BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24193_g6_i1 len=1359 path=[25273:0-735 6663:736-763 6691:764-1097
2016:1098-1125 4081:1126-1358]

Length=1359
                                                                      Score     E

ref|XP_009339133.1|  PREDICTED: uncharacterized protein LOC103931378    204   7e-58   
ref|XP_007210084.1|  hypothetical protein PRUPE_ppa019735mg             203   3e-57   
ref|XP_008239893.1|  PREDICTED: uncharacterized protein LOC103338467    203   4e-57   
ref|XP_009617175.1|  PREDICTED: uncharacterized protein LOC104109549    202   8e-57   
ref|XP_008374578.1|  PREDICTED: uncharacterized protein LOC103437852    201   9e-57   
emb|CAN78131.1|  hypothetical protein VITISV_000332                     201   2e-56   Vitis vinifera
ref|XP_010089884.1|  hypothetical protein L484_008572                   201   2e-56   
ref|XP_002284698.1|  PREDICTED: uncharacterized protein LOC100260477    200   3e-56   Vitis vinifera
ref|XP_009339684.1|  PREDICTED: uncharacterized protein LOC103931867    199   1e-55   
ref|XP_004242176.1|  PREDICTED: uncharacterized protein LOC101259449    198   3e-55   
ref|XP_008393355.1|  PREDICTED: uncharacterized protein LOC103455546    195   4e-54   
ref|XP_007037439.1|  Uncharacterized protein TCM_014112                 195   4e-54   
ref|XP_011012575.1|  PREDICTED: uncharacterized protein LOC105116791    194   6e-54   
gb|KEH31964.1|  transmembrane protein, putative                         193   2e-53   
ref|XP_006374437.1|  hypothetical protein POPTR_0015s07190g             192   3e-53   
ref|XP_004499518.1|  PREDICTED: uncharacterized protein LOC101505783    191   1e-52   
ref|XP_004508715.1|  PREDICTED: uncharacterized protein LOC101499112    189   6e-52   
gb|KDP31291.1|  hypothetical protein JCGZ_11667                         189   1e-51   
ref|XP_011101971.1|  PREDICTED: uncharacterized protein LOC105180005    187   5e-51   
ref|XP_011006296.1|  PREDICTED: uncharacterized protein LOC105112322    186   1e-50   
ref|XP_004236481.1|  PREDICTED: uncharacterized protein LOC101262301    184   4e-50   
ref|XP_008445049.1|  PREDICTED: uncharacterized protein LOC103488179    184   5e-50   
ref|XP_004137590.1|  PREDICTED: uncharacterized protein LOC101220892    183   1e-49   
gb|ACU19969.1|  unknown                                                 182   1e-49   Glycine max [soybeans]
gb|KHN18574.1|  hypothetical protein glysoja_006987                     182   2e-49   
ref|XP_003549689.1|  PREDICTED: uncharacterized protein LOC100819933    182   2e-49   
ref|XP_003524748.2|  PREDICTED: uncharacterized protein LOC100809875    183   2e-49   
gb|KHN48705.1|  hypothetical protein glysoja_015853                     182   2e-49   
gb|AFK39790.1|  unknown                                                 182   3e-49   
emb|CDP18310.1|  unnamed protein product                                181   8e-49   
ref|XP_002514717.1|  conserved hypothetical protein                     180   2e-48   Ricinus communis
gb|KEH33432.1|  transmembrane protein, putative                         179   2e-48   
ref|XP_011072808.1|  PREDICTED: uncharacterized protein LOC105157952    179   3e-48   
ref|XP_007138157.1|  hypothetical protein PHAVU_009G184900g             177   1e-47   
ref|XP_007155283.1|  hypothetical protein PHAVU_003G187900g             174   4e-46   
ref|XP_006440660.1|  hypothetical protein CICLE_v10020945mg             173   1e-45   
gb|KDO55467.1|  hypothetical protein CISIN_1g019105mg                   172   1e-45   
ref|XP_006494989.1|  PREDICTED: uncharacterized protein LOC102626486    172   1e-45   
ref|XP_002318598.2|  hypothetical protein POPTR_0012s06990g             171   2e-45   Populus trichocarpa [western balsam poplar]
gb|KHN45241.1|  hypothetical protein glysoja_041633                     171   4e-45   
ref|NP_001241590.1|  uncharacterized protein LOC100802807               169   1e-44   
gb|KHN26275.1|  hypothetical protein glysoja_032845                     169   1e-44   
ref|XP_003523005.1|  PREDICTED: uncharacterized protein LOC100797246    169   2e-44   
gb|ACU19144.1|  unknown                                                 166   3e-43   Glycine max [soybeans]
gb|KGN63693.1|  hypothetical protein Csa_1G011450                       164   2e-42   
ref|XP_008453222.1|  PREDICTED: uncharacterized protein LOC103494010    163   5e-42   
gb|KFK27894.1|  hypothetical protein AALP_AA8G443900                    160   4e-41   
ref|XP_009111986.1|  PREDICTED: uncharacterized protein LOC103837376    158   1e-40   
ref|XP_010258424.1|  PREDICTED: uncharacterized protein LOC104598194    158   2e-40   
dbj|BAB08489.1|  unnamed protein product                                156   2e-39   Arabidopsis thaliana [mouse-ear cress]
emb|CDY23069.1|  BnaC07g31180D                                          155   2e-39   
ref|XP_010483800.1|  PREDICTED: uncharacterized protein LOC104762247    155   2e-39   
ref|XP_010457239.1|  PREDICTED: uncharacterized protein LOC104738735    155   3e-39   
ref|NP_568933.1|  uncharacterized protein                               154   5e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010678454.1|  PREDICTED: uncharacterized protein LOC104894001    155   5e-39   
ref|XP_010443954.1|  PREDICTED: uncharacterized protein LOC104726721    153   2e-38   
ref|XP_006394517.1|  hypothetical protein EUTSA_v10005448mg             152   2e-38   
ref|XP_009136463.1|  PREDICTED: uncharacterized protein LOC103860586    152   3e-38   
ref|XP_002866429.1|  hypothetical protein ARALYDRAFT_919377             151   5e-38   
ref|XP_006280822.1|  hypothetical protein CARUB_v10026789mg             150   8e-38   
emb|CDY02155.1|  BnaA03g40120D                                          150   1e-37   
ref|XP_004174046.1|  PREDICTED: uncharacterized protein LOC101224752    147   5e-37   
ref|XP_010039067.1|  PREDICTED: uncharacterized protein LOC104427718    149   1e-36   
gb|KCW48865.1|  hypothetical protein EUGRSUZ_K02492                     148   2e-36   
ref|XP_009419078.1|  PREDICTED: uncharacterized protein LOC103999144    144   3e-35   
ref|XP_008787211.1|  PREDICTED: uncharacterized protein LOC103705324    143   4e-35   
emb|CDY16815.1|  BnaA09g05670D                                          140   4e-34   
ref|XP_010258661.1|  PREDICTED: uncharacterized protein LOC104598335    140   4e-34   
ref|XP_010523013.1|  PREDICTED: uncharacterized protein LOC104801435    139   1e-33   
ref|XP_002278774.2|  PREDICTED: uncharacterized protein LOC100256060    135   2e-32   Vitis vinifera
ref|XP_009130173.1|  PREDICTED: uncharacterized protein LOC103854959    132   6e-31   
ref|XP_010938751.1|  PREDICTED: uncharacterized protein LOC105057757    131   7e-31   
ref|XP_008781043.1|  PREDICTED: uncharacterized protein LOC103700923    131   7e-31   
ref|XP_010936510.1|  PREDICTED: uncharacterized protein LOC105056131    130   1e-30   
ref|XP_007032623.1|  Uncharacterized protein TCM_018662                 130   1e-30   
ref|XP_009417032.1|  PREDICTED: uncharacterized protein LOC103997509    135   2e-30   
ref|XP_002530020.1|  conserved hypothetical protein                     126   2e-29   Ricinus communis
ref|XP_010045591.1|  PREDICTED: uncharacterized protein LOC104434350    127   3e-29   
ref|XP_010939058.1|  PREDICTED: uncharacterized protein LOC105058004    126   4e-29   
emb|CDX87208.1|  BnaC09g05230D                                          124   1e-28   
ref|XP_010546430.1|  PREDICTED: uncharacterized protein LOC104818514    117   2e-26   
emb|CDY42877.1|  BnaAnng07020D                                          122   3e-26   
ref|XP_009790718.1|  PREDICTED: uncharacterized protein LOC104238132    114   3e-26   
ref|NP_001144457.1|  hypothetical protein                               116   8e-26   Zea mays [maize]
ref|XP_002305952.2|  hypothetical protein POPTR_0004s10270g             115   1e-25   Populus trichocarpa [western balsam poplar]
ref|XP_009415781.1|  PREDICTED: uncharacterized protein LOC103996578    114   3e-25   
gb|EPS68484.1|  hypothetical protein M569_06284                         113   7e-25   
ref|XP_002442380.1|  hypothetical protein SORBIDRAFT_08g019150          113   1e-24   Sorghum bicolor [broomcorn]
gb|EYU35794.1|  hypothetical protein MIMGU_mgv1a019183mg                110   7e-24   
ref|XP_008790099.1|  PREDICTED: uncharacterized protein LOC103707406    108   3e-23   
ref|XP_009405888.1|  PREDICTED: uncharacterized protein LOC103988924    108   6e-23   
ref|XP_010089561.1|  hypothetical protein L484_020951                   106   2e-22   
ref|XP_004962983.1|  PREDICTED: uncharacterized protein LOC101755659    106   3e-22   
ref|NP_001142588.1|  uncharacterized protein LOC100274853               104   1e-21   Zea mays [maize]
tpg|DAA47177.1|  TPA: hypothetical protein ZEAMMB73_688937              104   2e-21   
gb|EYU23500.1|  hypothetical protein MIMGU_mgv1a011493mg                103   2e-21   
gb|EEE53483.1|  hypothetical protein OsJ_36632                          100   3e-20   Oryza sativa Japonica Group [Japonica rice]
gb|EAY83630.1|  hypothetical protein OsI_38858                        99.4    1e-19   Oryza sativa Indica Group [Indian rice]
ref|NP_001067114.1|  Os12g0577200                                     99.0    1e-19   Oryza sativa Japonica Group [Japonica rice]
gb|AFK36617.1|  unknown                                               94.4    2e-19   
ref|XP_008648555.1|  PREDICTED: uncharacterized protein LOC103629156  72.0    2e-10   
ref|XP_010460285.1|  PREDICTED: uncharacterized protein LOC104741188  65.9    2e-08   
ref|XP_011004425.1|  PREDICTED: uncharacterized protein LOC105110918  62.0    4e-08   
ref|XP_004962922.1|  PREDICTED: uncharacterized protein LOC101765523  65.1    4e-08   
ref|XP_003528573.1|  PREDICTED: uncharacterized protein LOC100806351  64.7    5e-08   
ref|XP_010258226.1|  PREDICTED: uncharacterized protein LOC104598044  63.9    1e-07   
ref|XP_010499015.1|  PREDICTED: uncharacterized protein LOC104776618  63.5    1e-07   
ref|XP_002443243.1|  hypothetical protein SORBIDRAFT_08g016250        63.5    1e-07   Sorghum bicolor [broomcorn]
ref|XP_008389435.1|  PREDICTED: uncharacterized protein LOC103451785  63.5    1e-07   
ref|XP_010477835.1|  PREDICTED: uncharacterized protein LOC104756877  63.2    1e-07   
gb|KDP41249.1|  hypothetical protein JCGZ_15656                       62.8    2e-07   
ref|XP_006844834.1|  hypothetical protein AMTR_s00058p00077380        62.8    3e-07   
ref|XP_004516573.1|  PREDICTED: uncharacterized protein LOC101492424  62.4    3e-07   
ref|NP_001066845.1|  Os12g0507400                                     62.0    3e-07   Oryza sativa Japonica Group [Japonica rice]
gb|EAY83254.1|  hypothetical protein OsI_38462                        62.0    4e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_003556759.2|  PREDICTED: uncharacterized protein LOC100789016  61.2    7e-07   
ref|NP_564252.2|  uncharacterized protein                             61.2    7e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010250356.1|  PREDICTED: uncharacterized protein LOC104592610  59.7    7e-07   
ref|XP_010237231.1|  PREDICTED: uncharacterized protein LOC100823289  60.8    8e-07   
ref|XP_010258644.1|  PREDICTED: uncharacterized protein LOC104598320  60.8    8e-07   
gb|AAK59463.1|  unknown protein                                       58.5    8e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004299927.1|  PREDICTED: uncharacterized protein LOC101307497  60.8    9e-07   
ref|XP_006348815.1|  PREDICTED: uncharacterized protein LOC102581421  60.5    1e-06   
gb|KFK41365.1|  hypothetical protein AALP_AA2G120500                  60.5    1e-06   
ref|XP_002312265.1|  hypothetical protein POPTR_0008s09100g           60.1    2e-06   Populus trichocarpa [western balsam poplar]
ref|XP_008339849.1|  PREDICTED: uncharacterized protein LOC103402858  60.1    2e-06   
ref|XP_004239096.1|  PREDICTED: uncharacterized protein LOC101256486  60.1    2e-06   
ref|XP_002893390.1|  hypothetical protein ARALYDRAFT_472743           59.7    2e-06   
ref|XP_006483093.1|  PREDICTED: uncharacterized protein LOC102625077  59.7    2e-06   
gb|EYU28808.1|  hypothetical protein MIMGU_mgv1a026893mg              59.7    2e-06   
ref|XP_009105492.1|  PREDICTED: uncharacterized protein LOC103831343  59.7    2e-06   
ref|XP_006306437.1|  hypothetical protein CARUB_v10012379mg           59.7    2e-06   
ref|XP_006438763.1|  hypothetical protein CICLE_v10033399mg           59.7    2e-06   
ref|XP_002522492.1|  conserved hypothetical protein                   59.7    2e-06   Ricinus communis
gb|KEH30805.1|  transmembrane protein, putative                       59.7    2e-06   
emb|CDP00381.1|  unnamed protein product                              59.7    2e-06   
gb|KCW56258.1|  hypothetical protein EUGRSUZ_I02003                   58.9    3e-06   
ref|XP_010419096.1|  PREDICTED: uncharacterized protein LOC104704761  59.3    3e-06   
ref|XP_007045989.1|  Son of sevenless                                 59.3    3e-06   
ref|XP_009404772.1|  PREDICTED: uncharacterized protein LOC103988010  59.3    3e-06   
ref|XP_010030783.1|  PREDICTED: uncharacterized protein LOC104420686  58.9    3e-06   
ref|XP_003607775.1|  ATP synthase subunit beta                        59.3    3e-06   
ref|XP_006415943.1|  hypothetical protein EUTSA_v10008119mg           58.9    3e-06   
ref|XP_010511970.1|  PREDICTED: uncharacterized protein LOC104788003  58.9    4e-06   
emb|CDX95932.1|  BnaA07g27990D                                        58.5    4e-06   
gb|KDO83041.1|  hypothetical protein CISIN_1g018046mg                 58.9    4e-06   
emb|CDY40929.1|  BnaC06g30670D                                        58.5    5e-06   
ref|XP_011012681.1|  PREDICTED: uncharacterized protein LOC105116878  58.5    5e-06   
ref|XP_009421085.1|  PREDICTED: uncharacterized protein LOC104000701  57.8    8e-06   
ref|XP_010551632.1|  PREDICTED: uncharacterized protein LOC104822182  57.8    9e-06   
ref|XP_009624255.1|  PREDICTED: uncharacterized protein LOC104115351  57.4    1e-05   
ref|XP_002315026.2|  hypothetical protein POPTR_0010s17080g           57.4    1e-05   Populus trichocarpa [western balsam poplar]
ref|XP_009795710.1|  PREDICTED: uncharacterized protein LOC104242365  57.0    1e-05   
ref|XP_010470929.1|  PREDICTED: uncharacterized protein LOC104750779  57.0    2e-05   
ref|XP_002887236.1|  predicted protein                                57.0    2e-05   
ref|NP_177102.1|  uncharacterized protein                             56.6    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006391017.1|  hypothetical protein EUTSA_v10018794mg           56.6    2e-05   
emb|CDX85037.1|  BnaC05g20180D                                        56.6    2e-05   
ref|XP_010238889.1|  PREDICTED: uncharacterized protein LOC100833751  56.2    3e-05   
ref|XP_009115389.1|  PREDICTED: uncharacterized protein LOC103840632  56.2    3e-05   
emb|CDY16174.1|  BnaA09g29080D                                        56.2    3e-05   
ref|XP_008446402.1|  PREDICTED: uncharacterized protein LOC103489158  56.2    3e-05   
ref|XP_006302541.1|  hypothetical protein CARUB_v10020641mg           55.8    3e-05   
ref|XP_004155379.1|  PREDICTED: uncharacterized protein LOC101226354  55.8    3e-05   
ref|XP_010683099.1|  PREDICTED: uncharacterized protein LOC104897842  55.5    5e-05   
ref|XP_004135444.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  55.1    5e-05   
ref|XP_008787101.1|  PREDICTED: uncharacterized protein LOC103705238  54.7    9e-05   
ref|XP_010936511.1|  PREDICTED: uncharacterized protein LOC105056132  54.3    1e-04   
ref|XP_010552565.1|  PREDICTED: uncharacterized protein LOC104822905  54.3    1e-04   
ref|XP_002281196.1|  PREDICTED: uncharacterized protein LOC100250739  53.5    2e-04   Vitis vinifera
ref|XP_010532668.1|  PREDICTED: uncharacterized protein LOC104808637  53.1    2e-04   
ref|XP_007203111.1|  hypothetical protein PRUPE_ppa023904mg           52.4    4e-04   
ref|XP_010108724.1|  hypothetical protein L484_015713                 52.8    4e-04   
ref|XP_008790177.1|  PREDICTED: uncharacterized protein LOC103707457  50.8    5e-04   
ref|XP_008242640.1|  PREDICTED: uncharacterized protein LOC103340951  51.6    6e-04   
ref|XP_010939057.1|  PREDICTED: uncharacterized protein LOC105058003  52.0    6e-04   
emb|CAN79522.1|  hypothetical protein VITISV_034628                   52.0    7e-04   Vitis vinifera
ref|XP_010088844.1|  hypothetical protein L484_020828                 51.2    7e-04   



>ref|XP_009339133.1| PREDICTED: uncharacterized protein LOC103931378 [Pyrus x bretschneideri]
Length=319

 Score =   204 bits (520),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 147/326 (45%), Positives = 198/326 (61%), Gaps = 42/326 (13%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsssi  294
            MET   ILRRS+  FL  Y YFT+ A  +A PF+AS L+ Q+LLPS   ++ ++      
Sbjct  1    METAGKILRRSVHIFLLNYQYFTSTAALIALPFSASVLISQALLPSSSALLATVYNRLHS  60

Query  295  lf------------silHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQE---  429
            LF            +IL+ KLS TI  SV  FP +L+  L  K+ VI  L  S +Q+   
Sbjct  61   LFDAAGFPPSLEFFTILNHKLSQTITSSVFTFPFSLTFLLITKSFVIQTL--SRHQKPNS  118

Query  430  CPWPSFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS----LFF  576
               PSF     L+ PL+HT + NS   LS+       LFIAFN+ + G G SS    LF 
Sbjct  119  SSHPSFLSTISLYTPLLHTHVYNSFLILSANATVFSILFIAFNVLE-GSGFSSPNTLLFL  177

Query  577  SAIGALVFSL-------ICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINA  735
            SA GA+++S+       ICNLAL+LS TQK GG+ A+LKAC+LI+ R +TALSLALP++ 
Sbjct  178  SASGAVLYSIVLANALIICNLALVLSGTQKSGGYLAILKACLLIRGRTSTALSLALPVSL  237

Query  736  TMAAVEALFQYRVVRAYHDDGVF--SAALEGLFIAYLYALLIVLDTIVAYFFFTTCEEHK  909
            T+AAVEALFQYR+VRAYH  G    S A+EG+FIAYLY++L+VLDT V++ F  +C+   
Sbjct  238  TLAAVEALFQYRLVRAYHFTGQLGSSMAMEGVFIAYLYSILVVLDTTVSFLFLQSCKPSS  297

Query  910  DGRKKIAQDQSLACSCRSIKIVEGLP  987
             G +    ++    SC  +K V+ LP
Sbjct  298  RGIEYRDDEE----SCGDLKAVKVLP  319



>ref|XP_007210084.1| hypothetical protein PRUPE_ppa019735mg [Prunus persica]
 gb|EMJ11283.1| hypothetical protein PRUPE_ppa019735mg [Prunus persica]
Length=330

 Score =   203 bits (517),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 144/335 (43%), Positives = 197/335 (59%), Gaps = 49/335 (15%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsssi  294
            M     ILR+S+ TFLQ Y +FT+I   +A PF+AS L+ Q+L+PS   ++ ++      
Sbjct  1    MAKAGKILRKSVHTFLQNYQFFTSIVALIALPFSASVLISQALVPSSSSLLPTIYNRLQS  60

Query  295  lfsil------------HTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECP-  435
            LF               + KLS TI+ S+   P TL+  L  KASVI  L    N   P 
Sbjct  61   LFDAAGFPPSSEFFSILNHKLSQTISSSIFTIPFTLTFLLITKASVIQYL----NHRKPT  116

Query  436  ----WPSFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS----L  570
                 PSFS +  L+IPL+HT I NS   LS+       LFIAFN  + G G SS    L
Sbjct  117  TFSSHPSFSSVISLYIPLLHTHIFNSFLILSANATVFSLLFIAFNFLE-GFGFSSPNTLL  175

Query  571  FFSAIGALVFSL-------ICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPI  729
            F SA GA+++S+       ICNL+L+LS T++ GG+ A+LKAC+LI+ R ATALSLALP+
Sbjct  176  FLSASGAVLYSIVLANALIICNLSLVLSGTERSGGYLAILKACILIRGRTATALSLALPV  235

Query  730  NATMAAVEALFQYRVVRAYHDDGVF--SAALEGLFIAYLYALLIVLDTIVAYFFFTTCEE  903
            N  +AA+EALFQYRVVRA H  G    S ALEGL IAYLY++L+VLDTIV++ FF +C+ 
Sbjct  236  NLALAAIEALFQYRVVRACHFAGKLGSSMALEGLLIAYLYSVLVVLDTIVSFMFFKSCKP  295

Query  904  ----HKDGRKKIA---QDQSLACSCRSIKIVEGLP  987
                 ++G+       +D+       ++K ++ LP
Sbjct  296  SSWADQEGKHSCGIEYRDEESCGGYGNLKTLKELP  330



>ref|XP_008239893.1| PREDICTED: uncharacterized protein LOC103338467 [Prunus mume]
Length=339

 Score =   203 bits (517),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 145/336 (43%), Positives = 196/336 (58%), Gaps = 49/336 (15%)
 Frame = +1

Query  112  SMETPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsss  291
            SM     ILR+S+ TFLQ Y +FT+I   +A PF+AS L+ Q+L+PS   ++ ++     
Sbjct  9    SMAKAGKILRKSVHTFLQNYQFFTSIVALIALPFSASVLISQALVPSSSSLLPTIYNRLQ  68

Query  292  ilfsil------------HTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECP  435
             LF               + KLS TI+ S+   P TL+  L  KASVI  L    N + P
Sbjct  69   SLFDAAGFPPSSEFFSILNHKLSQTISSSIFTIPFTLTFLLITKASVIQYL----NHQKP  124

Query  436  -----WPSFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS----  567
                  PSFS +  L+ PL+HT I NS   LS+       LFIAFN  + G G SS    
Sbjct  125  TTFSSHPSFSSVISLYTPLLHTHIFNSFLILSANATVFSLLFIAFNFLE-GFGFSSPNTL  183

Query  568  LFFSAIGALVFSL-------ICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALP  726
            LF SA GA+++S+       ICNL+L+LS T++ GG+ A+LKAC+LI+ R ATALSLALP
Sbjct  184  LFLSASGAVLYSIVLANALIICNLSLVLSGTERSGGYLAILKACILIRGRTATALSLALP  243

Query  727  INATMAAVEALFQYRVVRAYHDDGVF--SAALEGLFIAYLYALLIVLDTIVAYFFFTTC-  897
            +N  +AA+EALFQYRVVRA H  G    S ALEGL IAYLY++L+VLDTIV++ FF +C 
Sbjct  244  VNLALAAIEALFQYRVVRACHFAGKLGSSMALEGLLIAYLYSVLVVLDTIVSFMFFKSCK  303

Query  898  ------EEHKDGRKKIAQDQSLACSCRSIKIVEGLP  987
                  +E K       +D+       ++K ++ LP
Sbjct  304  PSSWADQEGKHSGGIEYRDEESCGGYGNLKTLKELP  339



>ref|XP_009617175.1| PREDICTED: uncharacterized protein LOC104109549 [Nicotiana tomentosiformis]
Length=328

 Score =   202 bits (513),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 140/299 (47%), Positives = 192/299 (64%), Gaps = 37/299 (12%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIAT-----------FLAFPFAASTlllqsllpsqip  261
            M+  + I+RRSIF+FLQ Y +FTT A             L     +S+          + 
Sbjct  10   MQRTTKIIRRSIFSFLQNYQFFTTTAAFFAFPFAASFLLLQSFIPSSSFFPIIYERLHLL  69

Query  262  iihsllpsssilfsilHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWP  441
               +  PSSS  F++L++K+S TIAIS LAFP T+SSFLF KASVI AL  ++++    P
Sbjct  70   FDAAGFPSSSEFFTLLNSKISQTIAISFLAFPFTISSFLFSKASVIEAL--NSSKPAQNP  127

Query  442  SFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS----LFFSAIG  588
            SF   F    PL+ TQ+CNSL  +S+       LF  FNL DYG GLSS    L  SA G
Sbjct  128  SF---FSSFFPLLLTQLCNSLVIISANATCFTVLFFGFNLVDYGFGLSSPRLILLCSATG  184

Query  589  ALVFSLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAA  747
            A++ S+I       CNLAL++S T+K GG+ A+LK+C+LI+ R ATALSLA+P++  +AA
Sbjct  185  AVICSIILANTLIICNLALVISGTEKIGGYMAILKSCILIRGRTATALSLAVPVSLALAA  244

Query  748  VEALFQYRVVRAYHDD--GVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCEEHKDGR  918
            VEALFQYR+VRAY+ +   +FS ALEG+FIAY+Y++L+VLDTIV+  F+ +C+   +GR
Sbjct  245  VEALFQYRIVRAYYQEKTDLFSLALEGIFIAYMYSILLVLDTIVSIVFYRSCKTD-EGR  302



>ref|XP_008374578.1| PREDICTED: uncharacterized protein LOC103437852 [Malus domestica]
Length=319

 Score =   201 bits (512),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 144/326 (44%), Positives = 196/326 (60%), Gaps = 42/326 (13%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsssi  294
            MET   ILRRS+ TFL  Y YFT+ A  +A PF+AS L+ Q+LLPS   ++ ++      
Sbjct  1    METAGKILRRSVHTFLLNYQYFTSTAALIALPFSASVLISQALLPSSSALLAAVYNRLHS  60

Query  295  lfsil------------HTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQE---  429
            LF+              + KLS TI  SV  FP +L+  L  K+ VI  L  S +Q+   
Sbjct  61   LFNAAGFPPSLEFFNILNHKLSQTITSSVFTFPFSLTFLLITKSFVIQTL--SRHQKPNS  118

Query  430  CPWPSFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS----LFF  576
               PSF     L+ PL+HT + NS F +S+       LFIAFN+ + G G SS    LF 
Sbjct  119  SSHPSFLSTISLYTPLLHTHVYNSFFIISANATVFSILFIAFNVLE-GSGFSSPNTLLFL  177

Query  577  SAIGALVFSL-------ICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINA  735
            SA GA+++S+       ICNLAL+LS TQ  GG+ A+LKAC+LI+ R +TALSLALP++ 
Sbjct  178  SASGAVLYSIVLANALIICNLALVLSGTQNSGGYLAILKACLLIRGRTSTALSLALPVSL  237

Query  736  TMAAVEALFQYRVVRAYHDDGVF--SAALEGLFIAYLYALLIVLDTIVAYFFFTTCEEHK  909
            T+AAVEALFQYR+VRA H  G    S A+EG+FIAYLY++L+VLDT V++ F  +C+   
Sbjct  238  TLAAVEALFQYRLVRACHFTGQLGSSMAMEGVFIAYLYSILVVLDTTVSFLFLQSCKPSS  297

Query  910  DGRKKIAQDQSLACSCRSIKIVEGLP  987
             G +    ++    SC  +K V+ LP
Sbjct  298  RGIEYRDDEE----SCGDLKAVKVLP  319



>emb|CAN78131.1| hypothetical protein VITISV_000332 [Vitis vinifera]
Length=326

 Score =   201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 153/331 (46%), Positives = 199/331 (60%), Gaps = 45/331 (14%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipi----------  264
            ME    I+RRS++TFLQ+Y +FT+ A  L  PF+AS LL Q+ LP   P+          
Sbjct  1    MERTGRIMRRSVYTFLQQYQFFTSTAALLVLPFSASILLSQAFLPFSSPLLPVIHDRLQF  60

Query  265  --ihsllpsssilfsilHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPW  438
                +  P SS  F+IL+ KLS TI+ S+   P T+S  L  KA +I AL  + N+    
Sbjct  61   LFKAAGFPPSSQFFTILNLKLSQTISSSIFTLPFTISFLLIGKACIIQAL--NHNKPGFP  118

Query  439  PSFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSSL----FFSAI  585
            PSFS    L+ PL+ T I NSL  LS+       LFIAFN  + GLG SS     F SA 
Sbjct  119  PSFSSFISLYCPLLITYIWNSLLILSANATAFSVLFIAFNCLE-GLGYSSPNFVPFLSAA  177

Query  586  GALVFSLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMA  744
             A+++S+I       CNLAL+LS  ++ GG+ A+LKACV+I+ R +TALSLALPIN  +A
Sbjct  178  AAILYSIILANSLIICNLALVLSGMERCGGYIAILKACVMIRGRTSTALSLALPINLALA  237

Query  745  AVEALFQYRVVRAYHDDGV--FSAALEGLFIAYLYALLIVLDTIVAYFFFTTCEE----H  906
            AVEALFQYRVVRAYH  G    S ALEGLFIAY+Y+ L+VLDTIV+  FF  C+      
Sbjct  238  AVEALFQYRVVRAYHISGKPRSSIALEGLFIAYMYSJLVVLDTIVSCIFFKRCKRGCWTD  297

Query  907  KDG----RKKIAQDQSLACSCRSIKIVEGLP  987
            +DG    R +IA++   A    + +I E LP
Sbjct  298  QDGTHSYRIEIAEEGGKA--FENTRISEELP  326



>ref|XP_010089884.1| hypothetical protein L484_008572 [Morus notabilis]
 gb|EXB38544.1| hypothetical protein L484_008572 [Morus notabilis]
Length=330

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 144/333 (43%), Positives = 192/333 (58%), Gaps = 45/333 (14%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsssi  294
            ME    ILRRSI+TFLQ YH+FT+ A  LA PF+AS LL Q+L+         L    + 
Sbjct  1    MEKSCKILRRSIYTFLQNYHHFTSKAALLALPFSASILLSQALIFPSSSSSSLLPTIYTR  60

Query  295  lf---------------silHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQE  429
            L                +IL+ KLS TI++S+   P TL+ FL  KA VI +L  ++ + 
Sbjct  61   LDNLFDAAGFPHSSEFFTILNQKLSQTISLSIFTLPFTLTFFLLSKAYVIQSL--TSPKP  118

Query  430  CPWPSFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS----LFF  576
               PSFS +  L+ PL  T ICNSL  LS+       LF AFN+ D GL  +S    LF 
Sbjct  119  ASRPSFSSILSLYDPLFITYICNSLLILSANATVFTLLFFAFNVLD-GLSFNSPNTVLFL  177

Query  577  SAIGALVFSLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINA  735
            SA GA+++S++       CNLAL+LS  ++ GG+ A LKACVLIK RI+TALSLALP+N 
Sbjct  178  SASGAVLYSIVLANTLITCNLALVLSGMERSGGYLATLKACVLIKGRISTALSLALPLNL  237

Query  736  TMAAVEALFQYRVVRAYHDDGVF--SAALEGLFIAYLYALLIVLDTIVAYFFFTTC----  897
            T+AA+EALFQYRVVRAYH  G    S  LE + I YLY++L+V+DT+V   F  +C    
Sbjct  238  TLAALEALFQYRVVRAYHVHGKLGSSMVLESILIFYLYSILVVIDTVVNIMFCRSCQVGF  297

Query  898  ---EEHKDGRKKIAQDQSLACSCRSIKIVEGLP  987
               +E +    K    +       S+K +E +P
Sbjct  298  LIDQEERICGAKDGDHRDEKSGYASLKNLEEIP  330



>ref|XP_002284698.1| PREDICTED: uncharacterized protein LOC100260477 [Vitis vinifera]
Length=326

 Score =   200 bits (509),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 153/331 (46%), Positives = 200/331 (60%), Gaps = 45/331 (14%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipi----------  264
            ME    I+RRS++TFLQ+Y +FT+ A  L  PF+AS LL Q+ LP   P+          
Sbjct  1    MERTGRIMRRSVYTFLQQYQFFTSTAALLVLPFSASILLSQAFLPFSSPLLPVIHDRLQF  60

Query  265  --ihsllpsssilfsilHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPW  438
                +  P SS  F+IL+ KLS TI+ S+   P T+S  L  KA +I AL  + N+    
Sbjct  61   LFKAAGFPPSSQFFTILNLKLSQTISSSIFTLPFTISFLLIGKACIIQAL--NHNKPGFP  118

Query  439  PSFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSSL----FFSAI  585
            PSFS    L+ PL+ T I NSL  LS+       LFIAFN  + GLG SS     F SA 
Sbjct  119  PSFSSFISLYCPLLITYIWNSLLILSANATAFSVLFIAFNCLE-GLGYSSPNFVPFLSAA  177

Query  586  GALVFSLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMA  744
             A+++S+I       CNLAL+LS  ++ GG+ A+LKACV+I+ R +TALSLALPIN  +A
Sbjct  178  AAILYSIILANSLIICNLALVLSGMERCGGYIAILKACVMIRGRTSTALSLALPINLALA  237

Query  745  AVEALFQYRVVRAYHDDGV--FSAALEGLFIAYLYALLIVLDTIVAYFFFTTCEE----H  906
            AVEALFQYRVVRAYH  G    S ALEGLFIAY+Y++L+VLDTIV+  FF  C+      
Sbjct  238  AVEALFQYRVVRAYHISGKPRSSIALEGLFIAYMYSILVVLDTIVSCIFFKRCKRGCWTD  297

Query  907  KDG----RKKIAQDQSLACSCRSIKIVEGLP  987
            +DG    R +IA++   A    + +I E LP
Sbjct  298  QDGTHSYRIEIAEEGGKA--FENTRISEELP  326



>ref|XP_009339684.1| PREDICTED: uncharacterized protein LOC103931867 [Pyrus x bretschneideri]
Length=324

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 141/312 (45%), Positives = 190/312 (61%), Gaps = 46/312 (15%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsssi  294
            ME    I+R+S+ TFL  Y YFT+IA  +A PF+AS L+ Q+LLPS   ++ ++      
Sbjct  1    MEKAGRIIRKSVHTFLLNYQYFTSIAAVIALPFSASVLISQALLPSSSALLPAVYNRLHS  60

Query  295  lf------------silHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECP-  435
            LF            +IL+ KLS TI  S+  FP +L+  L  KA VI +L   ++ + P 
Sbjct  61   LFDAAGFPPSLEFFTILNNKLSQTITSSIFTFPFSLTFLLITKAFVIQSL---SHHQKPN  117

Query  436  ---WPSFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS----LF  573
                PSF     L+ PL+HT + NS   LS+       LFIAFN+ + GLG SS    LF
Sbjct  118  TSSHPSFLSTISLYTPLLHTHVYNSFLILSANATVFSLLFIAFNVLE-GLGFSSPNTLLF  176

Query  574  FSAIGALVFSL-------ICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPIN  732
             S  GA+++S+       ICNLAL+LS  QK GG+ ALLKAC+LI+ R +TAL LALP++
Sbjct  177  LSVSGAVLYSIVLANALIICNLALVLSGAQKSGGYLALLKACLLIRGRTSTALCLALPVS  236

Query  733  ATMAAVEALFQYRVVRAYHDDGVF--SAALEGLFIAYLYALLIVLDTIVAYFFFTTCE--  900
             T+AAVEALFQYRVVRAYH  G    S A+EG+FIAYLY++L+VLDT V+  F  +C+  
Sbjct  237  LTLAAVEALFQYRVVRAYHFAGKLGSSMAMEGVFIAYLYSILVVLDTTVSLMFLQSCKPS  296

Query  901  ----EHKDGRKK  924
                EH+D  + 
Sbjct  297  SRRIEHRDDEEN  308



>ref|XP_004242176.1| PREDICTED: uncharacterized protein LOC101259449 [Solanum lycopersicum]
Length=334

 Score =   198 bits (503),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 146/301 (49%), Positives = 188/301 (62%), Gaps = 33/301 (11%)
 Frame = +1

Query  94   KVRSICSMETPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsq------  255
            K  S   M+    I+RRSIF FLQ Y ++TTIA  LAFPFAAS LLLQ+ +PS       
Sbjct  2    KDYSSVPMQGSGKIIRRSIFIFLQNYQFYTTIAAVLAFPFAASVLLLQAFVPSTCFLLAI  61

Query  256  -----ipiihsllpsssilfsilHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMST  420
                        LPSSS LF++L++KLS T AIS LAFP TL+S LF KASVI AL  S 
Sbjct  62   HDHLHSLFDAVGLPSSSKLFTLLNSKLSQTFAISFLAFPFTLTSLLFAKASVIEAL--SD  119

Query  421  NQECPWPSFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS----  567
             +    P+F     L+  L+ TQ+CN++  +S+       LF  FN+ +YG  LSS    
Sbjct  120  QKSFKKPAFFSFCSLYSSLLLTQLCNTIVIISANATCFTLLFFTFNIFNYGFNLSSPSPI  179

Query  568  LFFSAIGALVFSLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALP  726
            LF SA GA++ S+I       CNLAL+LS  +  GG+ A+LKAC LIK + ATALSLA+ 
Sbjct  180  LFISATGAIICSIISASTLIICNLALVLSGLENIGGYMAILKACFLIKGKNATALSLAVI  239

Query  727  INATMAAVEALFQYRVVRAYHDD--GVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCE  900
             N   AAVE L+QYR+V++YH    G  + ALEG+FIAYLYA+L+VLDTI +  FF  C+
Sbjct  240  FNLAFAAVEVLYQYRIVKSYHHKRTGFSAIALEGMFIAYLYAILLVLDTISSCLFFECCK  299

Query  901  E  903
            +
Sbjct  300  K  300



>ref|XP_008393355.1| PREDICTED: uncharacterized protein LOC103455546 [Malus domestica]
Length=324

 Score =   195 bits (495),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 137/311 (44%), Positives = 190/311 (61%), Gaps = 46/311 (15%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsssi  294
            ME    I+R+S+ TFL  Y YFT+IA  +A PF+AS L+ Q+LLPS   ++ ++      
Sbjct  1    MEKAGRIIRKSVHTFLLNYQYFTSIAAVIALPFSASVLISQALLPSSFALLXAVYNRLHS  60

Query  295  lf------------silHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECP-  435
            LF            +IL+ KLS TI  S+  FP +L+  L  KA VI +L   ++ + P 
Sbjct  61   LFDXAGFPPSLEFFTILNNKLSQTITSSIFTFPFSLTFLLITKAFVIQSL---SHHQKPN  117

Query  436  ---WPSFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS----LF  573
                PSF     L+ PL+HT + NS   LS+       LFIAFN+ + GLG SS    LF
Sbjct  118  TSSHPSFLSTISLYTPLLHTHVYNSFLILSANATVFSLLFIAFNVLE-GLGFSSPNTLLF  176

Query  574  FSAIGALVFSL-------ICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPIN  732
             S  GA+++S+       ICNLAL+LS  QK GG+ A+LKAC+LI+ R +TAL LALP++
Sbjct  177  LSVSGAVLYSIVLXNALIICNLALVLSGAQKSGGYLAILKACLLIRGRTSTALCLALPVS  236

Query  733  ATMAAVEALFQYRVVRAYHDDGVF--SAALEGLFIAYLYALLIVLDTIVAYFFFTTCE--  900
             T+AAVEALFQYR+VRAYH  G    S A+EG+F+AYLY++L+VLD  V++ F  +C+  
Sbjct  237  LTLAAVEALFQYRIVRAYHFAGKLGSSMAMEGVFLAYLYSILVVLDITVSFMFLQSCKPS  296

Query  901  ----EHKDGRK  921
                EH+D  +
Sbjct  297  SRRIEHRDDXE  307



>ref|XP_007037439.1| Uncharacterized protein TCM_014112 [Theobroma cacao]
 gb|EOY21940.1| Uncharacterized protein TCM_014112 [Theobroma cacao]
Length=340

 Score =   195 bits (496),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 139/332 (42%), Positives = 189/332 (57%), Gaps = 48/332 (14%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsssi  294
            ME  S I+RRSI+TFLQ YHY T  A  LAFP++AS LL Q  +PS   +         +
Sbjct  16   MEKASKIIRRSIYTFLQNYHYLTATAALLAFPYSASILLSQLFVPSSPLLPTIHNRLRIL  75

Query  295  lfsilHT-----------KLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECP--  435
              +               K+S TI+ S+ A P TLS  L  KAS+I  L    N   P  
Sbjct  76   FQAAGFPPSSEFFTVLSFKISQTISSSIFALPFTLSFLLIAKASIIQLL----NHHKPNL  131

Query  436  WPSFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS----LFFSA  582
             PSFS +  L+ PL+ T ICN L  LS+       LF AFN  + G G +S    LF SA
Sbjct  132  PPSFSSVISLYKPLLATYICNFLLLLSANATAFSLLFFAFNFLE-GFGFTSPSWLLFLSA  190

Query  583  IGALVFS-------LICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATM  741
             GA+++S       +ICNLAL+ S  ++ GG+ A+LKACVLI+ R +TAL+LA+P+N  +
Sbjct  191  AGAVLYSIILANALIICNLALVSSGMERSGGYMAILKACVLIRGRTSTALTLAVPVNLVL  250

Query  742  AAVEALFQYRVVRAYHDDGV--FSAALEGLFIAYLYALLIVLDTIVAYFFFTTCEE----  903
            AA+EALF YRVVRA+H   V  F  A EG+ IA+LY+  +VLDT+V+  FF +C+     
Sbjct  251  AAIEALFHYRVVRAFHTGDVTSFPMASEGILIAFLYSTFVVLDTVVSCMFFKSCKTGSLV  310

Query  904  HKDGRK----KIAQDQSLACSCRSIKIVEGLP  987
             ++GR     +IA++   A     +K +E LP
Sbjct  311  EQEGRHSYRIEIAEEDGNAYV--KLKNIEQLP  340



>ref|XP_011012575.1| PREDICTED: uncharacterized protein LOC105116791 [Populus euphratica]
Length=319

 Score =   194 bits (493),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 126/288 (44%), Positives = 179/288 (62%), Gaps = 30/288 (10%)
 Frame = +1

Query  112  SMETPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsss  291
            S+ T S I+R+SI+T+LQ YHY+T  +  LAFPF+AS+L  Q LL S    + +++ +  
Sbjct  5    SIRTGSKIMRKSIYTYLQNYHYYTLTSALLAFPFSASSLFAQLLLVSPSSSLLAIIYNRL  64

Query  292  -------ilfsilHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWPSFS  450
                    L  +++ KLS TI+  +L  P   + FL  KASVI  +    N+  P PSF 
Sbjct  65   NRFPYSWELIDLVNLKLSQTISFFILTLPLNSTLFLIAKASVIQVV----NRHKP-PSFC  119

Query  451  CLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSSLFFSAIGALVFSLI  609
            C+F +  PL+ T + NSL  LS+       L IAFN     +G  SLF SA GA+V+S+I
Sbjct  120  CIFSIFNPLLLTYVSNSLLILSANATAFCLLSIAFNPFHDHIGFGSLFLSAAGAVVYSII  179

Query  610  -------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAVEALFQY  768
                   CNLAL++S  ++ GG+ A+LKACV+I+ R +TALSL L +N  +A VEALFQY
Sbjct  180  LANVIIICNLALVISGMERFGGYLAILKACVMIRGRASTALSLTLAVNTALAGVEALFQY  239

Query  769  RVVRAYHDDGVFSAAL----EGLFIAYLYALLIVLDTIVAYFFFTTCE  900
            R+VRAY D G   ++L    EG+ I YLY++L+VLDTI++  FF +C+
Sbjct  240  RIVRAYDDIGETPSSLLIISEGMLIVYLYSILVVLDTIISCIFFKSCK  287



>gb|KEH31964.1| transmembrane protein, putative [Medicago truncatula]
Length=324

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 132/307 (43%), Positives = 188/307 (61%), Gaps = 36/307 (12%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllp----  282
            ME    ILRRSI +FLQ YHYFT+   FL FPF+AS L+ Q+ +PS   ++  +      
Sbjct  1    MEVSCKILRRSIHSFLQNYHYFTSSIAFLVFPFSASILISQAFVPSPSSLLPQIYNRLRT  60

Query  283  --------sssilfsilHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPW  438
                    S S+LF+IL+ K+S TI  S+ + P TL+  L  KAS+IHAL ++ N+    
Sbjct  61   LFDAAGFPSYSLLFNILNLKVSQTITCSIFSLPFTLTVLLIAKASIIHALKLNHNKPSLP  120

Query  439  PSFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS----LFFSAI  585
            PSFS +  L+ PL HT ICN    +S+       +F+AF+  +  LG SS    LF SA 
Sbjct  121  PSFSSIIALYKPLFHTYICNCFLIISANATSFCIMFLAFSFVE-TLGYSSPSFLLFMSAT  179

Query  586  GALVFSLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMA  744
            GA++FS+I       CN++L+LS  +  GG++A+LKAC+LI+ + + AL LALP+N  +A
Sbjct  180  GAILFSVILANALVICNMSLVLSGMEGHGGYSAILKACILIRGKTSMALFLALPVNIALA  239

Query  745  AVEALFQYRVVRAYHDDGVFSAA--LEGLFIAYLYALLIVLDTIVAYFFFTTCEEHKDGR  918
            A+EALF +R+VR YH  G       LEG+FIAYLY++ I+LDTIV+  F+   +  K G 
Sbjct  240  AIEALFHFRIVREYHIVGKARPIVLLEGIFIAYLYSIFIILDTIVSCLFY---KSFKTGE  296

Query  919  KKIAQDQ  939
              I+Q+ 
Sbjct  297  SWISQED  303



>ref|XP_006374437.1| hypothetical protein POPTR_0015s07190g [Populus trichocarpa]
 gb|ERP52234.1| hypothetical protein POPTR_0015s07190g [Populus trichocarpa]
Length=308

 Score =   192 bits (487),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 134/309 (43%), Positives = 185/309 (60%), Gaps = 42/309 (14%)
 Frame = +1

Query  118  ETPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsssil  297
            ET S ILR+SIFTFLQ Y YFT+ A  LAFPF+AS LL   LL S   ++  +    + L
Sbjct  3    ETGSKILRKSIFTFLQNYQYFTSTAALLAFPFSASILLAHLLLDSSSSLLPVIYHRLTSL  62

Query  298  ------------fsilHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWP  441
                         ++++ KLS TI++S+L  P  L+  L  KASVI AL  + N + P P
Sbjct  63   FQAAGFPPSSELLNLVNLKLSQTISLSILTLPFALTFLLIMKASVIQAL--NNNHKKP-P  119

Query  442  SFSCLFKLHIPLIHTQICNSLFTLSSLFIAFNL---------ADYGLGLSSLFFSAIGAL  594
            SF C+F +  PL+ T ICNSL  LS+   AF+L          + G G   LF SA GA+
Sbjct  120  SFYCVFSIFNPLLLTYICNSLLILSANATAFSLLFFTSNLFLENIGFGFH-LFLSAAGAV  178

Query  595  VFSLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAVE  753
            V+S+I       CNLAL+LS  ++ GG+ A+LKACV+I+ R +TALSLAL +N  +A VE
Sbjct  179  VYSIILSHTIIICNLALVLSGVERIGGYLAILKACVMIRGRASTALSLALAVNIALAGVE  238

Query  754  ALFQYRVVRAYHDDGVFSAAL----EGLFIAYLYALLIVLDTIVAYFFFTTCE------E  903
            ALF+YR+VR Y       ++L    EG  I YLY++L+VL+TIV+  FF +C+      +
Sbjct  239  ALFRYRIVRTYRHIREAPSSLSIISEGTLIIYLYSILVVLETIVSCIFFKSCKATYSCID  298

Query  904  HKDGRKKIA  930
             ++ R K+A
Sbjct  299  QQEQRTKMA  307



>ref|XP_004499518.1| PREDICTED: uncharacterized protein LOC101505783 [Cicer arietinum]
Length=332

 Score =   191 bits (485),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 133/297 (45%), Positives = 183/297 (62%), Gaps = 36/297 (12%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllp----  282
            ME    ILRRS+ +FLQ YHYFTT   FLAFPF+AS LL Q+L+P    +   +      
Sbjct  1    MELSYKILRRSVHSFLQNYHYFTTTIVFLAFPFSASILLSQALVPFSSSLYPQIYNHLKI  60

Query  283  --------sssilfsilHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPW  438
                    SSS +F++L+ K+S TI  S+   P TL+ FL  K+ +I A+ M+ ++E   
Sbjct  61   LFDAAGFPSSSQIFTLLNLKVSQTITSSIFTLPFTLTFFLITKSFIIQAMKMNNHKENLQ  120

Query  439  PSFSCLFKLHI-PLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS----LFFSA  582
            PSF  +   H  PL  T I N+ F LS+       LF+ F+ A+ GLG SS    LF +A
Sbjct  121  PSFVDIISYHYKPLFQTYIYNTFFLLSANASTFCFLFLVFSFAE-GLGNSSPSLTLFVTA  179

Query  583  IGALVFSLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATM  741
              A+ FS+I        N+AL LS     GG+ A+LKACVL++ R +TAL LALPIN ++
Sbjct  180  AAAVFFSVILANALVISNMALTLSGMDGHGGYMAILKACVLLRGRTSTALFLALPINVSL  239

Query  742  AAVEALFQYRVVRAYHDDGVFSA----ALEGLFIAYLYALLIVLDTIVAYFFFTTCE  900
            AA+EALFQ+RVVR YH+ G  S+     LEG+FIAYLY++ I++DTIV+Y F+ +C+
Sbjct  240  AAIEALFQFRVVRGYHNIGGKSSWFFLGLEGIFIAYLYSIFIIIDTIVSYMFYKSCK  296



>ref|XP_004508715.1| PREDICTED: uncharacterized protein LOC101499112 [Cicer arietinum]
Length=322

 Score =   189 bits (479),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 131/310 (42%), Positives = 188/310 (61%), Gaps = 37/310 (12%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllp----  282
            ME    ILRRS+ +FLQ YHYFT+   F  FPF+AS L+ Q+L+PS   ++  +      
Sbjct  1    MEVSCKILRRSVHSFLQNYHYFTSSIAFFVFPFSASILISQALVPSPSSLLPQIYNRLRI  60

Query  283  --------sssilfsilHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPW  438
                    SSSILF+IL+ K+S TI  S+ + P TL+  L  KAS+I AL ++ N+    
Sbjct  61   LFDAAGFPSSSILFNILNLKVSQTITCSIFSLPFTLTFLLIAKASIIQALKLNHNKPSLP  120

Query  439  PSFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS----LFFSAI  585
            PSF+ +  L+ PL HT ICN    +S+       LF+AF+  + GLG SS    +F SA 
Sbjct  121  PSFASIIALYKPLFHTYICNCFLIISANATAFCFLFLAFSFME-GLGYSSSRLLIFMSAF  179

Query  586  GALVFSLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMA  744
            GA++FS+I       CN++L LS  +  GG++A+LKAC+ ++ + + AL LALP+N  +A
Sbjct  180  GAVLFSVILANALVICNMSLALSGMEGHGGYSAILKACIFVRGKTSMALFLALPVNVALA  239

Query  745  AVEALFQYRVVRAYHDDGVFS-AALEGLFIAYLYALLIVLDTIVAYFFFTTCE-----EH  906
            A+EALFQ+RVVRAYH          EG+FIAYLY++ I+LDTIV+  F+ + +      H
Sbjct  240  AIEALFQFRVVRAYHVGKARPFVVFEGIFIAYLYSIFIILDTIVSCLFYKSFKTRSWINH  299

Query  907  KDGRKKIAQD  936
            +DG  +   D
Sbjct  300  QDGHFQDEND  309



>gb|KDP31291.1| hypothetical protein JCGZ_11667 [Jatropha curcas]
Length=341

 Score =   189 bits (479),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 131/304 (43%), Positives = 174/304 (57%), Gaps = 36/304 (12%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIATFLAFPFA-------------ASTlllqsllpsq  255
            ME  S I+RRSI+TFLQ YHYFT+ A  LAFPF+             +STLL       Q
Sbjct  9    MEKTSRIIRRSIYTFLQNYHYFTSTAALLAFPFSISILLSQTLLVPSSSTLLSTLYTHLQ  68

Query  256  ipiihsllpsssilfsilHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECP  435
                 +  P S   F+IL+ K+S TI+ S+   P TLS FL  KA VI AL         
Sbjct  69   KLFQAAGFPPSLEFFNILNAKISQTISSSIFTLPFTLSFFLLAKALVIQALNYIPKPILT  128

Query  436  WPSFSCLFKLHIPLIHTQICNSLFTLSSLFIAFNLADY------GLGLSS----LFFSAI  585
             PSFS +  +  PL+ T ICN    +S+   AF           G G  S    L  SA 
Sbjct  129  PPSFSSIISIFNPLLVTYICNIFLIVSANATAFFFLFLSFNFLEGFGFGSPTGFLLLSAA  188

Query  586  GALVFSLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMA  744
            GA+ +S+I       CNL+L+LS T+K GGF ++LKACV+I  + +TALSLALP+N  +A
Sbjct  189  GAVFYSIILANALVICNLSLVLSGTEKSGGFLSILKACVMISGKTSTALSLALPVNLALA  248

Query  745  AVEALFQYRVVRAYHDDGVFSA--ALEGLFIAYLYALLIVLDTIVAYFFFTTCEE----H  906
             +EALFQYR+VRAY      ++   LEG+ IAYLY++ +VLDTIV++FFF +C+      
Sbjct  249  GIEALFQYRIVRAYQKGSTPNSLMILEGMLIAYLYSVFLVLDTIVSFFFFKSCKASSCID  308

Query  907  KDGR  918
            ++GR
Sbjct  309  QEGR  312



>ref|XP_011101971.1| PREDICTED: uncharacterized protein LOC105180005 [Sesamum indicum]
Length=325

 Score =   187 bits (474),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 143/302 (47%), Positives = 180/302 (60%), Gaps = 36/302 (12%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllp-----------sqip  261
            M     +LRRSIF+FLQ Y YFT+    LAFPFA STLL QSL+                
Sbjct  1    MGKAGAVLRRSIFSFLQNYQYFTSTPALLAFPFAVSTLLSQSLVSSSSLFPLVHGRLSSL  60

Query  262  iihsllpsssilfsilHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWP  441
             + +  P SS LF++L  KLS TI       P T S  L  KAS+I A  +  ++    P
Sbjct  61   FLAAGFPPSSELFTVLGLKLSQTILTFFFVCPFTFSFLLLAKASIIKA--VGPHKPAEQP  118

Query  442  SFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGL----SSLFFSAIG  588
            SFS    L  PL+ TQ+CNSL  L++       L I FNL D  LGL    S L  SA G
Sbjct  119  SFSSWIPLFCPLLITQLCNSLVILAANATCFFLLVIFFNLFDI-LGLLSPRSQLLLSATG  177

Query  589  ALVFSLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAA  747
            A+++S+I       CNLAL+L+  +KRGGF ++LKACVLI+ R ATALSLA+PIN  +AA
Sbjct  178  AVIYSIILANAYITCNLALVLAGIEKRGGFISILKACVLIQGRTATALSLAVPINMALAA  237

Query  748  VEALFQYRVVRAYHD-DGVFSAA-LEGLFIAYLYALLIVLDTIVAYFFFTTCEE--HKDG  915
            +EALFQYRV+ AYH   G  SA  LEG+F+ YLYALLIVLDT+V   F+ +C+   H D 
Sbjct  238  IEALFQYRVMSAYHRAKGPDSAMLLEGMFVGYLYALLIVLDTVVGCVFWRSCKTDFHTDR  297

Query  916  RK  921
             +
Sbjct  298  EE  299



>ref|XP_011006296.1| PREDICTED: uncharacterized protein LOC105112322 [Populus euphratica]
Length=332

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 134/293 (46%), Positives = 178/293 (61%), Gaps = 36/293 (12%)
 Frame = +1

Query  118  ETPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsll------  279
            ET S ILR+SIFTFLQ Y YFT+ A  LAFPF+AS LL   LL S   ++  +       
Sbjct  10   ETGSKILRKSIFTFLQNYQYFTSTAALLAFPFSASILLAHLLLDSSSSLLPVIYHRLTSL  69

Query  280  ------psssilfsilHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWP  441
                  PSSS L ++++ KLS TI +S+L  P  L+  L  KASVI AL  + N + P P
Sbjct  70   FQAAGFPSSSELLNLVNLKLSQTITLSILTLPFALTFLLIMKASVIQAL--NNNHKKP-P  126

Query  442  SFSCLFKLHIPLIHTQICNSLFTLSSLFIAFNL---------ADYGLGLSSLFFSAIGAL  594
            SF C+F +  PL+ T ICNSL  LS+   AF+L          + G G   LF SA GA+
Sbjct  127  SFYCVFSIFNPLLLTYICNSLLILSANATAFSLLFFTSNLFLENIGFGFH-LFLSAAGAV  185

Query  595  VFSLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAVE  753
            V+S+I       CNLAL+LS  ++ GG+ A+LKACV+I+ R +TALSLA+ +N  +A VE
Sbjct  186  VYSIILSHTIIICNLALVLSGVERIGGYLAILKACVMIRGRASTALSLAIAVNIALAGVE  245

Query  754  ALFQYRVVRA----YHDDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCE  900
            ALF+YR+VRA           S   EG  I YLY++L+VL+TIV+  FF +C+
Sbjct  246  ALFRYRIVRACRHIREAQSNLSIISEGTLIIYLYSILVVLETIVSCIFFKSCK  298



>ref|XP_004236481.1| PREDICTED: uncharacterized protein LOC101262301 [Solanum lycopersicum]
Length=332

 Score =   184 bits (467),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 131/298 (44%), Positives = 179/298 (60%), Gaps = 37/298 (12%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIAT-----------FLAFPFAASTlllqsllpsqip  261
            ME  + I+R+SIF FLQ Y +FTT              FL     +S+L         + 
Sbjct  9    MEKTTKIIRKSIFIFLQNYQFFTTTTAFFAFPFAASVLFLQSFIYSSSLYPIIYERLHLL  68

Query  262  iihsllpsssilfsilHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWP  441
               +  PSSS  F +L++K+S TI IS L+FP T+S +LF K+ VI +L  S       P
Sbjct  69   FDAAGFPSSSEFFILLNSKISQTILISFLSFPFTISFYLFAKSVVIESLKYSK------P  122

Query  442  SFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS----LFFSAIG  588
            S    F  +  L+ TQ+CNSL  +S+       LF  FNL DYG GLS+    L  SA G
Sbjct  123  SQRTTFPSYFNLLVTQLCNSLLIISANATCFTLLFFGFNLFDYGFGLSNPRTILLLSATG  182

Query  589  ALVFSLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAA  747
            A++ S+I       CNLAL+ S  ++ GGF A+LK+CVLI+ R ATALSLA+P+N  +AA
Sbjct  183  AVLCSIILANTLIICNLALVTSGNERIGGFMAILKSCVLIRGRTATALSLAVPVNLALAA  242

Query  748  VEALFQYRVVRAYHDDG--VFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCEEHKDG  915
            VEALFQYR+V AY+ +   +F+ ALEG+FIAY+Y+LLIVLDTI +  F+ +C+  + G
Sbjct  243  VEALFQYRIVNAYYQEKTELFTLALEGMFIAYIYSLLIVLDTIASCVFYKSCKTEEHG  300



>ref|XP_008445049.1| PREDICTED: uncharacterized protein LOC103488179 [Cucumis melo]
Length=327

 Score =   184 bits (467),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 127/304 (42%), Positives = 176/304 (58%), Gaps = 35/304 (12%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsssi  294
            M   ++I+RRSIF FLQKY YFT+ +   AFPF+ S LL Q+ + +    +   +     
Sbjct  1    MGKTNSIIRRSIFCFLQKYQYFTSASALYAFPFSVSLLLSQTFVFTSSISLLDNIYYHLK  60

Query  295  lfsilHT----------KLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWPS  444
            +                KLS TI  S+   P TL+  L  KASVI AL     +    PS
Sbjct  61   IVFDAAVFPSSLEFFIQKLSQTIFSSIFTIPFTLTFLLVAKASVIQAL--KETKSTSQPS  118

Query  445  FSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFN-LADYGLGLSS--LFFSAIGAL  594
            FS +  L+ PL  T ICNS+F LS+       LF AF  L ++G   S+  L+ SA GA+
Sbjct  119  FSSIKSLYCPLFLTNICNSIFILSANATVFSILFFAFTCLQEFGFSSSTNFLYLSAAGAV  178

Query  595  VFSL-------ICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAVE  753
            ++S+       I NL+L+LS  +K GG+ A+LKACV+I+ + +TAL LALP N  MAA+E
Sbjct  179  LYSIVLANTLVISNLSLVLSGMEKLGGYLAILKACVVIRGKTSTALLLALPTNLAMAAIE  238

Query  754  ALFQYRVVRAYHDDGVFSAAL--EGLFIAYLYALLIVLDTIVAYFFFTTCEE----HKDG  915
            ALFQYRVVRAY+  G+ S ++  EG+ IAYLY++ IVLDT V   FF  C++      +G
Sbjct  239  ALFQYRVVRAYNGVGILSLSMLFEGVIIAYLYSIFIVLDTTVCCMFFMNCKKVFWVDLEG  298

Query  916  RKKI  927
            R+ +
Sbjct  299  RQAL  302



>ref|XP_004137590.1| PREDICTED: uncharacterized protein LOC101220892 [Cucumis sativus]
 ref|XP_004157497.1| PREDICTED: uncharacterized LOC101220892 [Cucumis sativus]
 gb|KGN64022.1| hypothetical protein Csa_1G038890 [Cucumis sativus]
Length=327

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 125/304 (41%), Positives = 177/304 (58%), Gaps = 35/304 (12%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsssi  294
            M   ++I+RRSIF FLQKY YFT+++   AFPF+ + LL Q+ + +    +   +     
Sbjct  1    MGKTNSIIRRSIFCFLQKYQYFTSVSALYAFPFSVALLLSQTFVFTSSISLLDNIYYHMK  60

Query  295  lfsilH----------TKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWPS  444
            +                KLS TI  S+   P TL+  L  KASVI AL     +    PS
Sbjct  61   IVFDAAAFPSSLEFFIQKLSQTIFSSIFTIPFTLTFLLIAKASVIQAL--KETKSTSQPS  118

Query  445  FSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFN-LADYGLGLSS--LFFSAIGAL  594
            FS +  L+ P+  T ICNS+F LS+       LF AF  L ++G   S+  L+ SA GA+
Sbjct  119  FSSIKSLYSPIFLTNICNSIFILSANATVFSILFFAFACLQEFGFSSSTHFLYLSAAGAV  178

Query  595  VFSL-------ICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAVE  753
            ++S+       I NL+L+LS  +K GG+ A+LKACV+I+ + +TAL LALP N  MAA+E
Sbjct  179  LYSIVLANTLVISNLSLVLSGMEKLGGYLAILKACVVIRGKTSTALLLALPTNLAMAAIE  238

Query  754  ALFQYRVVRAYHDDGVFSAAL--EGLFIAYLYALLIVLDTIVAYFFFTTCEE----HKDG  915
            ALFQYRVVRAY+  G+ S ++  EG+ IAYLY++ IVLDT V   FF  C++      +G
Sbjct  239  ALFQYRVVRAYNGVGILSLSMLFEGVIIAYLYSVFIVLDTTVCCMFFMNCKKVFWVDLEG  298

Query  916  RKKI  927
            R+ +
Sbjct  299  RQAL  302



>gb|ACU19969.1| unknown [Glycine max]
Length=323

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 135/309 (44%), Positives = 183/309 (59%), Gaps = 42/309 (14%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsssi  294
            ME    ILRRS  TFLQ YH+FT+ A FLAFPF+AS LL Q+L+PS   ++  +      
Sbjct  1    MEVSCKILRRSTHTFLQNYHHFTSTAAFLAFPFSASILLSQALVPSPSSLLPQIYSRLRT  60

Query  295  -----------lfsilHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPW-  438
                       LF+IL+ K+S TI  S+LA P TL+  L  KAS+I AL    N   P  
Sbjct  61   LFDAAGFPSSHLFTILNLKVSQTITSSILALPFTLTFLLIAKASIIQAL----NHHKPTF  116

Query  439  -PSFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS-----LFFS  579
             PSF  +  L+ PL+HT  CN    LS+       +F+AF+  +  LG SS     LF S
Sbjct  117  PPSFKSILSLYKPLLHTYFCNRFLILSANATAFGLMFLAFSFIER-LGYSSPTGLTLFIS  175

Query  580  AIGALVFS-------LICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINAT  738
              GA++FS       +IC++AL LS  +  GG+ A+LKAC+L++ R + AL LALP+N  
Sbjct  176  VTGAILFSVILANALVICSMALALSGMEGHGGYLAILKACLLLRGRTSMALFLALPVNVA  235

Query  739  MAAVEALFQYRVVRAYHDDGVFS--AALEGLFIAYLYALLIVLDTIVAYFFFTTCEEHKD  912
            +AA+EALFQ+RVVR YH  G+     ALEG+FIAYLY++ I+LDTIV+  F+ +    K 
Sbjct  236  LAAIEALFQFRVVRPYHIAGIARPCVALEGIFIAYLYSIFIILDTIVSCIFYKSL---KT  292

Query  913  GRKKIAQDQ  939
            G     +D+
Sbjct  293  GSWISQEDK  301



>gb|KHN18574.1| hypothetical protein glysoja_006987 [Glycine soja]
Length=324

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 135/306 (44%), Positives = 182/306 (59%), Gaps = 45/306 (15%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllps---  285
            ME    ILRRS  +FLQ YHYFT+ A FLAFPF+AS LL Q+L+PS   ++  +      
Sbjct  1    MEVSCKILRRSTHSFLQNYHYFTSTAAFLAFPFSASILLSQALVPSPSSLLPQIYSRLRT  60

Query  286  --------ssilfsilHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPW-  438
                    SS LF+IL+ K+S TI  S+L  P TL+  L  KAS+I AL    N   P  
Sbjct  61   LFDAAGFPSSQLFTILNLKVSQTITSSILTLPFTLTFLLIAKASIIQAL----NHHKPTF  116

Query  439  -PSFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS------LFF  576
             PSF  +  L+ PL+HT  CN    LS+       +F AF+  +  LG SS      LF 
Sbjct  117  PPSFKSILSLYKPLLHTYFCNCFLILSANASAFGLMFSAFSFIER-LGYSSSPSGLILFM  175

Query  577  SAIGALVFSLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINA  735
            S  GA++FS+I       CN+AL LS  +  GG+ A+LKAC+L++ R + AL LALP+N 
Sbjct  176  SVTGAILFSVILANAIVICNMALALSGMEGHGGYLAILKACLLLRGRTSMALFLALPVNV  235

Query  736  TMAAVEALFQYRVVRAYHDDGVFSA--ALEGLFIAYLYALLIVLDTIVAYFFFTTCEE--  903
             +AA+EALFQ+RVVR YH  G+     ALEG+FIAYLY++ I+LDT+V+  F+ + +   
Sbjct  236  ALAAIEALFQFRVVRPYHVAGITRPCVALEGIFIAYLYSIFIILDTVVSCMFYKSLKTGP  295

Query  904  ---HKD  912
               H+D
Sbjct  296  LIGHED  301



>ref|XP_003549689.1| PREDICTED: uncharacterized protein LOC100819933 [Glycine max]
Length=324

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 135/306 (44%), Positives = 182/306 (59%), Gaps = 45/306 (15%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllps---  285
            ME    ILRRS  +FLQ YHYFT+ A FLAFPF+AS LL Q+L+PS   ++  +      
Sbjct  1    MEVSCKILRRSTHSFLQNYHYFTSTAAFLAFPFSASILLSQALVPSPSSLLPQIYSRLRT  60

Query  286  --------ssilfsilHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPW-  438
                    SS LF+IL+ K+S TI  S+L  P TL+  L  KAS+I AL    N   P  
Sbjct  61   LFDAAGFPSSQLFTILNLKVSQTITSSILTLPFTLTFLLIAKASIIQAL----NHHKPTF  116

Query  439  -PSFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS------LFF  576
             PSF  +  L+ PL+HT  CN    LS+       +F AF+  +  LG SS      LF 
Sbjct  117  PPSFKSILSLYKPLLHTYFCNCFLILSANASAFGLMFSAFSFIER-LGYSSSPSGLILFM  175

Query  577  SAIGALVFSLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINA  735
            S  GA++FS+I       CN+AL LS  +  GG+ A+LKAC+L++ R + AL LALP+N 
Sbjct  176  SVTGAILFSVILANAIVICNMALALSGMEGHGGYLAILKACLLLRGRTSMALFLALPVNV  235

Query  736  TMAAVEALFQYRVVRAYHDDGVFSA--ALEGLFIAYLYALLIVLDTIVAYFFFTTCEE--  903
             +AA+EALFQ+RVVR YH  G+     ALEG+FIAYLY++ I+LDT+V+  F+ + +   
Sbjct  236  ALAAIEALFQFRVVRPYHIAGITRPCVALEGIFIAYLYSIFIILDTVVSCMFYKSLKTGP  295

Query  904  ---HKD  912
               H+D
Sbjct  296  LIGHED  301



>ref|XP_003524748.2| PREDICTED: uncharacterized protein LOC100809875 [Glycine max]
Length=357

 Score =   183 bits (464),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 138/314 (44%), Positives = 186/314 (59%), Gaps = 43/314 (14%)
 Frame = +1

Query  100  RSICSMETPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsll  279
            RSI  ME    ILRRS  TFLQ YH+FT+ A FLAFPF+AS LL Q+L+PS   ++  + 
Sbjct  31   RSI-PMEVSCKILRRSTHTFLQNYHHFTSTAAFLAFPFSASILLSQALVPSPSSLLPQIY  89

Query  280  psssi-----------lfsilHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQ  426
                            LF+IL+ K+S TI  S+LA P TL+  L  KAS+I AL    N 
Sbjct  90   SRLRTLFDAAGFPSSHLFTILNLKVSQTITSSILALPFTLTFLLIAKASIIQAL----NH  145

Query  427  ECPW--PSFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS----  567
              P   PSF  +  L+ PL+HT  CN    LS+       +F+AF+  +  LG SS    
Sbjct  146  HKPTFPPSFKSILSLYKPLLHTYFCNCFLILSANATAFGLMFLAFSFIER-LGYSSPTGL  204

Query  568  -LFFSAIGALVFS-------LICNLALILSATQKRGGFTALLKACVLIKTRIATALSLAL  723
             LF S  GA++FS       +IC++AL LS  +  GG+ A+LKAC+L++ R + AL LAL
Sbjct  205  TLFISVTGAILFSVILANALVICSMALALSGMEGHGGYLAILKACLLLRGRTSMALFLAL  264

Query  724  PINATMAAVEALFQYRVVRAYHDDGVFSA--ALEGLFIAYLYALLIVLDTIVAYFFFTTC  897
            P+N  +AA+EALFQ+RVVR YH  G+     ALEG+FIAYLY++ I+LDTIV+  F+ + 
Sbjct  265  PVNVALAAIEALFQFRVVRPYHIAGIARPCVALEGIFIAYLYSIFIILDTIVSCIFYKSL  324

Query  898  EEHKDGRKKIAQDQ  939
               K G     +D+
Sbjct  325  ---KTGSWISQEDK  335



>gb|KHN48705.1| hypothetical protein glysoja_015853 [Glycine soja]
Length=323

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 135/309 (44%), Positives = 183/309 (59%), Gaps = 42/309 (14%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsssi  294
            ME    ILRRS  TFLQ YH+FT+ A FLAFPF+AS LL Q+L+PS   ++  +      
Sbjct  1    MEVSCKILRRSTHTFLQNYHHFTSTAAFLAFPFSASILLSQALVPSPSSLLPQIYSRLRT  60

Query  295  -----------lfsilHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPW-  438
                       LF+IL+ K+S TI  S+LA P TL+  L  KAS+I AL    N   P  
Sbjct  61   LFDAAGFPSSHLFTILNLKVSQTITSSILALPFTLTFLLIAKASIIQAL----NHHKPTF  116

Query  439  -PSFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS-----LFFS  579
             PSF  +  L+ PL+HT  CN    LS+       +F+AF+  +  LG SS     LF S
Sbjct  117  PPSFKSILSLYKPLLHTYFCNCFLILSANATAFGLMFLAFSFIER-LGYSSPTGLTLFIS  175

Query  580  AIGALVFS-------LICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINAT  738
              GA++FS       +IC++AL LS  +  GG+ A+LKAC+L++ R + AL LALP+N  
Sbjct  176  VTGAILFSVILANALVICSMALALSGMEGHGGYLAILKACLLLRGRTSMALFLALPVNVA  235

Query  739  MAAVEALFQYRVVRAYHDDGVFS--AALEGLFIAYLYALLIVLDTIVAYFFFTTCEEHKD  912
            +AA+EALFQ+RVVR YH  G+     ALEG+FIAYLY++ I+LDTIV+  F+ +    K 
Sbjct  236  LAAIEALFQFRVVRPYHIAGIARPCVALEGIFIAYLYSIFIILDTIVSCIFYKSL---KT  292

Query  913  GRKKIAQDQ  939
            G     +D+
Sbjct  293  GSWISQEDK  301



>gb|AFK39790.1| unknown [Lotus japonicus]
Length=329

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 129/316 (41%), Positives = 173/316 (55%), Gaps = 42/316 (13%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIATFLAFPFAAS---------Tlllqsllpsqipii  267
            M+     LRRSI  FLQ YHYFT+ A FLAFPF+AS         T             I
Sbjct  1    MDGSGKTLRRSIHCFLQNYHYFTSTAAFLAFPFSASILLPQALVPTSSSLLPQIYNHLRI  60

Query  268  hsllpsssilfsilHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWPSF  447
                        +   K+S TI  S+   P TL+ FL  KAS I AL        P PSF
Sbjct  61   LFDAAGFPSSSQLFTRKVSQTITSSIFTLPLTLTFFLIAKASTILALNHHRQNLLP-PSF  119

Query  448  SCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS----LFFSAIGAL  594
            +CL   + P++HT I NS   LS+        F++   A+ GLG SS    LF SA  A+
Sbjct  120  NCLIHHYKPILHTYIHNSFLILSANASSFCLFFLSLTFAE-GLGYSSPSCTLFLSAATAV  178

Query  595  VFSLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAVE  753
            V S+I       CN+ALI+S  +  GG+ A+LKACVL++   + AL LALP N  +AA+E
Sbjct  179  VSSVILATALVICNMALIISGMEGHGGYMAILKACVLLRGNTSKALFLALPGNLALAAIE  238

Query  754  ALFQYRVVRAYHDDG--VFS---AALEGLFIAYLYALLIVLDTIVAYFFFTTC-------  897
            ALFQ+RVVRAYH+ G  + S    ALEG+FIAYLY++ I++DTIV+  F+ +C       
Sbjct  239  ALFQFRVVRAYHNVGNSINSWPFMALEGIFIAYLYSISIIIDTIVSCMFYKSCNMGSLVD  298

Query  898  -EEHKDGRKKIAQDQS  942
             E+    R ++A++Q+
Sbjct  299  QEDMHFSRIELAEEQN  314



>emb|CDP18310.1| unnamed protein product [Coffea canephora]
Length=335

 Score =   181 bits (459),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 137/303 (45%), Positives = 176/303 (58%), Gaps = 39/303 (13%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIATFLAF-----------PFAASTlllqsllpsqip  261
            M     I+RRSI+TFLQKY +FTT A FLAF              +S+LL       Q  
Sbjct  9    MANTVRIMRRSIYTFLQKYQFFTTTAAFLAFPFAALVLLSEASIPSSSLLQVIQKRLQSL  68

Query  262  iihsllpsssilfsilHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWP  441
               +  P SS  F IL+ KLS TIA S +  P TL+  LF KA +I       ++    P
Sbjct  69   FNAAGFPRSSEFFFILNLKLSQTIATSFVVVPFTLTFLLFAKAFIIQ--FFCNHKPTAEP  126

Query  442  SFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS----LFFSAIG  588
             F+    L+ PL  TQICN L  +S+       LF AFN  D GLGL +    L FSA G
Sbjct  127  KFASFLSLYSPLFLTQICNMLVIISANATCFCLLFFAFNCLD-GLGLLNPKMLLLFSATG  185

Query  589  ALVFSLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAA  747
            A+++S+I       CNL LILS  +  GG+ A+LKACVLI+ R ATALSLALPIN  +AA
Sbjct  186  AVLYSIILANTLIICNLGLILSGIENTGGYIAILKACVLIRGRSATALSLALPINMALAA  245

Query  748  VEALFQYRVVRAYH--DDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCE-----EH  906
            +EALFQYRVVRAYH  +  V S   EG+FIAYLY++L+VLDT+V    + +C+     + 
Sbjct  246  IEALFQYRVVRAYHHAESPVSSIVFEGMFIAYLYSVLLVLDTVVGCVLYRSCKASIQIDQ  305

Query  907  KDG  915
            ++G
Sbjct  306  ENG  308



>ref|XP_002514717.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47823.1| conserved hypothetical protein [Ricinus communis]
Length=341

 Score =   180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 131/310 (42%), Positives = 177/310 (57%), Gaps = 47/310 (15%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsssi  294
            M     I+RRSI TFLQ Y YFT+ +  LA PF+ S LL Q+LL      +   + S   
Sbjct  11   MARTGKIIRRSIHTFLQNYQYFTSGSALLALPFSVSILLSQALLVPSSNSLFPTVHSRLQ  70

Query  295  lf-------------silHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECP  435
                           +IL  KLS TI+ SV A P TL+  LF KASVI AL    N+  P
Sbjct  71   ALFRAAGFPLSSEFFTILSLKLSQTISSSVFALPFTLTFLLFAKASVIQAL----NKSKP  126

Query  436  W---PSFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS----LF  573
                PSFSC+  +  PL+ T I N+   +S+       LF++FN  + G G SS    L 
Sbjct  127  TLSSPSFSCIICIFNPLLLTYIFNTFLIISANATAFCLLFLSFNFLE-GFGFSSPNSCLL  185

Query  574  FSAIGALVFSLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPIN  732
             SA GA+++S+I       CNLAL+LS  +K GGF A LKACV+I+ R +TALSLALP +
Sbjct  186  LSAAGAVLYSIILANALITCNLALVLSGGEKSGGFMAFLKACVMIRGRTSTALSLALPAS  245

Query  733  ATMAAVEALFQYRVVRAYHDDGVFSAAL---EGLFIAYLYALLIVLDTIVAYFFFTTCE-  900
             ++A +EALFQYR+VR Y+  G  +++L   EG+ IAYLY++ IVLDT+    F  +C  
Sbjct  246  ISLAGIEALFQYRIVRPYNHRGQTASSLMVMEGMLIAYLYSVFIVLDTVATCIFLESCNR  305

Query  901  ----EHKDGR  918
                + ++GR
Sbjct  306  NSCIDQEEGR  315



>gb|KEH33432.1| transmembrane protein, putative [Medicago truncatula]
Length=324

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 132/294 (45%), Positives = 182/294 (62%), Gaps = 39/294 (13%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllp----  282
            ME    ILRRSI +FLQ Y YFT   + LAFPF+AS LL Q+L+P    +   +      
Sbjct  1    MEVSYKILRRSIHSFLQNYQYFTITISILAFPFSASILLSQALVPFSSSLFPQIYNHLKT  60

Query  283  --------sssilfsilHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPW  438
                    SSS LF++L+ K+S TI  S+   P TL+ FL  KA +I AL  + N+E   
Sbjct  61   LFDAAGFPSSSQLFTVLNLKVSQTITSSIFTLPFTLTFFLIAKAFIIQAL--NKNKENFQ  118

Query  439  PSFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS----LFFSAI  585
            PS S  +K   P++HT I N+LF LS+       LF+AF+  + GLG SS    +F SA 
Sbjct  119  PS-SYNYK---PILHTYIYNTLFILSANATTFCFLFLAFSFTE-GLGNSSSSFTVFLSAA  173

Query  586  GALVFSLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMA  744
             A++FS+I       CN+AL LS  +  GG+  +LKACV+++ R + AL LALP+N  +A
Sbjct  174  AAVLFSVILANALVICNMALTLSGVEGHGGYMTILKACVVLRGRTSMALFLALPVNVGLA  233

Query  745  AVEALFQYRVVRAYHDD--GVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCE  900
            A+EALFQ+RVVR Y+ D    F  ALEG+FIAYLY++ I++DTIV+Y F+ +C+
Sbjct  234  AIEALFQFRVVRGYYIDEKSWFFIALEGIFIAYLYSIFIIIDTIVSYMFYKSCK  287



>ref|XP_011072808.1| PREDICTED: uncharacterized protein LOC105157952 [Sesamum indicum]
Length=331

 Score =   179 bits (455),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 134/310 (43%), Positives = 178/310 (57%), Gaps = 40/310 (13%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsssi  294
            M   S I+R+SIFTFLQ + +FT+  + LA PFA S LL Q L+ S            S+
Sbjct  14   MGKASRIMRKSIFTFLQNFQFFTSAPSLLAVPFAVSALLSQPLVSSSSLFPLVHGRLRSV  73

Query  295  lfsi-----------lHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALM-MSTNQECPW  438
              +            L+ KLS T+   ++  P TLS  L  KASVI AL    T Q   +
Sbjct  74   FLAAGFPPSSELFAILNLKLSQTVLSFLIVLPFTLSFLLLAKASVIRALEHQKTAQRHAF  133

Query  439  PSFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS----LFFSAI  585
             S+  +F    PL  TQ+CNSLF LS        L I FNL D  +GLSS    L  SA 
Sbjct  134  FSWVMIFN---PLFITQLCNSLFILSVNATCFCLLIICFNLFD-AVGLSSHGPLLLLSAT  189

Query  586  GALVFS-------LICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMA  744
            GA+++S       +ICNLAL++S  +++GGF ++LKACVLI+ R ATALSLA+PIN  +A
Sbjct  190  GAIIYSIILANAYIICNLALLVSGIERQGGFNSILKACVLIRGRTATALSLAVPINMALA  249

Query  745  AVEALFQYRVVRAYH----DDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCEEHKD  912
            AVEALFQYRVVRAY      D   S  LE + IAY+YA+L+VLDTI+ + F  +C+    
Sbjct  250  AVEALFQYRVVRAYGRAMAPDS--SIVLEAMLIAYVYAILLVLDTILGFAFLKSCKPDYQ  307

Query  913  GRKKIAQDQS  942
              +   Q+++
Sbjct  308  IDEIEIQERN  317



>ref|XP_007138157.1| hypothetical protein PHAVU_009G184900g [Phaseolus vulgaris]
 gb|ESW10151.1| hypothetical protein PHAVU_009G184900g [Phaseolus vulgaris]
Length=328

 Score =   177 bits (450),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 143/334 (43%), Positives = 195/334 (58%), Gaps = 49/334 (15%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllp----  282
            ME    ILRRSI +FLQ YHYFT+   FLA PF+AS LL Q+L+P    ++  +      
Sbjct  1    MEVSCKILRRSIHSFLQNYHYFTSTVAFLALPFSASILLSQALVPVSSSLLPQIHSHLRS  60

Query  283  --------sssilfsilHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECP-  435
                    SSS LF+IL+ K+S TI  S+   P TL+  L  KAS+I AL    NQ  P 
Sbjct  61   LFDAAGFPSSSKLFTILNLKVSQTITSSIFTLPFTLTFLLIAKASIIQAL----NQHKPT  116

Query  436  WPS-FSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS----LFFS  579
            +PS F+     + PL+ T I NS F LS+       LF+AF +A+ G G SS       S
Sbjct  117  FPSSFTSTLFHYKPLLLTYIYNSFFILSANASCFCLLFLAFTVAE-GFGYSSPSSTRLMS  175

Query  580  AIGALVFSLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINAT  738
            A  A++FS+I       CN+AL +S  +K  GF A+LKACV+++ + + AL LALP N  
Sbjct  176  AAAAVLFSVILANALVICNMALTVSGMEKHRGFMAILKACVMLRGKTSMALFLALPANVG  235

Query  739  MAAVEALFQYRVVRAYHDDGVFS---AALEGLFIAYLYALLIVLDTIVAYFFFTTCE---  900
            +AA+EALFQ+RVVRAYH+ G+ S    ALEG+FIAYLY+L I++DTIV+  F+  C+   
Sbjct  236  LAAIEALFQFRVVRAYHNCGMSSWPFMALEGIFIAYLYSLFIIIDTIVSCMFYKCCKMGL  295

Query  901  --EHKDG---RKKIAQDQSLACSCRSIKIVEGLP  987
              +H+D    R +  +++   C     K  E LP
Sbjct  296  RGDHEDKILLRIEFPEEED-NCGYLVFKNFEELP  328



>ref|XP_007155283.1| hypothetical protein PHAVU_003G187900g [Phaseolus vulgaris]
 gb|ESW27277.1| hypothetical protein PHAVU_003G187900g [Phaseolus vulgaris]
Length=359

 Score =   174 bits (442),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 130/306 (42%), Positives = 182/306 (59%), Gaps = 40/306 (13%)
 Frame = +1

Query  112  SMETPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllp---  282
             ME    ILRRS  +FL  YHYFT+ A FL FPF+AS LL Q+L+P+   ++  +     
Sbjct  35   QMEVSCKILRRSTHSFLLNYHYFTSTAAFLVFPFSASILLSQALVPTPSSLLPQIYSRLR  94

Query  283  ---------sssilfsilHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECP  435
                     SSS LFSIL+ K+S TI  S+   P TL+  L  KA +I AL  + N+   
Sbjct  95   ILFDAAGFPSSSQLFSILNLKVSQTITSSIFTLPFTLTFLLIAKAFIIQAL--NHNKPTL  152

Query  436  WPSFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS-----LFFS  579
             PSF+ +  L+ PL+HT  CN    LS+       +F+AF+  +   G SS     LF S
Sbjct  153  QPSFNSILSLYKPLLHTYFCNCFLILSANATTFGLMFLAFSFIER-FGYSSPSNLILFMS  211

Query  580  AIGALVFSLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINAT  738
              GA++FS+I       CN+AL LS  +  GG+ A+LKAC+L++ R + AL LALP+N  
Sbjct  212  VAGAVLFSVILANALVICNMALALSGMEGYGGYFAILKACLLLRGRTSMALFLALPVNVA  271

Query  739  MAAVEALFQYRVVRAYHDDGVFS--AALEGLFIAYLYALLIVLDTIVAYFFFTTCEE---  903
            +AA+EALFQ+RVVR YH  G+     ALEG+FIAYLY++ I+LDTIV+  F+ + +    
Sbjct  272  LAAIEALFQFRVVRPYHIAGIAGPCVALEGIFIAYLYSIFIILDTIVSCIFYKSLKTGSW  331

Query  904  -HKDGR  918
             H++ +
Sbjct  332  IHQEDK  337



>ref|XP_006440660.1| hypothetical protein CICLE_v10020945mg [Citrus clementina]
 gb|ESR53900.1| hypothetical protein CICLE_v10020945mg [Citrus clementina]
Length=346

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 134/305 (44%), Positives = 174/305 (57%), Gaps = 44/305 (14%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsssi  294
            M   + I+RRSI+ FLQ Y +FTT    LA PFAAS LL Q+L+PS   ++  +      
Sbjct  18   MAKTTKIIRRSIYIFLQNYQHFTTTVAVLAIPFAASILLSQALVPSSSSLLPLIHNPLKT  77

Query  295  lfsil------------HTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPW  438
            LF                 KLS TI+ S+   P +L+  L  KAS+I  L     Q  P 
Sbjct  78   LFQAAGFPPSSEFFSILSLKLSQTISASIFTLPFSLTFLLLAKASIIQVL----RQHKPT  133

Query  439  --PSFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS----LFFS  579
              PSFS LF    PL HT ICNS   LS+       L IAFN  + G G SS    LF S
Sbjct  134  FPPSFSSLFSAFSPLFHTYICNSFLILSANATVFSLLLIAFNFLE-GSGFSSPNCILFLS  192

Query  580  AIGALVFSL-------ICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINAT  738
            A GA+++S+       I NLALI+S  +  GG+ A+LKACVLI+ R + ALSLALP N  
Sbjct  193  AAGAVLYSIVLANALIISNLALIISGMESCGGYLAILKACVLIRGRTSVALSLALPANLV  252

Query  739  MAAVEALFQYRVVRAYHDDGV--FSAALEGLFIAYLYALLIVLDTIVAYFFFTTCE----  900
            +A +EALFQYR+VRAY   GV   S A EG+FIAYLY++ +VLDT+++  F+ +C+    
Sbjct  253  LAGIEALFQYRIVRAYRLGGVASHSMAFEGMFIAYLYSISVVLDTVISCMFYKSCKIGSW  312

Query  901  -EHKD  912
             E +D
Sbjct  313  IEQED  317



>gb|KDO55467.1| hypothetical protein CISIN_1g019105mg [Citrus sinensis]
Length=346

 Score =   172 bits (437),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 134/305 (44%), Positives = 174/305 (57%), Gaps = 44/305 (14%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsssi  294
            M   + I+RRSI+ FLQ Y +FTT    LA PFAAS LL Q+L+PS   ++  +      
Sbjct  18   MAKTTKIIRRSIYIFLQNYQHFTTTVAVLAIPFAASILLSQALVPSSSSLLPLIHNRLKT  77

Query  295  lfsil------------HTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPW  438
            LF                 KLS TI+ S+   P +L+  L  KAS+I  L     Q  P 
Sbjct  78   LFQAAGFPPSSEFFSILSLKLSQTISSSIFTLPFSLTFLLLAKASIIQVL----RQHKPT  133

Query  439  --PSFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS----LFFS  579
              PSFS LF    PL HT ICNS   LS+       L IAFN  + G G SS    LF S
Sbjct  134  FPPSFSSLFSAFSPLFHTYICNSFLILSANATVFSLLLIAFNFLE-GSGFSSPNCILFLS  192

Query  580  AIGALVFSL-------ICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINAT  738
            A GA+++S+       I NLALI+S  +  GG+ A+LKACVLI+ R + ALSLALP N  
Sbjct  193  AAGAVLYSIVLANALIISNLALIISGMESCGGYLAILKACVLIRGRTSVALSLALPANLV  252

Query  739  MAAVEALFQYRVVRAYHDDGV--FSAALEGLFIAYLYALLIVLDTIVAYFFFTTCE----  900
            +A +EALFQYR+VRAY   GV   S A EG+FIAYLY++ +VLDT+++  F+ +C+    
Sbjct  253  LAGIEALFQYRIVRAYRLGGVASHSMAFEGMFIAYLYSISVVLDTVISCMFYKSCKIGSW  312

Query  901  -EHKD  912
             E +D
Sbjct  313  IEQED  317



>ref|XP_006494989.1| PREDICTED: uncharacterized protein LOC102626486 [Citrus sinensis]
Length=346

 Score =   172 bits (437),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 134/305 (44%), Positives = 174/305 (57%), Gaps = 44/305 (14%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsssi  294
            M   + I+RRSI+ FLQ Y +FTT    LA PFAAS LL Q+L+PS   ++  +      
Sbjct  18   MAKTTKIIRRSIYIFLQNYQHFTTTVAVLAIPFAASILLSQALVPSSSSLLPLIHNRLKT  77

Query  295  lfsil------------HTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPW  438
            LF                 KLS TI+ S+   P +L+  L  KAS+I  L     Q  P 
Sbjct  78   LFQAAGFPPSSEFFSILSLKLSQTISSSIFTLPFSLTFLLLAKASIIQVL----RQHKPT  133

Query  439  --PSFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS----LFFS  579
              PSFS LF    PL HT ICNS   LS+       L IAFN  + G G SS    LF S
Sbjct  134  FPPSFSSLFSAFSPLFHTYICNSFLILSANATVFSLLLIAFNFLE-GSGFSSPNCILFLS  192

Query  580  AIGALVFSL-------ICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINAT  738
            A GA+++S+       I NLALI+S  +  GG+ A+LKACVLI+ R + ALSLALP N  
Sbjct  193  AAGAVLYSIVLANALIISNLALIISGMESCGGYLAILKACVLIRGRTSVALSLALPANLV  252

Query  739  MAAVEALFQYRVVRAYHDDGV--FSAALEGLFIAYLYALLIVLDTIVAYFFFTTCE----  900
            +A +EALFQYR+VRAY   GV   S A EG+FIAYLY++ +VLDT+++  F+ +C+    
Sbjct  253  LAGIEALFQYRIVRAYRLGGVASHSMAFEGMFIAYLYSISVVLDTVISCMFYKSCKIGSW  312

Query  901  -EHKD  912
             E +D
Sbjct  313  IEQED  317



>ref|XP_002318598.2| hypothetical protein POPTR_0012s06990g [Populus trichocarpa]
 gb|EEE96818.2| hypothetical protein POPTR_0012s06990g [Populus trichocarpa]
Length=302

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 122/290 (42%), Positives = 169/290 (58%), Gaps = 47/290 (16%)
 Frame = +1

Query  112  SMETPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllps--  285
            S+ T S I+R+SI+T+LQ YHYFT  +  LAFPF+ASTLL   LL S    +  ++ +  
Sbjct  12   SIPTGSKIMRKSIYTYLQNYHYFTLTSALLAFPFSASTLLAHLLLVSPSSSLLPIIYNRL  71

Query  286  -----------ssilfsilHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQEC  432
                       SS L +++  KLS TI+  +L  P   + FL  KASVI  +    N+  
Sbjct  72   NSLFHAAGFPHSSELIALVSLKLSQTISFFILTLPLNSTLFLIAKASVIQVV----NRHK  127

Query  433  PWPSFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSSLFFSAIGA  591
            P PSF C+F +  PL+ T   NSL  LS+       L IAFNL    +G  SLF SA GA
Sbjct  128  P-PSFYCIFSIFNPLLLTYASNSLLILSANATAFCLLSIAFNLFHDDIGFGSLFLSAAGA  186

Query  592  LVFSLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAV  750
            +V+S+I       CNLAL++S  ++ GG+ A+LKACV+I+ R +TALS  L +N  +A V
Sbjct  187  VVYSIILANVIIICNLALVISGMERFGGYLAILKACVMIRGRASTALSPTLAVNIALAGV  246

Query  751  EALFQYRVVRAYHDDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCE  900
            EALFQYR+               G+ I YLY++L+VLDTI++  FF +C+
Sbjct  247  EALFQYRI---------------GMLIVYLYSILVVLDTIISCIFFKSCK  281



>gb|KHN45241.1| hypothetical protein glysoja_041633 [Glycine soja]
Length=327

 Score =   171 bits (433),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 134/331 (40%), Positives = 191/331 (58%), Gaps = 44/331 (13%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipii---------  267
            ME    ILRRSI +FLQ YHYFT+ A FLA PF+AS +L Q+ +P+   ++         
Sbjct  1    MEVSCKILRRSIHSFLQNYHYFTSTAAFLALPFSASIILSQAFVPASSSLLPQIHGHLRT  60

Query  268  ---hsllpsssilfsilHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPW  438
                +  PS+S LF+IL+ K+S TI  S+   P TL+  L  KAS+I AL  S ++    
Sbjct  61   LFDAAGFPSTSQLFTILNLKVSQTITSSIFTLPFTLTFLLIAKASIIQAL--SHHKPTLP  118

Query  439  PSFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGL------------  561
             SF+ +   + PL+ T I NS F LS+       LF+AF  A+ GLG             
Sbjct  119  TSFTSILYHYKPLLLTYIYNSFFILSANASCFCLLFLAFTFAE-GLGYTSSSSTLLMSAA  177

Query  562  SSLFFSAIGALVFSLICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATM  741
            S++ +S I A  F +ICN++L LS  +  GG+ A+LKACV+++ R + AL LALP N  +
Sbjct  178  SAVLYSVILANAF-VICNMSLTLSGMEGHGGYMAILKACVMLRGRTSMALFLALPANVGL  236

Query  742  AAVEALFQYRVVRAYHDDGVFS---AALEGLFIAYLYALLIVLDTIVAYFFFTTCEEHKD  912
            AA+EALFQ+RVVRAYH+  + S    ALE +FIAYLY++ I +DTIV+  F+ +C+    
Sbjct  237  AAIEALFQFRVVRAYHNGEMSSWPFMALEAIFIAYLYSVFITIDTIVSCMFYKSCKVGLR  296

Query  913  GRK------KIAQDQSLACSCRSIKIVEGLP  987
            G +      +I   +  +C    +K  E LP
Sbjct  297  GDQEDKHFMRIEFPEEDSCGYLVLKNFEELP  327



>ref|NP_001241590.1| uncharacterized protein LOC100802807 [Glycine max]
 gb|ACU19929.1| unknown [Glycine max]
Length=328

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 133/333 (40%), Positives = 190/333 (57%), Gaps = 47/333 (14%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllp----  282
            ME    ILRRSI +FLQ YHYFT+ A FLA PF+AS LL ++ +P+   ++  +      
Sbjct  1    MEVSCKILRRSIHSFLQNYHYFTSTAAFLALPFSASILLSEAFVPASSSLLPQIHSHLRT  60

Query  283  --------sssilfsilHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPW  438
                    S+S LF+IL+ K+S TI  S+   P TL+  L  KAS+I AL    N   P 
Sbjct  61   LFDAAGFPSTSQLFTILNLKVSQTITSSIFTLPFTLTFLLIAKASIIQAL----NHHKPT  116

Query  439  --PSFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS----LFFS  579
               SF+ +   + PL+ T I NS F LS+       LF+AF  A+ GLG +S    LF S
Sbjct  117  LPTSFTSMVFHYKPLLLTYIYNSFFILSANASCFCLLFLAFTFAE-GLGYTSPSSTLFMS  175

Query  580  AIGALVFSLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINAT  738
            A  A++FS+I       CN+AL LS  +  GG+ A+LKACV+++ + + AL LALP N  
Sbjct  176  AAAAVLFSVILANALVICNMALTLSGMEGHGGYMAILKACVMLRGKTSMALFLALPANVG  235

Query  739  MAAVEALFQYRVVRAYHDDGVFS---AALEGLFIAYLYALLIVLDTIVAYFFFTTCEEHK  909
            +AA+EALFQ+RVVRA+ +  + S    ALE +FIAYL+++ I +DTIV+  F+ +C+   
Sbjct  236  LAAIEALFQFRVVRAFRNGEMSSRPFMALEAIFIAYLFSVFITIDTIVSCMFYKSCKVGL  295

Query  910  DGRKKIAQ-------DQSLACSCRSIKIVEGLP  987
             G ++          ++   C    +K  E LP
Sbjct  296  RGDQEDKHFLRIEFPEEEDNCGYMVLKNFEELP  328



>gb|KHN26275.1| hypothetical protein glysoja_032845 [Glycine soja]
Length=328

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 133/333 (40%), Positives = 190/333 (57%), Gaps = 47/333 (14%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllp----  282
            ME    ILRRSI +FLQ YHYFT+ A FLA PF+AS LL ++ +P+   ++  +      
Sbjct  1    MEVSCKILRRSIHSFLQNYHYFTSTAAFLALPFSASILLSEAFVPASSSLLPQIHSHLRT  60

Query  283  --------sssilfsilHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPW  438
                    S+S LF+IL+ K+S TI  S+   P TL+  L  KAS+I AL    N   P 
Sbjct  61   LFDAAGFPSTSQLFTILNLKVSQTITSSIFTLPFTLTFLLIAKASIIQAL----NHHKPT  116

Query  439  --PSFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS----LFFS  579
               SF+ +   + PL+ T I NS F LS+       LF+AF  A+ GLG +S    LF S
Sbjct  117  LPTSFTSMVFHYKPLLLTYIYNSFFILSANASCFCLLFLAFTFAE-GLGYTSPSSTLFMS  175

Query  580  AIGALVFSLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINAT  738
            A  A++FS+I       CN+AL LS  +  GG+ A+LKACV+++ + + AL LALP N  
Sbjct  176  AAAAVLFSVILANALVICNMALTLSGMEGHGGYMAILKACVMLRGKTSMALFLALPANVG  235

Query  739  MAAVEALFQYRVVRAYHDDGVFS---AALEGLFIAYLYALLIVLDTIVAYFFFTTCEEHK  909
            +AA+EALFQ+RVVRA+ +  + S    ALE +FIAYL+++ I +DTIV+  F+ +C+   
Sbjct  236  LAAIEALFQFRVVRAFRNGEMSSRPFMALEAIFIAYLFSVFITIDTIVSCMFYKSCKVGL  295

Query  910  DGRKKIAQ-------DQSLACSCRSIKIVEGLP  987
             G ++          ++   C    +K  E LP
Sbjct  296  RGDQEDKHFLRIEFPEEEGNCGYMVLKNFEELP  328



>ref|XP_003523005.1| PREDICTED: uncharacterized protein LOC100797246 [Glycine max]
Length=328

 Score =   169 bits (428),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 134/331 (40%), Positives = 191/331 (58%), Gaps = 44/331 (13%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipii---------  267
            ME    ILRRSI +FLQ YHYFT+ A FLA PF+AS +L Q+ +P+   ++         
Sbjct  1    MEVSCKILRRSIHSFLQNYHYFTSTAAFLALPFSASIILSQAFVPASSSLLPQIHGHLRT  60

Query  268  ---hsllpsssilfsilHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPW  438
                +  PS+S LF+IL+ K+S TI  S+   P TL+  L  KAS+I AL  S ++    
Sbjct  61   LFDAAGFPSTSQLFTILNLKVSQTITSSIFTLPFTLTFLLIAKASIIQAL--SHHKPTLP  118

Query  439  PSFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGL------------  561
             SF+ +   + PL+ T I NS F LS+       LF+AF  A+ GLG             
Sbjct  119  TSFTSILYHYKPLLLTYIYNSFFILSANASCFCLLFLAFTFAE-GLGYTSSSSTLLMSAA  177

Query  562  SSLFFSAIGALVFSLICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATM  741
            S++ +S I A  F +ICN++L LS  +  GG+ A+LKACV+++ R + AL LALP N  +
Sbjct  178  SAVLYSVILANAF-VICNMSLTLSGMEGHGGYMAILKACVMLRGRTSMALFLALPANVGL  236

Query  742  AAVEALFQYRVVRAYHDDGVFS---AALEGLFIAYLYALLIVLDTIVAYFFFTTCEEHKD  912
            AA+EALFQ+RVVRAYH+  + S    ALE +FIAYLY++ I +DTIV+  F+ +C+    
Sbjct  237  AAIEALFQFRVVRAYHNGEMSSWPFMALEAIFIAYLYSVFITIDTIVSCKFYKSCKVGLR  296

Query  913  GRK------KIAQDQSLACSCRSIKIVEGLP  987
            G +      +I   +  +C    +K  E LP
Sbjct  297  GDQEDKHFMRIEFPEEDSCGYLVLKNFEELP  327



>gb|ACU19144.1| unknown [Glycine max]
Length=328

 Score =   166 bits (419),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 132/331 (40%), Positives = 189/331 (57%), Gaps = 44/331 (13%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipii---------  267
            ME    ILRRSI +FLQ YHYFT+   FLA PF+AS +L Q+ +P+   ++         
Sbjct  1    MEVSCKILRRSIHSFLQNYHYFTSTTAFLALPFSASIILSQAFVPASSSLLPQIHGHLRT  60

Query  268  ---hsllpsssilfsilHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPW  438
                +  PS+S LF+IL+ K+S TI  S+   P TL+  L  KAS+I AL  S ++    
Sbjct  61   LFDAAGFPSTSQLFTILNLKVSQTITSSIFTLPFTLTFLLIAKASIIQAL--SHHKPTLP  118

Query  439  PSFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGL------------  561
             SF+ +   + PL+ T I NS F LS+       LF+A   A+ GLG             
Sbjct  119  TSFTSILYHYKPLLLTYIYNSFFILSANASCFCLLFLALTFAE-GLGYTSSSSTLLMSAA  177

Query  562  SSLFFSAIGALVFSLICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATM  741
            S++ +S I A  F +ICN++L LS  +  GG+ A+LKACV+++ R + AL LALP N  +
Sbjct  178  SAVLYSVILANAF-VICNMSLTLSGMEGHGGYMAILKACVMLRGRTSMALFLALPANVGL  236

Query  742  AAVEALFQYRVVRAYHDDGVFS---AALEGLFIAYLYALLIVLDTIVAYFFFTTCEEHKD  912
            AA+EALFQ+RVVRAYH+  + S    ALE +FIAYLY++ I +DTIV+  F+ +C+    
Sbjct  237  AAIEALFQFRVVRAYHNGEMSSWPFMALEAIFIAYLYSVFITIDTIVSCKFYKSCKVGLR  296

Query  913  GRK------KIAQDQSLACSCRSIKIVEGLP  987
            G +      +I   +  +C    +K  E LP
Sbjct  297  GDQEDKHFMRIEFPEEDSCGYLVLKNFEELP  327



>gb|KGN63693.1| hypothetical protein Csa_1G011450 [Cucumis sativus]
Length=351

 Score =   164 bits (416),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 126/314 (40%), Positives = 166/314 (53%), Gaps = 44/314 (14%)
 Frame = +1

Query  112  SMETPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsss  291
            SME    ++R+SI+ FLQ Y +FT+IA  LAFP+A S LL Q+LL S          +  
Sbjct  22   SMEESKKLVRKSIYNFLQNYQFFTSIAAALAFPYAISLLLSQTLLLSSSSSSSLFSFTFD  81

Query  292  ilfsilH---------------TKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQ  426
             L ++                  KLS TI  ++ + P +LS  L  KA VI  L    NQ
Sbjct  82   RLRAVFSAAGFPISSKFFLFFIQKLSQTIVSTIYSLPFSLSFLLISKACVIQVL----NQ  137

Query  427  ECP--WPSFSCLFKLHIPLIHTQICNSLF-------TLSSLFIAFNLADYGLGLSS----  567
            + P   PSFS +     PL  T +CN LF       T+  +         G G SS    
Sbjct  138  QKPNLLPSFSSILHFFNPLFFTHLCN-LFIFISANSTVFFMLFFAFNFLEGFGYSSPNCL  196

Query  568  LFFSAIGALVFSL-------ICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALP  726
            LF S +G  ++S+       ICNLA +LSA +++GGF  LLKACVLI+ R  TAL + LP
Sbjct  197  LFVSVLGGFLYSIAIAKAIVICNLASVLSAMERKGGFMTLLKACVLIQGRSTTALLVTLP  256

Query  727  INATMAAVEALFQYRVVRAYHDDGVF--SAALEGLFIAYLYALLIVLDTIVAYFFFTTCE  900
             N  MAAVEALFQYR+VR YH  G    S  +EG+F+AYLY++ +VLD IV   FF +C 
Sbjct  257  FNMGMAAVEALFQYRIVRDYHLRGKLEPSMVVEGMFVAYLYSVFVVLDAIVNTLFFKSCR  316

Query  901  EHKDGRKKIAQDQS  942
               D +  I +  S
Sbjct  317  --ADSQMGIERKSS  328



>ref|XP_008453222.1| PREDICTED: uncharacterized protein LOC103494010 [Cucumis melo]
Length=352

 Score =   163 bits (412),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 128/338 (38%), Positives = 177/338 (52%), Gaps = 53/338 (16%)
 Frame = +1

Query  112  SMETPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsss  291
            SME    + R+SI++FLQ Y +FT+IA   AFP+A S LL Q+ L S       L   + 
Sbjct  22   SMEESKKLTRKSIYSFLQNYQFFTSIAAAFAFPYAISLLLSQTFLLSSSSSSSYLFSFTF  81

Query  292  ilfsilHT----------------KLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTN  423
                 + +                KLS TI  ++ + P +L+  L  KA VI  L    N
Sbjct  82   DRLRAVFSAAGFPISSKFFLFFIQKLSQTIVSTIYSLPFSLTFLLISKACVIQVL----N  137

Query  424  QECP--WPSFSCLFKLHIPLIHTQICNSLF-------TLSSLFIAFNLADYGLGLSS---  567
            Q+ P   PSFS +  L  PL  T +CN LF       T+  +         G G SS   
Sbjct  138  QQKPNLLPSFSSILNLFNPLFFTHLCN-LFIFISANSTVFFMLFFAFNFLEGFGYSSPNC  196

Query  568  -LFFSAIGALVFSLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLAL  723
             LF S +G  ++S+        CNLA +LSA +++GGF A+LKACVLI+ R  TAL +AL
Sbjct  197  LLFVSVLGGFLYSIAIAKAIIICNLASVLSAMERKGGFMAVLKACVLIQGRSTTALLVAL  256

Query  724  PINATMAAVEALFQYRVVRAYHDDGVF--SAALEGLFIAYLYALLIVLDTIVAYFFFTTC  897
            P N  MAA+EALFQYR+VR YH  G    S  +EG+F+AYLY++ +VLD IV   FF +C
Sbjct  257  PFNIGMAAIEALFQYRIVRDYHLRGKLEPSMVVEGMFVAYLYSVFVVLDAIVNTLFFKSC  316

Query  898  E-EHKDGRKK-------IAQDQSLACSCRSIKIVEGLP  987
              + + G ++       IA+ ++    C  +K  E LP
Sbjct  317  RVDSQMGIERKSSFWFWIAEKENEG--CHHLKGFEELP  352



>gb|KFK27894.1| hypothetical protein AALP_AA8G443900 [Arabis alpina]
Length=327

 Score =   160 bits (404),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 126/320 (39%), Positives = 172/320 (54%), Gaps = 47/320 (15%)
 Frame = +1

Query  112  SMETPSNILRRSIFTFLQKYHYFTTIATFLAFPFAAS------------Tlllqsllpsq  255
            +ME PS I+RRSI TFLQ YH  TT A  +  PF+A+            +          
Sbjct  4    TMEDPSKIMRRSIHTFLQNYHRATTAAA-VVLPFSAALLLSQPFFSSSSSTSSSLHSKLN  62

Query  256  ipiihsllpsssilfsilHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECP  435
                 +   +S   F+IL  KLS T++ S    P +L+ FLF KA VI   ++S N    
Sbjct  63   TLFRGAGFSTSLDFFNILSLKLSQTLSSSFFTLPFSLTFFLFSKAYVIK--LLSNNHYSV  120

Query  436  WPSFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS----LFFSA  582
              S       +I L+ T ICN    LS+        F+AFNL     G  S     FFS 
Sbjct  121  SSSV-----YYIRLLKTYICNLFLLLSANASAFALFFLAFNLLQ-AFGFYSRNFYTFFSL  174

Query  583  IGALVFSLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATM  741
              A+++S+I        NLAL+ S +   GG+T +L+AC++I+ R +TAL+LALP N  +
Sbjct  175  SSAIIYSIILANAFVISNLALVSSVSSSSGGYTTILEACLMIRGRTSTALALALPTNLGL  234

Query  742  AAVEALFQYRVVRAYH--DDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTC-EEHKD  912
            A VEALFQYRVVR+Y+  D  + S  LEG FIAYLYAL +VLDTIV YFF+ +C +  ++
Sbjct  235  AGVEALFQYRVVRSYYKGDRDIASITLEGTFIAYLYALFLVLDTIVNYFFYQSCLKNDEE  294

Query  913  GRKKIAQDQSLACSCRSIKI  972
              +KI ++        SIKI
Sbjct  295  NHRKIGREDEY-----SIKI  309



>ref|XP_009111986.1| PREDICTED: uncharacterized protein LOC103837376 [Brassica rapa]
Length=319

 Score =   158 bits (400),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 118/305 (39%), Positives = 171/305 (56%), Gaps = 42/305 (14%)
 Frame = +1

Query  112  SMETPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsss  291
            +ME PS I+RRS+ TFLQ YH  TT A  +A PF+ + LL Q    S    IH  L +  
Sbjct  4    TMEDPSKIMRRSVHTFLQHYHRATTAAA-VALPFSTALLLSQPFFSSSSSSIHMKLNTLL  62

Query  292  ilfsilHT---------KLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWPS  444
                   +         KLS T++ S+   P +L+  LF KA +I   ++S N +  +  
Sbjct  63   RGAGFSSSLEFFNILSLKLSQTLSSSLFTLPFSLTFLLFSKAYIIK--LLSNNHDSIY--  118

Query  445  FSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS----LFFSAIGA  591
                   +  L+ T ICNS F LS+        F+A  + D   G SS    + FS   A
Sbjct  119  -------YFRLLRTYICNSFFILSANASAFALFFLASTILD-SFGFSSRNFYILFSLSSA  170

Query  592  LVFSLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAV  750
            +++S+I        NLAL+ S +   GG+T LLKAC+L++ R +TAL+LALP N  +A V
Sbjct  171  IIYSIILANAFVISNLALVSSPSSSSGGYTTLLKACLLLRGRTSTALALALPTNLGLAGV  230

Query  751  EALFQYRVVRAYH--DDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCEEHKDGRKK  924
            EALF+YRV+R+++  D  V S A+EG  IAYLYAL +VLDT+V +FF+ +C E+++ +K 
Sbjct  231  EALFRYRVMRSFYKGDRDVTSIAIEGTLIAYLYALFLVLDTVVNFFFYQSCVENEEEQKI  290

Query  925  IAQDQ  939
               D+
Sbjct  291  GGDDE  295



>ref|XP_010258424.1| PREDICTED: uncharacterized protein LOC104598194 [Nelumbo nucifera]
Length=327

 Score =   158 bits (399),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 133/305 (44%), Positives = 174/305 (57%), Gaps = 40/305 (13%)
 Frame = +1

Query  115  METPSN-ILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsss  291
            ME+ S+ I+RRSIFTFL+ Y +FT+IA    FP + S LL Q +LPS  P++  +     
Sbjct  1    MESSSSKIVRRSIFTFLKHYQHFTSIAALFVFPVSVSVLLSQVVLPSFSPLLQIIHARLQ  60

Query  292  ilf------------silHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECP  435
             LF            S+L  KLS TI+ S+L  P TLS  L  KA VI  L         
Sbjct  61   SLFHAAGFPPSLPFFSLLSLKLSQTISSSILTVPFTLSFLLIGKACVIQILHHPKLSLSS  120

Query  436  WPSFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS----LFFSA  582
              S+     L+  L+ T +CNS   L++       LF+ FN  D   G SS    L  SA
Sbjct  121  SLSYFAF--LYSRLLLTYLCNSFVILAANAAAFSILFLTFNSFD-AFGFSSPNFLLLLSA  177

Query  583  IGALVFSL-------ICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATM  741
             GA+++S+       ICNLALI++  +   G+  +LKACVLIK R + ALSLALPIN  +
Sbjct  178  AGAVLYSVVLANTLVICNLALIVAGMENCSGYLPILKACVLIKGRASKALSLALPINLGL  237

Query  742  AAVEALFQYRVVRAYH--DDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCEE----  903
            AA+EALFQYRVVR +H  D    S ALEG+ IAYLY+LL++LDTIV+  FF +C+     
Sbjct  238  AAIEALFQYRVVRGHHLYDRYGPSVALEGILIAYLYSLLVLLDTIVSCIFFKSCKSASQM  297

Query  904  HKDGR  918
            H  GR
Sbjct  298  HSQGR  302



>dbj|BAB08489.1| unnamed protein product [Arabidopsis thaliana]
Length=359

 Score =   156 bits (395),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 118/311 (38%), Positives = 167/311 (54%), Gaps = 38/311 (12%)
 Frame = +1

Query  94   KVRSICSMETPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihs  273
            K R   +ME PS I+RRSI TFLQ YH  TT A  +A PF+A  LL Q    S    +H 
Sbjct  31   KTRMKKTMEDPSKIMRRSIHTFLQNYHRVTTAAA-VALPFSAGLLLSQPFFSSSSSTLHM  89

Query  274  llpsssilfsilHT---------KLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQ  426
             L           +         KLS T++ S+   P +L+  L  KA VI   ++S N 
Sbjct  90   RLNMLFRGAGFSSSHDFFNILSLKLSQTLSSSLFTLPFSLTFLLLSKAYVIK--LLSNNH  147

Query  427  ECPWPSFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSSLFFSAI  585
                 S       ++ L+ T +CN  F LS+        F+A+N  +   G SS  F   
Sbjct  148  SADSSSV-----FYLRLLKTYVCNFFFLLSANASAFALFFLAYNTLE-AFGFSSRNFYTF  201

Query  586  GALVFS-----------LICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPIN  732
             +L  +           +I NLAL+ S +   GG+T +LKAC+LI+ R +TA++LALP N
Sbjct  202  LSLSSAIIYSIIIANAFVISNLALVSSPSSSSGGYTNILKACLLIRGRNSTAMALALPTN  261

Query  733  ATMAAVEALFQYRVVRAYH--DDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCEEH  906
              +A VEALFQYRV+R+Y+  D  + S ALEG FIAYLYAL +VLDTIV + F+ +C ++
Sbjct  262  LGLAGVEALFQYRVMRSYYNGDRDIISIALEGTFIAYLYALFLVLDTIVNFLFYQSCIKN  321

Query  907  KDGRKKIAQDQ  939
            ++ +    +D+
Sbjct  322  EEDQNIGREDE  332



>emb|CDY23069.1| BnaC07g31180D [Brassica napus]
Length=324

 Score =   155 bits (393),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 124/304 (41%), Positives = 165/304 (54%), Gaps = 44/304 (14%)
 Frame = +1

Query  112  SMETPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsss  291
            +ME PS I+RRSI TFL+ Y   TT A  L  PF+A+ LL Q  + S    +H  L    
Sbjct  4    TMEEPSKIMRRSIHTFLKHYDRATTAAA-LVLPFSAALLLSQPFVSSSSSFLHGKLNMLF  62

Query  292  ilfsilHT---------KLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWPS  444
                   +         KLS T++ S+   P +L+  LF KA +I  L  S      +  
Sbjct  63   RGAGFSFSLDFFNILSLKLSQTLSSSLFTLPFSLTFLLFSKAYIIKLLSNSHGDSSLY--  120

Query  445  FSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS----LFFSAIGA  591
                   +  L+ T I NS F LS+        F+AFNL +Y  GLSS      FS   A
Sbjct  121  -------YFRLLRTYIWNSFFLLSANASAFALFFVAFNLIEY-FGLSSRNFYTLFSLSSA  172

Query  592  LVFSLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAV  750
            +++S+I        NLALI S +   GG+  +LKAC+LI+ R +TAL+L+LP N  +A V
Sbjct  173  IIYSVILANAFVISNLALISSTSSSSGGYPTILKACLLIQGRTSTALALSLPTNLGLAGV  232

Query  751  EALFQYRVVRAYH--DDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTC----EEHKD  912
            EALFQYRVV +Y+  D  + S ALEG FIAYLYAL +VLDTIV + F+ +C    EE K 
Sbjct  233  EALFQYRVVSSYYKGDRDITSIALEGTFIAYLYALFLVLDTIVNFLFYQSCVKNDEEQKI  292

Query  913  GRKK  924
            GR+ 
Sbjct  293  GRED  296



>ref|XP_010483800.1| PREDICTED: uncharacterized protein LOC104762247 [Camelina sativa]
Length=326

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 119/305 (39%), Positives = 169/305 (55%), Gaps = 38/305 (12%)
 Frame = +1

Query  112  SMETPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsss  291
            +ME PS ++RRSI TFL+ YH  TT A  +A PF+A  LL Q    S   I+H+ L +  
Sbjct  4    TMEDPSKLMRRSIHTFLKNYHRVTTAAA-VALPFSAGLLLSQPFFSSSSSILHARLNTLF  62

Query  292  ilfsilHT---------KLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWPS  444
                   +         KLS T + S+   P +L+ FLF KA VI   ++S N      S
Sbjct  63   RGAGFSSSLDFFNILSLKLSQTFSSSLFTLPFSLTFFLFSKAYVIK--LLSNNHSADDSS  120

Query  445  FSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSSLFFSAIGALVFS  603
                   +  L+ T IC+  F +S+        F+AFN  +   G SS  F    +L  +
Sbjct  121  V-----YYFRLLKTYICSFFFLISANASAFALFFLAFNTLE-AFGFSSRNFYTFLSLSSA  174

Query  604  -----------LICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAV  750
                       +I NLAL+ S +   GG+T +LKAC+LI+ R + AL+LALP N  +A +
Sbjct  175  IIYSIIIANAFVISNLALVSSPSSSSGGYTNILKACLLIRKRTSPALALALPTNLGLAGI  234

Query  751  EALFQYRVVRAYH--DDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCEEHKDGRKK  924
            EALFQYRVVR+Y+  D  + S ALEG FIAYLYAL +VLDTIV +FF+ +C ++++ +K 
Sbjct  235  EALFQYRVVRSYYNGDRDITSIALEGTFIAYLYALFLVLDTIVNFFFYQSCVKNEEDQKI  294

Query  925  IAQDQ  939
              +D+
Sbjct  295  GREDE  299



>ref|XP_010457239.1| PREDICTED: uncharacterized protein LOC104738735 [Camelina sativa]
Length=327

 Score =   155 bits (391),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 120/305 (39%), Positives = 169/305 (55%), Gaps = 37/305 (12%)
 Frame = +1

Query  112  SMETPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsss  291
            +ME PS ++RRSI TFL+ YH  TT A  +A PF+A  LL Q    S   I+H+ L +  
Sbjct  4    TMEEPSKLMRRSIHTFLKNYHRVTTAAA-VALPFSAGLLLSQPFFSSSSSILHARLNTLF  62

Query  292  ilfsilHT---------KLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWPS  444
                   +         KLS T A S+   P +L+  LF KA VI   ++S N      S
Sbjct  63   RGAGFSSSLDFFNILSLKLSQTFASSLFTLPFSLTFLLFSKAYVIK--LLSNNNHSADDS  120

Query  445  FSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSSLFFSAIGALVFS  603
                F+L    + T IC+  F +S+        F+AFN  +   G SS  F    +L  +
Sbjct  121  SVYYFRL----LKTYICSFFFLISANASAFALFFLAFNTLE-AFGFSSRNFYTFLSLSSA  175

Query  604  -----------LICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAV  750
                       +I NLAL+ S +   GG+T +LKAC+LI+ R + AL+LALP N  +A +
Sbjct  176  IIYSIIIANAFVISNLALVSSPSSSSGGYTNILKACLLIRKRTSPALALALPTNLGLAGI  235

Query  751  EALFQYRVVRAYH--DDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCEEHKDGRKK  924
            EALFQYRVVR+Y+  D  + S ALEG FIAYLYAL +VLDTIV +FF+ +C ++++ +K 
Sbjct  236  EALFQYRVVRSYYNGDRDITSIALEGTFIAYLYALFLVLDTIVNFFFYQSCIKNEEDQKI  295

Query  925  IAQDQ  939
              +D+
Sbjct  296  GREDE  300



>ref|NP_568933.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK68745.2| Unknown protein [Arabidopsis thaliana]
 gb|AAM10264.1| unknown protein [Arabidopsis thaliana]
 gb|AED97456.1| uncharacterized protein AT5G61340 [Arabidopsis thaliana]
Length=326

 Score =   154 bits (389),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 116/305 (38%), Positives = 165/305 (54%), Gaps = 38/305 (12%)
 Frame = +1

Query  112  SMETPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsss  291
            +ME PS I+RRSI TFLQ YH  TT A  +A PF+A  LL Q    S    +H  L    
Sbjct  4    TMEDPSKIMRRSIHTFLQNYHRVTTAAA-VALPFSAGLLLSQPFFSSSSSTLHMRLNMLF  62

Query  292  ilfsilHT---------KLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWPS  444
                   +         KLS T++ S+   P +L+  L  KA VI   ++S N      S
Sbjct  63   RGAGFSSSHDFFNILSLKLSQTLSSSLFTLPFSLTFLLLSKAYVIK--LLSNNHSADSSS  120

Query  445  FSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSSLFFSAIGALVFS  603
                   ++ L+ T +CN  F LS+        F+A+N  +   G SS  F    +L  +
Sbjct  121  V-----FYLRLLKTYVCNFFFLLSANASAFALFFLAYNTLE-AFGFSSRNFYTFLSLSSA  174

Query  604  -----------LICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAV  750
                       +I NLAL+ S +   GG+T +LKAC+LI+ R +TA++LALP N  +A V
Sbjct  175  IIYSIIIANAFVISNLALVSSPSSSSGGYTNILKACLLIRGRNSTAMALALPTNLGLAGV  234

Query  751  EALFQYRVVRAYH--DDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCEEHKDGRKK  924
            EALFQYRV+R+Y+  D  + S ALEG FIAYLYAL +VLDTIV + F+ +C ++++ +  
Sbjct  235  EALFQYRVMRSYYNGDRDIISIALEGTFIAYLYALFLVLDTIVNFLFYQSCIKNEEDQNI  294

Query  925  IAQDQ  939
              +D+
Sbjct  295  GREDE  299



>ref|XP_010678454.1| PREDICTED: uncharacterized protein LOC104894001 [Beta vulgaris 
subsp. vulgaris]
Length=358

 Score =   155 bits (391),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 121/348 (35%), Positives = 188/348 (54%), Gaps = 58/348 (17%)
 Frame = +1

Query  112  SMETPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllps--  285
            SM   + I+RRSI+TFLQ YH+FT+IA+ +  PFA S L+ Q+ +P  +    ++     
Sbjct  8    SMAKAAKIIRRSIYTFLQHYHFFTSIASLIVLPFAISILITQATVPRSLVFFPTIYGRLH  67

Query  286  ----------ssilfsilHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMM------S  417
                      SS LF+++  KLS TI+ S++  P T+S FL  KAS+IH          +
Sbjct  68   SIFHAAGFPPSSDLFALVSLKLSQTISTSIITLPFTISFFLLAKASIIHFFTNIITQHPT  127

Query  418  TNQECPWPSFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS---  567
            +N     P  S    L+ P++ T +CN     ++       LF AFN  + G  L++   
Sbjct  128  SNYYSLSPPSSSFTTLYNPILSTHLCNCFIIFAANATCFSLLFFAFNFLE-GFHLNTPIW  186

Query  568  -LFFSAIGALVFSLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLAL  723
             L FS   A+ +S++       CNLALI S  ++RGGF ++LKACVLI+   +TAL+LA+
Sbjct  187  VLTFSVFAAVFYSIVLANTFVVCNLALISSGIERRGGFLSILKACVLIRGNTSTALALAV  246

Query  724  PINATMAAVEALFQYRVVRAYHD-------DGVFSAALEGLFIAYLYALLIVLDTIVAYF  882
            PIN  +AAVEALF +R+V A          + ++  ALEG+ IAY+Y++L+VLD I++  
Sbjct  247  PINLGLAAVEALFHFRIVAASQHAHRFDTTNSLWLVALEGVLIAYIYSVLLVLDVIISCM  306

Query  883  FFTTCEEHKDGRKKIAQ--------------DQSLACSCRSIKIVEGL  984
            F+ +C+  +    +I Q              D+   C    ++ ++GL
Sbjct  307  FYQSCQNDQAFIHQITQGYPANDQDAYVMEVDEEFRCYDYDVEKLKGL  354



>ref|XP_010443954.1| PREDICTED: uncharacterized protein LOC104726721 [Camelina sativa]
Length=324

 Score =   153 bits (386),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 117/305 (38%), Positives = 169/305 (55%), Gaps = 38/305 (12%)
 Frame = +1

Query  112  SMETPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsss  291
            +ME PS ++RRSI TFL+ YH  TT A  +A PF+A  LL Q    S   I+H+ L +  
Sbjct  4    TMEDPSKLMRRSIHTFLKNYHRVTTAAA-VALPFSAGLLLSQPFFSSSSSILHARLNTLF  62

Query  292  ilfsilHT---------KLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWPS  444
                   +         KLS T + S+   P +L+ FLF KA VI   ++S N      S
Sbjct  63   RGAGFSSSLDFFNILSLKLSQTFSSSLFTLPFSLTFFLFSKAYVIK--LLSNNHSADDSS  120

Query  445  FSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSSLFFSAIGALVFS  603
                   +  L+ T IC+  F +S+        F+AFN  +   G SS  F    ++  +
Sbjct  121  V-----YYFRLLKTYICSFFFLISANASAFALFFLAFNTLE-AFGFSSRNFYTFLSVSSA  174

Query  604  -----------LICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAV  750
                       +I NLAL+ S +   GG+T +LKAC+LI+ R + AL+LALP N  +A +
Sbjct  175  IIYSIIIANAFVISNLALVSSPSSSSGGYTNILKACLLIRKRTSPALALALPTNLGLAGI  234

Query  751  EALFQYRVVRAYH--DDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCEEHKDGRKK  924
            EALFQYRVV++Y+  D  + S ALEG FIAYLYAL +VLDTIV +FF+ +C ++++ +K 
Sbjct  235  EALFQYRVVKSYYNGDRDITSIALEGTFIAYLYALFLVLDTIVNFFFYQSCVKNEEDQKI  294

Query  925  IAQDQ  939
              +D+
Sbjct  295  GREDE  299



>ref|XP_006394517.1| hypothetical protein EUTSA_v10005448mg [Eutrema salsugineum]
 gb|ESQ31803.1| hypothetical protein EUTSA_v10005448mg [Eutrema salsugineum]
Length=326

 Score =   152 bits (385),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 120/303 (40%), Positives = 173/303 (57%), Gaps = 36/303 (12%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsssi  294
            ME PS I+RRSI TFLQ YH  TT A  +  PF+A+ LL Q    S    +H+ L +   
Sbjct  5    MEDPSKIMRRSIHTFLQNYHRATTAAA-VVLPFSAALLLSQPFFSSSSSSLHARLNTLFR  63

Query  295  lfsilHT---------KLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWPSF  447
                  +         KLS T++ S+   P +L+ FLF KA VI   ++S   +    S 
Sbjct  64   GAGFSSSLDFFNILSLKLSQTLSSSLFTLPFSLTFFLFSKAYVIR--LLSNKHDSEDSSV  121

Query  448  SCLFKLHIPLIHTQICNSLFTLSS-------LFIAFN-LADYGLGLSSLF--FSAIGALV  597
                  ++ L+ T ICNS F +S+        F+AFN L  +G    + +  FS   A++
Sbjct  122  -----YYLRLLRTYICNSFFLISANASAFALFFLAFNVLESFGFYSRNFYTLFSLSSAII  176

Query  598  FSLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAVEA  756
            +S+I        NLAL+ S +   GG+T +LKAC+LI+ R +TAL+LALP N  +A VEA
Sbjct  177  YSIILANAFVISNLALVSSTSSSSGGYTTILKACLLIRGRTSTALALALPTNLGLAGVEA  236

Query  757  LFQYRVVRAYH--DDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCEEHKDGRKKIA  930
            LF+YRVV++Y+  D  + S ALEG FIAYLYAL +VLDTIV + F+ +C ++ + +K   
Sbjct  237  LFRYRVVKSYYQGDRDIVSIALEGTFIAYLYALFLVLDTIVNFLFYQSCVKNDEDQKLCR  296

Query  931  QDQ  939
            +D+
Sbjct  297  EDE  299



>ref|XP_009136463.1| PREDICTED: uncharacterized protein LOC103860586 [Brassica rapa]
Length=324

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 121/305 (40%), Positives = 168/305 (55%), Gaps = 40/305 (13%)
 Frame = +1

Query  112  SMETPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsss  291
            +ME PS I+RRSI+TFL+ Y   TT A  L  PF+A+ LL Q    S    +H  L    
Sbjct  4    TMEEPSKIMRRSIYTFLKHYDRATTAAA-LVLPFSAALLLSQPFFSSSSSSLHGKLNMLF  62

Query  292  ilfsilHT---------KLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWPS  444
                   +         KLS T++ S+   P  L+  LF KA +I  L  S      +  
Sbjct  63   RGAGFSSSLDFFNILSLKLSQTLSSSLFTLPFALTFLLFSKAYIIKLLSNSHGDSSLY--  120

Query  445  FSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS----LFFSAIGA  591
                   +  L+ T ICNS F LS+        F++FNL +   GLSS      FS   A
Sbjct  121  -------YFRLLRTYICNSFFLLSANASAFALFFVSFNLIE-SFGLSSRNFYTLFSLSSA  172

Query  592  LVFSLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAV  750
            +++S+I        NLAL+ S +   GG+T +LKAC+LI+ R +TAL+L+LP N  +A V
Sbjct  173  IIYSIILANAFVISNLALVSSTSSSSGGYTTILKACLLIQGRTSTALALSLPTNLCLAGV  232

Query  751  EALFQYRVVRAYH--DDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCEEHKDGRKK  924
            EALFQYRVV +Y+  D G+ S ALEG FIAYLYAL +VLDTIV Y F+ +C ++ + ++ 
Sbjct  233  EALFQYRVVSSYYKGDRGITSIALEGAFIAYLYALFLVLDTIVNYLFYQSCVKNDEDQRI  292

Query  925  IAQDQ  939
              +D+
Sbjct  293  SREDE  297



>ref|XP_002866429.1| hypothetical protein ARALYDRAFT_919377 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42688.1| hypothetical protein ARALYDRAFT_919377 [Arabidopsis lyrata subsp. 
lyrata]
Length=325

 Score =   151 bits (382),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 120/306 (39%), Positives = 168/306 (55%), Gaps = 41/306 (13%)
 Frame = +1

Query  112  SMETPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsss  291
            +ME PS I+RRSI TFLQ YH  TT A  +A PF+A  LL Q    S   I+H  L    
Sbjct  4    TMEDPSKIMRRSIHTFLQNYHRVTTAAA-VALPFSAGLLLSQPFFSSSSSILHMRLNMLF  62

Query  292  ilfsilHT---------KLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWPS  444
                   +         KLS T++ S+   P +L+  L  KA VI   ++S N       
Sbjct  63   RGAGFSSSHNFFNILSLKLSQTLSSSLFTLPFSLTFLLLSKAYVIK--LLSNNHSADSSV  120

Query  445  FSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSSLFF---------  576
            F      ++ L+ T +CN  F LS+        F+A+N+ +   G SS  F         
Sbjct  121  F------YLRLLKTYVCNFFFLLSANASAFALFFLAYNILE-AFGFSSRNFYTFLSVSSP  173

Query  577  ---SAIGALVFSLICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAA  747
               S I A  F +I NLAL+ S +   GG+T +LKAC+LI  R +TAL++ALP N  +A 
Sbjct  174  IIYSIIIANAF-VISNLALVSSPSSSSGGYTNILKACLLIHGRSSTALAIALPTNLGLAG  232

Query  748  VEALFQYRVVRAYH--DDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCEEHKDGRK  921
            VEALFQYRV+R+Y+  D  + S ALEG FIAYLYAL +VLD+IV + F+ +C ++++ +K
Sbjct  233  VEALFQYRVLRSYYKGDRDITSIALEGTFIAYLYALFLVLDSIVNFLFYQSCIKNEEDQK  292

Query  922  KIAQDQ  939
               +D+
Sbjct  293  IGREDE  298



>ref|XP_006280822.1| hypothetical protein CARUB_v10026789mg [Capsella rubella]
 gb|EOA13720.1| hypothetical protein CARUB_v10026789mg [Capsella rubella]
Length=322

 Score =   150 bits (380),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 120/302 (40%), Positives = 165/302 (55%), Gaps = 43/302 (14%)
 Frame = +1

Query  112  SMETPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsss  291
            +ME PS ++RRS+ TFLQ YH  TT A  +A PF+A  LL Q    S    +H+ + +  
Sbjct  4    TMEDPSKLMRRSVHTFLQHYHRVTTAAA-VALPFSACLLLSQPFFSSSSSTLHARINTLF  62

Query  292  ilfsilHT---------KLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWPS  444
                   +         KLS T++ S+   P +L+  LF KA VI  L  + +       
Sbjct  63   RGAGFSSSLDFFNILSLKLSQTLSSSLFTLPFSLTFLLFSKAYVIKLLSSNNSASSSV--  120

Query  445  FSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSSLFFSAI----GA  591
                   ++ L+ T IC+  F LS+        F+AFN  +   G SS  F AI     A
Sbjct  121  ------YYLRLLKTYICSFFFLLSANASAFALFFVAFNTLE-AFGFSSRNFYAILSVSSA  173

Query  592  LVFSLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAV  750
            +++S+I        NLAL+ S +   GG+T +LKAC+LI+ R + AL LALP N  +A V
Sbjct  174  IIYSVIIANAFVISNLALVSSPSSSSGGYTNILKACLLIRGRTSPALYLALPTNLGLAGV  233

Query  751  EALFQYRVVRAYH--DDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTC----EEHKD  912
            EALFQYRVVR+Y+  D  + S ALEG FIAYLYAL +VLDTIV + F+ +C    E+ K 
Sbjct  234  EALFQYRVVRSYYNGDRDITSIALEGTFIAYLYALFLVLDTIVNFLFYQSCIKNEEDQKI  293

Query  913  GR  918
            GR
Sbjct  294  GR  295



>emb|CDY02155.1| BnaA03g40120D [Brassica napus]
Length=324

 Score =   150 bits (380),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 121/305 (40%), Positives = 169/305 (55%), Gaps = 40/305 (13%)
 Frame = +1

Query  112  SMETPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsss  291
            +ME PS I+RRSI TFL+ Y   TT A  L  PF+A+ LL Q    S    +H+ L    
Sbjct  4    TMEEPSKIMRRSIHTFLKHYDRATTAAA-LVLPFSAALLLSQPFFSSSSSSLHAKLNMLF  62

Query  292  ilfsilHT---------KLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWPS  444
                   +         KLS T++ S+   P +++  LF KA +I  L  S      +  
Sbjct  63   RGAGFSSSLDFFNILSLKLSQTLSSSLFTLPFSITFLLFSKAYIIKLLSNSHGDSSLY--  120

Query  445  FSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS----LFFSAIGA  591
                   +  L+ T ICNS F LS+        F+AFNL +   GLSS      FS   A
Sbjct  121  -------YFRLLRTYICNSFFLLSANASALALFFVAFNLIE-SFGLSSRNFYTLFSLSSA  172

Query  592  LVFSLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAV  750
            +++S+I        NLAL+ S +   GG+T +LKAC+LI+ R +TAL+L+LP N  +A V
Sbjct  173  IIYSIILANAFVISNLALVSSTSSSSGGYTTILKACLLIQGRTSTALALSLPTNLCLAGV  232

Query  751  EALFQYRVVRAYH--DDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCEEHKDGRKK  924
            EALFQYRVV +Y+  D G+ S ALEG FIAYLYAL +VLDTIV Y F+ +C ++ + ++ 
Sbjct  233  EALFQYRVVSSYYKGDRGITSIALEGAFIAYLYALFLVLDTIVNYLFYQSCVKNDEDQRI  292

Query  925  IAQDQ  939
              +D+
Sbjct  293  SREDE  297



>ref|XP_004174046.1| PREDICTED: uncharacterized protein LOC101224752, partial [Cucumis 
sativus]
Length=272

 Score =   147 bits (371),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 99/231 (43%), Positives = 128/231 (55%), Gaps = 29/231 (13%)
 Frame = +1

Query  316  KLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECP--WPSFSCLFKLHIPLIHTQ  489
            KLS TI  ++ + P +LS  L  KA VI  L    NQ+ P   PSFS +     PL  T 
Sbjct  26   KLSQTIVSTIYSLPFSLSFLLISKACVIQVL----NQQKPNLLPSFSAILHFFNPLFFTH  81

Query  490  ICNSLF-------TLSSLFIAFNLADYGLGLSS----LFFSAIGALVFSL-------ICN  615
            +CN LF       T+  +         G G SS    LF S +G  ++S+       ICN
Sbjct  82   LCN-LFIFISANSTVFFMLFFAFNFLDGFGYSSPNCLLFVSVLGGFLYSIAIAKAIVICN  140

Query  616  LALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRAYHDD  795
            LA +LSA +++GGF  LLKACVLI+ R  TAL + LP N  MAAVEALFQYR+VR YH  
Sbjct  141  LASVLSAMERKGGFMTLLKACVLIQGRSTTALLVTLPFNMGMAAVEALFQYRIVRDYHLR  200

Query  796  GVF--SAALEGLFIAYLYALLIVLDTIVAYFFFTTCEEHKDGRKKIAQDQS  942
            G    S  +EG+F+AYLY++ +VLD IV   FF +C    D +  I +  S
Sbjct  201  GKLEPSMVVEGMFVAYLYSVFVVLDAIVNTLFFKSC--RADSQMGIERKSS  249



>ref|XP_010039067.1| PREDICTED: uncharacterized protein LOC104427718 [Eucalyptus grandis]
Length=370

 Score =   149 bits (375),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 138/227 (61%), Gaps = 23/227 (10%)
 Frame = +1

Query  316  KLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWPSFSCLFKLHIPLIHTQIC  495
            KLS T + SVLA P  LS  L  K+SVI +L   T    P  S S    ++ PL+ T IC
Sbjct  115  KLSQTQSSSVLALPFALSFLLIAKSSVILSLA-GTKPSVPS-SLSSFLSIYRPLLATYIC  172

Query  496  NSLFTLSS-------LFIAFN-LADYGLGLSS--LFFSAIGALVFSLI-------CNLAL  624
            N L  LS+       LF AFN L     G S+  L  SA GA+V+S+I       CNLAL
Sbjct  173  NLLVILSANSTAFFLLFFAFNCLGGPQPGSSNYDLLLSATGAVVYSIILAHALVICNLAL  232

Query  625  ILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRAY--HDDG  798
            +LS  ++ GGF A+LKAC LI+  I+TALSLA+P+N  +A+ EALFQ+RV+RAY   +  
Sbjct  233  VLSGMERTGGFVAILKACALIRGSISTALSLAVPVNLALASTEALFQFRVMRAYSMKNGP  292

Query  799  VFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCEEHKDGRKKIAQDQ  939
            VF  A+EG  IAYLY++LIVLDTI+   FF +C+     R   ++DQ
Sbjct  293  VFPVAMEGWLIAYLYSILIVLDTILTCIFFKSCKNSSIIRG--SEDQ  337



>gb|KCW48865.1| hypothetical protein EUGRSUZ_K02492 [Eucalyptus grandis]
Length=394

 Score =   148 bits (374),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 138/227 (61%), Gaps = 23/227 (10%)
 Frame = +1

Query  316  KLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWPSFSCLFKLHIPLIHTQIC  495
            KLS T + SVLA P  LS  L  K+SVI +L   T    P  S S    ++ PL+ T IC
Sbjct  139  KLSQTQSSSVLALPFALSFLLIAKSSVILSLA-GTKPSVPS-SLSSFLSIYRPLLATYIC  196

Query  496  NSLFTLSS-------LFIAFN-LADYGLGLSS--LFFSAIGALVFSLI-------CNLAL  624
            N L  LS+       LF AFN L     G S+  L  SA GA+V+S+I       CNLAL
Sbjct  197  NLLVILSANSTAFFLLFFAFNCLGGPQPGSSNYDLLLSATGAVVYSIILAHALVICNLAL  256

Query  625  ILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRAY--HDDG  798
            +LS  ++ GGF A+LKAC LI+  I+TALSLA+P+N  +A+ EALFQ+RV+RAY   +  
Sbjct  257  VLSGMERTGGFVAILKACALIRGSISTALSLAVPVNLALASTEALFQFRVMRAYSMKNGP  316

Query  799  VFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCEEHKDGRKKIAQDQ  939
            VF  A+EG  IAYLY++LIVLDTI+   FF +C+     R   ++DQ
Sbjct  317  VFPVAMEGWLIAYLYSILIVLDTILTCIFFKSCKNSSIIRG--SEDQ  361



>ref|XP_009419078.1| PREDICTED: uncharacterized protein LOC103999144 [Musa acuminata 
subsp. malaccensis]
Length=324

 Score =   144 bits (362),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 118/301 (39%), Positives = 161/301 (53%), Gaps = 40/301 (13%)
 Frame = +1

Query  133  ILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsssilf----  300
            I+RRSI  F   Y  FT+IA  L FP +AS LL Q+L+P   P +   +           
Sbjct  7    IVRRSINAFFDGYQSFTSIAALLVFPVSASVLLSQALIPFATPPLLEAISLRLWSLFQAA  66

Query  301  ---------silHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTN---QECPWPS  444
                     S+L+ KL+ T+   V   P  L+  L  KASV+H +    +   +  P P 
Sbjct  67   RFPASVGFFSLLNVKLAQTVFTFVSTLPLVLTFQLLAKASVVHVVCEGRDPRRKRGP-PP  125

Query  445  FSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS----LFFSAIGA  591
             S    L+  ++ T + NS   LS+       LF+ FN  D  LGLS+    L  SA GA
Sbjct  126  LSSFLPLYRSILPTHLFNSFVVLSANASTFALLFLVFNAVDL-LGLSTSNVVLCLSAAGA  184

Query  592  LVFSL-------ICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAV  750
            +++S+       ICNLA+++SAT   GG+  +LKAC+LI+ R+ TAL LALP N  MAAV
Sbjct  185  VLYSVVVANTTVICNLAIVVSATDNCGGYLPVLKACLLIRGRVMTALGLALPANLGMAAV  244

Query  751  EALFQYRVVRAYHDDGVFSAAL--EGLFIAYLYALLIVLDTIVAYFFFTTCEE--HKDGR  918
            EALFQYRVVR Y+  G  +++L  E   I Y +ALL+VLD I++  FF  C    H D  
Sbjct  245  EALFQYRVVRQYNLSGELNSSLFWEAFSITYFHALLVVLDVIMSCMFFKICRTDCHSDCE  304

Query  919  K  921
            K
Sbjct  305  K  305



>ref|XP_008787211.1| PREDICTED: uncharacterized protein LOC103705324 [Phoenix dactylifera]
Length=319

 Score =   143 bits (360),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 120/291 (41%), Positives = 162/291 (56%), Gaps = 33/291 (11%)
 Frame = +1

Query  130  NILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsssilf---  300
            NI RRSI  F Q YH F + A  L FP AA+TLL QSL  S  PI+ ++     +LF   
Sbjct  6    NITRRSIHAFFQSYHSFASTAALLVFPVAAATLLSQSLTLSSSPILRTISSRLRLLFDAA  65

Query  301  ---------silHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWPSFSC  453
                     S+L+ KLS  I   +   P TL   +  KASV+  L     +    P  S 
Sbjct  66   GFPASSQFFSLLNFKLSQVILTFISTLPFTLIFLILAKASVVQILHEFPRRRLAPPPLSS  125

Query  454  LFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS----LFFSAIGALVF  600
            L  ++  L+ T + NSL  LS+       L +AFN+AD  L LSS    L FSA   +++
Sbjct  126  LLHIYPSLLLTYLFNSLVILSANAAIFSILLVAFNVADI-LHLSSNNSILVFSAASVILY  184

Query  601  SLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAVEAL  759
            S++       CNLA+++SA +  GG+ ++LKA VLI+ R AT ++LALP +  MAAVEAL
Sbjct  185  SVVIANTMVACNLAIVISAMEDSGGYLSILKALVLIRGRTATGITLALPASLGMAAVEAL  244

Query  760  FQYRVVRAYHDDGVFSAAL--EGLFIAYLYALLIVLDTIVAYFFFTTCEEH  906
            FQYRV+R YH    FS ++  E   IAY+Y+LLIVLDTI+   F   C+  
Sbjct  245  FQYRVMRPYHLLRKFSPSVICEAFLIAYIYSLLIVLDTIITCMFLKICKAE  295



>emb|CDY16815.1| BnaA09g05670D [Brassica napus]
Length=319

 Score =   140 bits (353),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 114/321 (36%), Positives = 165/321 (51%), Gaps = 74/321 (23%)
 Frame = +1

Query  112  SMETPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsss  291
            +ME PS I+RRS+ TFLQ YH  TT A  +A PF+ +              +    P  S
Sbjct  4    TMEDPSKIMRRSVHTFLQHYHRATTAAA-VALPFSTA--------------LLLSQPFFS  48

Query  292  ilfsilHTKLSHTIAISVLAFPSTLSSF-------------------------LFCKASV  396
               S +H KL+  +  +   F S+L  F                         LF KA +
Sbjct  49   SSSSSIHMKLNTLLRGA--GFSSSLEFFNILSLKLSQTLSSSLLTLPFSLTFLLFSKAYI  106

Query  397  IHALMMSTNQECPWPSFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGL  555
            I   ++S N +  +         +  L+ T ICNS F LS+        F+A  + D   
Sbjct  107  IK--LLSNNHDSIY---------YFRLLRTYICNSFFILSANASAFALFFLASTILD-SF  154

Query  556  GLSS----LFFSAIGALVFSLI-------CNLALILSATQKRGGFTALLKACVLIKTRIA  702
            G SS      FS   A+++S+I        NLAL+ S +   GG+T LLKAC+L++ R +
Sbjct  155  GFSSRNFYTLFSLSSAIIYSIILANAFVISNLALVSSPSSSSGGYTTLLKACLLLRGRTS  214

Query  703  TALSLALPINATMAAVEALFQYRVVRAYH--DDGVFSAALEGLFIAYLYALLIVLDTIVA  876
            TAL+LALP N  +A VEALF+YRV+R+++  D  V S A+EG  IAYLYAL +VLDTIV 
Sbjct  215  TALALALPTNLGLAGVEALFRYRVMRSFYKGDRDVTSIAIEGTLIAYLYALFLVLDTIVN  274

Query  877  YFFFTTCEEHKDGRKKIAQDQ  939
            +FF+ +C ++++ +K    D+
Sbjct  275  FFFYQSCVKNEEEQKIGGDDE  295



>ref|XP_010258661.1| PREDICTED: uncharacterized protein LOC104598335 [Nelumbo nucifera]
Length=335

 Score =   140 bits (354),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 131/317 (41%), Positives = 177/317 (56%), Gaps = 47/317 (15%)
 Frame = +1

Query  118  ETPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsssil  297
            E  S I+RRSIF FL+ Y +FTTIA    FP + S LL Q++LPS  P++ ++      L
Sbjct  10   ERTSKIVRRSIFIFLKHYQHFTTIAALFIFPVSVSILLSQAVLPSLSPLLPTIQARLQSL  69

Query  298  ------------fsilHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWP  441
                        FS+L  KLS TI  S++  P TLS  L  KA VI       N   P P
Sbjct  70   FDAAGFPPSSQLFSLLSLKLSQTICSSIVTIPFTLSFLLVAKACVIRGF----NHCKPSP  125

Query  442  S---FSCLFKLHIPLIHTQICNSLF-------TLSSLFIAFN-LADYGLGLSS--LFFSA  582
                FS  F L+  L  T I N          T S  F+AFN  A +G    +  LF SA
Sbjct  126  PASIFSLAF-LYSRLFFTYINNCFVILAANATTFSLFFLAFNSFAAFGFSSPNFLLFLSA  184

Query  583  IGALVFS-------LICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATM  741
             GA+++S       +ICNLAL+++  +   G+ A+LKA VL++ R + ALSLALP+N  +
Sbjct  185  AGAILYSVILANTFIICNLALVVAGMENCSGYLAILKAFVLLRGRTSIALSLALPVNLGL  244

Query  742  AAVEALFQYRVVRAYHDDGVF--SAALEGLFIAYLYALLIVLDTIVAYFFF----TTCEE  903
            AA+EALFQYRVVR YH    F  S ALEGL IAYLY+LL++LDTI +  FF    ++C++
Sbjct  245  AAIEALFQYRVVRDYHLSVKFRPSMALEGLLIAYLYSLLVLLDTIASCIFFKACKSSCQK  304

Query  904  HKDG----RKKIAQDQS  942
              +G    +  +AQ++ 
Sbjct  305  SLEGSHNYQIDLAQEED  321



>ref|XP_010523013.1| PREDICTED: uncharacterized protein LOC104801435 [Tarenaya hassleriana]
Length=315

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 126/323 (39%), Positives = 175/323 (54%), Gaps = 40/323 (12%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIAT----------FLAFPFAASTlllqsllpsqipi  264
            ME P  I+RRSI TFL+ YH FTT A            L+ PF++S+  L SL      +
Sbjct  1    MEEPIKIMRRSIHTFLRNYHRFTTAAAASAFPFAVALLLSQPFSSSSSALSSLRTRLNTL  60

Query  265  ihsllpsssilfsilHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWPS  444
             H+    S      L  KLS TI  SV A P +L+  LF KA VI  L   +N +     
Sbjct  61   FHAAGFPSFFDILSL--KLSQTICSSVFALPFSLTFLLFSKAYVIRLL---SNDKLSSSD  115

Query  445  FSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSSLFFSAI----GA  591
             S     ++ L+ T ICNS   LS+       LF+AFNL   G G SS  F  I     A
Sbjct  116  VS--LGDYLCLLRTYICNSFLLLSANASAFGLLFMAFNLLQ-GFGFSSQIFLGILSVSAA  172

Query  592  LVFSLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAV  750
            +V+S+I        NLAL+ S++    G+ A+LKACVLI+ R +TAL+LALP N  +AAV
Sbjct  173  VVYSIILANALVISNLALVSSSSSSSSGYMAILKACVLIRGRTSTALALALPTNIGLAAV  232

Query  751  EALFQYRVVRAY--HDDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCEEH-KDGRK  921
            EALFQ R+V++Y   D  + S   EG+ IAYLYA+ ++LDT+V + F+ +C+ + ++G  
Sbjct  233  EALFQTRIVKSYFAGDRDIASLVPEGMLIAYLYAIFVILDTVVNFLFYQSCKTNLEEGYS  292

Query  922  -KIAQDQSLACSCRSIKIVEGLP  987
             +I   +     C   K ++ LP
Sbjct  293  FQIETFEPEFVKCVGSKGIQELP  315



>ref|XP_002278774.2| PREDICTED: uncharacterized protein LOC100256060 [Vitis vinifera]
 emb|CBI22261.3| unnamed protein product [Vitis vinifera]
Length=324

 Score =   135 bits (341),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 118/319 (37%), Positives = 168/319 (53%), Gaps = 40/319 (13%)
 Frame = +1

Query  118  ETPS--------NILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihs  273
            ETPS         I+RRSIF FL+ Y +FT I   L  PF+   LLLQ+   S    +  
Sbjct  3    ETPSADMEIRATKIVRRSIFIFLKDYQFFTNIPVLLMLPFSVFVLLLQAFSSSSTSPLFV  62

Query  274  llps----ssilfsilHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWP  441
            +       S  LF +    +S++I  SV + P TLSS +  K  +I AL  + ++    P
Sbjct  63   IHALGFSPSLQLFLLSDFGVSYSIFSSVFSLPFTLSSLVMAKGYIIQAL--NQHKMVLPP  120

Query  442  SFSCLFKLHIPLIHTQICNSLFTLSSLFIAFNLADYGLG-LSSLFFSAIGALV------F  600
            SFS L  ++  L  TQ+CNS+   ++  +AF++   G   L S   S+   L+      F
Sbjct  121  SFSSLVSIYRSLFLTQVCNSVIIFTANAVAFSVLFMGFNSLESFDSSSKNPLILFVARSF  180

Query  601  S--------LICNLALILSATQKRGGFTALLKACVLIKT-RIATALSLALPINATMAAVE  753
            S        ++CN AL+++  +   G+ A+ KAC L++    + AL +ALP N   AAV 
Sbjct  181  SYSFLANTMVLCNFALVVTGMENCSGYLAVFKACSLLRRCGNSRALLMALPANLGAAAVG  240

Query  754  ALFQYRVVRAYH---DDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCEEHKDGRKK  924
            ALF YR+VRAYH     G    ALEGL IAYLY+LLIVLDTIV+  FF +C      +  
Sbjct  241  ALFHYRIVRAYHLSGRPGCIYMALEGLLIAYLYSLLIVLDTIVSCLFFKSC------KPT  294

Query  925  IAQDQSLACSCRSIKIVEG  981
               DQ+  C  + I++V+G
Sbjct  295  FQMDQTGGCHYQ-IELVKG  312



>ref|XP_009130173.1| PREDICTED: uncharacterized protein LOC103854959 [Brassica rapa]
Length=355

 Score =   132 bits (332),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 116/175 (66%), Gaps = 17/175 (10%)
 Frame = +1

Query  466  HIPLIHTQICNSLFTLSSLFIAFNL----ADYGLGLSSLF--FSAIGALVFSLI------  609
            ++PL+ T +CNSLF LS+   AF L    A +G    S +  FS   A+++S+I      
Sbjct  154  YLPLLRTYVCNSLFLLSANASAFALCFFIASFGFYSRSFYTLFSLASAIIYSIILANAYV  213

Query  610  -CNLALILSATQKR-GGFTA-LLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVR  780
              NLAL+ S +    GG+T  LLKAC+LI+ R +TAL+LALP N  +A VEALFQYRV R
Sbjct  214  ITNLALVSSTSSPSSGGYTTTLLKACLLIRGRASTALALALPTNLGLAGVEALFQYRVGR  273

Query  781  AYH--DDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCEEHKDGRKKIAQDQ  939
            +Y+  D G+ S A+EG+ IAYLYAL +VLDTIV++ F+ +C ++ + +KK  +D+
Sbjct  274  SYYKEDRGITSIAVEGMLIAYLYALFLVLDTIVSFLFYQSCLKNDEDQKKGREDE  328



>ref|XP_010938751.1| PREDICTED: uncharacterized protein LOC105057757 [Elaeis guineensis]
Length=316

 Score =   131 bits (329),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 111/291 (38%), Positives = 160/291 (55%), Gaps = 31/291 (11%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsssi  294
            M   + I+RRSI  F Q YH FT+IAT   FP +AS LL Q+ + S   I+ S+      
Sbjct  1    MGMATQIIRRSIHAFFQSYHSFTSIATLFVFPVSASLLLSQAFITSSAVILPSISSRLES  60

Query  295  lfsi-----------lHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWP  441
            LF             +  K+S TI   V  FP  L+  L  KAS++  +   +++    P
Sbjct  61   LFQAAGFPTSQFFSLVQLKISQTIFSFVFTFPFNLTFLLLAKASIVETIREFSHRNHA-P  119

Query  442  SFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADY--GLGLSSLFFSAIGAL  594
              S    LH  L+ T + NS   LS+       LF+ FN  D       +S   SA  A+
Sbjct  120  PLSSFLHLHRSLLLTYLFNSFAILSANATIFSLLFLVFNGVDIIGFSSSNSFLLSAAAAV  179

Query  595  VFSLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAVE  753
            ++S+I       CNLA+I++A +  GG+  +LKA +LI++R+ TAL+LALP N  MAA+E
Sbjct  180  LYSVIIANATVLCNLAIIVAAMENCGGYLPVLKAFMLIRSRLMTALTLALPANLGMAAIE  239

Query  754  ALFQYRVVRAYHDDGVFSAAL--EGLFIAYLYALLIVLDTIVAYFFFTTCE  900
            ALFQYRVVR YH    FS ++  E   I Y+++L+IVL+TI++  FF +C+
Sbjct  240  ALFQYRVVRPYHLSK-FSPSVIWEAFSITYMHSLIIVLETIMSCIFFESCK  289



>ref|XP_008781043.1| PREDICTED: uncharacterized protein LOC103700923 [Phoenix dactylifera]
Length=316

 Score =   131 bits (329),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 109/298 (37%), Positives = 157/298 (53%), Gaps = 33/298 (11%)
 Frame = +1

Query  127  SNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsssilfsi  306
            ++I+RRSI  F Q YH F +IAT   FP +AS LL Q+L+ S   I+ S+      LF  
Sbjct  3    THIIRRSIHAFFQSYHSFASIATLFVFPVSASLLLSQALVTSSSVILPSISSRLESLFQA  62

Query  307  -----------lHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWPSFSC  453
                       +  K+S TI    L  P T++  L  KAS+I  +    ++    P FS 
Sbjct  63   AGFPATQFFSLVRLKISQTIFSFTLTLPFTVTFLLLAKASIIEVIREFPSRSHAPPPFSS  122

Query  454  LFKLHIPLIHTQICNSLFTLSS-------LFIAFNLAD-----------YGLGLSSLFFS  579
               L+  L+ T + NSL  LS+       LF+ FN  D           +    +++ +S
Sbjct  123  FLHLYRSLLPTHLFNSLVILSANATIFSLLFLVFNAVDVIGFSSSNSLLFLSAAAAVLYS  182

Query  580  AIGALVFSLICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAVEAL  759
             I A   ++ICNLA+I+SA +   G   +LKAC+LI+ R+ TAL+LALP N  MAA+EAL
Sbjct  183  VIVANA-TVICNLAIIVSAMENSSGCLPVLKACMLIRGRVMTALTLALPPNLGMAAIEAL  241

Query  760  FQYRVVRAYH-DDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTC--EEHKDGRKK  924
            F YRVVR YH      S   E   I Y+++L+I+L+ I++  FF +C  E H +   K
Sbjct  242  FHYRVVRPYHLSKFSLSVIWEAFSITYMHSLVIILEIIMSCAFFRSCKLECHTNLENK  299



>ref|XP_010936510.1| PREDICTED: uncharacterized protein LOC105056131 [Elaeis guineensis]
Length=319

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 114/293 (39%), Positives = 156/293 (53%), Gaps = 33/293 (11%)
 Frame = +1

Query  130  NILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsssilfsil  309
             I RRSI  F Q YH F + A  L FP +A+TLL QSL  S  PI+ ++     +LF   
Sbjct  6    KITRRSIHAFFQSYHSFASTAALLVFPVSAATLLSQSLPLSSSPILRTISSRLRLLFEAA  65

Query  310  ------------HTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWPSFSC  453
                        + KLS  I   +   P TL   +  KASVI  +     +    P  S 
Sbjct  66   GFPASSQFFSLLNFKLSQAILTFISTLPFTLIFLILAKASVIQIIQEFPRRRLAPPPLSS  125

Query  454  LFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS----LFFSAIGALVF  600
            L  L+  L+ T + NSL  LS+       L +AFN+ D  L LSS    L  SA   +++
Sbjct  126  LLHLYPSLLLTFLSNSLVILSANAAIFSILVVAFNIPDI-LHLSSNNSILVLSAASVILY  184

Query  601  SLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAVEAL  759
            S++       CNLA+++SA +  GG+ ++LKA VLI+ R AT ++LALP + +MAAVEAL
Sbjct  185  SIVIANTMVACNLAIVISAMENSGGYLSILKALVLIRGRTATGITLALPASLSMAAVEAL  244

Query  760  FQYRVVRAYHDDGVFSAAL--EGLFIAYLYALLIVLDTIVAYFFFTTCEEHKD  912
            FQYRV+R YH    FS ++  E   I Y+Y+LLIVLDTI+   F   C+    
Sbjct  245  FQYRVMRPYHLSRKFSPSVIWEAFLITYIYSLLIVLDTIITCMFLRICKSESG  297



>ref|XP_007032623.1| Uncharacterized protein TCM_018662 [Theobroma cacao]
 gb|EOY03549.1| Uncharacterized protein TCM_018662 [Theobroma cacao]
Length=313

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 109/315 (35%), Positives = 159/315 (50%), Gaps = 41/315 (13%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIATFLAFPFAA------STlllqsllpsqipiihsl  276
            M+    I+R SI TFL+ +HYFTTI   L  PF+A      + +   S L S+       
Sbjct  1    MDCAGKIIRTSIHTFLKYFHYFTTIPVLLLLPFSAFVLLSQALITYSSPLLSETTYAQLD  60

Query  277  lpsssilfsilHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQ-----ECPWP  441
                   F       S T+   + + P  LSSF+  KAS+I A     NQ     + P+ 
Sbjct  61   SIFDLARFPFSSPLKSQTVFPFLFSLPFALSSFIIAKASIIQAF----NQHKLSLQAPFS  116

Query  442  SFSCLFKLHIPLIHTQICNSLF-------TLSSLFIAFN-LADYGLGLSSLFFSAIGALV  597
            SF  L+K   PL+ T +C+ +        T   LFI+ N L  + L   S    A GA+ 
Sbjct  117  SFKSLYK---PLLLTHLCSLVLIIAITSATFPLLFISLNSLKTFWLPDISQILPAFGAVF  173

Query  598  FS------LICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAVEAL  759
            +S      ++ NLAL+++  +   G  A+ KAC+L K + + AL L LP N  + ++EAL
Sbjct  174  YSFLANTIVVANLALVVAGMETCKGHVAIYKACLLRKGKNSMALLLFLPTNMGLVSIEAL  233

Query  760  FQYRVVRAYHDDGVF--SAALEGLFIAYLYALLIVLDTIVAYFFFTTCEEHKDGRKKIAQ  933
            F++RV+R Y   G    S ALEGL IAYLY+LLIVLDTI+   F+ +CE +    +    
Sbjct  234  FRFRVIRVYQILGGLNSSMALEGLLIAYLYSLLIVLDTIICCLFYKSCESNSMASR----  289

Query  934  DQSLACSCRSIKIVE  978
               +  SC  I++V+
Sbjct  290  ---IHRSCYDIELVQ  301



>ref|XP_009417032.1| PREDICTED: uncharacterized protein LOC103997509 [Musa acuminata 
subsp. malaccensis]
Length=966

 Score =   135 bits (340),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 108/288 (38%), Positives = 155/288 (54%), Gaps = 33/288 (11%)
 Frame = +1

Query  133  ILRRSIFTFLQKYHYFTTIATFLAFPFAAS------------Tlllqsllpsqipiihsl  276
            I+RRSI  F   YH FT IA  L FP +AS            T+L       +     + 
Sbjct  7    IMRRSINAFFHDYHCFTPIAVLLVFPASASLLLSQAPIPYSTTVLETISSRLRSLFQAAR  66

Query  277  lpsssilfsilHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWPSFSCL  456
             P +S  FS+L+ KL+ T    V   P  L+  L  KAS+IH +     ++   P  S  
Sbjct  67   FPVTSTFFSLLNVKLAQTGFSFVFTLPFVLTFLLLAKASIIHNVCGGPRRKRAPPRLSSS  126

Query  457  FKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS----LFFSAIGALVFS  603
             +L+  ++ T + NS   LS+       L +  N  D  LGLS+    L  SA GA+++S
Sbjct  127  LRLYRSILPTHLFNSCLVLSANASVFAFLSVVSNAVDL-LGLSTSNSMLVLSAAGAVLYS  185

Query  604  L-------ICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAVEALF  762
            +       IC+LA+++SAT    G+  +LKAC+LI+ R+ TALSLAL  N  +AAVEALF
Sbjct  186  IAVANTTVICSLAIVVSATDNCRGYIPVLKACMLIRGRVKTALSLALSANLGVAAVEALF  245

Query  763  QYRVVRAYHDDGVFSAAL--EGLFIAYLYALLIVLDTIVAYFFFTTCE  900
            QYRVVR Y   G   ++L  E L+I+Y++ALL+ L+ I+   FF +C+
Sbjct  246  QYRVVRQYDLSGKLDSSLLWEALYISYVHALLVALEVIMNCMFFKSCQ  293



>ref|XP_002530020.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32382.1| conserved hypothetical protein [Ricinus communis]
Length=285

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 99/288 (34%), Positives = 143/288 (50%), Gaps = 36/288 (13%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsssi  294
            ME P+ I+RRSI+T L+ +HYFT     L  PF+ S                S       
Sbjct  1    MEKPAKIIRRSIYTLLKDFHYFTNNPVILLLPFSVS--------LLLFRSTSSHQSFLVP  52

Query  295  lfsilHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWPSFSCLFKLHIP  474
                L       I   V + P  LSS +  KAS+I  L   T       + S L++   P
Sbjct  53   RLRFLDFNPCQLILSYVFSLPFALSSLIIAKASIIQYLDHKT-------TISSLYR---P  102

Query  475  LIHTQICNSLFTL-------SSLFIAFNLADYGLGLSS---LFFSAIGALVFS------L  606
            L+ T +C  L T+         L +A   A+   GLSS   +F  A+G + +       +
Sbjct  103  LLLTYLCGILLTIIISIAAYVLLLVASYSAEGIFGLSSKNHVFVMALGVVFYMVLTNTMI  162

Query  607  ICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRAY  786
            ICNL+L+++       + A+ KAC+L K   + AL LA PIN  +AA+E+LFQ+R+VRAY
Sbjct  163  ICNLSLVVAGMDNCNSYKAIQKACLLRKCTNSIALLLAFPINLGLAAIESLFQHRIVRAY  222

Query  787  HDDGVFSAAL--EGLFIAYLYALLIVLDTIVAYFFFTTCEEHKDGRKK  924
            H  G    ++  EGL IAY+++LLIVLDTI+  FF  +C    +  K+
Sbjct  223  HLFGRIDVSMIVEGLLIAYMFSLLIVLDTIICCFFIKSCYSQFELAKQ  270



>ref|XP_010045591.1| PREDICTED: uncharacterized protein LOC104434350 [Eucalyptus grandis]
 gb|KCW83666.1| hypothetical protein EUGRSUZ_B00548 [Eucalyptus grandis]
Length=339

 Score =   127 bits (318),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 90/216 (42%), Positives = 125/216 (58%), Gaps = 22/216 (10%)
 Frame = +1

Query  316  KLSHTIAISVLAFPSTLSSFLFCKASVIHAL-MMSTNQECPWPSFSCLFKLHIPLIHTQI  492
            KLS T+  S+   P T +  L  K+SVI  L  +  +   P+     +   + PL+ T +
Sbjct  85   KLSETVTSSIFTLPLTTTFLLIAKSSVIRRLAQVKADPSLPYSLPPDILSAYTPLLRTYV  144

Query  493  CNSLFTLSS-------LFIAFNLADYGLGLS----SLFFSAIGALVFSL-------ICNL  618
            C  L  LS+       LF  FN  + G  LS    SL  S + A+V+S+       ICNL
Sbjct  145  CGFLVILSANATAFFLLFFGFNCLE-GFQLSATEHSLSSSVVAAVVYSMVIANTFIICNL  203

Query  619  ALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRAYHDDG  798
            AL+LS T+K GG  A++KA ++++ R ATALS A+  N ++AA EALF+YRVV  YH  G
Sbjct  204  ALVLSGTEKHGGSLAIIKAYLMMRGRRATALSFAVIGNFSLAATEALFRYRVVAPYHASG  263

Query  799  VFSAA--LEGLFIAYLYALLIVLDTIVAYFFFTTCE  900
             FS    LEG +IAYLY++LIVLDT+V Y F  +C+
Sbjct  264  SFSLGILLEGCYIAYLYSVLIVLDTVVTYTFLRSCQ  299



>ref|XP_010939058.1| PREDICTED: uncharacterized protein LOC105058004 [Elaeis guineensis]
Length=319

 Score =   126 bits (316),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 118/301 (39%), Positives = 161/301 (53%), Gaps = 34/301 (11%)
 Frame = +1

Query  130  NILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsssilfsil  309
             I RRSI  F Q YH F T A  L FP +A+TLL QSL  S  PI+ ++     +LF   
Sbjct  6    EITRRSIHAFFQSYHSFATTAALLVFPVSAATLLSQSLTLSSSPILRTVSSRLRLLFEAA  65

Query  310  ------------HTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWPSFSC  453
                          K+S TI  S+   P T    +  KASVI  +          P FS 
Sbjct  66   GFPATSQFFSLLSFKISQTILTSISTLPFTHIFLILAKASVIQIIHEFPRCRLALPPFSS  125

Query  454  LFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS----LFFSAIGALVF  600
            L  L+  L+ T++ NSL  LS+       L + FN+AD  L LSS    L  SA  A+ +
Sbjct  126  LLHLYPSLLLTKLTNSLAILSANATIFSILLLVFNVADI-LHLSSSNSMLVLSAASAIFY  184

Query  601  SLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAVEAL  759
            S++       CNLA+++SA +  GG+ ++LKA VLI+ R ATA++LALP + +MAAVEAL
Sbjct  185  SIVIANTMVACNLAIVISAMENSGGYLSILKALVLIRGRTATAITLALPASLSMAAVEAL  244

Query  760  FQYRVVRAYHDDGVFSAAL--EGLFIAYLYALLIVLDTIVAYFFFTTCEEHKDGRKKIAQ  933
            FQ RV+R Y   G  + ++  E   I Y+Y+LLIVLDTI+   F  +C +  +G    A 
Sbjct  245  FQCRVMRPYRLSGNSNPSVIWEAFLITYIYSLLIVLDTIITCMFLKSC-KMGEGSHWYAY  303

Query  934  D  936
            D
Sbjct  304  D  304



>emb|CDX87208.1| BnaC09g05230D [Brassica napus]
Length=320

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 86/208 (41%), Positives = 120/208 (58%), Gaps = 31/208 (15%)
 Frame = +1

Query  376  LFCKASVIHALMMSTNQECPWPSFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAF  534
            LF KA +I   ++S N +     F  L         T ICNS F LS+        F+A 
Sbjct  100  LFSKAYIIK--LLSNNHDSSVYYFRIL--------KTCICNSFFLLSANASAFALFFLAS  149

Query  535  NLADYGLGLSS----LFFSAIGALVFSLI-------CNLALILSATQKRGGFTALLKACV  681
             + D  LG SS      FS   AL++S+I        NLAL+ S +   GG+T LLKAC+
Sbjct  150  TILD-SLGFSSRNFYTLFSLSSALIYSIILANAFVISNLALVSSPSSSSGGYTTLLKACL  208

Query  682  LIKTRIATALSLALPINATMAAVEALFQYRVVRAYH--DDGVFSAALEGLFIAYLYALLI  855
            L+  R +TAL+LALP N  +A VEALF+YRV+R+++  D  V   A+EG  IAYLYAL +
Sbjct  209  LLHGRTSTALALALPTNLGLAGVEALFRYRVMRSFYKGDRDVAWIAIEGTLIAYLYALFL  268

Query  856  VLDTIVAYFFFTTCEEHKDGRKKIAQDQ  939
            VLDT+V +FF+ +C E+++ +K    D+
Sbjct  269  VLDTVVNFFFYQSCVENEEEQKIGGDDE  296



>ref|XP_010546430.1| PREDICTED: uncharacterized protein LOC104818514 [Tarenaya hassleriana]
Length=291

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 94/250 (38%), Positives = 131/250 (52%), Gaps = 30/250 (12%)
 Frame = +1

Query  310  HTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWPSFSCLFKLHIPLIHTQ  489
            + KLS TI+ S+L +P ++S  LF KA VI  L+++        SFS L   +  L+ T 
Sbjct  45   NIKLSQTISSSLLTYPFSISFLLFSKAYVIRLLLLADKLSS---SFSVL---YFRLLRTY  98

Query  490  ICNSLFTLSS-------LFIAFNLADYGLGLSS----LFFSAIGALVFSLICNLALILS-  633
            ICNS   LS         F A NL     G SS     F S   A++F +I   AL++S 
Sbjct  99   ICNSFLILSVNASGFALFFFACNLLQ-AFGFSSEIFLAFLSVSAAVIFFVILANALVISN  157

Query  634  -------ATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRAY--  786
                   A        A+LKACVLI+ R +TALSL+LP N  +A VEALFQ R+V++Y  
Sbjct  158  LALALSAAETSSSSSMAILKACVLIRGRNSTALSLSLPTNLGLAGVEALFQCRIVKSYLS  217

Query  787  HDDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCEEHKDGRKKIAQDQSLACSCRSI  966
             D  + S  LEG+ IAYLYA+ +VLDT+  + F+ +C+   D R    +  S     R  
Sbjct  218  GDRDIASLVLEGMLIAYLYAIFVVLDTVANFLFYQSCK--NDQRTDPEEGFSSMIEIRET  275

Query  967  KIVEGLPW*K  996
            +  + + W K
Sbjct  276  ETAKCVVWSK  285



>emb|CDY42877.1| BnaAnng07020D [Brassica napus]
Length=1355

 Score =   122 bits (307),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 112/175 (64%), Gaps = 17/175 (10%)
 Frame = +1

Query  466  HIPLIHTQICNSLFTLSSLFIAFNLADY--GLGLSSLFFSAIGALVFS-----------L  606
            ++PL+ T +CNSLF LS+   AF +  +    GLSS  F  + +LV +           +
Sbjct  154  YLPLLRTYVCNSLFLLSANASAFAMCFFIASFGLSSRSFYTLFSLVSAIIYSIIIANAYV  213

Query  607  ICNLALILSATQKRGGFTA--LLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVR  780
            I NLAL+ S +    G     LLKAC+LI+ R +TAL+LALP N  +A VEALFQYRV R
Sbjct  214  ITNLALVSSTSSSSSGGYTTTLLKACLLIRGRASTALALALPTNLGLAGVEALFQYRVGR  273

Query  781  AYH--DDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCEEHKDGRKKIAQDQ  939
            +Y+  D G+ S A+EG+ IAYLYAL +VLDTIV++ F+ +C ++ + +KK  +D+
Sbjct  274  SYYKEDRGITSIAVEGMLIAYLYALFLVLDTIVSFLFYQSCLKNDEDQKKGREDE  328



>ref|XP_009790718.1| PREDICTED: uncharacterized protein LOC104238132 [Nicotiana sylvestris]
Length=178

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 79/109 (72%), Gaps = 2/109 (2%)
 Frame = +1

Query  604  LICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRA  783
            +I NLA+ILS  +K GG+ A+LKAC LI+ R AT+LSLAL +N  +AAVE LFQYR+VRA
Sbjct  53   IISNLAIILSGMEKIGGYMAILKACFLIRGRTATSLSLALIVNLALAAVEVLFQYRIVRA  112

Query  784  YHDD--GVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCEEHKDGRKK  924
            YH     + S ALEG+FIA+LY++L+VLDTI +  F  +  +   G K+
Sbjct  113  YHHKRTRLSSIALEGIFIAHLYSILLVLDTISSCVFLKSVRQIARGMKR  161



>ref|NP_001144457.1| hypothetical protein [Zea mays]
 gb|ACG40666.1| hypothetical protein [Zea mays]
 tpg|DAA55165.1| TPA: hypothetical protein ZEAMMB73_011676 [Zea mays]
Length=341

 Score =   116 bits (291),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 98/314 (31%), Positives = 155/314 (49%), Gaps = 46/314 (15%)
 Frame = +1

Query  133  ILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsssilfsil-  309
            ++R ++  F   YH FT++A  LA PF+A+ L  +++ PS   +        S+  +   
Sbjct  23   VMRAAVSAFFAGYHRFTSVAALLALPFSAAVLASEAMAPSSWALRAVAARLRSVFAAAGF  82

Query  310  ---------HTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQ--ECPWPSFSCL  456
                       KLS T+       P  L+  L  KA V   L +  +   E P P    +
Sbjct  83   PPSPFFALLEAKLSQTVFTFAATLPFALTFLLLAKACVAAMLRLRDDDASESPPPRRRRV  142

Query  457  FKLHIP-----------LIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS----L  570
                +P           ++ T + N+   LS+       L +AF  AD  LGL+S    L
Sbjct  143  AVAALPPCAAVARAYPAVVATHLLNAFLMLSANAAVFSLLLLAFGAADL-LGLTSHVWTL  201

Query  571  FFSAIGALVFSLI-------CNLALILSATQKR-GGFTALLKACVLIKTRIATALSLALP  726
              SA GA+V+SL+       CNLA++++AT+    G  A+L+ACV I+ R++TAL+LALP
Sbjct  202  ALSAAGAIVYSLVVGVATVVCNLAIVVAATEPGCAGHAAVLRACVAIRGRVSTALALALP  261

Query  727  INATMAAVEALFQYRVVRAYHDDGVFSAAL--EGLFIAYLYALLIVLDTIVAYFFFTTCE  900
             N  MAA EALF  RVV     DG  +  +  E   IAY++A+ +VL+ IV   F+ +C+
Sbjct  262  TNLGMAAAEALFGLRVVAQRRRDGRLAPGVAGEAFSIAYIHAICVVLEIIVTCMFYRSCK  321

Query  901  EHK-DGRKKIAQDQ  939
              + D  +++  ++
Sbjct  322  RSEADELRELEPEE  335



>ref|XP_002305952.2| hypothetical protein POPTR_0004s10270g [Populus trichocarpa]
 gb|EEE86463.2| hypothetical protein POPTR_0004s10270g [Populus trichocarpa]
Length=296

 Score =   115 bits (289),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 110/302 (36%), Positives = 148/302 (49%), Gaps = 41/302 (14%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsssi  294
            ME  + I+RRSI T L+ +HYFT+I T L  PF++S LL  S                  
Sbjct  1    MEKAAKIIRRSIHTLLKDFHYFTSIPTILLLPFSSSILLSLSFYQPCSLTRSIFQGRRVS  60

Query  295  lfsilHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWPSFSCLFKLHI-  471
            L  +    L   I + V + P  LSS +  KAS+I +L    N   P  S SC   + + 
Sbjct  61   LLVL---DLPQMIFVLVFSLPLALSSLVLAKASIIQSL----NHHKPVFSLSCSSPVSLC  113

Query  472  --PLIHTQICNS-------------LFTLSSLFIAFNLADYGLGLSSL--FFSAIGALVF  600
              PL+ T ICN              LF  SS F         L LSS+  FF     +VF
Sbjct  114  YKPLVLTCICNIILTVTITTTTLSFLFEASSFFKGL------LILSSIRPFFDLAAGIVF  167

Query  601  SLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAVEAL  759
             ++       CNLAL+++       + +L KAC+L K   + AL LALPIN  + A EAL
Sbjct  168  YMVLTNTMATCNLALVVAGIDNCTIYKSLRKACLLRKGTDSMALLLALPINLGLVATEAL  227

Query  760  FQYRVVRAYHDD-GVFSAA--LEGLFIAYLYALLIVLDTIVAYFFFTTCEEHKDGRKKIA  930
            F+YRVVRAY    G FS    LEGL I+YL++LL+VLDTI +Y F    +  +   K + 
Sbjct  228  FRYRVVRAYDPVFGRFSMPMLLEGLLISYLFSLLVVLDTISSYLFIRNLQFTRKSMKILL  287

Query  931  QD  936
             +
Sbjct  288  NE  289



>ref|XP_009415781.1| PREDICTED: uncharacterized protein LOC103996578 [Musa acuminata 
subsp. malaccensis]
Length=296

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 106/299 (35%), Positives = 154/299 (52%), Gaps = 40/299 (13%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsssi  294
            M     ILR S   F   YH F + A  L FP++  TLL QS   S   ++ ++     +
Sbjct  1    MGEAIKILRTSFHAFFLSYHTFISTAALLVFPYSIVTLLSQSSSSSSPYLLPAISSRLWL  60

Query  295  lf-----------silHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWP  441
            LF           ++L+ KLS      V A P   +S +  KASV   +          P
Sbjct  61   LFEASGFPSSHFFALLNVKLSQAAFSFVAALPLGATSLILAKASVFQTI------HGKLP  114

Query  442  SFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS----LFFSAIG  588
            S + L +L+  L+ T +CNS   L++       LF+AFN AD  L L+S    L  S  G
Sbjct  115  SLASLLRLYPSLVLTYLCNSFLVLAANAAVLSLLFLAFNAADV-LDLASSSLTLAISVAG  173

Query  589  ALVFSLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAA  747
             +++SL+       CN+A I+SA +  GG+  +L+A VL+  ++ATA++LALP +   AA
Sbjct  174  VILYSLVLAHALITCNMATIISAAENTGGYLCILEALVLVHGKMATAITLALPASLGAAA  233

Query  748  VEALFQYRVVRAYHDDG---VFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCE-EHKD  912
            +EALF  RV+R Y + G      A LE + IAY Y+LL+V DTI+   F  +C+ E KD
Sbjct  234  MEALFHCRVIRPYSESGGKLQPLAILEAVSIAYSYSLLLVFDTIITCNFVKSCKSEEKD  292



>gb|EPS68484.1| hypothetical protein M569_06284 [Genlisea aurea]
Length=311

 Score =   113 bits (283),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 95/292 (33%), Positives = 147/292 (50%), Gaps = 40/292 (14%)
 Frame = +1

Query  127  SNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsssilfsi  306
            + I+R+SIF FL+  H F++    LA P++A+ LL   L+ S      ++ P+       
Sbjct  8    TKIMRKSIFLFLRNIHLFSSSPALLAVPYSAAVLLFPPLVSSSSSSSAAVFPALRNRLDA  67

Query  307  lHTKLSHTIAI----SVLAFPSTLSSFLFCKASVIHALMMSTNQECPWPSFSCLFKLHIP  474
            L   L+  +A+    S+ AFP  +SS L  K   +  L     +  P P           
Sbjct  68   LSPPLARVLAVALVSSLFAFPLAISSLLLAKTRAVGVLKDEDGRSLPLPV----------  117

Query  475  LIHTQICNSLFT-------LSSLFIAFNLADYGLGLSS----LFFSAIGALVFSL-----  606
            L+  Q+C S          L +LF+  +L D  LG SS    +  + +GA+++S+     
Sbjct  118  LVAAQLCGSSLRWGVDAACLCALFVGSDLMD-DLGFSSRGMRIPIAGVGAVLYSILMSNA  176

Query  607  --ICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVR  780
              + NL+ I+    + G   ++L AC  +      A+ LA+P+N  +A VEALF+YRVVR
Sbjct  177  CIVSNLSAIVCMCSEGGVLRSILGAC-RVGIGGGAAIRLAMPMNVGLAGVEALFRYRVVR  235

Query  781  AYHDDGVF---SAALEGLFIAYLYALLIVLDTIVAYFF---FTTCEEHKDGR  918
             Y + G     S  +EG+FIAYLY+LL+VLDT+V +     F   EE +DGR
Sbjct  236  GYGERGGTADCSLVVEGMFIAYLYSLLLVLDTVVGFVLLKSFREGEEEEDGR  287



>ref|XP_002442380.1| hypothetical protein SORBIDRAFT_08g019150 [Sorghum bicolor]
 gb|EES16218.1| hypothetical protein SORBIDRAFT_08g019150 [Sorghum bicolor]
Length=341

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 95/314 (30%), Positives = 153/314 (49%), Gaps = 45/314 (14%)
 Frame = +1

Query  130  NILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsssilfsil  309
             ++R ++  F   YH FT++A  LA PF+A+ L  +++ PS   +        ++  +  
Sbjct  23   KVMRAAVSAFFAGYHCFTSVAALLALPFSAAVLASEAMAPSSGILRGVAARLRAVFAAAG  82

Query  310  ----------HTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQE----------  429
                        KLS T+       P  L+  L  KA V   L    +            
Sbjct  83   FPPSPFFALLEAKLSQTVFTFAATLPFALTFLLLAKACVAAMLRDDVDDGHRRRRRLAVA  142

Query  430  -CPWPSFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSSLFF---  576
                P    + + +  ++ T + N+   LS+       L +AF  AD  LGL+S F+   
Sbjct  143  VAKLPPCGAVARAYPAVVATHLLNAFLMLSANAAVFSLLLLAFGAADL-LGLTSHFWTLA  201

Query  577  -SAIGALVFSL-------ICNLALILSATQKR-GGFTALLKACVLIKTRIATALSLALPI  729
             SA GA+V+SL       +CNLA++++AT+    G  A+L+ACV I+ R++TAL+LALP 
Sbjct  202  LSAAGAIVYSLAVGVATVVCNLAVVVAATEPGCAGHAAVLRACVAIRGRVSTALALALPT  261

Query  730  NATMAAVEALFQYRVVRAYHDDG---VFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCE  900
            N  MAA EALF  RVV     DG       A E   IAY++A+ +VL+ IV+  F+ +C+
Sbjct  262  NLGMAAAEALFGLRVVAQRRKDGGRLAPGVAGEAFSIAYIHAICVVLEIIVSCMFYRSCK  321

Query  901  EHK-DGRKKIAQDQ  939
              + D  +++  ++
Sbjct  322  RSEADELRELEPEE  335



>gb|EYU35794.1| hypothetical protein MIMGU_mgv1a019183mg [Erythranthe guttata]
Length=313

 Score =   110 bits (276),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 120/311 (39%), Positives = 164/311 (53%), Gaps = 57/311 (18%)
 Frame = +1

Query  136  LRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllps-----------qipiihsllp  282
            +RRSIFTFLQ +H FT   + L  P+AA+TLL   LL S               + +  P
Sbjct  1    MRRSIFTFLQNFHRFTAAPSLLLLPYAAATLLSHPLLSSSYIFPIIHGRFTSIFLAAGFP  60

Query  283  sssilfsilHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWPSFSCLFK  462
             SS LFSIL+ KLS T+  S+   P TLS  L  K+SVI +L    +        +   +
Sbjct  61   PSSQLFSILNLKLSQTLLSSIFVSPFTLSFLLLSKSSVITSLQKFNSNNYSNKIITIFNR  120

Query  463  LHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS-----LFFSAIGALVFSL  606
            L +    TQICNSL  LS+       L IAFN++D  LGLSS     L  SAIGA+V+S+
Sbjct  121  LFV----TQICNSLVILSANATCFSLLVIAFNVSDLILGLSSHPRFVLLTSAIGAVVYSV  176

Query  607  I-------CNLALILSATQKRG----------GFTALLKACVLIK---TRIATALSLALP  726
            +       CNL+LILS   ++           GF++++ ACV++         ALSLA+ 
Sbjct  177  VLANACVVCNLSLILSGLLEKNNNNKKKKNCCGFSSIVDACVVLMRGGGGGGVALSLAVA  236

Query  727  INATMAAVEALFQYR-----VVRAYHDDGVFSA-----ALEGLFIAYLYALLIVLDTIVA  876
            +N  MAA+EALFQYR           D G  +A      LE + IAY+Y +++VLDTIV 
Sbjct  237  MNMGMAAIEALFQYRVVRAYYYYYRGDGGDVAALDWPVVLEAVVIAYMYGVVVVLDTIVG  296

Query  877  YFFFTTCEEHK  909
            + F  +CE  +
Sbjct  297  FVFLESCELDR  307



>ref|XP_008790099.1| PREDICTED: uncharacterized protein LOC103707406 [Phoenix dactylifera]
Length=319

 Score =   108 bits (271),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 111/288 (39%), Positives = 153/288 (53%), Gaps = 31/288 (11%)
 Frame = +1

Query  130  NILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsssilfsil  309
             I RRSI  F Q YH F + A  L FP +A+TLL  SL  S  PI+ ++     +LF   
Sbjct  6    EITRRSIHAFFQSYHSFASTAALLVFPVSAATLLSHSLTLSSSPILRTISSRLRLLFVAA  65

Query  310  ------------HTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWPSFSC  453
                        + +LS  I   +   P TL   +  KASVI  +          P FS 
Sbjct  66   GFPATSQFFSLLNFRLSQAILTFISTLPFTLVFLILAKASVIQIIWEFPRCRLAPPPFSS  125

Query  454  LFKLHIPLIHTQICNSLFTLSS-------LFIAFNLAD---YGLGLSSLFFSAIGALVFS  603
            L  L+  L+ +Q+ NSL  LS        L +AFN  D        S L  SA  A+++S
Sbjct  126  LLHLYPSLLLSQLSNSLAILSVNAVIFSILLLAFNAVDILHLSSSNSMLLLSATSAILYS  185

Query  604  LI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAVEALF  762
            ++       CNLA+++SAT+  GG+ ++LKA VLI+ R ATA++LALP +  MAAVEALF
Sbjct  186  MVNANAMVACNLAIVISATENNGGYLSILKALVLIRGRTATAITLALPASLGMAAVEALF  245

Query  763  QYRVVRAYHDDGVFSAAL--EGLFIAYLYALLIVLDTIVAYFFFTTCE  900
            Q RV+R YH  G  + ++  E   I Y+Y+LL+VLDTIV   F  +C+
Sbjct  246  QCRVMRPYHLSGKSNPSVIWEASLITYIYSLLVVLDTIVTCMFLKSCK  293



>ref|XP_009405888.1| PREDICTED: uncharacterized protein LOC103988924 [Musa acuminata 
subsp. malaccensis]
Length=313

 Score =   108 bits (269),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 85/239 (36%), Positives = 125/239 (52%), Gaps = 31/239 (13%)
 Frame = +1

Query  310  HTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWPSFSCLFKLHIPLIHTQ  489
            ++KLS +I   V   P  L+  L  KASV+      T         + L +L+  L  T 
Sbjct  77   NSKLSQSIFTFVSTLPFALTFSLLAKASVLR-----TTYGIRRRGAASLLRLYPSLALTH  131

Query  490  ICNSLFTLSS-------LFIAFNLAD---YGLGLSSLFFSAIGALVFSLI-------CNL  618
            + NS   LS+       LF+AFN+ D        S L  SA G +++S +       CNL
Sbjct  132  LFNSWLVLSANAAVLSLLFLAFNVLDALHLSSSGSVLVLSASGVILYSFVLANAVATCNL  191

Query  619  ALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRAYHDDG  798
            ++++SA   RGG+ ++LK  VL++ R ATA++L LP +  MAA+EALFQYRVVR Y    
Sbjct  192  SVVISAIDGRGGYHSILKTLVLLRGRTATAITLTLPASLGMAAIEALFQYRVVRPYRLTA  251

Query  799  VF--SAALEGLFIAYLYALLIVLDTIVAYFFFTTCE-------EHKDGRKKIAQDQSLA  948
             F  SA  E   I Y+++LL+VLDTI+A  F  +C         + D    +A ++ +A
Sbjct  252  RFHPSAIWEAFSIGYVHSLLVVLDTIMACVFLRSCRSTVWSRWSNYDHDVDVASEEKIA  310



>ref|XP_010089561.1| hypothetical protein L484_020951 [Morus notabilis]
 gb|EXB38032.1| hypothetical protein L484_020951 [Morus notabilis]
Length=291

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 97/273 (36%), Positives = 145/273 (53%), Gaps = 30/273 (11%)
 Frame = +1

Query  115  METPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsssi  294
            ME    I+R+S+ TFL+ +HYFTT    L  PF++S L+ Q L  S      SL  S   
Sbjct  10   MERTEKIMRKSVSTFLKHFHYFTTTPVLLVLPFSSSVLISQPLFSSSASSKFSLFLS---  66

Query  295  lfsilHTKLSHT-IAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWPSFSCLFKLHI  471
                 H   S + I+ S+   P  LSS L  KASVI+   ++++Q     SF  L++   
Sbjct  67   -----HDHFSRSFISPSIFVIPFALSSLLIAKASVINRHKLASSQATSL-SFLSLYR---  117

Query  472  PLIHTQICNSLFTLSS--------LFIAFNLADYGLGLSSLFFSAIGALVFS------LI  609
            PL+ T + N +  +S         L I  +L  +G   +++F +  G  +++      L+
Sbjct  118  PLLLTHLLNIILCISIHITSTFLLLIIIHSLGSFGF-FTAIFRTVCGIFLYAFVTNIILL  176

Query  610  CNLALILSATQKRGGFTALLKACVLIKTRIATALSL-ALPINATMAAVEALFQYRVVRAY  786
            CNLAL+++  +   G  A+ +A +L K + + AL   A   N  +A+VEALF +R+VR  
Sbjct  177  CNLALVVAGMENCSGCKAIYRAYLLRKGKNSMALIFWAFLTNLGLASVEALFCFRLVRP-  235

Query  787  HDDGVFSAALEGLFIAYLYALLIVLDTIVAYFF  885
            H     S ALEGL IAYLY+++IVLDTI   FF
Sbjct  236  HQRPSLSIALEGLLIAYLYSIIIVLDTIACCFF  268



>ref|XP_004962983.1| PREDICTED: uncharacterized protein LOC101755659 [Setaria italica]
Length=340

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 96/317 (30%), Positives = 155/317 (49%), Gaps = 49/317 (15%)
 Frame = +1

Query  127  SNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsssilfsi  306
            + ++R ++  F   YH FT++A  LA PF+A+ L  ++  PS   +  +     S+  + 
Sbjct  21   TRVMRAAVSAFFGGYHCFTSVAALLALPFSAAVLASEAAAPSSATLRGTAARLRSVFAAA  80

Query  307  l----------HTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQE---------  429
                         KLS T+       P  L+  L  KA V  A M+    +         
Sbjct  81   GFPPSPFFALLEAKLSQTVFTFAATLPFALTFLLLAKACV--AAMLRDRDDGGVAPPRRQ  138

Query  430  -----CPWPSFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSSLF  573
                    P    + + +  +  T + N+   LS+       L +AF  AD  LGL+S F
Sbjct  139  QRKLASALPPCGAVVRAYPAVAATHLLNAFLMLSANAAVFSLLLLAFGAADL-LGLTSHF  197

Query  574  F----SAIGALVFSL-------ICNLALILSATQKR-GGFTALLKACVLIKTRIATALSL  717
            +    SA GA+V+SL       +CNLA+I++AT+    G  A+L+ACV I+ R++TAL+L
Sbjct  198  WTLALSAAGAIVYSLAIGVATVVCNLAVIVAATEPGCAGHAAVLRACVAIRGRVSTALAL  257

Query  718  ALPINATMAAVEALFQYRVVRAYHDDGVFSAALEG--LFIAYLYALLIVLDTIVAYFFFT  891
            ALP N  MAA EALF  RVV      G  +  + G    IAY++A+ +VL+ IV+  F+ 
Sbjct  258  ALPTNLGMAAAEALFGLRVVAQRRSAGRLAPGVAGEAFSIAYIHAICVVLEIIVSCMFYR  317

Query  892  TCEEHK-DGRKKIAQDQ  939
            +C+  + D  +++  ++
Sbjct  318  SCKRSEADELRELEPEE  334



>ref|NP_001142588.1| uncharacterized protein LOC100274853 [Zea mays]
 gb|ACG25306.1| hypothetical protein [Zea mays]
Length=340

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 101/318 (32%), Positives = 161/318 (51%), Gaps = 52/318 (16%)
 Frame = +1

Query  133  ILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsssilf----  300
            ++R +   F   YH FT++A  LA PF+A+ L+ ++   +  P   +L   ++ L     
Sbjct  20   VMRAAASAFFAGYHCFTSVAALLALPFSAAVLVAEAAAAAPAPAPVALRALAARLRAVFA  79

Query  301  ----------silHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECP-----  435
                      ++L  KLS T+     A P  L+  L  KA V  A M+  +   P     
Sbjct  80   AAGFPPSPFFALLEAKLSQTVFTFAAALPFALTFLLLAKACV--AAMLRDDAASPRRHRR  137

Query  436  --WPSFSCL------FKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS-  567
              WP  + L       + +  ++ T +  +   LS+       L +AF  AD  LGL+S 
Sbjct  138  RMWPGVAALPACGAVARAYPAVLATHVLGAFLMLSANAAAFSLLLLAFGAADL-LGLTSR  196

Query  568  ---LFFSAIGALVFSL-------ICNLALILSATQKR-GGFTALLKACVLIKTRIATALS  714
               L  SA GA+ +SL       +CNLA++++AT+    G  A+L+ACV I+ R++TAL+
Sbjct  197  AWTLALSAAGAVAYSLAVGVAAVVCNLAVVVAATEPGCAGHAAVLRACVAIRGRVSTALA  256

Query  715  LALPINATMAAVEALFQYRVVRAYHDDGVFSAAL--EGLFIAYLYALLIVLDTIVAYFFF  888
            LALP N  MAA EALF  RVV     DG  + A+  E   IAY++A+ +VL+ IVA  F+
Sbjct  257  LALPTNLGMAAAEALFGLRVVAQRRKDGRLAPAVAAEAFSIAYIHAVCVVLEIIVACVFY  316

Query  889  TTCEEHK-DGRKKIAQDQ  939
             +C+  + D  +++  ++
Sbjct  317  RSCKRSEADELRELEPEE  334



>tpg|DAA47177.1| TPA: hypothetical protein ZEAMMB73_688937 [Zea mays]
Length=340

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 101/318 (32%), Positives = 161/318 (51%), Gaps = 52/318 (16%)
 Frame = +1

Query  133  ILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsssilf----  300
            ++R +   F   YH FT++A  LA PF+A+ L+ ++   +  P   +L   ++ L     
Sbjct  20   VMRAAASAFFAGYHCFTSVAALLALPFSAAVLVAEAAAAAPAPAPVALRALAARLRAVFA  79

Query  301  ----------silHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECP-----  435
                      ++L  KLS T+     A P  L+  L  KA V  A M+  +   P     
Sbjct  80   AAGFPPSPFFALLEAKLSQTVFTFAAALPFALTFLLLAKACV--AAMLRDDAASPRRHRR  137

Query  436  --WPSFSCL------FKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS-  567
              WP  + L       + +  ++ T +  +   LS+       L +AF  AD  LGL+S 
Sbjct  138  RRWPGVAALPACGAVARAYPAVLATHVLGAFLMLSANAAAFSLLLLAFGAADL-LGLTSR  196

Query  568  ---LFFSAIGALVFSL-------ICNLALILSATQKR-GGFTALLKACVLIKTRIATALS  714
               L  SA GA+ +SL       +CNLA++++AT+    G  A+L+ACV I+ R++TAL+
Sbjct  197  AWTLALSAAGAVAYSLAVGVAAVVCNLAVVVAATEPGCAGHAAVLRACVAIRGRVSTALA  256

Query  715  LALPINATMAAVEALFQYRVVRAYHDDGVFSAAL--EGLFIAYLYALLIVLDTIVAYFFF  888
            LALP N  MAA EALF  RVV     DG  + A+  E   IAY++A+ +VL+ IVA  F+
Sbjct  257  LALPTNLGMAAAEALFGLRVVAQRRRDGRLAPAVAAEAFSIAYIHAVCVVLEIIVACVFY  316

Query  889  TTCEEHK-DGRKKIAQDQ  939
             +C+  + D  +++  ++
Sbjct  317  RSCKRSEADELRELEPEE  334



>gb|EYU23500.1| hypothetical protein MIMGU_mgv1a011493mg [Erythranthe guttata]
Length=279

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 101/256 (39%), Positives = 136/256 (53%), Gaps = 38/256 (15%)
 Frame = +1

Query  145  SIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllp-----------sss  291
            +IFTFLQ Y  FT+ ++ LAFPFA STLL Q L+ S                      SS
Sbjct  18   AIFTFLQNYQCFTSTSSLLAFPFAVSTLLSQMLVYSSDVFPVIHARLRSLFLAAGFPLSS  77

Query  292  ilfsilHTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWPSFSCLFKLHI  471
             LFS+L+ KLS TI   +   P T S  L  KASVI     +  +E P  S S    L I
Sbjct  78   ELFSLLNLKLSQTILSFLFVSPFTYSFLLLAKASVIKTFDQNKPEENPRVSSS--ISLFI  135

Query  472  PLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS----LFFSAIGALVFS-----  603
            PL+ TQ+CNSL  L++       L I FN   Y LG+SS    +  SA+G +++S     
Sbjct  136  PLLITQLCNSLLILAANATCFFILVIFFNFL-YVLGISSPGPTMLVSALGVVIYSIVLAN  194

Query  604  --LICNLALILSATQKRGGFTALLKACVLI--KTRIATALSLALPI---NATMAAVEALF  762
              ++ NLAL+ +  +KRGGF ++LKACV+I  + R ATALSLA+PI   +  +   E + 
Sbjct  195  AYIVSNLALVSTGMEKRGGFISILKACVMILLQGRNATALSLAVPICTKDQRIIDEEEMH  254

Query  763  QYRVVRAYHDDGVFSA  810
             Y+ +     DG F A
Sbjct  255  SYK-IEIEDRDGKFLA  269



>gb|EEE53483.1| hypothetical protein OsJ_36632 [Oryza sativa Japonica Group]
Length=330

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 85/299 (28%), Positives = 141/299 (47%), Gaps = 44/299 (15%)
 Frame = +1

Query  127  SNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsssilfsi  306
              ++R ++  F   YH +T++A  L  PF+A+ L   ++       + ++      +F  
Sbjct  21   GRVMRAAVAAFFHGYHCYTSVAGLLVLPFSAAVLASGAMASPSSGALAAVSARIRRMFDA  80

Query  307  l-----------HTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWPSFSC  453
                        + KLS T+     A P TL+     +A           ++        
Sbjct  81   AGFPPSSFFALFNAKLSQTVFTFAAALPFTLTRGA-ARARRGEGDAAPAVRDLGGRVPGD  139

Query  454  LFKLHIPLIHTQICNS-LFTLSSLFIAFNLADYGLGLSS----------------LFFSA  582
                 +  +   + N+ +F+L  +F+AFN AD  LGL++                 +  A
Sbjct  140  GGDAPVRRVRDAVANAAVFSL--MFLAFNGADL-LGLTTTSHAAATLALSAAGAIAYSVA  196

Query  583  IGALVFSLICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAVEALF  762
            +G  + +++CNLA+++SA ++R G  A+L+ACV+I+ R+ TAL+LALP N  MAA EALF
Sbjct  197  VG--IATVVCNLAVVVSAMERRAGHAAVLRACVVIRGRVPTALALALPTNLGMAAAEALF  254

Query  763  QYRVVR-------AYHDDG---VFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCEEHK  909
            Q RVV        A   DG       A E   IAY++AL +VL+ IV+  F+ +C   +
Sbjct  255  QLRVVSQAQRHRLAGAGDGKRLAAGVAGEAFSIAYIHALCVVLEIIVSCMFYRSCRRSE  313



>gb|EAY83630.1| hypothetical protein OsI_38858 [Oryza sativa Indica Group]
Length=351

 Score = 99.4 bits (246),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 91/317 (29%), Positives = 146/317 (46%), Gaps = 59/317 (19%)
 Frame = +1

Query  127  SNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsssilfsi  306
              ++R ++  F   YH +T++A  L  PF+A+ L   ++       + ++      +F  
Sbjct  21   GRVMRAAVAAFFHGYHCYTSVAGLLVLPFSAAVLASGAMASPSSGALAAVSARIRRMFDA  80

Query  307  l-----------HTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQE--------  429
                        + KLS T+     A P TL+  L  KA V   L    + E        
Sbjct  81   AGFPPSSFFALLNAKLSQTVFTFAAALPFTLTFLLLAKACVAAMLRPDDDGEGVARRGRG  140

Query  430  ----CPWPSFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS---  567
                   P    +   +  ++ T +  +   LS+       +F+AFN AD  LGL++   
Sbjct  141  VARATRLPPCGSVAGAYPAMVATHLFGAFVMLSANAAVFSLMFLAFNGADL-LGLTTTSH  199

Query  568  -------------LFFSAIGALVFSLICNLALILSATQKRGGFTALLKACVLIKTRIATA  708
                          +  A+G  + +++CNLA+++SA ++R G  A+L+ACV+I+ R+ TA
Sbjct  200  AAATLALSAAGAIAYSVAVG--IATVVCNLAVVVSAMERRAGHAAVLRACVVIRGRVPTA  257

Query  709  LSLALPINATMAAVEALFQYRVVR-------AYHDDG---VFSAALEGLFIAYLYALLIV  858
            L+LALP N  MAA EALFQ RVV        A   DG       A E   IAY++AL +V
Sbjct  258  LALALPTNLGMAAAEALFQLRVVSQAQRHRLAGAGDGKRLAAGVAGEAFSIAYIHALCVV  317

Query  859  LDTIVAYFFFTTCEEHK  909
            L+ IV+  F+ +C   +
Sbjct  318  LEIIVSCMFYRSCRRSE  334



>ref|NP_001067114.1| Os12g0577200 [Oryza sativa Japonica Group]
 gb|ABA99058.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF30133.1| Os12g0577200 [Oryza sativa Japonica Group]
Length=351

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 91/317 (29%), Positives = 146/317 (46%), Gaps = 59/317 (19%)
 Frame = +1

Query  127  SNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllpsssilfsi  306
              ++R ++  F   YH +T++A  L  PF+A+ L   ++       + ++      +F  
Sbjct  21   GRVMRAAVAAFFHGYHCYTSVAGLLVLPFSAAVLASGAMASPSSGALAAVSARIRRMFDA  80

Query  307  l-----------HTKLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQE--------  429
                        + KLS T+     A P TL+  L  KA V   L    + E        
Sbjct  81   AGFPPSSFFALFNAKLSQTVFTFAAALPFTLTFLLLAKACVAAMLRPDDDGEGVARRGRG  140

Query  430  ----CPWPSFSCLFKLHIPLIHTQICNSLFTLSS-------LFIAFNLADYGLGLSS---  567
                   P    +   +  ++ T +  +   LS+       +F+AFN AD  LGL++   
Sbjct  141  VARATRLPPCGSVAGAYPAMVATHLFGAFVMLSANAAVFSLMFLAFNGADL-LGLTTTSH  199

Query  568  -------------LFFSAIGALVFSLICNLALILSATQKRGGFTALLKACVLIKTRIATA  708
                          +  A+G  + +++CNLA+++SA ++R G  A+L+ACV+I+ R+ TA
Sbjct  200  AAATLALSAAGAIAYSVAVG--IATVVCNLAVVVSAMERRAGHAAVLRACVVIRGRVPTA  257

Query  709  LSLALPINATMAAVEALFQYRVVR-------AYHDDG---VFSAALEGLFIAYLYALLIV  858
            L+LALP N  MAA EALFQ RVV        A   DG       A E   IAY++AL +V
Sbjct  258  LALALPTNLGMAAAEALFQLRVVSQAQRHRLAGAGDGKRLAAGVAGEAFSIAYIHALCVV  317

Query  859  LDTIVAYFFFTTCEEHK  909
            L+ IV+  F+ +C   +
Sbjct  318  LEIIVSCMFYRSCRRSE  334



>gb|AFK36617.1| unknown [Medicago truncatula]
Length=121

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 70/103 (68%), Gaps = 5/103 (5%)
 Frame = +1

Query  640  QKRGGFTALLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRAYHDDGVFS--AA  813
            +  GG++A+LKAC+LI+ + + AL LALP+N  +AA+EALF +R+VR YH  G       
Sbjct  2    EGHGGYSAILKACILIRGKTSMALFLALPVNIALAAIEALFHFRIVREYHIVGKARPIVL  61

Query  814  LEGLFIAYLYALLIVLDTIVAYFFFTTCEEHKDGRKKIAQDQS  942
            LEG+FIAYLY++ I+LDTIV+  F+ +    K G   I+Q+  
Sbjct  62   LEGIFIAYLYSIFIILDTIVSCLFYKSF---KTGESWISQEDK  101



>ref|XP_008648555.1| PREDICTED: uncharacterized protein LOC103629156 [Zea mays]
 gb|AFW74683.1| hypothetical protein ZEAMMB73_719723 [Zea mays]
Length=346

 Score = 72.0 bits (175),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 87/160 (54%), Gaps = 27/160 (17%)
 Frame = +1

Query  514  SSLFIAFNLADY----------------GLGLSSLFFSAIGALVFSLI-------CNLAL  624
            S+L  AFN A+                 G G + L  SA G +V+S+        CNLA 
Sbjct  163  SALLAAFNAAEAMHLLGAAPQPTSTSSPGSGRAVLALSAAGVIVYSVALANASAACNLAT  222

Query  625  ILSATQKRGGFTALLKACVLI--KTRIATALSLALPINATMAAVEALFQYRVVRAYHDDG  798
            +++A + RGG  A+LKA +++      ATA++ +LP +   AAVEALFQ RV+R Y   G
Sbjct  223  VVAAAEGRGGAHAVLKAVLMLLRSGDAATAVAASLPASLAAAAVEALFQLRVMRPYAATG  282

Query  799  VFSAAL--EGLFIAYLYALLIVLDTIVAYFFFTTCEEHKD  912
              +  +  EGL +AY++A++ VLDT+V    + +C+  + 
Sbjct  283  RVTPGMLWEGLLVAYIHAMVCVLDTVVTTMVYRSCKASRS  322



>ref|XP_010460285.1| PREDICTED: uncharacterized protein LOC104741188 [Camelina sativa]
Length=339

 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 74/139 (53%), Gaps = 9/139 (6%)
 Frame = +1

Query  490  ICNSLFTL--SSLFIAFNLADYGLGLSSLFFSAIGALVFSLICNLALILSATQKRGGFTA  663
            IC+S F L  S  F  +     GL  S +F +AI      +ICN A+++S  +   G  A
Sbjct  182  ICSSFFVLGFSPDFSVYGAILVGLAFSVVFANAI------IICNTAVVISVLEDVSGIGA  235

Query  664  LLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLY  843
            L++A VLIK +I   L + L     +A VE LF +RV +  + DG  S   EG  +  +Y
Sbjct  236  LVRASVLIKGQIQVGLLMFLGSTLGLAFVEGLFDHRVKKVSYGDGS-SRLWEGPLLVLMY  294

Query  844  ALLIVLDTIVAYFFFTTCE  900
            + + ++D++++  F+ +C 
Sbjct  295  SFVTLIDSMMSAVFYFSCR  313



>ref|XP_011004425.1| PREDICTED: uncharacterized protein LOC105110918 [Populus euphratica]
Length=113

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 44/67 (66%), Gaps = 2/67 (3%)
 Frame = +1

Query  604  LICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRA  783
            + CNLAL+++       + +L KAC+L K   + AL LALPIN  + A EALF+YRVVRA
Sbjct  8    VTCNLALVVAGIDNCTIYKSLRKACLLRKGTDSMALLLALPINLGLVATEALFRYRVVRA  67

Query  784  YHDDGVF  804
            Y  D VF
Sbjct  68   Y--DPVF  72



>ref|XP_004962922.1| PREDICTED: uncharacterized protein LOC101765523 [Setaria italica]
Length=333

 Score = 65.1 bits (157),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 76/122 (62%), Gaps = 11/122 (9%)
 Frame = +1

Query  568  LFFSAIGALVFSL-------ICNLALILSATQKRGGFTALLKA--CVLIKTRIATALSLA  720
            L  SA G +V+S+       +CNLA +++A + RGG  A+LKA   VL     ATA++ +
Sbjct  192  LALSAAGVIVYSVALANASAVCNLATVVAAAEGRGGAHAMLKALLMVLRAGDAATAVAAS  251

Query  721  LPINATMAAVEALFQYRVVRAYHDDGVFSAAL--EGLFIAYLYALLIVLDTIVAYFFFTT  894
            LP +   AAVEALFQ RV+R Y   G  +A +  EGL +AY++A++ VLDT++    + T
Sbjct  252  LPASLAAAAVEALFQLRVMRPYTLTGKVTAGMLCEGLLVAYIHAMICVLDTVITSMVYQT  311

Query  895  CE  900
            C+
Sbjct  312  CK  313



>ref|XP_003528573.1| PREDICTED: uncharacterized protein LOC100806351 [Glycine max]
 gb|KHN42927.1| hypothetical protein glysoja_007457 [Glycine soja]
Length=357

 Score = 64.7 bits (156),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 58/225 (26%), Positives = 110/225 (49%), Gaps = 23/225 (10%)
 Frame = +1

Query  316  KLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWPSFSCL----FKLHIPLIH  483
            + + T+  S + FP   +  L  KA+V++++  + +++    S  C+    F   I   +
Sbjct  118  RFAETVVSSAMCFPFYATLLLLSKAAVVYSVDCTYSRKKVDASKFCVIVAKFWRKILFTY  177

Query  484  TQICNSLFTLSSLF----IAFNLADYGLGLSS---LFFSAIGALVFS-------LICNLA  621
              +C  +    +LF    +AF  A   LG S    ++ + +  LVFS       +ICN+A
Sbjct  178  MWVCTVVVGCITLFCVFLVAFCSALAVLGFSPDVVVYCAMLVGLVFSVVFAKAIIICNIA  237

Query  622  LILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRAYHDDGV  801
            +++S  +   G  A+L++ +LIK +    L + L     MA VE LF++RV    + DG 
Sbjct  238  MVISVLEDVSGAQAMLRSSILIKGQTQVGLLIFLGSTIGMAFVEGLFEHRVKTLSYGDGS  297

Query  802  FSAALEGLFIAYLYALLIVLDTIVAYFFFTTCE----EHKDGRKK  924
             S   EG  +  +Y+ ++++D++++  F+ +C     E  D   K
Sbjct  298  -SRVWEGPLLVVMYSFVVLIDSMMSAVFYFSCRSSNMEISDSEGK  341



>ref|XP_010258226.1| PREDICTED: uncharacterized protein LOC104598044 [Nelumbo nucifera]
Length=366

 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 74/144 (51%), Gaps = 9/144 (6%)
 Frame = +1

Query  475  LIHTQICNSLFT--LSSLFIAFNLADYGLGLSSLFFSAIGALVFSLICNLALILSATQKR  648
            L+   ICN  F     S  + +     GL  S LF +AI      +ICNLA+++S  +  
Sbjct  202  LLMVAICNMFFMAGFPSTLLIYPAIMVGLVFSILFANAI------IICNLAIVISVLEDV  255

Query  649  GGFTALLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRAYHDDGVFSAALEGLF  828
             G  ALL++ VLI+ +    L + L     MA VE L+++RV    + DG  S   EG  
Sbjct  256  SGPQALLRSSVLIQGQTQVGLMIFLGSTMGMAFVEGLYEHRVKTLSYGDGS-SRIWEGPL  314

Query  829  IAYLYALLIVLDTIVAYFFFTTCE  900
            +  +Y+ ++++D+++   F+ TC 
Sbjct  315  LVIMYSFVVLMDSMMNAVFYFTCR  338



>ref|XP_010499015.1| PREDICTED: uncharacterized protein LOC104776618 [Camelina sativa]
Length=339

 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 47/157 (30%), Positives = 78/157 (50%), Gaps = 15/157 (10%)
 Frame = +1

Query  490  ICNSLFTL--SSLFIAFNLADYGLGLSSLFFSAIGALVFSLICNLALILSATQKRGGFTA  663
            IC+S F L  S  F  +     GL  S +F +AI      +ICN A+++S  +   G  A
Sbjct  182  ICSSFFVLGFSPDFSVYGAILVGLAFSVVFANAI------IICNTAVVISVLEDVSGVGA  235

Query  664  LLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLY  843
            L++A  LIK +I   L + L     +A VE LF +RV +  + DG  S   EG  +  +Y
Sbjct  236  LVRASDLIKGQIQVGLLMFLGSTLGLAFVEGLFDHRVKKVSYGDGS-SRLWEGPLLVLMY  294

Query  844  ALLIVLDTIVAYFFFTTC------EEHKDGRKKIAQD  936
            + + ++D++++  F+ +C      E  + G  +   D
Sbjct  295  SFVTLIDSMMSAVFYFSCRVYYSMEASRGGETQPIMD  331



>ref|XP_002443243.1| hypothetical protein SORBIDRAFT_08g016250 [Sorghum bicolor]
 gb|EES17081.1| hypothetical protein SORBIDRAFT_08g016250 [Sorghum bicolor]
Length=346

 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 80/131 (61%), Gaps = 12/131 (9%)
 Frame = +1

Query  544  DYGLGLSS-LFFSAIGALVFSL-------ICNLALILSATQKRGGFTALLKACVLI--KT  693
            D G G  + L  SA G +V+S+       +CNLA +++A + RGG  A+LKA +++    
Sbjct  194  DSGSGSRAVLALSAAGVIVYSVALANASAVCNLATVVAAAEGRGGAHAMLKAILMLLRAG  253

Query  694  RIATALSLALPINATMAAVEALFQYRVVRAYHDDGVFSAAL--EGLFIAYLYALLIVLDT  867
              ATA++ +LP +   AAVEALFQ RV+R Y   G  +  +  EGL +AY+++++ VLDT
Sbjct  254  DAATAVAASLPASLAAAAVEALFQLRVMRPYTATGKVTVGMLCEGLLVAYIHSMICVLDT  313

Query  868  IVAYFFFTTCE  900
            +V    + +C+
Sbjct  314  VVTSMVYQSCK  324



>ref|XP_008389435.1| PREDICTED: uncharacterized protein LOC103451785 [Malus domestica]
Length=355

 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 75/141 (53%), Gaps = 9/141 (6%)
 Frame = +1

Query  493  CN--SLFTLSSLFIAFNLADYGLGLSSLFFSAIGALVFSLICNLALILSATQKRGGFTAL  666
            CN  S+  LS  +I +     GL  S +F +AI      +ICN+A ++S  +   G  AL
Sbjct  196  CNACSIVGLSPNYIVYAAMVVGLAFSVVFANAI------IICNIAFVISVLEDVSGPEAL  249

Query  667  LKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLYA  846
            +++ VLIK +    L + L  +  MA VE LF++RV    + DG  S   EG  +  +Y+
Sbjct  250  VQSGVLIKGQTQVGLLIFLGSSIGMAFVEGLFEHRVKTLSYGDGS-SRIWEGPLLVIMYS  308

Query  847  LLIVLDTIVAYFFFTTCEEHK  909
             ++++D++ +  F+ +C   K
Sbjct  309  FVVLIDSMNSAVFYFSCRSLK  329



>ref|XP_010477835.1| PREDICTED: uncharacterized protein LOC104756877 [Camelina sativa]
Length=339

 Score = 63.2 bits (152),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/139 (32%), Positives = 73/139 (53%), Gaps = 9/139 (6%)
 Frame = +1

Query  490  ICNSLFTL--SSLFIAFNLADYGLGLSSLFFSAIGALVFSLICNLALILSATQKRGGFTA  663
            IC+S F L  S  F  +     GL  S +F +AI      +ICN A+++S  +   G  A
Sbjct  182  ICSSFFVLGFSPDFSVYGAILVGLAFSVVFANAI------IICNTAVVISVLEDVSGIGA  235

Query  664  LLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLY  843
            L++A  LIK +I   L + L     +A VE LF +RV +  + DG  S   EG  +  +Y
Sbjct  236  LVRASDLIKGQIQVGLLMFLGSTLGLAFVEGLFDHRVKKVSYGDGS-SRLWEGPLLVLMY  294

Query  844  ALLIVLDTIVAYFFFTTCE  900
            + + ++D++++  F+ +C 
Sbjct  295  SFVTLIDSMMSAVFYFSCR  313



>gb|KDP41249.1| hypothetical protein JCGZ_15656 [Jatropha curcas]
Length=364

 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/145 (30%), Positives = 78/145 (54%), Gaps = 15/145 (10%)
 Frame = +1

Query  490  ICNSLFTLS-----SLFIAFNLADYGLGLSSLFFSAIGALVFSLICNLALILSATQKRGG  654
            IC+SLF +      +L+ A  +   GL  S +F +AI      +ICN+ +++S  +   G
Sbjct  205  ICSSLFVIGFLPELNLYAAMMV---GLVFSVVFANAI------IICNVGIVISVLEDVSG  255

Query  655  FTALLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIA  834
              ALL + +LI+ +    L + L     MA VE LF++RV    + DG  S   EG  + 
Sbjct  256  PQALLHSSILIRGQTQVGLLIYLGSTIGMAFVEGLFEHRVKTLSYGDGS-SRIWEGPLLV  314

Query  835  YLYALLIVLDTIVAYFFFTTCEEHK  909
             +Y+ ++++DT+++  F+ +C  ++
Sbjct  315  IMYSFVVLIDTMMSAVFYFSCRSYR  339



>ref|XP_006844834.1| hypothetical protein AMTR_s00058p00077380 [Amborella trichopoda]
 gb|ERN06509.1| hypothetical protein AMTR_s00058p00077380 [Amborella trichopoda]
Length=382

 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 76/147 (52%), Gaps = 15/147 (10%)
 Frame = +1

Query  475  LIHTQICNSLFTL---SSLFI--AFNLADYGLGLSSLFFSAIGALVFSLICNLALILSAT  639
            L+ T +CN    +   SSL I  AF LA        + FS + A V  +ICNLA ++S  
Sbjct  216  LVLTTVCNMFVIMGVPSSLIIYPAFGLA--------VAFSVVFAHVI-IICNLANVISVL  266

Query  640  QKRGGFTALLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRAYHDDGVFSAALE  819
            +   G  A L+A  LI+ +    L + L     MA VE LF+YRV    + DG  S   E
Sbjct  267  EDLSGPRAFLRAVFLIRGQTQVGLLIFLGSTIGMAFVEGLFEYRVKTLSYGDGS-SRIWE  325

Query  820  GLFIAYLYALLIVLDTIVAYFFFTTCE  900
            G  +  +Y+ L+++D++++  F+ TC 
Sbjct  326  GPLLVVMYSFLVLIDSMMSAVFYFTCR  352



>ref|XP_004516573.1| PREDICTED: uncharacterized protein LOC101492424 [Cicer arietinum]
Length=365

 Score = 62.4 bits (150),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 70/127 (55%), Gaps = 11/127 (9%)
 Frame = +1

Query  550  GLGLSSLFFSAIGALVFSLICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPI  729
            GL  S +F +AI      +ICN+AL++S  +   G  A+L++ +LIK +    L + L  
Sbjct  228  GLVFSVIFANAI------IICNIALVISVLEDVSGAQAMLQSSILIKGQTQVGLLIYLGS  281

Query  730  NATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCE---  900
               MA VE LF++RV    + DG  S   EG  +  +Y+ ++++D++++  F+ +C    
Sbjct  282  TIGMAFVEGLFEHRVKTLSYGDGS-SRMWEGPLLVIMYSFVVLIDSMMSAVFYFSCRSFS  340

Query  901  -EHKDGR  918
             E+ +G 
Sbjct  341  VENSNGE  347



>ref|NP_001066845.1| Os12g0507400 [Oryza sativa Japonica Group]
 gb|ABA98691.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF29864.1| Os12g0507400 [Oryza sativa Japonica Group]
Length=328

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 77/125 (62%), Gaps = 10/125 (8%)
 Frame = +1

Query  556  GLSSLFFSAIGALVFSL-------ICNLA-LILSATQKRGGFTALLKACVLIKTRIATAL  711
            G + L  SA G +V+S+       +CNLA ++ +A   RGG  A+L+A +L++   ATA+
Sbjct  186  GRAVLALSAAGVIVYSVALANAAAVCNLATVVAAAEGGRGGARAVLRAVLLVRGDAATAV  245

Query  712  SLALPINATMAAVEALFQYRVVRAYHDDGVFSAAL--EGLFIAYLYALLIVLDTIVAYFF  885
            ++ALP     AAVE LFQ R+ R Y   G  ++++  EG  IAY+Y+++ VLDT++    
Sbjct  246  AVALPATLATAAVEGLFQLRIARPYAVTGELTSSMVCEGFLIAYIYSIICVLDTVITCMV  305

Query  886  FTTCE  900
            + TC+
Sbjct  306  YQTCK  310



>gb|EAY83254.1| hypothetical protein OsI_38462 [Oryza sativa Indica Group]
Length=328

 Score = 62.0 bits (149),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 77/125 (62%), Gaps = 10/125 (8%)
 Frame = +1

Query  556  GLSSLFFSAIGALVFSL-------ICNLA-LILSATQKRGGFTALLKACVLIKTRIATAL  711
            G + L  SA G +V+S+       +CNLA ++ +A   RGG  A+L+A +L++   ATA+
Sbjct  186  GRAVLALSAAGVIVYSVALANAAAVCNLATVVAAAEGGRGGARAVLRAVLLVRGDAATAV  245

Query  712  SLALPINATMAAVEALFQYRVVRAYHDDGVFSAAL--EGLFIAYLYALLIVLDTIVAYFF  885
            ++ALP     AAVE LFQ R+ R Y   G  ++++  EG  IAY+Y+++ VLDT++    
Sbjct  246  AVALPATLATAAVEGLFQLRIARPYAVTGELTSSMVCEGFLIAYIYSIICVLDTVITCMV  305

Query  886  FTTCE  900
            + TC+
Sbjct  306  YQTCK  310



>ref|XP_003556759.2| PREDICTED: uncharacterized protein LOC100789016 [Glycine max]
Length=361

 Score = 61.2 bits (147),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 66/117 (56%), Gaps = 7/117 (6%)
 Frame = +1

Query  550  GLGLSSLFFSAIGALVFSLICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPI  729
            GL  S +F +AI      +ICN+A+++S  +   G  A+L++ +LIK +    L + L  
Sbjct  224  GLVFSVVFANAI------IICNIAMVISVLEDVSGAQAMLRSSILIKGQTQVGLLIFLGS  277

Query  730  NATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCE  900
               MA VE LF++RV    + DG  S   EG  +  +Y+ ++++D++++  F+ +C 
Sbjct  278  TIGMAFVEGLFEHRVKTLSYGDGS-SRVWEGPLLVVMYSFVVLIDSMMSAVFYFSCR  333



>ref|NP_564252.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF87024.1|AC006535_2 T24P13.3 [Arabidopsis thaliana]
 gb|AEE30714.1| uncharacterized protein AT1G26650 [Arabidopsis thaliana]
Length=335

 Score = 61.2 bits (147),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 45/152 (30%), Positives = 78/152 (51%), Gaps = 5/152 (3%)
 Frame = +1

Query  490  ICNSLFTLSSLFIAFNLADYGLGLSSLFFSAIGALVFSLICNLALILSATQKRGGFTALL  669
            IC+S F++      FN+  YG  L  L FS + A    +ICN A+++S  +   G  AL+
Sbjct  179  ICSS-FSVLGFSPDFNV--YGAMLVGLAFSVVFANAI-IICNTAIVISVLEDVSGLGALM  234

Query  670  KACVLIKTRIATALSLALPINATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLYAL  849
            +A  LIK +I   L + L     +A VE LF +RV +  + DG  S   EG  +  +Y+ 
Sbjct  235  RASDLIKGQIQVGLLMFLGSTLGLAFVEGLFDHRVKKVSYGDGS-SRLWEGPLLVLMYSF  293

Query  850  LIVLDTIVAYFFFTTCEEHKDGRKKIAQDQSL  945
            + ++D++++  F+ +C  +        + Q +
Sbjct  294  VTLIDSMMSAVFYFSCRVYYSMEASRGETQPI  325



>ref|XP_010250356.1| PREDICTED: uncharacterized protein LOC104592610 [Nelumbo nucifera]
Length=227

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 60/101 (59%), Gaps = 8/101 (8%)
 Frame = +1

Query  601  SLICNLALILSATQKRG-GFTALLKACVLIKTRIATALSLALPINATMAAVEALFQYRVV  777
            +++ NLA +LS  +    GF +L+KA  LI+ R  TAL + L  N  +  VE LF++R+ 
Sbjct  128  TVVGNLARVLSVLENECYGFASLMKAKSLIEGRRQTALLMTLFSNVGLRLVECLFEFRMC  187

Query  778  RAYHDDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCE  900
            +         +  EGL +A +Y+L++VLDT++   F+ TC+
Sbjct  188  KGM-------SLWEGLMLASMYSLVLVLDTVMNVVFYYTCK  221



>ref|XP_010237231.1| PREDICTED: uncharacterized protein LOC100823289 [Brachypodium 
distachyon]
 gb|ACF22685.1| hypothetical protein-2 [Brachypodium distachyon]
Length=317

 Score = 60.8 bits (146),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 74/126 (59%), Gaps = 17/126 (13%)
 Frame = +1

Query  574  FSAIGALVFSL-------ICNLALILSATQ---KRGG-----FTALLKACVLIKTRIATA  708
             SA G +V+S+       +CNLA +++A +    RGG       ALL          ATA
Sbjct  174  LSAAGVIVYSVALANAAAVCNLATVVAAAEPGRDRGGCGAVLRAALLLLARGGGADAATA  233

Query  709  LSLALPINATMAAVEALFQYRVVRAYHDDGVFSAAL--EGLFIAYLYALLIVLDTIVAYF  882
            +++ALP +   AAVE LFQ RV+R Y  DG  ++A+  EGL IAY+++++ VLDT+V + 
Sbjct  234  VAVALPASLATAAVEGLFQLRVMRLYMADGRITSAMVCEGLLIAYIHSMICVLDTVVTFI  293

Query  883  FFTTCE  900
             + TC+
Sbjct  294  VYQTCK  299



>ref|XP_010258644.1| PREDICTED: uncharacterized protein LOC104598320 [Nelumbo nucifera]
Length=364

 Score = 60.8 bits (146),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 73/138 (53%), Gaps = 9/138 (7%)
 Frame = +1

Query  493  CN--SLFTLSSLFIAFNLADYGLGLSSLFFSAIGALVFSLICNLALILSATQKRGGFTAL  666
            CN  S+    S  I +     GL  S +F +A      ++ICNLA+++S  +   G  AL
Sbjct  206  CNIVSIVGCPSSVIVYPAVMMGLVFSIIFANA------TIICNLAIVISVLEDISGPQAL  259

Query  667  LKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLYA  846
            L++ VLI+ +    L + L     MA VE LF+ RV    + DG  S   EG  +  +Y+
Sbjct  260  LRSGVLIQGQTQVGLIIYLGSTIGMALVEGLFENRVKTLSYGDGP-SRIWEGPLLVIMYS  318

Query  847  LLIVLDTIVAYFFFTTCE  900
            +++++D++++  F+ TC 
Sbjct  319  IVVLVDSMMSAVFYFTCR  336



>gb|AAK59463.1| unknown protein [Arabidopsis thaliana]
 gb|AAL34175.1| unknown protein [Arabidopsis thaliana]
Length=138

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 37/116 (32%), Positives = 64/116 (55%), Gaps = 7/116 (6%)
 Frame = +1

Query  550  GLGLSSLFFSAIGALVFSLICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPI  729
            GL  S +F +AI      +ICN A+++S  +   G  AL++A  LIK +I   L + L  
Sbjct  4    GLAFSVVFANAI------IICNTAIVISVLEDVSGLGALMRASDLIKGQIQVGLLMFLGS  57

Query  730  NATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTC  897
               +A VE LF +RV +  + DG  S   EG  +  +Y+ + ++D++++  F+ +C
Sbjct  58   TLGLAFVEGLFDHRVKKVSYGDGS-SRLWEGPLLVLMYSFVTLIDSMMSAVFYFSC  112



>ref|XP_004299927.1| PREDICTED: uncharacterized protein LOC101307497 [Fragaria vesca 
subsp. vesca]
Length=358

 Score = 60.8 bits (146),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 41/142 (29%), Positives = 74/142 (52%), Gaps = 9/142 (6%)
 Frame = +1

Query  490  ICN--SLFTLSSLFIAFNLADYGLGLSSLFFSAIGALVFSLICNLALILSATQKRGGFTA  663
            +CN  S+F LS   I +     GL  S +F +AI      +ICN+A+++   +   G  A
Sbjct  198  VCNTCSVFGLSPQLIIYAAIMVGLIFSVVFANAI------IICNIAMVICVLEDVSGPEA  251

Query  664  LLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLY  843
            L+++  LI+ +    L + L     MA VE LF++RV    + DG  S   EG  +  +Y
Sbjct  252  LVQSGALIRGQTQVGLLIFLGSTVGMAFVEGLFEHRVKTLSYGDGS-SRIWEGPLLVVMY  310

Query  844  ALLIVLDTIVAYFFFTTCEEHK  909
            + ++++D+++   F+ +C   +
Sbjct  311  SFVVLIDSMMNAVFYFSCRSFR  332



>ref|XP_006348815.1| PREDICTED: uncharacterized protein LOC102581421 [Solanum tuberosum]
Length=358

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 66/114 (58%), Gaps = 4/114 (4%)
 Frame = +1

Query  604  LICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRA  783
            +ICN+A+++S  +   G  ALL++  LIK +    L + L     M  VE LF++RV   
Sbjct  229  IICNIAIVISVLEDDSGPEALLRSSSLIKGQTQVGLLIFLGSTIGMTFVEGLFEHRVKII  288

Query  784  YHDDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCEEHKDGRKKIAQDQSL  945
             ++DG  S   EG  +  LY+ ++++D++++  F+ +C+ +   R + + ++SL
Sbjct  289  SYEDGS-SRIWEGPLLVILYSFVMLIDSMMSTVFYFSCKSY---RMEASNEESL  338



>gb|KFK41365.1| hypothetical protein AALP_AA2G120500 [Arabis alpina]
Length=346

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 73/141 (52%), Gaps = 9/141 (6%)
 Frame = +1

Query  490  ICNSLFTL--SSLFIAFNLADYGLGLSSLFFSAIGALVFSLICNLALILSATQKRGGFTA  663
            +C+S F L  S  F A+     GLG S +F + I      +ICN  +++S  +   G  A
Sbjct  184  VCSSFFVLGFSPDFNAYGAILIGLGFSVVFANVI------IICNTTMVISILEDVSGPLA  237

Query  664  LLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLY  843
            L++A  LIK +    L + L     M  VE LF++RV    + DG  S   EG  +  +Y
Sbjct  238  LVRASDLIKGQTQVGLLIFLGSTIGMTFVEGLFEHRVKILSYGDGS-SRIWEGPLLVVMY  296

Query  844  ALLIVLDTIVAYFFFTTCEEH  906
            + ++++DT+++  F+ +C  +
Sbjct  297  SFVVLIDTMMSAVFYFSCRSY  317



>ref|XP_002312265.1| hypothetical protein POPTR_0008s09100g [Populus trichocarpa]
 gb|EEE89632.1| hypothetical protein POPTR_0008s09100g [Populus trichocarpa]
Length=360

 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 68/129 (53%), Gaps = 12/129 (9%)
 Frame = +1

Query  565  SLFFSAIGALVFSLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLAL  723
            +L+ + I  LVFS+I       CN+A+++S      G  ALL++ VLI+ +    L + L
Sbjct  215  NLYAAMIVGLVFSVIFANAIIVCNIAVVISVLVDVSGPQALLRSSVLIRGQTQVGLLIFL  274

Query  724  PINATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCEE  903
                 MA +E LF++RV    + DG  S   EG  +  +Y+ ++++D +++  F+ +C  
Sbjct  275  GSTIGMAFIEGLFEHRVKTLSYGDGS-SRIWEGPLLVIMYSFVVLIDLMMSAVFYYSCRS  333

Query  904  H----KDGR  918
            H     DG 
Sbjct  334  HGMEASDGE  342



>ref|XP_008339849.1| PREDICTED: uncharacterized protein LOC103402858 [Malus domestica]
Length=355

 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 75/141 (53%), Gaps = 9/141 (6%)
 Frame = +1

Query  493  CN--SLFTLSSLFIAFNLADYGLGLSSLFFSAIGALVFSLICNLALILSATQKRGGFTAL  666
            CN  S+  LS  +I +      L  S +F +A+      +ICN+A+++S  +   G  AL
Sbjct  196  CNACSIVGLSPNYIVYAAMVVALIFSVVFANAV------IICNIAIVISVLEDVSGPEAL  249

Query  667  LKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLYA  846
            +++ VLIK +    L + L  +  MA VE LF++RV    + DG  S   EG  +  +Y+
Sbjct  250  VQSGVLIKGQTQVGLLIFLGSSIGMAFVEGLFEHRVKTLSYGDGS-SRIWEGPLLVIMYS  308

Query  847  LLIVLDTIVAYFFFTTCEEHK  909
             ++++D++ +  F+ +C   K
Sbjct  309  FVVLIDSMNSAVFYFSCRSFK  329



>ref|XP_004239096.1| PREDICTED: uncharacterized protein LOC101256486 [Solanum lycopersicum]
Length=355

 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 74/133 (56%), Gaps = 11/133 (8%)
 Frame = +1

Query  568  LFFSAIGALVFSLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALP  726
            L+ + I  ++FS+I       CN+A+++S  +   G  ALL++  LIK +    L + L 
Sbjct  211  LYTAMIVGIIFSIILANAMIICNIAVVISVLEDDSGPEALLRSSSLIKGQTQVGLLIFLG  270

Query  727  INATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCEEH  906
                M  VE LF++RV    ++DG  S   EG  +  LY+ ++++D++++  F+ +C+ +
Sbjct  271  STIGMTFVEGLFEHRVKIISYEDGS-SRIWEGPLLVILYSFVMLIDSMMSTVFYFSCKSY  329

Query  907  KDGRKKIAQDQSL  945
               R + + ++SL
Sbjct  330  ---RMEASNEESL  339



>ref|XP_002893390.1| hypothetical protein ARALYDRAFT_472743 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69649.1| hypothetical protein ARALYDRAFT_472743 [Arabidopsis lyrata subsp. 
lyrata]
Length=335

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/152 (29%), Positives = 77/152 (51%), Gaps = 5/152 (3%)
 Frame = +1

Query  490  ICNSLFTLSSLFIAFNLADYGLGLSSLFFSAIGALVFSLICNLALILSATQKRGGFTALL  669
            IC+S F++      FN+  YG  L  L FS + A    +ICN A+++S  +   G  A++
Sbjct  179  ICSS-FSVLGFSPDFNV--YGAMLVGLAFSVVFANAI-IICNTAIVISVLEDVSGLGAMM  234

Query  670  KACVLIKTRIATALSLALPINATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLYAL  849
            +A  LIK  I   L + L     +A VE LF +RV +  + DG  S   EG  +  +Y+ 
Sbjct  235  RASDLIKGHIQVGLLMFLGSTLGLAFVEGLFDHRVKKVSYGDGS-SRLWEGPLLVLMYSF  293

Query  850  LIVLDTIVAYFFFTTCEEHKDGRKKIAQDQSL  945
            + ++D++++  F+ +C  +        + Q +
Sbjct  294  VTLIDSMMSAVFYFSCRVYYSMEASRGETQPI  325



>ref|XP_006483093.1| PREDICTED: uncharacterized protein LOC102625077 [Citrus sinensis]
Length=361

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/135 (26%), Positives = 73/135 (54%), Gaps = 2/135 (1%)
 Frame = +1

Query  511  LSSLFIAFNLADYGLGLSSLFFSAIGALVFSLICNLALILSATQKRGGFTALLKACVLIK  690
            +S+++ + +L  Y   +  L FS + A    +ICN+ +++S  +   G  AL ++ VLI+
Sbjct  206  VSAIWFSPDLVFYAAIVVGLVFSVVYANAI-VICNIGIVISVLEDVSGVQALFRSGVLIR  264

Query  691  TRIATALSLALPINATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLYALLIVLDTI  870
             +    L + L     M  +E LF++RV    + DG  S   EG  +  +Y+ ++++D++
Sbjct  265  GQTQVGLLIFLGSTVGMGFIEGLFEHRVTTLSYGDGS-SRLWEGPLLVIMYSFVVLIDSM  323

Query  871  VAYFFFTTCEEHKDG  915
            ++  F+ +C+ +  G
Sbjct  324  MSAVFYFSCKSYGMG  338



>gb|EYU28808.1| hypothetical protein MIMGU_mgv1a026893mg [Erythranthe guttata]
Length=357

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 60/102 (59%), Gaps = 1/102 (1%)
 Frame = +1

Query  604  LICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRA  783
            +ICN+A+++S  +   G  ALL++  LIK +    L + L     MA VE LF++RV   
Sbjct  236  IICNIAVVISVLEDVSGPQALLRSSSLIKGQTQVGLLIFLGSTIGMAFVEGLFEHRVKTL  295

Query  784  YHDDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCEEHK  909
             + DG  S   EG  +  +Y+ ++++D++++  F+ +C+ ++
Sbjct  296  SYGDGS-SRIWEGPLLVVMYSFVVLIDSMMSAVFYFSCKSYR  336



>ref|XP_009105492.1| PREDICTED: uncharacterized protein LOC103831343 [Brassica rapa]
Length=340

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 73/141 (52%), Gaps = 9/141 (6%)
 Frame = +1

Query  490  ICNSLFTL--SSLFIAFNLADYGLGLSSLFFSAIGALVFSLICNLALILSATQKRGGFTA  663
            +C+S F L  S  F A+     GLG S +F + I      +ICN  +++S  +   G  A
Sbjct  178  VCSSFFVLGFSPDFNAYGAILIGLGFSVVFANVI------IICNTTIVISILEDVSGPRA  231

Query  664  LLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLY  843
            L++A  LIK +    L + L     +  VE LF++RV    + DG  S   EG  +  +Y
Sbjct  232  LVRANDLIKGQTQVGLLIFLGSTIGLTFVEGLFEHRVKILSYGDGS-SRIWEGPLLVVMY  290

Query  844  ALLIVLDTIVAYFFFTTCEEH  906
            + ++++DT+++  F+ +C  +
Sbjct  291  SFVVLIDTMMSAVFYFSCRSY  311



>ref|XP_006306437.1| hypothetical protein CARUB_v10012379mg [Capsella rubella]
 gb|EOA39335.1| hypothetical protein CARUB_v10012379mg [Capsella rubella]
Length=341

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/154 (29%), Positives = 75/154 (49%), Gaps = 9/154 (6%)
 Frame = +1

Query  490  ICNSLFTL--SSLFIAFNLADYGLGLSSLFFSAIGALVFSLICNLALILSATQKRGGFTA  663
            IC+S   L  S  F  +     GL  S +F +AI      +ICN A+++S  +   G  A
Sbjct  185  ICSSFSVLGFSPDFSVYGAILVGLAFSVVFANAI------IICNTAVVISVLEDVSGIGA  238

Query  664  LLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLY  843
            L++A  LIK  I   L + L     +A VE LF +RV +  + DG  S   EG  +  +Y
Sbjct  239  LVRASDLIKGHIQVGLLMFLGSTLGLAFVEGLFDHRVKKVSYGDGS-SRLWEGPLLVLMY  297

Query  844  ALLIVLDTIVAYFFFTTCEEHKDGRKKIAQDQSL  945
            + + ++D++++  F+ +C  +        + Q +
Sbjct  298  SFVTLIDSMMSAVFYFSCRVYYSMETSRGETQPI  331



>ref|XP_006438763.1| hypothetical protein CICLE_v10033399mg [Citrus clementina]
 gb|ESR52003.1| hypothetical protein CICLE_v10033399mg [Citrus clementina]
Length=361

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 68/124 (55%), Gaps = 9/124 (7%)
 Frame = +1

Query  568  LFFSAIG-ALVFSL-------ICNLALILSATQKRGGFTALLKACVLIKTRIATALSLAL  723
            +F++AI   LVFS+       ICN+ +++S  +   G  AL ++ VLI+ +    L + L
Sbjct  216  VFYAAIVVGLVFSVVYANAIVICNIGIVISVLEDVSGVQALFRSGVLIRGQTQVGLLIFL  275

Query  724  PINATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCEE  903
                 M  +E LF++RV    + DG  S   EG  +  +Y+ ++++D++++  F+ +C+ 
Sbjct  276  GSTVGMGFIEGLFEHRVTTLSYGDGS-SRLWEGPLLVIMYSFVVLIDSMMSAVFYFSCKS  334

Query  904  HKDG  915
            +  G
Sbjct  335  YGMG  338



>ref|XP_002522492.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39984.1| conserved hypothetical protein [Ricinus communis]
Length=363

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/132 (29%), Positives = 72/132 (55%), Gaps = 8/132 (6%)
 Frame = +1

Query  550  GLGLSSLFFSAIGALVFSLICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPI  729
            GL  S +F +AI      +ICN+A+++S  +   G  ALL++ +LI+ +    L + L  
Sbjct  226  GLVFSVVFANAI------VICNIAIVISVLEDVSGPQALLRSSILIRGQTQVGLLIYLGS  279

Query  730  NATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCEEHK  909
               +A VE LF++RV    + DG  S   EG  +  +Y+ ++++D +++  F+ +C  ++
Sbjct  280  TIGLAFVEGLFEHRVKTLSYGDGS-SRIWEGPLLVIMYSFVVLIDLMMSAIFYFSCRSYR  338

Query  910  DGRKKIAQDQSL  945
                  A+ QS+
Sbjct  339  TEASD-AESQSI  349



>gb|KEH30805.1| transmembrane protein, putative [Medicago truncatula]
Length=358

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 70/126 (56%), Gaps = 11/126 (9%)
 Frame = +1

Query  550  GLGLSSLFFSAIGALVFSLICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPI  729
            GL  S +F +AI      +IC++AL++S  +   G  A+L++ +LIK +    L + L  
Sbjct  221  GLVFSVVFANAI------IICSVALVISVLEDVSGAQAMLRSSILIKGQTQVGLLIYLGS  274

Query  730  NATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCE---  900
               MA VE LF++RV    + DG  S   EG  +  +Y+ ++++D++++  F+ +C    
Sbjct  275  TIGMAFVEGLFEHRVKTLSYGDGS-SRMWEGPLLVIMYSFVVLIDSMMSAVFYFSCRSFS  333

Query  901  -EHKDG  915
             E+ +G
Sbjct  334  MENSNG  339



>emb|CDP00381.1| unnamed protein product [Coffea canephora]
Length=361

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 60/102 (59%), Gaps = 1/102 (1%)
 Frame = +1

Query  601  SLICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVR  780
            ++ICN+A+++S  +   G  ALL++  L+K +    L + L     MA VE LF++RV  
Sbjct  235  TIICNIAIVISVLEDVSGPQALLRSSSLVKGQTQVGLLIFLGSTIGMAMVEGLFEHRVKT  294

Query  781  AYHDDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCEEH  906
              + DG  S   EG  +  +Y+ ++++D++++  F+ +C+ +
Sbjct  295  LSYGDGS-SRIWEGPLLVIMYSFVVLIDSMMSAVFYFSCKSY  335



>gb|KCW56258.1| hypothetical protein EUGRSUZ_I02003, partial [Eucalyptus grandis]
Length=300

 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 68/132 (52%), Gaps = 17/132 (13%)
 Frame = +1

Query  553  LGLSSLFFSAIGALVFSLICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPIN  732
            L L+S   S   A   S +C++AL +   +      A+ +AC L + R + AL +ALP  
Sbjct  147  LALTSRTVSCAIAANLSAVCDVALAIVGIENCSASEAIRRACSL-RRRESAALLIALPHY  205

Query  733  ATMAAVEAL--FQYRVV-------RAYHDDGVFSAALEGLFIAYLYALLIVLDTIVAYFF  885
               AAVEAL  F+YR V       R Y        A EGL IA++Y++++VLDTI    +
Sbjct  206  LCFAAVEALCWFRYRSVMEGLSAERPY-----LGMASEGLVIAWMYSVVVVLDTIACGLY  260

Query  886  FTTCEEHK--DG  915
              +CE +   DG
Sbjct  261  VKSCESNSRADG  272



>ref|XP_010419096.1| PREDICTED: uncharacterized protein LOC104704761 [Camelina sativa]
Length=320

 Score = 59.3 bits (142),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 46/160 (29%), Positives = 81/160 (51%), Gaps = 13/160 (8%)
 Frame = +1

Query  490  ICNSLFTLSSLFIAFNLADYGLGLSSLFFSAIGALVFSLICNLALILSATQKRGGFTALL  669
            +C+S + L     + + + YG  L  L FS + A V  +ICN  +++S  +   G  ALL
Sbjct  165  VCSSFYVLG---FSPDFSAYGAILVGLVFSVVFANVI-IICNTTIVISILEDVSGPEALL  220

Query  670  KACVLIKTRIATALSLALPINATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLYAL  849
            +A  LIK +    L + L     +  VE LF++RV    + DG  S   EG  +  +Y+ 
Sbjct  221  RASDLIKGQTQVGLLIFLGSTIGLTFVEGLFEHRVKSLSYGDGS-SRLWEGPLLVVMYSF  279

Query  850  LIVLDTIVAYFFFTTC--------EEHKDGRKKIAQDQSL  945
            ++++DT+++  F+ +C        E  +   + ++QD SL
Sbjct  280  VVLIDTMMSAVFYFSCRSYSMEAVEALEASGEIVSQDLSL  319



>ref|XP_007045989.1| Son of sevenless [Theobroma cacao]
 gb|EOY01821.1| Son of sevenless [Theobroma cacao]
Length=360

 Score = 59.3 bits (142),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/136 (29%), Positives = 70/136 (51%), Gaps = 11/136 (8%)
 Frame = +1

Query  523  FIAFNLADYGLGLSSLFFSAIGALVFSLICNLALILSATQKRGGFTALLKACVLIKTRIA  702
             I + +   GL  S +F +AI      ++CN+ +++   ++  G  ALL+A VLIK +  
Sbjct  214  LIVYAVIMMGLVFSVVFANAI------VVCNIGIVICVLEEVSGLQALLRAGVLIKGQTQ  267

Query  703  TALSLALPINATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLYALLIVLDTIVAYF  882
              L + L     +A VE LF++RV    + DG  S   EG  +  +Y+ ++++D+++   
Sbjct  268  VGLLIFLGSTIGLAFVEGLFEHRVKTLSYGDGS-SRIWEGPLLVIMYSFVVLVDSMMNTV  326

Query  883  FFTTCE----EHKDGR  918
            F+ +C     E  DG 
Sbjct  327  FYFSCRSYSVEASDGE  342



>ref|XP_009404772.1| PREDICTED: uncharacterized protein LOC103988010 [Musa acuminata 
subsp. malaccensis]
Length=332

 Score = 59.3 bits (142),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 66/120 (55%), Gaps = 8/120 (7%)
 Frame = +1

Query  604  LICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRA  783
            ++CNLA ++S  ++  G  ALL++  LI+ +    L + L     MA VE LF++RV   
Sbjct  208  IVCNLASVISVLEEVSGLLALLRSVRLIRGQTQAGLLMFLGSTIGMAFVEGLFEHRVKTL  267

Query  784  YHDDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTC------EEHKDGRK-KIAQDQS  942
             + +G  S   EG  + ++Y+ ++++D++++  F+ TC      E   DGR  K  Q+ S
Sbjct  268  SYGNGS-SRLWEGPLLVFMYSFVVLIDSMMSAVFYFTCRSSVMEELDGDGRALKGTQNAS  326



>ref|XP_010030783.1| PREDICTED: uncharacterized protein LOC104420686 [Eucalyptus grandis]
Length=287

 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 68/132 (52%), Gaps = 17/132 (13%)
 Frame = +1

Query  553  LGLSSLFFSAIGALVFSLICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPIN  732
            L L+S   S   A   S +C++AL +   +      A+ +AC L + R + AL +ALP  
Sbjct  134  LALTSRTVSCAIAANLSAVCDVALAIVGIENCSASEAIRRACSL-RRRESAALLIALPHY  192

Query  733  ATMAAVEAL--FQYRVV-------RAYHDDGVFSAALEGLFIAYLYALLIVLDTIVAYFF  885
               AAVEAL  F+YR V       R Y        A EGL IA++Y++++VLDTI    +
Sbjct  193  LCFAAVEALCWFRYRSVMEGLSAERPY-----LGMASEGLVIAWMYSVVVVLDTIACGLY  247

Query  886  FTTCEEHK--DG  915
              +CE +   DG
Sbjct  248  VKSCESNSRADG  259



>ref|XP_003607775.1| ATP synthase subunit beta [Medicago truncatula]
Length=409

 Score = 59.3 bits (142),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 70/126 (56%), Gaps = 11/126 (9%)
 Frame = +1

Query  550  GLGLSSLFFSAIGALVFSLICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPI  729
            GL  S +F +AI      +IC++AL++S  +   G  A+L++ +LIK +    L + L  
Sbjct  221  GLVFSVVFANAI------IICSVALVISVLEDVSGAQAMLRSSILIKGQTQVGLLIYLGS  274

Query  730  NATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCE---  900
               MA VE LF++RV    + DG  S   EG  +  +Y+ ++++D++++  F+ +C    
Sbjct  275  TIGMAFVEGLFEHRVKTLSYGDGS-SRMWEGPLLVIMYSFVVLIDSMMSAVFYFSCRSFS  333

Query  901  -EHKDG  915
             E+ +G
Sbjct  334  MENSNG  339



>ref|XP_006415943.1| hypothetical protein EUTSA_v10008119mg [Eutrema salsugineum]
 gb|ESQ34296.1| hypothetical protein EUTSA_v10008119mg [Eutrema salsugineum]
Length=341

 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 72/139 (52%), Gaps = 9/139 (6%)
 Frame = +1

Query  490  ICNSLFTL--SSLFIAFNLADYGLGLSSLFFSAIGALVFSLICNLALILSATQKRGGFTA  663
            IC+S   L  S  F  +     GL  S +F +AI      +ICN A+++S  +   G  A
Sbjct  184  ICSSFSVLGFSPDFSVYGAILVGLAFSVVFANAI------IICNTAIVISVLEDVSGAGA  237

Query  664  LLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLY  843
            L++A  LIK +I   L + L     +A VE LF +RV +  + DG  S   EG  +  +Y
Sbjct  238  LVRASDLIKGQIQVGLLIFLGSTLGLAFVEGLFDHRVKKVSYGDGS-SRLWEGPLLVLMY  296

Query  844  ALLIVLDTIVAYFFFTTCE  900
            + + ++D++++  F+ +C 
Sbjct  297  SFVTLIDSMMSAVFYFSCR  315



>ref|XP_010511970.1| PREDICTED: uncharacterized protein LOC104788003 [Camelina sativa]
 ref|XP_010511971.1| PREDICTED: uncharacterized protein LOC104788003 [Camelina sativa]
Length=348

 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 46/160 (29%), Positives = 80/160 (50%), Gaps = 13/160 (8%)
 Frame = +1

Query  490  ICNSLFTLSSLFIAFNLADYGLGLSSLFFSAIGALVFSLICNLALILSATQKRGGFTALL  669
            +C+S + L     + +   YG  L  L FS + A V  +ICN  +++S  +   G  ALL
Sbjct  193  VCSSFYVLG---FSPDFNAYGAILVGLVFSVVFANVI-IICNTTIVISILEDVSGPEALL  248

Query  670  KACVLIKTRIATALSLALPINATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLYAL  849
            +A  LIK +    L + L     +  VE LF++RV    + DG  S   EG  +  +Y+ 
Sbjct  249  RASDLIKGQTQVGLLIFLGSTIGLTFVEGLFEHRVKSLSYGDGS-SRLWEGPLLVVMYSF  307

Query  850  LIVLDTIVAYFFFTTC--------EEHKDGRKKIAQDQSL  945
            ++++DT+++  F+ +C        E  +   + ++QD SL
Sbjct  308  VVLIDTMMSAVFYFSCRSYSMEAVEALEASGEIVSQDLSL  347



>emb|CDX95932.1| BnaA07g27990D [Brassica napus]
Length=317

 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 73/141 (52%), Gaps = 9/141 (6%)
 Frame = +1

Query  490  ICNSLFTL--SSLFIAFNLADYGLGLSSLFFSAIGALVFSLICNLALILSATQKRGGFTA  663
            +C+S F L  S  F A+     GLG S +F + I      +ICN  +++S  +   G  A
Sbjct  155  VCSSFFVLGFSPDFNAYGAILIGLGFSVVFANVI------IICNTTIVISILEDVSGPRA  208

Query  664  LLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLY  843
            L++A  LIK +    L + L     +  VE LF++RV    + DG  S   EG  +  +Y
Sbjct  209  LVRANDLIKGQTQVGLLIFLGSTIGLTFVEGLFEHRVKILSYGDGS-SRIWEGPLLVVMY  267

Query  844  ALLIVLDTIVAYFFFTTCEEH  906
            + ++++DT+++  F+ +C  +
Sbjct  268  SFVVLIDTMMSAVFYFSCRSY  288



>gb|KDO83041.1| hypothetical protein CISIN_1g018046mg [Citrus sinensis]
Length=361

 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/135 (26%), Positives = 73/135 (54%), Gaps = 2/135 (1%)
 Frame = +1

Query  511  LSSLFIAFNLADYGLGLSSLFFSAIGALVFSLICNLALILSATQKRGGFTALLKACVLIK  690
            +S+++ + +L  Y   +  L FS + A    +ICN+ +++S  +   G  AL ++ VLI+
Sbjct  206  VSAIWFSPDLVFYAAIVVGLVFSVVYANAI-VICNIGIVISVLEDVSGAQALFRSGVLIR  264

Query  691  TRIATALSLALPINATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLYALLIVLDTI  870
             +    L + L     M  +E LF++RV    + DG  S   EG  +  +Y+ ++++D++
Sbjct  265  GQTQVGLLIFLGSTVGMGFIEGLFEHRVTTLSYGDGS-SRLWEGPLLVIMYSFVVLIDSM  323

Query  871  VAYFFFTTCEEHKDG  915
            ++  F+ +C+ +  G
Sbjct  324  MSAVFYFSCKSYGMG  338



>emb|CDY40929.1| BnaC06g30670D [Brassica napus]
Length=317

 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 73/141 (52%), Gaps = 9/141 (6%)
 Frame = +1

Query  490  ICNSLFTL--SSLFIAFNLADYGLGLSSLFFSAIGALVFSLICNLALILSATQKRGGFTA  663
            +C+S F L  S  F A+     GLG S +F + I      +ICN  +++S  +   G  A
Sbjct  155  VCSSFFVLGFSPDFNAYGAIFIGLGFSVVFANVI------IICNTTIVISILEDVSGPRA  208

Query  664  LLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLY  843
            L++A  LIK +    L + L     +  VE LF++RV    + DG  S   EG  +  +Y
Sbjct  209  LVRANDLIKGQTQVGLLIFLGSTIGLTFVEGLFEHRVKILSYGDGS-SRIWEGPLLVVMY  267

Query  844  ALLIVLDTIVAYFFFTTCEEH  906
            + ++++DT+++  F+ +C  +
Sbjct  268  SFVVLIDTMMSAVFYFSCRSY  288



>ref|XP_011012681.1| PREDICTED: uncharacterized protein LOC105116878 [Populus euphratica]
 ref|XP_011012689.1| PREDICTED: uncharacterized protein LOC105116878 [Populus euphratica]
Length=360

 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 66/127 (52%), Gaps = 11/127 (9%)
 Frame = +1

Query  550  GLGLSSLFFSAIGALVFSLICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPI  729
            G+  S +F +AI      +ICN A+++   +   G  ALL++ VLI+ +    L + L  
Sbjct  223  GIAFSVVFANAI------IICNTAVVVCMLEDVSGPQALLRSSVLIRGQTQVGLLIFLGS  276

Query  730  NATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCE---  900
               MA +E LF++RV    + DG  S   EG  +  +Y+ ++++D +++  F+ +C    
Sbjct  277  TIGMAMIEGLFEHRVKTLSYGDGS-SRIWEGPLLVVMYSFVVLIDLMMSAVFYYSCRSYS  335

Query  901  -EHKDGR  918
             E  DG 
Sbjct  336  METSDGE  342



>ref|XP_009421085.1| PREDICTED: uncharacterized protein LOC104000701 [Musa acuminata 
subsp. malaccensis]
Length=327

 Score = 57.8 bits (138),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 68/127 (54%), Gaps = 6/127 (5%)
 Frame = +1

Query  604  LICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRA  783
            ++CNLA ++S  ++  G  A L++  LI+ +    L + L     M  V+ LF++RV   
Sbjct  202  IVCNLAGVVSVLEEISGLRAFLRSVRLIRGKRQVGLLMFLGSTIGMGFVQGLFEHRVKTV  261

Query  784  YHDDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTC-----EEHKDGRKKIAQDQSLA  948
             + DG  S   EG  + ++Y+ ++++D++++  F+ TC     EE  +   ++ + ++++
Sbjct  262  SYGDGS-SRLWEGPLLVFMYSFVVLVDSMMSAVFYFTCRSSIIEETDEDVHELEEKENVS  320

Query  949  CSCRSIK  969
                 IK
Sbjct  321  TEVTDIK  327



>ref|XP_010551632.1| PREDICTED: uncharacterized protein LOC104822182 [Tarenaya hassleriana]
Length=352

 Score = 57.8 bits (138),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 41/149 (28%), Positives = 79/149 (53%), Gaps = 5/149 (3%)
 Frame = +1

Query  490  ICNSLFTLSSLFIAFNLADYGLGLSSLFFSAIGALVFSLICNLALILSATQKRGGFTALL  669
            IC+S    S L ++ +L  YG  +  + FS + A    +ICN A+++   +   G  AL+
Sbjct  191  ICSSF---SVLGLSPDLHTYGAIVVGMVFSVVFANAI-IICNTAIVVCILEDLSGHRALV  246

Query  670  KACVLIKTRIATALSLALPINATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLYAL  849
            +A  LIK +    L + L     +A VE LF++RV    + DG  S   EG  +  +Y+ 
Sbjct  247  RASDLIKGQTQVGLLIFLGSTIGLAFVEGLFEHRVKNLSYGDGS-SRIWEGPLLVVMYSF  305

Query  850  LIVLDTIVAYFFFTTCEEHKDGRKKIAQD  936
            ++++D++++  F+ +C  ++    +I ++
Sbjct  306  VVLVDSMMSAVFYFSCRFYRSEGCRILRE  334



>ref|XP_009624255.1| PREDICTED: uncharacterized protein LOC104115351 [Nicotiana tomentosiformis]
Length=362

 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 68/121 (56%), Gaps = 8/121 (7%)
 Frame = +1

Query  568  LFFSAIGALVFSLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALP  726
            L+ + I  ++FS+I       CN+A+++S  +   G  ALL++  LIK +    L + L 
Sbjct  218  LYPAMIVGMIFSIILANAMIICNIAIVISVLEDDSGPQALLRSSSLIKGQTQVGLLIFLG  277

Query  727  INATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCEEH  906
                MA VE LF++RV    + +G  S   EG  +  +Y+ ++++D++++  F+ +C+ +
Sbjct  278  STIGMAFVEGLFEHRVKILSYGNGS-SRIWEGPLLVIMYSFVMLIDSMMSTVFYFSCKSY  336

Query  907  K  909
            +
Sbjct  337  R  337



>ref|XP_002315026.2| hypothetical protein POPTR_0010s17080g [Populus trichocarpa]
 gb|EEF01197.2| hypothetical protein POPTR_0010s17080g [Populus trichocarpa]
Length=360

 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 66/127 (52%), Gaps = 11/127 (9%)
 Frame = +1

Query  550  GLGLSSLFFSAIGALVFSLICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPI  729
            GL  S +F +AI      +ICN A+++   +   G  ALL++ VLI+ +    L + L  
Sbjct  223  GLAFSVVFANAI------IICNTAVVVCMLEDVSGPQALLRSSVLIRGQTQVGLLIFLGS  276

Query  730  NATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCE---  900
               MA +E LF++RV    + DG  S   EG  +  +++ ++++D +++  F+ +C    
Sbjct  277  TIGMAMIEGLFEHRVKTLSYGDGS-SRIWEGPLLVVMHSFVVLIDLMMSAVFYYSCRSYS  335

Query  901  -EHKDGR  918
             E  DG 
Sbjct  336  METSDGE  342



>ref|XP_009795710.1| PREDICTED: uncharacterized protein LOC104242365 [Nicotiana sylvestris]
Length=362

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/134 (28%), Positives = 75/134 (56%), Gaps = 13/134 (10%)
 Frame = +1

Query  568  LFFSAIGALVFSLI-------CNLALILSATQKRGGFTALLKACVLIKTRIATALSLALP  726
            L+ + I  ++FS+I       CN+A+++S  +   G  ALL++  LIK +    L + L 
Sbjct  218  LYPAMIVGMIFSIILANAMIICNIAIVISVLEDDSGAQALLRSSSLIKGQTQVGLLIFLG  277

Query  727  INATMAAVEALFQYRV-VRAYHDDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCEE  903
                MA VE LF++RV + +Y ++   S   EG  +  +Y+ ++++D++++  F+  C+ 
Sbjct  278  STIGMAFVEGLFEHRVKILSYGNES--SRIWEGPLLVIMYSFVMLVDSMMSTVFYFRCKS  335

Query  904  HKDGRKKIAQDQSL  945
            +   R + + ++SL
Sbjct  336  Y---RMEASNEESL  346



>ref|XP_010470929.1| PREDICTED: uncharacterized protein LOC104750779 [Camelina sativa]
Length=351

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 81/161 (50%), Gaps = 15/161 (9%)
 Frame = +1

Query  490  ICNSLFTLSSLFIAFNLADYGLGLSSLFFSAIGALVFSLICNLALILSATQKRGGFTALL  669
            +C+S + L      FN   YG  L  L FS + A V  +ICN  +++S  +   G  ALL
Sbjct  196  VCSSFYVLG-FSPGFN--AYGAILVGLVFSVVFANVI-IICNTTIVISILEDVSGPEALL  251

Query  670  KACVLIKTRIATALSLALPINATMAAVEALFQYRVVRAYHDDGVFSAAL-EGLFIAYLYA  846
            +A  LIK +    L + L     +  VE LF++RV    + DG  S  L EG  +  +Y+
Sbjct  252  RASDLIKGQTQVGLLIFLGSTIGLTFVEGLFEHRVKSLSYGDG--SPRLWEGPLLVVMYS  309

Query  847  LLIVLDTIVAYFFFTTC--------EEHKDGRKKIAQDQSL  945
             ++++DT+++  F+ +C        E  +   + ++QD SL
Sbjct  310  FVVLIDTMMSAVFYFSCRSYSMEAVEALEASGEIVSQDLSL  350



>ref|XP_002887236.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63495.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=348

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 81/162 (50%), Gaps = 17/162 (10%)
 Frame = +1

Query  490  ICNSLFTL--SSLFIAFNLADYGLGLSSLFFSAIGALVFSLICNLALILSATQKRGGFTA  663
            +C+S + L  S  F A+     GL  S +F +AI      +ICN  +++S  +   G  A
Sbjct  193  VCSSFYVLGFSPDFNAYGAILVGLVFSVVFANAI------IICNTTIVISILEDVSGPQA  246

Query  664  LLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLY  843
            L++A  LIK +    L + L     +  VE LF++RV    + DG  S   EG  +  +Y
Sbjct  247  LVRASDLIKGQTQVGLLIFLGSTIGLTFVEGLFEHRVKSLSYGDGS-SRLWEGPLLVVMY  305

Query  844  ALLIVLDTIVAYFFFTTC--------EEHKDGRKKIAQDQSL  945
            + ++++DT+++  F+ +C        E  +   + ++QD SL
Sbjct  306  SFVVLIDTMMSAVFYFSCRSYSMEAVEALEASGEIVSQDLSL  347



>ref|NP_177102.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAG60093.1|AC073178_4 unknown protein [Arabidopsis thaliana]
 gb|AAX55097.1| hypothetical protein At1g69430 [Arabidopsis thaliana]
 gb|AAZ52711.1| hypothetical protein At1g69430 [Arabidopsis thaliana]
 gb|AEE34924.1| uncharacterized protein AT1G69430 [Arabidopsis thaliana]
Length=350

 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 81/162 (50%), Gaps = 17/162 (10%)
 Frame = +1

Query  490  ICNSLFTL--SSLFIAFNLADYGLGLSSLFFSAIGALVFSLICNLALILSATQKRGGFTA  663
            +C+S + L  S  F A+     GL  S +F +AI      +ICN  +++S  +   G  A
Sbjct  195  VCSSFYVLGFSPDFNAYGAILVGLVFSVVFANAI------IICNTTIVISILEDVSGPGA  248

Query  664  LLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLY  843
            L++A  LIK +    L + L     +  VE LF++RV    + DG  S   EG  +  +Y
Sbjct  249  LVRASDLIKGQTQVGLLIFLGSTIGLTFVEGLFEHRVKSLSYGDGS-SRLWEGPLLVVMY  307

Query  844  ALLIVLDTIVAYFFFTTC--------EEHKDGRKKIAQDQSL  945
            + ++++DT+++  F+ +C        E  +   + ++QD SL
Sbjct  308  SFVVLIDTMMSAVFYFSCRSYSMEAVEALEASGEIVSQDLSL  349



>ref|XP_006391017.1| hypothetical protein EUTSA_v10018794mg [Eutrema salsugineum]
 gb|ESQ28303.1| hypothetical protein EUTSA_v10018794mg [Eutrema salsugineum]
Length=350

 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 72/139 (52%), Gaps = 5/139 (4%)
 Frame = +1

Query  490  ICNSLFTLSSLFIAFNLADYGLGLSSLFFSAIGALVFSLICNLALILSATQKRGGFTALL  669
            +C+S F L     + +   YG  L  L FS + A V  +ICN  +++S  +   G  AL+
Sbjct  190  VCSSFFVLG---FSPDFNAYGAILVGLVFSVVFANVI-IICNTTVVISILEDVSGPLALV  245

Query  670  KACVLIKTRIATALSLALPINATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLYAL  849
            +A  LIK +    L + L     +  VE LF++RV    + DG  S   EG  +  +Y+ 
Sbjct  246  RANDLIKGQTQVGLLIFLGSTIGLTFVEGLFEHRVKILSYGDGS-SRIWEGPLLVVMYSF  304

Query  850  LIVLDTIVAYFFFTTCEEH  906
            ++++DT+++  F+ +C  +
Sbjct  305  VVLVDTMMSAVFYFSCRSY  323



>emb|CDX85037.1| BnaC05g20180D [Brassica napus]
Length=336

 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 64/117 (55%), Gaps = 7/117 (6%)
 Frame = +1

Query  550  GLGLSSLFFSAIGALVFSLICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPI  729
            GL  S +F +AI      ++CN A+++S  +   G  AL++A  LIK ++   L + L  
Sbjct  201  GLAFSIVFANAI------IVCNTAVVISVLEDVSGAGALVRASDLIKGQVQVGLLIFLGS  254

Query  730  NATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCE  900
               +A VE LF +RV +  + DG  S   EG  +  +Y+ + ++D++++  F+ +C 
Sbjct  255  TLGLAFVEGLFDHRVKKLSYGDGS-SRLWEGPLLVVMYSFVTLIDSMMSAVFYFSCR  310



>ref|XP_010238889.1| PREDICTED: uncharacterized protein LOC100833751 [Brachypodium 
distachyon]
Length=345

 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 75/136 (55%), Gaps = 24/136 (18%)
 Frame = +1

Query  601  SLICNLALILSATQKR-------GGFTALLKACVLIKTRIATALSLALPINATMAAVEAL  759
            +++C+LAL ++A + +        G  A+ +ACVL++ R+  AL+LALP    MAA EAL
Sbjct  210  TVVCSLALAVAAMEAQSSTGAMVAGHAAVARACVLVRGRVRAALALALPARLAMAAAEAL  269

Query  760  FQYRVVR--------AYHDDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTC------  897
            FQ RVVR        A         A E L IAY++AL +VLD IV   F+T+C      
Sbjct  270  FQLRVVRNVATSAGGATRSWAAPGVAGEALSIAYIHALCVVLDIIVGCMFYTSCCKTTDD  329

Query  898  --EEHKDGRKKIAQDQ  939
              ++HK  R+   +D+
Sbjct  330  DNDDHKP-RELEPEDK  344



>ref|XP_009115389.1| PREDICTED: uncharacterized protein LOC103840632 [Brassica rapa]
Length=336

 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 63/117 (54%), Gaps = 7/117 (6%)
 Frame = +1

Query  550  GLGLSSLFFSAIGALVFSLICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPI  729
            GL  S +F +AI      ++CN A+++S  +   G  AL +A  LIK ++   L + L  
Sbjct  201  GLAFSIVFANAI------IVCNTAVVISVLEDVSGAGALARASDLIKGQVQVGLLIFLGS  254

Query  730  NATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCE  900
               +A VE LF +RV +  + DG  S   EG  +  +Y+ + ++D++++  F+ +C 
Sbjct  255  TLGLAFVEGLFDHRVKKVSYGDGS-SRLWEGPLLVVMYSFVTLIDSMMSAVFYFSCR  310



>emb|CDY16174.1| BnaA09g29080D [Brassica napus]
Length=336

 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 63/117 (54%), Gaps = 7/117 (6%)
 Frame = +1

Query  550  GLGLSSLFFSAIGALVFSLICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPI  729
            GL  S +F +AI      ++CN A+++S  +   G  AL +A  LIK ++   L + L  
Sbjct  201  GLAFSIVFANAI------IVCNTAVVISVLEDVSGAGALARASDLIKGQVQVGLLIFLGS  254

Query  730  NATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCE  900
               +A VE LF +RV +  + DG  S   EG  +  +Y+ + ++D++++  F+ +C 
Sbjct  255  TLGLAFVEGLFDHRVKKVSYGDGS-SRLWEGPLLVVMYSFVTLIDSMMSAVFYFSCR  310



>ref|XP_008446402.1| PREDICTED: uncharacterized protein LOC103489158 [Cucumis melo]
Length=361

 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 67/128 (52%), Gaps = 11/128 (9%)
 Frame = +1

Query  547  YGLGLS-SLFFSA--IGALVFSLI-------CNLALILSATQKRGGFTALLKACVLIKTR  696
            Y LG S  L  SA  I  LVFS+I       CN+A+++   +   G  ALL++CVLI+ +
Sbjct  208  YVLGFSPDLIVSAAVIVGLVFSIIFANAVIICNIAIVICVLEDVAGPGALLRSCVLIRGQ  267

Query  697  IATALSLALPINATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLYALLIVLDTIVA  876
                L + L        VE LF++RV    + DG  S   EG  +  +Y+ +++ D++++
Sbjct  268  TQVGLLIFLGSTIGTVFVEGLFEHRVKTLSYGDGS-SRIWEGPLLVVMYSFVVLTDSMMS  326

Query  877  YFFFTTCE  900
              F+ +C 
Sbjct  327  AVFYFSCR  334



>ref|XP_006302541.1| hypothetical protein CARUB_v10020641mg [Capsella rubella]
 gb|EOA35439.1| hypothetical protein CARUB_v10020641mg [Capsella rubella]
Length=328

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 79/162 (49%), Gaps = 17/162 (10%)
 Frame = +1

Query  490  ICNSLFTL--SSLFIAFNLADYGLGLSSLFFSAIGALVFSLICNLALILSATQKRGGFTA  663
            +C+S + L  S  F A+     GL  S +F  AI      +ICN  +++S  +   G  A
Sbjct  173  VCSSFYVLGFSPDFNAYGAILVGLVFSVVFADAI------IICNTTVVISILEDVSGPQA  226

Query  664  LLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLY  843
            L++A  LIK +    L + L     +  VE LF++RV    + DG  S   EG  +  +Y
Sbjct  227  LVRASDLIKGQTQVGLLIFLGSTIGLTFVEGLFEHRVKSLSYGDGS-SRLWEGPLLVVMY  285

Query  844  ALLIVLDTIVAYFFFTTC--------EEHKDGRKKIAQDQSL  945
              ++++DT+++  F+ +C        E  +   + ++QD SL
Sbjct  286  TFVVLIDTMMSAVFYFSCRSYSMEAVEALEASGEIVSQDLSL  327



>ref|XP_004155379.1| PREDICTED: uncharacterized protein LOC101226354 [Cucumis sativus]
 gb|KGN51954.1| hypothetical protein Csa_5G606450 [Cucumis sativus]
Length=361

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 71/139 (51%), Gaps = 9/139 (6%)
 Frame = +1

Query  490  ICNSLFTL--SSLFIAFNLADYGLGLSSLFFSAIGALVFSLICNLALILSATQKRGGFTA  663
            +C++L+ L  S   I       GL  S +F +A+      +ICN+ +++   +   G  A
Sbjct  203  VCSTLYVLGFSPDLIVSAAVIVGLVFSVIFANAV------IICNIGIVICVLEDVAGPGA  256

Query  664  LLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLY  843
            LL++CVLI+ +    L + L        VE LF++RV    + DG  S   EG  +  +Y
Sbjct  257  LLRSCVLIRGQTQVGLLIFLGSTIGTVFVEGLFEHRVKTLSYGDG-SSRIWEGPLLVVMY  315

Query  844  ALLIVLDTIVAYFFFTTCE  900
            + +++ D++++  F+ +C 
Sbjct  316  SFVVLTDSMMSAVFYLSCR  334



>ref|XP_010683099.1| PREDICTED: uncharacterized protein LOC104897842 [Beta vulgaris 
subsp. vulgaris]
Length=361

 Score = 55.5 bits (132),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 64/117 (55%), Gaps = 7/117 (6%)
 Frame = +1

Query  550  GLGLSSLFFSAIGALVFSLICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPI  729
            GL  S +F +AI      ++CN+A+++S  +   G  ALL++ VLI+ +    L + L  
Sbjct  214  GLVFSIVFANAI------IVCNVAVVISVLEDASGPQALLRSSVLIRGQTQVGLLMYLGS  267

Query  730  NATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCE  900
               MA V+ LF++RV    + DG  S   EG  +  +Y+ ++++D ++   F+ +C 
Sbjct  268  TIGMAFVQGLFEHRVKTLSYGDG-SSRLWEGPLLVIMYSFVVLVDAMMTAVFYFSCR  323



>ref|XP_004135444.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101222691 
[Cucumis sativus]
Length=356

 Score = 55.1 bits (131),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 55/215 (26%), Positives = 98/215 (46%), Gaps = 28/215 (13%)
 Frame = +1

Query  316  KLSHTIAISVLAFPSTLSSFLFCKASVIHALMMSTNQECPWPSFSCLFKLHIPLIHTQIC  495
            + + +I  S + FP  L+  L  KA+V+H +      +C +        L + ++   I 
Sbjct  123  RFAESILSSAMCFPLFLTLSLVSKAAVVHTV------DCTYAKRRFELGLFLAIVR-NIW  175

Query  496  NSLFTLSSLFIAFNL----------ADYGLGLS-SLFFSA--IGALVFS-------LICN  615
            N L +  ++     +            Y LG S  L  SA  I  LVFS       +ICN
Sbjct  176  NRLLSSXAIVGCLTMFLVLLGAVCSTLYVLGFSPDLIVSAAVIVGLVFSVIFANAVIICN  235

Query  616  LALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRAYHDD  795
            + +++   +   G  ALL++CVLI+ +    L + L        VE LF++RV    + D
Sbjct  236  IGIVICVLEDVAGPGALLRSCVLIRGQTQVGLLIFLGSTIGTVFVEGLFEHRVKTLSYGD  295

Query  796  GVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCE  900
            G  S   EG  +  +Y+ +++ D++++  F+ +C 
Sbjct  296  G-SSRIWEGPLLVVMYSFVVLTDSMMSAVFYLSCR  329



>ref|XP_008787101.1| PREDICTED: uncharacterized protein LOC103705238 [Phoenix dactylifera]
Length=346

 Score = 54.7 bits (130),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 56/99 (57%), Gaps = 1/99 (1%)
 Frame = +1

Query  604  LICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRA  783
            ++CNLA ++S  +   G  AL+++  LIK +    L + L     MA VE LF++RV   
Sbjct  221  IVCNLATVISILEDVWGPQALVRSVHLIKGQTQAGLLIFLGSTIGMAFVEGLFEHRVKTL  280

Query  784  YHDDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCE  900
             + DG  S   EG  +  +Y+ ++++D++++  F+ TC 
Sbjct  281  SYGDGS-SRLWEGPLLVLMYSFVVLVDSMMSAVFYFTCR  318



>ref|XP_010936511.1| PREDICTED: uncharacterized protein LOC105056132 [Elaeis guineensis]
Length=346

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 55/99 (56%), Gaps = 1/99 (1%)
 Frame = +1

Query  604  LICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRA  783
            ++CNLA ++S  +   G  AL ++  LIK +    L + L     MA VE LF++RV   
Sbjct  221  IVCNLATVISILEDVSGPQALARSVHLIKGQTQAGLLIFLGSTIGMALVEGLFEHRVKTL  280

Query  784  YHDDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCE  900
             + DG  S   EG  +  +Y+ ++++D++++  F+ TC 
Sbjct  281  SYGDG-SSRLWEGPLLVLMYSFVVLVDSMMSAVFYFTCR  318



>ref|XP_010552565.1| PREDICTED: uncharacterized protein LOC104822905 [Tarenaya hassleriana]
Length=351

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 64/125 (51%), Gaps = 12/125 (10%)
 Frame = +1

Query  565  SLFFSAIGALVFSL-----------ICNLALILSATQKRGGFTALLKACVLIKTRIATAL  711
            SL F+A GA+V  +           ICN  +++   +   G  AL++A  LIK +    L
Sbjct  201  SLDFNAHGAIVVGMVFSVVFADAIIICNTGIVICILEDVSGAGALVRAIDLIKGQTQVGL  260

Query  712  SLALPINATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFT  891
             + L     +A VE LF++RV    + DG  S   EG  +  +Y+ ++++D++++  F+ 
Sbjct  261  LIFLGSTIGLAFVEGLFEHRVKTLSYGDGS-SRVWEGPLLVMMYSFVVLIDSMMSVVFYF  319

Query  892  TCEEH  906
            +C  +
Sbjct  320  SCRSY  324



>ref|XP_002281196.1| PREDICTED: uncharacterized protein LOC100250739 [Vitis vinifera]
 emb|CBI28090.3| unnamed protein product [Vitis vinifera]
Length=301

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/144 (31%), Positives = 74/144 (51%), Gaps = 21/144 (15%)
 Frame = +1

Query  499  SLFTLSSLFIAFNLADYGLGLSSLFFSAIG------ALVFS---LICNLALILSATQKRG  651
            SL T+  +  AF +    LG    FFS +G       +VF+   ++ NLA ++S  +   
Sbjct  162  SLATVPKILFAFGVCSRVLG----FFSVLGFAGIPFCVVFAHVMIVGNLARVVSVVESEC  217

Query  652  -GFTALLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRAYHDDGVFSAALEGLF  828
             GF +++KA  L++ R  TAL +AL  N     VE LF++R+           +  EG  
Sbjct  218  YGFDSIVKAKRLMEGRRHTALVMALLSNVGFRLVECLFEFRMCTGM-------SLWEGPL  270

Query  829  IAYLYALLIVLDTIVAYFFFTTCE  900
            +  +Y+L++VLDT++   F+  C+
Sbjct  271  LVSMYSLVLVLDTVMNAVFYYACK  294



>ref|XP_010532668.1| PREDICTED: uncharacterized protein LOC104808637 [Tarenaya hassleriana]
Length=351

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 73/146 (50%), Gaps = 10/146 (7%)
 Frame = +1

Query  550  GLGLSSLFFSAIGALVFSLICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPI  729
            G+  S +F  AI      +ICN ++++   +   G  ALL+A  LIK +    L + L  
Sbjct  213  GMVFSVVFADAI------IICNTSMVICILEDVSGPRALLRAVDLIKGQTQVGLLIFLGS  266

Query  730  NATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCEEHK  909
               +A VE LF++RV    + DG  S   EG  +  +Y  ++++D++++  F+ +C  + 
Sbjct  267  TIGLAFVEGLFEHRVKTLSYGDGS-SRIWEGPLLVVMYTFVVLIDSMMSAVFYFSCRSYS  325

Query  910  ---DGRKKIAQDQSLACSCRSIKIVE  978
                G +     +++  +  S+ I++
Sbjct  326  MEASGSENQPILETMVVTSSSVDIIQ  351



>ref|XP_007203111.1| hypothetical protein PRUPE_ppa023904mg [Prunus persica]
 gb|EMJ04310.1| hypothetical protein PRUPE_ppa023904mg [Prunus persica]
Length=291

 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 81/302 (27%), Positives = 127/302 (42%), Gaps = 58/302 (19%)
 Frame = +1

Query  103  SICSMETPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllp  282
            S+ SM T + I R SI   L    +F +I+ FL  P  AS  +   LL     I  S + 
Sbjct  11   SLNSMST-TQIFRESIRVILLHPTHFHSISIFLFSPLPASLFISHFLLHHFPQIPSSTIK  69

Query  283  sssilfsilHTKL-SHTIAISVLAFPSTLSSFLFCKASVIHALMMSTN------------  423
             +  + +    KL S TI   VL FPS+++  L  +A+ I A+  S N            
Sbjct  70   ITDHILAHPLPKLLSKTIVHIVLCFPSSITFSLLGRAATIQAVSDSYNGINLDRRRLLVR  129

Query  424  QECPWPSFSCLFKLHIPLIHTQICN-------------SLFTLSSLFIAFNLADYGLGLS  564
                W          I L++T +C              SL  +  +  A+ +    LG  
Sbjct  130  SGLNW----------IKLLNTGLCELIIVLGLLGVLVASLAVVPKILFAWGVCSEVLG--  177

Query  565  SLFFSAIGALVFS---------LICNLALILSATQKRG-GFTALLKACVLIKTRIATALS  714
              F+  +G L            ++ NLA +LS  +    GF  L+KA  L++ +  TAL 
Sbjct  178  --FWGVLGFLGVPFCVAFAHVMVVGNLARVLSVLEGECYGFETLIKAKRLMERKRKTALV  235

Query  715  LALPINATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTT  894
            +AL  N     VE LF +R+ +  +         EG  +  +Y+LL+V DT++   F+  
Sbjct  236  MALLSNVGFRLVECLFDFRMSKGIN-------LWEGPLLVSMYSLLLVFDTVMNVVFYYA  288

Query  895  CE  900
            C+
Sbjct  289  CK  290



>ref|XP_010108724.1| hypothetical protein L484_015713 [Morus notabilis]
 gb|EXC20035.1| hypothetical protein L484_015713 [Morus notabilis]
Length=358

 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 57/217 (26%), Positives = 106/217 (49%), Gaps = 25/217 (12%)
 Frame = +1

Query  340  SVLAFPSTLSSFLFCKASVIHALMMSTNQECPWPS--FSCLFKLHIPLIHTQI-------  492
            SV+ FP  +S  L  KA+V++A+  S +++    S  F+ + K+   L+ T I       
Sbjct  126  SVMCFPLYVSLSLLSKAAVVYAVDCSYSRKQFDSSKFFAIIRKIWKRLVSTYIWVCMVIV  185

Query  493  -CNSLF---------TLSSLFIAFNLADYGLGLSSLFFSAIGALVFSLICNLALILSATQ  642
             C +LF          LS ++   ++  Y      L FS + A    ++C++A+++S  +
Sbjct  186  GCITLFFVILAAVCNVLSIIWAPPDVVVYAAVAVGLVFSVVFANAV-IVCSIAVVISVLE  244

Query  643  KRGGFTALLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRAYHDDGVFSAALEG  822
               G  AL ++ VLIK +    L + L     MA VE LF++RV    + DG  S   EG
Sbjct  245  DVSGPEALFRSGVLIKGQTHVGLLIFLGSAIGMAFVEGLFEHRVKTLSYGDGS-SRMWEG  303

Query  823  LFIAYLYALLIVLDTIVAYFFFTTCE----EHKDGRK  921
              +  + + ++++D++++  F+ +C     E  +G +
Sbjct  304  PLLVLMNSFVVLIDSMMSAVFYYSCRCSSLESSNGEE  340



>ref|XP_008790177.1| PREDICTED: uncharacterized protein LOC103707457, partial [Phoenix 
dactylifera]
Length=206

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 55/104 (53%), Gaps = 1/104 (1%)
 Frame = +1

Query  604  LICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRA  783
            ++CNLA ++S  +   G  AL+++  LIK +    L + L     MA VE LF++RV   
Sbjct  81   IVCNLASVISVLEDVLGPQALVRSIHLIKGQTQAGLLIFLGSAIGMAFVEGLFEHRVKTL  140

Query  784  YHDDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCEEHKDG  915
             + DG  S   EG  +  +Y+ +++ D +++  F+ TC     G
Sbjct  141  SYGDGS-SRLWEGPLLVLMYSFVVLTDYMMSAVFYFTCRSSSMG  183



>ref|XP_008242640.1| PREDICTED: uncharacterized protein LOC103340951 [Prunus mume]
Length=291

 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 81/302 (27%), Positives = 127/302 (42%), Gaps = 58/302 (19%)
 Frame = +1

Query  103  SICSMETPSNILRRSIFTFLQKYHYFTTIATFLAFPFAASTlllqsllpsqipiihsllp  282
            S+ SM T + I R SI   L    +F +I+ FL  P  AS  +   LL     I  S + 
Sbjct  11   SLNSMST-TQIFRESIRVILLHPTHFHSISIFLFSPLPASLFISHFLLHHFPQIPSSTIK  69

Query  283  sssilfsilHTKL-SHTIAISVLAFPSTLSSFLFCKASVIHALMMSTN------------  423
             +  + +    KL S TI   VL FPS+++  L  +A+ I A+  S N            
Sbjct  70   ITDHILAHPLPKLLSKTIVHFVLCFPSSITFSLLGRAATIQAVSDSYNGINLDRRRLLVR  129

Query  424  QECPWPSFSCLFKLHIPLIHTQICN-------------SLFTLSSLFIAFNLADYGLGLS  564
                W          I L++T +C              SL  +  +  A+ +    LG  
Sbjct  130  SGLNW----------IKLLNTGLCELIIVLGLLGVLVASLAVVPKILFAWGVCSEVLG--  177

Query  565  SLFFSAIGALVFS---------LICNLALILSATQKRG-GFTALLKACVLIKTRIATALS  714
              F+  +G L            ++ NLA +LS  +    GF  L+KA  L++ +  TAL 
Sbjct  178  --FWGVLGFLGVPFCVAFAHVMVVGNLARVLSVLEGECCGFETLIKAKRLMERKRKTALV  235

Query  715  LALPINATMAAVEALFQYRVVRAYHDDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTT  894
            +AL  N     VE LF +R+ +  +         EG  +  +Y+LL+V DT++   F+  
Sbjct  236  MALLSNVGFRLVECLFDFRMSKGIN-------FWEGPLLVSMYSLLLVFDTVMNVVFYYA  288

Query  895  CE  900
            C+
Sbjct  289  CK  290



>ref|XP_010939057.1| PREDICTED: uncharacterized protein LOC105058003 [Elaeis guineensis]
Length=346

 Score = 52.0 bits (123),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 54/99 (55%), Gaps = 1/99 (1%)
 Frame = +1

Query  604  LICNLALILSATQKRGGFTALLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRA  783
            ++CNLA ++S  +   G  AL+++  LIK +    L + L     MA VE LF++RV   
Sbjct  221  IVCNLASVISVLEDVLGPQALVRSVRLIKGQTQAGLLIFLGSTIGMAFVEGLFEHRVKTL  280

Query  784  YHDDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCE  900
             + DG  S   EG  +  +Y+ +++ D +++  F+ TC 
Sbjct  281  SYGDGS-SRLWEGPLLVLMYSFVVLADYMMSAVFYFTCR  318



>emb|CAN79522.1| hypothetical protein VITISV_034628 [Vitis vinifera]
Length=388

 Score = 52.0 bits (123),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 76/147 (52%), Gaps = 22/147 (15%)
 Frame = +1

Query  499  SLFTLSSLFIAFNLADYGLGLSSLFFSAIG------ALVFS---LICNLALILSATQKR-  648
            SL T+  +  AF +    LG    FFS +G       +VF+   ++ NLA ++S  +   
Sbjct  162  SLATVPKILFAFGVCSRVLG----FFSVLGFAGIPFCVVFAHVMIVGNLARVVSVVESEC  217

Query  649  GGFTALLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVRAYHDDGVFSAALEGLF  828
             GF +++KA  L++ R  TAL +AL  N     VE LF++R+           +  EG  
Sbjct  218  YGFDSIVKAKRLMEGRRHTALVMALLSNVGFRLVECLFEFRMCTGM-------SLWEGPL  270

Query  829  IAYLYALLIVLDTIV-AYFFFTTCEEH  906
            +  +Y+L++VLDT++ A F++    +H
Sbjct  271  LVSMYSLVLVLDTVMNAVFYYAFFRDH  297



>ref|XP_010088844.1| hypothetical protein L484_020828 [Morus notabilis]
 gb|EXB37041.1| hypothetical protein L484_020828 [Morus notabilis]
Length=267

 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/104 (29%), Positives = 56/104 (54%), Gaps = 8/104 (8%)
 Frame = +1

Query  604  LICNLALILSATQKRG-GFTALLKACVLIKTRIATALSLALPINATMAAVEALFQYRVVR  780
            ++ N+A ++S  +    GF  LL+A  L++ R  TAL +AL  N  +  VE +F++R+ +
Sbjct  171  VVGNMARVISVLEGECYGFETLLRAKTLMEGRRQTALIMALLSNMGLRLVECVFEFRMCK  230

Query  781  AYHDDGVFSAALEGLFIAYLYALLIVLDTIVAYFFFTTCEEHKD  912
              +         EG  +  +Y+L++V DT++   F+  C+   D
Sbjct  231  GIN-------LWEGPVLVSMYSLVLVFDTVMNVVFYYACKSFND  267



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3595941013084