARCAAEYLEM E+V++GN
Sbjct  61   ANEENSHDIYLDDFPGGPKAFEICAKFCYGMTVTLNAYNVVAARCAAEYLEMTEDVDRGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            L+ KI+VFLNSSI   WKDSIIVLQT+KS LP  E+LK+VG C+++IAS+ S+D + + W
Sbjct  121  LVLKIEVFLNSSIFCRWKDSIIVLQTSKSLLPWSEDLKIVGRCIDSIASKTSVDPAYITW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRK    +    D      +   VP+DWWVE
Sbjct  181  SYTYNRKLTEPDKIVEDKMTFLEKIESVPEDWWVE  215



>ref|XP_009394935.1| PREDICTED: BTB/POZ domain-containing protein NPY1-like [Musa 
acuminata subsp. malaccensis]
Length=612

 Score =   292 bits (747),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 139/216 (64%), Positives = 167/216 (77%), Gaps = 6/216 (3%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQS+G N+R+V SEL +D+ + IG+V+FYLHKFPLLSKS  LQ L+  
Sbjct  1    MKFMKLGSKPDAFQSDGGNIRFVVSELPTDVSVRIGEVRFYLHKFPLLSKSNRLQGLILR  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
              E + +E+ + D PGG  AFEICAKFCYGM VTLNAYN++AARCAAEYLEM ENVEKGN
Sbjct  61   VGEDSTNEIFLHDFPGGPKAFEICAKFCYGMIVTLNAYNVVAARCAAEYLEMTENVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VFLNSS+L+SWKDSIIVLQ TKS LP  EELK+ G C++ IAS+ S+D + ++W
Sbjct  121  LIYKIEVFLNSSVLRSWKDSIIVLQATKSLLPWSEELKVAGRCIDCIASKTSVDPTNINW  180

Query  105  SYTYNRK-KIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRK    +E  +I       R   VP DWWVE
Sbjct  181  SYTYNRKLAASDEIVEIQ-----QRMHTVPNDWWVE  211



>ref|XP_010048297.1| PREDICTED: BTB/POZ domain-containing protein NPY1 [Eucalyptus 
grandis]
 gb|KCW80549.1| hypothetical protein EUGRSUZ_C01899 [Eucalyptus grandis]
Length=611

 Score =   292 bits (747),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 140/222 (63%), Positives = 176/222 (79%), Gaps = 14/222 (6%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD F ++G ++RY+++ELA+DI I +G+VKFYLHKFPLLSKS  +QKLV  
Sbjct  1    MKFMKLGSKPDAFLADGKSIRYISAELATDIAICVGEVKFYLHKFPLLSKSYRMQKLVQK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            ++E N DE+++ D PGG  AFEICAKFCYGMTVTLNAY+++AARCAAEYLEM E+V++GN
Sbjct  61   AHEENSDEINLVDFPGGPKAFEICAKFCYGMTVTLNAYDVVAARCAAEYLEMTEDVDRGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LI+KI+VFLNSSI +SWKDSIIVLQTT+S LP   +LK+VG C+++IAS+ SID + V W
Sbjct  121  LIFKIEVFLNSSIFRSWKDSIIVLQTTRSLLPWSNDLKIVGRCIDSIASKTSIDPTSVHW  180

Query  105  SYTYNRK-----KIHEENNDIDPNFDGARSRM--VPKDWWVE  1
            SYT+NRK     +I EE           R RM  VPKDWW+E
Sbjct  181  SYTHNRKLASADRIVEEGIKF-------RERMESVPKDWWIE  215



>ref|XP_006660633.1| PREDICTED: BTB/POZ domain-containing protein NPY1-like [Oryza 
brachyantha]
Length=617

 Score =   292 bits (747),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 136/220 (62%), Positives = 172/220 (78%), Gaps = 14/220 (6%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQS+G ++RYV S+LA+D+I+H+ +VKFYLHKFPLLSKS+ LQ+ V  
Sbjct  1    MKFMKLGSKPDAFQSDGADVRYVISDLATDVIVHVSEVKFYLHKFPLLSKSSKLQRFVIK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            + E   DEVHI   PGG T FEICAKFCYGM VTL+ +N++AARCAAEYLEM E+VEKGN
Sbjct  61   ATEDGTDEVHIDGFPGGATTFEICAKFCYGMVVTLSPHNVVAARCAAEYLEMTEDVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LI+KIDVF+NSSIL+SWKDSIIVLQ+TK+ LP  EELK++G C++AIAS+ S+D + V W
Sbjct  121  LIFKIDVFINSSILRSWKDSIIVLQSTKALLPWSEELKVIGRCIDAIASKTSVDPANVTW  180

Query  105  SYTYNRK-----KIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SY++++K     +I E            R+ + PKDWWVE
Sbjct  181  SYSHSKKGMGCTEIVEST---------GRTSIAPKDWWVE  211



>ref|XP_010101025.1| BTB/POZ domain-containing protein NPY1 [Morus notabilis]
 gb|EXB86673.1| BTB/POZ domain-containing protein NPY1 [Morus notabilis]
Length=621

 Score =   292 bits (747),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 138/219 (63%), Positives = 180/219 (82%), Gaps = 8/219 (4%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G ++RYV+S+LA+D+ I++G+VKF+LHKFPLLSKS+ LQKLV  
Sbjct  1    MKFMKLGSKPDAFQADGKSVRYVSSDLATDVTINVGEVKFHLHKFPLLSKSSRLQKLVLK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            ++E N +E+H+ D PGG  AFEICAKFCYGMTVTLNAYN++AARCAAE LEM E++++GN
Sbjct  61   ASEENYEEIHMADFPGGPKAFEICAKFCYGMTVTLNAYNVVAARCAAECLEMTEDIDRGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LI+KI+VFLNSSIL+SWKDSIIVLQTTKS LP  E+LK+VG C+++IAS+ S + + + W
Sbjct  121  LIFKIEVFLNSSILRSWKDSIIVLQTTKSLLPWSEDLKIVGRCIDSIASKTSWEPANITW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSR----MVPKDWWVE  1
            SYT+NR K+ E +  ++   DG + R     VP DWWVE
Sbjct  181  SYTFNR-KLAEPDRIVE---DGMKFREKTESVPMDWWVE  215



>ref|XP_010942829.1| PREDICTED: BTB/POZ domain-containing protein NPY4-like isoform 
X2 [Elaeis guineensis]
Length=612

 Score =   291 bits (746),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 171/196 (87%), Gaps = 2/196 (1%)
 Frame = -2

Query  585  RYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTNSNEGNGDEVHIRDIPGGHTA  406
            R+VA+ELA+DIIIH+G+VKF+LHKFPLLSKSA LQKLV  +N+ + +E+HI +IPGG  A
Sbjct  12   RFVATELATDIIIHVGEVKFHLHKFPLLSKSARLQKLVAATNDESNNEIHILNIPGGPAA  71

Query  405  FEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGNLIYKIDVFLNSSILKSWKDS  226
            FEICAKFCYGMTVTLNAYN++AARCAA +LEM+E+VEKGNLIYKI+VFL++SI +SWKDS
Sbjct  72   FEICAKFCYGMTVTLNAYNVVAARCAAAFLEMHESVEKGNLIYKIEVFLDTSIFRSWKDS  131

Query  225  IIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDWSYTYNRKKIHEENNDIDPNF  46
            IIVLQTTKS LP  E+LKLV HC+++IAS+ASID S V+WSYTYNRKK+  EN  +D ++
Sbjct  132  IIVLQTTKSLLPWSEDLKLVSHCIDSIASKASIDASMVEWSYTYNRKKLPSENG-LDTHW  190

Query  45   DGARSRM-VPKDWWVE  1
            +G + +  VPKDWWV+
Sbjct  191  NGVKKQQSVPKDWWVD  206



>ref|XP_006362513.1| PREDICTED: BTB/POZ domain-containing protein NPY1-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006362514.1| PREDICTED: BTB/POZ domain-containing protein NPY1-like isoform 
X2 [Solanum tuberosum]
Length=615

 Score =   291 bits (746),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 136/216 (63%), Positives = 170/216 (79%), Gaps = 2/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ +G ++RYV+SELA+D+ I +G+V FYLHKFPLLS S  LQKLV+ 
Sbjct  1    MKFMKLGSKPDTFQDQGKSIRYVSSELATDVTIIVGEVIFYLHKFPLLSMSNRLQKLVSK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N D + + D PGG  AFE CAKFCYGMTVTLN YN++AARCAAEYLEM E V++GN
Sbjct  61   ANEENSDVIQLVDFPGGPKAFENCAKFCYGMTVTLNPYNVVAARCAAEYLEMTEEVDRGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LI+KI+VFLNSS+ +SWKDSIIVLQTTKS  P  E+LK+VG C+++IAS+ S+D   + W
Sbjct  121  LIFKIEVFLNSSVFRSWKDSIIVLQTTKSLQPWSEDLKVVGRCIDSIASKTSMDPLSITW  180

Query  105  SYTYNRK-KIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRK  + ++  ++   F G +   VPKDWWVE
Sbjct  181  SYTYNRKVAVSDKITEVGMKFPG-KLESVPKDWWVE  215



>gb|KHG03398.1| BTB/POZ domain-containing NPY1 -like protein [Gossypium arboreum]
Length=614

 Score =   291 bits (746),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 138/215 (64%), Positives = 170/215 (79%), Gaps = 0/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ +G  +R+V S+LA+DIII +GD+KFYLHKFPLLSKS H+QKLV  
Sbjct  1    MKFMKLGSKPDAFQVDGKCIRHVTSDLATDIIIKVGDLKFYLHKFPLLSKSNHMQKLVQK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            ++E N DE+++ D PGG  AFEICAKFCYGM VTLNAYN++AARCAAEYLEM E+V++GN
Sbjct  61   ASEENCDEINMVDFPGGPNAFEICAKFCYGMAVTLNAYNVVAARCAAEYLEMTEDVDRGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LI+KI+VFLNSSI  SWKDSIIVL+T KS LP  E LK+VG C+++IAS+ S+D + + W
Sbjct  121  LIFKIEVFLNSSIFHSWKDSIIVLRTAKSLLPWSENLKIVGRCIDSIASKTSVDPANITW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRK   ++    D      +   VPKDWWVE
Sbjct  181  SYTYNRKLSVQDKIVGDSMKLREKIESVPKDWWVE  215



>tpg|DAA61508.1| TPA: putative phototropic-responsive NPH3 family protein [Zea 
mays]
Length=448

 Score =   286 bits (733),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 171/215 (80%), Gaps = 3/215 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQS+G ++RYV S+LA+D+++H+G+VKFYLHKFPLLSKS  LQ+LV  
Sbjct  1    MKFMKLGSKPDAFQSDGADVRYVVSDLATDVVVHVGEVKFYLHKFPLLSKSGKLQRLVLK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            + E   DEV I D+PGG  +FEICAKFCYGM VTL+ +N++AARCA++YLEM E++EKGN
Sbjct  61   AAEDETDEVRIDDLPGGAKSFEICAKFCYGMVVTLSPHNVVAARCASQYLEMTEDMEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LI+KI+VF+NSSIL+SWKDSIIVLQ+TK+  P  EELK+VG C++AIAS+ S D + V W
Sbjct  121  LIFKIEVFINSSILRSWKDSIIVLQSTKALSPWSEELKVVGRCIDAIASKTSADPANVTW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SY+++ KK       ++P     +  + PKDWWVE
Sbjct  181  SYSHSSKKGGACAEIVEP---AGKPSIAPKDWWVE  212



>ref|XP_008803708.1| PREDICTED: BTB/POZ domain-containing protein NPY1-like [Phoenix 
dactylifera]
Length=613

 Score =   291 bits (745),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 137/215 (64%), Positives = 174/215 (81%), Gaps = 4/215 (2%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKP+ FQS+G+N RYV SELA+D+IIH+G+++FYLHKFPLLSKS  LQ+L+  
Sbjct  1    MKFMKLGSKPEAFQSDGSNDRYVVSELATDVIIHVGELRFYLHKFPLLSKSHRLQRLILK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            ++E + DEV + D PGG  AFEICAKFCYGMTV LNAYN++AARCAAEYLEM E++EKGN
Sbjct  61   ASEDSIDEVFMHDFPGGPKAFEICAKFCYGMTVILNAYNVVAARCAAEYLEMTEDIEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LI+KI+VFLNSS+ +SWKDSIIVLQTTKS LP  EEL++VG C+++IAS+AS+D + V+W
Sbjct  121  LIFKIEVFLNSSVFRSWKDSIIVLQTTKSLLPWSEELEVVGRCIDSIASKASVDPANVNW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYT + KK+      I+         +VPK WW+E
Sbjct  181  SYTCS-KKLAASGEIIESQ---QTKHVVPKHWWIE  211



>gb|EYU21991.1| hypothetical protein MIMGU_mgv1a003050mg [Erythranthe guttata]
Length=612

 Score =   291 bits (745),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 137/215 (64%), Positives = 174/215 (81%), Gaps = 6/215 (3%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++GN++RY++SELA+D+I+++GDVKF+LHKFPLLSKS  LQK+V+ 
Sbjct  1    MKFMKLGSKPDAFQTDGNSVRYISSELATDVIVNVGDVKFHLHKFPLLSKSNKLQKIVSK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            SN    +E+ + D PGG  AFEICAKFCYG+TVTLN YN++AARCAAEYLEM E +E+GN
Sbjct  61   SNGETPEELSLADFPGGPKAFEICAKFCYGITVTLNPYNVVAARCAAEYLEMTEEIERGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            L+ KI++FLNSSIL++WKDSIIVLQT KS LP  E LK+VG C+++IAS+ S+D + + W
Sbjct  121  LVLKIEIFLNSSILRNWKDSIIVLQTAKSLLPWSENLKIVGRCIDSIASKTSVDPTLITW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRK    + N I PN  G +    PKDWWVE
Sbjct  181  SYTYNRKLASLDKN-ILPN--GVK---CPKDWWVE  209



>ref|XP_011081969.1| PREDICTED: BTB/POZ domain-containing protein NPY1 [Sesamum indicum]
Length=617

 Score =   291 bits (745),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 137/215 (64%), Positives = 171/215 (80%), Gaps = 0/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G+ +RY++SELA+D+II +GDVKF+LHKFPLLSKS  LQKLV+ 
Sbjct  1    MKFMKLGSKPDAFQTDGSCVRYISSELATDVIISVGDVKFHLHKFPLLSKSNKLQKLVSK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            + E + DE+ + D PGG  AFEICAKFCYG+TVTLN YN++AARCAAEYLEM E++++GN
Sbjct  61   AGEESLDEILLVDFPGGPKAFEICAKFCYGITVTLNPYNVVAARCAAEYLEMTEDIDRGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LI KI++FLNSSIL++WKDSIIVLQTTKS LP  E LK+VG CV++IAS+ S+D S + W
Sbjct  121  LILKIEIFLNSSILRNWKDSIIVLQTTKSLLPWSENLKIVGRCVDSIASKTSVDPSLITW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRK                ++  VPKDWWVE
Sbjct  181  SYTYNRKLATSGQIIQSGRKFPEKNESVPKDWWVE  215



>ref|NP_201545.1| MAB4/ENP/NPY1-LIKE 2 [Arabidopsis thaliana]
 sp|Q9FN09.1|NPY3_ARATH RecName: Full=BTB/POZ domain-containing protein NPY3; AltName: 
Full=Protein NAKED PINS IN YUC MUTANTS 3 [Arabidopsis thaliana]
 dbj|BAB09029.1| photoreceptor-interacting protein-like [Arabidopsis thaliana]
 gb|AED98344.1| MAB4/ENP/NPY1-LIKE 2 [Arabidopsis thaliana]
 dbj|BAP16477.1| photoreceptor-interacting protein-like [Cloning vector pTACAtg1]
Length=579

 Score =   290 bits (742),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 137/220 (62%), Positives = 174/220 (79%), Gaps = 16/220 (7%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLV--  472
            MKFMKLGSKPD FQS+ + +RYVA+ELA+D+++ +GDVKF+LHKFPLLSKSA LQKL+  
Sbjct  1    MKFMKLGSKPDSFQSDEDCVRYVATELATDVVVIVGDVKFHLHKFPLLSKSARLQKLIAT  60

Query  471  -TNSNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVE  295
             T   + + DE+ I DIPGG  AFEICAKFCYGM VTLNAYN++A RCAAEYLEM E++E
Sbjct  61   TTTDEQSDDDEIRIPDIPGGPPAFEICAKFCYGMAVTLNAYNVVAVRCAAEYLEMYESIE  120

Query  294  KGNLIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSK  115
             GNL+YK++VFLNSS+L+SWKDSIIVLQTT+S  P  E++KL   C+E+IA +A++D ++
Sbjct  121  NGNLVYKMEVFLNSSVLRSWKDSIIVLQTTRSFYPWSEDVKLDVRCLESIALKAAMDPAR  180

Query  114  VDWSYTYNRKKI--HEENNDIDPNFDGARSRMVPKDWWVE  1
            VDWSYTYNR+K+   E NN+            VP+DWWVE
Sbjct  181  VDWSYTYNRRKLLPPEMNNN-----------SVPRDWWVE  209



>gb|AAK96885.1| photoreceptor-interacting protein-like [Arabidopsis thaliana]
 gb|AAM91121.1| photoreceptor-interacting protein-like [Arabidopsis thaliana]
Length=579

 Score =   290 bits (741),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 137/220 (62%), Positives = 174/220 (79%), Gaps = 16/220 (7%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLV--  472
            MKFMKLGSKPD FQS+ + +RYVA+ELA+D+++ +GDVKF+LHKFPLLSKSA LQKL+  
Sbjct  1    MKFMKLGSKPDSFQSDEDCVRYVATELATDVVVIVGDVKFHLHKFPLLSKSARLQKLIAT  60

Query  471  -TNSNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVE  295
             T   + + DE+ I DIPGG  AFEICAKFCYGM VTLNAYN++A RCAAEYLEM E++E
Sbjct  61   TTTDEQSDDDEIRIPDIPGGPPAFEICAKFCYGMAVTLNAYNVVAVRCAAEYLEMYESIE  120

Query  294  KGNLIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSK  115
             GNL+YK++VFLNSS+L+SWKDSIIVLQTT+S  P  E++KL   C+E+IA +A++D ++
Sbjct  121  NGNLVYKMEVFLNSSVLRSWKDSIIVLQTTRSFYPWSEDVKLDVRCLESIALKAAMDPAR  180

Query  114  VDWSYTYNRKKI--HEENNDIDPNFDGARSRMVPKDWWVE  1
            VDWSYTYNR+K+   E NN+            VP+DWWVE
Sbjct  181  VDWSYTYNRRKLLPPEMNNN-----------SVPRDWWVE  209



>ref|XP_002462390.1| hypothetical protein SORBIDRAFT_02g024890 [Sorghum bicolor]
 gb|EER98911.1| hypothetical protein SORBIDRAFT_02g024890 [Sorghum bicolor]
Length=619

 Score =   290 bits (743),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/215 (62%), Positives = 172/215 (80%), Gaps = 3/215 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQS+G ++RYV S+LA+D+++H+G VKFYLHKFPLLSKS+ LQ+LV  
Sbjct  1    MKFMKLGSKPDAFQSDGADVRYVVSDLATDVVVHVGQVKFYLHKFPLLSKSSKLQRLVLK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            + E   DEV I D+PGG  +FEICAKFCYGM VTL+ +N++AARCAAEYLEM E++EKGN
Sbjct  61   AAEEVTDEVRIDDLPGGAKSFEICAKFCYGMVVTLSPHNVVAARCAAEYLEMTEDMEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LI+KI+VF+NSSIL+SWKDSIIVLQ+TK+ LP  EELK+VG C++AIAS+ S+D + V W
Sbjct  121  LIFKIEVFINSSILRSWKDSIIVLQSTKALLPWSEELKVVGRCIDAIASKTSVDPANVTW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SY++N KK       ++      +  + PKDWWVE
Sbjct  181  SYSHNSKKGGTCAEIVE---SAGKPSIAPKDWWVE  212



>ref|XP_003526168.1| PREDICTED: BTB/POZ domain-containing protein NPY1-like [Glycine 
max]
 gb|KHN07018.1| BTB/POZ domain-containing protein NPY1 [Glycine soja]
Length=611

 Score =   290 bits (742),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/215 (62%), Positives = 172/215 (80%), Gaps = 0/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKP+  Q++GN++RYV+SELA+D+ +++GD+KFYLHKFPLLSKS  LQKLV+ 
Sbjct  1    MKFMKLGSKPNALQADGNSIRYVSSELATDVAVNVGDIKFYLHKFPLLSKSNRLQKLVSK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N D++++ D PGG   FEICAKFCYGMTVTLNAYN++AARCAAE+LEM E+V++GN
Sbjct  61   ANEENSDDIYLDDFPGGPKTFEICAKFCYGMTVTLNAYNVVAARCAAEFLEMTEDVDRGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            L+ KI+VFLNSSI + WKDSIIVLQT+KS LP  E+LK+VG C+++IAS+ S+D + + W
Sbjct  121  LVSKIEVFLNSSIFRRWKDSIIVLQTSKSLLPWSEDLKIVGRCIDSIASKTSVDPAYITW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYT NRK    +    D      +   VPKDWWVE
Sbjct  181  SYTCNRKLTEPDKIVEDKMTFLEKIESVPKDWWVE  215



>ref|XP_007136940.1| hypothetical protein PHAVU_009G086900g [Phaseolus vulgaris]
 gb|ESW08934.1| hypothetical protein PHAVU_009G086900g [Phaseolus vulgaris]
Length=616

 Score =   290 bits (741),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/215 (62%), Positives = 171/215 (80%), Gaps = 0/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD  Q++GN +RYV+SELA+D+ +++GDV F+LHKFPLLSKS  LQKLV+ 
Sbjct  1    MKFMKLGSKPDALQADGNCIRYVSSELATDVTVNVGDVTFHLHKFPLLSKSNRLQKLVSK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N D++++ D PGG  AFEICAKFCYG+TVTLNAYN++AARCAAEYLEM E+V++GN
Sbjct  61   ANEENSDDIYLDDFPGGPKAFEICAKFCYGITVTLNAYNVVAARCAAEYLEMTEDVDRGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            L+ KI+VFLNSSI + WKDSIIVLQT+KS LP  E+LK++G C ++IAS+ S+D + + W
Sbjct  121  LVLKIEVFLNSSIFRCWKDSIIVLQTSKSLLPWSEDLKIIGRCTDSIASKTSVDPAYITW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRK    +    D      +   VPKDWWVE
Sbjct  181  SYTYNRKLSEPDKIVEDKMTFLEKIESVPKDWWVE  215



>emb|CDY18660.1| BnaA09g07350D [Brassica napus]
Length=528

 Score =   287 bits (734),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 139/221 (63%), Positives = 174/221 (79%), Gaps = 19/221 (9%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQSE + +RYVAS+LA+D+++++GDVKFYLHKFPLLSKSA LQKL+  
Sbjct  1    MKFMKLGSKPDSFQSEEDCIRYVASDLATDVVVNVGDVKFYLHKFPLLSKSARLQKLIAA  60

Query  465  S-NEGN-----GDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNE  304
            + NE        DE+ I DIPGG  AFEICAKFCYGMTVTLNAY+++AARCAAEYLEM E
Sbjct  61   TINEQQQQQQPDDEISIPDIPGGPPAFEICAKFCYGMTVTLNAYSVVAARCAAEYLEMYE  120

Query  303  NVEKGNLIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASID  124
            +VE GNL+YKI+VFLNSS+L+SWKDSIIVLQTT++  P   + K+   C+E+IAS+A++D
Sbjct  121  SVETGNLVYKIEVFLNSSVLRSWKDSIIVLQTTRAFHPWSRDAKIDARCLESIASKAAVD  180

Query  123  VSKVDWSYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
             ++VDWSYT NR+K+    N I          +VP+DWWVE
Sbjct  181  PARVDWSYTCNRRKV----NSIG---------VVPRDWWVE  208



>ref|XP_009363621.1| PREDICTED: BTB/POZ domain-containing protein NPY1-like [Pyrus 
x bretschneideri]
Length=613

 Score =   289 bits (740),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 136/216 (63%), Positives = 174/216 (81%), Gaps = 3/216 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G ++RYV+SEL +D++I++G+VKFYLHKFPLLSKS  LQKLV+ 
Sbjct  1    MKFMKLGSKPDAFQADGKSIRYVSSELQTDVVINVGEVKFYLHKFPLLSKSNRLQKLVSK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE + +E+ + D PGG  +FEICAKFCYGMTVTLNAYN++AARCAAEYLEM E V+  N
Sbjct  61   ANE-DSEEIDMVDFPGGPKSFEICAKFCYGMTVTLNAYNVVAARCAAEYLEMTEGVDHSN  119

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VFLNSSI +SWKDSIIVLQTTK  L   E+LK+VG C+++IAS+ S+D + + W
Sbjct  120  LIYKIEVFLNSSIFRSWKDSIIVLQTTKPLLSWSEDLKIVGRCIDSIASKTSVDPANITW  179

Query  105  SYTYNRKKIHEENNDIDPNFD-GARSRMVPKDWWVE  1
            SYTYNR K+ E +  I+   +   +   VP+DWWVE
Sbjct  180  SYTYNR-KLAERDKIIEAGMNYRDKFEKVPRDWWVE  214



>emb|CBI22467.3| unnamed protein product [Vitis vinifera]
Length=526

 Score =   286 bits (733),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 168/216 (78%), Gaps = 31/216 (14%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++GN++RYVASELA+DI++++G+VKFYLHKFPLLSKS  LQKLV  
Sbjct  1    MKFMKLGSKPDSFQTDGNSVRYVASELATDIVVNVGEVKFYLHKFPLLSKSECLQKLVAA  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +N+GN DEVHI DIPGG +AFEICAKFCYGMTVTLNAYN++AARCAAEYL M+E +EKGN
Sbjct  61   TNDGNSDEVHIPDIPGGPSAFEICAKFCYGMTVTLNAYNVVAARCAAEYLGMHETIEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKID                             +LK++ HC+++IAS+ASIDVS+VDW
Sbjct  121  LIYKID-----------------------------DLKVISHCIDSIASKASIDVSRVDW  151

Query  105  SYTYNRKKIHEENNDIDPNFDGARSR-MVPKDWWVE  1
            SYTYNRKK+ EEN   DP ++G  +R +VPKDWWVE
Sbjct  152  SYTYNRKKLPEENG-TDPKWNGVGNRPVVPKDWWVE  186



>ref|XP_009112216.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
NPY3-like [Brassica rapa]
Length=552

 Score =   287 bits (734),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 139/221 (63%), Positives = 174/221 (79%), Gaps = 19/221 (9%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQSE + +RYVAS+LA+D+++++GDVKFYLHKFPLLSKSA LQKL+  
Sbjct  1    MKFMKLGSKPDSFQSEEDCIRYVASDLATDVVVNVGDVKFYLHKFPLLSKSARLQKLIAA  60

Query  465  S-NEGN-----GDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNE  304
            + NE        DE+ I DIPGG  AFEICAKFCYGMTVTLNAY+++AARCAAEYLEM E
Sbjct  61   TINEQQQQQQPDDEISIPDIPGGPPAFEICAKFCYGMTVTLNAYSVVAARCAAEYLEMYE  120

Query  303  NVEKGNLIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASID  124
            +VE GNL+YKI+VFLNSS+L+SWKDSIIVLQTT++  P   + K+   C+E+IAS+A++D
Sbjct  121  SVETGNLVYKIEVFLNSSVLRSWKDSIIVLQTTRAFHPWSRDAKIDARCLESIASKAAVD  180

Query  123  VSKVDWSYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
             ++VDWSYT NR+K+    N I          +VP+DWWVE
Sbjct  181  PARVDWSYTCNRRKV----NSIG---------VVPRDWWVE  208



>ref|XP_008379044.1| PREDICTED: BTB/POZ domain-containing protein NPY1 [Malus domestica]
Length=613

 Score =   288 bits (736),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/220 (63%), Positives = 172/220 (78%), Gaps = 11/220 (5%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G  +RYV+SEL +D++I++G+VKFYLHKFPLLSKS  LQKLV+ 
Sbjct  1    MKFMKLGSKPDAFQADGKFIRYVSSELQTDVVINVGEVKFYLHKFPLLSKSNRLQKLVSK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE + +E+ + D PGG  +FEICAKFCYGMTVTLNAYN++AARCAAEYLEM E V+  N
Sbjct  61   ANE-DSEEIDMVDFPGGPKSFEICAKFCYGMTVTLNAYNVVAARCAAEYLEMTEGVDHSN  119

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VFLNSSI +SWKDSIIVLQTTK  L   E+LK+ G C+++IAS+ S+D + + W
Sbjct  120  LIYKIEVFLNSSIFRSWKDSIIVLQTTKPLLSWSEDLKIAGRCIDSIASKTSVDPANITW  179

Query  105  SYTYNRK-----KIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRK     KI EE  +    F+      VP+DWWVE
Sbjct  180  SYTYNRKLAEPDKIIEEGMNYRDKFEK-----VPRDWWVE  214



>ref|XP_008652721.1| PREDICTED: BTB/POZ domain-containing protein NPY1-like [Zea mays]
 tpg|DAA61509.1| TPA: putative phototropic-responsive NPH3 family protein [Zea 
mays]
 gb|AIB05841.1| orphans transcription factor, partial [Zea mays]
Length=619

 Score =   287 bits (735),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 171/215 (80%), Gaps = 3/215 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQS+G ++RYV S+LA+D+++H+G+VKFYLHKFPLLSKS  LQ+LV  
Sbjct  1    MKFMKLGSKPDAFQSDGADVRYVVSDLATDVVVHVGEVKFYLHKFPLLSKSGKLQRLVLK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            + E   DEV I D+PGG  +FEICAKFCYGM VTL+ +N++AARCA++YLEM E++EKGN
Sbjct  61   AAEDETDEVRIDDLPGGAKSFEICAKFCYGMVVTLSPHNVVAARCASQYLEMTEDMEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LI+KI+VF+NSSIL+SWKDSIIVLQ+TK+  P  EELK+VG C++AIAS+ S D + V W
Sbjct  121  LIFKIEVFINSSILRSWKDSIIVLQSTKALSPWSEELKVVGRCIDAIASKTSADPANVTW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SY+++ KK       ++P     +  + PKDWWVE
Sbjct  181  SYSHSSKKGGACAEIVEP---AGKPSIAPKDWWVE  212



>ref|XP_008445264.1| PREDICTED: BTB/POZ domain-containing protein NPY1 [Cucumis melo]
 ref|XP_008445265.1| PREDICTED: BTB/POZ domain-containing protein NPY1 [Cucumis melo]
Length=612

 Score =   287 bits (734),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 135/220 (61%), Positives = 169/220 (77%), Gaps = 10/220 (5%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSK D F ++G   RYV+SEL +D+ I +G+VKF +HKFPLLSKS  LQKLV+ 
Sbjct  1    MKFMKLGSKSDAFLADGKTTRYVSSELPTDVTIFVGEVKFLVHKFPLLSKSNCLQKLVSK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N +E+H+ D PGG  AFEICAKFCYGMTVTLNAYN++AARCAAE+LEM E++E+GN
Sbjct  61   ANEENSEEIHLIDFPGGPKAFEICAKFCYGMTVTLNAYNVVAARCAAEFLEMTEDIERGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            L++KI+VFLNSSI +SWKDSIIVLQT KS LP  E+LK+VG C+++IAS+ S+D + + W
Sbjct  121  LVFKIEVFLNSSIFRSWKDSIIVLQTAKSLLPWSEDLKIVGRCIDSIASKTSVDPANITW  180

Query  105  SYTYNRK-----KIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRK     +I E+        D      VP DWWVE
Sbjct  181  SYTYNRKLAEVDRIVEDGIKYQKKID-----CVPNDWWVE  215



>gb|EPS65621.1| hypothetical protein M569_09155 [Genlisea aurea]
Length=591

 Score =   286 bits (732),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 168/216 (78%), Gaps = 13/216 (6%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQS+GNN+RYVA+ELASD+++ +G+ KFYLHKFPLLSKS+ LQKLV++
Sbjct  1    MKFMKLGSKPDNFQSDGNNIRYVATELASDVVVRVGEAKFYLHKFPLLSKSSRLQKLVSS  60

Query  465  SNEGNG-DEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKG  289
            ++E NG DE+ +  IPGG  AFE+CAKFCYGMTVTLNA+N++AARCAAEYL M+E VEKG
Sbjct  61   ADESNGGDEIDVDGIPGGAAAFELCAKFCYGMTVTLNAHNVVAARCAAEYLGMHEAVEKG  120

Query  288  NLIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVD  109
            NL YKIDVFL S++L+SW+DSI+ L+TT+   P  +EL L G C +A+A++AS+  S+VD
Sbjct  121  NLAYKIDVFLASTVLRSWRDSIVALRTTRGFSPHADELNLAGRCADAVAAKASVHPSRVD  180

Query  108  WSYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            W Y+Y+R +  E+ +              P DW+ E
Sbjct  181  WPYSYSRGRRREDGS------------TTPDDWFAE  204



>gb|EMT16012.1| BTB/POZ domain-containing protein [Aegilops tauschii]
Length=597

 Score =   286 bits (732),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 133/215 (62%), Positives = 172/215 (80%), Gaps = 4/215 (2%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQS G ++R V S+LA+D+I+HIG+V+FYLHKFPLLSKS+ LQKLV  
Sbjct  1    MKFMKLGSKPDAFQSGGADVRLVVSDLATDVIVHIGEVRFYLHKFPLLSKSSKLQKLVLK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            + E   D+VHI D+PGG   FEICAKFCYGM VTL+ +N++AARCAAEYL M E+++KGN
Sbjct  61   ATEKGTDDVHIDDLPGGAKGFEICAKFCYGMVVTLSPHNVVAARCAAEYLGMTEDMDKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LI+KI+VF+NSSIL+SWKDSIIVL +TK+ LP  EELK+VG C++AIAS+ S+D + V W
Sbjct  121  LIFKIEVFINSSILRSWKDSIIVLLSTKALLPWSEELKVVGRCIDAIASKTSVDPANVSW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SY+YN+K +     +I  +    ++ + PKDWWVE
Sbjct  181  SYSYNKKGV--ACTEIIES--AGKTSVAPKDWWVE  211



>ref|XP_010942083.1| PREDICTED: BTB/POZ domain-containing protein NPY1-like [Elaeis 
guineensis]
Length=610

 Score =   286 bits (733),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 172/215 (80%), Gaps = 4/215 (2%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQS+G+N R+V SELA+D+IIH+G+++F LHKFPLLSKS  LQ+L+  
Sbjct  1    MKFMKLGSKPDAFQSDGSNDRFVVSELATDVIIHVGELRFSLHKFPLLSKSNRLQRLILK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            ++E + DEV + D PGG  AFE+CAKFCYGMTV LNAYN++AARCAAEYLEM E+VEKGN
Sbjct  61   ASEDSIDEVSMHDFPGGPKAFELCAKFCYGMTVILNAYNVVAARCAAEYLEMTEDVEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LI+KI+VFL+S +  SWKDSIIVLQTTKS LP  EELK+VG C+++IAS+AS+D + V+W
Sbjct  121  LIFKIEVFLHSGVFCSWKDSIIVLQTTKSLLPWSEELKVVGRCIDSIASKASVDPANVNW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTY+ KK+      ++          VPK+WW+E
Sbjct  181  SYTYS-KKLAASGEIVESQ---QTKHAVPKNWWIE  211



>ref|XP_006393947.1| hypothetical protein EUTSA_v10003889mg [Eutrema salsugineum]
 gb|ESQ31233.1| hypothetical protein EUTSA_v10003889mg [Eutrema salsugineum]
Length=587

 Score =   285 bits (730),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 172/217 (79%), Gaps = 14/217 (6%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYV-ASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVT  469
            MKFMKLGSKPD FQS+ +  R+V AS+LA+D+++++GDVKFYLHKFPLLSKSA LQKL+ 
Sbjct  1    MKFMKLGSKPDSFQSDKDRRRFVVASDLATDVVVNVGDVKFYLHKFPLLSKSARLQKLIA  60

Query  468  NS-NEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEK  292
             + +E   DE+ I DIPGG  AFEICAKFCYGMTVTLNAYN++A RCAAEYLEM E++E 
Sbjct  61   ATIDEEADDEIRIPDIPGGPPAFEICAKFCYGMTVTLNAYNVVAVRCAAEYLEMYESIES  120

Query  291  GNLIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKV  112
            GNL+YKI+VFL SS+L++WKDSIIVL+TT+S  P  E++K+   C+E+IA +A++D ++V
Sbjct  121  GNLVYKIEVFLTSSVLRAWKDSIIVLKTTRSFYPWSEDVKIDVRCLESIALKAAMDPARV  180

Query  111  DWSYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            DWSYTYNR+K+   NN             VP+DWWVE
Sbjct  181  DWSYTYNRRKLLPPNNG------------VPRDWWVE  205



>ref|NP_001147935.1| signal transducer [Zea mays]
 ref|XP_008667928.1| PREDICTED: signal transducer isoform X1 [Zea mays]
 ref|XP_008667929.1| PREDICTED: signal transducer isoform X1 [Zea mays]
 ref|XP_008667931.1| PREDICTED: signal transducer isoform X1 [Zea mays]
 gb|ACG29173.1| signal transducer [Zea mays]
 gb|ACN28821.1| unknown [Zea mays]
 tpg|DAA40090.1| TPA: putative phototropic-responsive NPH3 family protein [Zea 
mays]
 gb|AIB04947.1| orphans transcription factor, partial [Zea mays]
Length=625

 Score =   286 bits (732),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 132/215 (61%), Positives = 170/215 (79%), Gaps = 2/215 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQS+G ++RYVAS+LA+D+++H+ +VKFYLHKFPL+SKS+ LQ+LV  
Sbjct  1    MKFMKLGSKPDAFQSDGADVRYVASDLATDVVVHVREVKFYLHKFPLISKSSRLQRLVLK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            + E   DEV I D+PGG  +FEICAKFCYGM VTL+ +N++AARCAAEYLEM E +EKGN
Sbjct  61   ATEETTDEVRIDDLPGGAKSFEICAKFCYGMVVTLSPHNVVAARCAAEYLEMTEEMEKGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LI+KI+VF+NSSIL+SWKDSIIVLQ TK+  P  EELK+VG C++AIAS+ S+D + V W
Sbjct  121  LIFKIEVFMNSSILRSWKDSIIVLQRTKALSPWSEELKVVGRCIDAIASKTSVDPANVTW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SY++N  K      +I  +    +  + PKDWWVE
Sbjct  181  SYSHNNSKKGGACAEIVES--AGKPSIAPKDWWVE  213



>ref|XP_002437972.1| hypothetical protein SORBIDRAFT_10g005710 [Sorghum bicolor]
 gb|EER89339.1| hypothetical protein SORBIDRAFT_10g005710 [Sorghum bicolor]
Length=635

 Score =   286 bits (733),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 136/217 (63%), Positives = 168/217 (77%), Gaps = 8/217 (4%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G++ RYV S+L SDI+IH+ D +FYLHKFPLL KS+ LQ+L+  
Sbjct  1    MKFMKLGSKPDAFQTDGSDARYVLSDLPSDIVIHVEDARFYLHKFPLLCKSSLLQRLIIE  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +++   DEV I+DIPGG   FEICAKFCYGM VTLNAYN++AARCAAEYL M E+VEK N
Sbjct  61   ASQNGTDEVVIQDIPGGVKTFEICAKFCYGMVVTLNAYNVVAARCAAEYLGMTEDVEKSN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LI+KI+VFLNS I +SWKDSII LQTT + LP  EELKLVG C+++IA++A+++ S V W
Sbjct  121  LIFKIEVFLNSGIFRSWKDSIIALQTTDALLPWSEELKLVGRCIDSIATKATVNPSNVMW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGAR--SRMVPKDWWVE  1
            SYTYNRK    +          AR  S+ VPKDWWVE
Sbjct  181  SYTYNRKSASSD------EIVEARKSSQAVPKDWWVE  211



>ref|XP_010517747.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Camelina 
sativa]
 ref|XP_010517752.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Camelina 
sativa]
 ref|XP_010517760.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Camelina 
sativa]
 ref|XP_010517769.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Camelina 
sativa]
 ref|XP_010517777.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Camelina 
sativa]
 ref|XP_010517783.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Camelina 
sativa]
 ref|XP_010517790.1| PREDICTED: BTB/POZ domain-containing protein NPY2-like [Camelina 
sativa]
Length=626

 Score =   285 bits (730),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 139/215 (65%), Positives = 169/215 (79%), Gaps = 9/215 (4%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMK+ SKPD F+++GNN RYV +ELASDI +++   +F LHKFPLLSK A LQKL+++
Sbjct  1    MKFMKISSKPDSFKTDGNNARYVENELASDISVNVDGSRFCLHKFPLLSKCACLQKLLSS  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +     DEV I  IPGG TAFE CAKFCYGMTVTL+AYN++A RCAAEYL M+E VEKGN
Sbjct  61   T-----DEVDISGIPGGPTAFETCAKFCYGMTVTLSAYNVVATRCAAEYLGMHEVVEKGN  115

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKIDVFLNSS+ +SWKDSI VLQTTK  LP+ E+LKLV  C++AIAS+  +DVS V+W
Sbjct  116  LIYKIDVFLNSSLFRSWKDSITVLQTTKPFLPLSEDLKLVSLCIDAIASKVCVDVSHVEW  175

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRKK+ EE +      D  ++R VP DWWVE
Sbjct  176  SYTYNRKKLPEEIS----GADQIKAREVPHDWWVE  206



>gb|KHG00066.1| BTB/POZ domain-containing protein NPY1 [Gossypium arboreum]
Length=966

 Score =   292 bits (748),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 139/215 (65%), Positives = 171/215 (80%), Gaps = 0/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G  +RYV S+LA+D+ I +G+VKF+LHKFPL+SKS  LQKLV  
Sbjct  1    MKFMKLGSKPDTFQADGKCIRYVISDLATDVTIIVGEVKFHLHKFPLMSKSNRLQKLVLK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            ++E N DE+ + D PGG  AFEICAKFCYGMTVTLNAYN++AARCAAEYLEM E+V++GN
Sbjct  61   ASEENSDEIDMVDFPGGPKAFEICAKFCYGMTVTLNAYNVVAARCAAEYLEMTEDVDRGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LI+KI+VF+NSSIL+SWKDSIIVLQTTKS LP  E LK+VG C+++IAS+ S+D + V W
Sbjct  121  LIFKIEVFINSSILRSWKDSIIVLQTTKSLLPWSENLKIVGRCIDSIASKTSVDPANVTW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRK +  E           +   VPKDWWVE
Sbjct  181  SYTYNRKLLAPEIIVKGGMKYQEKIESVPKDWWVE  215



>ref|XP_008365065.1| PREDICTED: BTB/POZ domain-containing protein NPY1-like [Malus 
domestica]
Length=452

 Score =   280 bits (717),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 161/187 (86%), Gaps = 1/187 (1%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G ++RYV+S+L +D+II++GDVKFYLHKFPLLSKS  LQKLV+ 
Sbjct  1    MKFMKLGSKPDAFQADGKSIRYVSSDLQTDVIINVGDVKFYLHKFPLLSKSNRLQKLVSK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
             N+ + +EV + D PGG  +FEICAKFCYGMTVTLNAYN++AARCAAEYLEM E+V++ N
Sbjct  61   PND-DSEEVDMVDFPGGPKSFEICAKFCYGMTVTLNAYNVVAARCAAEYLEMTEDVDRSN  119

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LIYKI+VFLNSSI +SWKDSIIVLQTTKS L   ++LK+VG C+++IAS+ S+D + + W
Sbjct  120  LIYKIEVFLNSSIFRSWKDSIIVLQTTKSLLSWSDDLKIVGRCIDSIASKTSVDPTNITW  179

Query  105  SYTYNRK  85
            SYTYNRK
Sbjct  180  SYTYNRK  186



>ref|XP_008220672.1| PREDICTED: BTB/POZ domain-containing protein NPY1 [Prunus mume]
Length=613

 Score =   285 bits (728),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 138/215 (64%), Positives = 179/215 (83%), Gaps = 5/215 (2%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G ++RYV+SELA+D+II++G+VKFYLHKFPLLSKS  LQKLV+ 
Sbjct  1    MKFMKLGSKPDAFQADGKSIRYVSSELATDVIINVGEVKFYLHKFPLLSKSNRLQKLVSE  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            +NE N +EV++ D PGG  +FEICAKFCYGMTVTLNAYN++AARCAAEYLEM E+V++ N
Sbjct  61   ANEENSEEVYMVDFPGGPKSFEICAKFCYGMTVTLNAYNVVAARCAAEYLEMTEDVDRSN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            L++KI+VFLNSSI +SWKDSIIVLQTTK  L   E+LK+VG C++++AS+ S+D + + W
Sbjct  121  LVFKIEVFLNSSIFRSWKDSIIVLQTTKPLLSWAEDLKIVGRCIDSVASKTSVDPANISW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNR K+ E +  ++   +G   R VP+DWWVE
Sbjct  181  SYTYNR-KLAETDKIVE---EGMNYR-VPRDWWVE  210



>ref|XP_006404771.1| hypothetical protein EUTSA_v10000147mg [Eutrema salsugineum]
 gb|ESQ46224.1| hypothetical protein EUTSA_v10000147mg [Eutrema salsugineum]
Length=485

 Score =   281 bits (718),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 140/223 (63%), Positives = 166/223 (74%), Gaps = 16/223 (7%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD  QS+G+N+RYVA+EL ++II+ IG VKFYLHKFPLLSKS  L+KL+  
Sbjct  1    MKFMKLGSKPDSSQSKGDNIRYVATELETEIIVIIGSVKFYLHKFPLLSKSGFLEKLIAT  60

Query  465  SNEGNG-----DEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNEN  301
            SN         DE+ I +IPGG  AFEIC KFCYG+TVTLNAYN++AAR AAE+LEMNE 
Sbjct  61   SNNEEKKNHQIDEIDISEIPGGSVAFEICVKFCYGITVTLNAYNVVAARSAAEFLEMNET  120

Query  300  VEKGNLIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEE---LKLVGHCVEAIASRAS  130
             EK NL+YKIDVFLNS+I  SWKDSIIVLQTT+   P C +   LKLV  C+++IAS AS
Sbjct  121  FEKSNLVYKIDVFLNSTIFHSWKDSIIVLQTTRDISPNCSDEFSLKLVKRCLDSIASTAS  180

Query  129  IDVSKVDWSYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            ID SKV+WSYTYNRKK  ++           +   VPKDWWVE
Sbjct  181  IDTSKVEWSYTYNRKKKLDQK--------VRKQEAVPKDWWVE  215



>gb|AFW85546.1| putative phototropic-responsive NPH3 family protein [Zea mays]
Length=574

 Score =   283 bits (725),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 166/218 (76%), Gaps = 8/218 (4%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGN--NLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLV  472
            MKFMKLGSKPD FQ++G   + RYV S+L SDI++H+ D +FYLHKFPLLSKS  LQ+L+
Sbjct  1    MKFMKLGSKPDAFQTDGGGGDARYVLSDLPSDIVVHVDDARFYLHKFPLLSKSGLLQRLI  60

Query  471  TNSNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEK  292
              +++   DEV I+D+PGG   FEICAKFCYGM VTLNAYN++AARCAAEYL M E+VEK
Sbjct  61   VEASQNGSDEVAIQDVPGGAKTFEICAKFCYGMVVTLNAYNVVAARCAAEYLGMTEDVEK  120

Query  291  GNLIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKV  112
             NL++KI+VFL+S I +SWKDSII LQTT + LP  EELKLVG CV+++A++A++  S V
Sbjct  121  SNLVFKIEVFLSSGIFRSWKDSIIALQTTDALLPWSEELKLVGRCVDSVAAKATVSASNV  180

Query  111  DWSYTYNRKKIHEENNDIDPNFDGAR-SRMVPKDWWVE  1
             WSYTYNRK         D   +  R S+ VPKDWWVE
Sbjct  181  VWSYTYNRKSASS-----DEIVEARRSSQAVPKDWWVE  213



>gb|KHG00065.1| BTB/POZ domain-containing protein NPY1 [Gossypium arboreum]
Length=1038

 Score =   292 bits (748),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 139/215 (65%), Positives = 171/215 (80%), Gaps = 0/215 (0%)
 Frame = -2

Query  645  MKFMKLGSKPDCFQSEGNNLRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTN  466
            MKFMKLGSKPD FQ++G  +RYV S+LA+D+ I +G+VKF+LHKFPL+SKS  LQKLV  
Sbjct  1    MKFMKLGSKPDTFQADGKCIRYVISDLATDVTIIVGEVKFHLHKFPLMSKSNRLQKLVLK  60

Query  465  SNEGNGDEVHIRDIPGGHTAFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGN  286
            ++E N DE+ + D PGG  AFEICAKFCYGMTVTLNAYN++AARCAAEYLEM E+V++GN
Sbjct  61   ASEENSDEIDMVDFPGGPKAFEICAKFCYGMTVTLNAYNVVAARCAAEYLEMTEDVDRGN  120

Query  285  LIYKIDVFLNSSILKSWKDSIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDW  106
            LI+KI+VF+NSSIL+SWKDSIIVLQTTKS LP  E LK+VG C+++IAS+ S+D + V W
Sbjct  121  LIFKIEVFINSSILRSWKDSIIVLQTTKSLLPWSENLKIVGRCIDSIASKTSVDPANVTW  180

Query  105  SYTYNRKKIHEENNDIDPNFDGARSRMVPKDWWVE  1
            SYTYNRK +  E           +   VPKDWWVE
Sbjct  181  SYTYNRKLLAPEIIVKGGMKYQEKIESVPKDWWVE  215



>ref|XP_010317781.1| PREDICTED: BTB/POZ domain-containing protein NPY4 isoform X2 
[Solanum lycopersicum]
Length=615

 Score =   284 bits (727),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 137/197 (70%), Positives = 165/197 (84%), Gaps = 2/197 (1%)
 Frame = -2

Query  588  LRYVASELASDIIIHIGDVKFYLHKFPLLSKSAHLQKLVTNSNEGNGDEVHIRDIPGGHT  409
             RYVA+ELA+D+II++GDVKFYLHKFPLL KS  LQKL+  +NE N DE++I DIPGG  
Sbjct  5    FRYVAAELATDMIINVGDVKFYLHKFPLLLKSYRLQKLIACTNEENIDEINIHDIPGGPA  64

Query  408  AFEICAKFCYGMTVTLNAYNLIAARCAAEYLEMNENVEKGNLIYKIDVFLNSSILKSWKD  229
            AFE+CAKFCY MTVTLNAYN++AARCAAEYLEM E+VEKGNLIYKI+VFL SSI +SWKD
Sbjct  65   AFEVCAKFCYNMTVTLNAYNVVAARCAAEYLEMYESVEKGNLIYKIEVFLTSSIFRSWKD  124

Query  228  SIIVLQTTKSHLPMCEELKLVGHCVEAIASRASIDVSKVDWSYTYNRKKIHEEN-NDIDP  52
            SIIVLQTTK+ LP  EELK+V HC+E++AS+AS+D SKVDWSYTYN KK+  EN +D+  
Sbjct  125  SIIVLQTTKAFLPWSEELKIVSHCLESVASKASVDTSKVDWSYTYNHKKLPSENGSDLHC  184

Query  51   NFDGARSRMVPKDWWVE  1
            N    + ++VP DWWVE
Sbjct  185  NAISCQ-QLVPIDWWVE  200



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1116851065560