BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24193_g5_i1 len=1269 path=[5910:0-752 6663:753-780 26768:781-1268]

Length=1269
                                                                      Score     E

ref|XP_004242176.1|  PREDICTED: uncharacterized protein LOC101259449    370   3e-122   
ref|XP_002284698.1|  PREDICTED: uncharacterized protein LOC100260477    358   8e-118   Vitis vinifera
emb|CAN78131.1|  hypothetical protein VITISV_000332                     358   2e-117   Vitis vinifera
ref|XP_007037439.1|  Uncharacterized protein TCM_014112                 350   4e-114   
ref|XP_009617175.1|  PREDICTED: uncharacterized protein LOC104109549    346   8e-113   
emb|CDP18310.1|  unnamed protein product                                345   3e-112   
ref|XP_008239893.1|  PREDICTED: uncharacterized protein LOC103338467    335   2e-108   
ref|XP_011072808.1|  PREDICTED: uncharacterized protein LOC105157952    333   7e-108   
ref|XP_007210084.1|  hypothetical protein PRUPE_ppa019735mg             330   1e-106   
ref|XP_010089884.1|  hypothetical protein L484_008572                   330   2e-106   
ref|XP_004236481.1|  PREDICTED: uncharacterized protein LOC101262301    328   6e-106   
ref|XP_011101971.1|  PREDICTED: uncharacterized protein LOC105180005    323   4e-104   
ref|XP_009339133.1|  PREDICTED: uncharacterized protein LOC103931378    320   5e-103   
ref|XP_009339684.1|  PREDICTED: uncharacterized protein LOC103931867    320   8e-103   
ref|XP_002514717.1|  conserved hypothetical protein                     318   9e-102   Ricinus communis
gb|KDO55467.1|  hypothetical protein CISIN_1g019105mg                   315   1e-100   
ref|XP_010258424.1|  PREDICTED: uncharacterized protein LOC104598194    314   2e-100   
ref|XP_006494989.1|  PREDICTED: uncharacterized protein LOC102626486    313   7e-100   
ref|XP_006440660.1|  hypothetical protein CICLE_v10020945mg             313   1e-99    
ref|XP_008393355.1|  PREDICTED: uncharacterized protein LOC103455546    310   6e-99    
ref|XP_008374578.1|  PREDICTED: uncharacterized protein LOC103437852    309   1e-98    
gb|KDP31291.1|  hypothetical protein JCGZ_11667                         306   3e-97    
gb|ACU19969.1|  unknown                                                 305   4e-97    Glycine max [soybeans]
ref|NP_001241590.1|  uncharacterized protein LOC100802807               305   6e-97    
gb|KHN48705.1|  hypothetical protein glysoja_015853                     305   1e-96    
ref|XP_003524748.2|  PREDICTED: uncharacterized protein LOC100809875    305   2e-96    
ref|XP_007138157.1|  hypothetical protein PHAVU_009G184900g             304   2e-96    
gb|KHN26275.1|  hypothetical protein glysoja_032845                     302   9e-96    
ref|XP_007155283.1|  hypothetical protein PHAVU_003G187900g             303   1e-95    
gb|KHN45241.1|  hypothetical protein glysoja_041633                     301   3e-95    
ref|XP_003523005.1|  PREDICTED: uncharacterized protein LOC100797246    300   8e-95    
gb|KEH31964.1|  transmembrane protein, putative                         298   3e-94    
gb|ACU19144.1|  unknown                                                 296   2e-93    Glycine max [soybeans]
ref|XP_003549689.1|  PREDICTED: uncharacterized protein LOC100819933    294   1e-92    
gb|KHN18574.1|  hypothetical protein glysoja_006987                     294   2e-92    
ref|XP_004137590.1|  PREDICTED: uncharacterized protein LOC101220892    292   6e-92    
ref|XP_008445049.1|  PREDICTED: uncharacterized protein LOC103488179    291   1e-91    
ref|XP_004499518.1|  PREDICTED: uncharacterized protein LOC101505783    289   1e-90    
gb|KEH33432.1|  transmembrane protein, putative                         288   3e-90    
ref|XP_006374437.1|  hypothetical protein POPTR_0015s07190g             287   5e-90    
gb|AFK39790.1|  unknown                                                 287   6e-90    
ref|XP_010258661.1|  PREDICTED: uncharacterized protein LOC104598335    287   8e-90    
ref|XP_004508715.1|  PREDICTED: uncharacterized protein LOC101499112    286   2e-89    
ref|XP_010678454.1|  PREDICTED: uncharacterized protein LOC104894001    286   4e-89    
ref|XP_011006296.1|  PREDICTED: uncharacterized protein LOC105112322    282   7e-88    
gb|KGN63693.1|  hypothetical protein Csa_1G011450                       259   1e-78    
gb|KFK27894.1|  hypothetical protein AALP_AA8G443900                    256   5e-78    
ref|XP_006280822.1|  hypothetical protein CARUB_v10026789mg             252   2e-76    
ref|XP_011012575.1|  PREDICTED: uncharacterized protein LOC105116791    251   4e-76    
ref|XP_008787211.1|  PREDICTED: uncharacterized protein LOC103705324    249   2e-75    
ref|XP_009111986.1|  PREDICTED: uncharacterized protein LOC103837376    249   3e-75    
ref|XP_002318598.2|  hypothetical protein POPTR_0012s06990g             247   1e-74    Populus trichocarpa [western balsam poplar]
ref|XP_009419078.1|  PREDICTED: uncharacterized protein LOC103999144    247   1e-74    
ref|XP_006394517.1|  hypothetical protein EUTSA_v10005448mg             247   2e-74    
ref|XP_002866429.1|  hypothetical protein ARALYDRAFT_919377             246   5e-74    
ref|XP_009136463.1|  PREDICTED: uncharacterized protein LOC103860586    244   2e-73    
ref|XP_008453222.1|  PREDICTED: uncharacterized protein LOC103494010    245   2e-73    
emb|CDY23069.1|  BnaC07g31180D                                          243   8e-73    
ref|XP_010483800.1|  PREDICTED: uncharacterized protein LOC104762247    243   1e-72    
emb|CDY02155.1|  BnaA03g40120D                                          242   2e-72    
ref|NP_568933.1|  uncharacterized protein                               241   4e-72    Arabidopsis thaliana [mouse-ear cress]
dbj|BAB08489.1|  unnamed protein product                                241   8e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010443954.1|  PREDICTED: uncharacterized protein LOC104726721    239   2e-71    
ref|XP_010039067.1|  PREDICTED: uncharacterized protein LOC104427718    240   4e-71    
ref|XP_010936510.1|  PREDICTED: uncharacterized protein LOC105056131    238   6e-71    
ref|XP_004174046.1|  PREDICTED: uncharacterized protein LOC101224752    236   9e-71    
gb|KCW48865.1|  hypothetical protein EUGRSUZ_K02492                     239   1e-70    
ref|XP_010457239.1|  PREDICTED: uncharacterized protein LOC104738735    237   2e-70    
ref|XP_010939058.1|  PREDICTED: uncharacterized protein LOC105058004    234   1e-69    
ref|XP_010523013.1|  PREDICTED: uncharacterized protein LOC104801435    233   5e-69    
ref|XP_008781043.1|  PREDICTED: uncharacterized protein LOC103700923    229   2e-67    
ref|XP_010045591.1|  PREDICTED: uncharacterized protein LOC104434350    228   4e-67    
ref|XP_010938751.1|  PREDICTED: uncharacterized protein LOC105057757    221   9e-65    
emb|CDY16815.1|  BnaA09g05670D                                          218   2e-63    
ref|XP_002278774.2|  PREDICTED: uncharacterized protein LOC100256060    214   5e-62    Vitis vinifera
ref|XP_007032623.1|  Uncharacterized protein TCM_018662                 210   2e-60    
ref|XP_009417032.1|  PREDICTED: uncharacterized protein LOC103997509    220   7e-60    
emb|CDX87208.1|  BnaC09g05230D                                          209   7e-60    
ref|XP_009415781.1|  PREDICTED: uncharacterized protein LOC103996578    206   6e-59    
ref|XP_008790099.1|  PREDICTED: uncharacterized protein LOC103707406    206   9e-59    
ref|NP_001144457.1|  hypothetical protein                               207   9e-59    Zea mays [maize]
gb|EYU23500.1|  hypothetical protein MIMGU_mgv1a011493mg                204   1e-58    
ref|XP_009405888.1|  PREDICTED: uncharacterized protein LOC103988924    205   1e-58    
ref|XP_002442380.1|  hypothetical protein SORBIDRAFT_08g019150          202   3e-57    Sorghum bicolor [broomcorn]
ref|XP_010546430.1|  PREDICTED: uncharacterized protein LOC104818514    196   2e-55    
ref|XP_004962983.1|  PREDICTED: uncharacterized protein LOC101755659    195   3e-54    
gb|EYU35794.1|  hypothetical protein MIMGU_mgv1a019183mg                191   2e-53    
ref|XP_009130173.1|  PREDICTED: uncharacterized protein LOC103854959    183   1e-49    
gb|EAY83630.1|  hypothetical protein OsI_38858                          170   6e-45    Oryza sativa Indica Group [Indian rice]
gb|EEE53483.1|  hypothetical protein OsJ_36632                          169   6e-45    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002530020.1|  conserved hypothetical protein                     168   7e-45    Ricinus communis
ref|NP_001067114.1|  Os12g0577200                                       168   3e-44    Oryza sativa Japonica Group [Japonica rice]
emb|CDY42877.1|  BnaAnng07020D                                          171   3e-42    
ref|NP_001142588.1|  uncharacterized protein LOC100274853               160   2e-41    Zea mays [maize]
tpg|DAA47177.1|  TPA: hypothetical protein ZEAMMB73_688937              157   3e-40    
ref|XP_010089561.1|  hypothetical protein L484_020951                   148   3e-37    
gb|EPS68484.1|  hypothetical protein M569_06284                         146   2e-36    
ref|XP_006844836.1|  hypothetical protein AMTR_s00058p00078540          146   3e-36    
ref|XP_009790718.1|  PREDICTED: uncharacterized protein LOC104238132    140   1e-35    
ref|XP_002305952.2|  hypothetical protein POPTR_0004s10270g             119   4e-27    Populus trichocarpa [western balsam poplar]
ref|XP_008648555.1|  PREDICTED: uncharacterized protein LOC103629156    114   6e-25    
gb|AFK36617.1|  unknown                                                 105   9e-24    
gb|EAY83254.1|  hypothetical protein OsI_38462                        99.8    4e-20    Oryza sativa Indica Group [Indian rice]
ref|NP_001066845.1|  Os12g0507400                                     98.6    1e-19    Oryza sativa Japonica Group [Japonica rice]
gb|KCW56258.1|  hypothetical protein EUGRSUZ_I02003                   95.5    8e-19    
ref|XP_010030783.1|  PREDICTED: uncharacterized protein LOC104420686  95.5    8e-19    
ref|XP_009624255.1|  PREDICTED: uncharacterized protein LOC104115351  85.1    9e-15    
gb|EYU28808.1|  hypothetical protein MIMGU_mgv1a026893mg              84.3    1e-14    
ref|XP_009795710.1|  PREDICTED: uncharacterized protein LOC104242365  83.2    4e-14    
ref|XP_010238889.1|  PREDICTED: uncharacterized protein LOC100833751  82.8    4e-14    
ref|XP_004239096.1|  PREDICTED: uncharacterized protein LOC101256486  80.1    4e-13    
ref|XP_004299927.1|  PREDICTED: uncharacterized protein LOC101307497  80.1    4e-13    
ref|XP_006483093.1|  PREDICTED: uncharacterized protein LOC102625077  80.1    5e-13    
gb|KDO83041.1|  hypothetical protein CISIN_1g018046mg                 79.0    9e-13    
ref|XP_002443243.1|  hypothetical protein SORBIDRAFT_08g016250        77.8    2e-12    Sorghum bicolor [broomcorn]
ref|XP_006438763.1|  hypothetical protein CICLE_v10033399mg           77.4    3e-12    
ref|XP_002893390.1|  hypothetical protein ARALYDRAFT_472743           76.3    7e-12    
ref|XP_011004425.1|  PREDICTED: uncharacterized protein LOC105110918  72.4    8e-12    
ref|XP_010460285.1|  PREDICTED: uncharacterized protein LOC104741188  75.9    9e-12    
ref|XP_010258226.1|  PREDICTED: uncharacterized protein LOC104598044  75.9    1e-11    
ref|XP_007045989.1|  Son of sevenless                                 75.5    1e-11    
emb|CDX85037.1|  BnaC05g20180D                                        75.1    2e-11    
gb|KDP41249.1|  hypothetical protein JCGZ_15656                       75.1    2e-11    
ref|XP_010551632.1|  PREDICTED: uncharacterized protein LOC104822182  74.7    2e-11    
ref|XP_004155379.1|  PREDICTED: uncharacterized protein LOC101226354  74.3    3e-11    
ref|XP_010237231.1|  PREDICTED: uncharacterized protein LOC100823289  73.6    4e-11    
ref|XP_006415943.1|  hypothetical protein EUTSA_v10008119mg           73.9    4e-11    
ref|XP_002312265.1|  hypothetical protein POPTR_0008s09100g           73.9    4e-11    Populus trichocarpa [western balsam poplar]
ref|XP_004516573.1|  PREDICTED: uncharacterized protein LOC101492424  73.9    5e-11    
ref|XP_006844834.1|  hypothetical protein AMTR_s00058p00077380        73.9    5e-11    
ref|XP_003528573.1|  PREDICTED: uncharacterized protein LOC100806351  73.6    6e-11    
emb|CDP00381.1|  unnamed protein product                              73.6    7e-11    
ref|XP_002522492.1|  conserved hypothetical protein                   73.6    7e-11    Ricinus communis
ref|XP_006306437.1|  hypothetical protein CARUB_v10012379mg           73.2    7e-11    
ref|XP_010477835.1|  PREDICTED: uncharacterized protein LOC104756877  73.2    7e-11    
ref|XP_010499015.1|  PREDICTED: uncharacterized protein LOC104776618  73.2    7e-11    
ref|XP_004135444.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  73.2    8e-11    
ref|XP_008446402.1|  PREDICTED: uncharacterized protein LOC103489158  73.2    8e-11    
ref|XP_011012681.1|  PREDICTED: uncharacterized protein LOC105116878  73.2    9e-11    
emb|CDY16174.1|  BnaA09g29080D                                        72.8    1e-10    
ref|XP_009115389.1|  PREDICTED: uncharacterized protein LOC103840632  72.4    1e-10    
ref|XP_006348815.1|  PREDICTED: uncharacterized protein LOC102581421  72.8    1e-10    
ref|XP_008339849.1|  PREDICTED: uncharacterized protein LOC103402858  72.0    2e-10    
ref|XP_002281196.1|  PREDICTED: uncharacterized protein LOC100250739  71.2    2e-10    Vitis vinifera
gb|KFK41365.1|  hypothetical protein AALP_AA2G120500                  72.0    2e-10    
ref|XP_002315026.2|  hypothetical protein POPTR_0010s17080g           72.0    2e-10    Populus trichocarpa [western balsam poplar]
ref|XP_006451107.1|  hypothetical protein CICLE_v10010230mg           70.9    2e-10    
ref|XP_010511970.1|  PREDICTED: uncharacterized protein LOC104788003  71.6    2e-10    
ref|NP_564252.2|  uncharacterized protein                             71.2    3e-10    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003556759.2|  PREDICTED: uncharacterized protein LOC100789016  71.6    3e-10    
ref|XP_007203111.1|  hypothetical protein PRUPE_ppa023904mg           70.5    3e-10    
ref|XP_008389435.1|  PREDICTED: uncharacterized protein LOC103451785  70.5    6e-10    
ref|XP_010258644.1|  PREDICTED: uncharacterized protein LOC104598320  70.5    6e-10    
ref|XP_008242640.1|  PREDICTED: uncharacterized protein LOC103340951  69.3    7e-10    
ref|XP_010683099.1|  PREDICTED: uncharacterized protein LOC104897842  69.7    1e-09    
ref|XP_010532668.1|  PREDICTED: uncharacterized protein LOC104808637  69.3    1e-09    
ref|XP_002887236.1|  predicted protein                                69.3    2e-09    
ref|XP_010470929.1|  PREDICTED: uncharacterized protein LOC104750779  69.3    2e-09    
ref|XP_006391017.1|  hypothetical protein EUTSA_v10018794mg           68.9    2e-09    
gb|KEH30805.1|  transmembrane protein, putative                       68.9    2e-09    
ref|XP_003607775.1|  ATP synthase subunit beta                        68.2    4e-09    
ref|XP_006302541.1|  hypothetical protein CARUB_v10020641mg           67.4    6e-09    
ref|XP_006476100.1|  PREDICTED: uncharacterized protein LOC102625444  65.5    6e-09    
emb|CAN79522.1|  hypothetical protein VITISV_034628                   67.4    8e-09    Vitis vinifera
ref|XP_010108724.1|  hypothetical protein L484_015713                 66.2    1e-08    
ref|XP_004962922.1|  PREDICTED: uncharacterized protein LOC101765523  65.5    2e-08    
ref|NP_177102.1|  uncharacterized protein                             65.5    2e-08    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010419096.1|  PREDICTED: uncharacterized protein LOC104704761  65.5    2e-08    
gb|EPS58318.1|  hypothetical protein M569_16497                       65.1    3e-08    
ref|XP_009105492.1|  PREDICTED: uncharacterized protein LOC103831343  65.1    3e-08    
gb|AAK59463.1|  unknown protein                                       62.0    4e-08    Arabidopsis thaliana [mouse-ear cress]
emb|CDX95932.1|  BnaA07g27990D                                        64.3    4e-08    
ref|XP_010552565.1|  PREDICTED: uncharacterized protein LOC104822905  64.7    5e-08    
emb|CDY40929.1|  BnaC06g30670D                                        64.3    5e-08    
ref|XP_010088844.1|  hypothetical protein L484_020828                 63.5    5e-08    
ref|XP_006359583.1|  PREDICTED: uncharacterized protein LOC102587208  62.8    2e-07    
ref|XP_007158630.1|  hypothetical protein PHAVU_002G168800g           62.0    3e-07    
ref|XP_004228368.1|  PREDICTED: uncharacterized protein LOC101245192  61.6    5e-07    
ref|XP_009421085.1|  PREDICTED: uncharacterized protein LOC104000701  60.5    9e-07    
ref|XP_009786893.1|  PREDICTED: uncharacterized protein LOC104234939  60.5    1e-06    
ref|XP_009404772.1|  PREDICTED: uncharacterized protein LOC103988010  60.1    1e-06    
ref|XP_008787101.1|  PREDICTED: uncharacterized protein LOC103705238  59.7    2e-06    
ref|XP_010936511.1|  PREDICTED: uncharacterized protein LOC105056132  59.7    2e-06    
ref|XP_010250356.1|  PREDICTED: uncharacterized protein LOC104592610  58.2    2e-06    
ref|XP_002965042.1|  hypothetical protein SELMODRAFT_82741            58.9    3e-06    
ref|XP_011075546.1|  PREDICTED: uncharacterized protein LOC105160002  58.2    6e-06    
ref|XP_010939057.1|  PREDICTED: uncharacterized protein LOC105058003  57.8    7e-06    
ref|XP_002267888.1|  PREDICTED: uncharacterized protein LOC100248804  57.4    9e-06    Vitis vinifera
ref|XP_006381704.1|  hypothetical protein POPTR_0006s16160g           55.8    3e-05    
ref|XP_008790177.1|  PREDICTED: uncharacterized protein LOC103707457  54.3    4e-05    
ref|XP_008654136.1|  PREDICTED: uncharacterized protein LOC103634377  55.5    4e-05    
ref|XP_011012331.1|  PREDICTED: uncharacterized protein LOC105116603  55.1    4e-05    
ref|XP_006658763.1|  PREDICTED: uncharacterized protein LOC102716517  52.8    7e-05    
ref|XP_004958201.1|  PREDICTED: uncharacterized protein LOC101756977  54.3    1e-04    
ref|XP_002460962.1|  hypothetical protein SORBIDRAFT_02g038260        53.9    1e-04    Sorghum bicolor [broomcorn]
ref|XP_003562770.1|  PREDICTED: uncharacterized protein LOC100824049  53.9    1e-04    
gb|EAZ04574.1|  hypothetical protein OsI_26726                        51.6    2e-04    Oryza sativa Indica Group [Indian rice]
ref|XP_009619962.1|  PREDICTED: uncharacterized protein LOC104111872  53.1    2e-04    
dbj|BAC55692.1|  hypothetical protein                                 52.4    4e-04    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ40524.1|  hypothetical protein OsJ_24980                        52.0    4e-04    Oryza sativa Japonica Group [Japonica rice]



>ref|XP_004242176.1| PREDICTED: uncharacterized protein LOC101259449 [Solanum lycopersicum]
Length=334

 Score =   370 bits (950),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 190/333 (57%), Positives = 245/333 (74%), Gaps = 2/333 (1%)
 Frame = +3

Query  30    MQEFSAAGMESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAM  209
             M+++S+  M+ + KI RRS+F FLQ +QF+TT A VLAFP+AASVL+ Q+FVPS+ FL  
Sbjct  1     MKDYSSVPMQGSGKIIRRSIFIFLQNYQFYTTIAAVLAFPFAASVLLLQAFVPSTCFLLA  60

Query  210   IHARIHTLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQ  389
             IH  +H+LFDA G PSSS+ FT+LN KLSQT AISFLA PFTL+  L +KA VI+AL DQ
Sbjct  61    IHDHLHSLFDAVGLPSSSKLFTLLNSKLSQTFAISFLAFPFTLTSLLFAKASVIEALSDQ  120

Query  390   ELPKRSLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLAD-EFGFSSPRFEL  566
             +  K+  F     ++S LLLTQLCN+ +++SANATCF LL F FN+ +  F  SSP   L
Sbjct  121   KSFKKPAFFSFCSLYSSLLLTQLCNTIVIISANATCFTLLFFTFNIFNYGFNLSSPSPIL  180

Query  567   FLSVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPI  746
             F+S +GA++CSII A+T  ICNLALVLSG E  GG+ AILKAC LIKG+  TALSLA+  
Sbjct  181   FISATGAIICSIISASTLIICNLALVLSGLENIGGYMAILKACFLIKGKNATALSLAVIF  240

Query  747   NMAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEG  926
             N+A AAVE L+QYRIV+ YHH +TG S++ALEGM IAY+YAILLVLDTI  C F   C+ 
Sbjct  241   NLAFAAVEVLYQYRIVKSYHHKRTGFSAIALEGMFIAYLYAILLVLDTISSCLFFECCKK  300

Query  927   DCHIDQYRRLPSHVEIEE-DNNAFRTVKIVEDL  1022
              C +D+    P  +EIE+ D++    +K +E+L
Sbjct  301   SCQMDEEGCFPYQIEIEDRDHHTVLLIKNLEEL  333



>ref|XP_002284698.1| PREDICTED: uncharacterized protein LOC100260477 [Vitis vinifera]
Length=326

 Score =   358 bits (920),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 187/326 (57%), Positives = 235/326 (72%), Gaps = 2/326 (1%)
 Frame = +3

Query  54    MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVP-SSPFLAMIHARIHT  230
             ME   +I RRSV+ FLQ++QFFT+TA +L  P++AS+L+ Q+F+P SSP L +IH R+  
Sbjct  1     MERTGRIMRRSVYTFLQQYQFFTSTAALLVLPFSASILLSQAFLPFSSPLLPVIHDRLQF  60

Query  231   LFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSL  410
             LF AAGFP SS+FFTILNLKLSQT++ S   LPFT+SF L+ KAC+IQAL   +      
Sbjct  61    LFKAAGFPPSSQFFTILNLKLSQTISSSIFTLPFTISFLLIGKACIIQALNHNKPGFPPS  120

Query  411   FSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGAL  590
             FS    ++ PLL+T + NS L+LSANAT F +L  AFN  +  G+SSP F  FLS + A+
Sbjct  121   FSSFISLYCPLLITYIWNSLLILSANATAFSVLFIAFNCLEGLGYSSPNFVPFLSAAAAI  180

Query  591   LCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVE  770
             L SIILAN+  ICNLALVLSG E  GG+ AILKACV+I+GRT TALSLALPIN+A+AAVE
Sbjct  181   LYSIILANSLIICNLALVLSGMERCGGYIAILKACVMIRGRTSTALSLALPINLALAAVE  240

Query  771   ALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHIDQYR  950
             ALFQYR+VR YH +    SS+ALEG+ IAYMY+IL+VLDTIV C F + C+  C  DQ  
Sbjct  241   ALFQYRVVRAYHISGKPRSSIALEGLFIAYMYSILVVLDTIVSCIFFKRCKRGCWTDQDG  300

Query  951   RLPSHVEI-EEDNNAFRTVKIVEDLP  1025
                  +EI EE   AF   +I E+LP
Sbjct  301   THSYRIEIAEEGGKAFENTRISEELP  326



>emb|CAN78131.1| hypothetical protein VITISV_000332 [Vitis vinifera]
Length=326

 Score =   358 bits (918),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 186/326 (57%), Positives = 234/326 (72%), Gaps = 2/326 (1%)
 Frame = +3

Query  54    MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVP-SSPFLAMIHARIHT  230
             ME   +I RRSV+ FLQ++QFFT+TA +L  P++AS+L+ Q+F+P SSP L +IH R+  
Sbjct  1     MERTGRIMRRSVYTFLQQYQFFTSTAALLVLPFSASILLSQAFLPFSSPLLPVIHDRLQF  60

Query  231   LFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSL  410
             LF AAGFP SS+FFTILNLKLSQT++ S   LPFT+SF L+ KAC+IQAL   +      
Sbjct  61    LFKAAGFPPSSQFFTILNLKLSQTISSSIFTLPFTISFLLIGKACIIQALNHNKPGFPPS  120

Query  411   FSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGAL  590
             FS    ++ PLL+T + NS L+LSANAT F +L  AFN  +  G+SSP F  FLS + A+
Sbjct  121   FSSFISLYCPLLITYIWNSLLILSANATAFSVLFIAFNCLEGLGYSSPNFVPFLSAAAAI  180

Query  591   LCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVE  770
             L SIILAN+  ICNLALVLSG E  GG+ AILKACV+I+GRT TALSLALPIN+A+AAVE
Sbjct  181   LYSIILANSLIICNLALVLSGMERCGGYIAILKACVMIRGRTSTALSLALPINLALAAVE  240

Query  771   ALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHIDQYR  950
             ALFQYR+VR YH +    SS+ALEG+ IAYMY+ L+VLDTIV C F + C+  C  DQ  
Sbjct  241   ALFQYRVVRAYHISGKPRSSIALEGLFIAYMYSJLVVLDTIVSCIFFKRCKRGCWTDQDG  300

Query  951   RLPSHVEI-EEDNNAFRTVKIVEDLP  1025
                  +EI EE   AF   +I E+LP
Sbjct  301   THSYRIEIAEEGGKAFENTRISEELP  326



>ref|XP_007037439.1| Uncharacterized protein TCM_014112 [Theobroma cacao]
 gb|EOY21940.1| Uncharacterized protein TCM_014112 [Theobroma cacao]
Length=340

 Score =   350 bits (897),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 178/333 (53%), Positives = 235/333 (71%), Gaps = 1/333 (0%)
 Frame = +3

Query  30    MQEFSAAGMESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAM  209
             M++     ME A+KI RRS++ FLQ + + T TA +LAFPY+AS+L+ Q FVPSSP L  
Sbjct  8     MEDSPRIQMEKASKIIRRSIYTFLQNYHYLTATAALLAFPYSASILLSQLFVPSSPLLPT  67

Query  210   IHARIHTLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQ  389
             IH R+  LF AAGFP SSEFFT+L+ K+SQT++ S  ALPFTLSF L++KA +IQ L   
Sbjct  68    IHNRLRILFQAAGFPPSSEFFTVLSFKISQTISSSIFALPFTLSFLLIAKASIIQLLNHH  127

Query  390   ELPKRSLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELF  569
             +      FS +  ++ PLL T +CN  L+LSANAT F LL FAFN  + FGF+SP + LF
Sbjct  128   KPNLPPSFSSVISLYKPLLATYICNFLLLLSANATAFSLLFFAFNFLEGFGFTSPSWLLF  187

Query  570   LSVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPIN  749
             LS +GA+L SIILAN   ICNLALV SG E +GG+ AILKACVLI+GRT TAL+LA+P+N
Sbjct  188   LSAAGAVLYSIILANALIICNLALVSSGMERSGGYMAILKACVLIRGRTSTALTLAVPVN  247

Query  750   MAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGD  929
             + +AA+EALF YR+VR +H        +A EG+LIA++Y+  +VLDT+V C F +SC+  
Sbjct  248   LVLAAIEALFHYRVVRAFHTGDVTSFPMASEGILIAFLYSTFVVLDTVVSCMFFKSCKTG  307

Query  930   CHIDQYRRLPSHVEI-EEDNNAFRTVKIVEDLP  1025
               ++Q  R    +EI EED NA+  +K +E LP
Sbjct  308   SLVEQEGRHSYRIEIAEEDGNAYVKLKNIEQLP  340



>ref|XP_009617175.1| PREDICTED: uncharacterized protein LOC104109549 [Nicotiana tomentosiformis]
Length=328

 Score =   346 bits (887),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 199/334 (60%), Positives = 249/334 (75%), Gaps = 12/334 (4%)
 Frame = +3

Query  30    MQEF-SAAGMESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLA  206
             M+++ S+  M+   KI RRS+F FLQ +QFFTTTA   AFP+AAS L+ QSF+PSS F  
Sbjct  1     MEDYNSSIPMQRTTKIIRRSIFSFLQNYQFFTTTAAFFAFPFAASFLLLQSFIPSSSFFP  60

Query  207   MIHARIHTLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGD  386
             +I+ R+H LFDAAGFPSSSEFFT+LN K+SQT+AISFLA PFT+S FL SKA VI+AL  
Sbjct  61    IIYERLHLLFDAAGFPSSSEFFTLLNSKISQTIAISFLAFPFTISSFLFSKASVIEALNS  120

Query  387   QELPKR-SLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLAD-EFGFSSPRF  560
              +  +  S FS       PLLLTQLCNS +++SANATCF +L F FNL D  FG SSPR 
Sbjct  121   SKPAQNPSFFSSF----FPLLLTQLCNSLVIISANATCFTVLFFGFNLVDYGFGLSSPRL  176

Query  561   ELFLSVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLAL  740
              L  S +GA++CSIILANT  ICNLALV+SG E  GG+ AILK+C+LI+GRT TALSLA+
Sbjct  177   ILLCSATGAVICSIILANTLIICNLALVISGTEKIGGYMAILKSCILIRGRTATALSLAV  236

Query  741   PINMAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSC  920
             P+++A+AAVEALFQYRIVR Y+  KT + S+ALEG+ IAYMY+ILLVLDTIV   F RSC
Sbjct  237   PVSLALAAVEALFQYRIVRAYYQEKTDLFSLALEGIFIAYMYSILLVLDTIVSIVFYRSC  296

Query  921   EGDCHIDQYRRLPSHVEIEE-DNNAFRTVKIVED  1019
             +     D+ R LP  VEI++ D +    +K +E+
Sbjct  297   KT----DEGRILPYQVEIQDRDEHTVLKIKTLEE  326



>emb|CDP18310.1| unnamed protein product [Coffea canephora]
Length=335

 Score =   345 bits (884),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 187/335 (56%), Positives = 240/335 (72%), Gaps = 5/335 (1%)
 Frame = +3

Query  30    MQEFSAAGMESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAM  209
             M++     M +  +I RRS++ FLQK+QFFTTTA  LAFP+AA VL+ ++ +PSS  L +
Sbjct  1     MEQCPRYPMANTVRIMRRSIYTFLQKYQFFTTTAAFLAFPFAALVLLSEASIPSSSLLQV  60

Query  210   IHARIHTLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQ  389
             I  R+ +LF+AAGFP SSEFF ILNLKLSQT+A SF+ +PFTL+F L +KA +IQ   + 
Sbjct  61    IQKRLQSLFNAAGFPRSSEFFFILNLKLSQTIATSFVVVPFTLTFLLFAKAFIIQFFCNH  120

Query  390   ELPKRSLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELF  569
             +      F+    ++SPL LTQ+CN  +++SANATCF LL FAFN  D  G  +P+  L 
Sbjct  121   KPTAEPKFASFLSLYSPLFLTQICNMLVIISANATCFCLLFFAFNCLDGLGLLNPKMLLL  180

Query  570   LSVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPIN  749
              S +GA+L SIILANT  ICNL L+LSG E TGG+ AILKACVLI+GR+ TALSLALPIN
Sbjct  181   FSATGAVLYSIILANTLIICNLGLILSGIENTGGYIAILKACVLIRGRSATALSLALPIN  240

Query  750   MAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGD  929
             MA+AA+EALFQYR+VR YHHA++ +SS+  EGM IAY+Y++LLVLDT+V C   RSC+  
Sbjct  241   MALAAIEALFQYRVVRAYHHAESPVSSIVFEGMFIAYLYSVLLVLDTVVGCVLYRSCKAS  300

Query  930   CHIDQYRRLPSH---VEIE-EDNNAFRTVKIVEDL  1022
               IDQ     SH   VE E ED N F   K ++DL
Sbjct  301   IQIDQENGY-SHSYLVEFEDEDVNYFAKSKALDDL  334



>ref|XP_008239893.1| PREDICTED: uncharacterized protein LOC103338467 [Prunus mume]
Length=339

 Score =   335 bits (859),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 179/330 (54%), Positives = 233/330 (71%), Gaps = 6/330 (2%)
 Frame = +3

Query  54    MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSP-FLAMIHARIHT  230
             M  A KI R+SV  FLQ +QFFT+   ++A P++ASVL+ Q+ VPSS   L  I+ R+ +
Sbjct  10    MAKAGKILRKSVHTFLQNYQFFTSIVALIALPFSASVLISQALVPSSSSLLPTIYNRLQS  69

Query  231   LFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQE---LPK  401
             LFDAAGFP SSEFF+ILN KLSQT++ S   +PFTL+F L++KA VIQ L  Q+      
Sbjct  70    LFDAAGFPPSSEFFSILNHKLSQTISSSIFTIPFTLTFLLITKASVIQYLNHQKPTTFSS  129

Query  402   RSLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVS  581
                FS +  +++PLL T + NSFL+LSANAT F LL  AFN  + FGFSSP   LFLS S
Sbjct  130   HPSFSSVISLYTPLLHTHIFNSFLILSANATVFSLLFIAFNFLEGFGFSSPNTLLFLSAS  189

Query  582   GALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMA  761
             GA+L SI+LAN   ICNL+LVLSG E +GG+ AILKAC+LI+GRT TALSLALP+N+A+A
Sbjct  190   GAVLYSIVLANALIICNLSLVLSGTERSGGYLAILKACILIRGRTATALSLALPVNLALA  249

Query  762   AVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHID  941
             A+EALFQYR+VR  H A    SS+ALEG+LIAY+Y++L+VLDTIV   F +SC+     D
Sbjct  250   AIEALFQYRVVRACHFAGKLGSSMALEGLLIAYLYSVLVVLDTIVSFMFFKSCKPSSWAD  309

Query  942   QYRRLPSHVEI--EEDNNAFRTVKIVEDLP  1025
             Q  +    +E   EE    +  +K +++LP
Sbjct  310   QEGKHSGGIEYRDEESCGGYGNLKTLKELP  339



>ref|XP_011072808.1| PREDICTED: uncharacterized protein LOC105157952 [Sesamum indicum]
Length=331

 Score =   333 bits (855),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 183/325 (56%), Positives = 226/325 (70%), Gaps = 12/325 (4%)
 Frame = +3

Query  30   MQE-----FSAAGMESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSS  194
            MQE     +S+  M  A++I R+S+F FLQ FQFFT+   +LA P+A S L+ Q  V SS
Sbjct  1    MQEHCSYYYSSFPMGKASRIMRKSIFTFLQNFQFFTSAPSLLAVPFAVSALLSQPLVSSS  60

Query  195  PFLAMIHARIHTLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQ  374
                ++H R+ ++F AAGFP SSE F ILNLKLSQTV    + LPFTLSF LL+KA VI+
Sbjct  61   SLFPLVHGRLRSVFLAAGFPPSSELFAILNLKLSQTVLSFLIVLPFTLSFLLLAKASVIR  120

Query  375  ALGDQELPKRSLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSP  554
            AL  Q+  +R  F     I +PL +TQLCNS  +LS NATCF LL+  FNL D  G SS 
Sbjct  121  ALEHQKTAQRHAFFSWVMIFNPLFITQLCNSLFILSVNATCFCLLIICFNLFDAVGLSSH  180

Query  555  RFELFLSVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSL  734
               L LS +GA++ SIILAN + ICNLAL++SG E  GGF +ILKACVLI+GRT TALSL
Sbjct  181  GPLLLLSATGAIIYSIILANAYIICNLALLVSGIERQGGFNSILKACVLIRGRTATALSL  240

Query  735  ALPINMAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLR  914
            A+PINMA+AAVEALFQYR+VR Y  A    SS+ LE MLIAY+YAILLVLDTI+   FL+
Sbjct  241  AVPINMALAAVEALFQYRVVRAYGRAMAPDSSIVLEAMLIAYVYAILLVLDTILGFAFLK  300

Query  915  SCEGDCHIDQYRRLPSHVEIEEDNN  989
            SC+ D  ID+       +EI+E NN
Sbjct  301  SCKPDYQIDE-------IEIQERNN  318



>ref|XP_007210084.1| hypothetical protein PRUPE_ppa019735mg [Prunus persica]
 gb|EMJ11283.1| hypothetical protein PRUPE_ppa019735mg [Prunus persica]
Length=330

 Score =   330 bits (846),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 178/330 (54%), Positives = 232/330 (70%), Gaps = 6/330 (2%)
 Frame = +3

Query  54    MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSP-FLAMIHARIHT  230
             M  A KI R+SV  FLQ +QFFT+   ++A P++ASVL+ Q+ VPSS   L  I+ R+ +
Sbjct  1     MAKAGKILRKSVHTFLQNYQFFTSIVALIALPFSASVLISQALVPSSSSLLPTIYNRLQS  60

Query  231   LFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQE---LPK  401
             LFDAAGFP SSEFF+ILN KLSQT++ S   +PFTL+F L++KA VIQ L  ++      
Sbjct  61    LFDAAGFPPSSEFFSILNHKLSQTISSSIFTIPFTLTFLLITKASVIQYLNHRKPTTFSS  120

Query  402   RSLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVS  581
                FS +  ++ PLL T + NSFL+LSANAT F LL  AFN  + FGFSSP   LFLS S
Sbjct  121   HPSFSSVISLYIPLLHTHIFNSFLILSANATVFSLLFIAFNFLEGFGFSSPNTLLFLSAS  180

Query  582   GALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMA  761
             GA+L SI+LAN   ICNL+LVLSG E +GG+ AILKAC+LI+GRT TALSLALP+N+A+A
Sbjct  181   GAVLYSIVLANALIICNLSLVLSGTERSGGYLAILKACILIRGRTATALSLALPVNLALA  240

Query  762   AVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHID  941
             A+EALFQYR+VR  H A    SS+ALEG+LIAY+Y++L+VLDTIV   F +SC+     D
Sbjct  241   AIEALFQYRVVRACHFAGKLGSSMALEGLLIAYLYSVLVVLDTIVSFMFFKSCKPSSWAD  300

Query  942   QYRRLPSHVEI--EEDNNAFRTVKIVEDLP  1025
             Q  +    +E   EE    +  +K +++LP
Sbjct  301   QEGKHSCGIEYRDEESCGGYGNLKTLKELP  330



>ref|XP_010089884.1| hypothetical protein L484_008572 [Morus notabilis]
 gb|EXB38544.1| hypothetical protein L484_008572 [Morus notabilis]
Length=330

 Score =   330 bits (845),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 178/331 (54%), Positives = 234/331 (71%), Gaps = 8/331 (2%)
 Frame = +3

Query  54    MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFV----PSSPFLAMIHAR  221
             ME + KI RRS++ FLQ +  FT+ A +LA P++AS+L+ Q+ +     SS  L  I+ R
Sbjct  1     MEKSCKILRRSIYTFLQNYHHFTSKAALLALPFSASILLSQALIFPSSSSSSLLPTIYTR  60

Query  222   IHTLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPK  401
             +  LFDAAGFP SSEFFTILN KLSQT+++S   LPFTL+FFLLSKA VIQ+L   +   
Sbjct  61    LDNLFDAAGFPHSSEFFTILNQKLSQTISLSIFTLPFTLTFFLLSKAYVIQSLTSPKPAS  120

Query  402   RSLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVS  581
             R  FS +  ++ PL +T +CNS L+LSANAT F LL FAFN+ D   F+SP   LFLS S
Sbjct  121   RPSFSSILSLYDPLFITYICNSLLILSANATVFTLLFFAFNVLDGLSFNSPNTVLFLSAS  180

Query  582   GALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMA  761
             GA+L SI+LANT   CNLALVLSG E +GG+ A LKACVLIKGR  TALSLALP+N+ +A
Sbjct  181   GAVLYSIVLANTLITCNLALVLSGMERSGGYLATLKACVLIKGRISTALSLALPLNLTLA  240

Query  762   AVEALFQYRIVRVYH-HAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHI  938
             A+EALFQYR+VR YH H K G SS+ LE +LI Y+Y+IL+V+DT+V   F RSC+    I
Sbjct  241   ALEALFQYRVVRAYHVHGKLG-SSMVLESILIFYLYSILVVIDTVVNIMFCRSCQVGFLI  299

Query  939   DQYRRL--PSHVEIEEDNNAFRTVKIVEDLP  1025
             DQ  R+      +  ++ + + ++K +E++P
Sbjct  300   DQEERICGAKDGDHRDEKSGYASLKNLEEIP  330



>ref|XP_004236481.1| PREDICTED: uncharacterized protein LOC101262301 [Solanum lycopersicum]
Length=332

 Score =   328 bits (842),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 180/303 (59%), Positives = 228/303 (75%), Gaps = 5/303 (2%)
 Frame = +3

Query  30   MQEFSAAGMESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAM  209
            M+ +S+  ME   KI R+S+F FLQ +QFFTTT    AFP+AASVL  QSF+ SS    +
Sbjct  1    METYSSVPMEKTTKIIRKSIFIFLQNYQFFTTTTAFFAFPFAASVLFLQSFIYSSSLYPI  60

Query  210  IHARIHTLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQ  389
            I+ R+H LFDAAGFPSSSEFF +LN K+SQT+ ISFL+ PFT+SF+L +K+ VI++L   
Sbjct  61   IYERLHLLFDAAGFPSSSEFFILLNSKISQTILISFLSFPFTISFYLFAKSVVIESLKYS  120

Query  390  ELPKRSLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADE-FGFSSPRFEL  566
            +  +R+ F      +  LL+TQLCNS L++SANATCF LL F FNL D  FG S+PR  L
Sbjct  121  KPSQRTTFPS----YFNLLVTQLCNSLLIISANATCFTLLFFGFNLFDYGFGLSNPRTIL  176

Query  567  FLSVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPI  746
             LS +GA+LCSIILANT  ICNLALV SG E  GGF AILK+CVLI+GRT TALSLA+P+
Sbjct  177  LLSATGAVLCSIILANTLIICNLALVTSGNERIGGFMAILKSCVLIRGRTATALSLAVPV  236

Query  747  NMAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEG  926
            N+A+AAVEALFQYRIV  Y+  KT + ++ALEGM IAY+Y++L+VLDTI  C F +SC+ 
Sbjct  237  NLALAAVEALFQYRIVNAYYQEKTELFTLALEGMFIAYIYSLLIVLDTIASCVFYKSCKT  296

Query  927  DCH  935
            + H
Sbjct  297  EEH  299



>ref|XP_011101971.1| PREDICTED: uncharacterized protein LOC105180005 [Sesamum indicum]
Length=325

 Score =   323 bits (829),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 171/314 (54%), Positives = 222/314 (71%), Gaps = 0/314 (0%)
 Frame = +3

Query  54   MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTL  233
            M  A  + RRS+F FLQ +Q+FT+T  +LAFP+A S L+ QS V SS    ++H R+ +L
Sbjct  1    MGKAGAVLRRSIFSFLQNYQYFTSTPALLAFPFAVSTLLSQSLVSSSSLFPLVHGRLSSL  60

Query  234  FDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSLF  413
            F AAGFP SSE FT+L LKLSQT+   F   PFT SF LL+KA +I+A+G  +  ++  F
Sbjct  61   FLAAGFPPSSELFTVLGLKLSQTILTFFFVCPFTFSFLLLAKASIIKAVGPHKPAEQPSF  120

Query  414  SCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGALL  593
            S    +  PLL+TQLCNS ++L+ANATCF LL+  FNL D  G  SPR +L LS +GA++
Sbjct  121  SSWIPLFCPLLITQLCNSLVILAANATCFFLLVIFFNLFDILGLLSPRSQLLLSATGAVI  180

Query  594  CSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEA  773
             SIILAN +  CNLALVL+G E  GGF +ILKACVLI+GRT TALSLA+PINMA+AA+EA
Sbjct  181  YSIILANAYITCNLALVLAGIEKRGGFISILKACVLIQGRTATALSLAVPINMALAAIEA  240

Query  774  LFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHIDQYRR  953
            LFQYR++  YH AK   S++ LEGM + Y+YA+L+VLDT+V C F RSC+ D H D+   
Sbjct  241  LFQYRVMSAYHRAKGPDSAMLLEGMFVGYLYALLIVLDTVVGCVFWRSCKTDFHTDREEA  300

Query  954  LPSHVEIEEDNNAF  995
                +EI E +  F
Sbjct  301  YSHRIEIREIDGKF  314



>ref|XP_009339133.1| PREDICTED: uncharacterized protein LOC103931378 [Pyrus x bretschneideri]
Length=319

 Score =   320 bits (821),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 173/324 (53%), Positives = 228/324 (70%), Gaps = 10/324 (3%)
 Frame = +3

Query  54    MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSP-FLAMIHARIHT  230
             ME+A KI RRSV  FL  +Q+FT+TA ++A P++ASVL+ Q+ +PSS   LA ++ R+H+
Sbjct  1     METAGKILRRSVHIFLLNYQYFTSTAALIALPFSASVLISQALLPSSSALLATVYNRLHS  60

Query  231   LFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSL  410
             LFDAAGFP S EFFTILN KLSQT+  S    PF+L+F L++K+ VIQ L   + P  S 
Sbjct  61    LFDAAGFPPSLEFFTILNHKLSQTITSSVFTFPFSLTFLLITKSFVIQTLSRHQKPNSSS  120

Query  411   ---FSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVS  581
                F     +++PLL T + NSFL+LSANAT F +L  AFN+ +  GFSSP   LFLS S
Sbjct  121   HPSFLSTISLYTPLLHTHVYNSFLILSANATVFSILFIAFNVLEGSGFSSPNTLLFLSAS  180

Query  582   GALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMA  761
             GA+L SI+LAN   ICNLALVLSG + +GG+ AILKAC+LI+GRT TALSLALP+++ +A
Sbjct  181   GAVLYSIVLANALIICNLALVLSGTQKSGGYLAILKACLLIRGRTSTALSLALPVSLTLA  240

Query  762   AVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHID  941
             AVEALFQYR+VR YH      SS+A+EG+ IAY+Y+IL+VLDT V   FL+SC+      
Sbjct  241   AVEALFQYRLVRAYHFTGQLGSSMAMEGVFIAYLYSILVVLDTTVSFLFLQSCKPSSRGI  300

Query  942   QYRRLPSHVEIEEDNNAFRTVKIV  1013
             +YR      + EE     + VK++
Sbjct  301   EYR------DDEESCGDLKAVKVL  318



>ref|XP_009339684.1| PREDICTED: uncharacterized protein LOC103931867 [Pyrus x bretschneideri]
Length=324

 Score =   320 bits (820),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 173/322 (54%), Positives = 227/322 (70%), Gaps = 10/322 (3%)
 Frame = +3

Query  54    MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSP-FLAMIHARIHT  230
             ME A +I R+SV  FL  +Q+FT+ A V+A P++ASVL+ Q+ +PSS   L  ++ R+H+
Sbjct  1     MEKAGRIIRKSVHTFLLNYQYFTSIAAVIALPFSASVLISQALLPSSSALLPAVYNRLHS  60

Query  231   LFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSL  410
             LFDAAGFP S EFFTILN KLSQT+  S    PF+L+F L++KA VIQ+L   + P  S 
Sbjct  61    LFDAAGFPPSLEFFTILNNKLSQTITSSIFTFPFSLTFLLITKAFVIQSLSHHQKPNTSS  120

Query  411   ---FSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVS  581
                F     +++PLL T + NSFL+LSANAT F LL  AFN+ +  GFSSP   LFLSVS
Sbjct  121   HPSFLSTISLYTPLLHTHVYNSFLILSANATVFSLLFIAFNVLEGLGFSSPNTLLFLSVS  180

Query  582   GALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMA  761
             GA+L SI+LAN   ICNLALVLSG + +GG+ A+LKAC+LI+GRT TAL LALP+++ +A
Sbjct  181   GAVLYSIVLANALIICNLALVLSGAQKSGGYLALLKACLLIRGRTSTALCLALPVSLTLA  240

Query  762   AVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHID  941
             AVEALFQYR+VR YH A    SS+A+EG+ IAY+Y+IL+VLDT V   FL+SC+      
Sbjct  241   AVEALFQYRVVRAYHFAGKLGSSMAMEGVFIAYLYSILVVLDTTVSLMFLQSCKPSS---  297

Query  942   QYRRLPSHVEIEEDNNAFRTVK  1007
               RR+  H + EE+    + VK
Sbjct  298   --RRI-EHRDDEENRGDLKAVK  316



>ref|XP_002514717.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47823.1| conserved hypothetical protein [Ricinus communis]
Length=341

 Score =   318 bits (815),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 179/332 (54%), Positives = 233/332 (70%), Gaps = 9/332 (3%)
 Frame = +3

Query  54    MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSF-VPSSPFL-AMIHARIH  227
             M    KI RRS+  FLQ +Q+FT+ + +LA P++ S+L+ Q+  VPSS  L   +H+R+ 
Sbjct  11    MARTGKIIRRSIHTFLQNYQYFTSGSALLALPFSVSILLSQALLVPSSNSLFPTVHSRLQ  70

Query  228   TLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRS  407
              LF AAGFP SSEFFTIL+LKLSQT++ S  ALPFTL+F L +KA VIQAL ++  P  S
Sbjct  71    ALFRAAGFPLSSEFFTILSLKLSQTISSSVFALPFTLTFLLFAKASVIQAL-NKSKPTLS  129

Query  408   L--FSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVS  581
                FSC+  I +PLLLT + N+FL++SANAT F LL  +FN  + FGFSSP   L LS +
Sbjct  130   SPSFSCIICIFNPLLLTYIFNTFLIISANATAFCLLFLSFNFLEGFGFSSPNSCLLLSAA  189

Query  582   GALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMA  761
             GA+L SIILAN    CNLALVLSG E +GGF A LKACV+I+GRT TALSLALP ++++A
Sbjct  190   GAVLYSIILANALITCNLALVLSGGEKSGGFMAFLKACVMIRGRTSTALSLALPASISLA  249

Query  762   AVEALFQYRIVRVYHH-AKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHI  938
              +EALFQYRIVR Y+H  +T  S + +EGMLIAY+Y++ +VLDT+  C FL SC  +  I
Sbjct  250   GIEALFQYRIVRPYNHRGQTASSLMVMEGMLIAYLYSVFIVLDTVATCIFLESCNRNSCI  309

Query  939   DQYR-RLPSHVEI-EED-NNAFRTVKIVEDLP  1025
             DQ   R    +EI EED    + + K  ++LP
Sbjct  310   DQEEGRFAYRIEILEEDYQGGYVSSKATQELP  341



>gb|KDO55467.1| hypothetical protein CISIN_1g019105mg [Citrus sinensis]
Length=346

 Score =   315 bits (808),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 176/334 (53%), Positives = 222/334 (66%), Gaps = 5/334 (1%)
 Frame = +3

Query  33    QEFSAAGMESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSP-FLAM  209
             QE     M    KI RRS++ FLQ +Q FTTT  VLA P+AAS+L+ Q+ VPSS   L +
Sbjct  11    QETPRIPMAKTTKIIRRSIYIFLQNYQHFTTTVAVLAIPFAASILLSQALVPSSSSLLPL  70

Query  210   IHARIHTLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQ  389
             IH R+ TLF AAGFP SSEFF+IL+LKLSQT++ S   LPF+L+F LL+KA +IQ L   
Sbjct  71    IHNRLKTLFQAAGFPPSSEFFSILSLKLSQTISSSIFTLPFSLTFLLLAKASIIQVLRQH  130

Query  390   ELPKRSLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELF  569
             +      FS L    SPL  T +CNSFL+LSANAT F LLL AFN  +  GFSSP   LF
Sbjct  131   KPTFPPSFSSLFSAFSPLFHTYICNSFLILSANATVFSLLLIAFNFLEGSGFSSPNCILF  190

Query  570   LSVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPIN  749
             LS +GA+L SI+LAN   I NLAL++SG E+ GG+ AILKACVLI+GRT  ALSLALP N
Sbjct  191   LSAAGAVLYSIVLANALIISNLALIISGMESCGGYLAILKACVLIRGRTSVALSLALPAN  250

Query  750   MAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGD  929
             + +A +EALFQYRIVR Y        S+A EGM IAY+Y+I +VLDT++ C F +SC+  
Sbjct  251   LVLAGIEALFQYRIVRAYRLGGVASHSMAFEGMFIAYLYSISVVLDTVISCMFYKSCKIG  310

Query  930   CHIDQYRRLPSHVE----IEEDNNAFRTVKIVED  1019
               I+Q  R+  +        ED   +  +K  E+
Sbjct  311   SWIEQEDRISYYSNQTDTAGEDKEGYVNLKNCEE  344



>ref|XP_010258424.1| PREDICTED: uncharacterized protein LOC104598194 [Nelumbo nucifera]
Length=327

 Score =   314 bits (805),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 171/325 (53%), Positives = 226/325 (70%), Gaps = 2/325 (1%)
 Frame = +3

Query  57    ESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPS-SPFLAMIHARIHTL  233
              S++KI RRS+F FL+ +Q FT+ A +  FP + SVL+ Q  +PS SP L +IHAR+ +L
Sbjct  3     SSSSKIVRRSIFTFLKHYQHFTSIAALFVFPVSVSVLLSQVVLPSFSPLLQIIHARLQSL  62

Query  234   FDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSLF  413
             F AAGFP S  FF++L+LKLSQT++ S L +PFTLSF L+ KACVIQ L   +L   S  
Sbjct  63    FHAAGFPPSLPFFSLLSLKLSQTISSSILTVPFTLSFLLIGKACVIQILHHPKLSLSSSL  122

Query  414   SCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGALL  593
             S    ++S LLLT LCNSF++L+ANA  F +L   FN  D FGFSSP F L LS +GA+L
Sbjct  123   SYFAFLYSRLLLTYLCNSFVILAANAAAFSILFLTFNSFDAFGFSSPNFLLLLSAAGAVL  182

Query  594   CSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEA  773
              S++LANT  ICNLAL+++G E   G+  ILKACVLIKGR   ALSLALPIN+ +AA+EA
Sbjct  183   YSVVLANTLVICNLALIVAGMENCSGYLPILKACVLIKGRASKALSLALPINLGLAAIEA  242

Query  774   LFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHIDQYRR  953
             LFQYR+VR +H       SVALEG+LIAY+Y++L++LDTIV C F +SC+    +    R
Sbjct  243   LFQYRVVRGHHLYDRYGPSVALEGILIAYLYSLLVLLDTIVSCIFFKSCKSASQMHSQGR  302

Query  954   LPSHVEIEEDNNA-FRTVKIVEDLP  1025
                 + I E+NN+ F   K + ++P
Sbjct  303   YNYQMGIAEENNSIFTYSKALLEIP  327



>ref|XP_006494989.1| PREDICTED: uncharacterized protein LOC102626486 [Citrus sinensis]
Length=346

 Score =   313 bits (803),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 172/309 (56%), Positives = 214/309 (69%), Gaps = 1/309 (0%)
 Frame = +3

Query  33   QEFSAAGMESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSP-FLAM  209
            QE     M    KI RRS++ FLQ +Q FTTT  VLA P+AAS+L+ Q+ VPSS   L +
Sbjct  11   QETPRIPMAKTTKIIRRSIYIFLQNYQHFTTTVAVLAIPFAASILLSQALVPSSSSLLPL  70

Query  210  IHARIHTLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQ  389
            IH R+ TLF AAGFP SSEFF+IL+LKLSQT++ S   LPF+L+F LL+KA +IQ L   
Sbjct  71   IHNRLKTLFQAAGFPPSSEFFSILSLKLSQTISSSIFTLPFSLTFLLLAKASIIQVLRQH  130

Query  390  ELPKRSLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELF  569
            +      FS L    SPL  T +CNSFL+LSANAT F LLL AFN  +  GFSSP   LF
Sbjct  131  KPTFPPSFSSLFSAFSPLFHTYICNSFLILSANATVFSLLLIAFNFLEGSGFSSPNCILF  190

Query  570  LSVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPIN  749
            LS +GA+L SI+LAN   I NLAL++SG E+ GG+ AILKACVLI+GRT  ALSLALP N
Sbjct  191  LSAAGAVLYSIVLANALIISNLALIISGMESCGGYLAILKACVLIRGRTSVALSLALPAN  250

Query  750  MAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGD  929
            + +A +EALFQYRIVR Y        S+A EGM IAY+Y+I +VLDT++ C F +SC+  
Sbjct  251  LVLAGIEALFQYRIVRAYRLGGVASHSMAFEGMFIAYLYSISVVLDTVISCMFYKSCKIG  310

Query  930  CHIDQYRRL  956
              I+Q  R+
Sbjct  311  SWIEQEDRI  319



>ref|XP_006440660.1| hypothetical protein CICLE_v10020945mg [Citrus clementina]
 gb|ESR53900.1| hypothetical protein CICLE_v10020945mg [Citrus clementina]
Length=346

 Score =   313 bits (801),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 175/334 (52%), Positives = 221/334 (66%), Gaps = 5/334 (1%)
 Frame = +3

Query  33    QEFSAAGMESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSP-FLAM  209
             QE     M    KI RRS++ FLQ +Q FTTT  VLA P+AAS+L+ Q+ VPSS   L +
Sbjct  11    QETPRIPMAKTTKIIRRSIYIFLQNYQHFTTTVAVLAIPFAASILLSQALVPSSSSLLPL  70

Query  210   IHARIHTLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQ  389
             IH  + TLF AAGFP SSEFF+IL+LKLSQT++ S   LPF+L+F LL+KA +IQ L   
Sbjct  71    IHNPLKTLFQAAGFPPSSEFFSILSLKLSQTISASIFTLPFSLTFLLLAKASIIQVLRQH  130

Query  390   ELPKRSLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELF  569
             +      FS L    SPL  T +CNSFL+LSANAT F LLL AFN  +  GFSSP   LF
Sbjct  131   KPTFPPSFSSLFSAFSPLFHTYICNSFLILSANATVFSLLLIAFNFLEGSGFSSPNCILF  190

Query  570   LSVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPIN  749
             LS +GA+L SI+LAN   I NLAL++SG E+ GG+ AILKACVLI+GRT  ALSLALP N
Sbjct  191   LSAAGAVLYSIVLANALIISNLALIISGMESCGGYLAILKACVLIRGRTSVALSLALPAN  250

Query  750   MAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGD  929
             + +A +EALFQYRIVR Y        S+A EGM IAY+Y+I +VLDT++ C F +SC+  
Sbjct  251   LVLAGIEALFQYRIVRAYRLGGVASHSMAFEGMFIAYLYSISVVLDTVISCMFYKSCKIG  310

Query  930   CHIDQYRRLPSHVE----IEEDNNAFRTVKIVED  1019
               I+Q  R+  +        ED   +  +K  E+
Sbjct  311   SWIEQEDRISYYSNQTDTAGEDKEGYVNLKNCEE  344



>ref|XP_008393355.1| PREDICTED: uncharacterized protein LOC103455546 [Malus domestica]
Length=324

 Score =   310 bits (795),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 170/322 (53%), Positives = 222/322 (69%), Gaps = 10/322 (3%)
 Frame = +3

Query  54    MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSS-PFLAMIHARIHT  230
             ME A +I R+SV  FL  +Q+FT+ A V+A P++ASVL+ Q+ +PSS   L  ++ R+H+
Sbjct  1     MEKAGRIIRKSVHTFLLNYQYFTSIAAVIALPFSASVLISQALLPSSFALLXAVYNRLHS  60

Query  231   LFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSL  410
             LFD AGFP S EFFTILN KLSQT+  S    PF+L+F L++KA VIQ+L   + P  S 
Sbjct  61    LFDXAGFPPSLEFFTILNNKLSQTITSSIFTFPFSLTFLLITKAFVIQSLSHHQKPNTSS  120

Query  411   ---FSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVS  581
                F     +++PLL T + NSFL+LSANAT F LL  AFN+ +  GFSSP   LFLSVS
Sbjct  121   HPSFLSTISLYTPLLHTHVYNSFLILSANATVFSLLFIAFNVLEGLGFSSPNTLLFLSVS  180

Query  582   GALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMA  761
             GA+L SI+L N   ICNLALVLSG + +GG+ AILKAC+LI+GRT TAL LALP+++ +A
Sbjct  181   GAVLYSIVLXNALIICNLALVLSGAQKSGGYLAILKACLLIRGRTSTALCLALPVSLTLA  240

Query  762   AVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHID  941
             AVEALFQYRIVR YH A    SS+A+EG+ +AY+Y+IL+VLD  V   FL+SC+      
Sbjct  241   AVEALFQYRIVRAYHFAGKLGSSMAMEGVFLAYLYSILVVLDITVSFMFLQSCKPSS---  297

Query  942   QYRRLPSHVEIEEDNNAFRTVK  1007
               RR+  H +  E     + VK
Sbjct  298   --RRI-EHRDDXESRGDLKAVK  316



>ref|XP_008374578.1| PREDICTED: uncharacterized protein LOC103437852 [Malus domestica]
Length=319

 Score =   309 bits (792),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 168/324 (52%), Positives = 225/324 (69%), Gaps = 10/324 (3%)
 Frame = +3

Query  54    MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSP-FLAMIHARIHT  230
             ME+A KI RRSV  FL  +Q+FT+TA ++A P++ASVL+ Q+ +PSS   LA ++ R+H+
Sbjct  1     METAGKILRRSVHTFLLNYQYFTSTAALIALPFSASVLISQALLPSSSALLAAVYNRLHS  60

Query  231   LFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSL  410
             LF+AAGFP S EFF ILN KLSQT+  S    PF+L+F L++K+ VIQ L   + P  S 
Sbjct  61    LFNAAGFPPSLEFFNILNHKLSQTITSSVFTFPFSLTFLLITKSFVIQTLSRHQKPNSSS  120

Query  411   ---FSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVS  581
                F     +++PLL T + NSF ++SANAT F +L  AFN+ +  GFSSP   LFLS S
Sbjct  121   HPSFLSTISLYTPLLHTHVYNSFFIISANATVFSILFIAFNVLEGSGFSSPNTLLFLSAS  180

Query  582   GALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMA  761
             GA+L SI+LAN   ICNLALVLSG + +GG+ AILKAC+LI+GRT TALSLALP+++ +A
Sbjct  181   GAVLYSIVLANALIICNLALVLSGTQNSGGYLAILKACLLIRGRTSTALSLALPVSLTLA  240

Query  762   AVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHID  941
             AVEALFQYR+VR  H      SS+A+EG+ IAY+Y+IL+VLDT V   FL+SC+      
Sbjct  241   AVEALFQYRLVRACHFTGQLGSSMAMEGVFIAYLYSILVVLDTTVSFLFLQSCKPSSRGI  300

Query  942   QYRRLPSHVEIEEDNNAFRTVKIV  1013
             +YR      + EE     + VK++
Sbjct  301   EYR------DDEESCGDLKAVKVL  318



>gb|KDP31291.1| hypothetical protein JCGZ_11667 [Jatropha curcas]
Length=341

 Score =   306 bits (785),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 180/343 (52%), Positives = 234/343 (68%), Gaps = 13/343 (4%)
 Frame = +3

Query  30    MQEFSAAGMESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSF-VPSSP-FL  203
             M++ S   ME  ++I RRS++ FLQ + +FT+TA +LAFP++ S+L+ Q+  VPSS   L
Sbjct  1     MEDSSRFPMEKTSRIIRRSIYTFLQNYHYFTSTAALLAFPFSISILLSQTLLVPSSSTLL  60

Query  204   AMIHARIHTLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALG  383
             + ++  +  LF AAGFP S EFF ILN K+SQT++ S   LPFTLSFFLL+KA VIQAL 
Sbjct  61    STLYTHLQKLFQAAGFPPSLEFFNILNAKISQTISSSIFTLPFTLSFFLLAKALVIQAL-  119

Query  384   DQELPKRSL----FSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSS  551
                +PK  L    FS +  I +PLL+T +CN FL++SANAT F  L  +FN  + FGF S
Sbjct  120   -NYIPKPILTPPSFSSIISIFNPLLVTYICNIFLIVSANATAFFFLFLSFNFLEGFGFGS  178

Query  552   PRFELFLSVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALS  731
             P   L LS +GA+  SIILAN   ICNL+LVLSG E +GGF +ILKACV+I G+T TALS
Sbjct  179   PTGFLLLSAAGAVFYSIILANALVICNLSLVLSGTEKSGGFLSILKACVMISGKTSTALS  238

Query  732   LALPINMAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFL  911
             LALP+N+A+A +EALFQYRIVR Y    T  S + LEGMLIAY+Y++ LVLDTIV  FF 
Sbjct  239   LALPVNLALAGIEALFQYRIVRAYQKGSTPNSLMILEGMLIAYLYSVFLVLDTIVSFFFF  298

Query  912   RSCEGDCHIDQ-----YRRLPSHVEIEEDNNAFRTVKIVEDLP  1025
             +SC+    IDQ     Y R+    E E+DN  F + K  ++ P
Sbjct  299   KSCKASSCIDQEGRYTYCRIEIAEEEEDDNADFASSKNSQEFP  341



>gb|ACU19969.1| unknown [Glycine max]
Length=323

 Score =   305 bits (782),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 169/327 (52%), Positives = 221/327 (68%), Gaps = 7/327 (2%)
 Frame = +3

Query  54    MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPS-SPFLAMIHARIHT  230
             ME + KI RRS   FLQ +  FT+TA  LAFP++AS+L+ Q+ VPS S  L  I++R+ T
Sbjct  1     MEVSCKILRRSTHTFLQNYHHFTSTAAFLAFPFSASILLSQALVPSPSSLLPQIYSRLRT  60

Query  231   LFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSL  410
             LFDAAGFPSS   FTILNLK+SQT+  S LALPFTL+F L++KA +IQAL   +      
Sbjct  61    LFDAAGFPSS-HLFTILNLKVSQTITSSILALPFTLTFLLIAKASIIQALNHHKPTFPPS  119

Query  411   FSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPR-FELFLSVSGA  587
             F  +  ++ PLL T  CN FL+LSANAT F L+  AF+  +  G+SSP    LF+SV+GA
Sbjct  120   FKSILSLYKPLLHTYFCNRFLILSANATAFGLMFLAFSFIERLGYSSPTGLTLFISVTGA  179

Query  588   LLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAV  767
             +L S+ILAN   IC++AL LSG E  GG+ AILKAC+L++GRT  AL LALP+N+A+AA+
Sbjct  180   ILFSVILANALVICSMALALSGMEGHGGYLAILKACLLLRGRTSMALFLALPVNVALAAI  239

Query  768   EALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHIDQY  947
             EALFQ+R+VR YH A      VALEG+ IAY+Y+I ++LDTIV C F +S +    I Q 
Sbjct  240   EALFQFRVVRPYHIAGIARPCVALEGIFIAYLYSIFIILDTIVSCIFYKSLKTGSWISQE  299

Query  948   RRLPSHVEI-EEDNNAFRTVKIVEDLP  1025
              +    +E  EE    +   K   DLP
Sbjct  300   DKHSLRIEFPEEGKYGYMGTK---DLP  323



>ref|NP_001241590.1| uncharacterized protein LOC100802807 [Glycine max]
 gb|ACU19929.1| unknown [Glycine max]
Length=328

 Score =   305 bits (781),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 159/328 (48%), Positives = 224/328 (68%), Gaps = 4/328 (1%)
 Frame = +3

Query  54    MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVP-SSPFLAMIHARIHT  230
             ME + KI RRS+  FLQ + +FT+TA  LA P++AS+L+ ++FVP SS  L  IH+ + T
Sbjct  1     MEVSCKILRRSIHSFLQNYHYFTSTAAFLALPFSASILLSEAFVPASSSLLPQIHSHLRT  60

Query  231   LFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSL  410
             LFDAAGFPS+S+ FTILNLK+SQT+  S   LPFTL+F L++KA +IQAL   +    + 
Sbjct  61    LFDAAGFPSTSQLFTILNLKVSQTITSSIFTLPFTLTFLLIAKASIIQALNHHKPTLPTS  120

Query  411   FSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGAL  590
             F+ +   + PLLLT + NSF +LSANA+CF LL  AF  A+  G++SP   LF+S + A+
Sbjct  121   FTSMVFHYKPLLLTYIYNSFFILSANASCFCLLFLAFTFAEGLGYTSPSSTLFMSAAAAV  180

Query  591   LCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVE  770
             L S+ILAN   ICN+AL LSG E  GG+ AILKACV+++G+T  AL LALP N+ +AA+E
Sbjct  181   LFSVILANALVICNMALTLSGMEGHGGYMAILKACVMLRGKTSMALFLALPANVGLAAIE  240

Query  771   ALFQYRIVRVYHHAKTGISS-VALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHIDQY  947
             ALFQ+R+VR + + +      +ALE + IAY++++ + +DTIV C F +SC+     DQ 
Sbjct  241   ALFQFRVVRAFRNGEMSSRPFMALEAIFIAYLFSVFITIDTIVSCMFYKSCKVGLRGDQE  300

Query  948   RRLPSHVEI--EEDNNAFRTVKIVEDLP  1025
              +    +E   EEDN  +  +K  E+LP
Sbjct  301   DKHFLRIEFPEEEDNCGYMVLKNFEELP  328



>gb|KHN48705.1| hypothetical protein glysoja_015853 [Glycine soja]
Length=323

 Score =   305 bits (780),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 169/327 (52%), Positives = 221/327 (68%), Gaps = 7/327 (2%)
 Frame = +3

Query  54    MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPS-SPFLAMIHARIHT  230
             ME + KI RRS   FLQ +  FT+TA  LAFP++AS+L+ Q+ VPS S  L  I++R+ T
Sbjct  1     MEVSCKILRRSTHTFLQNYHHFTSTAAFLAFPFSASILLSQALVPSPSSLLPQIYSRLRT  60

Query  231   LFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSL  410
             LFDAAGFPSS   FTILNLK+SQT+  S LALPFTL+F L++KA +IQAL   +      
Sbjct  61    LFDAAGFPSS-HLFTILNLKVSQTITSSILALPFTLTFLLIAKASIIQALNHHKPTFPPS  119

Query  411   FSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPR-FELFLSVSGA  587
             F  +  ++ PLL T  CN FL+LSANAT F L+  AF+  +  G+SSP    LF+SV+GA
Sbjct  120   FKSILSLYKPLLHTYFCNCFLILSANATAFGLMFLAFSFIERLGYSSPTGLTLFISVTGA  179

Query  588   LLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAV  767
             +L S+ILAN   IC++AL LSG E  GG+ AILKAC+L++GRT  AL LALP+N+A+AA+
Sbjct  180   ILFSVILANALVICSMALALSGMEGHGGYLAILKACLLLRGRTSMALFLALPVNVALAAI  239

Query  768   EALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHIDQY  947
             EALFQ+R+VR YH A      VALEG+ IAY+Y+I ++LDTIV C F +S +    I Q 
Sbjct  240   EALFQFRVVRPYHIAGIARPCVALEGIFIAYLYSIFIILDTIVSCIFYKSLKTGSWISQE  299

Query  948   RRLPSHVEI-EEDNNAFRTVKIVEDLP  1025
              +    +E  EE    +   K   DLP
Sbjct  300   DKHSLRIEFPEEGKYGYMGTK---DLP  323



>ref|XP_003524748.2| PREDICTED: uncharacterized protein LOC100809875 [Glycine max]
Length=357

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 169/327 (52%), Positives = 221/327 (68%), Gaps = 7/327 (2%)
 Frame = +3

Query  54    MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPS-SPFLAMIHARIHT  230
             ME + KI RRS   FLQ +  FT+TA  LAFP++AS+L+ Q+ VPS S  L  I++R+ T
Sbjct  35    MEVSCKILRRSTHTFLQNYHHFTSTAAFLAFPFSASILLSQALVPSPSSLLPQIYSRLRT  94

Query  231   LFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSL  410
             LFDAAGFPSS   FTILNLK+SQT+  S LALPFTL+F L++KA +IQAL   +      
Sbjct  95    LFDAAGFPSS-HLFTILNLKVSQTITSSILALPFTLTFLLIAKASIIQALNHHKPTFPPS  153

Query  411   FSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPR-FELFLSVSGA  587
             F  +  ++ PLL T  CN FL+LSANAT F L+  AF+  +  G+SSP    LF+SV+GA
Sbjct  154   FKSILSLYKPLLHTYFCNCFLILSANATAFGLMFLAFSFIERLGYSSPTGLTLFISVTGA  213

Query  588   LLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAV  767
             +L S+ILAN   IC++AL LSG E  GG+ AILKAC+L++GRT  AL LALP+N+A+AA+
Sbjct  214   ILFSVILANALVICSMALALSGMEGHGGYLAILKACLLLRGRTSMALFLALPVNVALAAI  273

Query  768   EALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHIDQY  947
             EALFQ+R+VR YH A      VALEG+ IAY+Y+I ++LDTIV C F +S +    I Q 
Sbjct  274   EALFQFRVVRPYHIAGIARPCVALEGIFIAYLYSIFIILDTIVSCIFYKSLKTGSWISQE  333

Query  948   RRLPSHVEI-EEDNNAFRTVKIVEDLP  1025
              +    +E  EE    +   K   DLP
Sbjct  334   DKHSLRIEFPEEGKYGYMGTK---DLP  357



>ref|XP_007138157.1| hypothetical protein PHAVU_009G184900g [Phaseolus vulgaris]
 gb|ESW10151.1| hypothetical protein PHAVU_009G184900g [Phaseolus vulgaris]
Length=328

 Score =   304 bits (778),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 163/330 (49%), Positives = 224/330 (68%), Gaps = 8/330 (2%)
 Frame = +3

Query  54    MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVP-SSPFLAMIHARIHT  230
             ME + KI RRS+  FLQ + +FT+T   LA P++AS+L+ Q+ VP SS  L  IH+ + +
Sbjct  1     MEVSCKILRRSIHSFLQNYHYFTSTVAFLALPFSASILLSQALVPVSSSLLPQIHSHLRS  60

Query  231   LFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSL  410
             LFDAAGFPSSS+ FTILNLK+SQT+  S   LPFTL+F L++KA +IQAL   +    S 
Sbjct  61    LFDAAGFPSSSKLFTILNLKVSQTITSSIFTLPFTLTFLLIAKASIIQALNQHKPTFPSS  120

Query  411   FSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGAL  590
             F+     + PLLLT + NSF +LSANA+CF LL  AF +A+ FG+SSP     +S + A+
Sbjct  121   FTSTLFHYKPLLLTYIYNSFFILSANASCFCLLFLAFTVAEGFGYSSPSSTRLMSAAAAV  180

Query  591   LCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVE  770
             L S+ILAN   ICN+AL +SG E   GF AILKACV+++G+T  AL LALP N+ +AA+E
Sbjct  181   LFSVILANALVICNMALTVSGMEKHRGFMAILKACVMLRGKTSMALFLALPANVGLAAIE  240

Query  771   ALFQYRIVRVYHHAKTGISS---VALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHID  941
             ALFQ+R+VR YH+   G+SS   +ALEG+ IAY+Y++ +++DTIV C F + C+     D
Sbjct  241   ALFQFRVVRAYHNC--GMSSWPFMALEGIFIAYLYSLFIIIDTIVSCMFYKCCKMGLRGD  298

Query  942   QYRRLPSHVEI--EEDNNAFRTVKIVEDLP  1025
                ++   +E   EEDN  +   K  E+LP
Sbjct  299   HEDKILLRIEFPEEEDNCGYLVFKNFEELP  328



>gb|KHN26275.1| hypothetical protein glysoja_032845 [Glycine soja]
Length=328

 Score =   302 bits (774),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 158/328 (48%), Positives = 223/328 (68%), Gaps = 4/328 (1%)
 Frame = +3

Query  54    MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVP-SSPFLAMIHARIHT  230
             ME + KI RRS+  FLQ + +FT+TA  LA P++AS+L+ ++FVP SS  L  IH+ + T
Sbjct  1     MEVSCKILRRSIHSFLQNYHYFTSTAAFLALPFSASILLSEAFVPASSSLLPQIHSHLRT  60

Query  231   LFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSL  410
             LFDAAGFPS+S+ FTILNLK+SQT+  S   LPFTL+F L++KA +IQAL   +    + 
Sbjct  61    LFDAAGFPSTSQLFTILNLKVSQTITSSIFTLPFTLTFLLIAKASIIQALNHHKPTLPTS  120

Query  411   FSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGAL  590
             F+ +   + PLLLT + NSF +LSANA+CF LL  AF  A+  G++SP   LF+S + A+
Sbjct  121   FTSMVFHYKPLLLTYIYNSFFILSANASCFCLLFLAFTFAEGLGYTSPSSTLFMSAAAAV  180

Query  591   LCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVE  770
             L S+ILAN   ICN+AL LSG E  GG+ AILKACV+++G+T  AL LALP N+ +AA+E
Sbjct  181   LFSVILANALVICNMALTLSGMEGHGGYMAILKACVMLRGKTSMALFLALPANVGLAAIE  240

Query  771   ALFQYRIVRVYHHAKTGISS-VALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHIDQY  947
             ALFQ+R+VR + + +      +ALE + IAY++++ + +DTIV C F +SC+     DQ 
Sbjct  241   ALFQFRVVRAFRNGEMSSRPFMALEAIFIAYLFSVFITIDTIVSCMFYKSCKVGLRGDQE  300

Query  948   RRLPSHVEI--EEDNNAFRTVKIVEDLP  1025
              +    +E   EE N  +  +K  E+LP
Sbjct  301   DKHFLRIEFPEEEGNCGYMVLKNFEELP  328



>ref|XP_007155283.1| hypothetical protein PHAVU_003G187900g [Phaseolus vulgaris]
 gb|ESW27277.1| hypothetical protein PHAVU_003G187900g [Phaseolus vulgaris]
Length=359

 Score =   303 bits (776),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 163/327 (50%), Positives = 224/327 (69%), Gaps = 6/327 (2%)
 Frame = +3

Query  54    MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPS-SPFLAMIHARIHT  230
             ME + KI RRS   FL  + +FT+TA  L FP++AS+L+ Q+ VP+ S  L  I++R+  
Sbjct  36    MEVSCKILRRSTHSFLLNYHYFTSTAAFLVFPFSASILLSQALVPTPSSLLPQIYSRLRI  95

Query  231   LFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSL  410
             LFDAAGFPSSS+ F+ILNLK+SQT+  S   LPFTL+F L++KA +IQAL   +   +  
Sbjct  96    LFDAAGFPSSSQLFSILNLKVSQTITSSIFTLPFTLTFLLIAKAFIIQALNHNKPTLQPS  155

Query  411   FSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSP-RFELFLSVSGA  587
             F+ +  ++ PLL T  CN FL+LSANAT F L+  AF+  + FG+SSP    LF+SV+GA
Sbjct  156   FNSILSLYKPLLHTYFCNCFLILSANATTFGLMFLAFSFIERFGYSSPSNLILFMSVAGA  215

Query  588   LLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAV  767
             +L S+ILAN   ICN+AL LSG E  GG+ AILKAC+L++GRT  AL LALP+N+A+AA+
Sbjct  216   VLFSVILANALVICNMALALSGMEGYGGYFAILKACLLLRGRTSMALFLALPVNVALAAI  275

Query  768   EALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHIDQY  947
             EALFQ+R+VR YH A      VALEG+ IAY+Y+I ++LDTIV C F +S +    I Q 
Sbjct  276   EALFQFRVVRPYHIAGIAGPCVALEGIFIAYLYSIFIILDTIVSCIFYKSLKTGSWIHQE  335

Query  948   RRLPSHVEIEE-DNNAFRTVKIVEDLP  1025
              +    +E+ + D   + + K   +LP
Sbjct  336   DKYLFRIELPDGDQYGYLSTK---ELP  359



>gb|KHN45241.1| hypothetical protein glysoja_041633 [Glycine soja]
Length=327

 Score =   301 bits (771),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 160/327 (49%), Positives = 224/327 (69%), Gaps = 3/327 (1%)
 Frame = +3

Query  54    MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVP-SSPFLAMIHARIHT  230
             ME + KI RRS+  FLQ + +FT+TA  LA P++AS+++ Q+FVP SS  L  IH  + T
Sbjct  1     MEVSCKILRRSIHSFLQNYHYFTSTAAFLALPFSASIILSQAFVPASSSLLPQIHGHLRT  60

Query  231   LFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSL  410
             LFDAAGFPS+S+ FTILNLK+SQT+  S   LPFTL+F L++KA +IQAL   +    + 
Sbjct  61    LFDAAGFPSTSQLFTILNLKVSQTITSSIFTLPFTLTFLLIAKASIIQALSHHKPTLPTS  120

Query  411   FSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGAL  590
             F+ +   + PLLLT + NSF +LSANA+CF LL  AF  A+  G++S    L +S + A+
Sbjct  121   FTSILYHYKPLLLTYIYNSFFILSANASCFCLLFLAFTFAEGLGYTSSSSTLLMSAASAV  180

Query  591   LCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVE  770
             L S+ILAN F ICN++L LSG E  GG+ AILKACV+++GRT  AL LALP N+ +AA+E
Sbjct  181   LYSVILANAFVICNMSLTLSGMEGHGGYMAILKACVMLRGRTSMALFLALPANVGLAAIE  240

Query  771   ALFQYRIVRVYHHAK-TGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHIDQY  947
             ALFQ+R+VR YH+ + +    +ALE + IAY+Y++ + +DTIV C F +SC+     DQ 
Sbjct  241   ALFQFRVVRAYHNGEMSSWPFMALEAIFIAYLYSVFITIDTIVSCMFYKSCKVGLRGDQE  300

Query  948   RRLPSHVEI-EEDNNAFRTVKIVEDLP  1025
              +    +E  EED+  +  +K  E+LP
Sbjct  301   DKHFMRIEFPEEDSCGYLVLKNFEELP  327



>ref|XP_003523005.1| PREDICTED: uncharacterized protein LOC100797246 [Glycine max]
Length=328

 Score =   300 bits (767),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 160/327 (49%), Positives = 224/327 (69%), Gaps = 3/327 (1%)
 Frame = +3

Query  54    MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVP-SSPFLAMIHARIHT  230
             ME + KI RRS+  FLQ + +FT+TA  LA P++AS+++ Q+FVP SS  L  IH  + T
Sbjct  1     MEVSCKILRRSIHSFLQNYHYFTSTAAFLALPFSASIILSQAFVPASSSLLPQIHGHLRT  60

Query  231   LFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSL  410
             LFDAAGFPS+S+ FTILNLK+SQT+  S   LPFTL+F L++KA +IQAL   +    + 
Sbjct  61    LFDAAGFPSTSQLFTILNLKVSQTITSSIFTLPFTLTFLLIAKASIIQALSHHKPTLPTS  120

Query  411   FSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGAL  590
             F+ +   + PLLLT + NSF +LSANA+CF LL  AF  A+  G++S    L +S + A+
Sbjct  121   FTSILYHYKPLLLTYIYNSFFILSANASCFCLLFLAFTFAEGLGYTSSSSTLLMSAASAV  180

Query  591   LCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVE  770
             L S+ILAN F ICN++L LSG E  GG+ AILKACV+++GRT  AL LALP N+ +AA+E
Sbjct  181   LYSVILANAFVICNMSLTLSGMEGHGGYMAILKACVMLRGRTSMALFLALPANVGLAAIE  240

Query  771   ALFQYRIVRVYHHAK-TGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHIDQY  947
             ALFQ+R+VR YH+ + +    +ALE + IAY+Y++ + +DTIV C F +SC+     DQ 
Sbjct  241   ALFQFRVVRAYHNGEMSSWPFMALEAIFIAYLYSVFITIDTIVSCKFYKSCKVGLRGDQE  300

Query  948   RRLPSHVEI-EEDNNAFRTVKIVEDLP  1025
              +    +E  EED+  +  +K  E+LP
Sbjct  301   DKHFMRIEFPEEDSCGYLVLKNFEELP  327



>gb|KEH31964.1| transmembrane protein, putative [Medicago truncatula]
Length=324

 Score =   298 bits (763),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 162/330 (49%), Positives = 221/330 (67%), Gaps = 12/330 (4%)
 Frame = +3

Query  54    MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPS-SPFLAMIHARIHT  230
             ME + KI RRS+  FLQ + +FT++   L FP++AS+L+ Q+FVPS S  L  I+ R+ T
Sbjct  1     MEVSCKILRRSIHSFLQNYHYFTSSIAFLVFPFSASILISQAFVPSPSSLLPQIYNRLRT  60

Query  231   LFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQAL----GDQELP  398
             LFDAAGFPS S  F ILNLK+SQT+  S  +LPFTL+  L++KA +I AL        LP
Sbjct  61    LFDAAGFPSYSLLFNILNLKVSQTITCSIFSLPFTLTVLLIAKASIIHALKLNHNKPSLP  120

Query  399   KRSLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSV  578
                 FS +  ++ PL  T +CN FL++SANAT F ++  AF+  +  G+SSP F LF+S 
Sbjct  121   PS--FSSIIALYKPLFHTYICNCFLIISANATSFCIMFLAFSFVETLGYSSPSFLLFMSA  178

Query  579   SGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAM  758
             +GA+L S+ILAN   ICN++LVLSG E  GG++AILKAC+LI+G+T  AL LALP+N+A+
Sbjct  179   TGAILFSVILANALVICNMSLVLSGMEGHGGYSAILKACILIRGKTSMALFLALPVNIAL  238

Query  759   AAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE-GDCH  935
             AA+EALF +RIVR YH        V LEG+ IAY+Y+I ++LDTIV C F +S + G+  
Sbjct  239   AAIEALFHFRIVREYHIVGKARPIVLLEGIFIAYLYSIFIILDTIVSCLFYKSFKTGESW  298

Query  936   IDQYRRLPSHVEIEEDNNAFRTVKIVEDLP  1025
             I Q  +   H + + DN      K  E+LP
Sbjct  299   ISQEDK---HFQ-DVDNYGHIGNKNFEELP  324



>gb|ACU19144.1| unknown [Glycine max]
Length=328

 Score =   296 bits (758),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 158/327 (48%), Positives = 222/327 (68%), Gaps = 3/327 (1%)
 Frame = +3

Query  54    MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVP-SSPFLAMIHARIHT  230
             ME + KI RRS+  FLQ + +FT+T   LA P++AS+++ Q+FVP SS  L  IH  + T
Sbjct  1     MEVSCKILRRSIHSFLQNYHYFTSTTAFLALPFSASIILSQAFVPASSSLLPQIHGHLRT  60

Query  231   LFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSL  410
             LFDAAGFPS+S+ FTILNLK+SQT+  S   LPFTL+F L++KA +IQAL   +    + 
Sbjct  61    LFDAAGFPSTSQLFTILNLKVSQTITSSIFTLPFTLTFLLIAKASIIQALSHHKPTLPTS  120

Query  411   FSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGAL  590
             F+ +   + PLLLT + NSF +LSANA+CF LL  A   A+  G++S    L +S + A+
Sbjct  121   FTSILYHYKPLLLTYIYNSFFILSANASCFCLLFLALTFAEGLGYTSSSSTLLMSAASAV  180

Query  591   LCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVE  770
             L S+ILAN F ICN++L LSG E  GG+ AILKACV+++GRT  AL LALP N+ +AA+E
Sbjct  181   LYSVILANAFVICNMSLTLSGMEGHGGYMAILKACVMLRGRTSMALFLALPANVGLAAIE  240

Query  771   ALFQYRIVRVYHHAK-TGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHIDQY  947
             ALFQ+R+VR YH+ + +    +ALE + IAY+Y++ + +DTIV C F +SC+     DQ 
Sbjct  241   ALFQFRVVRAYHNGEMSSWPFMALEAIFIAYLYSVFITIDTIVSCKFYKSCKVGLRGDQE  300

Query  948   RRLPSHVEI-EEDNNAFRTVKIVEDLP  1025
              +    +E  EED+  +  +K  E+LP
Sbjct  301   DKHFMRIEFPEEDSCGYLVLKNFEELP  327



>ref|XP_003549689.1| PREDICTED: uncharacterized protein LOC100819933 [Glycine max]
Length=324

 Score =   294 bits (752),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 166/331 (50%), Positives = 219/331 (66%), Gaps = 15/331 (5%)
 Frame = +3

Query  54    MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPS-SPFLAMIHARIHT  230
             ME + KI RRS   FLQ + +FT+TA  LAFP++AS+L+ Q+ VPS S  L  I++R+ T
Sbjct  1     MEVSCKILRRSTHSFLQNYHYFTSTAAFLAFPFSASILLSQALVPSPSSLLPQIYSRLRT  60

Query  231   LFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSL  410
             LFDAAGFPSS + FTILNLK+SQT+  S L LPFTL+F L++KA +IQAL   +      
Sbjct  61    LFDAAGFPSS-QLFTILNLKVSQTITSSILTLPFTLTFLLIAKASIIQALNHHKPTFPPS  119

Query  411   FSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPR--FELFLSVSG  584
             F  +  ++ PLL T  CN FL+LSANA+ F L+  AF+  +  G+SS      LF+SV+G
Sbjct  120   FKSILSLYKPLLHTYFCNCFLILSANASAFGLMFSAFSFIERLGYSSSPSGLILFMSVTG  179

Query  585   ALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAA  764
             A+L S+ILAN   ICN+AL LSG E  GG+ AILKAC+L++GRT  AL LALP+N+A+AA
Sbjct  180   AILFSVILANAIVICNMALALSGMEGHGGYLAILKACLLLRGRTSMALFLALPVNVALAA  239

Query  765   VEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHIDQ  944
             +EALFQ+R+VR YH A      VALEG+ IAY+Y+I ++LDT+V C F +S +    I  
Sbjct  240   IEALFQFRVVRPYHIAGITRPCVALEGIFIAYLYSIFIILDTVVSCMFYKSLKTGPLIGH  299

Query  945   YRRLPSHVEIEEDNNAFRTVKIVEDLP*YFG  1037
                        ED + FR     ED   Y G
Sbjct  300   -----------EDKHLFRIEFPDEDKYGYMG  319



>gb|KHN18574.1| hypothetical protein glysoja_006987 [Glycine soja]
Length=324

 Score =   294 bits (752),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 166/331 (50%), Positives = 219/331 (66%), Gaps = 15/331 (5%)
 Frame = +3

Query  54    MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPS-SPFLAMIHARIHT  230
             ME + KI RRS   FLQ + +FT+TA  LAFP++AS+L+ Q+ VPS S  L  I++R+ T
Sbjct  1     MEVSCKILRRSTHSFLQNYHYFTSTAAFLAFPFSASILLSQALVPSPSSLLPQIYSRLRT  60

Query  231   LFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSL  410
             LFDAAGFPSS + FTILNLK+SQT+  S L LPFTL+F L++KA +IQAL   +      
Sbjct  61    LFDAAGFPSS-QLFTILNLKVSQTITSSILTLPFTLTFLLIAKASIIQALNHHKPTFPPS  119

Query  411   FSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPR--FELFLSVSG  584
             F  +  ++ PLL T  CN FL+LSANA+ F L+  AF+  +  G+SS      LF+SV+G
Sbjct  120   FKSILSLYKPLLHTYFCNCFLILSANASAFGLMFSAFSFIERLGYSSSPSGLILFMSVTG  179

Query  585   ALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAA  764
             A+L S+ILAN   ICN+AL LSG E  GG+ AILKAC+L++GRT  AL LALP+N+A+AA
Sbjct  180   AILFSVILANAIVICNMALALSGMEGHGGYLAILKACLLLRGRTSMALFLALPVNVALAA  239

Query  765   VEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHIDQ  944
             +EALFQ+R+VR YH A      VALEG+ IAY+Y+I ++LDT+V C F +S +    I  
Sbjct  240   IEALFQFRVVRPYHVAGITRPCVALEGIFIAYLYSIFIILDTVVSCMFYKSLKTGPLIGH  299

Query  945   YRRLPSHVEIEEDNNAFRTVKIVEDLP*YFG  1037
                        ED + FR     ED   Y G
Sbjct  300   -----------EDKHLFRIEFPDEDKYGYMG  319



>ref|XP_004137590.1| PREDICTED: uncharacterized protein LOC101220892 [Cucumis sativus]
 ref|XP_004157497.1| PREDICTED: uncharacterized LOC101220892 [Cucumis sativus]
 gb|KGN64022.1| hypothetical protein Csa_1G038890 [Cucumis sativus]
Length=327

 Score =   292 bits (748),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 160/328 (49%), Positives = 221/328 (67%), Gaps = 10/328 (3%)
 Frame = +3

Query  54    MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSP--FLAMIHARIH  227
             M     I RRS+FCFLQK+Q+FT+ + + AFP++ ++L+ Q+FV +S    L  I+  + 
Sbjct  1     MGKTNSIIRRSIFCFLQKYQYFTSVSALYAFPFSVALLLSQTFVFTSSISLLDNIYYHMK  60

Query  228   TLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRS  407
              +FDAA FPSS EFF     KLSQT+  S   +PFTL+F L++KA VIQAL + +   + 
Sbjct  61    IVFDAAAFPSSLEFFI---QKLSQTIFSSIFTIPFTLTFLLIAKASVIQALKETKSTSQP  117

Query  408   LFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGA  587
              FS +  ++SP+ LT +CNS  +LSANAT F +L FAF    EFGFSS    L+LS +GA
Sbjct  118   SFSSIKSLYSPIFLTNICNSIFILSANATVFSILFFAFACLQEFGFSSSTHFLYLSAAGA  177

Query  588   LLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAV  767
             +L SI+LANT  I NL+LVLSG E  GG+ AILKACV+I+G+T TAL LALP N+AMAA+
Sbjct  178   VLYSIVLANTLVISNLSLVLSGMEKLGGYLAILKACVVIRGKTSTALLLALPTNLAMAAI  237

Query  768   EALFQYRIVRVYHHAKTGISSVAL--EGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHID  941
             EALFQYR+VR Y+    GI S+++  EG++IAY+Y++ +VLDT V C F  +C+    +D
Sbjct  238   EALFQYRVVRAYN--GVGILSLSMLFEGVIIAYLYSVFIVLDTTVCCMFFMNCKKVFWVD  295

Query  942   QYRRLPSHVE-IEEDNNAFRTVKIVEDL  1022
                R    +E  EE N  +   K+ ++L
Sbjct  296   LEGRQALQIESAEEHNGDYMDSKVEQNL  323



>ref|XP_008445049.1| PREDICTED: uncharacterized protein LOC103488179 [Cucumis melo]
Length=327

 Score =   291 bits (746),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 160/326 (49%), Positives = 216/326 (66%), Gaps = 6/326 (2%)
 Frame = +3

Query  54    MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSP--FLAMIHARIH  227
             M     I RRS+FCFLQK+Q+FT+ + + AFP++ S+L+ Q+FV +S    L  I+  + 
Sbjct  1     MGKTNSIIRRSIFCFLQKYQYFTSASALYAFPFSVSLLLSQTFVFTSSISLLDNIYYHLK  60

Query  228   TLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRS  407
              +FDAA FPSS EFF     KLSQT+  S   +PFTL+F L++KA VIQAL + +   + 
Sbjct  61    IVFDAAVFPSSLEFFI---QKLSQTIFSSIFTIPFTLTFLLVAKASVIQALKETKSTSQP  117

Query  408   LFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGA  587
              FS +  ++ PL LT +CNS  +LSANAT F +L FAF    EFGFSS    L+LS +GA
Sbjct  118   SFSSIKSLYCPLFLTNICNSIFILSANATVFSILFFAFTCLQEFGFSSSTNFLYLSAAGA  177

Query  588   LLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAV  767
             +L SI+LANT  I NL+LVLSG E  GG+ AILKACV+I+G+T TAL LALP N+AMAA+
Sbjct  178   VLYSIVLANTLVISNLSLVLSGMEKLGGYLAILKACVVIRGKTSTALLLALPTNLAMAAI  237

Query  768   EALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHIDQY  947
             EALFQYR+VR Y+       S+  EG++IAY+Y+I +VLDT V C F  +C+    +D  
Sbjct  238   EALFQYRVVRAYNGVGILSLSMLFEGVIIAYLYSIFIVLDTTVCCMFFMNCKKVFWVDLE  297

Query  948   RRLPSHVE-IEEDNNAFRTVKIVEDL  1022
              R    +E  EE N  +   K+ ++L
Sbjct  298   GRQALQIESAEEHNGDYMNSKVEQNL  323



>ref|XP_004499518.1| PREDICTED: uncharacterized protein LOC101505783 [Cicer arietinum]
Length=332

 Score =   289 bits (740),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 157/332 (47%), Positives = 221/332 (67%), Gaps = 8/332 (2%)
 Frame = +3

Query  54    MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVP-SSPFLAMIHARIHT  230
             ME + KI RRSV  FLQ + +FTTT V LAFP++AS+L+ Q+ VP SS     I+  +  
Sbjct  1     MELSYKILRRSVHSFLQNYHYFTTTIVFLAFPFSASILLSQALVPFSSSLYPQIYNHLKI  60

Query  231   LFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQAL---GDQELPK  401
             LFDAAGFPSSS+ FT+LNLK+SQT+  S   LPFTL+FFL++K+ +IQA+     +E  +
Sbjct  61    LFDAAGFPSSSQIFTLLNLKVSQTITSSIFTLPFTLTFFLITKSFIIQAMKMNNHKENLQ  120

Query  402   RSLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVS  581
              S    +   + PL  T + N+F +LSANA+ F  L   F+ A+  G SSP   LF++ +
Sbjct  121   PSFVDIISYHYKPLFQTYIYNTFFLLSANASTFCFLFLVFSFAEGLGNSSPSLTLFVTAA  180

Query  582   GALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMA  761
              A+  S+ILAN   I N+AL LSG +  GG+ AILKACVL++GRT TAL LALPIN+++A
Sbjct  181   AAVFFSVILANALVISNMALTLSGMDGHGGYMAILKACVLLRGRTSTALFLALPINVSLA  240

Query  762   AVEALFQYRIVRVYHH--AKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE-GDC  932
             A+EALFQ+R+VR YH+   K+    + LEG+ IAY+Y+I +++DTIV   F +SC+ G  
Sbjct  241   AIEALFQFRVVRGYHNIGGKSSWFFLGLEGIFIAYLYSIFIIIDTIVSYMFYKSCKIGGS  300

Query  933   HIDQYRRLPSHVE-IEEDNNAFRTVKIVEDLP  1025
              +D+  +    +E IEEDN  +      ++LP
Sbjct  301   LVDKEDKHFLRIEFIEEDNYGYLGDNNFQELP  332



>gb|KEH33432.1| transmembrane protein, putative [Medicago truncatula]
Length=324

 Score =   288 bits (736),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 157/328 (48%), Positives = 218/328 (66%), Gaps = 8/328 (2%)
 Frame = +3

Query  54    MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVP-SSPFLAMIHARIHT  230
             ME + KI RRS+  FLQ +Q+FT T  +LAFP++AS+L+ Q+ VP SS     I+  + T
Sbjct  1     MEVSYKILRRSIHSFLQNYQYFTITISILAFPFSASILLSQALVPFSSSLFPQIYNHLKT  60

Query  231   LFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSL  410
             LFDAAGFPSSS+ FT+LNLK+SQT+  S   LPFTL+FFL++KA +IQAL       +  
Sbjct  61    LFDAAGFPSSSQLFTVLNLKVSQTITSSIFTLPFTLTFFLIAKAFIIQALNKN----KEN  116

Query  411   FSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGAL  590
             F      + P+L T + N+  +LSANAT F  L  AF+  +  G SS  F +FLS + A+
Sbjct  117   FQPSSYNYKPILHTYIYNTLFILSANATTFCFLFLAFSFTEGLGNSSSSFTVFLSAAAAV  176

Query  591   LCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVE  770
             L S+ILAN   ICN+AL LSG E  GG+  ILKACV+++GRT  AL LALP+N+ +AA+E
Sbjct  177   LFSVILANALVICNMALTLSGVEGHGGYMTILKACVVLRGRTSMALFLALPVNVGLAAIE  236

Query  771   ALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE-GDCHIDQY  947
             ALFQ+R+VR Y+  +     +ALEG+ IAY+Y+I +++DTIV   F +SC+     ID+ 
Sbjct  237   ALFQFRVVRGYYIDEKSWFFIALEGIFIAYLYSIFIIIDTIVSYMFYKSCKVRGSLIDKE  296

Query  948   RRLPSHVE-IEEDN-NAFRTVKIVEDLP  1025
              +    +E IEEDN   +  +K  ++LP
Sbjct  297   DKHFLRIELIEEDNYYGYLGIKNFQELP  324



>ref|XP_006374437.1| hypothetical protein POPTR_0015s07190g [Populus trichocarpa]
 gb|ERP52234.1| hypothetical protein POPTR_0015s07190g [Populus trichocarpa]
Length=308

 Score =   287 bits (734),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 164/304 (54%), Positives = 217/304 (71%), Gaps = 9/304 (3%)
 Frame = +3

Query  57   ESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLA-MIHARIHTL  233
            E+ +KI R+S+F FLQ +Q+FT+TA +LAFP++AS+L+    + SS  L  +I+ R+ +L
Sbjct  3    ETGSKILRKSIFTFLQNYQYFTSTAALLAFPFSASILLAHLLLDSSSSLLPVIYHRLTSL  62

Query  234  FDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSLF  413
            F AAGFP SSE   ++NLKLSQT+++S L LPF L+F L+ KA VIQAL +    K   F
Sbjct  63   FQAAGFPPSSELLNLVNLKLSQTISLSILTLPFALTFLLIMKASVIQALNNNH-KKPPSF  121

Query  414  SCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNL-ADEFGFSSPRFELFLSVSGAL  590
             C+  I +PLLLT +CNS L+LSANAT F LL F  NL  +  GF    F LFLS +GA+
Sbjct  122  YCVFSIFNPLLLTYICNSLLILSANATAFSLLFFTSNLFLENIGFG---FHLFLSAAGAV  178

Query  591  LCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVE  770
            + SIIL++T  ICNLALVLSG E  GG+ AILKACV+I+GR  TALSLAL +N+A+A VE
Sbjct  179  VYSIILSHTIIICNLALVLSGVERIGGYLAILKACVMIRGRASTALSLALAVNIALAGVE  238

Query  771  ALFQYRIVRVYHHAKTGISSVAL--EGMLIAYMYAILLVLDTIVVCFFLRSCEGDCH-ID  941
            ALF+YRIVR Y H +   SS+++  EG LI Y+Y+IL+VL+TIV C F +SC+     ID
Sbjct  239  ALFRYRIVRTYRHIREAPSSLSIISEGTLIIYLYSILVVLETIVSCIFFKSCKATYSCID  298

Query  942  QYRR  953
            Q  +
Sbjct  299  QQEQ  302



>gb|AFK39790.1| unknown [Lotus japonicus]
Length=329

 Score =   287 bits (735),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 155/319 (49%), Positives = 212/319 (66%), Gaps = 12/319 (4%)
 Frame = +3

Query  54   MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVP-SSPFLAMIHARIHT  230
            M+ + K  RRS+ CFLQ + +FT+TA  LAFP++AS+L+ Q+ VP SS  L  I+  +  
Sbjct  1    MDGSGKTLRRSIHCFLQNYHYFTSTAAFLAFPFSASILLPQALVPTSSSLLPQIYNHLRI  60

Query  231  LFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQE---LPK  401
            LFDAAGFPSSS+ FT    K+SQT+  S   LP TL+FFL++KA  I AL       LP 
Sbjct  61   LFDAAGFPSSSQLFT---RKVSQTITSSIFTLPLTLTFFLIAKASTILALNHHRQNLLPP  117

Query  402  RSLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVS  581
               F+CL   + P+L T + NSFL+LSANA+ F L   +   A+  G+SSP   LFLS +
Sbjct  118  S--FNCLIHHYKPILHTYIHNSFLILSANASSFCLFFLSLTFAEGLGYSSPSCTLFLSAA  175

Query  582  GALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMA  761
             A++ S+ILA    ICN+AL++SG E  GG+ AILKACVL++G T  AL LALP N+A+A
Sbjct  176  TAVVSSVILATALVICNMALIISGMEGHGGYMAILKACVLLRGNTSKALFLALPGNLALA  235

Query  762  AVEALFQYRIVRVYHHAKTGISS---VALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDC  932
            A+EALFQ+R+VR YH+    I+S   +ALEG+ IAY+Y+I +++DTIV C F +SC    
Sbjct  236  AIEALFQFRVVRAYHNVGNSINSWPFMALEGIFIAYLYSISIIIDTIVSCMFYKSCNMGS  295

Query  933  HIDQYRRLPSHVEIEEDNN  989
             +DQ     S +E+ E+ N
Sbjct  296  LVDQEDMHFSRIELAEEQN  314



>ref|XP_010258661.1| PREDICTED: uncharacterized protein LOC104598335 [Nelumbo nucifera]
Length=335

 Score =   287 bits (735),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 167/336 (50%), Positives = 230/336 (68%), Gaps = 5/336 (1%)
 Frame = +3

Query  30    MQEFSAAGMESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPS-SPFLA  206
             M+E  +   E  +KI RRS+F FL+ +Q FTT A +  FP + S+L+ Q+ +PS SP L 
Sbjct  1     MEESPSIPTERTSKIVRRSIFIFLKHYQHFTTIAALFIFPVSVSILLSQAVLPSLSPLLP  60

Query  207   MIHARIHTLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGD  386
              I AR+ +LFDAAGFP SS+ F++L+LKLSQT+  S + +PFTLSF L++KACVI+    
Sbjct  61    TIQARLQSLFDAAGFPPSSQLFSLLSLKLSQTICSSIVTIPFTLSFLLVAKACVIRGFNH  120

Query  387   -QELPKRSLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFE  563
              +  P  S+FS L  ++S L  T + N F++L+ANAT F L   AFN    FGFSSP F 
Sbjct  121   CKPSPPASIFS-LAFLYSRLFFTYINNCFVILAANATTFSLFFLAFNSFAAFGFSSPNFL  179

Query  564   LFLSVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALP  743
             LFLS +GA+L S+ILANTF ICNLALV++G E   G+ AILKA VL++GRT  ALSLALP
Sbjct  180   LFLSAAGAILYSVILANTFIICNLALVVAGMENCSGYLAILKAFVLLRGRTSIALSLALP  239

Query  744   INMAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
             +N+ +AA+EALFQYR+VR YH +     S+ALEG+LIAY+Y++L++LDTI  C F ++C+
Sbjct  240   VNLGLAAIEALFQYRVVRDYHLSVKFRPSMALEGLLIAYLYSLLVLLDTIASCIFFKACK  299

Query  924   GDCH--IDQYRRLPSHVEIEEDNNAFRTVKIVEDLP  1025
               C   ++        +  EED + F   K +++ P
Sbjct  300   SSCQKSLEGSHNYQIDLAQEEDKSIFTIRKTLQEFP  335



>ref|XP_004508715.1| PREDICTED: uncharacterized protein LOC101499112 [Cicer arietinum]
Length=322

 Score =   286 bits (731),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 155/329 (47%), Positives = 216/329 (66%), Gaps = 12/329 (4%)
 Frame = +3

Query  54    MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPS-SPFLAMIHARIHT  230
             ME + KI RRSV  FLQ + +FT++     FP++AS+L+ Q+ VPS S  L  I+ R+  
Sbjct  1     MEVSCKILRRSVHSFLQNYHYFTSSIAFFVFPFSASILISQALVPSPSSLLPQIYNRLRI  60

Query  231   LFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQAL----GDQELP  398
             LFDAAGFPSSS  F ILNLK+SQT+  S  +LPFTL+F L++KA +IQAL        LP
Sbjct  61    LFDAAGFPSSSILFNILNLKVSQTITCSIFSLPFTLTFLLIAKASIIQALKLNHNKPSLP  120

Query  399   KRSLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSV  578
                 F+ +  ++ PL  T +CN FL++SANAT F  L  AF+  +  G+SS R  +F+S 
Sbjct  121   PS--FASIIALYKPLFHTYICNCFLIISANATAFCFLFLAFSFMEGLGYSSSRLLIFMSA  178

Query  579   SGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAM  758
              GA+L S+ILAN   ICN++L LSG E  GG++AILKAC+ ++G+T  AL LALP+N+A+
Sbjct  179   FGAVLFSVILANALVICNMSLALSGMEGHGGYSAILKACIFVRGKTSMALFLALPVNVAL  238

Query  759   AAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHI  938
             AA+EALFQ+R+VR YH  K     V  EG+ IAY+Y+I ++LDTIV C F +S +    I
Sbjct  239   AAIEALFQFRVVRAYHVGKAR-PFVVFEGIFIAYLYSIFIILDTIVSCLFYKSFKTRSWI  297

Query  939   DQYRRLPSHVEIEEDNNAFRTVKIVEDLP  1025
             +       H + +E++  +   K  E+LP
Sbjct  298   NHQD---GHFQ-DENDYGYVGGKNFEELP  322



>ref|XP_010678454.1| PREDICTED: uncharacterized protein LOC104894001 [Beta vulgaris 
subsp. vulgaris]
Length=358

 Score =   286 bits (732),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 154/314 (49%), Positives = 213/314 (68%), Gaps = 14/314 (4%)
 Frame = +3

Query  30   MQEFSAAGMESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSS-PFLA  206
            M+E  A  M  AAKI RRS++ FLQ + FFT+ A ++  P+A S+L+ Q+ VP S  F  
Sbjct  1    MEENPAISMAKAAKIIRRSIYTFLQHYHFFTSIASLIVLPFAISILITQATVPRSLVFFP  60

Query  207  MIHARIHTLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGD  386
             I+ R+H++F AAGFP SS+ F +++LKLSQT++ S + LPFT+SFFLL+KA +I    +
Sbjct  61   TIYGRLHSIFHAAGFPPSSDLFALVSLKLSQTISTSIITLPFTISFFLLAKASIIHFFTN  120

Query  387  --QELPKRSLFSC------LPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFG  542
               + P  + +S          +++P+L T LCN F++ +ANATCF LL FAFN  + F 
Sbjct  121  IITQHPTSNYYSLSPPSSSFTTLYNPILSTHLCNCFIIFAANATCFSLLFFAFNFLEGFH  180

Query  543  FSSPRFELFLSVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGT  722
             ++P + L  SV  A+  SI+LANTF +CNLAL+ SG E  GGF +ILKACVLI+G T T
Sbjct  181  LNTPIWVLTFSVFAAVFYSIVLANTFVVCNLALISSGIERRGGFLSILKACVLIRGNTST  240

Query  723  ALSLALPINMAMAAVEALFQYRIVRVYHHAK-----TGISSVALEGMLIAYMYAILLVLD  887
            AL+LA+PIN+ +AAVEALF +RIV    HA        +  VALEG+LIAY+Y++LLVLD
Sbjct  241  ALALAVPINLGLAAVEALFHFRIVAASQHAHRFDTTNSLWLVALEGVLIAYIYSVLLVLD  300

Query  888  TIVVCFFLRSCEGD  929
             I+ C F +SC+ D
Sbjct  301  VIISCMFYQSCQND  314



>ref|XP_011006296.1| PREDICTED: uncharacterized protein LOC105112322 [Populus euphratica]
Length=332

 Score =   282 bits (721),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 162/301 (54%), Positives = 215/301 (71%), Gaps = 9/301 (3%)
 Frame = +3

Query  57   ESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLA-MIHARIHTL  233
            E+ +KI R+S+F FLQ +Q+FT+TA +LAFP++AS+L+    + SS  L  +I+ R+ +L
Sbjct  10   ETGSKILRKSIFTFLQNYQYFTSTAALLAFPFSASILLAHLLLDSSSSLLPVIYHRLTSL  69

Query  234  FDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSLF  413
            F AAGFPSSSE   ++NLKLSQT+ +S L LPF L+F L+ KA VIQAL +    K   F
Sbjct  70   FQAAGFPSSSELLNLVNLKLSQTITLSILTLPFALTFLLIMKASVIQALNNNH-KKPPSF  128

Query  414  SCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNL-ADEFGFSSPRFELFLSVSGAL  590
             C+  I +PLLLT +CNS L+LSANAT F LL F  NL  +  GF    F LFLS +GA+
Sbjct  129  YCVFSIFNPLLLTYICNSLLILSANATAFSLLFFTSNLFLENIGFG---FHLFLSAAGAV  185

Query  591  LCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVE  770
            + SIIL++T  ICNLALVLSG E  GG+ AILKACV+I+GR  TALSLA+ +N+A+A VE
Sbjct  186  VYSIILSHTIIICNLALVLSGVERIGGYLAILKACVMIRGRASTALSLAIAVNIALAGVE  245

Query  771  ALFQYRIVRVYHHAKTGISSVAL--EGMLIAYMYAILLVLDTIVVCFFLRSCEGDCH-ID  941
            ALF+YRIVR   H +   S++++  EG LI Y+Y+IL+VL+TIV C F +SC+     ID
Sbjct  246  ALFRYRIVRACRHIREAQSNLSIISEGTLIIYLYSILVVLETIVSCIFFKSCKATYSCID  305

Query  942  Q  944
            Q
Sbjct  306  Q  306



>gb|KGN63693.1| hypothetical protein Csa_1G011450 [Cucumis sativus]
Length=351

 Score =   259 bits (661),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 157/329 (48%), Positives = 203/329 (62%), Gaps = 5/329 (2%)
 Frame = +3

Query  54    MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYA----ASVLVFQSFVPSSPFLAMIHAR  221
             ME + K+ R+S++ FLQ +QFFT+ A  LAFPYA     S  +  S   SS   +    R
Sbjct  23    MEESKKLVRKSIYNFLQNYQFFTSIAAALAFPYAISLLLSQTLLLSSSSSSSLFSFTFDR  82

Query  222   IHTLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPK  401
             +  +F AAGFP SS+FF     KLSQT+  +  +LPF+LSF L+SKACVIQ L  Q+   
Sbjct  83    LRAVFSAAGFPISSKFFLFFIQKLSQTIVSTIYSLPFSLSFLLISKACVIQVLNQQKPNL  142

Query  402   RSLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVS  581
                FS +    +PL  T LCN F+ +SAN+T F +L FAFN  + FG+SSP   LF+SV 
Sbjct  143   LPSFSSILHFFNPLFFTHLCNLFIFISANSTVFFMLFFAFNFLEGFGYSSPNCLLFVSVL  202

Query  582   GALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMA  761
             G  L SI +A    ICNLA VLS  E  GGF  +LKACVLI+GR+ TAL + LP NM MA
Sbjct  203   GGFLYSIAIAKAIVICNLASVLSAMERKGGFMTLLKACVLIQGRSTTALLVTLPFNMGMA  262

Query  762   AVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHID  941
             AVEALFQYRIVR YH       S+ +EGM +AY+Y++ +VLD IV   F +SC  D  + 
Sbjct  263   AVEALFQYRIVRDYHLRGKLEPSMVVEGMFVAYLYSVFVVLDAIVNTLFFKSCRADSQMG  322

Query  942   QYRRLPSHVEI-EEDNNAFRTVKIVEDLP  1025
               R+      I E++N  F  +K  E+LP
Sbjct  323   IERKSSFWFWIAEKENEGFHHLKGFEELP  351



>gb|KFK27894.1| hypothetical protein AALP_AA8G443900 [Arabis alpina]
Length=327

 Score =   256 bits (655),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 156/324 (48%), Positives = 210/324 (65%), Gaps = 12/324 (4%)
 Frame = +3

Query  54    MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSF-VPSSPFLAMIHARIHT  230
             ME  +KI RRS+  FLQ +   TT A V+  P++A++L+ Q F   SS   + +H++++T
Sbjct  5     MEDPSKIMRRSIHTFLQNYHRATTAAAVV-LPFSAALLLSQPFFSSSSSTSSSLHSKLNT  63

Query  231   LFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSL  410
             LF  AGF +S +FF IL+LKLSQT++ SF  LPF+L+FFL SKA VI+ L +      S+
Sbjct  64    LFRGAGFSTSLDFFNILSLKLSQTLSSSFFTLPFSLTFFLFSKAYVIKLLSNNHY---SV  120

Query  411   FSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGAL  590
              S +  I   LL T +CN FL+LSANA+ F L   AFNL   FGF S  F  F S+S A+
Sbjct  121   SSSVYYIR--LLKTYICNLFLLLSANASAFALFFLAFNLLQAFGFYSRNFYTFFSLSSAI  178

Query  591   LCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVE  770
             + SIILAN F I NLALV S   ++GG+T IL+AC++I+GRT TAL+LALP N+ +A VE
Sbjct  179   IYSIILANAFVISNLALVSSVSSSSGGYTTILEACLMIRGRTSTALALALPTNLGLAGVE  238

Query  771   ALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSC-----EGDCH  935
             ALFQYR+VR Y+     I+S+ LEG  IAY+YA+ LVLDTIV  FF +SC     E    
Sbjct  239   ALFQYRVVRSYYKGDRDIASITLEGTFIAYLYALFLVLDTIVNYFFYQSCLKNDEENHRK  298

Query  936   IDQYRRLPSHVEIEEDNNAFRTVK  1007
             I +       ++I E  N   ++K
Sbjct  299   IGREDEYSIKIQISETENTKISIK  322



>ref|XP_006280822.1| hypothetical protein CARUB_v10026789mg [Capsella rubella]
 gb|EOA13720.1| hypothetical protein CARUB_v10026789mg [Capsella rubella]
Length=322

 Score =   252 bits (644),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 155/315 (49%), Positives = 202/315 (64%), Gaps = 12/315 (4%)
 Frame = +3

Query  54   MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTL  233
            ME  +K+ RRSV  FLQ +   TT A V A P++A +L+ Q F  SS   + +HARI+TL
Sbjct  5    MEDPSKLMRRSVHTFLQHYHRVTTAAAV-ALPFSACLLLSQPFFSSS--SSTLHARINTL  61

Query  234  FDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSLF  413
            F  AGF SS +FF IL+LKLSQT++ S   LPF+L+F L SKA VI+ L        S++
Sbjct  62   FRGAGFSSSLDFFNILSLKLSQTLSSSLFTLPFSLTFLLFSKAYVIKLLSSNNSASSSVY  121

Query  414  SCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGALL  593
                  +  LL T +C+ F +LSANA+ F L   AFN  + FGFSS  F   LSVS A++
Sbjct  122  ------YLRLLKTYICSFFFLLSANASAFALFFVAFNTLEAFGFSSRNFYAILSVSSAII  175

Query  594  CSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEA  773
             S+I+AN F I NLALV S   ++GG+T ILKAC+LI+GRT  AL LALP N+ +A VEA
Sbjct  176  YSVIIANAFVISNLALVSSPSSSSGGYTNILKACLLIRGRTSPALYLALPTNLGLAGVEA  235

Query  774  LFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSC---EGDCHIDQ  944
            LFQYR+VR Y++    I+S+ALEG  IAY+YA+ LVLDTIV   F +SC   E D  I +
Sbjct  236  LFQYRVVRSYYNGDRDITSIALEGTFIAYLYALFLVLDTIVNFLFYQSCIKNEEDQKIGR  295

Query  945  YRRLPSHVEIEEDNN  989
                   ++I E  N
Sbjct  296  GDDYSIKIQISETEN  310



>ref|XP_011012575.1| PREDICTED: uncharacterized protein LOC105116791 [Populus euphratica]
Length=319

 Score =   251 bits (641),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 151/320 (47%), Positives = 202/320 (63%), Gaps = 22/320 (7%)
 Frame = +3

Query  54   MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFL--AMIHARIH  227
            + + +KI R+S++ +LQ + ++T T+ +LAFP++AS L  Q  + S      A+I+ R++
Sbjct  6    IRTGSKIMRKSIYTYLQNYHYYTLTSALLAFPFSASSLFAQLLLVSPSSSLLAIIYNRLN  65

Query  228  TLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRS  407
                   FP S E   ++NLKLSQT++   L LP   + FL++KA VIQ +   + P   
Sbjct  66   R------FPYSWELIDLVNLKLSQTISFFILTLPLNSTLFLIAKASVIQVVNRHKPPS--  117

Query  408  LFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFN-LADEFGFSSPRFELFLSVSG  584
             F C+  I +PLLLT + NS L+LSANAT F LL  AFN   D  GF S    LFLS +G
Sbjct  118  -FCCIFSIFNPLLLTYVSNSLLILSANATAFCLLSIAFNPFHDHIGFGS----LFLSAAG  172

Query  585  ALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAA  764
            A++ SIILAN   ICNLALV+SG E  GG+ AILKACV+I+GR  TALSL L +N A+A 
Sbjct  173  AVVYSIILANVIIICNLALVISGMERFGGYLAILKACVMIRGRASTALSLTLAVNTALAG  232

Query  765  VEALFQYRIVRVYHHAKTGISSVAL--EGMLIAYMYAILLVLDTIVVCFFLRSCEGDCH-  935
            VEALFQYRIVR Y       SS+ +  EGMLI Y+Y+IL+VLDTI+ C F +SC+     
Sbjct  233  VEALFQYRIVRAYDDIGETPSSLLIISEGMLIVYLYSILVVLDTIISCIFFKSCKATSSF  292

Query  936  IDQYRRLPSH---VEIEEDN  986
            IDQ  +       +E EED 
Sbjct  293  IDQQGKYAYRIIVIEGEEDG  312



>ref|XP_008787211.1| PREDICTED: uncharacterized protein LOC103705324 [Phoenix dactylifera]
Length=319

 Score =   249 bits (636),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 146/297 (49%), Positives = 194/297 (65%), Gaps = 7/297 (2%)
 Frame = +3

Query  54   MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSS-PFLAMIHARIHT  230
            M     I RRS+  F Q +  F +TA +L FP AA+ L+ QS   SS P L  I +R+  
Sbjct  1    MGKVINITRRSIHAFFQSYHSFASTAALLVFPVAAATLLSQSLTLSSSPILRTISSRLRL  60

Query  231  LFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSL  410
            LFDAAGFP+SS+FF++LN KLSQ +      LPFTL F +L+KA V+Q L   E P+R L
Sbjct  61   LFDAAGFPASSQFFSLLNFKLSQVILTFISTLPFTLIFLILAKASVVQIL--HEFPRRRL  118

Query  411  ----FSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSV  578
                 S L  I+  LLLT L NS ++LSANA  F +LL AFN+AD    SS    L  S 
Sbjct  119  APPPLSSLLHIYPSLLLTYLFNSLVILSANAAIFSILLVAFNVADILHLSSNNSILVFSA  178

Query  579  SGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAM  758
            +  +L S+++ANT   CNLA+V+S  E +GG+ +ILKA VLI+GRT T ++LALP ++ M
Sbjct  179  ASVILYSVVIANTMVACNLAIVISAMEDSGGYLSILKALVLIRGRTATGITLALPASLGM  238

Query  759  AAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGD  929
            AAVEALFQYR++R YH  +    SV  E  LIAY+Y++L+VLDTI+ C FL+ C+ +
Sbjct  239  AAVEALFQYRVMRPYHLLRKFSPSVICEAFLIAYIYSLLIVLDTIITCMFLKICKAE  295



>ref|XP_009111986.1| PREDICTED: uncharacterized protein LOC103837376 [Brassica rapa]
Length=319

 Score =   249 bits (635),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 147/315 (47%), Positives = 203/315 (64%), Gaps = 15/315 (5%)
 Frame = +3

Query  54   MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTL  233
            ME  +KI RRSV  FLQ +   TT A V A P++ ++L+ Q F  SS   + IH +++TL
Sbjct  5    MEDPSKIMRRSVHTFLQHYHRATTAAAV-ALPFSTALLLSQPFFSSS--SSSIHMKLNTL  61

Query  234  FDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSLF  413
               AGF SS EFF IL+LKLSQT++ S   LPF+L+F L SKA +I+ L +      S++
Sbjct  62   LRGAGFSSSLEFFNILSLKLSQTLSSSLFTLPFSLTFLLFSKAYIIKLLSNNH---DSIY  118

Query  414  SCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGALL  593
                  +  LL T +CNSF +LSANA+ F L   A  + D FGFSS  F +  S+S A++
Sbjct  119  ------YFRLLRTYICNSFFILSANASAFALFFLASTILDSFGFSSRNFYILFSLSSAII  172

Query  594  CSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEA  773
             SIILAN F I NLALV S   ++GG+T +LKAC+L++GRT TAL+LALP N+ +A VEA
Sbjct  173  YSIILANAFVISNLALVSSPSSSSGGYTTLLKACLLLRGRTSTALALALPTNLGLAGVEA  232

Query  774  LFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSC---EGDCHIDQ  944
            LF+YR++R ++     ++S+A+EG LIAY+YA+ LVLDT+V  FF +SC   E +  I  
Sbjct  233  LFRYRVMRSFYKGDRDVTSIAIEGTLIAYLYALFLVLDTVVNFFFYQSCVENEEEQKIGG  292

Query  945  YRRLPSHVEIEEDNN  989
                   ++I E  N
Sbjct  293  DDEYSIKIQICESEN  307



>ref|XP_002318598.2| hypothetical protein POPTR_0012s06990g [Populus trichocarpa]
 gb|EEE96818.2| hypothetical protein POPTR_0012s06990g [Populus trichocarpa]
Length=302

 Score =   247 bits (630),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 148/316 (47%), Positives = 200/316 (63%), Gaps = 36/316 (11%)
 Frame = +3

Query  54   MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLA--MIHARIH  227
            + + +KI R+S++ +LQ + +FT T+ +LAFP++AS L+    + S       +I+ R++
Sbjct  13   IPTGSKIMRKSIYTYLQNYHYFTLTSALLAFPFSASTLLAHLLLVSPSSSLLPIIYNRLN  72

Query  228  TLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRS  407
            +LF AAGFP SSE   +++LKLSQT++   L LP   + FL++KA VIQ +   + P   
Sbjct  73   SLFHAAGFPHSSELIALVSLKLSQTISFFILTLPLNSTLFLIAKASVIQVVNRHKPPS--  130

Query  408  LFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNL-ADEFGFSSPRFELFLSVSG  584
             F C+  I +PLLLT   NS L+LSANAT F LL  AFNL  D+ GF S    LFLS +G
Sbjct  131  -FYCIFSIFNPLLLTYASNSLLILSANATAFCLLSIAFNLFHDDIGFGS----LFLSAAG  185

Query  585  ALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAA  764
            A++ SIILAN   ICNLALV+SG E  GG+ AILKACV+I+GR  TALS  L +N+A+A 
Sbjct  186  AVVYSIILANVIIICNLALVISGMERFGGYLAILKACVMIRGRASTALSPTLAVNIALAG  245

Query  765  VEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGD-CHID  941
            VEALFQYRI                 GMLI Y+Y+IL+VLDTI+ C F +SC+     ID
Sbjct  246  VEALFQYRI-----------------GMLIVYLYSILVVLDTIISCIFFKSCKATYSFID  288

Query  942  QYRRLPSHVEIEEDNN  989
            Q        + EED +
Sbjct  289  Q--------QGEEDAD  296



>ref|XP_009419078.1| PREDICTED: uncharacterized protein LOC103999144 [Musa acuminata 
subsp. malaccensis]
Length=324

 Score =   247 bits (631),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 145/319 (45%), Positives = 197/319 (62%), Gaps = 8/319 (3%)
 Frame = +3

Query  54   MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVP--SSPFLAMIHARIH  227
            M  A  I RRS+  F   +Q FT+ A +L FP +ASVL+ Q+ +P  + P L  I  R+ 
Sbjct  1    MGMAVWIVRRSINAFFDGYQSFTSIAALLVFPVSASVLLSQALIPFATPPLLEAISLRLW  60

Query  228  TLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRS  407
            +LF AA FP+S  FF++LN+KL+QTV      LP  L+F LL+KA V+  + +   P+R 
Sbjct  61   SLFQAARFPASVGFFSLLNVKLAQTVFTFVSTLPLVLTFQLLAKASVVHVVCEGRDPRRK  120

Query  408  -----LFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFL  572
                 L S LP ++  +L T L NSF+VLSANA+ F LL   FN  D  G S+    L L
Sbjct  121  RGPPPLSSFLP-LYRSILPTHLFNSFVVLSANASTFALLFLVFNAVDLLGLSTSNVVLCL  179

Query  573  SVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINM  752
            S +GA+L S+++ANT  ICNLA+V+S  +  GG+  +LKAC+LI+GR  TAL LALP N+
Sbjct  180  SAAGAVLYSVVVANTTVICNLAIVVSATDNCGGYLPVLKACLLIRGRVMTALGLALPANL  239

Query  753  AMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDC  932
             MAAVEALFQYR+VR Y+ +    SS+  E   I Y +A+L+VLD I+ C F + C  DC
Sbjct  240  GMAAVEALFQYRVVRQYNLSGELNSSLFWEAFSITYFHALLVVLDVIMSCMFFKICRTDC  299

Query  933  HIDQYRRLPSHVEIEEDNN  989
            H D  +    H E  E  +
Sbjct  300  HSDCEKGHEHHGEELEPED  318



>ref|XP_006394517.1| hypothetical protein EUTSA_v10005448mg [Eutrema salsugineum]
 gb|ESQ31803.1| hypothetical protein EUTSA_v10005448mg [Eutrema salsugineum]
Length=326

 Score =   247 bits (631),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 151/304 (50%), Positives = 201/304 (66%), Gaps = 14/304 (5%)
 Frame = +3

Query  54   MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTL  233
            ME  +KI RRS+  FLQ +   TT A V+  P++A++L+ Q F  SS   + +HAR++TL
Sbjct  5    MEDPSKIMRRSIHTFLQNYHRATTAAAVV-LPFSAALLLSQPFFSSS--SSSLHARLNTL  61

Query  234  FDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSLF  413
            F  AGF SS +FF IL+LKLSQT++ S   LPF+L+FFL SKA VI+ L ++   + S  
Sbjct  62   FRGAGFSSSLDFFNILSLKLSQTLSSSLFTLPFSLTFFLFSKAYVIRLLSNKHDSEDSSV  121

Query  414  SCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGALL  593
              L      LL T +CNSF ++SANA+ F L   AFN+ + FGF S  F    S+S A++
Sbjct  122  YYLR-----LLRTYICNSFFLISANASAFALFFLAFNVLESFGFYSRNFYTLFSLSSAII  176

Query  594  CSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEA  773
             SIILAN F I NLALV S   ++GG+T ILKAC+LI+GRT TAL+LALP N+ +A VEA
Sbjct  177  YSIILANAFVISNLALVSSTSSSSGGYTTILKACLLIRGRTSTALALALPTNLGLAGVEA  236

Query  774  LFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGD------CH  935
            LF+YR+V+ Y+     I S+ALEG  IAY+YA+ LVLDTIV   F +SC  +      C 
Sbjct  237  LFRYRVVKSYYQGDRDIVSIALEGTFIAYLYALFLVLDTIVNFLFYQSCVKNDEDQKLCR  296

Query  936  IDQY  947
             D+Y
Sbjct  297  EDEY  300



>ref|XP_002866429.1| hypothetical protein ARALYDRAFT_919377 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42688.1| hypothetical protein ARALYDRAFT_919377 [Arabidopsis lyrata subsp. 
lyrata]
Length=325

 Score =   246 bits (628),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 154/326 (47%), Positives = 208/326 (64%), Gaps = 12/326 (4%)
 Frame = +3

Query  54    MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTL  233
             ME  +KI RRS+  FLQ +   TT A V A P++A +L+ Q F  SS   +++H R++ L
Sbjct  5     MEDPSKIMRRSIHTFLQNYHRVTTAAAV-ALPFSAGLLLSQPFFSSS--SSILHMRLNML  61

Query  234   FDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSLF  413
             F  AGF SS  FF IL+LKLSQT++ S   LPF+L+F LLSKA VI+ L +      S+F
Sbjct  62    FRGAGFSSSHNFFNILSLKLSQTLSSSLFTLPFSLTFLLLSKAYVIKLLSNNHSADSSVF  121

Query  414   SCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGALL  593
                   +  LL T +CN F +LSANA+ F L   A+N+ + FGFSS  F  FLSVS  ++
Sbjct  122   ------YLRLLKTYVCNFFFLLSANASAFALFFLAYNILEAFGFSSRNFYTFLSVSSPII  175

Query  594   CSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEA  773
              SII+AN F I NLALV S   ++GG+T ILKAC+LI GR+ TAL++ALP N+ +A VEA
Sbjct  176   YSIIIANAFVISNLALVSSPSSSSGGYTNILKACLLIHGRSSTALAIALPTNLGLAGVEA  235

Query  774   LFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSC---EGDCHIDQ  944
             LFQYR++R Y+     I+S+ALEG  IAY+YA+ LVLD+IV   F +SC   E D  I +
Sbjct  236   LFQYRVLRSYYKGDRDITSIALEGTFIAYLYALFLVLDSIVNFLFYQSCIKNEEDQKIGR  295

Query  945   YRRLPSHVEIEEDNNAFRTVKIVEDL  1022
                    ++I E  N    +K  ++L
Sbjct  296   EDEYSIKIQISETENTKIHIKGSKNL  321



>ref|XP_009136463.1| PREDICTED: uncharacterized protein LOC103860586 [Brassica rapa]
Length=324

 Score =   244 bits (623),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 149/315 (47%), Positives = 202/315 (64%), Gaps = 13/315 (4%)
 Frame = +3

Query  54   MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTL  233
            ME  +KI RRS++ FL+ +    TTA  L  P++A++L+ Q F  SS   + +H +++ L
Sbjct  5    MEEPSKIMRRSIYTFLKHYDR-ATTAAALVLPFSAALLLSQPFFSSS--SSSLHGKLNML  61

Query  234  FDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSLF  413
            F  AGF SS +FF IL+LKLSQT++ S   LPF L+F L SKA +I+ L +      SL+
Sbjct  62   FRGAGFSSSLDFFNILSLKLSQTLSSSLFTLPFALTFLLFSKAYIIKLLSNSH-GDSSLY  120

Query  414  SCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGALL  593
                  +  LL T +CNSF +LSANA+ F L   +FNL + FG SS  F    S+S A++
Sbjct  121  ------YFRLLRTYICNSFFLLSANASAFALFFVSFNLIESFGLSSRNFYTLFSLSSAII  174

Query  594  CSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEA  773
             SIILAN F I NLALV S   ++GG+T ILKAC+LI+GRT TAL+L+LP N+ +A VEA
Sbjct  175  YSIILANAFVISNLALVSSTSSSSGGYTTILKACLLIQGRTSTALALSLPTNLCLAGVEA  234

Query  774  LFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSC---EGDCHIDQ  944
            LFQYR+V  Y+    GI+S+ALEG  IAY+YA+ LVLDTIV   F +SC   + D  I +
Sbjct  235  LFQYRVVSSYYKGDRGITSIALEGAFIAYLYALFLVLDTIVNYLFYQSCVKNDEDQRISR  294

Query  945  YRRLPSHVEIEEDNN  989
                   ++I E  N
Sbjct  295  EDEYSIKIQISETEN  309



>ref|XP_008453222.1| PREDICTED: uncharacterized protein LOC103494010 [Cucumis melo]
Length=352

 Score =   245 bits (625),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 153/330 (46%), Positives = 204/330 (62%), Gaps = 6/330 (2%)
 Frame = +3

Query  54    MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYA-----ASVLVFQSFVPSSPFLAMIHA  218
             ME + K+ R+S++ FLQ +QFFT+ A   AFPYA     +   +  S   SS   +    
Sbjct  23    MEESKKLTRKSIYSFLQNYQFFTSIAAAFAFPYAISLLLSQTFLLSSSSSSSYLFSFTFD  82

Query  219   RIHTLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELP  398
             R+  +F AAGFP SS+FF     KLSQT+  +  +LPF+L+F L+SKACVIQ L  Q+  
Sbjct  83    RLRAVFSAAGFPISSKFFLFFIQKLSQTIVSTIYSLPFSLTFLLISKACVIQVLNQQKPN  142

Query  399   KRSLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSV  578
                 FS +  + +PL  T LCN F+ +SAN+T F +L FAFN  + FG+SSP   LF+SV
Sbjct  143   LLPSFSSILNLFNPLFFTHLCNLFIFISANSTVFFMLFFAFNFLEGFGYSSPNCLLFVSV  202

Query  579   SGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAM  758
              G  L SI +A    ICNLA VLS  E  GGF A+LKACVLI+GR+ TAL +ALP N+ M
Sbjct  203   LGGFLYSIAIAKAIIICNLASVLSAMERKGGFMAVLKACVLIQGRSTTALLVALPFNIGM  262

Query  759   AAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHI  938
             AA+EALFQYRIVR YH       S+ +EGM +AY+Y++ +VLD IV   F +SC  D  +
Sbjct  263   AAIEALFQYRIVRDYHLRGKLEPSMVVEGMFVAYLYSVFVVLDAIVNTLFFKSCRVDSQM  322

Query  939   DQYRRLPSHVEI-EEDNNAFRTVKIVEDLP  1025
                R+      I E++N     +K  E+LP
Sbjct  323   GIERKSSFWFWIAEKENEGCHHLKGFEELP  352



>emb|CDY23069.1| BnaC07g31180D [Brassica napus]
Length=324

 Score =   243 bits (620),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 144/315 (46%), Positives = 199/315 (63%), Gaps = 13/315 (4%)
 Frame = +3

Query  54   MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTL  233
            ME  +KI RRS+  FL+ +    TTA  L  P++A++L+ Q FV SS   + +H +++ L
Sbjct  5    MEEPSKIMRRSIHTFLKHYDR-ATTAAALVLPFSAALLLSQPFVSSS--SSFLHGKLNML  61

Query  234  FDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSLF  413
            F  AGF  S +FF IL+LKLSQT++ S   LPF+L+F L SKA +I+ L +      SL+
Sbjct  62   FRGAGFSFSLDFFNILSLKLSQTLSSSLFTLPFSLTFLLFSKAYIIKLLSNSH-GDSSLY  120

Query  414  SCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGALL  593
                  +  LL T + NSF +LSANA+ F L   AFNL + FG SS  F    S+S A++
Sbjct  121  ------YFRLLRTYIWNSFFLLSANASAFALFFVAFNLIEYFGLSSRNFYTLFSLSSAII  174

Query  594  CSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEA  773
             S+ILAN F I NLAL+ S   ++GG+  ILKAC+LI+GRT TAL+L+LP N+ +A VEA
Sbjct  175  YSVILANAFVISNLALISSTSSSSGGYPTILKACLLIQGRTSTALALSLPTNLGLAGVEA  234

Query  774  LFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSC---EGDCHIDQ  944
            LFQYR+V  Y+     I+S+ALEG  IAY+YA+ LVLDTIV   F +SC   + +  I +
Sbjct  235  LFQYRVVSSYYKGDRDITSIALEGTFIAYLYALFLVLDTIVNFLFYQSCVKNDEEQKIGR  294

Query  945  YRRLPSHVEIEEDNN  989
                   ++I E  N
Sbjct  295  EDEYSIKIQISETEN  309



>ref|XP_010483800.1| PREDICTED: uncharacterized protein LOC104762247 [Camelina sativa]
Length=326

 Score =   243 bits (619),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 155/326 (48%), Positives = 209/326 (64%), Gaps = 11/326 (3%)
 Frame = +3

Query  54    MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTL  233
             ME  +K+ RRS+  FL+ +   TT A V A P++A +L+ Q F  SS   +++HAR++TL
Sbjct  5     MEDPSKLMRRSIHTFLKNYHRVTTAAAV-ALPFSAGLLLSQPFFSSS--SSILHARLNTL  61

Query  234   FDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSLF  413
             F  AGF SS +FF IL+LKLSQT + S   LPF+L+FFL SKA VI+ L +      S  
Sbjct  62    FRGAGFSSSLDFFNILSLKLSQTFSSSLFTLPFSLTFFLFSKAYVIKLLSNNHSADDS--  119

Query  414   SCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGALL  593
                   +  LL T +C+ F ++SANA+ F L   AFN  + FGFSS  F  FLS+S A++
Sbjct  120   ---SVYYFRLLKTYICSFFFLISANASAFALFFLAFNTLEAFGFSSRNFYTFLSLSSAII  176

Query  594   CSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEA  773
              SII+AN F I NLALV S   ++GG+T ILKAC+LI+ RT  AL+LALP N+ +A +EA
Sbjct  177   YSIIIANAFVISNLALVSSPSSSSGGYTNILKACLLIRKRTSPALALALPTNLGLAGIEA  236

Query  774   LFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSC---EGDCHIDQ  944
             LFQYR+VR Y++    I+S+ALEG  IAY+YA+ LVLDTIV  FF +SC   E D  I +
Sbjct  237   LFQYRVVRSYYNGDRDITSIALEGTFIAYLYALFLVLDTIVNFFFYQSCVKNEEDQKIGR  296

Query  945   YRRLPSHVEIEEDNNAFRTVKIVEDL  1022
                    ++I E  N    +K  +DL
Sbjct  297   EDEYSIKIQISETENTKIHIKGSKDL  322



>emb|CDY02155.1| BnaA03g40120D [Brassica napus]
Length=324

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 149/315 (47%), Positives = 202/315 (64%), Gaps = 13/315 (4%)
 Frame = +3

Query  54   MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTL  233
            ME  +KI RRS+  FL+ +    TTA  L  P++A++L+ Q F  SS   + +HA+++ L
Sbjct  5    MEEPSKIMRRSIHTFLKHYDR-ATTAAALVLPFSAALLLSQPFFSSS--SSSLHAKLNML  61

Query  234  FDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSLF  413
            F  AGF SS +FF IL+LKLSQT++ S   LPF+++F L SKA +I+ L +      SL+
Sbjct  62   FRGAGFSSSLDFFNILSLKLSQTLSSSLFTLPFSITFLLFSKAYIIKLLSNSH-GDSSLY  120

Query  414  SCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGALL  593
                  +  LL T +CNSF +LSANA+   L   AFNL + FG SS  F    S+S A++
Sbjct  121  ------YFRLLRTYICNSFFLLSANASALALFFVAFNLIESFGLSSRNFYTLFSLSSAII  174

Query  594  CSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEA  773
             SIILAN F I NLALV S   ++GG+T ILKAC+LI+GRT TAL+L+LP N+ +A VEA
Sbjct  175  YSIILANAFVISNLALVSSTSSSSGGYTTILKACLLIQGRTSTALALSLPTNLCLAGVEA  234

Query  774  LFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSC---EGDCHIDQ  944
            LFQYR+V  Y+    GI+S+ALEG  IAY+YA+ LVLDTIV   F +SC   + D  I +
Sbjct  235  LFQYRVVSSYYKGDRGITSIALEGAFIAYLYALFLVLDTIVNYLFYQSCVKNDEDQRISR  294

Query  945  YRRLPSHVEIEEDNN  989
                   ++I E  N
Sbjct  295  EDEYSIKIQISETEN  309



>ref|NP_568933.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK68745.2| Unknown protein [Arabidopsis thaliana]
 gb|AAM10264.1| unknown protein [Arabidopsis thaliana]
 gb|AED97456.1| uncharacterized protein AT5G61340 [Arabidopsis thaliana]
Length=326

 Score =   241 bits (615),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 154/326 (47%), Positives = 207/326 (63%), Gaps = 11/326 (3%)
 Frame = +3

Query  54    MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTL  233
             ME  +KI RRS+  FLQ +   TT A V A P++A +L+ Q F  SS   + +H R++ L
Sbjct  5     MEDPSKIMRRSIHTFLQNYHRVTTAAAV-ALPFSAGLLLSQPFFSSS--SSTLHMRLNML  61

Query  234   FDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSLF  413
             F  AGF SS +FF IL+LKLSQT++ S   LPF+L+F LLSKA VI+ L +      S  
Sbjct  62    FRGAGFSSSHDFFNILSLKLSQTLSSSLFTLPFSLTFLLLSKAYVIKLLSNNHSADSS--  119

Query  414   SCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGALL  593
                   +  LL T +CN F +LSANA+ F L   A+N  + FGFSS  F  FLS+S A++
Sbjct  120   ---SVFYLRLLKTYVCNFFFLLSANASAFALFFLAYNTLEAFGFSSRNFYTFLSLSSAII  176

Query  594   CSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEA  773
              SII+AN F I NLALV S   ++GG+T ILKAC+LI+GR  TA++LALP N+ +A VEA
Sbjct  177   YSIIIANAFVISNLALVSSPSSSSGGYTNILKACLLIRGRNSTAMALALPTNLGLAGVEA  236

Query  774   LFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSC---EGDCHIDQ  944
             LFQYR++R Y++    I S+ALEG  IAY+YA+ LVLDTIV   F +SC   E D +I +
Sbjct  237   LFQYRVMRSYYNGDRDIISIALEGTFIAYLYALFLVLDTIVNFLFYQSCIKNEEDQNIGR  296

Query  945   YRRLPSHVEIEEDNNAFRTVKIVEDL  1022
                    ++I E  N    +K  ++L
Sbjct  297   EDEYSIKIQISETENTKIHIKGSKNL  322



>dbj|BAB08489.1| unnamed protein product [Arabidopsis thaliana]
Length=359

 Score =   241 bits (616),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 154/326 (47%), Positives = 207/326 (63%), Gaps = 11/326 (3%)
 Frame = +3

Query  54    MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTL  233
             ME  +KI RRS+  FLQ +   TT A V A P++A +L+ Q F  SS   + +H R++ L
Sbjct  38    MEDPSKIMRRSIHTFLQNYHRVTTAAAV-ALPFSAGLLLSQPFFSSS--SSTLHMRLNML  94

Query  234   FDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSLF  413
             F  AGF SS +FF IL+LKLSQT++ S   LPF+L+F LLSKA VI+ L +      S  
Sbjct  95    FRGAGFSSSHDFFNILSLKLSQTLSSSLFTLPFSLTFLLLSKAYVIKLLSNNHSADSS--  152

Query  414   SCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGALL  593
                   +  LL T +CN F +LSANA+ F L   A+N  + FGFSS  F  FLS+S A++
Sbjct  153   ---SVFYLRLLKTYVCNFFFLLSANASAFALFFLAYNTLEAFGFSSRNFYTFLSLSSAII  209

Query  594   CSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEA  773
              SII+AN F I NLALV S   ++GG+T ILKAC+LI+GR  TA++LALP N+ +A VEA
Sbjct  210   YSIIIANAFVISNLALVSSPSSSSGGYTNILKACLLIRGRNSTAMALALPTNLGLAGVEA  269

Query  774   LFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSC---EGDCHIDQ  944
             LFQYR++R Y++    I S+ALEG  IAY+YA+ LVLDTIV   F +SC   E D +I +
Sbjct  270   LFQYRVMRSYYNGDRDIISIALEGTFIAYLYALFLVLDTIVNFLFYQSCIKNEEDQNIGR  329

Query  945   YRRLPSHVEIEEDNNAFRTVKIVEDL  1022
                    ++I E  N    +K  ++L
Sbjct  330   EDEYSIKIQISETENTKIHIKGSKNL  355



>ref|XP_010443954.1| PREDICTED: uncharacterized protein LOC104726721 [Camelina sativa]
Length=324

 Score =   239 bits (610),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 151/313 (48%), Positives = 204/313 (65%), Gaps = 11/313 (4%)
 Frame = +3

Query  54   MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTL  233
            ME  +K+ RRS+  FL+ +   TT A V A P++A +L+ Q F  SS   +++HAR++TL
Sbjct  5    MEDPSKLMRRSIHTFLKNYHRVTTAAAV-ALPFSAGLLLSQPFFSSS--SSILHARLNTL  61

Query  234  FDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSLF  413
            F  AGF SS +FF IL+LKLSQT + S   LPF+L+FFL SKA VI+ L +      S  
Sbjct  62   FRGAGFSSSLDFFNILSLKLSQTFSSSLFTLPFSLTFFLFSKAYVIKLLSNNHSADDS--  119

Query  414  SCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGALL  593
                  +  LL T +C+ F ++SANA+ F L   AFN  + FGFSS  F  FLSVS A++
Sbjct  120  ---SVYYFRLLKTYICSFFFLISANASAFALFFLAFNTLEAFGFSSRNFYTFLSVSSAII  176

Query  594  CSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEA  773
             SII+AN F I NLALV S   ++GG+T ILKAC+LI+ RT  AL+LALP N+ +A +EA
Sbjct  177  YSIIIANAFVISNLALVSSPSSSSGGYTNILKACLLIRKRTSPALALALPTNLGLAGIEA  236

Query  774  LFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSC---EGDCHIDQ  944
            LFQYR+V+ Y++    I+S+ALEG  IAY+YA+ LVLDTIV  FF +SC   E D  I +
Sbjct  237  LFQYRVVKSYYNGDRDITSIALEGTFIAYLYALFLVLDTIVNFFFYQSCVKNEEDQKIGR  296

Query  945  YRRLPSHVEIEED  983
                   ++I E+
Sbjct  297  EDEYSIKIQIREN  309



>ref|XP_010039067.1| PREDICTED: uncharacterized protein LOC104427718 [Eucalyptus grandis]
Length=370

 Score =   240 bits (612),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 142/281 (51%), Positives = 185/281 (66%), Gaps = 11/281 (4%)
 Frame = +3

Query  159  SVLVFQSFVPSSPFLAM-IHARIHTLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFT  335
            S+L+ Q+ VP+S  L + IH+R+  LFDAAGFP SSE F +LN KLSQT + S LALPF 
Sbjct  71   SILLSQALVPASSSLVLAIHSRLRDLFDAAGFPPSSELFALLNFKLSQTQSSSVLALPFA  130

Query  336  LSFFLLSKACVIQALGDQELPKRSLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLF  515
            LSF L++K+ VI +L   +    S  S    I+ PLL T +CN  ++LSAN+T F LL F
Sbjct  131  LSFLLIAKSSVILSLAGTKPSVPSSLSSFLSIYRPLLATYICNLLVILSANSTAFFLLFF  190

Query  516  AFNLADEFGFSSPRFELFLSVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKAC  695
            AFN        S  ++L LS +GA++ SIILA+   ICNLALVLSG E TGGF AILKAC
Sbjct  191  AFNCLGGPQPGSSNYDLLLSATGAVVYSIILAHALVICNLALVLSGMERTGGFVAILKAC  250

Query  696  VLIKGRTGTALSLALPINMAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAIL  875
             LI+G   TALSLA+P+N+A+A+ EALFQ+R++R Y      +  VA+EG LIAY+Y+IL
Sbjct  251  ALIRGSISTALSLAVPVNLALASTEALFQFRVMRAYSMKNGPVFPVAMEGWLIAYLYSIL  310

Query  876  LVLDTIVVCFFLRSCEGDCHIDQYRRLPSHVEIEEDNNAFR  998
            +VLDTI+ C F +SC+            S +   ED   FR
Sbjct  311  IVLDTILTCIFFKSCKNS----------SIIRGSEDQRYFR  341



>ref|XP_010936510.1| PREDICTED: uncharacterized protein LOC105056131 [Elaeis guineensis]
Length=319

 Score =   238 bits (606),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 145/297 (49%), Positives = 197/297 (66%), Gaps = 7/297 (2%)
 Frame = +3

Query  54   MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPY-AASVLVFQSFVPSSPFLAMIHARIHT  230
            M  A KI RRS+  F Q +  F +TA +L FP  AA++L     + SSP L  I +R+  
Sbjct  1    MGKAIKITRRSIHAFFQSYHSFASTAALLVFPVSAATLLSQSLPLSSSPILRTISSRLRL  60

Query  231  LFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSL  410
            LF+AAGFP+SS+FF++LN KLSQ +      LPFTL F +L+KA VIQ +  QE P+R L
Sbjct  61   LFEAAGFPASSQFFSLLNFKLSQAILTFISTLPFTLIFLILAKASVIQII--QEFPRRRL  118

Query  411  ----FSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSV  578
                 S L  ++  LLLT L NS ++LSANA  F +L+ AFN+ D    SS    L LS 
Sbjct  119  APPPLSSLLHLYPSLLLTFLSNSLVILSANAAIFSILVVAFNIPDILHLSSNNSILVLSA  178

Query  579  SGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAM  758
            +  +L SI++ANT   CNLA+V+S  E +GG+ +ILKA VLI+GRT T ++LALP +++M
Sbjct  179  ASVILYSIVIANTMVACNLAIVISAMENSGGYLSILKALVLIRGRTATGITLALPASLSM  238

Query  759  AAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGD  929
            AAVEALFQYR++R YH ++    SV  E  LI Y+Y++L+VLDTI+ C FLR C+ +
Sbjct  239  AAVEALFQYRVMRPYHLSRKFSPSVIWEAFLITYIYSLLIVLDTIITCMFLRICKSE  295



>ref|XP_004174046.1| PREDICTED: uncharacterized protein LOC101224752, partial [Cucumis 
sativus]
Length=272

 Score =   236 bits (601),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 136/270 (50%), Positives = 172/270 (64%), Gaps = 1/270 (0%)
 Frame = +3

Query  219   RIHTLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELP  398
             R+  +F AAGFP SS+FF     KLSQT+  +  +LPF+LSF L+SKACVIQ L  Q+  
Sbjct  3     RLRAVFSAAGFPISSKFFLFFIQKLSQTIVSTIYSLPFSLSFLLISKACVIQVLNQQKPN  62

Query  399   KRSLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSV  578
                 FS +    +PL  T LCN F+ +SAN+T F +L FAFN  D FG+SSP   LF+SV
Sbjct  63    LLPSFSAILHFFNPLFFTHLCNLFIFISANSTVFFMLFFAFNFLDGFGYSSPNCLLFVSV  122

Query  579   SGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAM  758
              G  L SI +A    ICNLA VLS  E  GGF  +LKACVLI+GR+ TAL + LP NM M
Sbjct  123   LGGFLYSIAIAKAIVICNLASVLSAMERKGGFMTLLKACVLIQGRSTTALLVTLPFNMGM  182

Query  759   AAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHI  938
             AAVEALFQYRIVR YH       S+ +EGM +AY+Y++ +VLD IV   F +SC  D  +
Sbjct  183   AAVEALFQYRIVRDYHLRGKLEPSMVVEGMFVAYLYSVFVVLDAIVNTLFFKSCRADSQM  242

Query  939   DQYRRLPSHVEI-EEDNNAFRTVKIVEDLP  1025
                R+      I E++N  FR +K  E+LP
Sbjct  243   GIERKSSFWFWIAEKENEGFRHLKGFEELP  272



>gb|KCW48865.1| hypothetical protein EUGRSUZ_K02492 [Eucalyptus grandis]
Length=394

 Score =   239 bits (611),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 142/281 (51%), Positives = 185/281 (66%), Gaps = 11/281 (4%)
 Frame = +3

Query  159  SVLVFQSFVPSSPFLAM-IHARIHTLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFT  335
            S+L+ Q+ VP+S  L + IH+R+  LFDAAGFP SSE F +LN KLSQT + S LALPF 
Sbjct  95   SILLSQALVPASSSLVLAIHSRLRDLFDAAGFPPSSELFALLNFKLSQTQSSSVLALPFA  154

Query  336  LSFFLLSKACVIQALGDQELPKRSLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLF  515
            LSF L++K+ VI +L   +    S  S    I+ PLL T +CN  ++LSAN+T F LL F
Sbjct  155  LSFLLIAKSSVILSLAGTKPSVPSSLSSFLSIYRPLLATYICNLLVILSANSTAFFLLFF  214

Query  516  AFNLADEFGFSSPRFELFLSVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKAC  695
            AFN        S  ++L LS +GA++ SIILA+   ICNLALVLSG E TGGF AILKAC
Sbjct  215  AFNCLGGPQPGSSNYDLLLSATGAVVYSIILAHALVICNLALVLSGMERTGGFVAILKAC  274

Query  696  VLIKGRTGTALSLALPINMAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAIL  875
             LI+G   TALSLA+P+N+A+A+ EALFQ+R++R Y      +  VA+EG LIAY+Y+IL
Sbjct  275  ALIRGSISTALSLAVPVNLALASTEALFQFRVMRAYSMKNGPVFPVAMEGWLIAYLYSIL  334

Query  876  LVLDTIVVCFFLRSCEGDCHIDQYRRLPSHVEIEEDNNAFR  998
            +VLDTI+ C F +SC+            S +   ED   FR
Sbjct  335  IVLDTILTCIFFKSCKNS----------SIIRGSEDQRYFR  365



>ref|XP_010457239.1| PREDICTED: uncharacterized protein LOC104738735 [Camelina sativa]
Length=327

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 152/317 (48%), Positives = 205/317 (65%), Gaps = 14/317 (4%)
 Frame = +3

Query  54   MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTL  233
            ME  +K+ RRS+  FL+ +   TT A V A P++A +L+ Q F  SS   +++HAR++TL
Sbjct  5    MEEPSKLMRRSIHTFLKNYHRVTTAAAV-ALPFSAGLLLSQPFFSSS--SSILHARLNTL  61

Query  234  FDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQAL--GDQELPKRS  407
            F  AGF SS +FF IL+LKLSQT A S   LPF+L+F L SKA VI+ L   +      S
Sbjct  62   FRGAGFSSSLDFFNILSLKLSQTFASSLFTLPFSLTFLLFSKAYVIKLLSNNNHSADDSS  121

Query  408  LFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGA  587
            ++      +  LL T +C+ F ++SANA+ F L   AFN  + FGFSS  F  FLS+S A
Sbjct  122  VY------YFRLLKTYICSFFFLISANASAFALFFLAFNTLEAFGFSSRNFYTFLSLSSA  175

Query  588  LLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAV  767
            ++ SII+AN F I NLALV S   ++GG+T ILKAC+LI+ RT  AL+LALP N+ +A +
Sbjct  176  IIYSIIIANAFVISNLALVSSPSSSSGGYTNILKACLLIRKRTSPALALALPTNLGLAGI  235

Query  768  EALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSC---EGDCHI  938
            EALFQYR+VR Y++    I+S+ALEG  IAY+YA+ LVLDTIV  FF +SC   E D  I
Sbjct  236  EALFQYRVVRSYYNGDRDITSIALEGTFIAYLYALFLVLDTIVNFFFYQSCIKNEEDQKI  295

Query  939  DQYRRLPSHVEIEEDNN  989
             +       ++I E  N
Sbjct  296  GREDEYSIKIQISETEN  312



>ref|XP_010939058.1| PREDICTED: uncharacterized protein LOC105058004 [Elaeis guineensis]
Length=319

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 146/310 (47%), Positives = 199/310 (64%), Gaps = 16/310 (5%)
 Frame = +3

Query  54   MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPY-AASVLVFQSFVPSSPFLAMIHARIHT  230
            M    +I RRS+  F Q +  F TTA +L FP  AA++L     + SSP L  + +R+  
Sbjct  1    MGKVIEITRRSIHAFFQSYHSFATTAALLVFPVSAATLLSQSLTLSSSPILRTVSSRLRL  60

Query  231  LFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSL  410
            LF+AAGFP++S+FF++L+ K+SQT+  S   LPFT  F +L+KA VIQ +   E P+  L
Sbjct  61   LFEAAGFPATSQFFSLLSFKISQTILTSISTLPFTHIFLILAKASVIQII--HEFPRCRL  118

Query  411  ----FSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSV  578
                FS L  ++  LLLT+L NS  +LSANAT F +LL  FN+AD    SS    L LS 
Sbjct  119  ALPPFSSLLHLYPSLLLTKLTNSLAILSANATIFSILLLVFNVADILHLSSSNSMLVLSA  178

Query  579  SGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAM  758
            + A+  SI++ANT   CNLA+V+S  E +GG+ +ILKA VLI+GRT TA++LALP +++M
Sbjct  179  ASAIFYSIVIANTMVACNLAIVISAMENSGGYLSILKALVLIRGRTATAITLALPASLSM  238

Query  759  AAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSC---EG-  926
            AAVEALFQ R++R Y  +     SV  E  LI Y+Y++L+VLDTI+ C FL+SC   EG 
Sbjct  239  AAVEALFQCRVMRPYRLSGNSNPSVIWEAFLITYIYSLLIVLDTIITCMFLKSCKMGEGS  298

Query  927  -----DCHID  941
                 DC  D
Sbjct  299  HWYAYDCQTD  308



>ref|XP_010523013.1| PREDICTED: uncharacterized protein LOC104801435 [Tarenaya hassleriana]
Length=315

 Score =   233 bits (593),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 155/296 (52%), Positives = 197/296 (67%), Gaps = 14/296 (5%)
 Frame = +3

Query  54   MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTL  233
            ME   KI RRS+  FL+ +  FTT A   AFP+A ++L+ Q F  SS  L+ +  R++TL
Sbjct  1    MEEPIKIMRRSIHTFLRNYHRFTTAAAASAFPFAVALLLSQPFSSSSSALSSLRTRLNTL  60

Query  234  FDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSL-  410
            F AAGFPS   FF IL+LKLSQT+  S  ALPF+L+F L SKA VI+ L + +L    + 
Sbjct  61   FHAAGFPS---FFDILSLKLSQTICSSVFALPFSLTFLLFSKAYVIRLLSNDKLSSSDVS  117

Query  411  ---FSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVS  581
               + CL R       T +CNSFL+LSANA+ F LL  AFNL   FGFSS  F   LSVS
Sbjct  118  LGDYLCLLR-------TYICNSFLLLSANASAFGLLFMAFNLLQGFGFSSQIFLGILSVS  170

Query  582  GALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMA  761
             A++ SIILAN   I NLALV S   ++ G+ AILKACVLI+GRT TAL+LALP N+ +A
Sbjct  171  AAVVYSIILANALVISNLALVSSSSSSSSGYMAILKACVLIRGRTSTALALALPTNIGLA  230

Query  762  AVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGD  929
            AVEALFQ RIV+ Y      I+S+  EGMLIAY+YAI ++LDT+V   F +SC+ +
Sbjct  231  AVEALFQTRIVKSYFAGDRDIASLVPEGMLIAYLYAIFVILDTVVNFLFYQSCKTN  286



>ref|XP_008781043.1| PREDICTED: uncharacterized protein LOC103700923 [Phoenix dactylifera]
Length=316

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 139/315 (44%), Positives = 200/315 (63%), Gaps = 9/315 (3%)
 Frame = +3

Query  63   AAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSP-FLAMIHARIHTLFD  239
            A  I RRS+  F Q +  F + A +  FP +AS+L+ Q+ V SS   L  I +R+ +LF 
Sbjct  2    ATHIIRRSIHAFFQSYHSFASIATLFVFPVSASLLLSQALVTSSSVILPSISSRLESLFQ  61

Query  240  AAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSL---  410
            AAGFP++ +FF+++ LK+SQT+    L LPFT++F LL+KA +I+ +  +E P RS    
Sbjct  62   AAGFPAT-QFFSLVRLKISQTIFSFTLTLPFTVTFLLLAKASIIEVI--REFPSRSHAPP  118

Query  411  -FSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGA  587
             FS    ++  LL T L NS ++LSANAT F LL   FN  D  GFSS    LFLS + A
Sbjct  119  PFSSFLHLYRSLLPTHLFNSLVILSANATIFSLLFLVFNAVDVIGFSSSNSLLFLSAAAA  178

Query  588  LLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAV  767
            +L S+I+AN   ICNLA+++S  E + G   +LKAC+LI+GR  TAL+LALP N+ MAA+
Sbjct  179  VLYSVIVANATVICNLAIIVSAMENSSGCLPVLKACMLIRGRVMTALTLALPPNLGMAAI  238

Query  768  EALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHIDQY  947
            EALF YR+VR YH +K  + SV  E   I YM++++++L+ I+ C F RSC+ +CH +  
Sbjct  239  EALFHYRVVRPYHLSKFSL-SVIWEAFSITYMHSLVIILEIIMSCAFFRSCKLECHTNLE  297

Query  948  RRLPSHVEIEEDNNA  992
             +     E+E +   
Sbjct  298  NKSYYKTELEPEEKG  312



>ref|XP_010045591.1| PREDICTED: uncharacterized protein LOC104434350 [Eucalyptus grandis]
 gb|KCW83666.1| hypothetical protein EUGRSUZ_B00548 [Eucalyptus grandis]
Length=339

 Score =   228 bits (582),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 142/321 (44%), Positives = 198/321 (62%), Gaps = 9/321 (3%)
 Frame = +3

Query  54   MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSF------VPSSPFLAMIH  215
            ME   KI RRSV  FLQ +Q+FTT +  LA P++A  L+ Q+F        S     +IH
Sbjct  1    MEGTGKILRRSVHTFLQNYQYFTTISASLALPFSALFLISQAFFLPSSSSSSPLLPQLIH  60

Query  216  ARIHTLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQEL  395
                 LF AAGFP+SS FFTIL+LKLS+TV  S   LP T +F L++K+ VI+ L   + 
Sbjct  61   NHFQALFRAAGFPTSSGFFTILSLKLSETVTSSIFTLPLTTTFLLIAKSSVIRRLAQVKA  120

Query  396  PKRSLFSCLPRI---HSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFEL  566
                 +S  P I   ++PLL T +C   ++LSANAT F LL F FN  + F  S+    L
Sbjct  121  DPSLPYSLPPDILSAYTPLLRTYVCGFLVILSANATAFFLLFFGFNCLEGFQLSATEHSL  180

Query  567  FLSVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPI  746
              SV  A++ S+++ANTF ICNLALVLSG E  GG  AI+KA ++++GR  TALS A+  
Sbjct  181  SSSVVAAVVYSMVIANTFIICNLALVLSGTEKHGGSLAIIKAYLMMRGRRATALSFAVIG  240

Query  747  NMAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEG  926
            N ++AA EALF+YR+V  YH + +    + LEG  IAY+Y++L+VLDT+V   FLRSC+ 
Sbjct  241  NFSLAATEALFRYRVVAPYHASGSFSLGILLEGCYIAYLYSVLIVLDTVVTYTFLRSCQV  300

Query  927  DCHIDQYRRLPSHVEIEEDNN  989
            +  I+   +    ++I +  +
Sbjct  301  EDLINCEDKFYCQIQIWDATD  321



>ref|XP_010938751.1| PREDICTED: uncharacterized protein LOC105057757 [Elaeis guineensis]
Length=316

 Score =   221 bits (564),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 137/320 (43%), Positives = 200/320 (63%), Gaps = 10/320 (3%)
 Frame = +3

Query  54   MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSP-FLAMIHARIHT  230
            M  A +I RRS+  F Q +  FT+ A +  FP +AS+L+ Q+F+ SS   L  I +R+ +
Sbjct  1    MGMATQIIRRSIHAFFQSYHSFTSIATLFVFPVSASLLLSQAFITSSAVILPSISSRLES  60

Query  231  LFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSL  410
            LF AAGFP+S +FF+++ LK+SQT+       PF L+F LL+KA +++ +  +E   R+ 
Sbjct  61   LFQAAGFPTS-QFFSLVQLKISQTIFSFVFTFPFNLTFLLLAKASIVETI--REFSHRNH  117

Query  411  ---FSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVS  581
                S    +H  LLLT L NSF +LSANAT F LL   FN  D  GFSS    L  + +
Sbjct  118  APPLSSFLHLHRSLLLTYLFNSFAILSANATIFSLLFLVFNGVDIIGFSSSNSFLLSA-A  176

Query  582  GALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMA  761
             A+L S+I+AN   +CNLA++++  E  GG+  +LKA +LI+ R  TAL+LALP N+ MA
Sbjct  177  AAVLYSVIIANATVLCNLAIIVAAMENCGGYLPVLKAFMLIRSRLMTALTLALPANLGMA  236

Query  762  AVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHID  941
            A+EALFQYR+VR YH +K    SV  E   I YM+++++VL+TI+ C F  SC+ +C  +
Sbjct  237  AIEALFQYRVVRPYHLSKFS-PSVIWEAFSITYMHSLIIVLETIMSCIFFESCKLECRTN  295

Query  942  QYRRLPSHVEIE-EDNNAFR  998
               R     E+E E+ +A +
Sbjct  296  LENRSFYRTELEPEEKDALQ  315



>emb|CDY16815.1| BnaA09g05670D [Brassica napus]
Length=319

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 149/315 (47%), Positives = 203/315 (64%), Gaps = 15/315 (5%)
 Frame = +3

Query  54   MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTL  233
            ME  +KI RRSV  FLQ +   TT A V A P++ ++L+ Q F  SS   + IH +++TL
Sbjct  5    MEDPSKIMRRSVHTFLQHYHRATTAAAV-ALPFSTALLLSQPFFSSS--SSSIHMKLNTL  61

Query  234  FDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSLF  413
               AGF SS EFF IL+LKLSQT++ S L LPF+L+F L SKA +I+ L +      S++
Sbjct  62   LRGAGFSSSLEFFNILSLKLSQTLSSSLLTLPFSLTFLLFSKAYIIKLLSNNH---DSIY  118

Query  414  SCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGALL  593
                  +  LL T +CNSF +LSANA+ F L   A  + D FGFSS  F    S+S A++
Sbjct  119  ------YFRLLRTYICNSFFILSANASAFALFFLASTILDSFGFSSRNFYTLFSLSSAII  172

Query  594  CSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEA  773
             SIILAN F I NLALV S   ++GG+T +LKAC+L++GRT TAL+LALP N+ +A VEA
Sbjct  173  YSIILANAFVISNLALVSSPSSSSGGYTTLLKACLLLRGRTSTALALALPTNLGLAGVEA  232

Query  774  LFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSC---EGDCHIDQ  944
            LF+YR++R ++     ++S+A+EG LIAY+YA+ LVLDTIV  FF +SC   E +  I  
Sbjct  233  LFRYRVMRSFYKGDRDVTSIAIEGTLIAYLYALFLVLDTIVNFFFYQSCVKNEEEQKIGG  292

Query  945  YRRLPSHVEIEEDNN  989
                   ++I E  N
Sbjct  293  DDEYSIKIQICESEN  307



>ref|XP_002278774.2| PREDICTED: uncharacterized protein LOC100256060 [Vitis vinifera]
 emb|CBI22261.3| unnamed protein product [Vitis vinifera]
Length=324

 Score =   214 bits (546),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 142/336 (42%), Positives = 197/336 (59%), Gaps = 22/336 (7%)
 Frame = +3

Query  30    MQEFSAAGME-SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPF-L  203
             M+E  +A ME  A KI RRS+F FL+ +QFFT   V+L  P++  VL+ Q+F  SS   L
Sbjct  1     MEETPSADMEIRATKIVRRSIFIFLKDYQFFTNIPVLLMLPFSVFVLLLQAFSSSSTSPL  60

Query  204   AMIHARIHTLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALG  383
              +IHA         GF  S + F + +  +S ++  S  +LPFTLS  +++K  +IQAL 
Sbjct  61    FVIHA--------LGFSPSLQLFLLSDFGVSYSIFSSVFSLPFTLSSLVMAKGYIIQALN  112

Query  384   DQELPKRSLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFE  563
               ++     FS L  I+  L LTQ+CNS ++ +ANA  F +L   FN  + F  SS +  
Sbjct  113   QHKMVLPPSFSSLVSIYRSLFLTQVCNSVIIFTANAVAFSVLFMGFNSLESFD-SSSKNP  171

Query  564   LFLSVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGT--ALSLA  737
             L L V+ +   S  LANT  +CN ALV++G E   G+ A+ KAC L++ R G   AL +A
Sbjct  172   LILFVARSFSYS-FLANTMVLCNFALVVTGMENCSGYLAVFKACSLLR-RCGNSRALLMA  229

Query  738   LPINMAMAAVEALFQYRIVRVYH-HAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLR  914
             LP N+  AAV ALF YRIVR YH   + G   +ALEG+LIAY+Y++L+VLDTIV C F +
Sbjct  230   LPANLGAAAVGALFHYRIVRAYHLSGRPGCIYMALEGLLIAYLYSLLIVLDTIVSCLFFK  289

Query  915   SCEGDCHIDQYRRLPSHVEIE----EDNNAFRTVKI  1010
             SC+    +DQ      H +IE    EDN  +   KI
Sbjct  290   SCKPTFQMDQTGG--CHYQIELVKGEDNGTYANRKI  323



>ref|XP_007032623.1| Uncharacterized protein TCM_018662 [Theobroma cacao]
 gb|EOY03549.1| Uncharacterized protein TCM_018662 [Theobroma cacao]
Length=313

 Score =   210 bits (535),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 129/316 (41%), Positives = 189/316 (60%), Gaps = 12/316 (4%)
 Frame = +3

Query  54   MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVP-SSPFLA-MIHARIH  227
            M+ A KI R S+  FL+ F +FTT  V+L  P++A VL+ Q+ +  SSP L+   +A++ 
Sbjct  1    MDCAGKIIRTSIHTFLKYFHYFTTIPVLLLLPFSAFVLLSQALITYSSPLLSETTYAQLD  60

Query  228  TLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRS  407
            ++FD A FP SS       LK SQTV     +LPF LS F+++KA +IQA    +L  ++
Sbjct  61   SIFDLARFPFSSP------LK-SQTVFPFLFSLPFALSSFIIAKASIIQAFNQHKLSLQA  113

Query  408  LFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGA  587
             FS    ++ PLLLT LC+  L+++  +  F LL  + N    F    P     L   GA
Sbjct  114  PFSSFKSLYKPLLLTHLCSLVLIIAITSATFPLLFISLNSLKTFWL--PDISQILPAFGA  171

Query  588  LLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAV  767
            +  S  LANT  + NLALV++G E   G  AI KAC+L KG+   AL L LP NM + ++
Sbjct  172  VFYSF-LANTIVVANLALVVAGMETCKGHVAIYKACLLRKGKNSMALLLFLPTNMGLVSI  230

Query  768  EALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHIDQY  947
            EALF++R++RVY       SS+ALEG+LIAY+Y++L+VLDTI+ C F +SCE +    + 
Sbjct  231  EALFRFRVIRVYQILGGLNSSMALEGLLIAYLYSLLIVLDTIICCLFYKSCESNSMASRI  290

Query  948  RRLPSHVEIEEDNNAF  995
             R    +E+ ++  +F
Sbjct  291  HRSCYDIELVQERESF  306



>ref|XP_009417032.1| PREDICTED: uncharacterized protein LOC103997509 [Musa acuminata 
subsp. malaccensis]
Length=966

 Score =   220 bits (560),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 136/298 (46%), Positives = 191/298 (64%), Gaps = 7/298 (2%)
 Frame = +3

Query  54   MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVP-SSPFLAMIHARIHT  230
            M  A +I RRS+  F   +  FT  AV+L FP +AS+L+ Q+ +P S+  L  I +R+ +
Sbjct  1    MGVAIRIMRRSINAFFHDYHCFTPIAVLLVFPASASLLLSQAPIPYSTTVLETISSRLRS  60

Query  231  LFDAAGFPSSSEFFTILNLKLSQTVAISFL-ALPFTLSFFLLSKACVIQALGDQELPKRS  407
            LF AA FP +S FF++LN+KL+QT   SF+  LPF L+F LL+KA +I  +      KR+
Sbjct  61   LFQAARFPVTSTFFSLLNVKLAQT-GFSFVFTLPFVLTFLLLAKASIIHNVCGGPRRKRA  119

Query  408  ---LFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSV  578
               L S L R++  +L T L NS LVLSANA+ F  L    N  D  G S+    L LS 
Sbjct  120  PPRLSSSL-RLYRSILPTHLFNSCLVLSANASVFAFLSVVSNAVDLLGLSTSNSMLVLSA  178

Query  579  SGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAM  758
            +GA+L SI +ANT  IC+LA+V+S  +   G+  +LKAC+LI+GR  TALSLAL  N+ +
Sbjct  179  AGAVLYSIAVANTTVICSLAIVVSATDNCRGYIPVLKACMLIRGRVKTALSLALSANLGV  238

Query  759  AAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDC  932
            AAVEALFQYR+VR Y  +    SS+  E + I+Y++A+L+ L+ I+ C F +SC+ DC
Sbjct  239  AAVEALFQYRVVRQYDLSGKLDSSLLWEALYISYVHALLVALEVIMNCMFFKSCQTDC  296



>emb|CDX87208.1| BnaC09g05230D [Brassica napus]
Length=320

 Score =   209 bits (531),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 144/315 (46%), Positives = 196/315 (62%), Gaps = 14/315 (4%)
 Frame = +3

Query  54   MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTL  233
            ME  +KI RRS+  FLQ +   TT A V A P++ ++ + Q F  SS   + IH +++TL
Sbjct  5    MEDPSKIMRRSIHTFLQHYHRATTAAAV-ALPFSTALFLSQPFFSSS--SSSIHMKLNTL  61

Query  234  FDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSLF  413
            F  AGF SS  FF IL+LKLSQT++ S L LPF+L+F L SKA +I+ L +        F
Sbjct  62   FRGAGFSSSLGFFNILSLKLSQTLSSSLLTLPFSLTFLLFSKAYIIKLLSNNHDSSVYYF  121

Query  414  SCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGALL  593
              L         T +CNSF +LSANA+ F L   A  + D  GFSS  F    S+S AL+
Sbjct  122  RILK--------TCICNSFFLLSANASAFALFFLASTILDSLGFSSRNFYTLFSLSSALI  173

Query  594  CSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEA  773
             SIILAN F I NLALV S   ++GG+T +LKAC+L+ GRT TAL+LALP N+ +A VEA
Sbjct  174  YSIILANAFVISNLALVSSPSSSSGGYTTLLKACLLLHGRTSTALALALPTNLGLAGVEA  233

Query  774  LFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSC---EGDCHIDQ  944
            LF+YR++R ++     ++ +A+EG LIAY+YA+ LVLDT+V  FF +SC   E +  I  
Sbjct  234  LFRYRVMRSFYKGDRDVAWIAIEGTLIAYLYALFLVLDTVVNFFFYQSCVENEEEQKIGG  293

Query  945  YRRLPSHVEIEEDNN  989
                   ++I E +N
Sbjct  294  DDEYSIKIQICESDN  308



>ref|XP_009415781.1| PREDICTED: uncharacterized protein LOC103996578 [Musa acuminata 
subsp. malaccensis]
Length=296

 Score =   206 bits (523),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 131/301 (44%), Positives = 187/301 (62%), Gaps = 9/301 (3%)
 Frame = +3

Query  54   MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFL-AMIHARIHT  230
            M  A KI R S   F   +  F +TA +L FPY+   L+ QS   SSP+L   I +R+  
Sbjct  1    MGEAIKILRTSFHAFFLSYHTFISTAALLVFPYSIVTLLSQSSSSSSPYLLPAISSRLWL  60

Query  231  LFDAAGFPSSSEFFTILNLKLSQTVAISFLA-LPFTLSFFLLSKACVIQALGDQELPKRS  407
            LF+A+GFPSS  FF +LN+KLSQ  A SF+A LP   +  +L+KA V Q +   +LP   
Sbjct  61   LFEASGFPSS-HFFALLNVKLSQA-AFSFVAALPLGATSLILAKASVFQTI-HGKLPS--  115

Query  408  LFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGA  587
              + L R++  L+LT LCNSFLVL+ANA    LL  AFN AD    +S    L +SV+G 
Sbjct  116  -LASLLRLYPSLVLTYLCNSFLVLAANAAVLSLLFLAFNAADVLDLASSSLTLAISVAGV  174

Query  588  LLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAV  767
            +L S++LA+    CN+A ++S  E TGG+  IL+A VL+ G+  TA++LALP ++  AA+
Sbjct  175  ILYSLVLAHALITCNMATIISAAENTGGYLCILEALVLVHGKMATAITLALPASLGAAAM  234

Query  768  EALFQYRIVRVYHHAKTGISSVA-LEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHIDQ  944
            EALF  R++R Y  +   +  +A LE + IAY Y++LLV DTI+ C F++SC+ +   D 
Sbjct  235  EALFHCRVIRPYSESGGKLQPLAILEAVSIAYSYSLLLVFDTIITCNFVKSCKSEEKDDV  294

Query  945  Y  947
            +
Sbjct  295  H  295



>ref|XP_008790099.1| PREDICTED: uncharacterized protein LOC103707406 [Phoenix dactylifera]
Length=319

 Score =   206 bits (524),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 143/305 (47%), Positives = 192/305 (63%), Gaps = 9/305 (3%)
 Frame = +3

Query  54   MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPY-AASVLVFQSFVPSSPFLAMIHARIHT  230
            M    +I RRS+  F Q +  F +TA +L FP  AA++L     + SSP L  I +R+  
Sbjct  1    MGKVIEITRRSIHAFFQSYHSFASTAALLVFPVSAATLLSHSLTLSSSPILRTISSRLRL  60

Query  231  LFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSL  410
            LF AAGFP++S+FF++LN +LSQ +      LPFTL F +L+KA VIQ +   E P+  L
Sbjct  61   LFVAAGFPATSQFFSLLNFRLSQAILTFISTLPFTLVFLILAKASVIQII--WEFPRCRL  118

Query  411  ----FSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSV  578
                FS L  ++  LLL+QL NS  +LS NA  F +LL AFN  D    SS    L LS 
Sbjct  119  APPPFSSLLHLYPSLLLSQLSNSLAILSVNAVIFSILLLAFNAVDILHLSSSNSMLLLSA  178

Query  579  SGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAM  758
            + A+L S++ AN    CNLA+V+S  E  GG+ +ILKA VLI+GRT TA++LALP ++ M
Sbjct  179  TSAILYSMVNANAMVACNLAIVISATENNGGYLSILKALVLIRGRTATAITLALPASLGM  238

Query  759  AAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE--GDC  932
            AAVEALFQ R++R YH +     SV  E  LI Y+Y++L+VLDTIV C FL+SC+  G  
Sbjct  239  AAVEALFQCRVMRPYHLSGKSNPSVIWEASLITYIYSLLVVLDTIVTCMFLKSCKMGGGS  298

Query  933  HIDQY  947
            H  +Y
Sbjct  299  HWHEY  303



>ref|NP_001144457.1| hypothetical protein [Zea mays]
 gb|ACG40666.1| hypothetical protein [Zea mays]
 tpg|DAA55165.1| TPA: hypothetical protein ZEAMMB73_011676 [Zea mays]
Length=341

 Score =   207 bits (526),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 133/322 (41%), Positives = 182/322 (57%), Gaps = 22/322 (7%)
 Frame = +3

Query  72   IFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTLFDAAGF  251
            + R +V  F   +  FT+ A +LA P++A+VL  ++  PSS  L  + AR+ ++F AAGF
Sbjct  23   VMRAAVSAFFAGYHRFTSVAALLALPFSAAVLASEAMAPSSWALRAVAARLRSVFAAAGF  82

Query  252  PSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQAL-----GDQELP----KR  404
            P S  FF +L  KLSQTV      LPF L+F LL+KACV   L        E P    +R
Sbjct  83   PPS-PFFALLEAKLSQTVFTFAATLPFALTFLLLAKACVAAMLRLRDDDASESPPPRRRR  141

Query  405  SLFSCLP------RIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFEL  566
               + LP      R +  ++ T L N+FL+LSANA  F LLL AF  AD  G +S  + L
Sbjct  142  VAVAALPPCAAVARAYPAVVATHLLNAFLMLSANAAVFSLLLLAFGAADLLGLTSHVWTL  201

Query  567  FLSVSGALLCSIILANTFTICNLALVLSGRE-ATGGFTAILKACVLIKGRTGTALSLALP  743
             LS +GA++ S+++     +CNLA+V++  E    G  A+L+ACV I+GR  TAL+LALP
Sbjct  202  ALSAAGAIVYSLVVGVATVVCNLAIVVAATEPGCAGHAAVLRACVAIRGRVSTALALALP  261

Query  744  INMAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
             N+ MAA EALF  R+V            VA E   IAY++AI +VL+ IV C F RSC+
Sbjct  262  TNLGMAAAEALFGLRVVAQRRRDGRLAPGVAGEAFSIAYIHAICVVLEIIVTCMFYRSCK  321

Query  924  GDCHIDQYRRLPSHVEIEEDNN  989
                 D+ R L    E EE  +
Sbjct  322  -RSEADELREL----EPEEKGD  338



>gb|EYU23500.1| hypothetical protein MIMGU_mgv1a011493mg [Erythranthe guttata]
Length=279

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 126/268 (47%), Positives = 173/268 (65%), Gaps = 19/268 (7%)
 Frame = +3

Query  84   SVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTLFDAAGFPSSS  263
            ++F FLQ +Q FT+T+ +LAFP+A S L+ Q  V SS    +IHAR+ +LF AAGFP SS
Sbjct  18   AIFTFLQNYQCFTSTSSLLAFPFAVSTLLSQMLVYSSDVFPVIHARLRSLFLAAGFPLSS  77

Query  264  EFFTILNLKLSQTVAISFLAL-PFTLSFFLLSKACVIQALGDQELPKRSLFSCLPRIHS-  437
            E F++LNLKLSQT+ +SFL + PFT SF LL+KA VI+   DQ  P+ +     PR+ S 
Sbjct  78   ELFSLLNLKLSQTI-LSFLFVSPFTYSFLLLAKASVIKTF-DQNKPEEN-----PRVSSS  130

Query  438  -----PLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGALLCSI  602
                 PLL+TQLCNS L+L+ANATCF +L+  FN     G SSP   + +S  G ++ SI
Sbjct  131  ISLFIPLLITQLCNSLLILAANATCFFILVIFFNFLYVLGISSPGPTMLVSALGVVIYSI  190

Query  603  ILANTFTICNLALVLSGREATGGFTAILKACVLI--KGRTGTALSLALPI---NMAMAAV  767
            +LAN + + NLALV +G E  GGF +ILKACV+I  +GR  TALSLA+PI   +  +   
Sbjct  191  VLANAYIVSNLALVSTGMEKRGGFISILKACVMILLQGRNATALSLAVPICTKDQRIIDE  250

Query  768  EALFQYRIVRVYHHAKTGISSVALEGML  851
            E +  Y+I       K    S++L+ ++
Sbjct  251  EEMHSYKIEIEDRDGKFLAKSMSLDEII  278



>ref|XP_009405888.1| PREDICTED: uncharacterized protein LOC103988924 [Musa acuminata 
subsp. malaccensis]
Length=313

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 138/317 (44%), Positives = 190/317 (60%), Gaps = 7/317 (2%)
 Frame = +3

Query  54   MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVP-SSPFLAMIHARIHT  230
            M  A KI RRS+  F + +Q F   A +L FP +A+ L+ QS    SSP L  I +R+  
Sbjct  1    MAKAMKIVRRSLHAFSRSYQAFAAVAALLVFPASAATLLAQSLPSLSSPILRSISSRLAF  60

Query  231  LFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSL  410
            LF+AAGFP S +FF++LN KLSQ++      LPF L+F LL+KA V++      + +R  
Sbjct  61   LFEAAGFPPS-QFFSLLNSKLSQSIFTFVSTLPFALTFSLLAKASVLRT--TYGIRRRGA  117

Query  411  FSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGAL  590
             S L R++  L LT L NS+LVLSANA    LL  AFN+ D    SS    L LS SG +
Sbjct  118  ASLL-RLYPSLALTHLFNSWLVLSANAAVLSLLFLAFNVLDALHLSSSGSVLVLSASGVI  176

Query  591  LCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVE  770
            L S +LAN    CNL++V+S  +  GG+ +ILK  VL++GRT TA++L LP ++ MAA+E
Sbjct  177  LYSFVLANAVATCNLSVVISAIDGRGGYHSILKTLVLLRGRTATAITLTLPASLGMAAIE  236

Query  771  ALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHIDQYR  950
            ALFQYR+VR Y        S   E   I Y++++L+VLDTI+ C FLRSC       ++ 
Sbjct  237  ALFQYRVVRPYRLTARFHPSAIWEAFSIGYVHSLLVVLDTIMACVFLRSCRSTVW-SRWS  295

Query  951  RLPSHVEI-EEDNNAFR  998
                 V++  E+  A R
Sbjct  296  NYDHDVDVASEEKIALR  312



>ref|XP_002442380.1| hypothetical protein SORBIDRAFT_08g019150 [Sorghum bicolor]
 gb|EES16218.1| hypothetical protein SORBIDRAFT_08g019150 [Sorghum bicolor]
Length=341

 Score =   202 bits (515),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 133/324 (41%), Positives = 180/324 (56%), Gaps = 25/324 (8%)
 Frame = +3

Query  69   KIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTLFDAAG  248
            K+ R +V  F   +  FT+ A +LA P++A+VL  ++  PSS  L  + AR+  +F AAG
Sbjct  23   KVMRAAVSAFFAGYHCFTSVAALLALPFSAAVLASEAMAPSSGILRGVAARLRAVFAAAG  82

Query  249  FPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQ-------------  389
            FP S  FF +L  KLSQTV      LPF L+F LL+KACV   L D              
Sbjct  83   FPPS-PFFALLEAKLSQTVFTFAATLPFALTFLLLAKACVAAMLRDDVDDGHRRRRRLAV  141

Query  390  ELPKRSLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELF  569
             + K      + R +  ++ T L N+FL+LSANA  F LLL AF  AD  G +S  + L 
Sbjct  142  AVAKLPPCGAVARAYPAVVATHLLNAFLMLSANAAVFSLLLLAFGAADLLGLTSHFWTLA  201

Query  570  LSVSGALLCSIILANTFTICNLALVLSGRE-ATGGFTAILKACVLIKGRTGTALSLALPI  746
            LS +GA++ S+ +     +CNLA+V++  E    G  A+L+ACV I+GR  TAL+LALP 
Sbjct  202  LSAAGAIVYSLAVGVATVVCNLAVVVAATEPGCAGHAAVLRACVAIRGRVSTALALALPT  261

Query  747  NMAMAAVEALFQYRIVRVYHHAKTG---ISSVALEGMLIAYMYAILLVLDTIVVCFFLRS  917
            N+ MAA EALF  R+  V    K G      VA E   IAY++AI +VL+ IV C F RS
Sbjct  262  NLGMAAAEALFGLRV--VAQRRKDGGRLAPGVAGEAFSIAYIHAICVVLEIIVSCMFYRS  319

Query  918  CEGDCHIDQYRRLPSHVEIEEDNN  989
            C+     D+ R L    E EE  +
Sbjct  320  CK-RSEADELREL----EPEEKGD  338



>ref|XP_010546430.1| PREDICTED: uncharacterized protein LOC104818514 [Tarenaya hassleriana]
Length=291

 Score =   196 bits (498),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 137/304 (45%), Positives = 175/304 (58%), Gaps = 24/304 (8%)
 Frame = +3

Query  129   AVVLAFPYAASVLVFQSFVPS--SPFLAMIHARIHTLFDAAGFPSSSEFFTILNLKLSQT  302
             A V A P+AA+ L+ Q F PS  SP    +      +F               N+KLSQT
Sbjct  7     AAVFALPFAAAFLLSQPFSPSVLSPPDTWLRRTPPVVF---------------NIKLSQT  51

Query  303   VAISFLALPFTLSFFLLSKACVIQALGDQELPKRSLFSCLPRIHSPLLLTQLCNSFLVLS  482
             ++ S L  PF++SF L SKA VI+ L    L    L S    ++  LL T +CNSFL+LS
Sbjct  52    ISSSLLTYPFSISFLLFSKAYVIRLL----LLADKLSSSFSVLYFRLLRTYICNSFLILS  107

Query  483   ANATCFILLLFAFNLADEFGFSSPRFELFLSVSGALLCSIILANTFTICNLALVLSGREA  662
              NA+ F L  FA NL   FGFSS  F  FLSVS A++  +ILAN   I NLAL LS  E 
Sbjct  108   VNASGFALFFFACNLLQAFGFSSEIFLAFLSVSAAVIFFVILANALVISNLALALSAAET  167

Query  663   TGGFTA-ILKACVLIKGRTGTALSLALPINMAMAAVEALFQYRIVRVYHHAKTGISSVAL  839
             +   +  ILKACVLI+GR  TALSL+LP N+ +A VEALFQ RIV+ Y      I+S+ L
Sbjct  168   SSSSSMAILKACVLIRGRNSTALSLSLPTNLGLAGVEALFQCRIVKSYLSGDRDIASLVL  227

Query  840   EGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHIDQYRRLPSHVEIEEDNNAFRTV--KIV  1013
             EGMLIAY+YAI +VLDT+    F +SC+ D   D      S +EI E   A   V  K +
Sbjct  228   EGMLIAYLYAIFVVLDTVANFLFYQSCKNDQRTDPEEGFSSMIEIRETETAKCVVWSKGI  287

Query  1014  EDLP  1025
             +++P
Sbjct  288   KNVP  291



>ref|XP_004962983.1| PREDICTED: uncharacterized protein LOC101755659 [Setaria italica]
Length=340

 Score =   195 bits (495),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 138/331 (42%), Positives = 188/331 (57%), Gaps = 23/331 (7%)
 Frame = +3

Query  42   SAAGMESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHAR  221
            +AAG   A ++ R +V  F   +  FT+ A +LA P++A+VL  ++  PSS  L    AR
Sbjct  15   TAAG--RATRVMRAAVSAFFGGYHCFTSVAALLALPFSAAVLASEAAAPSSATLRGTAAR  72

Query  222  IHTLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQE---  392
            + ++F AAGFP S  FF +L  KLSQTV      LPF L+F LL+KACV   L D++   
Sbjct  73   LRSVFAAAGFPPS-PFFALLEAKLSQTVFTFAATLPFALTFLLLAKACVAAMLRDRDDGG  131

Query  393  -----LPKRSLFSCLP------RIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEF  539
                   +R L S LP      R +  +  T L N+FL+LSANA  F LLL AF  AD  
Sbjct  132  VAPPRRQQRKLASALPPCGAVVRAYPAVAATHLLNAFLMLSANAAVFSLLLLAFGAADLL  191

Query  540  GFSSPRFELFLSVSGALLCSIILANTFTICNLALVLSGRE-ATGGFTAILKACVLIKGRT  716
            G +S  + L LS +GA++ S+ +     +CNLA++++  E    G  A+L+ACV I+GR 
Sbjct  192  GLTSHFWTLALSAAGAIVYSLAIGVATVVCNLAVIVAATEPGCAGHAAVLRACVAIRGRV  251

Query  717  GTALSLALPINMAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIV  896
             TAL+LALP N+ MAA EALF  R+V     A      VA E   IAY++AI +VL+ IV
Sbjct  252  STALALALPTNLGMAAAEALFGLRVVAQRRSAGRLAPGVAGEAFSIAYIHAICVVLEIIV  311

Query  897  VCFFLRSCEGDCHIDQYRRLPSHVEIEEDNN  989
             C F RSC+     D+ R L    E EE  +
Sbjct  312  SCMFYRSCK-RSEADELREL----EPEEKGD  337



>gb|EYU35794.1| hypothetical protein MIMGU_mgv1a019183mg [Erythranthe guttata]
Length=313

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 145/307 (47%), Positives = 195/307 (64%), Gaps = 25/307 (8%)
 Frame = +3

Query  78   RRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTLFDAAGFPS  257
            RRS+F FLQ F  FT    +L  PYAA+ L+    + SS    +IH R  ++F AAGFP 
Sbjct  2    RRSIFTFLQNFHRFTAAPSLLLLPYAAATLLSHPLLSSSYIFPIIHGRFTSIFLAAGFPP  61

Query  258  SSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSLFSCLPRIHS  437
            SS+ F+ILNLKLSQT+  S    PFTLSF LLSK+ VI +L  Q+    +  + +  I +
Sbjct  62   SSQLFSILNLKLSQTLLSSIFVSPFTLSFLLLSKSSVITSL--QKFNSNNYSNKIITIFN  119

Query  438  PLLLTQLCNSFLVLSANATCFILLLFAFNLAD-EFGFSS-PRFELFLSVSGALLCSIILA  611
             L +TQ+CNS ++LSANATCF LL+ AFN++D   G SS PRF L  S  GA++ S++LA
Sbjct  120  RLFVTQICNSLVILSANATCFSLLVIAFNVSDLILGLSSHPRFVLLTSAIGAVVYSVVLA  179

Query  612  NTFTICNLALVLSG----------REATGGFTAILKACVLI---KGRTGTALSLALPINM  752
            N   +CNL+L+LSG          ++   GF++I+ ACV++    G  G ALSLA+ +NM
Sbjct  180  NACVVCNLSLILSGLLEKNNNNKKKKNCCGFSSIVDACVVLMRGGGGGGVALSLAVAMNM  239

Query  753  AMAAVEALFQYRIVRVYHHAKTGISS--------VALEGMLIAYMYAILLVLDTIVVCFF  908
             MAA+EALFQYR+VR Y++   G           V LE ++IAYMY +++VLDTIV   F
Sbjct  240  GMAAIEALFQYRVVRAYYYYYRGDGGDVAALDWPVVLEAVVIAYMYGVVVVLDTIVGFVF  299

Query  909  LRSCEGD  929
            L SCE D
Sbjct  300  LESCELD  306



>ref|XP_009130173.1| PREDICTED: uncharacterized protein LOC103854959 [Brassica rapa]
Length=355

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 146/311 (47%), Positives = 197/311 (63%), Gaps = 17/311 (5%)
 Frame = +3

Query  54   MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTL  233
            ME ++KI RRS+  FLQ +    TTA  +A P++AS+L+ Q+F  SS   +  H R++TL
Sbjct  38   MEDSSKIMRRSIHTFLQNYHH-ATTAAAIALPFSASLLISQAFFSSSS-SSSFHLRLNTL  95

Query  234  FDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSLF  413
            F  AGF SS  FF +L+LKLSQT++ S L L F+L+F L SKA VI+ L +         
Sbjct  96   FHGAGFTSSLYFFNMLSLKLSQTLSSSLLTLLFSLTFLLFSKAYVIKLLSNNHDS-----  150

Query  414  SCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGALL  593
             C    + PLL T +CNS  +LSANA+ F L  F       FGF S  F    S++ A++
Sbjct  151  FCY---YLPLLRTYVCNSLFLLSANASAFALCFFI----ASFGFYSRSFYTLFSLASAII  203

Query  594  CSIILANTFTICNLALVLSGREAT-GGFTA-ILKACVLIKGRTGTALSLALPINMAMAAV  767
             SIILAN + I NLALV S    + GG+T  +LKAC+LI+GR  TAL+LALP N+ +A V
Sbjct  204  YSIILANAYVITNLALVSSTSSPSSGGYTTTLLKACLLIRGRASTALALALPTNLGLAGV  263

Query  768  EALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSC-EGDCHIDQ  944
            EALFQYR+ R Y+    GI+S+A+EGMLIAY+YA+ LVLDTIV   F +SC + D    +
Sbjct  264  EALFQYRVGRSYYKEDRGITSIAVEGMLIAYLYALFLVLDTIVSFLFYQSCLKNDEDQKK  323

Query  945  YRRLPSHVEIE  977
             R     ++I+
Sbjct  324  GREDEYTIKIQ  334



>gb|EAY83630.1| hypothetical protein OsI_38858 [Oryza sativa Indica Group]
Length=351

 Score =   170 bits (431),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 134/335 (40%), Positives = 182/335 (54%), Gaps = 32/335 (10%)
 Frame = +3

Query  63   AAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFV-PSSPFLAMIHARIHTLFD  239
            A ++ R +V  F   +  +T+ A +L  P++A+VL   +   PSS  LA + ARI  +FD
Sbjct  20   AGRVMRAAVAAFFHGYHCYTSVAGLLVLPFSAAVLASGAMASPSSGALAAVSARIRRMFD  79

Query  240  AAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQAL---GDQELPKR--  404
            AAGFP SS FF +LN KLSQTV     ALPFTL+F LL+KACV   L    D E   R  
Sbjct  80   AAGFPPSS-FFALLNAKLSQTVFTFAAALPFTLTFLLLAKACVAAMLRPDDDGEGVARRG  138

Query  405  ---SLFSCLPRIHS------PLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPR  557
               +  + LP   S       ++ T L  +F++LSANA  F L+  AFN AD  G ++  
Sbjct  139  RGVARATRLPPCGSVAGAYPAMVATHLFGAFVMLSANAAVFSLMFLAFNGADLLGLTTTS  198

Query  558  FELFLSVSGA---LLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTAL  728
                     A   +  S+ +     +CNLA+V+S  E   G  A+L+ACV+I+GR  TAL
Sbjct  199  HAAATLALSAAGAIAYSVAVGIATVVCNLAVVVSAMERRAGHAAVLRACVVIRGRVPTAL  258

Query  729  SLALPINMAMAAVEALFQYRIV-RVYHHAKTG-------ISSVALEGMLIAYMYAILLVL  884
            +LALP N+ MAA EALFQ R+V +   H   G        + VA E   IAY++A+ +VL
Sbjct  259  ALALPTNLGMAAAEALFQLRVVSQAQRHRLAGAGDGKRLAAGVAGEAFSIAYIHALCVVL  318

Query  885  DTIVVCFFLRSCEGDCHIDQYRRLPSHVEIEEDNN  989
            + IV C F RSC      D+ R L    E EE  +
Sbjct  319  EIIVSCMFYRSCR-RSEADELREL----EPEEKGD  348



>gb|EEE53483.1| hypothetical protein OsJ_36632 [Oryza sativa Japonica Group]
Length=330

 Score =   169 bits (429),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 120/321 (37%), Positives = 167/321 (52%), Gaps = 25/321 (8%)
 Frame = +3

Query  63   AAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFV-PSSPFLAMIHARIHTLFD  239
            A ++ R +V  F   +  +T+ A +L  P++A+VL   +   PSS  LA + ARI  +FD
Sbjct  20   AGRVMRAAVAAFFHGYHCYTSVAGLLVLPFSAAVLASGAMASPSSGALAAVSARIRRMFD  79

Query  240  AAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSLFSC  419
            AAGFP SS FF + N KLSQTV     ALPFTL+      A   +  GD     R L   
Sbjct  80   AAGFPPSS-FFALFNAKLSQTVFTFAAALPFTLT---RGAARARRGEGDAAPAVRDLGGR  135

Query  420  LPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGA---L  590
            +P       + ++ ++     ANA  F L+  AFN AD  G ++           A   +
Sbjct  136  VPGDGGDAPVRRVRDAV----ANAAVFSLMFLAFNGADLLGLTTTSHAAATLALSAAGAI  191

Query  591  LCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVE  770
              S+ +     +CNLA+V+S  E   G  A+L+ACV+I+GR  TAL+LALP N+ MAA E
Sbjct  192  AYSVAVGIATVVCNLAVVVSAMERRAGHAAVLRACVVIRGRVPTALALALPTNLGMAAAE  251

Query  771  ALFQYRIV-RVYHHAKTG-------ISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEG  926
            ALFQ R+V +   H   G        + VA E   IAY++A+ +VL+ IV C F RSC  
Sbjct  252  ALFQLRVVSQAQRHRLAGAGDGKRLAAGVAGEAFSIAYIHALCVVLEIIVSCMFYRSCR-  310

Query  927  DCHIDQYRRLPSHVEIEEDNN  989
                D+ R L    E EE  +
Sbjct  311  RSEADELREL----EPEEKGD  327



>ref|XP_002530020.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32382.1| conserved hypothetical protein [Ricinus communis]
Length=285

 Score =   168 bits (426),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 107/290 (37%), Positives = 162/290 (56%), Gaps = 30/290 (10%)
 Frame = +3

Query  54   MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTL  233
            ME  AKI RRS++  L+ F +FT   V+L  P++ S+L+F+S      FL     R+   
Sbjct  1    MEKPAKIIRRSIYTLLKDFHYFTNNPVILLLPFSVSLLLFRSTSSHQSFLV---PRLR--  55

Query  234  FDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSLF  413
                           L+    Q +     +LPF LS  +++KA +IQ L  +        
Sbjct  56   --------------FLDFNPCQLILSYVFSLPFALSSLIIAKASIIQYLDHK--------  93

Query  414  SCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFA-FNLADEFGFSSPRFELFLSVSGAL  590
            + +  ++ PLLLT LC   L +  +   ++LLL A ++    FG SS    +F+   G +
Sbjct  94   TTISSLYRPLLLTYLCGILLTIIISIAAYVLLLVASYSAEGIFGLSSKN-HVFVMALGVV  152

Query  591  LCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVE  770
               ++L NT  ICNL+LV++G +    + AI KAC+L K     AL LA PIN+ +AA+E
Sbjct  153  F-YMVLTNTMIICNLSLVVAGMDNCNSYKAIQKACLLRKCTNSIALLLAFPINLGLAAIE  211

Query  771  ALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSC  920
            +LFQ+RIVR YH       S+ +EG+LIAYM+++L+VLDTI+ CFF++SC
Sbjct  212  SLFQHRIVRAYHLFGRIDVSMIVEGLLIAYMFSLLIVLDTIICCFFIKSC  261



>ref|NP_001067114.1| Os12g0577200 [Oryza sativa Japonica Group]
 gb|ABA99058.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF30133.1| Os12g0577200 [Oryza sativa Japonica Group]
Length=351

 Score =   168 bits (426),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 133/335 (40%), Positives = 181/335 (54%), Gaps = 32/335 (10%)
 Frame = +3

Query  63   AAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFV-PSSPFLAMIHARIHTLFD  239
            A ++ R +V  F   +  +T+ A +L  P++A+VL   +   PSS  LA + ARI  +FD
Sbjct  20   AGRVMRAAVAAFFHGYHCYTSVAGLLVLPFSAAVLASGAMASPSSGALAAVSARIRRMFD  79

Query  240  AAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQAL---GDQELPKR--  404
            AAGFP SS FF + N KLSQTV     ALPFTL+F LL+KACV   L    D E   R  
Sbjct  80   AAGFPPSS-FFALFNAKLSQTVFTFAAALPFTLTFLLLAKACVAAMLRPDDDGEGVARRG  138

Query  405  ---SLFSCLPRIHS------PLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPR  557
               +  + LP   S       ++ T L  +F++LSANA  F L+  AFN AD  G ++  
Sbjct  139  RGVARATRLPPCGSVAGAYPAMVATHLFGAFVMLSANAAVFSLMFLAFNGADLLGLTTTS  198

Query  558  FELFLSVSGA---LLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTAL  728
                     A   +  S+ +     +CNLA+V+S  E   G  A+L+ACV+I+GR  TAL
Sbjct  199  HAAATLALSAAGAIAYSVAVGIATVVCNLAVVVSAMERRAGHAAVLRACVVIRGRVPTAL  258

Query  729  SLALPINMAMAAVEALFQYRIV-RVYHHAKTG-------ISSVALEGMLIAYMYAILLVL  884
            +LALP N+ MAA EALFQ R+V +   H   G        + VA E   IAY++A+ +VL
Sbjct  259  ALALPTNLGMAAAEALFQLRVVSQAQRHRLAGAGDGKRLAAGVAGEAFSIAYIHALCVVL  318

Query  885  DTIVVCFFLRSCEGDCHIDQYRRLPSHVEIEEDNN  989
            + IV C F RSC      D+ R L    E EE  +
Sbjct  319  EIIVSCMFYRSCR-RSEADELREL----EPEEKGD  348



>emb|CDY42877.1| BnaAnng07020D [Brassica napus]
Length=1355

 Score =   171 bits (432),  Expect = 3e-42, Method: Composition-based stats.
 Identities = 138/291 (47%), Positives = 187/291 (64%), Gaps = 16/291 (5%)
 Frame = +3

Query  54   MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTL  233
            ME ++KI RRS+  FLQ +    TTA  +A P++A++L+ Q+F  SS   +  H R++TL
Sbjct  38   MEDSSKIMRRSIHTFLQNYHH-ATTAAAIALPFSAALLLSQAFFSSSS-SSSFHLRLNTL  95

Query  234  FDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSLF  413
            F  AGF SS  FF +L+LKLSQT++ S L L F+L+F L SKA VI+ L +        F
Sbjct  96   FHGAGFTSSLYFFNMLSLKLSQTLSSSLLTLLFSLTFLLFSKAYVIKLLSNNH----DSF  151

Query  414  SCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGALL  593
                  + PLL T +CNS  +LSANA+ F +  F  +    FG SS  F    S+  A++
Sbjct  152  C----YYLPLLRTYVCNSLFLLSANASAFAMCFFIAS----FGLSSRSFYTLFSLVSAII  203

Query  594  CSIILANTFTICNLALVLSGREATGGFTA--ILKACVLIKGRTGTALSLALPINMAMAAV  767
             SII+AN + I NLALV S   ++ G     +LKAC+LI+GR  TAL+LALP N+ +A V
Sbjct  204  YSIIIANAYVITNLALVSSTSSSSSGGYTTTLLKACLLIRGRASTALALALPTNLGLAGV  263

Query  768  EALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSC  920
            EALFQYR+ R Y+    GI+S+A+EGMLIAY+YA+ LVLDTIV   F +SC
Sbjct  264  EALFQYRVGRSYYKEDRGITSIAVEGMLIAYLYALFLVLDTIVSFLFYQSC  314



>ref|NP_001142588.1| uncharacterized protein LOC100274853 [Zea mays]
 gb|ACG25306.1| hypothetical protein [Zea mays]
Length=340

 Score =   160 bits (405),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 125/324 (39%), Positives = 173/324 (53%), Gaps = 24/324 (7%)
 Frame = +3

Query  72   IFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHT----LFD  239
            + R +   F   +  FT+ A +LA P++A+VLV ++   +     +    +      +F 
Sbjct  20   VMRAAASAFFAGYHCFTSVAALLALPFSAAVLVAEAAAAAPAPAPVALRALAARLRAVFA  79

Query  240  AAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQEL-PKRSLFS  416
            AAGFP S  FF +L  KLSQTV     ALPF L+F LL+KACV   L D    P+R    
Sbjct  80   AAGFPPS-PFFALLEAKLSQTVFTFAAALPFALTFLLLAKACVAAMLRDDAASPRRHRRR  138

Query  417  CLP------------RIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRF  560
              P            R +  +L T +  +FL+LSANA  F LLL AF  AD  G +S  +
Sbjct  139  MWPGVAALPACGAVARAYPAVLATHVLGAFLMLSANAAAFSLLLLAFGAADLLGLTSRAW  198

Query  561  ELFLSVSGALLCSIILANTFTICNLALVLSGRE-ATGGFTAILKACVLIKGRTGTALSLA  737
             L LS +GA+  S+ +     +CNLA+V++  E    G  A+L+ACV I+GR  TAL+LA
Sbjct  199  TLALSAAGAVAYSLAVGVAAVVCNLAVVVAATEPGCAGHAAVLRACVAIRGRVSTALALA  258

Query  738  LPINMAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRS  917
            LP N+ MAA EALF  R+V           +VA E   IAY++A+ +VL+ IV C F RS
Sbjct  259  LPTNLGMAAAEALFGLRVVAQRRKDGRLAPAVAAEAFSIAYIHAVCVVLEIIVACVFYRS  318

Query  918  CEGDCHIDQYRRLPSHVEIEEDNN  989
            C+     D+ R L    E EE  +
Sbjct  319  CK-RSEADELREL----EPEEKGD  337



>tpg|DAA47177.1| TPA: hypothetical protein ZEAMMB73_688937 [Zea mays]
Length=340

 Score =   157 bits (397),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 125/324 (39%), Positives = 173/324 (53%), Gaps = 24/324 (7%)
 Frame = +3

Query  72   IFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHT----LFD  239
            + R +   F   +  FT+ A +LA P++A+VLV ++   +     +    +      +F 
Sbjct  20   VMRAAASAFFAGYHCFTSVAALLALPFSAAVLVAEAAAAAPAPAPVALRALAARLRAVFA  79

Query  240  AAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQEL-PKRSLFS  416
            AAGFP S  FF +L  KLSQTV     ALPF L+F LL+KACV   L D    P+R    
Sbjct  80   AAGFPPS-PFFALLEAKLSQTVFTFAAALPFALTFLLLAKACVAAMLRDDAASPRRHRRR  138

Query  417  CLP------------RIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRF  560
              P            R +  +L T +  +FL+LSANA  F LLL AF  AD  G +S  +
Sbjct  139  RWPGVAALPACGAVARAYPAVLATHVLGAFLMLSANAAAFSLLLLAFGAADLLGLTSRAW  198

Query  561  ELFLSVSGALLCSIILANTFTICNLALVLSGRE-ATGGFTAILKACVLIKGRTGTALSLA  737
             L LS +GA+  S+ +     +CNLA+V++  E    G  A+L+ACV I+GR  TAL+LA
Sbjct  199  TLALSAAGAVAYSLAVGVAAVVCNLAVVVAATEPGCAGHAAVLRACVAIRGRVSTALALA  258

Query  738  LPINMAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRS  917
            LP N+ MAA EALF  R+V           +VA E   IAY++A+ +VL+ IV C F RS
Sbjct  259  LPTNLGMAAAEALFGLRVVAQRRRDGRLAPAVAAEAFSIAYIHAVCVVLEIIVACVFYRS  318

Query  918  CEGDCHIDQYRRLPSHVEIEEDNN  989
            C+     D+ R L    E EE  +
Sbjct  319  CK-RSEADELREL----EPEEKGD  337



>ref|XP_010089561.1| hypothetical protein L484_020951 [Morus notabilis]
 gb|EXB38032.1| hypothetical protein L484_020951 [Morus notabilis]
Length=291

 Score =   148 bits (373),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 114/318 (36%), Positives = 165/318 (52%), Gaps = 32/318 (10%)
 Frame = +3

Query  30   MQEFSAAGMESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAM  209
            ++EF +  ME   KI R+SV  FL+ F +FTTT V+L  P+++SVL+ Q    SS     
Sbjct  2    VEEFPSDPMERTEKIMRKSVSTFLKHFHYFTTTPVLLVLPFSSSVLISQPLFSSSASSKF  61

Query  210  IHARIHTLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVI--QALG  383
                 H  F  + F S S F                  +PF LS  L++KA VI    L 
Sbjct  62   SLFLSHDHFSRS-FISPSIF-----------------VIPFALSSLLIAKASVINRHKLA  103

Query  384  DQELPKRSLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFE  563
              +    S  S    ++ PLLLT L N  L +S + T   LLL   +    FGF +    
Sbjct  104  SSQATSLSFLS----LYRPLLLTHLLNIILCISIHITSTFLLLIIIHSLGSFGFFT---A  156

Query  564  LFLSVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALS-LAL  740
            +F +V G  L + +  N   +CNLALV++G E   G  AI +A +L KG+   AL   A 
Sbjct  157  IFRTVCGIFLYAFV-TNIILLCNLALVVAGMENCSGCKAIYRAYLLRKGKNSMALIFWAF  215

Query  741  PINMAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSC  920
              N+ +A+VEALF +R+VR +        S+ALEG+LIAY+Y+I++VLDTI  CFF++S 
Sbjct  216  LTNLGLASVEALFCFRLVRPHQRPSL---SIALEGLLIAYLYSIIIVLDTIACCFFIKSR  272

Query  921  EGDCHIDQYRRLPSHVEI  974
              D   +    + + +E+
Sbjct  273  TPDSSTENGNGIYNQIEL  290



>gb|EPS68484.1| hypothetical protein M569_06284 [Genlisea aurea]
Length=311

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 103/291 (35%), Positives = 156/291 (54%), Gaps = 25/291 (9%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTLFD  239
            S  KI R+S+F FL+    F+++  +LA PY+A+VL+F   V              +   
Sbjct  6    STTKIMRKSIFLFLRNIHLFSSSPALLAVPYSAAVLLFPPLV-----------SSSSSSS  54

Query  240  AAGFPSSSEFFTILNLKLSQTVAI----SFLALPFTLSFFLLSKACVIQALGDQELPKRS  407
            AA FP+       L+  L++ +A+    S  A P  +S  LL+K   +  L D++   RS
Sbjct  55   AAVFPALRNRLDALSPPLARVLAVALVSSLFAFPLAISSLLLAKTRAVGVLKDED--GRS  112

Query  408  LFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGA  587
            L   LP     L+  QLC S L    +A C   L    +L D+ GFSS    + ++  GA
Sbjct  113  L--PLPV----LVAAQLCGSSLRWGVDAACLCALFVGSDLMDDLGFSSRGMRIPIAGVGA  166

Query  588  LLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAV  767
            +L SI+++N   + NL+ ++      G   +IL AC +  G  G A+ LA+P+N+ +A V
Sbjct  167  VLYSILMSNACIVSNLSAIVCMCSEGGVLRSILGACRVGIG-GGAAIRLAMPMNVGLAGV  225

Query  768  EALFQYRIVRVY-HHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRS  917
            EALF+YR+VR Y     T   S+ +EGM IAY+Y++LLVLDT+V    L+S
Sbjct  226  EALFRYRVVRGYGERGGTADCSLVVEGMFIAYLYSLLLVLDTVVGFVLLKS  276



>ref|XP_006844836.1| hypothetical protein AMTR_s00058p00078540 [Amborella trichopoda]
 gb|ERN06511.1| hypothetical protein AMTR_s00058p00078540 [Amborella trichopoda]
Length=336

 Score =   146 bits (368),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 128/324 (40%), Positives = 188/324 (58%), Gaps = 14/324 (4%)
 Frame = +3

Query  69    KIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTLFDAAG  248
             ++ RRSV+ FLQ +      A +LA P +AS+L+  +   S   L  I +RI +L  A G
Sbjct  16    RVMRRSVYTFLQNYSSIACVAAILALPASASILLSNTL--SFSILPAILSRIRSLSLATG  73

Query  249   FPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSLFSCLPR  428
              P +    +++ LKLSQT++ S L+LPF+LSF LL+KA + +      + KRS  S L  
Sbjct  74    LPET-RLASLIQLKLSQTLSSSLLSLPFSLSFLLLAKAYLFRT--TFSVSKRSTSSLLS-  129

Query  429   IHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSS--PRFELFLSVSGALLCSI  602
             I + LL+T L  S  +L+ NAT F LL  +    D   FSS  P    FLSV+ A+L SI
Sbjct  130   IWTRLLITHLSTSLFILTVNATLFSLLSISILSLDILDFSSLPPNCSHFLSVAAAILYSI  189

Query  603   ILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEALFQ  782
             IL NT  +CNLA V+SG E    F AILKA +LI+GRT TAL + L  N+++A VEALFQ
Sbjct  190   ILTNTIVVCNLATVVSGLENFSAFLAILKAYILIQGRTATALLITLCTNLSLAGVEALFQ  249

Query  783   YRIVRVYHHAKTGIS-----SVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHIDQY  947
             YR+V   ++           +   EG L+ Y+Y+I+ +LD ++ C F +SC+     +  
Sbjct  250   YRVVGASYYFSASSYYYFEMNALWEGPLLIYIYSIITMLDLVMWCVFYKSCKSISLSENQ  309

Query  948   RRLPSHVEIEEDNNAFRTVKIVED  1019
             R     + I +D++  R+ K++E+
Sbjct  310   RIYQFQMRILDDDDGARS-KLLEE  332



>ref|XP_009790718.1| PREDICTED: uncharacterized protein LOC104238132 [Nicotiana sylvestris]
Length=178

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +3

Query  624  ICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEALFQYRIVRVY  803
            I NLA++LSG E  GG+ AILKAC LI+GRT T+LSLAL +N+A+AAVE LFQYRIVR Y
Sbjct  54   ISNLAIILSGMEKIGGYMAILKACFLIRGRTATSLSLALIVNLALAAVEVLFQYRIVRAY  113

Query  804  HHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
            HH +T +SS+ALEG+ IA++Y+ILLVLDTI  C FL+S  
Sbjct  114  HHKRTRLSSIALEGIFIAHLYSILLVLDTISSCVFLKSVR  153



>ref|XP_002305952.2| hypothetical protein POPTR_0004s10270g [Populus trichocarpa]
 gb|EEE86463.2| hypothetical protein POPTR_0004s10270g [Populus trichocarpa]
Length=296

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 107/299 (36%), Positives = 163/299 (55%), Gaps = 31/299 (10%)
 Frame = +3

Query  54   MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFV-PSSPFLAMIHARIHT  230
            ME AAKI RRS+   L+ F +FT+   +L  P+++S+L+  SF  P S   ++   R  +
Sbjct  1    MEKAAKIIRRSIHTLLKDFHYFTSIPTILLLPFSSSILLSLSFYQPCSLTRSIFQGRRVS  60

Query  231  LFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSL  410
            L               L L L Q + +   +LP  LS  +L+KA +IQ+L   + P  SL
Sbjct  61   L---------------LVLDLPQMIFVLVFSLPLALSSLVLAKASIIQSLNHHK-PVFSL  104

Query  411  FSCLPRI---HSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFG----FSSPRFELF  569
             SC   +   + PL+LT +CN  L ++   T    L F F  +  F      SS R   F
Sbjct  105  -SCSSPVSLCYKPLVLTCICNIILTVTITTT---TLSFLFEASSFFKGLLILSSIR--PF  158

Query  570  LSVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPIN  749
              ++  ++  ++L NT   CNLALV++G +    + ++ KAC+L KG    AL LALPIN
Sbjct  159  FDLAAGIVFYMVLTNTMATCNLALVVAGIDNCTIYKSLRKACLLRKGTDSMALLLALPIN  218

Query  750  MAMAAVEALFQYRIVRVYHHAKTGIS-SVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
            + + A EALF+YR+VR Y       S  + LEG+LI+Y++++L+VLDTI    F+R+ +
Sbjct  219  LGLVATEALFRYRVVRAYDPVFGRFSMPMLLEGLLISYLFSLLVVLDTISSYLFIRNLQ  277



>ref|XP_008648555.1| PREDICTED: uncharacterized protein LOC103629156 [Zea mays]
 gb|AFW74683.1| hypothetical protein ZEAMMB73_719723 [Zea mays]
Length=346

 Score =   114 bits (284),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 100/264 (38%), Positives = 137/264 (52%), Gaps = 34/264 (13%)
 Frame = +3

Query  240  AAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSLFSC  419
            AAGFP +S+   +L+ +LSQ    S  A PF LSF LL+KAC +    D   P      C
Sbjct  63   AAGFPPASQLLFLLSHRLSQRACASLAAAPFALSFLLLAKACAVHRCCDCSPPPPHATQC  122

Query  420  LPRIHSPLLLTQLCNS-------------FLVLSANATCFILLLFAFNLADEFGF-----  545
              R +      QL  S               +L ANA  F  LL AFN A+         
Sbjct  123  CRRRNESGTFAQLLRSSYPAMACTQLANCLALLLANAAVFSALLAAFNAAEAMHLLGAAP  182

Query  546  -----SSP---RFELFLSVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVL  701
                 SSP   R  L LS +G ++ S+ LAN    CNLA V++  E  GG  A+LKA ++
Sbjct  183  QPTSTSSPGSGRAVLALSAAGVIVYSVALANASAACNLATVVAAAEGRGGAHAVLKAVLM  242

Query  702  I--KGRTGTALSLALPINMAMAAVEALFQYRIVRVYHHAKTGISSVAL--EGMLIAYMYA  869
            +   G   TA++ +LP ++A AAVEALFQ R++R Y  A TG  +  +  EG+L+AY++A
Sbjct  243  LLRSGDAATAVAASLPASLAAAAVEALFQLRVMRPY--AATGRVTPGMLWEGLLVAYIHA  300

Query  870  ILLVLDTIVVCFFLRSCEG--DCH  935
            ++ VLDT+V     RSC+    CH
Sbjct  301  MVCVLDTVVTTMVYRSCKASRSCH  324



>gb|AFK36617.1| unknown [Medicago truncatula]
Length=121

 Score =   105 bits (262),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 50/87 (57%), Positives = 66/87 (76%), Gaps = 0/87 (0%)
 Frame = +3

Query  657  EATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEALFQYRIVRVYHHAKTGISSVA  836
            E  GG++AILKAC+LI+G+T  AL LALP+N+A+AA+EALF +RIVR YH        V 
Sbjct  2    EGHGGYSAILKACILIRGKTSMALFLALPVNIALAAIEALFHFRIVREYHIVGKARPIVL  61

Query  837  LEGMLIAYMYAILLVLDTIVVCFFLRS  917
            LEG+ IAY+Y+I ++LDTIV C F +S
Sbjct  62   LEGIFIAYLYSIFIILDTIVSCLFYKS  88



>gb|EAY83254.1| hypothetical protein OsI_38462 [Oryza sativa Indica Group]
Length=328

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 114/341 (33%), Positives = 171/341 (50%), Gaps = 45/341 (13%)
 Frame = +3

Query  54   MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQS------FVPSSPFLAMIH  215
            M SA +I R ++  F   +    + A +LA P++A+VLV +S        P    L +  
Sbjct  1    MGSATRIVRMALHAFFSHYHPAASAAALLALPFSAAVLVSRSPALLQLAAPPRAILLLQP  60

Query  216  A---RIHTLFDAAGFPSSSEFFTILNLKLSQTVAISFLA-LPFTLSFFLL----------  353
            A   R+  +F AAGFP +S+   +LN +LSQ++ +SFLA LP  +SF LL          
Sbjct  61   ALSRRLRRVFVAAGFPPASQLLFLLNHRLSQSI-VSFLATLPLAMSFLLLAKAYAVHAVV  119

Query  354  ------SKACVIQALGDQELPKRSLFSCLPRIHSPLLLTQLCN--SFLVLSANATCFILL  509
                  ++ CV  A        R+ +  + R       TQL +  + L   A     +L 
Sbjct  120  AARGRGARRCVGGAAPSMASLVRASYPAMAR-------TQLASFGALLSAHAAVFAALLA  172

Query  510  LFAFNLADEFGFSSPRFELFLSVSGALLCSIILANTFTICNLA-LVLSGREATGGFTAIL  686
             F    A   G S  R  L LS +G ++ S+ LAN   +CNLA +V +     GG  A+L
Sbjct  173  AFNAAEALRLG-SDGRAVLALSAAGVIVYSVALANAAAVCNLATVVAAAEGGRGGARAVL  231

Query  687  KACVLIKGRTGTALSLALPINMAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMY  866
            +A +L++G   TA+++ALP  +A AAVE LFQ RI R Y       SS+  EG LIAY+Y
Sbjct  232  RAVLLVRGDAATAVAVALPATLATAAVEGLFQLRIARPYAVTGELTSSMVCEGFLIAYIY  291

Query  867  AILLVLDTIVVCFFLRSCEGDCHIDQYRRLPSHVEIEEDNN  989
            +I+ VLDT++ C   ++C+     D        +E+EE  +
Sbjct  292  SIICVLDTVITCMVYQTCKMSHSCDL-------LELEEKGD  325



>ref|NP_001066845.1| Os12g0507400 [Oryza sativa Japonica Group]
 gb|ABA98691.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF29864.1| Os12g0507400 [Oryza sativa Japonica Group]
Length=328

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 96/277 (35%), Positives = 142/277 (51%), Gaps = 36/277 (13%)
 Frame = +3

Query  219  RIHTLFDAAGFPSSSEFFTILNLKLSQTVAISFLA-LPFTLSFFLL--------------  353
            R+  +F AAGFP +S+   +LN +LSQ++ +SFLA LP  +SF LL              
Sbjct  65   RLRRVFVAAGFPPASQLLFLLNHRLSQSI-VSFLATLPLAMSFLLLAKAYAVHAVVAARG  123

Query  354  --SKACVIQALGDQELPKRSLFSCLPRIHSPLLLTQLCN--SFLVLSANATCFILLLFAF  521
              ++ CV  A        R+ +  + R       TQL +  + L   A     +L  F  
Sbjct  124  RGARRCVGGAAPSMASLVRASYPAMAR-------TQLASFGALLSAHAAVFAALLAAFNA  176

Query  522  NLADEFGFSSPRFELFLSVSGALLCSIILANTFTICNLA-LVLSGREATGGFTAILKACV  698
              A   G S  R  L LS +G ++ S+ LAN   +CNLA +V +     GG  A+L+A +
Sbjct  177  AEALRLG-SDGRAVLALSAAGVIVYSVALANAAAVCNLATVVAAAEGGRGGARAVLRAVL  235

Query  699  LIKGRTGTALSLALPINMAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILL  878
            L++G   TA+++ALP  +A AAVE LFQ RI R Y       SS+  EG LIAY+Y+I+ 
Sbjct  236  LVRGDAATAVAVALPATLATAAVEGLFQLRIARPYAVTGELTSSMVCEGFLIAYIYSIIC  295

Query  879  VLDTIVVCFFLRSCEGDCHIDQYRRLPSHVEIEEDNN  989
            VLDT++ C   ++C+     D        +E+EE  +
Sbjct  296  VLDTVITCMVYQTCKMSHSCDL-------LELEEKGD  325



>gb|KCW56258.1| hypothetical protein EUGRSUZ_I02003, partial [Eucalyptus grandis]
Length=300

 Score = 95.5 bits (236),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 100/329 (30%), Positives = 156/329 (47%), Gaps = 46/329 (14%)
 Frame = +3

Query  45    AAGMESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARI  224
             A+ ME AA+I RRS+  FL+    F T  ++L  PY+AS+L++  F P++          
Sbjct  11    ASEMERAARIIRRSIHGFLKNIGSFHTPVLIL-LPYSASLLLYGCFFPAA----------  59

Query  225   HTLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKR  404
                                +L L Q+V  + L+    L+F  ++KA V+QAL ++     
Sbjct  60    ----------------KTASLSLPQSVFRAVLSFAPALTFLAVAKARVLQALTNRH--DP  101

Query  405   SLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSG  584
             S  S    ++  L+  Q    FL      T   L   A   A    FS  +  L    S 
Sbjct  102   SPLSSSFSLYGRLVKLQ----FL-----KTSVALAADAIAWAPHGSFSRGQGTLLALTSR  152

Query  585   ALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAA  764
              + C+I  AN   +C++AL + G E      AI +AC L + R   AL +ALP  +  AA
Sbjct  153   TVSCAIA-ANLSAVCDVALAIVGIENCSASEAIRRACSL-RRRESAALLIALPHYLCFAA  210

Query  765   VEAL--FQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHI  938
             VEAL  F+YR V     A+     +A EG++IA+MY++++VLDTI    +++SCE +   
Sbjct  211   VEALCWFRYRSVMEGLSAERPYLGMASEGLVIAWMYSVVVVLDTIACGLYVKSCESNSRA  270

Query  939   D---QYRRLPSHVEIEEDNNAFRTVKIVE  1016
             D    +    ++V   +D+   R  KI +
Sbjct  271   DGAANHGHSTANVN-NDDDKGDRCGKIAD  298



>ref|XP_010030783.1| PREDICTED: uncharacterized protein LOC104420686 [Eucalyptus grandis]
Length=287

 Score = 95.5 bits (236),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 99/326 (30%), Positives = 154/326 (47%), Gaps = 46/326 (14%)
 Frame = +3

Query  54    MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTL  233
             ME AA+I RRS+  FL+    F T  ++L  PY+AS+L++  F P++             
Sbjct  1     MERAARIIRRSIHGFLKNIGSFHTPVLIL-LPYSASLLLYGCFFPAA-------------  46

Query  234   FDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSLF  413
                             +L L Q+V  + L+    L+F  ++KA V+QAL ++     S  
Sbjct  47    -------------KTASLSLPQSVFRAVLSFAPALTFLAVAKARVLQALTNRH--DPSPL  91

Query  414   SCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGALL  593
             S    ++  L+  Q    FL      T   L   A   A    FS  +  L    S  + 
Sbjct  92    SSSFSLYGRLVKLQ----FL-----KTSVALAADAIAWAPHGSFSRGQGTLLALTSRTVS  142

Query  594   CSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEA  773
             C+I  AN   +C++AL + G E      AI +AC L + R   AL +ALP  +  AAVEA
Sbjct  143   CAIA-ANLSAVCDVALAIVGIENCSASEAIRRACSL-RRRESAALLIALPHYLCFAAVEA  200

Query  774   L--FQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHID--  941
             L  F+YR V     A+     +A EG++IA+MY++++VLDTI    +++SCE +   D  
Sbjct  201   LCWFRYRSVMEGLSAERPYLGMASEGLVIAWMYSVVVVLDTIACGLYVKSCESNSRADGA  260

Query  942   -QYRRLPSHVEIEEDNNAFRTVKIVE  1016
               +    ++V   +D+   R  KI +
Sbjct  261   ANHGHSTANVN-NDDDKGDRCGKIAD  285



>ref|XP_009624255.1| PREDICTED: uncharacterized protein LOC104115351 [Nicotiana tomentosiformis]
Length=362

 Score = 85.1 bits (209),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 88/313 (28%), Positives = 151/313 (48%), Gaps = 27/313 (9%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAA----SVLVFQSFVPSSPFLAMIHARIH  227
             A +I + +V         F + A +L  P +A    +VLV QS V        +  R+ 
Sbjct  50   DALEILKETVRILRYNPIGFLSIATLLICPVSAILLSNVLVDQSIVKK------LTIRLL  103

Query  228  TLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALG----DQEL  395
             L  ++G P    F      K S+ V  + +  P  ++  LLSKA ++ ++      +  
Sbjct  104  LLAKSSGLPLKP-FIKQSCQKFSEMVISAVMCFPLYVTLLLLSKAAIVYSVDCTYSRKNF  162

Query  396  PKRSLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLA-DEFGFSSPRFELFL  572
              +  +  + +I   +++T +    +V+S     FI+LL A + A    GF  P   L+ 
Sbjct  163  DSKKFYVIVTKIWKRIVITYMWVC-MVISGCLALFIVLLVAVSSAFSVMGFP-PDLILYP  220

Query  573  SVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINM  752
            ++   ++ SIILAN   ICN+A+V+S  E   G  A+L++  LIKG+T   L + L   +
Sbjct  221  AMIVGMIFSIILANAMIICNIAIVISVLEDDSGPQALLRSSSLIKGQTQVGLLIFLGSTI  280

Query  753  AMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDC  932
             MA VE LF++R V++  +     SS   EG L+  MY+ ++++D+++   F  SC+   
Sbjct  281  GMAFVEGLFEHR-VKILSYGNG--SSRIWEGPLLVIMYSFVMLIDSMMSTVFYFSCKS--  335

Query  933  HIDQYRRLPSHVE  971
                YR   S+ E
Sbjct  336  ----YRMEASNEE  344



>gb|EYU28808.1| hypothetical protein MIMGU_mgv1a026893mg [Erythranthe guttata]
Length=357

 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 91/300 (30%), Positives = 150/300 (50%), Gaps = 26/300 (9%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAA----SVLVFQSFVPSSPFLAMIHARIH  227
            SA +I R +V         F     VL  P +A    +VLV QS    S +L++   R+ 
Sbjct  48   SALEILRETVRILRYNSAGFMAIVAVLICPVSAVVLSNVLVNQSL---SKWLSI---RLL  101

Query  228  TLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALG----DQEL  395
             +  ++G P    F      KLS+TV    L+ P  ++  LLSKA V+ ++      ++ 
Sbjct  102  LIAKSSGLPLRP-FVKHSCQKLSETVVSVTLSFPLFITLSLLSKAAVVYSVDCTYSRRKF  160

Query  396  PKRSLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEF----GFSSPRFE  563
                L+  + +I   ++ T L    LV+S   T F++LL    ++  F    GF S    
Sbjct  161  DSSKLYVIVSKIWKRVVFTYLWVC-LVVSGCVTLFLVLLIV--VSSVFFLIMGFPSDLI-  216

Query  564  LFLSVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALP  743
            L+ ++    L S++LANT  ICN+A+V+S  E   G  A+L++  LIKG+T   L + L 
Sbjct  217  LYPAMVVGFLFSVVLANTIIICNIAVVISVLEDVSGPQALLRSSSLIKGQTQVGLLIFLG  276

Query  744  INMAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
              + MA VE LF++R+  + +      SS   EG L+  MY+ ++++D+++   F  SC+
Sbjct  277  STIGMAFVEGLFEHRVKTLSYGDG---SSRIWEGPLLVVMYSFVVLIDSMMSAVFYFSCK  333



>ref|XP_009795710.1| PREDICTED: uncharacterized protein LOC104242365 [Nicotiana sylvestris]
Length=362

 Score = 83.2 bits (204),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 88/313 (28%), Positives = 149/313 (48%), Gaps = 27/313 (9%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAA----SVLVFQSFVPSSPFLAMIHARIH  227
             A +I + +V         F + A +L  P +A    +VLV QS V        +  R+ 
Sbjct  50   DALEILKETVRILRYNPIGFLSIATLLICPVSAVLLSNVLVDQSIVKK------LTIRLL  103

Query  228  TLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALG----DQEL  395
             L  ++G P    F      K S+ V  + +  P   +  LLSKA ++ ++      +  
Sbjct  104  LLAKSSGLPLKP-FIKQSCQKFSEMVISAAMCFPLYATLLLLSKAAIVYSVDCTYSRKNF  162

Query  396  PKRSLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLA-DEFGFSSPRFELFL  572
              R  +  + +I   +++T +    +V+S     FI+LL A + A    GF  P   L+ 
Sbjct  163  DTRKFYVIVTKIWKRIVMTYMWVC-MVISGCLVLFIVLLVAVSSAFSVMGFP-PDLILYP  220

Query  573  SVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINM  752
            ++   ++ SIILAN   ICN+A+V+S  E   G  A+L++  LIKG+T   L + L   +
Sbjct  221  AMIVGMIFSIILANAMIICNIAIVISVLEDDSGAQALLRSSSLIKGQTQVGLLIFLGSTI  280

Query  753  AMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDC  932
             MA VE LF++R V++  +     SS   EG L+  MY+ ++++D+++   F   C+   
Sbjct  281  GMAFVEGLFEHR-VKILSYGNE--SSRIWEGPLLVIMYSFVMLVDSMMSTVFYFRCKS--  335

Query  933  HIDQYRRLPSHVE  971
                YR   S+ E
Sbjct  336  ----YRMEASNEE  344



>ref|XP_010238889.1| PREDICTED: uncharacterized protein LOC100833751 [Brachypodium 
distachyon]
Length=345

 Score = 82.8 bits (203),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 115/330 (35%), Positives = 167/330 (51%), Gaps = 35/330 (11%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTLFD  239
            SA K+ R +V  FL  +  F+  A  LA P++A+         SSP  +++HA + + F 
Sbjct  26   SARKVMRSAVAAFLDGYHCFSPVAAALALPFSAA---------SSP-ASVVHAAVASAFR  75

Query  240  AAGF---PSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRS-  407
             AG     S S   ++L  KLSQT+ +S   LPF L+F LL++AC    L  +   +R  
Sbjct  76   LAGLAATDSGSPLLSLLAAKLSQTLFVSAATLPFALTFLLLARACAAAILLRRPRERRRR  135

Query  408  ------LFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELF  569
                  L   + R +  LL TQL    L ++A+A    LL  A + A  FG +S      
Sbjct  136  TLPPTPLLPAVARAYGALLPTQLATLLLTVAAHAAALSLLSAAVSFAGLFG-NSAASAAV  194

Query  570  LSVSGALLCSIILANTFTICNLALVLSGREA---TG----GFTAILKACVLIKGRTGTAL  728
             +      C +++A    +C+LAL ++  EA   TG    G  A+ +ACVL++GR   AL
Sbjct  195  TAAGAIAYC-VLVAMATVVCSLALAVAAMEAQSSTGAMVAGHAAVARACVLVRGRVRAAL  253

Query  729  SLALPINMAMAAVEALFQYRIVRVYHHAKTGIS------SVALEGMLIAYMYAILLVLDT  890
            +LALP  +AMAA EALFQ R+VR    +  G +       VA E + IAY++A+ +VLD 
Sbjct  254  ALALPARLAMAAAEALFQLRVVRNVATSAGGATRSWAAPGVAGEALSIAYIHALCVVLDI  313

Query  891  IVVCFFLRSCEGDCHIDQYRRLPSHVEIEE  980
            IV C F  SC      D     P  +E E+
Sbjct  314  IVGCMFYTSCCKTTDDDNDDHKPRELEPED  343



>ref|XP_004239096.1| PREDICTED: uncharacterized protein LOC101256486 [Solanum lycopersicum]
Length=355

 Score = 80.1 bits (196),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 68/235 (29%), Positives = 121/235 (51%), Gaps = 20/235 (9%)
 Frame = +3

Query  288  KLSQTVAISFLALPFTLSFFLLSKACVIQALG----DQELPKRSLFSCLPRIHSPLLLT-  452
            K S+ V  + +  P  +S  LLSKA ++ ++      +    +  +  + +I   +L+T 
Sbjct  116  KFSEMVISAVVCFPLYVSLLLLSKAAIVYSVDCTYSRKNFDGKKFYIIVTKIWKRILVTY  175

Query  453  -QLCNSFLVLSANATCFILLLFAFNLA-DEFGFSSPRFELFLSVSGALLCSIILANTFTI  626
              +C   +V++   T F++LL A + A    GF  P   L+ ++   ++ SIILAN   I
Sbjct  176  IWVC---MVITGCLTLFLVLLVAVSSAFSVIGFP-PDLILYTAMIVGIIFSIILANAMII  231

Query  627  CNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEALFQYRIVRVYH  806
            CN+A+V+S  E   G  A+L++  LIKG+T   L + L   + M  VE LF++R+  + +
Sbjct  232  CNIAVVISVLEDDSGPEALLRSSSLIKGQTQVGLLIFLGSTIGMTFVEGLFEHRVKIISY  291

Query  807  HAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHIDQYRRLPSHVE  971
                  SS   EG L+  +Y+ ++++D+++   F  SC+       YR   S+ E
Sbjct  292  EDG---SSRIWEGPLLVILYSFVMLIDSMMSTVFYFSCKS------YRMEASNEE  337



>ref|XP_004299927.1| PREDICTED: uncharacterized protein LOC101307497 [Fragaria vesca 
subsp. vesca]
Length=358

 Score = 80.1 bits (196),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 78/313 (25%), Positives = 151/313 (48%), Gaps = 17/313 (5%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTLFD  239
            +A +I R +V         F   A++L  P +A++L+    V  S  +  +  R+  +  
Sbjct  44   NALEILRETVRILRFNSWGFLAIAILLISPVSAAMLLSNMLVDHS-LVKRLTVRMLLIAK  102

Query  240  AAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQAL----GDQELPKRS  407
            ++G P    F +    KL++T   S +  P  ++  LLSKA ++ ++      ++     
Sbjct  103  SSGLPLR-PFVSHSCQKLAETAISSAMCFPLYITLSLLSKAALVYSVYWSYSHKKFDASK  161

Query  408  LFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGA  587
             +  + +I   L+ T +    +V+   A   ++LL   N    FG S P+  ++ ++   
Sbjct  162  FYLVMCKIWRRLVSTFVWMCMVVVGCIALFLMVLLAVCNTCSVFGLS-PQLIIYAAIMVG  220

Query  588  LLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAV  767
            L+ S++ AN   ICN+A+V+   E   G  A++++  LI+G+T   L + L   + MA V
Sbjct  221  LIFSVVFANAIIICNIAMVICVLEDVSGPEALVQSGALIRGQTQVGLLIFLGSTVGMAFV  280

Query  768  EALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHIDQY  947
            E LF++R+  + +      SS   EG L+  MY+ ++++D+++   F  SC         
Sbjct  281  EGLFEHRVKTLSYGDG---SSRIWEGPLLVVMYSFVVLIDSMMNAVFYFSCRS-------  330

Query  948  RRLPSHVEIEEDN  986
             R+ + +E E D+
Sbjct  331  FRMETSLEGESDS  343



>ref|XP_006483093.1| PREDICTED: uncharacterized protein LOC102625077 [Citrus sinensis]
Length=361

 Score = 80.1 bits (196),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 73/292 (25%), Positives = 138/292 (47%), Gaps = 11/292 (4%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTLFD  239
            SA  I R +V         F  TA VL  P +A  ++  + V     +  +  R+  + +
Sbjct  49   SALDILRETVRILRFNSSGFMITAAVLICPVSA--ILLSNLVVDQHIVNKLTYRLLLVAE  106

Query  240  AAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQAL----GDQELPKRS  407
              G P +  F T+   K S+ V    +  P  ++  LLSKA V+ ++      +++    
Sbjct  107  VCGLPLT-PFVTVSCHKFSEMVLSLTMCFPLFITSSLLSKAAVVYSVYCTYSRKKVEISK  165

Query  408  LFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGA  587
             F  + +I   +++T L    +++      F+LL+   +      FS P    + ++   
Sbjct  166  FFVIVRKIWKKVVVTYLWVCMVIVGCIMLFFVLLVAVCSAVSAIWFS-PDLVFYAAIVVG  224

Query  588  LLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAV  767
            L+ S++ AN   ICN+ +V+S  E   G  A+ ++ VLI+G+T   L + L   + M  +
Sbjct  225  LVFSVVYANAIVICNIGIVISVLEDVSGVQALFRSGVLIRGQTQVGLLIFLGSTVGMGFI  284

Query  768  EALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
            E LF++R+  + +      SS   EG L+  MY+ ++++D+++   F  SC+
Sbjct  285  EGLFEHRVTTLSYGDG---SSRLWEGPLLVIMYSFVVLIDSMMSAVFYFSCK  333



>gb|KDO83041.1| hypothetical protein CISIN_1g018046mg [Citrus sinensis]
Length=361

 Score = 79.0 bits (193),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 73/292 (25%), Positives = 138/292 (47%), Gaps = 11/292 (4%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTLFD  239
            SA  I R +V         F  TA VL  P +A  ++  + V     +  +  R+  + +
Sbjct  49   SALDILRETVRILRFNSSGFMITAAVLICPVSA--ILLSNLVVDQHIVNKLTYRLLLVAE  106

Query  240  AAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQAL----GDQELPKRS  407
              G P +  F T+   K S+ V    +  P  ++  LLSKA V+ ++      +++    
Sbjct  107  VCGLPLT-PFVTVSCHKFSEMVLSLTMCFPLFITSSLLSKAAVVYSVYCTYSRKKVEISK  165

Query  408  LFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGA  587
             F  + +I   +++T L    +++      F+LL+   +      FS P    + ++   
Sbjct  166  FFVIVRKIWKKVVVTYLWVCMVIVGCIMLFFVLLVAVCSAVSAIWFS-PDLVFYAAIVVG  224

Query  588  LLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAV  767
            L+ S++ AN   ICN+ +V+S  E   G  A+ ++ VLI+G+T   L + L   + M  +
Sbjct  225  LVFSVVYANAIVICNIGIVISVLEDVSGAQALFRSGVLIRGQTQVGLLIFLGSTVGMGFI  284

Query  768  EALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
            E LF++R+  + +      SS   EG L+  MY+ ++++D+++   F  SC+
Sbjct  285  EGLFEHRVTTLSYGDG---SSRLWEGPLLVIMYSFVVLIDSMMSAVFYFSCK  333



>ref|XP_002443243.1| hypothetical protein SORBIDRAFT_08g016250 [Sorghum bicolor]
 gb|EES17081.1| hypothetical protein SORBIDRAFT_08g016250 [Sorghum bicolor]
Length=346

 Score = 77.8 bits (190),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 115/360 (32%), Positives = 179/360 (50%), Gaps = 55/360 (15%)
 Frame = +3

Query  54    MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTL  233
             M  A K+ R ++  F + +   ++ A +LA P++A+ L+ +S  P+   LA  H     L
Sbjct  1     MGGAGKMIRTALHSFFRHYHPASSAASLLALPFSAAALLSRSH-PA--LLAPSHLLSRRL  57

Query  234   FD---AAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQ-----ALGDQ  389
                  AAGFP +S+   +L+ +LSQ       ALPF+LSF LL+KAC +        G Q
Sbjct  58    RRVLVAAGFPPASQLLFLLSHRLSQRACAFLAALPFSLSFLLLAKACAVHFCCCSPHGQQ  117

Query  390   ELPKRSLFSC--LPRIHSPLLLTQLCN-----------SFLVLSANATCFILLLFAFNLA  530
                K S  +   L   +  +  TQL N              +L+A      L L     A
Sbjct  118   RRRKDSTSAAAVLRSSYPAMAWTQLVNCLALLLANAAVFAALLAAFNAAEALQLLGVGGA  177

Query  531   DEFG--------FSSP------RFELFLSVSGALLCSIILANTFTICNLALVLSGREATG  668
                G         SSP      R  L LS +G ++ S+ LAN   +CNLA V++  E  G
Sbjct  178   PPHGSGSRPTSGTSSPDSGSGSRAVLALSAAGVIVYSVALANASAVCNLATVVAAAEGRG  237

Query  669   GFTAILKACVLI--KGRTGTALSLALPINMAMAAVEALFQYRIVRVYHHAKTGISSVAL-  839
             G  A+LKA +++   G   TA++ +LP ++A AAVEALFQ R++R Y    TG  +V + 
Sbjct  238   GAHAMLKAILMLLRAGDAATAVAASLPASLAAAAVEALFQLRVMRPY--TATGKVTVGML  295

Query  840   -EGMLIAYMYAILLVLDTIVVCFFLRSCEG--DCHIDQYRRLPSHVEIEEDNNAFRTVKI  1010
              EG+L+AY+++++ VLDT+V     +SC+    CH+         +E+E D +    +++
Sbjct  296   CEGLLVAYIHSMICVLDTVVTSMVYQSCKASHSCHL---------LELELDGDRKDDLRV  346



>ref|XP_006438763.1| hypothetical protein CICLE_v10033399mg [Citrus clementina]
 gb|ESR52003.1| hypothetical protein CICLE_v10033399mg [Citrus clementina]
Length=361

 Score = 77.4 bits (189),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 72/292 (25%), Positives = 137/292 (47%), Gaps = 11/292 (4%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTLFD  239
            SA  I R +V         F  TA VL  P +A  ++  + V     +  +  R+  + +
Sbjct  49   SALDILRETVRILRFNSSGFMITAAVLICPVSA--ILLSNLVVDQHIVNKLTYRLLLVAE  106

Query  240  AAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQAL----GDQELPKRS  407
              G P +  F T+   K S+ V    +  P  ++  LLSKA V+ ++      +++    
Sbjct  107  VCGLPLT-PFVTVSCHKFSEMVLSLTMCFPLFITSSLLSKAAVVYSVYCTYSRKKVEISK  165

Query  408  LFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGA  587
             F  + +I   +++T L    +++      F+LL+   +      F  P    + ++   
Sbjct  166  FFVIVRKIWKKVVVTYLWVCMVIVGCIMLFFVLLVAVCSAVSAIWFL-PDLVFYAAIVVG  224

Query  588  LLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAV  767
            L+ S++ AN   ICN+ +V+S  E   G  A+ ++ VLI+G+T   L + L   + M  +
Sbjct  225  LVFSVVYANAIVICNIGIVISVLEDVSGVQALFRSGVLIRGQTQVGLLIFLGSTVGMGFI  284

Query  768  EALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
            E LF++R+  + +      SS   EG L+  MY+ ++++D+++   F  SC+
Sbjct  285  EGLFEHRVTTLSYGDG---SSRLWEGPLLVIMYSFVVLIDSMMSAVFYFSCK  333



>ref|XP_002893390.1| hypothetical protein ARALYDRAFT_472743 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69649.1| hypothetical protein ARALYDRAFT_472743 [Arabidopsis lyrata subsp. 
lyrata]
Length=335

 Score = 76.3 bits (186),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 81/296 (27%), Positives = 138/296 (47%), Gaps = 19/296 (6%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTLFD  239
            +A +I R +V         F  T  VL  P +A  L+  +F+     +  +  ++  +  
Sbjct  26   NALEILRETVRILRYNLGAFMITTAVLICPVSA--LLLPNFLVDQSLVNKLTLKLLLVAK  83

Query  240  AAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALG---DQELPKRSL  410
            ++G P    F      K ++T   S +  P  ++  LLSKA VI ++     +E+   S 
Sbjct  84   SSGLPLQ-PFVKHSCQKFAETAVSSAMCFPLFITVSLLSKAAVIYSVDCTYSREIVDISK  142

Query  411  F-SCLPRIHSPLLLTQLCNSFLVLSANATCF----ILLLFAFNLADEFGFSSPRFELFLS  575
            F   L +I   ++ T L    L++     CF    +LL+   +     GFS P F ++ +
Sbjct  143  FLGTLQKIWRRVVFTYLWICILIVG----CFTFFCVLLVAICSSFSVLGFS-PDFNVYGA  197

Query  576  VSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMA  755
            +   L  S++ AN   ICN A+V+S  E   G  A+++A  LIKG     L + L   + 
Sbjct  198  MLVGLAFSVVFANAIIICNTAIVISVLEDVSGLGAMMRASDLIKGHIQVGLLMFLGSTLG  257

Query  756  MAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
            +A VE LF +R+ +V +      SS   EG L+  MY+ + ++D+++   F  SC 
Sbjct  258  LAFVEGLFDHRVKKVSYGDG---SSRLWEGPLLVLMYSFVTLIDSMMSAVFYFSCR  310



>ref|XP_011004425.1| PREDICTED: uncharacterized protein LOC105110918 [Populus euphratica]
Length=113

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 34/68 (50%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = +3

Query  600  IILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEALF  779
            ++L NT   CNLALV++G +    + ++ KAC+L KG    AL LALPIN+ + A EALF
Sbjct  1    MVLTNTMVTCNLALVVAGIDNCTIYKSLRKACLLRKGTDSMALLLALPINLGLVATEALF  60

Query  780  QYRIVRVY  803
            +YR+VR Y
Sbjct  61   RYRVVRAY  68



>ref|XP_010460285.1| PREDICTED: uncharacterized protein LOC104741188 [Camelina sativa]
Length=339

 Score = 75.9 bits (185),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 82/295 (28%), Positives = 140/295 (47%), Gaps = 17/295 (6%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTLFD  239
            +A +I R SV         F  T   L  P +A  L+  +F+     +  +  ++  +  
Sbjct  29   NALEIVRESVRILRYNLGAFMITTAALICPVSA--LILPNFLVDQSLVNKLTVKLLLVAK  86

Query  240  AAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALG---DQELPKRSL  410
            ++G P    F      K ++T   S +  P  ++  LLSKA V+ ++     +E  + S 
Sbjct  87   SSGLPLQ-PFVKHSCQKFAETSVSSAMCFPLFITVSLLSKAAVVYSVDCTYSREKAEISK  145

Query  411  F-SCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEF---GFSSPRFELFLSV  578
            F   L +I   ++ T L    +++    T F +LL A  +   F   GFS P F ++ ++
Sbjct  146  FLVALNKIWKRVVYTYLWICIMIVGC-FTFFCVLLVA--ICSSFFVLGFS-PDFSVYGAI  201

Query  579  SGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAM  758
               L  S++ AN   ICN A+V+S  E   G  A+++A VLIKG+    L + L   + +
Sbjct  202  LVGLAFSVVFANAIIICNTAVVISVLEDVSGIGALVRASVLIKGQIQVGLLMFLGSTLGL  261

Query  759  AAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
            A VE LF +R+ +V +      SS   EG L+  MY+ + ++D+++   F  SC 
Sbjct  262  AFVEGLFDHRVKKVSYGDG---SSRLWEGPLLVLMYSFVTLIDSMMSAVFYFSCR  313



>ref|XP_010258226.1| PREDICTED: uncharacterized protein LOC104598044 [Nelumbo nucifera]
Length=366

 Score = 75.9 bits (185),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 80/313 (26%), Positives = 145/313 (46%), Gaps = 22/313 (7%)
 Frame = +3

Query  33   QEFSAAGMESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMI  212
            Q+F + G   A +I R +V         F   A VL  P +A VL   + +     L  +
Sbjct  48   QQFHSMG---ALEILRETVRILRYNSPGFMMIAAVLICPVSAVVL--SNVLVDHSILKRL  102

Query  213  HARIHTLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQE  392
              R+  +  ++G P           +LS     +    PF ++  LLSK+ ++ ++    
Sbjct  103  STRLLLVAKSSGLPLDPSIKQSCQ-RLSNMALSAAFCFPFYITLLLLSKSAIVYSVDCTY  161

Query  393  LPKR----SLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRF  560
              K+      F+ + +I    + T +    +++   A   +L++   N+    GF S   
Sbjct  162  SRKKFNISKFFAFIVKIWKRPVSTYVWACMVIVGCLALFLLLMVAICNMFFMAGFPSTLL  221

Query  561  ELFLSVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLAL  740
             ++ ++   L+ SI+ AN   ICNLA+V+S  E   G  A+L++ VLI+G+T   L + L
Sbjct  222  -IYPAIMVGLVFSILFANAIIICNLAIVISVLEDVSGPQALLRSSVLIQGQTQVGLMIFL  280

Query  741  PINMAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSC  920
               M MA VE L+++R+  + +      SS   EG L+  MY+ ++++D+++   F  +C
Sbjct  281  GSTMGMAFVEGLYEHRVKTLSYGDG---SSRIWEGPLLVIMYSFVVLMDSMMNAVFYFTC  337

Query  921  --------EGDCH  935
                    EG+ H
Sbjct  338  RSSSIEALEGEHH  350



>ref|XP_007045989.1| Son of sevenless [Theobroma cacao]
 gb|EOY01821.1| Son of sevenless [Theobroma cacao]
Length=360

 Score = 75.5 bits (184),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 74/305 (24%), Positives = 141/305 (46%), Gaps = 21/305 (7%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTLFD  239
            +A +I R +V         F   A +L  P +A  ++  + +     +     R+  +  
Sbjct  48   NALEILRETVRILRYNSSGFMIIAALLICPVSA--VLMSNLLVDHSIVKRFTVRLLLVAK  105

Query  240  AAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRS----  407
             +G P  S F      + ++T   S +  P  ++  LLSKA V+  + D    ++S    
Sbjct  106  TSGLPLRS-FLKQSCQRFAETAVSSAMCFPLFITLSLLSKAAVVYCV-DCTYSRKSADVS  163

Query  408  -LFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSG  584
              F  + +    L+ T +    +++    T F+ L+ A ++    GF+ P   ++  +  
Sbjct  164  KFFVIIRKFWRRLVSTYVWMCMVIVGCVTTFFVFLVAACSVLSVIGFT-PDLIVYAVIMM  222

Query  585  ALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAA  764
             L+ S++ AN   +CN+ +V+   E   G  A+L+A VLIKG+T   L + L   + +A 
Sbjct  223  GLVFSVVFANAIVVCNIGIVICVLEEVSGLQALLRAGVLIKGQTQVGLLIFLGSTIGLAF  282

Query  765  VEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSC--------  920
            VE LF++R+  + +      SS   EG L+  MY+ ++++D+++   F  SC        
Sbjct  283  VEGLFEHRVKTLSYGDG---SSRIWEGPLLVIMYSFVVLVDSMMNTVFYFSCRSYSVEAS  339

Query  921  EGDCH  935
            +G+C 
Sbjct  340  DGECR  344



>emb|CDX85037.1| BnaC05g20180D [Brassica napus]
Length=336

 Score = 75.1 bits (183),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 77/296 (26%), Positives = 139/296 (47%), Gaps = 19/296 (6%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTLFD  239
            +A +I R SV         F  TA VL  P +A +L   +F+     +  +  ++  +  
Sbjct  26   NALEILRESVRILRYNLGAFMLTAAVLICPVSAVLL--PNFLVDHSLVNKLTVKLLLVAK  83

Query  240  AAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALG----DQELPKRS  407
            ++G P    F      K ++T   S +  P  ++  LLSKA V+ ++      +++    
Sbjct  84   SSGLPLQ-PFVKHSCQKFAETAVSSAMCFPLFVTVSLLSKAAVVYSVDATYSREKVEINK  142

Query  408  LFSCLPRIHSPLLLTQLCNSFLVLSANATCF----ILLLFAFNLADEFGFSSPRFELFLS  575
              + L ++   ++ T L    L++     CF    +LL+   +     GFS P F ++ +
Sbjct  143  FLAALKKLWKRVVYTYLWVCILIVG----CFTFFCVLLVSICSSFSVLGFS-PDFNVYGA  197

Query  576  VSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMA  755
            +   L  SI+ AN   +CN A+V+S  E   G  A+++A  LIKG+    L + L   + 
Sbjct  198  ILVGLAFSIVFANAIIVCNTAVVISVLEDVSGAGALVRASDLIKGQVQVGLLIFLGSTLG  257

Query  756  MAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
            +A VE LF +R+ ++ +      SS   EG L+  MY+ + ++D+++   F  SC 
Sbjct  258  LAFVEGLFDHRVKKLSYGDG---SSRLWEGPLLVVMYSFVTLIDSMMSAVFYFSCR  310



>gb|KDP41249.1| hypothetical protein JCGZ_15656 [Jatropha curcas]
Length=364

 Score = 75.1 bits (183),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 90/329 (27%), Positives = 147/329 (45%), Gaps = 30/329 (9%)
 Frame = +3

Query  60    SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVL----VFQSFVPSSPFLAMIHARIH  227
             +A +I R +V         F   A +L  P +A VL    V QS V       M+ A+ H
Sbjct  52    NALEILRETVRILRFNSSSFMIIAALLICPVSAIVLSNVFVDQSVVKRLTIRLMLVAK-H  110

Query  228   TLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRS  407
             +      F   S +      + S+ V  S +  P   +  LLSKA V+ ++      K+ 
Sbjct  111   SGLPLRPFLKQSSY------RFSEMVVSSAMCFPLFFTLSLLSKAAVVYSVDCTYAKKKV  164

Query  408   LFS----CLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAF-NLADEFGFSSPRFELFL  572
              FS     + +I   ++ T L    +++    T F +LL A  +     GF  P   L+ 
Sbjct  165   QFSKFYVIMRKIWRKVVSTYLWACMMIVGC-VTLFCVLLLAICSSLFVIGFL-PELNLYA  222

Query  573   SVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINM  752
             ++   L+ S++ AN   ICN+ +V+S  E   G  A+L + +LI+G+T   L + L   +
Sbjct  223   AMMVGLVFSVVFANAIIICNVGIVISVLEDVSGPQALLHSSILIRGQTQVGLLIYLGSTI  282

Query  753   AMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDC  932
              MA VE LF++R+  + +      SS   EG L+  MY+ ++++DT++   F  SC    
Sbjct  283   GMAFVEGLFEHRVKTLSYGDG---SSRIWEGPLLVIMYSFVVLIDTMMSAVFYFSCR---  336

Query  933   HIDQYRRLPSHVEIEEDNNAFRTVKIVED  1019
                 YR   S     E  +   T+ I  D
Sbjct  337   ---SYRLENSDA---ESQSILETITISSD  359



>ref|XP_010551632.1| PREDICTED: uncharacterized protein LOC104822182 [Tarenaya hassleriana]
Length=352

 Score = 74.7 bits (182),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 77/311 (25%), Positives = 147/311 (47%), Gaps = 23/311 (7%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTLFD  239
            +A +I R +V         F  TA VL  P +A +L   + +     +  +  R+  + +
Sbjct  38   NALEILRETVRILRYNLGAFMLTAAVLICPVSAVLL--PNLLVDESLVEKLTVRLLIVTE  95

Query  240  AAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALG------DQELPK  401
            ++G P    F      K ++T   S +  P +++  LLS+A ++ ++       + ++ K
Sbjct  96   SSGLPLKP-FVKHSCRKFAETAVSSAMCFPLSVTLSLLSRAAIVYSVDCTYSRTNADVSK  154

Query  402  RSLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVS  581
                  + R+   L++T L    +++    + F++L+   +     G S P    + ++ 
Sbjct  155  --FIVTVQRLWKQLVVTYLWICLVIVGCLTSFFVILIAICSSFSVLGLS-PDLHTYGAIV  211

Query  582  GALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMA  761
              ++ S++ AN   ICN A+V+   E   G  A+++A  LIKG+T   L + L   + +A
Sbjct  212  VGMVFSVVFANAIIICNTAIVVCILEDLSGHRALVRASDLIKGQTQVGLLIFLGSTIGLA  271

Query  762  AVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSC-----EG  926
             VE LF++R+  + +      SS   EG L+  MY+ ++++D+++   F  SC     EG
Sbjct  272  FVEGLFEHRVKNLSYGDG---SSRIWEGPLLVVMYSFVVLVDSMMSAVFYFSCRFYRSEG  328

Query  927  DCHIDQYRRLP  959
             C I   R LP
Sbjct  329  -CRI--LRELP  336



>ref|XP_004155379.1| PREDICTED: uncharacterized protein LOC101226354 [Cucumis sativus]
 gb|KGN51954.1| hypothetical protein Csa_5G606450 [Cucumis sativus]
Length=361

 Score = 74.3 bits (181),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 85/300 (28%), Positives = 141/300 (47%), Gaps = 27/300 (9%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAA----SVLVFQSFVPSSPFLAMIHARIH  227
            SA +I R SV         F   A++L  P +A    +VLV +S V       M+  R+ 
Sbjct  50   SALEILRESVRILRYNSTAFVLIAILLICPVSAVFLSNVLVDESVVK------MLTIRLI  103

Query  228  TLFDAAGFPSSSEFFTILN---LKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELP  398
             +  ++G P       I+     + ++++  S +  P  L+  L+SKA V+  + D    
Sbjct  104  LVAKSSGLP----LMPIIEHSCQRFAESILSSAMCFPLFLTLSLVSKAAVVHTV-DCTYA  158

Query  399  KR----SLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAF-NLADEFGFSSPRFE  563
            KR     LF  + R     LL+   +  L +    T F++LL A  +     GFS P   
Sbjct  159  KRRFELGLFLAIVRNIWNRLLSTYASVCLAIVGCLTMFLVLLGAVCSTLYVLGFS-PDLI  217

Query  564  LFLSVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALP  743
            +  +V   L+ S+I AN   ICN+ +V+   E   G  A+L++CVLI+G+T   L + L 
Sbjct  218  VSAAVIVGLVFSVIFANAVIICNIGIVICVLEDVAGPGALLRSCVLIRGQTQVGLLIFLG  277

Query  744  INMAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
              +    VE LF++R+  + +      SS   EG L+  MY+ +++ D+++   F  SC 
Sbjct  278  STIGTVFVEGLFEHRVKTLSYGDG---SSRIWEGPLLVVMYSFVVLTDSMMSAVFYLSCR  334



>ref|XP_010237231.1| PREDICTED: uncharacterized protein LOC100823289 [Brachypodium 
distachyon]
 gb|ACF22685.1| hypothetical protein-2 [Brachypodium distachyon]
Length=317

 Score = 73.6 bits (179),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 104/324 (32%), Positives = 167/324 (52%), Gaps = 22/324 (7%)
 Frame = +3

Query  54   MESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTL  233
            M SA++I R ++  F   +    ++A +LA P++A+ L+ +S  PS   L  +  R+  +
Sbjct  1    MGSASRIMRAALHAFFTHYHPAASSAALLALPFSAAALLSRSPPPSLLLLPALSRRLRRV  60

Query  234  FDAAGFPSSSEFFTILNLKLSQTVAISFLA-LPFTLSFFLLSKACVIQALGDQELPKRSL  410
              AAGFP +S+   +LN KLSQ+ A SFLA LPF+LSF LLSK+C ++AL   +  +   
Sbjct  61   LVAAGFPPASQLLFLLNHKLSQS-AFSFLATLPFSLSFLLLSKSCAVRALQPAKHHQNQR  119

Query  411  FSCLPRI-HSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGA  587
             S  P +  + L          +    A                G    R  L LS +G 
Sbjct  120  TSSYPAMARTQLANYAALLLANLAVFAALLAAFNAAEALGLGGGGAGEGRAALALSAAGV  179

Query  588  LLCSIILANTFTICNLALVLS----GREATG----GFTAILKACVLIKGRTGTALSLALP  743
            ++ S+ LAN   +CNLA V++    GR+  G       A+L           TA+++ALP
Sbjct  180  IVYSVALANAAAVCNLATVVAAAEPGRDRGGCGAVLRAALLLLARGGGADAATAVAVALP  239

Query  744  INMAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
             ++A AAVE LFQ R++R+Y       S++  EG+LIAY+++++ VLDT+V     ++C+
Sbjct  240  ASLATAAVEGLFQLRVMRLYMADGRITSAMVCEGLLIAYIHSMICVLDTVVTFIVYQTCK  299

Query  924  G--DCHIDQYRRLPSHVEIEEDNN  989
                CH+         +++EE  +
Sbjct  300  ATHSCHL---------LDLEEKGD  314



>ref|XP_006415943.1| hypothetical protein EUTSA_v10008119mg [Eutrema salsugineum]
 gb|ESQ34296.1| hypothetical protein EUTSA_v10008119mg [Eutrema salsugineum]
Length=341

 Score = 73.9 bits (180),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 80/296 (27%), Positives = 140/296 (47%), Gaps = 19/296 (6%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTLFD  239
            +A +I R +V         F  TA VL  P +A +L   +F+     +  +  ++  +  
Sbjct  31   NALEILREAVRILRYNLGAFMLTAAVLICPVSAFLL--PNFLVDQSLVNKLTVKLLLVAK  88

Query  240  AAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVI---QALGDQELPKRSL  410
            ++G P    F      K ++T   S +  P  ++  LLSK  V+    A   +E+ + S 
Sbjct  89   SSGLPLQ-PFVKHSCQKFAETAVSSAMCFPLFITVSLLSKTAVVYSVDATYSREIVEVSK  147

Query  411  F-SCLPRIHSPLLLTQLCNSFLVLSANATCF----ILLLFAFNLADEFGFSSPRFELFLS  575
            F + L +I   ++ T +    L++     CF    +LL+   +     GFS P F ++ +
Sbjct  148  FLATLQKIWRRVVFTYMWICILIVG----CFTFFCVLLVAICSSFSVLGFS-PDFSVYGA  202

Query  576  VSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMA  755
            +   L  S++ AN   ICN A+V+S  E   G  A+++A  LIKG+    L + L   + 
Sbjct  203  ILVGLAFSVVFANAIIICNTAIVISVLEDVSGAGALVRASDLIKGQIQVGLLIFLGSTLG  262

Query  756  MAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
            +A VE LF +R+ +V +      SS   EG L+  MY+ + ++D+++   F  SC 
Sbjct  263  LAFVEGLFDHRVKKVSYGDG---SSRLWEGPLLVLMYSFVTLIDSMMSAVFYFSCR  315



>ref|XP_002312265.1| hypothetical protein POPTR_0008s09100g [Populus trichocarpa]
 gb|EEE89632.1| hypothetical protein POPTR_0008s09100g [Populus trichocarpa]
Length=360

 Score = 73.9 bits (180),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 77/307 (25%), Positives = 142/307 (46%), Gaps = 27/307 (9%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAA----SVLVFQSFVPSSPFLAMIHARIH  227
            SA  I R +          F T A +L  P +A    +VLV QS V        +  R+ 
Sbjct  48   SALDILRETARILRCNSWSFMTIAALLICPVSAILLSNVLVDQSIVKR------LSTRLL  101

Query  228  TLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALG----DQEL  395
             + +++G P        L  + ++    S    P  ++  LLS+A V+ ++      +++
Sbjct  102  LVANSSGLPLR-PLIKQLCHRFAEMAVSSATCFPLFITLSLLSRAAVVYSVDCTYSRKDV  160

Query  396  PKRSLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLS  575
                  + + +I   ++ T L +  +++      F+LLL   +     GF  P   L+ +
Sbjct  161  DGSKFLAMISKIWRRIVSTYLWSCMVIVGCLTLFFVLLLAVCSTFLVLGFW-PELNLYAA  219

Query  576  VSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMA  755
            +   L+ S+I AN   +CN+A+V+S      G  A+L++ VLI+G+T   L + L   + 
Sbjct  220  MIVGLVFSVIFANAIIVCNIAVVISVLVDVSGPQALLRSSVLIRGQTQVGLLIFLGSTIG  279

Query  756  MAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSC-----  920
            MA +E LF++R+  + +      SS   EG L+  MY+ ++++D ++   F  SC     
Sbjct  280  MAFIEGLFEHRVKTLSYGDG---SSRIWEGPLLVIMYSFVVLIDLMMSAVFYYSCRSHGM  336

Query  921  ---EGDC  932
               +G+C
Sbjct  337  EASDGEC  343



>ref|XP_004516573.1| PREDICTED: uncharacterized protein LOC101492424 [Cicer arietinum]
Length=365

 Score = 73.9 bits (180),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 65/218 (30%), Positives = 111/218 (51%), Gaps = 12/218 (6%)
 Frame = +3

Query  288  KLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSLFSC-----LPRIHSPLLLT  452
            + ++TV  S +  P   +  LLSK  V+ ++ D    ++   S      + +    +L T
Sbjct  126  RFAETVTASAMCFPLYATLLLLSKTAVVYSV-DCTYSRKKFDSSKFCVIVSKFWRKILST  184

Query  453  QLCNSFLVLSANATCFILLLFAFNLA-DEFGFSSPRFELFLSVSGALLCSIILANTFTIC  629
             +    +V+    T F + L AF  A    GFS P   ++ ++   L+ S+I AN   IC
Sbjct  185  YMWACTIVVGC-ITMFCVFLVAFCSALAVLGFS-PNVVVYAALMVGLVFSVIFANAIIIC  242

Query  630  NLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEALFQYRIVRVYHH  809
            N+ALV+S  E   G  A+L++ +LIKG+T   L + L   + MA VE LF++R+  + + 
Sbjct  243  NIALVISVLEDVSGAQAMLQSSILIKGQTQVGLLIYLGSTIGMAFVEGLFEHRVKTLSYG  302

Query  810  AKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
                 SS   EG L+  MY+ ++++D+++   F  SC 
Sbjct  303  DG---SSRMWEGPLLVIMYSFVVLIDSMMSAVFYFSCR  337



>ref|XP_006844834.1| hypothetical protein AMTR_s00058p00077380 [Amborella trichopoda]
 gb|ERN06509.1| hypothetical protein AMTR_s00058p00077380 [Amborella trichopoda]
Length=382

 Score = 73.9 bits (180),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 81/297 (27%), Positives = 137/297 (46%), Gaps = 20/297 (7%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTLFD  239
             A +I R +V     K   F T   VL  P +A +L+  + V     +  +  R+ +L  
Sbjct  67   DALEILRETVRILRCKSSAFMTIVAVLICPVSA-ILLSDALVFDRSLVKSVSLRLLSLAI  125

Query  240  AAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALG----DQELPKRS  407
            ++G P +  F      ++S+ +  S    P  ++  LLSKA ++ ++      ++L    
Sbjct  126  SSGIPPT-LFLKQSCRRVSEMLVSSAFCFPLFITLSLLSKAAIVYSVACTYFGKQLWLSK  184

Query  408  LFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSS-----PRFELFL  572
             F+ + +I   L+ T L N   +L       ++L    N+    G  S     P F L  
Sbjct  185  FFATVAKIWRRLVSTYLLNCAAILGCVVLFVLVLTTVCNMFVIMGVPSSLIIYPAFGL--  242

Query  573  SVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINM  752
                A+  S++ A+   ICNLA V+S  E   G  A L+A  LI+G+T   L + L   +
Sbjct  243  ----AVAFSVVFAHVIIICNLANVISVLEDLSGPRAFLRAVFLIRGQTQVGLLIFLGSTI  298

Query  753  AMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
             MA VE LF+YR+  + +      SS   EG L+  MY+ L+++D+++   F  +C 
Sbjct  299  GMAFVEGLFEYRVKTLSYGDG---SSRIWEGPLLVVMYSFLVLIDSMMSAVFYFTCR  352



>ref|XP_003528573.1| PREDICTED: uncharacterized protein LOC100806351 [Glycine max]
 gb|KHN42927.1| hypothetical protein glysoja_007457 [Glycine soja]
Length=357

 Score = 73.6 bits (179),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 62/217 (29%), Positives = 111/217 (51%), Gaps = 10/217 (5%)
 Frame = +3

Query  288  KLSQTVAISFLALPFTLSFFLLSKACVIQALG----DQELPKRSLFSCLPRIHSPLLLTQ  455
            + ++TV  S +  PF  +  LLSKA V+ ++      +++        + +    +L T 
Sbjct  118  RFAETVVSSAMCFPFYATLLLLSKAAVVYSVDCTYSRKKVDASKFCVIVAKFWRKILFTY  177

Query  456  LCNSFLVLSANATCFILLLFAFNLA-DEFGFSSPRFELFLSVSGALLCSIILANTFTICN  632
            +    +V+    T F + L AF  A    GFS P   ++ ++   L+ S++ A    ICN
Sbjct  178  MWVCTVVVGC-ITLFCVFLVAFCSALAVLGFS-PDVVVYCAMLVGLVFSVVFAKAIIICN  235

Query  633  LALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEALFQYRIVRVYHHA  812
            +A+V+S  E   G  A+L++ +LIKG+T   L + L   + MA VE LF++R+  + +  
Sbjct  236  IAMVISVLEDVSGAQAMLRSSILIKGQTQVGLLIFLGSTIGMAFVEGLFEHRVKTLSYGD  295

Query  813  KTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
                SS   EG L+  MY+ ++++D+++   F  SC 
Sbjct  296  G---SSRVWEGPLLVVMYSFVVLIDSMMSAVFYFSCR  329



>emb|CDP00381.1| unnamed protein product [Coffea canephora]
Length=361

 Score = 73.6 bits (179),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 82/297 (28%), Positives = 143/297 (48%), Gaps = 21/297 (7%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAA----SVLVFQSFVPSSPFLAMIHARIH  227
            +A +I R +V         F     +L  P +A    +VLV QS V        +  R+ 
Sbjct  49   NALEILRETVRILRYNSTGFVAILALLICPVSAVVLSNVLVDQSIVKQ------LTIRLL  102

Query  228  TLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKR-  404
             +  ++G P S  F      K ++    + +  P  ++  LLSKA V+ ++      KR 
Sbjct  103  LVAKSSGLPLS-PFIRQSCQKFAEMAVAATMCFPLYITLSLLSKAAVVYSVDCTYSRKRF  161

Query  405  ---SLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLA-DEFGFSSPRFELFL  572
                 +  + +I   +++T      +++S   T F +LL A +      GF S    L+ 
Sbjct  162  DSSKFYVIVRKIWRRIVVTYFWVCVVIVSC-ITLFCVLLVAVSSTFSVMGFPSDLI-LYP  219

Query  573  SVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINM  752
            ++   L+ SIILAN+  ICN+A+V+S  E   G  A+L++  L+KG+T   L + L   +
Sbjct  220  AMVLGLIFSIILANSTIICNIAIVISVLEDVSGPQALLRSSSLVKGQTQVGLLIFLGSTI  279

Query  753  AMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
             MA VE LF++R+  + +      SS   EG L+  MY+ ++++D+++   F  SC+
Sbjct  280  GMAMVEGLFEHRVKTLSYGDG---SSRIWEGPLLVIMYSFVVLIDSMMSAVFYFSCK  333



>ref|XP_002522492.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39984.1| conserved hypothetical protein [Ricinus communis]
Length=363

 Score = 73.6 bits (179),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 62/231 (27%), Positives = 109/231 (47%), Gaps = 14/231 (6%)
 Frame = +3

Query  291  LSQTVAISFLALPFTLSFFLLSKACVIQALG----DQELPKRSLFSCLPRIHSPLLLTQL  458
            LS+    S +  P  ++  LLSKA V+ ++      Q +        + +I   ++ T  
Sbjct  125  LSEMAIASAMYFPLFITLSLLSKAAVVYSVDCTYSRQNIDVSKFIGIMSKIWRRVVSTYW  184

Query  459  CNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGALLCSIILANTFTICNLA  638
                +++       +LLL   +L    GF  P   L+  +   L+ S++ AN   ICN+A
Sbjct  185  WACMMIVGCITLFCVLLLAICSLLSVIGFP-PALNLYAGILVGLVFSVVFANAIVICNIA  243

Query  639  LVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEALFQYRIVRVYHHAKT  818
            +V+S  E   G  A+L++ +LI+G+T   L + L   + +A VE LF++R+  + +    
Sbjct  244  IVISVLEDVSGPQALLRSSILIRGQTQVGLLIYLGSTIGLAFVEGLFEHRVKTLSYGDG-  302

Query  819  GISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHIDQYRRLPSHVE  971
              SS   EG L+  MY+ ++++D ++   F  SC        YR   S  E
Sbjct  303  --SSRIWEGPLLVIMYSFVVLIDLMMSAIFYFSCR------SYRTEASDAE  345



>ref|XP_006306437.1| hypothetical protein CARUB_v10012379mg [Capsella rubella]
 gb|EOA39335.1| hypothetical protein CARUB_v10012379mg [Capsella rubella]
Length=341

 Score = 73.2 bits (178),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 77/296 (26%), Positives = 134/296 (45%), Gaps = 19/296 (6%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTLFD  239
            +A +I R SV         F  T   L  P +A  L+  +F+     +  +  ++  +  
Sbjct  32   NALEILRESVRILRYNLGAFMITTAALICPVSA--LILPNFLVDQSLVNKLTVKLLLVAK  89

Query  240  AAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQAL----GDQELPKRS  407
            ++G P    F      K ++T   S +  P  ++  LLSKA V+ ++      ++     
Sbjct  90   SSGLPLQ-PFVKHSCQKFAETSVSSAMCFPLFITVSLLSKAAVVYSVDCTYSREKAEISK  148

Query  408  LFSCLPRIHSPLLLTQLCNSFLVLSANATCF----ILLLFAFNLADEFGFSSPRFELFLS  575
             F    +I   ++ T L    L++     CF    +LL+   +     GFS P F ++ +
Sbjct  149  FFVAFQKIWKRVVFTYLWICTLIVG----CFTFFCVLLVAICSSFSVLGFS-PDFSVYGA  203

Query  576  VSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMA  755
            +   L  S++ AN   ICN A+V+S  E   G  A+++A  LIKG     L + L   + 
Sbjct  204  ILVGLAFSVVFANAIIICNTAVVISVLEDVSGIGALVRASDLIKGHIQVGLLMFLGSTLG  263

Query  756  MAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
            +A VE LF +R+ +V +      SS   EG L+  MY+ + ++D+++   F  SC 
Sbjct  264  LAFVEGLFDHRVKKVSYGDG---SSRLWEGPLLVLMYSFVTLIDSMMSAVFYFSCR  316



>ref|XP_010477835.1| PREDICTED: uncharacterized protein LOC104756877 [Camelina sativa]
Length=339

 Score = 73.2 bits (178),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 81/295 (27%), Positives = 139/295 (47%), Gaps = 17/295 (6%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTLFD  239
            +A +I R SV         F  T   L  P +A  L+  +F+     +  +  ++  +  
Sbjct  29   NALEILRESVRILRYNLGAFMITTAALICPVSA--LILPNFLVDQSLVNKLTVKLLLVAK  86

Query  240  AAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALG---DQELPKRSL  410
            ++G P    F      K ++T   S +  P  ++  LLSKA V+ ++     +E  + S 
Sbjct  87   SSGLPLQ-PFVKHSCQKFAETSVSSAMCFPLFITVSLLSKAAVVYSVDCTYSREKAEISK  145

Query  411  F-SCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEF---GFSSPRFELFLSV  578
            F   L ++   ++ T L    L++    T F +LL A  +   F   GFS P F ++ ++
Sbjct  146  FLVALNKMWKRVVFTYLWVCVLIVGC-FTFFCVLLVA--ICSSFFVLGFS-PDFSVYGAI  201

Query  579  SGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAM  758
               L  S++ AN   ICN A+V+S  E   G  A+++A  LIKG+    L + L   + +
Sbjct  202  LVGLAFSVVFANAIIICNTAVVISVLEDVSGIGALVRASDLIKGQIQVGLLMFLGSTLGL  261

Query  759  AAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
            A VE LF +R+ +V +      SS   EG L+  MY+ + ++D+++   F  SC 
Sbjct  262  AFVEGLFDHRVKKVSYGDG---SSRLWEGPLLVLMYSFVTLIDSMMSAVFYFSCR  313



>ref|XP_010499015.1| PREDICTED: uncharacterized protein LOC104776618 [Camelina sativa]
Length=339

 Score = 73.2 bits (178),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 82/295 (28%), Positives = 139/295 (47%), Gaps = 17/295 (6%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTLFD  239
            +A +I R SV         F  T   L  P +A  L+  +F+     +  +  ++  +  
Sbjct  29   NALEILRESVRILRYNLGAFMITTAALICPVSA--LLLPNFLVDQSLVNKLTVKLLLVAK  86

Query  240  AAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALG---DQELPKRSL  410
            ++G P    F      K ++T   S +  P  ++  LLSKA V+ ++     +E  + S 
Sbjct  87   SSGLPLQ-PFVKHSCQKFAETSVSSAMCFPLFITVSLLSKAAVVYSVDCTYSREKAEISK  145

Query  411  F-SCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEF---GFSSPRFELFLSV  578
            F   L +I   ++ T L    L++    T F +LL A  +   F   GFS P F ++ ++
Sbjct  146  FLVALNKIWKRVVYTYLWICILIVGC-FTFFCVLLVA--ICSSFFVLGFS-PDFSVYGAI  201

Query  579  SGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAM  758
               L  S++ AN   ICN A+V+S  E   G  A+++A  LIKG+    L + L   + +
Sbjct  202  LVGLAFSVVFANAIIICNTAVVISVLEDVSGVGALVRASDLIKGQIQVGLLMFLGSTLGL  261

Query  759  AAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
            A VE LF +R+ +V +      SS   EG L+  MY+ + ++D+++   F  SC 
Sbjct  262  AFVEGLFDHRVKKVSYGDG---SSRLWEGPLLVLMYSFVTLIDSMMSAVFYFSCR  313



>ref|XP_004135444.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101222691 
[Cucumis sativus]
Length=356

 Score = 73.2 bits (178),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 84/304 (28%), Positives = 137/304 (45%), Gaps = 40/304 (13%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAA----SVLVFQSFVPSSPFLAMIHARIH  227
            SA +I R SV         F   A++L  P +A    +VLV +S V       M+  R+ 
Sbjct  50   SALEILRESVRILRYNSTAFVLIAILLICPVSAVFLSNVLVDESVV------KMLTIRLI  103

Query  228  TLFDAAGFPSSSEFFTILN---LKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELP  398
             +  ++G P       I+     + ++++  S +  P  L+  L+SKA V+  + D    
Sbjct  104  LVAKSSGLP----LMPIIEHSCQRFAESILSSAMCFPLFLTLSLVSKAAVVHTV-DCTYA  158

Query  399  KR----SLF-----SCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSS  551
            KR     LF     +   R+ S   +      FLVL   A C  L +  F         S
Sbjct  159  KRRFELGLFLAIVRNIWNRLLSSXAIVGCLTMFLVL-LGAVCSTLYVLGF---------S  208

Query  552  PRFELFLSVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALS  731
            P   +  +V   L+ S+I AN   ICN+ +V+   E   G  A+L++CVLI+G+T   L 
Sbjct  209  PDLIVSAAVIVGLVFSVIFANAVIICNIGIVICVLEDVAGPGALLRSCVLIRGQTQVGLL  268

Query  732  LALPINMAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFL  911
            + L   +    VE LF++R+  + +      SS   EG L+  MY+ +++ D+++   F 
Sbjct  269  IFLGSTIGTVFVEGLFEHRVKTLSYGDG---SSRIWEGPLLVVMYSFVVLTDSMMSAVFY  325

Query  912  RSCE  923
             SC 
Sbjct  326  LSCR  329



>ref|XP_008446402.1| PREDICTED: uncharacterized protein LOC103489158 [Cucumis melo]
Length=361

 Score = 73.2 bits (178),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 85/300 (28%), Positives = 141/300 (47%), Gaps = 27/300 (9%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAA----SVLVFQSFVPSSPFLAMIHARIH  227
            SA +I R +V         F   A+++  P +A    +VLV +S V       M+  R+ 
Sbjct  50   SALEILRETVRILRYNSTAFVLIAILVICPVSAVFLSNVLVDESVVK------MLTIRLI  103

Query  228  TLFDAAGFPSSSEFFTILN---LKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELP  398
             +  ++G P       I+     + ++++  S +  P  L+  L+SKA V+  + D    
Sbjct  104  LVAKSSGLP----LMPIIEHSCQRFAESILSSAMCFPLFLTLSLVSKAAVVHTV-DCTYA  158

Query  399  KR----SLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAF-NLADEFGFSSPRFE  563
            KR     LF  + R     LL+   +  L +    T F++LL A        GFS P   
Sbjct  159  KRRFELGLFLAIVRNIWNRLLSTYASVCLAIVGCLTMFLVLLGAVCTTLYVLGFS-PDLI  217

Query  564  LFLSVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALP  743
            +  +V   L+ SII AN   ICN+A+V+   E   G  A+L++CVLI+G+T   L + L 
Sbjct  218  VSAAVIVGLVFSIIFANAVIICNIAIVICVLEDVAGPGALLRSCVLIRGQTQVGLLIFLG  277

Query  744  INMAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
              +    VE LF++R+  + +      SS   EG L+  MY+ +++ D+++   F  SC 
Sbjct  278  STIGTVFVEGLFEHRVKTLSYGDG---SSRIWEGPLLVVMYSFVVLTDSMMSAVFYFSCR  334



>ref|XP_011012681.1| PREDICTED: uncharacterized protein LOC105116878 [Populus euphratica]
 ref|XP_011012689.1| PREDICTED: uncharacterized protein LOC105116878 [Populus euphratica]
Length=360

 Score = 73.2 bits (178),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 77/308 (25%), Positives = 139/308 (45%), Gaps = 27/308 (9%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAA----SVLVFQSFVPSSPFLAMIHARIH  227
            SA +I R +V         F T A +L  P +A    +VLV QS V        +  R+ 
Sbjct  48   SALEILRETVRILRCNSWSFMTIAALLICPVSAILLSNVLVDQSIVKK------LSIRLL  101

Query  228  TLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALG----DQEL  395
             +  ++G P    F      + S+    S +  P  ++  LLS+A V+ ++      + +
Sbjct  102  LVAKSSGLPLR-PFIKQSCHRFSEMAVSSAMCFPLFITLSLLSRAAVVYSVDCTYSKKNV  160

Query  396  PKRSLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLS  575
                    + +    ++ T L +S +++       +LLL A +     GF      L+ +
Sbjct  161  DGSKFLVIMSKNWRRVVSTYLWSSLVIVGCLTLFCVLLLAACSTFSAIGFWQ-ELNLYAA  219

Query  576  VSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMA  755
            +   +  S++ AN   ICN A+V+   E   G  A+L++ VLI+G+T   L + L   + 
Sbjct  220  IIAGIAFSVVFANAIIICNTAVVVCMLEDVSGPQALLRSSVLIRGQTQVGLLIFLGSTIG  279

Query  756  MAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSC-----  920
            MA +E LF++R+  + +      SS   EG L+  MY+ ++++D ++   F  SC     
Sbjct  280  MAMIEGLFEHRVKTLSYGDG---SSRIWEGPLLVVMYSFVVLIDLMMSAVFYYSCRSYSM  336

Query  921  ---EGDCH  935
               +G+C 
Sbjct  337  ETSDGECQ  344



>emb|CDY16174.1| BnaA09g29080D [Brassica napus]
Length=336

 Score = 72.8 bits (177),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 77/296 (26%), Positives = 136/296 (46%), Gaps = 19/296 (6%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTLFD  239
            +A +I R SV         F  TA VL  P +A +L   +F+     +  +  ++  +  
Sbjct  26   NALEILRESVRILRYNLGAFMLTAAVLICPVSAVLL--PNFLVDHSLVNKLTVKLLLVAK  83

Query  240  AAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALG----DQELPKRS  407
            ++G P    F      K ++T   S +  P  ++  LLSK  V+ ++      +++    
Sbjct  84   SSGLPLQ-PFVKHSCQKFAETAVSSAMCFPMFVTVSLLSKTAVVYSVDATYSREKVEINK  142

Query  408  LFSCLPRIHSPLLLTQLCNSFLVLSANATCF----ILLLFAFNLADEFGFSSPRFELFLS  575
                L ++   ++ T L    L++     CF    +LL+   +     GFS P F ++ +
Sbjct  143  FLVALKKLWKRVVYTYLWVCILIVG----CFTFFCVLLVSICSSFSVLGFS-PDFNVYGA  197

Query  576  VSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMA  755
            +   L  SI+ AN   +CN A+V+S  E   G  A+ +A  LIKG+    L + L   + 
Sbjct  198  ILVGLAFSIVFANAIIVCNTAVVISVLEDVSGAGALARASDLIKGQVQVGLLIFLGSTLG  257

Query  756  MAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
            +A VE LF +R+ +V +      SS   EG L+  MY+ + ++D+++   F  SC 
Sbjct  258  LAFVEGLFDHRVKKVSYGDG---SSRLWEGPLLVVMYSFVTLIDSMMSAVFYFSCR  310



>ref|XP_009115389.1| PREDICTED: uncharacterized protein LOC103840632 [Brassica rapa]
Length=336

 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 77/296 (26%), Positives = 136/296 (46%), Gaps = 19/296 (6%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTLFD  239
            +A +I R SV         F  TA VL  P +A +L   +F+     +  +  ++  +  
Sbjct  26   NALEILRESVRILRYNLGAFMLTAAVLICPVSAVLL--PNFLVDHSLVNKLTVKLLLVAK  83

Query  240  AAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALG----DQELPKRS  407
            ++G P    F      K ++T   S +  P  ++  LLSK  V+ ++      +++    
Sbjct  84   SSGLPLQ-PFVKHSCQKFAETAVSSAMCFPLFVTVSLLSKTAVVYSVDATYSREKVEINK  142

Query  408  LFSCLPRIHSPLLLTQLCNSFLVLSANATCF----ILLLFAFNLADEFGFSSPRFELFLS  575
                L ++   ++ T L    L++     CF    +LL+   +     GFS P F ++ +
Sbjct  143  FLVALKKLWKRVVYTYLWVCILIVG----CFTFFCVLLVSICSSFSVLGFS-PDFNVYGA  197

Query  576  VSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMA  755
            +   L  SI+ AN   +CN A+V+S  E   G  A+ +A  LIKG+    L + L   + 
Sbjct  198  ILVGLAFSIVFANAIIVCNTAVVISVLEDVSGAGALARASDLIKGQVQVGLLIFLGSTLG  257

Query  756  MAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
            +A VE LF +R+ +V +      SS   EG L+  MY+ + ++D+++   F  SC 
Sbjct  258  LAFVEGLFDHRVKKVSYGDG---SSRLWEGPLLVVMYSFVTLIDSMMSAVFYFSCR  310



>ref|XP_006348815.1| PREDICTED: uncharacterized protein LOC102581421 [Solanum tuberosum]
Length=358

 Score = 72.8 bits (177),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 62/232 (27%), Positives = 115/232 (50%), Gaps = 14/232 (6%)
 Frame = +3

Query  288  KLSQTVAISFLALPFTLSFFLLSKACVIQALG----DQELPKRSLFSCLPRIHSPLLLTQ  455
            K S+ V  + +  P  +S  LLSKA ++ ++      +    +  +  + +I   +++T 
Sbjct  115  KFSEMVISAVMCFPLYVSLLLLSKAAIVYSVDCTYSRKNFDSKKFYIIVTKIWKRIVVTY  174

Query  456  LCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGALLCSIILANTFTICNL  635
            +    ++    A   +LL+   +     GF  P   L+ ++   ++ SIILAN   ICN+
Sbjct  175  MWVCMVITGCLALFLVLLVAVSSAFSVMGFP-PDLILYPAMIVGIIFSIILANAMIICNI  233

Query  636  ALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEALFQYRIVRVYHHAK  815
            A+V+S  E   G  A+L++  LIKG+T   L + L   + M  VE LF++R+  + +   
Sbjct  234  AIVISVLEDDSGPEALLRSSSLIKGQTQVGLLIFLGSTIGMTFVEGLFEHRVKIISYEDG  293

Query  816  TGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHIDQYRRLPSHVE  971
               SS   EG L+  +Y+ ++++D+++   F  SC+       YR   S+ E
Sbjct  294  ---SSRIWEGPLLVILYSFVMLIDSMMSTVFYFSCKS------YRMEASNEE  336



>ref|XP_008339849.1| PREDICTED: uncharacterized protein LOC103402858 [Malus domestica]
Length=355

 Score = 72.0 bits (175),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 75/292 (26%), Positives = 139/292 (48%), Gaps = 11/292 (4%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTLFD  239
            SA +I R +V         F   A++L  P +A  L+  + V     +  +  R+  +  
Sbjct  42   SALEILRETVRILRYNSWGFLAIALLLICPVSA--LLLSNLVVDHSLVKRLTIRMLLIAK  99

Query  240  AAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQAL----GDQELPKRS  407
            ++G P   +F +    K ++      +  P  ++  LLSKA V+ ++      ++     
Sbjct  100  SSGLPLR-DFISHSCQKFAEMAISCTMCFPLYITLSLLSKAAVVYSVYCSYSLKKFDASQ  158

Query  408  LFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGA  587
             +  L +I   ++ T +    +V        +LLL   N     G S P + ++ ++  A
Sbjct  159  FYLVLRKIWRRVVSTYVWMCMVVAGCVVLFLVLLLAVCNACSIVGLS-PNYIVYAAMVVA  217

Query  588  LLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAV  767
            L+ S++ AN   ICN+A+V+S  E   G  A++++ VLIKG+T   L + L  ++ MA V
Sbjct  218  LIFSVVFANAVIICNIAIVISVLEDVSGPEALVQSGVLIKGQTQVGLLIFLGSSIGMAFV  277

Query  768  EALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
            E LF++R+  + +      SS   EG L+  MY+ ++++D++    F  SC 
Sbjct  278  EGLFEHRVKTLSYGDG---SSRIWEGPLLVIMYSFVVLIDSMNSAVFYFSCR  326



>ref|XP_002281196.1| PREDICTED: uncharacterized protein LOC100250739 [Vitis vinifera]
 emb|CBI28090.3| unnamed protein product [Vitis vinifera]
Length=301

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 87/312 (28%), Positives = 140/312 (45%), Gaps = 39/312 (13%)
 Frame = +3

Query  33   QEFSAAGMESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFV---PSSPFL  203
            Q   +  + + A+IFR ++         F + ++ L  P   S+ +    +   P  P  
Sbjct  7    QVLESIHLMNTAQIFREAIRIIFLHPTHFHSISIFLFSPLPISLFMSHFLIHQFPQIPIS  66

Query  204  AMIHARIHTLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALG  383
            A+  A  H+L      P        L   L +T+    +  P  ++F LL +A  +QA+ 
Sbjct  67   AL-KAIDHSLGQHGVLP--------LPKLLPKTLVHIIICFPSIITFSLLGRAATVQAVS  117

Query  384  DQ----ELPKRSLFSCLPRIHSPLLLTQLCNSFLVLS------ANATCFILLLFAFNLAD  533
            D      L +R L      +   LL T      +VL       A+      +LFAF +  
Sbjct  118  DGYHGINLDRRRLLMRSGLVWVKLLHTSFWEFLIVLGLFGALVASLATVPKILFAFGVCS  177

Query  534  E-FGFSSPRFELFLSVSGALLCSIILANTFTICNLALVLSGREAT-GGFTAILKACVLIK  707
               GF S      L  +G   C ++ A+   + NLA V+S  E+   GF +I+KA  L++
Sbjct  178  RVLGFFS-----VLGFAGIPFC-VVFAHVMIVGNLARVVSVVESECYGFDSIVKAKRLME  231

Query  708  GRTGTALSLALPINMAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLD  887
            GR  TAL +AL  N+    VE LF++R+        TG+S    EG L+  MY+++LVLD
Sbjct  232  GRRHTALVMALLSNVGFRLVECLFEFRMC-------TGMS--LWEGPLLVSMYSLVLVLD  282

Query  888  TIVVCFFLRSCE  923
            T++   F  +C+
Sbjct  283  TVMNAVFYYACK  294



>gb|KFK41365.1| hypothetical protein AALP_AA2G120500 [Arabis alpina]
Length=346

 Score = 72.0 bits (175),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 86/299 (29%), Positives = 142/299 (47%), Gaps = 25/299 (8%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAA----SVLVFQSFVPSSPFLAMIHARIH  227
            +A +I R +V         F   A +L  P +A    ++LV QS V S     ++ A+  
Sbjct  31   NALEILRETVRILRYNLGAFMLIAALLICPVSAILLPNLLVDQSVVNSLTVKLLLVAK--  88

Query  228  TLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRS  407
                ++G P    F     LK S+T   S +  P  ++  LLS+A ++ ++      ++ 
Sbjct  89   ----SSGLPLL-PFVRNSCLKFSETAVSSAMCFPLFITLSLLSRAAIVYSVDCTYSRRKV  143

Query  408  LFS----CLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEF---GFSSPRFEL  566
            + S     + R+   L+ T L  S LV+    T F + L A  +   F   GFS P F  
Sbjct  144  VISKFLLIMQRLWKRLVFTYLWIS-LVIVVCLTSFCVFLVA--VCSSFFVLGFS-PDFNA  199

Query  567  FLSVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPI  746
            + ++   L  S++ AN   ICN  +V+S  E   G  A+++A  LIKG+T   L + L  
Sbjct  200  YGAILIGLGFSVVFANVIIICNTTMVISILEDVSGPLALVRASDLIKGQTQVGLLIFLGS  259

Query  747  NMAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
             + M  VE LF++R V++  +     SS   EG L+  MY+ ++++DT++   F  SC 
Sbjct  260  TIGMTFVEGLFEHR-VKILSYGDG--SSRIWEGPLLVVMYSFVVLIDTMMSAVFYFSCR  315



>ref|XP_002315026.2| hypothetical protein POPTR_0010s17080g [Populus trichocarpa]
 gb|EEF01197.2| hypothetical protein POPTR_0010s17080g [Populus trichocarpa]
Length=360

 Score = 72.0 bits (175),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 77/308 (25%), Positives = 139/308 (45%), Gaps = 27/308 (9%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAA----SVLVFQSFVPSSPFLAMIHARIH  227
            SA +I R +V         F T A +L  P +A    +VLV QS V        +  R+ 
Sbjct  48   SALEILRETVRILRCNSWSFMTIAALLICPVSAILLSNVLVDQSIVKK------LSVRLL  101

Query  228  TLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALG----DQEL  395
             +  ++G P    F      + S+    S +  P  ++  LLS+A V+ ++      + +
Sbjct  102  LVAKSSGLPLR-PFIKQSCHRFSEMAVSSAMCFPLFITLSLLSRAAVVYSVDCTYSKKNV  160

Query  396  PKRSLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLS  575
                    + +    ++ T L +S +++       +LLL A +     GF      L+ +
Sbjct  161  DGSKFLVIVSKNWRRVVSTYLWSSLVIVGCLTLFCVLLLAACSTFSAIGFWQ-ELNLYAA  219

Query  576  VSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMA  755
            +   L  S++ AN   ICN A+V+   E   G  A+L++ VLI+G+T   L + L   + 
Sbjct  220  IIAGLAFSVVFANAIIICNTAVVVCMLEDVSGPQALLRSSVLIRGQTQVGLLIFLGSTIG  279

Query  756  MAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSC-----  920
            MA +E LF++R+  + +      SS   EG L+  M++ ++++D ++   F  SC     
Sbjct  280  MAMIEGLFEHRVKTLSYGDG---SSRIWEGPLLVVMHSFVVLIDLMMSAVFYYSCRSYSM  336

Query  921  ---EGDCH  935
               +G+C 
Sbjct  337  ETSDGECQ  344



>ref|XP_006451107.1| hypothetical protein CICLE_v10010230mg [Citrus clementina]
 gb|ESR64347.1| hypothetical protein CICLE_v10010230mg [Citrus clementina]
Length=292

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 91/308 (30%), Positives = 137/308 (44%), Gaps = 34/308 (11%)
 Frame = +3

Query  33   QEFSAAGMESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLV---FQSFVPSSPFL  203
            Q F +  +   A+IFR S+   L     F + ++    P + S+ +      + P  P  
Sbjct  7    QVFESVYLIDTAQIFRESIRVILLHPTQFHSISIFFFSPLSISLFISHFLVRYFPQIPSW  66

Query  204  AMIHARIHTLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALG  383
            + I+   H L    G P       +L + LS+T+    +  P  ++F L+ +A  IQA+ 
Sbjct  67   S-INITDHLL----GHP-------LLKI-LSKTIMHLIICFPSFITFSLIGRAATIQAVS  113

Query  384  DQ----ELPKRSLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSS  551
            D      L +R L +        LL T     F+VL       I L     L    G  S
Sbjct  114  DNYNGISLDRRRLLTKSGMTWIKLLHTSFWEFFIVLGLFGALLISLATVPKLLFSMGLLS  173

Query  552  PRFELFLSVSGAL---LCSIILANTFTICNLALVLSGREAT-GGFTAILKACVLIKGRTG  719
             R   FL V G L    C ++ A    + NLA VLS  E+   G  ++LKA  L+KGR  
Sbjct  174  SRMLGFLCVLGFLGIPFC-VVFAQLMVVGNLAKVLSVLESECYGLESLLKANNLMKGRRQ  232

Query  720  TALSLALPINMAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVV  899
            TAL + L  NM++  VE LF++RI R        IS    E  L+  MY+ +LV D+++ 
Sbjct  233  TALIMTLLSNMSLRLVEFLFEFRICR-------DIS--IWEAPLLVSMYSSVLVFDSVMN  283

Query  900  CFFLRSCE  923
              F  +C+
Sbjct  284  VVFYYACK  291



>ref|XP_010511970.1| PREDICTED: uncharacterized protein LOC104788003 [Camelina sativa]
 ref|XP_010511971.1| PREDICTED: uncharacterized protein LOC104788003 [Camelina sativa]
Length=348

 Score = 71.6 bits (174),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 85/301 (28%), Positives = 142/301 (47%), Gaps = 29/301 (10%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAA----SVLVFQSFVPSSPFLAMIHARIH  227
            +A +I R +V         F   A++L  P +A    ++LV QS V S      +  R+ 
Sbjct  40   NALEILRETVRILRYNLGAFMLIALLLICPVSAILLPNLLVDQSVVNS------LTVRLL  93

Query  228  TLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRS  407
             +  ++G P    F      K S+T   S +  P  ++  LLS+A V+ ++      K+ 
Sbjct  94   LVSKSSGLPLL-PFVRNSCQKFSETAVSSAMCFPLFITLSLLSRAAVVYSVDCTYSRKKV  152

Query  408  LFS----CLPRIHSPLLLTQL--CNSFLVLSANATCFILLLFAFNLADEF---GFSSPRF  560
            + S     + R+   L++T L  C    V+    T F + L A  +   F   GFS P F
Sbjct  153  VMSKFVVIMQRLWKRLVITYLWICT---VIVVCLTSFCVFLVA--VCSSFYVLGFS-PDF  206

Query  561  ELFLSVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLAL  740
              + ++   L+ S++ AN   ICN  +V+S  E   G  A+L+A  LIKG+T   L + L
Sbjct  207  NAYGAILVGLVFSVVFANVIIICNTTIVISILEDVSGPEALLRASDLIKGQTQVGLLIFL  266

Query  741  PINMAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSC  920
               + +  VE LF++R+  + +      SS   EG L+  MY+ ++++DT++   F  SC
Sbjct  267  GSTIGLTFVEGLFEHRVKSLSYGDG---SSRLWEGPLLVVMYSFVVLIDTMMSAVFYFSC  323

Query  921  E  923
             
Sbjct  324  R  324



>ref|NP_564252.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF87024.1|AC006535_2 T24P13.3 [Arabidopsis thaliana]
 gb|AEE30714.1| uncharacterized protein AT1G26650 [Arabidopsis thaliana]
Length=335

 Score = 71.2 bits (173),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 78/296 (26%), Positives = 138/296 (47%), Gaps = 19/296 (6%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTLFD  239
            +A +I R +V            T  VL  P +A  L+  +F+     +  +  ++  +  
Sbjct  26   NALEILRETVRILRYNLGALMLTTAVLICPVSA--LLLPNFLVDQSLVNKLTVKLLLVAK  83

Query  240  AAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALG---DQELPKRSL  410
            ++G P    F      K ++T   S +  P  ++  LLSKA V+ ++     +E+   S 
Sbjct  84   SSGLPLQ-PFVKHSCQKFAETAVSSAMCFPVFITVSLLSKAAVVYSVDCSYSREVVDISK  142

Query  411  F-SCLPRIHSPLLLTQLCNSFLVLSANATCF----ILLLFAFNLADEFGFSSPRFELFLS  575
            F   L +I   ++ T +    L++     CF    +LL+   +     GFS P F ++ +
Sbjct  143  FLVILQKIWRRVVFTYVWICILIVG----CFTFFCVLLVAICSSFSVLGFS-PDFNVYGA  197

Query  576  VSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMA  755
            +   L  S++ AN   ICN A+V+S  E   G  A+++A  LIKG+    L + L   + 
Sbjct  198  MLVGLAFSVVFANAIIICNTAIVISVLEDVSGLGALMRASDLIKGQIQVGLLMFLGSTLG  257

Query  756  MAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
            +A VE LF +R+ +V +      SS   EG L+  MY+ + ++D+++   F  SC 
Sbjct  258  LAFVEGLFDHRVKKVSYGDG---SSRLWEGPLLVLMYSFVTLIDSMMSAVFYFSCR  310



>ref|XP_003556759.2| PREDICTED: uncharacterized protein LOC100789016 [Glycine max]
Length=361

 Score = 71.6 bits (174),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 61/217 (28%), Positives = 109/217 (50%), Gaps = 10/217 (5%)
 Frame = +3

Query  288  KLSQTVAISFLALPFTLSFFLLSKACVIQALG----DQELPKRSLFSCLPRIHSPLLLTQ  455
            + ++TV  S +  PF  +  LLSKA V+ ++      ++         + +    +L T 
Sbjct  122  RFAETVVSSAMCFPFYATLLLLSKAAVVYSVDCTYSRKKFDASKFCVIVAKFWRKILFTY  181

Query  456  LCN-SFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGALLCSIILANTFTICN  632
            +   + +V      C  L+ F   LA   GF  P   ++ ++   L+ S++ AN   ICN
Sbjct  182  MWVCTVIVCCITLFCVFLVAFCSALA-VLGFL-PDVVVYCAMLVGLVFSVVFANAIIICN  239

Query  633  LALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEALFQYRIVRVYHHA  812
            +A+V+S  E   G  A+L++ +LIKG+T   L + L   + MA VE LF++R+  + +  
Sbjct  240  IAMVISVLEDVSGAQAMLRSSILIKGQTQVGLLIFLGSTIGMAFVEGLFEHRVKTLSYGD  299

Query  813  KTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
                SS   EG L+  MY+ ++++D+++   F  SC 
Sbjct  300  G---SSRVWEGPLLVVMYSFVVLIDSMMSAVFYFSCR  333



>ref|XP_007203111.1| hypothetical protein PRUPE_ppa023904mg [Prunus persica]
 gb|EMJ04310.1| hypothetical protein PRUPE_ppa023904mg [Prunus persica]
Length=291

 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 94/317 (30%), Positives = 137/317 (43%), Gaps = 53/317 (17%)
 Frame = +3

Query  33   QEFSAAGMESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLV----FQSF--VPSS  194
            Q   +    S  +IFR S+   L     F + ++ L  P  AS+ +       F  +PSS
Sbjct  7    QVLDSLNSMSTTQIFRESIRVILLHPTHFHSISIFLFSPLPASLFISHFLLHHFPQIPSS  66

Query  195  PFLAMIHARIHTLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQ  374
                  H   H L      P            LS+T+    L  P +++F LL +A  IQ
Sbjct  67   TIKITDHILAHPL------PK----------LLSKTIVHIVLCFPSSITFSLLGRAATIQ  110

Query  375  ALGDQ----ELPKRSLF--SCLPRIHSPLLLTQLCNSFLVLS------ANATCFILLLFA  518
            A+ D      L +R L   S L  I   LL T LC   +VL       A+      +LFA
Sbjct  111  AVSDSYNGINLDRRRLLVRSGLNWI--KLLNTGLCELIIVLGLLGVLVASLAVVPKILFA  168

Query  519  FNLADE-FGFSSPRFELFLSVSGALLCSIILANTFTICNLALVLSGREAT-GGFTAILKA  692
            + +  E  GF        L   G   C +  A+   + NLA VLS  E    GF  ++KA
Sbjct  169  WGVCSEVLGFWG-----VLGFLGVPFC-VAFAHVMVVGNLARVLSVLEGECYGFETLIKA  222

Query  693  CVLIKGRTGTALSLALPINMAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAI  872
              L++ +  TAL +AL  N+    VE LF +R+ +       GI+    EG L+  MY++
Sbjct  223  KRLMERKRKTALVMALLSNVGFRLVECLFDFRMSK-------GIN--LWEGPLLVSMYSL  273

Query  873  LLVLDTIVVCFFLRSCE  923
            LLV DT++   F  +C+
Sbjct  274  LLVFDTVMNVVFYYACK  290



>ref|XP_008389435.1| PREDICTED: uncharacterized protein LOC103451785 [Malus domestica]
Length=355

 Score = 70.5 bits (171),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 74/292 (25%), Positives = 139/292 (48%), Gaps = 11/292 (4%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTLFD  239
            SA +I R +V         F   A++L  P +A +L   +F+     +  +  R+  +  
Sbjct  42   SALEILRETVRILRYNSWGFLAIAMLLICPISAVLL--SNFLVDQSLVKRLTIRMLLIAK  99

Query  240  AAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQAL----GDQELPKRS  407
            ++G P   +F +    KL++      +  P  ++  LLSKA V+ ++      ++     
Sbjct  100  SSGLPLR-DFISHSCQKLAEMAISCTMCFPLYITLSLLSKAAVVYSVYCSYSLKKFDASQ  158

Query  408  LFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGA  587
             +  + +I   ++ T +    +V  +     +LLL   N     G S P + ++ ++   
Sbjct  159  FYFVMCKIWRRVVSTYMWMCMVVAGSVVLFLVLLLAVCNACSIVGLS-PNYIVYAAMVVG  217

Query  588  LLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAV  767
            L  S++ AN   ICN+A V+S  E   G  A++++ VLIKG+T   L + L  ++ MA V
Sbjct  218  LAFSVVFANAIIICNIAFVISVLEDVSGPEALVQSGVLIKGQTQVGLLIFLGSSIGMAFV  277

Query  768  EALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
            E LF++R+  + +      SS   EG L+  MY+ ++++D++    F  SC 
Sbjct  278  EGLFEHRVKTLSYGDG---SSRIWEGPLLVIMYSFVVLIDSMNSAVFYFSCR  326



>ref|XP_010258644.1| PREDICTED: uncharacterized protein LOC104598320 [Nelumbo nucifera]
Length=364

 Score = 70.5 bits (171),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 79/302 (26%), Positives = 140/302 (46%), Gaps = 16/302 (5%)
 Frame = +3

Query  33   QEFSAAGMESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMI  212
            QEF +     A +I R +V         F     VL  P +A VL   + +     +  +
Sbjct  46   QEFDSM---DALEILRETVRILRYNSSGFLVITAVLICPVSAVVL--SNILVDHSIVKRL  100

Query  213  HARIHTLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALG---  383
              R+  +  ++G P    F      +LS+    +    P  ++F LLSKA ++ ++    
Sbjct  101  TNRLLLVAKSSGLPLK-YFIRQSCQRLSEMTISAAFCFPLYITFSLLSKAAIVYSVDCTY  159

Query  384  -DQELPKRSLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRF  560
              ++      F+ + +I   ++ T      +++   A   +LL+   N+    G  S   
Sbjct  160  SRKKFNMSKFFAVIIKIWKRVVSTYTWACMVIVGCLALFLVLLVAVCNIVSIVGCPSSVI  219

Query  561  ELFLSVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLAL  740
             ++ +V   L+ SII AN   ICNLA+V+S  E   G  A+L++ VLI+G+T   L + L
Sbjct  220  -VYPAVMMGLVFSIIFANATIICNLAIVISVLEDISGPQALLRSGVLIQGQTQVGLIIYL  278

Query  741  PINMAMAAVEALFQYRIVRV-YHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRS  917
               + MA VE LF+ R+  + Y    + I     EG L+  MY+I++++D+++   F  +
Sbjct  279  GSTIGMALVEGLFENRVKTLSYGDGPSRI----WEGPLLVIMYSIVVLVDSMMSAVFYFT  334

Query  918  CE  923
            C 
Sbjct  335  CR  336



>ref|XP_008242640.1| PREDICTED: uncharacterized protein LOC103340951 [Prunus mume]
Length=291

 Score = 69.3 bits (168),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 89/302 (29%), Positives = 133/302 (44%), Gaps = 41/302 (14%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTLFD  239
            S  +IFR S+   L     F + ++ L  P  AS+ +    +   P +     +I     
Sbjct  16   STTQIFRESIRVILLHPTHFHSISIFLFSPLPASLFISHFLLHHFPQIPSSTIKITDHIL  75

Query  240  AAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQ----ELPKRS  407
            A   P            LS+T+    L  P +++F LL +A  IQA+ D      L +R 
Sbjct  76   AHPLPK----------LLSKTIVHFVLCFPSSITFSLLGRAATIQAVSDSYNGINLDRRR  125

Query  408  LF--SCLPRIHSPLLLTQLCNSFLVLS------ANATCFILLLFAFNLADE-FGFSSPRF  560
            L   S L  I   LL T LC   +VL       A+      +LFA+ +  E  GF     
Sbjct  126  LLVRSGLNWIK--LLNTGLCELIIVLGLLGVLVASLAVVPKILFAWGVCSEVLGFWG---  180

Query  561  ELFLSVSGALLCSIILANTFTICNLALVLSGREATG-GFTAILKACVLIKGRTGTALSLA  737
               L   G   C +  A+   + NLA VLS  E    GF  ++KA  L++ +  TAL +A
Sbjct  181  --VLGFLGVPFC-VAFAHVMVVGNLARVLSVLEGECCGFETLIKAKRLMERKRKTALVMA  237

Query  738  LPINMAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRS  917
            L  N+    VE LF +R+ +       GI+    EG L+  MY++LLV DT++   F  +
Sbjct  238  LLSNVGFRLVECLFDFRMSK-------GIN--FWEGPLLVSMYSLLLVFDTVMNVVFYYA  288

Query  918  CE  923
            C+
Sbjct  289  CK  290



>ref|XP_010683099.1| PREDICTED: uncharacterized protein LOC104897842 [Beta vulgaris 
subsp. vulgaris]
Length=361

 Score = 69.7 bits (169),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 57/204 (28%), Positives = 107/204 (52%), Gaps = 10/204 (5%)
 Frame = +3

Query  327  PFTLSFFLLSKACVIQALG----DQELPKRSLFSCLPRIHSPLLLTQLCNSFLVLSANAT  494
            P  ++  LLSKA V+ ++      ++         + ++   +++T +    +++ A  T
Sbjct  125  PLYVTLSLLSKAAVVYSVDCTYTKKQFDASKFCVIVGKLWRRVVVTYVWACMVIVGA-VT  183

Query  495  CFILLLFAF-NLADEFGFSSPRFELFLSVSGALLCSIILANTFTICNLALVLSGREATGG  671
             F++LL A  N+   FGF  P   ++  +   L+ SI+ AN   +CN+A+V+S  E   G
Sbjct  184  LFLVLLVAICNVFLIFGFI-PDLVVYPGIVVGLVFSIVFANAIIVCNVAVVISVLEDASG  242

Query  672  FTAILKACVLIKGRTGTALSLALPINMAMAAVEALFQYRIVRVYHHAKTGISSVALEGML  851
              A+L++ VLI+G+T   L + L   + MA V+ LF++R+  + +      SS   EG L
Sbjct  243  PQALLRSSVLIRGQTQVGLLMYLGSTIGMAFVQGLFEHRVKTLSYGDG---SSRLWEGPL  299

Query  852  IAYMYAILLVLDTIVVCFFLRSCE  923
            +  MY+ ++++D ++   F  SC 
Sbjct  300  LVIMYSFVVLVDAMMTAVFYFSCR  323



>ref|XP_010532668.1| PREDICTED: uncharacterized protein LOC104808637 [Tarenaya hassleriana]
Length=351

 Score = 69.3 bits (168),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 56/217 (26%), Positives = 110/217 (51%), Gaps = 10/217 (5%)
 Frame = +3

Query  288  KLSQTVAISFLALPFTLSFFLLSKACVIQALG----DQELPKRSLFSCLPRIHSPLLLTQ  455
            K ++T   S +  P  ++ +LLS+A ++ ++      +++        + R+   L+ T 
Sbjct  111  KFAETAVSSAMCFPLFITLYLLSRAAIVYSVDCTYSRKKVDLSKFIVIIQRLWKRLVFTY  170

Query  456  LCNSFLVLSANATCFILLLFAFNLA-DEFGFSSPRFELFLSVSGALLCSIILANTFTICN  632
            L    +++    T F +LL A   +    GFS P    +++++  ++ S++ A+   ICN
Sbjct  171  LWVCMMIVGC-VTSFCVLLIAICSSFSVLGFS-PDSNAYVAIAVGMVFSVVFADAIIICN  228

Query  633  LALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEALFQYRIVRVYHHA  812
             ++V+   E   G  A+L+A  LIKG+T   L + L   + +A VE LF++R+  + +  
Sbjct  229  TSMVICILEDVSGPRALLRAVDLIKGQTQVGLLIFLGSTIGLAFVEGLFEHRVKTLSYGD  288

Query  813  KTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
                SS   EG L+  MY  ++++D+++   F  SC 
Sbjct  289  G---SSRIWEGPLLVVMYTFVVLIDSMMSAVFYFSCR  322



>ref|XP_002887236.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63495.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=348

 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 83/301 (28%), Positives = 142/301 (47%), Gaps = 29/301 (10%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAA----SVLVFQSFVPSSPFLAMIHARIH  227
            +A +I R +V         F   A++L  P +A    ++LV QS V S      +  R+ 
Sbjct  40   NALEILRETVRILRYNLGAFMLIALLLICPVSAILLPNLLVDQSVVNS------LTVRLL  93

Query  228  TLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRS  407
             +  ++G P    F      K S+T   S +  P  ++  LLS+A V+ ++      K+ 
Sbjct  94   LVSKSSGLPLL-PFVRNSCQKFSETAVSSAMCFPLFITLSLLSRAAVVYSVDCTYSRKKV  152

Query  408  LFS----CLPRIHSPLLLTQL--CNSFLVLSANATCFILLLFAFNLADEF---GFSSPRF  560
            + +     + R+   L++T L  C    V+    T F + L A  +   F   GFS P F
Sbjct  153  VITKFLVIMQRLWKRLVITYLWICT---VIVVCLTSFCVFLVA--VCSSFYVLGFS-PDF  206

Query  561  ELFLSVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLAL  740
              + ++   L+ S++ AN   ICN  +V+S  E   G  A+++A  LIKG+T   L + L
Sbjct  207  NAYGAILVGLVFSVVFANAIIICNTTIVISILEDVSGPQALVRASDLIKGQTQVGLLIFL  266

Query  741  PINMAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSC  920
               + +  VE LF++R+  + +      SS   EG L+  MY+ ++++DT++   F  SC
Sbjct  267  GSTIGLTFVEGLFEHRVKSLSYGDG---SSRLWEGPLLVVMYSFVVLIDTMMSAVFYFSC  323

Query  921  E  923
             
Sbjct  324  R  324



>ref|XP_010470929.1| PREDICTED: uncharacterized protein LOC104750779 [Camelina sativa]
Length=351

 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 84/301 (28%), Positives = 141/301 (47%), Gaps = 29/301 (10%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAA----SVLVFQSFVPSSPFLAMIHARIH  227
            +A +I R +V         F   A++L  P +A    ++LV QS V S      +  R+ 
Sbjct  43   NALEILRETVRILRYNLGAFMLIALLLICPVSAILLPNLLVDQSVVNS------LTVRLL  96

Query  228  TLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRS  407
             +  ++G P    F      K S+T   S +  P  ++  LLS+A V+ ++      K+ 
Sbjct  97   LVSKSSGLPLL-PFVRNSCQKFSETAVSSAMCFPLFITLSLLSRAAVVYSVDCTYSRKKV  155

Query  408  LFS----CLPRIHSPLLLTQL--CNSFLVLSANATCFILLLFAFNLADEF---GFSSPRF  560
            + S     + R+   L++T L  C    V+    T F + L A  +   F   GFS P F
Sbjct  156  VMSKFVVIMQRLWKRLVITYLWICT---VIVVCLTSFCVFLVA--VCSSFYVLGFS-PGF  209

Query  561  ELFLSVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLAL  740
              + ++   L+ S++ AN   ICN  +V+S  E   G  A+L+A  LIKG+T   L + L
Sbjct  210  NAYGAILVGLVFSVVFANVIIICNTTIVISILEDVSGPEALLRASDLIKGQTQVGLLIFL  269

Query  741  PINMAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSC  920
               + +  VE LF++R+  + +      S    EG L+  MY+ ++++DT++   F  SC
Sbjct  270  GSTIGLTFVEGLFEHRVKSLSYGDG---SPRLWEGPLLVVMYSFVVLIDTMMSAVFYFSC  326

Query  921  E  923
             
Sbjct  327  R  327



>ref|XP_006391017.1| hypothetical protein EUTSA_v10018794mg [Eutrema salsugineum]
 gb|ESQ28303.1| hypothetical protein EUTSA_v10018794mg [Eutrema salsugineum]
Length=350

 Score = 68.9 bits (167),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 84/299 (28%), Positives = 141/299 (47%), Gaps = 25/299 (8%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAA----SVLVFQSFVPSSPFLAMIHARIH  227
            +A +I R +V         F   A +L  P +A    ++LV QS V S      +  R+ 
Sbjct  37   NALEILRETVRILRYNLAAFMLIAALLICPVSAILLPNLLVDQSVVNS------LTVRLL  90

Query  228  TLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRS  407
             +  ++G P    F      K S+T   S +  P  ++  LLS+A V+ ++      ++ 
Sbjct  91   LVAKSSGLPLL-PFVRNSCQKFSETAVSSAMCFPLFITLSLLSRAAVVYSVDCTYSRRKV  149

Query  408  LFS----CLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEF---GFSSPRFEL  566
            + S     + R+   L+ T L    LV+    T F + L A  +   F   GFS P F  
Sbjct  150  VMSKFLVIMQRLWKRLVFTYLWVC-LVIVVCLTSFCVFLVA--VCSSFFVLGFS-PDFNA  205

Query  567  FLSVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPI  746
            + ++   L+ S++ AN   ICN  +V+S  E   G  A+++A  LIKG+T   L + L  
Sbjct  206  YGAILVGLVFSVVFANVIIICNTTVVISILEDVSGPLALVRANDLIKGQTQVGLLIFLGS  265

Query  747  NMAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
             + +  VE LF++R V++  +     SS   EG L+  MY+ ++++DT++   F  SC 
Sbjct  266  TIGLTFVEGLFEHR-VKILSYGDG--SSRIWEGPLLVVMYSFVVLVDTMMSAVFYFSCR  321



>gb|KEH30805.1| transmembrane protein, putative [Medicago truncatula]
Length=358

 Score = 68.9 bits (167),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 63/216 (29%), Positives = 107/216 (50%), Gaps = 8/216 (4%)
 Frame = +3

Query  288  KLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKR---SLFSCLPRIHSPLLLTQL  458
            + + TV  S +  P   +  LLSK  V+ ++      K+   S F  +       +L   
Sbjct  119  RFADTVIASAMCFPLYATLLLLSKTAVVYSVDCTYSRKKFDGSKFCVIVAKFWRKILATY  178

Query  459  CNSFLVLSANATCFILLLFAFNLA-DEFGFSSPRFELFLSVSGALLCSIILANTFTICNL  635
              +  V+    T F + L AF  A    GFS P   ++ ++   L+ S++ AN   IC++
Sbjct  179  MWACTVIVGCITMFCVFLVAFCSALAVLGFS-PNVVVYAALMVGLVFSVVFANAIIICSV  237

Query  636  ALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEALFQYRIVRVYHHAK  815
            ALV+S  E   G  A+L++ +LIKG+T   L + L   + MA VE LF++R+  + +   
Sbjct  238  ALVISVLEDVSGAQAMLRSSILIKGQTQVGLLIYLGSTIGMAFVEGLFEHRVKTLSYGDG  297

Query  816  TGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
               SS   EG L+  MY+ ++++D+++   F  SC 
Sbjct  298  ---SSRMWEGPLLVIMYSFVVLIDSMMSAVFYFSCR  330



>ref|XP_003607775.1| ATP synthase subunit beta [Medicago truncatula]
Length=409

 Score = 68.2 bits (165),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 80/143 (56%), Gaps = 5/143 (3%)
 Frame = +3

Query  495  CFILLLFAFNLADEFGFSSPRFELFLSVSGALLCSIILANTFTICNLALVLSGREATGGF  674
            C  L+ F   LA   GFS P   ++ ++   L+ S++ AN   IC++ALV+S  E   G 
Sbjct  193  CVFLVAFCSALA-VLGFS-PNVVVYAALMVGLVFSVVFANAIIICSVALVISVLEDVSGA  250

Query  675  TAILKACVLIKGRTGTALSLALPINMAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLI  854
             A+L++ +LIKG+T   L + L   + MA VE LF++R+  + +      SS   EG L+
Sbjct  251  QAMLRSSILIKGQTQVGLLIYLGSTIGMAFVEGLFEHRVKTLSYGDG---SSRMWEGPLL  307

Query  855  AYMYAILLVLDTIVVCFFLRSCE  923
              MY+ ++++D+++   F  SC 
Sbjct  308  VIMYSFVVLIDSMMSAVFYFSCR  330



>ref|XP_006302541.1| hypothetical protein CARUB_v10020641mg [Capsella rubella]
 gb|EOA35439.1| hypothetical protein CARUB_v10020641mg [Capsella rubella]
Length=328

 Score = 67.4 bits (163),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 83/301 (28%), Positives = 141/301 (47%), Gaps = 29/301 (10%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAA----SVLVFQSFVPSSPFLAMIHARIH  227
            +A +I R +V         F   A++L  P +A    ++LV QS V S      +  R+ 
Sbjct  20   NALEILRETVRILRYNLGAFMLIALLLICPVSAILLPNLLVDQSVVNS------LTVRLL  73

Query  228  TLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRS  407
             +  ++G P    F      K S+T   S +  P  ++  LLS+A V+ ++      K+ 
Sbjct  74   LVSKSSGLPLL-PFVRNSCQKFSETAVSSAMCFPLFITLSLLSRAAVVYSVDCTYSRKKV  132

Query  408  LFS----CLPRIHSPLLLTQL--CNSFLVLSANATCFILLLFAFNLADEF---GFSSPRF  560
            + S     + R+   L++T L  C    V+    T F + L A  +   F   GFS P F
Sbjct  133  VISKFVVIMQRLWKRLVITYLWICT---VIVVCLTSFCVFLVA--VCSSFYVLGFS-PDF  186

Query  561  ELFLSVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLAL  740
              + ++   L+ S++ A+   ICN  +V+S  E   G  A+++A  LIKG+T   L + L
Sbjct  187  NAYGAILVGLVFSVVFADAIIICNTTVVISILEDVSGPQALVRASDLIKGQTQVGLLIFL  246

Query  741  PINMAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSC  920
               + +  VE LF++R+  + +      SS   EG L+  MY  ++++DT++   F  SC
Sbjct  247  GSTIGLTFVEGLFEHRVKSLSYGDG---SSRLWEGPLLVVMYTFVVLIDTMMSAVFYFSC  303

Query  921  E  923
             
Sbjct  304  R  304



>ref|XP_006476100.1| PREDICTED: uncharacterized protein LOC102625444 [Citrus sinensis]
 gb|KDO54170.1| hypothetical protein CISIN_1g028728mg [Citrus sinensis]
Length=205

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 97/207 (47%), Gaps = 18/207 (9%)
 Frame = +3

Query  327  PFTLSFFLLSKACVIQALGDQ----ELPKRSLFSCLPRIHSPLLLTQLCNSFLVLSANAT  494
            P  ++F L+ +A  IQA+ D      L +R L +        LL T     F+VL     
Sbjct  8    PSFITFSLIGRAATIQAVSDNYNGISLDRRRLLTKSGMTWIKLLHTSFWEFFIVLGLFGA  67

Query  495  CFILLLFAFNLADEFGFSSPRFELFLSVSGAL---LCSIILANTFTICNLALVLSGREAT  665
              I L     L    G  S R   FL V G L    C ++ A    + NLA VLS  E+ 
Sbjct  68   LLISLATVPKLLFSMGLLSSRMLGFLCVLGFLGIPFC-VVFAQLMVVGNLAKVLSVLESE  126

Query  666  -GGFTAILKACVLIKGRTGTALSLALPINMAMAAVEALFQYRIVRVYHHAKTGISSVALE  842
              G  ++LKA  L+KGR  TAL + L  NM++  VE LF++RI R        IS    E
Sbjct  127  CYGLESLLKANNLMKGRRQTALIMTLLSNMSLRLVEFLFEFRICR-------DIS--IWE  177

Query  843  GMLIAYMYAILLVLDTIVVCFFLRSCE  923
              L+  MY+ +LV D+++   F  +C+
Sbjct  178  APLLVSMYSSVLVFDSVMNVVFYYACK  204



>emb|CAN79522.1| hypothetical protein VITISV_034628 [Vitis vinifera]
Length=388

 Score = 67.4 bits (163),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 85/307 (28%), Positives = 137/307 (45%), Gaps = 39/307 (13%)
 Frame = +3

Query  33   QEFSAAGMESAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFV---PSSPFL  203
            Q   +  + + A+IFR ++         F + ++ L  P   S+ +    +   P  P +
Sbjct  7    QVLESIHLMNTAQIFREAIRIIFLHPTHFHSISIFLFSPLPISLFMSHFLIHQFPQIP-I  65

Query  204  AMIHARIHTLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALG  383
            + + A  H+L      P        L   L +T+    +  P  ++F LL  A  +QA+ 
Sbjct  66   SALKAIDHSLXQHGVLP--------LPKLLPKTLVHIIICFPSIITFSLLGIAATVQAVS  117

Query  384  DQ----ELPKRSLFSCLPRIHSPLLLTQLCNSFLVLS------ANATCFILLLFAFNLAD  533
            D      L +R L      +   LL T      +VL       A+      +LFAF +  
Sbjct  118  DGYHGINLDRRRLLMRSGLVWVKLLHTSFWEFLIVLGLFGALVASLATVPKILFAFGVCS  177

Query  534  E-FGFSSPRFELFLSVSGALLCSIILANTFTICNLALVLSGREAT-GGFTAILKACVLIK  707
               GF S      L  +G   C ++ A+   + NLA V+S  E+   GF +I+KA  L++
Sbjct  178  RVLGFFS-----VLGFAGIPFC-VVFAHVMIVGNLARVVSVVESECYGFDSIVKAKRLME  231

Query  708  GRTGTALSLALPINMAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLD  887
            GR  TAL +AL  N+    VE LF++R+        TG+S    EG L+  MY+++LVLD
Sbjct  232  GRRHTALVMALLSNVGFRLVECLFEFRMC-------TGMS--LWEGPLLVSMYSLVLVLD  282

Query  888  TIVVCFF  908
            T++   F
Sbjct  283  TVMNAVF  289



>ref|XP_010108724.1| hypothetical protein L484_015713 [Morus notabilis]
 gb|EXC20035.1| hypothetical protein L484_015713 [Morus notabilis]
Length=358

 Score = 66.2 bits (160),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 106/208 (51%), Gaps = 8/208 (4%)
 Frame = +3

Query  312  SFLALPFTLSFFLLSKACVIQALG----DQELPKRSLFSCLPRIHSPLLLTQLCNSFLVL  479
            S +  P  +S  LLSKA V+ A+      ++      F+ + +I   L+ T +    +++
Sbjct  126  SVMCFPLYVSLSLLSKAAVVYAVDCSYSRKQFDSSKFFAIIRKIWKRLVSTYIWVCMVIV  185

Query  480  SANATCFILLLFAFNLADEFGFSSPRFELFLSVSGALLCSIILANTFTICNLALVLSGRE  659
                  F++L    N+     ++ P   ++ +V+  L+ S++ AN   +C++A+V+S  E
Sbjct  186  GCITLFFVILAAVCNVLSII-WAPPDVVVYAAVAVGLVFSVVFANAVIVCSIAVVISVLE  244

Query  660  ATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEALFQYRIVRVYHHAKTGISSVAL  839
               G  A+ ++ VLIKG+T   L + L   + MA VE LF++R+  + +      SS   
Sbjct  245  DVSGPEALFRSGVLIKGQTHVGLLIFLGSAIGMAFVEGLFEHRVKTLSYGDG---SSRMW  301

Query  840  EGMLIAYMYAILLVLDTIVVCFFLRSCE  923
            EG L+  M + ++++D+++   F  SC 
Sbjct  302  EGPLLVLMNSFVVLIDSMMSAVFYYSCR  329



>ref|XP_004962922.1| PREDICTED: uncharacterized protein LOC101765523 [Setaria italica]
Length=333

 Score = 65.5 bits (158),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 87/149 (58%), Gaps = 13/149 (9%)
 Frame = +3

Query  555  RFELFLSVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKA--CVLIKGRTGTAL  728
            R  L LS +G ++ S+ LAN   +CNLA V++  E  GG  A+LKA   VL  G   TA+
Sbjct  189  RAVLALSAAGVIVYSVALANASAVCNLATVVAAAEGRGGAHAMLKALLMVLRAGDAATAV  248

Query  729  SLALPINMAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFF  908
            + +LP ++A AAVEALFQ R++R Y       + +  EG+L+AY++A++ VLDT++    
Sbjct  249  AASLPASLAAAAVEALFQLRVMRPYTLTGKVTAGMLCEGLLVAYIHAMICVLDTVITSMV  308

Query  909  LRSCEG--DCHIDQYRRLPSHVEIEEDNN  989
             ++C+    CH+         +E+E D  
Sbjct  309  YQTCKASHSCHL---------LELELDGK  328



>ref|NP_177102.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAG60093.1|AC073178_4 unknown protein [Arabidopsis thaliana]
 gb|AAX55097.1| hypothetical protein At1g69430 [Arabidopsis thaliana]
 gb|AAZ52711.1| hypothetical protein At1g69430 [Arabidopsis thaliana]
 gb|AEE34924.1| uncharacterized protein AT1G69430 [Arabidopsis thaliana]
Length=350

 Score = 65.5 bits (158),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 82/301 (27%), Positives = 141/301 (47%), Gaps = 29/301 (10%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAA----SVLVFQSFVPSSPFLAMIHARIH  227
            +A +I R +V         F   A++L  P +A    ++LV QS V S      +  R+ 
Sbjct  42   NALEILRETVRILRYNLGAFMLIALLLICPVSAILLPNLLVDQSVVNS------LTVRLL  95

Query  228  TLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALG----DQEL  395
             +  ++G P    F      K S+T   S +  P  ++  LLS+A V+ ++      +++
Sbjct  96   LVSKSSGLPLL-PFVRNSCQKFSETAVSSAMCFPLFITLSLLSRAAVVYSVDCTYSRKKV  154

Query  396  PKRSLFSCLPRIHSPLLLTQL--CNSFLVLSANATCFILLLFAFNLADEF---GFSSPRF  560
                    + R+   L++T L  C    V+    T F + L A  +   F   GFS P F
Sbjct  155  VVTKFVVIMQRLWKRLVITYLWICT---VIVVCLTSFCVFLVA--VCSSFYVLGFS-PDF  208

Query  561  ELFLSVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLAL  740
              + ++   L+ S++ AN   ICN  +V+S  E   G  A+++A  LIKG+T   L + L
Sbjct  209  NAYGAILVGLVFSVVFANAIIICNTTIVISILEDVSGPGALVRASDLIKGQTQVGLLIFL  268

Query  741  PINMAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSC  920
               + +  VE LF++R+  + +      SS   EG L+  MY+ ++++DT++   F  SC
Sbjct  269  GSTIGLTFVEGLFEHRVKSLSYGDG---SSRLWEGPLLVVMYSFVVLIDTMMSAVFYFSC  325

Query  921  E  923
             
Sbjct  326  R  326



>ref|XP_010419096.1| PREDICTED: uncharacterized protein LOC104704761 [Camelina sativa]
Length=320

 Score = 65.5 bits (158),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 70/128 (55%), Gaps = 4/128 (3%)
 Frame = +3

Query  540  GFSSPRFELFLSVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTG  719
            GFS P F  + ++   L+ S++ AN   ICN  +V+S  E   G  A+L+A  LIKG+T 
Sbjct  173  GFS-PDFSAYGAILVGLVFSVVFANVIIICNTTIVISILEDVSGPEALLRASDLIKGQTQ  231

Query  720  TALSLALPINMAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVV  899
              L + L   + +  VE LF++R+  + +      SS   EG L+  MY+ ++++DT++ 
Sbjct  232  VGLLIFLGSTIGLTFVEGLFEHRVKSLSYGDG---SSRLWEGPLLVVMYSFVVLIDTMMS  288

Query  900  CFFLRSCE  923
              F  SC 
Sbjct  289  AVFYFSCR  296



>gb|EPS58318.1| hypothetical protein M569_16497, partial [Genlisea aurea]
Length=339

 Score = 65.1 bits (157),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 87/302 (29%), Positives = 136/302 (45%), Gaps = 31/302 (10%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAA----SVLVFQSFVPSSPFLAMIHARIH  227
            +A +I R ++    Q      +   VL  P +A    SVLV +S V       MI A+  
Sbjct  46   NALEILRETIRILRQSSAALLSVTAVLICPVSAVFLSSVLVDESVVKWLTLHLMIVAKSG  105

Query  228  TLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALG--------  383
             L        S + F+    +++ + A+ F   P   S  LLSKA V+ ++G        
Sbjct  106  GLPLDPVVKRSCQRFS----EMAVSAAVCF---PLFTSALLLSKAAVVFSIGCTYSGKQF  158

Query  384  DQELPKRSLFSCLPRIHSPLLL--TQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPR  557
            D  + K  +     RI S  LL  T LC  ++ +      F+ LLFA       GFSS  
Sbjct  159  DPTIFKLIVSKIWKRILSTYLLVCTVLCCCYVAMIILLNAFVALLFAV------GFSSDS  212

Query  558  FELFLSVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLA  737
                  V G    +++LAN     N+A+V S  E   G  A+L++  L++GR    + + 
Sbjct  213  MLYAAFVVGPAF-AVVLANATVASNVAVVASILEEVSGPRALLRSLSLVRGRRHVGMVMF  271

Query  738  LPINMAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRS  917
            L   +    VE LF++R VRV  +     SS   EG L+ +M++ LL++DT++   F   
Sbjct  272  LGSTVGTVFVEGLFEHR-VRVISYGDG--SSRLWEGPLLVFMHSFLLLIDTMMNAIFYFD  328

Query  918  CE  923
            C+
Sbjct  329  CK  330



>ref|XP_009105492.1| PREDICTED: uncharacterized protein LOC103831343 [Brassica rapa]
Length=340

 Score = 65.1 bits (157),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 65/220 (30%), Positives = 109/220 (50%), Gaps = 16/220 (7%)
 Frame = +3

Query  288  KLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSLFSC-----LPRIHSPLLLT  452
            K S+T   S    P  ++  LLS+A V+ ++ D    +R + +      + R+   L+ T
Sbjct  98   KFSETAVSSAACFPLFVTLSLLSRAAVVYSV-DCTYSRRKVVATKFVVIMQRLWKRLVFT  156

Query  453  QLCNSFLVLSANATCFILLLFAFNLADEF---GFSSPRFELFLSVSGALLCSIILANTFT  623
             L    +V+    T F + L A  +   F   GFS P F  + ++   L  S++ AN   
Sbjct  157  YLWVC-VVIVVCLTSFCVFLVA--VCSSFFVLGFS-PDFNAYGAILIGLGFSVVFANVII  212

Query  624  ICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEALFQYRIVRVY  803
            ICN  +V+S  E   G  A+++A  LIKG+T   L + L   + +  VE LF++R V++ 
Sbjct  213  ICNTTIVISILEDVSGPRALVRANDLIKGQTQVGLLIFLGSTIGLTFVEGLFEHR-VKIL  271

Query  804  HHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
             +     SS   EG L+  MY+ ++++DT++   F  SC 
Sbjct  272  SYGDG--SSRIWEGPLLVVMYSFVVLIDTMMSAVFYFSCR  309



>gb|AAK59463.1| unknown protein [Arabidopsis thaliana]
 gb|AAL34175.1| unknown protein [Arabidopsis thaliana]
Length=138

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 60/109 (55%), Gaps = 3/109 (3%)
 Frame = +3

Query  597  SIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEAL  776
            S++ AN   ICN A+V+S  E   G  A+++A  LIKG+    L + L   + +A VE L
Sbjct  8    SVVFANAIIICNTAIVISVLEDVSGLGALMRASDLIKGQIQVGLLMFLGSTLGLAFVEGL  67

Query  777  FQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
            F +R+ +V +      SS   EG L+  MY+ + ++D+++   F  SC 
Sbjct  68   FDHRVKKVSYGDG---SSRLWEGPLLVLMYSFVTLIDSMMSAVFYFSCR  113



>emb|CDX95932.1| BnaA07g27990D [Brassica napus]
Length=317

 Score = 64.3 bits (155),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 65/220 (30%), Positives = 109/220 (50%), Gaps = 16/220 (7%)
 Frame = +3

Query  288  KLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSLFSC-----LPRIHSPLLLT  452
            K S+T   S    P  ++  LLS+A V+ ++ D    +R + +      + R+   L+ T
Sbjct  75   KFSETAVSSAACFPLFVTLSLLSRAAVVYSV-DCTYSRRKVVATKFVVIMQRLWKRLVFT  133

Query  453  QLCNSFLVLSANATCFILLLFAFNLADEF---GFSSPRFELFLSVSGALLCSIILANTFT  623
             L    +V+    T F + L A  +   F   GFS P F  + ++   L  S++ AN   
Sbjct  134  YLWVC-VVIVVCLTSFCVFLVA--VCSSFFVLGFS-PDFNAYGAILIGLGFSVVFANVII  189

Query  624  ICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEALFQYRIVRVY  803
            ICN  +V+S  E   G  A+++A  LIKG+T   L + L   + +  VE LF++R V++ 
Sbjct  190  ICNTTIVISILEDVSGPRALVRANDLIKGQTQVGLLIFLGSTIGLTFVEGLFEHR-VKIL  248

Query  804  HHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
             +     SS   EG L+  MY+ ++++DT++   F  SC 
Sbjct  249  SYGDG--SSRIWEGPLLVVMYSFVVLIDTMMSAVFYFSCR  286



>ref|XP_010552565.1| PREDICTED: uncharacterized protein LOC104822905 [Tarenaya hassleriana]
Length=351

 Score = 64.7 bits (156),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 78/300 (26%), Positives = 136/300 (45%), Gaps = 27/300 (9%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAA----SVLVFQSFVPSSPFLAMIHARIH  227
            +A +I R +V         F  T  VL  P +A    ++LV +S V       +I A+  
Sbjct  38   NALEILRETVRILRYNLGAFMLTTAVLICPVSAILLPNLLVDESIVKRFTVRLLIVAK--  95

Query  228  TLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALG----DQEL  395
                + G P    F      K ++T   S +  P  ++  LLS+A V+ ++      +++
Sbjct  96   ----SNGLPLKP-FVKHSCQKFAETAVSSAMCFPLFITLSLLSRAAVVYSVDCTYSRKKV  150

Query  396  PKRSLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLS  575
                    + R+   L+LT L    +V+    T F +LL     +    FS   F L  +
Sbjct  151  DISKFIVIVQRLWKRLVLTYLWMC-MVIVGCLTSFCVLLITICSS----FSVLGFSLDFN  205

Query  576  VSGALLC----SIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALP  743
              GA++     S++ A+   ICN  +V+   E   G  A+++A  LIKG+T   L + L 
Sbjct  206  AHGAIVVGMVFSVVFADAIIICNTGIVICILEDVSGAGALVRAIDLIKGQTQVGLLIFLG  265

Query  744  INMAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
              + +A VE LF++R+  + +      SS   EG L+  MY+ ++++D+++   F  SC 
Sbjct  266  STIGLAFVEGLFEHRVKTLSYGDG---SSRVWEGPLLVMMYSFVVLIDSMMSVVFYFSCR  322



>emb|CDY40929.1| BnaC06g30670D [Brassica napus]
Length=317

 Score = 64.3 bits (155),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 65/220 (30%), Positives = 109/220 (50%), Gaps = 16/220 (7%)
 Frame = +3

Query  288  KLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKRSLFSC-----LPRIHSPLLLT  452
            K S+T   S    P  ++  LLS+A V+ ++ D    +R + +      + R+   L+ T
Sbjct  75   KFSETAVSSAACFPLFVTLSLLSRAAVVYSV-DCTYSRRRVVAAKFVVIMQRLWKRLVFT  133

Query  453  QLCNSFLVLSANATCFILLLFAFNLADEF---GFSSPRFELFLSVSGALLCSIILANTFT  623
             L    +V+    T F + L A  +   F   GFS P F  + ++   L  S++ AN   
Sbjct  134  YLWVC-VVIVVCLTSFCVFLVA--VCSSFFVLGFS-PDFNAYGAIFIGLGFSVVFANVII  189

Query  624  ICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEALFQYRIVRVY  803
            ICN  +V+S  E   G  A+++A  LIKG+T   L + L   + +  VE LF++R V++ 
Sbjct  190  ICNTTIVISILEDVSGPRALVRANDLIKGQTQVGLLIFLGSTIGLTFVEGLFEHR-VKIL  248

Query  804  HHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
             +     SS   EG L+  MY+ ++++DT++   F  SC 
Sbjct  249  SYGDG--SSRIWEGPLLVVMYSFVVLIDTMMSAVFYFSCR  286



>ref|XP_010088844.1| hypothetical protein L484_020828 [Morus notabilis]
 gb|EXB37041.1| hypothetical protein L484_020828 [Morus notabilis]
Length=267

 Score = 63.5 bits (153),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 64/223 (29%), Positives = 103/223 (46%), Gaps = 27/223 (12%)
 Frame = +3

Query  291  LSQTVAISFLALPFTLSFFLLSKACVIQALGD---------QELPKRSLFSCLPRIHSPL  443
            LS+T+    +  P + +F LL KA  +QA+ D         + L  RS  S +  +H   
Sbjct  56   LSKTMLHIIICFPLSTTFSLLGKAATVQAVSDSYNGINLDGRRLLIRSGVSWIKLLH---  112

Query  444  LLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSP--RFELFLSVSGALLCSIILANT  617
              T    S +VL       + L     +    G  S    F   L   G   C +  A+ 
Sbjct  113  --TTFWESLIVLGLIGVLVVNLAIVPKILHMCGICSEVLGFWGVLGFLGIPFC-VAFAHV  169

Query  618  FTICNLALVLSGREAT-GGFTAILKACVLIKGRTGTALSLALPINMAMAAVEALFQYRIV  794
              + N+A V+S  E    GF  +L+A  L++GR  TAL +AL  NM +  VE +F++R+ 
Sbjct  170  MVVGNMARVISVLEGECYGFETLLRAKTLMEGRRQTALIMALLSNMGLRLVECVFEFRMC  229

Query  795  RVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
            +       GI+    EG ++  MY+++LV DT++   F  +C+
Sbjct  230  K-------GIN--LWEGPVLVSMYSLVLVFDTVMNVVFYYACK  263



>ref|XP_006359583.1| PREDICTED: uncharacterized protein LOC102587208 [Solanum tuberosum]
Length=363

 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 81/297 (27%), Positives = 148/297 (50%), Gaps = 21/297 (7%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAA----SVLVFQSFVPSSPFLAMIHARIH  227
            +A +I R +V         F T A +L  P +A    +VLV+Q      PF+  +  R+ 
Sbjct  48   NALEILRETVRILRYNSIGFMTIAALLICPVSAVVLSNVLVYQ------PFVTRLSMRLL  101

Query  228  TLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALG----DQEL  395
             +   +G P    F      K S+ V  + +  P  ++  LLSKA ++ ++      ++ 
Sbjct  102  LVAKTSGLPLK-PFIKQSCHKFSEVVISAVMCFPLYVTLSLLSKAAIVYSVDCTYSRKKF  160

Query  396  PKRSLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFN-LADEFGFSSPRFELFL  572
              +  +  + +I   +++T L    +V++   T FI+LL + + +    GF  P   L+ 
Sbjct  161  DSQKFYLIMTKIWKRVVVTYLWVC-VVIAGCLTLFIVLLVSVSSVFSIMGFP-PDLILYP  218

Query  573  SVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINM  752
            ++   ++ SIILAN   ICN+A+V+S  E   G  A+L +  LIKG+T   L + L   +
Sbjct  219  AMVVGMIFSIILANAIIICNIAIVISVLEDDSGPQALLMSSSLIKGQTQVGLLIFLGSTI  278

Query  753  AMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
             MA V+ LF++R+  + +      SS   EG L+  +Y+ ++++D+++   F  SC+
Sbjct  279  GMAIVQGLFEHRVKTISYGDG---SSRLWEGPLLVILYSFVILIDSMMSTVFYFSCK  332



>ref|XP_007158630.1| hypothetical protein PHAVU_002G168800g [Phaseolus vulgaris]
 gb|ESW30624.1| hypothetical protein PHAVU_002G168800g [Phaseolus vulgaris]
Length=357

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 79/305 (26%), Positives = 140/305 (46%), Gaps = 23/305 (8%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTLFD  239
            +A  I R +V         F   AV+L  P +A +L   + +     +  +  R+  +  
Sbjct  45   NALDILRETVRILRFNSWGFVAIAVMLICPVSAVLL--SNVIVDMTIVKNLSIRLMLVAQ  102

Query  240  AAGFPSSSEFFTILNL---KLSQTVAISFLALPFTLSFFLLSKACVIQALG----DQELP  398
            A+G P       I+     + ++TV  S +  P   +  LLSKA ++ ++      ++  
Sbjct  103  ASGLP----LRPIIKQSCQRFAETVVSSAMCFPLYSTLLLLSKAGIVYSVDCTYSRKKFD  158

Query  399  KRSLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSV  578
                   + +I   +L T L    LV+    T F + L AF  A      SP   ++ ++
Sbjct  159  ASKFCVIVSKIWRKILFTYLWGCALVVGC-ITLFCVFLVAFCSALAVLRFSPDIVVYCAM  217

Query  579  SGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAM  758
               L+ S++ AN   ICN+++V+S  E   G  A+L++ +LIKG+T   L + L   + M
Sbjct  218  MVGLVFSVVFANAIIICNISIVISVLEDVSGAQAMLRSSILIKGQTQVGLLIFLGSTIGM  277

Query  759  AAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE-----  923
            A VE LF++R+  + +      SS   EG L+  MY+ ++++D+++   F  SC      
Sbjct  278  AFVEGLFEHRVKTLSYGDG---SSRVWEGPLLVVMYSFVVLIDSMMSAVFYFSCRSSSLE  334

Query  924  -GDCH  935
              DC 
Sbjct  335  ISDCE  339



>ref|XP_004228368.1| PREDICTED: uncharacterized protein LOC101245192 [Solanum lycopersicum]
Length=363

 Score = 61.6 bits (148),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 80/297 (27%), Positives = 147/297 (49%), Gaps = 21/297 (7%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAA----SVLVFQSFVPSSPFLAMIHARIH  227
            SA +I R +V         F T A +L  P +A    +VLV+Q      PF+  +  R+ 
Sbjct  48   SALEILRETVRILRYNSIGFMTIAALLICPVSAVVLSNVLVYQ------PFVTRLSMRLL  101

Query  228  TLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALG----DQEL  395
             +   +G P    F      K S+ V  + +  P  ++  + SKA ++ ++      ++ 
Sbjct  102  LVAKTSGLPLE-PFIKQSCHKFSEVVISAVMCFPLYVTLSVFSKAAIVYSVDCTYSRKKF  160

Query  396  PKRSLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFN-LADEFGFSSPRFELFL  572
              +  +  + +I   +++T L    +V++   T FI+LL + + +    GF  P   L+ 
Sbjct  161  DSQKFYVIMTKIWKRVVVTYLWVC-VVIAGCLTLFIVLLVSVSSVFSIMGFP-PDLILYP  218

Query  573  SVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINM  752
            ++   ++ SIILAN   ICN+A+V+S  E   G  A+L +  LIKG+T   L + L   +
Sbjct  219  AMIVGMIFSIILANAIIICNIAIVISVLEDDSGPQALLMSSSLIKGQTQVGLLIFLGSTI  278

Query  753  AMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
             MA V+ LF++R+  + +      SS   EG L+  +Y+ ++++D+++   F  SC+
Sbjct  279  GMAIVQGLFEHRVKTISYGDG---SSRLWEGPLLVILYSFVILIDSMMSTVFYFSCK  332



>ref|XP_009421085.1| PREDICTED: uncharacterized protein LOC104000701 [Musa acuminata 
subsp. malaccensis]
Length=327

 Score = 60.5 bits (145),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 71/134 (53%), Gaps = 6/134 (4%)
 Frame = +3

Query  588  LLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAV  767
            L+ SI+ A+T  +CNLA V+S  E   G  A L++  LI+G+    L + L   + M  V
Sbjct  191  LVFSIVYAHTIIVCNLAGVVSVLEEISGLRAFLRSVRLIRGKRQVGLLMFLGSTIGMGFV  250

Query  768  EALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHIDQY  947
            + LF++R+  V +      SS   EG L+ +MY+ ++++D+++   F  +C     I + 
Sbjct  251  QGLFEHRVKTVSYGDG---SSRLWEGPLLVFMYSFVVLVDSMMSAVFYFTCRSS--IIEE  305

Query  948  RRLPSHVEIEEDNN  989
                 H E+EE  N
Sbjct  306  TDEDVH-ELEEKEN  318



>ref|XP_009786893.1| PREDICTED: uncharacterized protein LOC104234939 [Nicotiana sylvestris]
Length=360

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 80/295 (27%), Positives = 146/295 (49%), Gaps = 17/295 (6%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTLFD  239
            +A +I R +V         F   A +L  P +A VL   + + +   +  +  R+  +  
Sbjct  48   NALEILRETVRILRYNSIGFMAIAALLICPVSAVVL--SNVLVNHSLVKRLTIRLLLVAK  105

Query  240  AAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALG----DQELPKRS  407
            ++G P    F      K S+ V  + +  P  ++  LLSKA ++ ++      ++   + 
Sbjct  106  SSGLPLK-PFIKQSCQKFSEVVISAVMCFPLYVTLSLLSKAAIVYSVDCTYSRKKFDSQK  164

Query  408  LFSCLPRIHSPLLLTQL--CNSFLVLSANATCFILLLFAFNLA-DEFGFSSPRFELFLSV  578
             +  + +I   ++LT L  C    V+S   T FI+L+ + + A    GF  P   L+ ++
Sbjct  165  FYVIMTKIWKRVVLTYLWVCT---VISGCFTLFIVLVVSVSSAFSIMGFP-PDLILYPAM  220

Query  579  SGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAM  758
               ++ SIILAN   ICN+A+V+S  E   G  A+L++  LIKG+T   L + L   + M
Sbjct  221  VVGMIFSIILANAIIICNIAIVISVLEDESGPQALLRSSSLIKGQTQVGLLIFLGSTIGM  280

Query  759  AAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
            A VE LF++R+  + +      SS   EG L+  +Y+ ++++D+++   F  SC+
Sbjct  281  AIVEGLFEHRVKTISYGDG---SSRLWEGPLLVLLYSFVMLIDSMMSTVFYFSCK  332



>ref|XP_009404772.1| PREDICTED: uncharacterized protein LOC103988010 [Musa acuminata 
subsp. malaccensis]
Length=332

 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 63/109 (58%), Gaps = 3/109 (3%)
 Frame = +3

Query  597  SIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEAL  776
            S+  A+T  +CNLA V+S  E   G  A+L++  LI+G+T   L + L   + MA VE L
Sbjct  200  SMAYAHTIIVCNLASVISVLEEVSGLLALLRSVRLIRGQTQAGLLMFLGSTIGMAFVEGL  259

Query  777  FQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
            F++R+  + +      SS   EG L+ +MY+ ++++D+++   F  +C 
Sbjct  260  FEHRVKTLSYGNG---SSRLWEGPLLVFMYSFVVLIDSMMSAVFYFTCR  305



>ref|XP_008787101.1| PREDICTED: uncharacterized protein LOC103705238 [Phoenix dactylifera]
Length=346

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/152 (30%), Positives = 79/152 (52%), Gaps = 12/152 (8%)
 Frame = +3

Query  504  LLLFAFNLADEFGFSSPRFELFLSVSGALLCSIILANTFTICNLALVLSGREATGGFTAI  683
            LL+   N     G+  P   ++ ++   L+ S++ A+T  +CNLA V+S  E   G  A+
Sbjct  183  LLVMVCNAFAALGYP-PEIVVYPALFTVLVFSMVYAHTIIVCNLATVISILEDVWGPQAL  241

Query  684  LKACVLIKGRTGTALSLALPINMAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYM  863
            +++  LIKG+T   L + L   + MA VE LF++R+  + +      SS   EG L+  M
Sbjct  242  VRSVHLIKGQTQAGLLIFLGSTIGMAFVEGLFEHRVKTLSYGDG---SSRLWEGPLLVLM  298

Query  864  YAILLVLDTIVVCFFLRSC--------EGDCH  935
            Y+ ++++D+++   F  +C         GD H
Sbjct  299  YSFVVLVDSMMSAVFYFTCRSSTMEVLNGDDH  330



>ref|XP_010936511.1| PREDICTED: uncharacterized protein LOC105056132 [Elaeis guineensis]
Length=346

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 79/312 (25%), Positives = 144/312 (46%), Gaps = 20/312 (6%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTLFD  239
            +A +I R +V         F T   +L  P +A++L   + V ++   A+ H R+  L  
Sbjct  34   NALEILRETVRILRTDPSTFMTILGLLICPVSAALL-SNTLVDAAVVGAVSH-RLVLLAV  91

Query  240  AAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQELPKR----S  407
             +G P +  F   +   L+ TV       P  L+F LL++A ++ ++      K+     
Sbjct  92   TSGLPLT-HFLKQMCHHLAGTVVSCTFCFPLLLTFLLLARASIVYSVACSYAGKKVVALE  150

Query  408  LFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGA  587
             F    RI   L+ T +     +    A    LL+   N     G+  P   ++ ++   
Sbjct  151  FFGTASRIWRRLVSTYIWICVSICGCLALFLALLVMVCNALAVLGYP-PEIVVYPALFTV  209

Query  588  LLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAV  767
            L+ S++ A+T  +CNLA V+S  E   G  A+ ++  LIKG+T   L + L   + MA V
Sbjct  210  LVFSMVYAHTIIVCNLATVISILEDVSGPQALARSVHLIKGQTQAGLLIFLGSTIGMALV  269

Query  768  EALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSC--------E  923
            E LF++R+  + +      SS   EG L+  MY+ ++++D+++   F  +C         
Sbjct  270  EGLFEHRVKTLSYGDG---SSRLWEGPLLVLMYSFVVLVDSMMSAVFYFTCRSSSMEVLN  326

Query  924  GDCH-IDQYRRL  956
            GD H +++  ++
Sbjct  327  GDDHSVEELEKI  338



>ref|XP_010250356.1| PREDICTED: uncharacterized protein LOC104592610 [Nelumbo nucifera]
Length=227

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 64/106 (60%), Gaps = 10/106 (9%)
 Frame = +3

Query  609  ANTFTICNLALVLSGREAT-GGFTAILKACVLIKGRTGTALSLALPINMAMAAVEALFQY  785
            A+   + NLA VLS  E    GF +++KA  LI+GR  TAL + L  N+ +  VE LF++
Sbjct  125  AHITVVGNLARVLSVLENECYGFASLMKAKSLIEGRRQTALLMTLFSNVGLRLVECLFEF  184

Query  786  RIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
            R+ +       G+S    EG+++A MY+++LVLDT++   F  +C+
Sbjct  185  RMCK-------GMS--LWEGLMLASMYSLVLVLDTVMNVVFYYTCK  221



>ref|XP_002965042.1| hypothetical protein SELMODRAFT_82741 [Selaginella moellendorffii]
 gb|EFJ33880.1| hypothetical protein SELMODRAFT_82741 [Selaginella moellendorffii]
Length=320

 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 65/114 (57%), Gaps = 3/114 (3%)
 Frame = +3

Query  597  SIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEAL  776
            S++ A+   I NL++ +S  E   G  A++KA ++++GRT   L L +    A A++++L
Sbjct  195  SLLFAHLVIISNLSITISMLEDIQGRAALMKAILILRGRTQVGLLLFIIATAATASIDSL  254

Query  777  FQYRIVRV--YHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDC  932
            FQYR+V V  Y +A   +SS   E  L+  MY+ L + ++I    F  +C+  C
Sbjct  255  FQYRVVGVPGYKYA-IDLSSKLWEMPLLVGMYSFLYLFNSIPSAIFYFTCKSSC  307



>ref|XP_011075546.1| PREDICTED: uncharacterized protein LOC105160002 [Sesamum indicum]
Length=361

 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 84/314 (27%), Positives = 143/314 (46%), Gaps = 25/314 (8%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAA----SVLVFQSFVPSSPFLAMIHARIH  227
            +A +I R +V         F     VL  P +A    +VLV QS V       ++  R+ 
Sbjct  49   NALEILRETVRILRYNSTGFMAIVAVLICPVSAVVLSNVLVDQSLV------KILSLRLL  102

Query  228  TLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALG----DQEL  395
             +  ++G P    F      KLS+    + +  P  ++  LLSKA +  ++      ++ 
Sbjct  103  LIAKSSGLPLK-PFVKQSCQKLSEMAVSATMCFPLFITLLLLSKAAIAHSVDCTYSRRKF  161

Query  396  PKRSLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLS  575
                 +  + +I   ++ T L    +V+S     FI+LL   +    F    P   L+ +
Sbjct  162  DSSKFYVIISKIWRRIVFTYLWVC-VVISGCLILFIVLLVVVSSMFLFMGFPPDLILYPA  220

Query  576  VSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMA  755
            +    L SIILAN   IC++A+V+S  E   G  A+L++  LI G+T   L + L   + 
Sbjct  221  MVVGFLFSIILANAIIICSIAIVISVLEDVSGPQALLRSSSLISGQTQVGLLIFLGSTIG  280

Query  756  MAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCH  935
            MA VE LF++R+  + +      SS   EG L+  MY+ ++++D+++   F  SC+    
Sbjct  281  MAFVEGLFEHRVKTLSYGDG---SSRIWEGPLLVLMYSFVVLIDSMMNAVFYFSCK----  333

Query  936  IDQYRRLPSHVEIE  977
               YR   +  E E
Sbjct  334  --SYRMESADAESE  345



>ref|XP_010939057.1| PREDICTED: uncharacterized protein LOC105058003 [Elaeis guineensis]
Length=346

 Score = 57.8 bits (138),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 77/304 (25%), Positives = 139/304 (46%), Gaps = 19/304 (6%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTLFD  239
            +A +I R +V         F T   +L FP + ++L   + +  +  +  +  R+  L  
Sbjct  34   NALEILRETVRILRADPSTFMTILALLIFPVSTALL--SNTLIDATAVGAVSRRLVFLAV  91

Query  240  AAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALG----DQELPKRS  407
             +G P +  F   +   L+ TV  S    P  L+F LL++A ++ ++      +++    
Sbjct  92   TSGLPLT-HFLKQMCHHLAGTVVSSAFCFPLLLTFLLLARASIVYSVACFYAGKKVVALE  150

Query  408  LFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLSVSGA  587
             F  + RI   L+ T L     +    A    LL+   N     G+  P   ++ ++   
Sbjct  151  FFGTMRRIWRRLVFTYLWVCVSISGCLALFLALLVVVCNAFSGLGYP-PEIVVYPALFTV  209

Query  588  LLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAV  767
            L+ S++ A+T  +CNLA V+S  E   G  A++++  LIKG+T   L + L   + MA V
Sbjct  210  LVFSMVYAHTIIVCNLASVISVLEDVLGPQALVRSVRLIKGQTQAGLLIFLGSTIGMAFV  269

Query  768  EALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSC--------E  923
            E LF++R+  + +      SS   EG L+  MY+ +++ D ++   F  +C         
Sbjct  270  EGLFEHRVKTLSYGDG---SSRLWEGPLLVLMYSFVVLADYMMSAVFYFTCRSSSMQVLN  326

Query  924  GDCH  935
            GD H
Sbjct  327  GDDH  330



>ref|XP_002267888.1| PREDICTED: uncharacterized protein LOC100248804 [Vitis vinifera]
Length=347

 Score = 57.4 bits (137),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 81/320 (25%), Positives = 143/320 (45%), Gaps = 25/320 (8%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAA----SVLVFQSFVPSSPFLAMIHARIH  227
            +A +I R +V+        F   A +L  P +A    +VLV QS V       ++ AR  
Sbjct  39   NALQILRETVWILRYNSSGFMLIAALLICPVSALLLSNVLVDQSIVKRLSIRLLLVAR--  96

Query  228  TLFDAAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALG----DQEL  395
                ++G P    F      K S+    +    P   +  LLSKA V+ ++      ++ 
Sbjct  97   ----SSGLPLR-PFIKQSCQKFSEMAISAATCFPLYFTISLLSKAAVVYSVDCSYSRKKF  151

Query  396  PKRSLFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADEFGFSSPRFELFLS  575
                 +  + +I   L+ T L    L++S      + L+   N+    GF      ++ +
Sbjct  152  DSSKFYVIVVKIWRRLVSTYLWVCMLIVSCLTVFLVTLIAVCNVFLIIGFPGDLI-VYAA  210

Query  576  VSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMA  755
            +   L+ S++ A    ICN+A+V+   E   G  A+L++ VLIKG+T   L + L   + 
Sbjct  211  IMVGLIFSVVFAKAIIICNIAIVICVLEEVSGPQALLRSGVLIKGQTQVGLLIFLGSTIG  270

Query  756  MAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEG---  926
            MA VE LF++R+  + +      SS   EG L+  MY+ ++++D+++   F  SC     
Sbjct  271  MAFVEGLFEHRVKTLSYGDG---SSRVWEGPLLVVMYSFVVLIDSMMSAVFYFSCRSSSR  327

Query  927  ---DCHIDQYRRLPSHVEIE  977
               D  I      P+ ++I+
Sbjct  328  EALDGEIHPILETPASMDIQ  347



>ref|XP_006381704.1| hypothetical protein POPTR_0006s16160g [Populus trichocarpa]
 gb|ABK92664.1| unknown [Populus trichocarpa]
 gb|ERP59501.1| hypothetical protein POPTR_0006s16160g [Populus trichocarpa]
Length=293

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 79/298 (27%), Positives = 127/298 (43%), Gaps = 39/298 (13%)
 Frame = +3

Query  72   IFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARI--HTLFDAA  245
            IF+ S+   L     F + ++ L  P   S+ +      SSP L      I  H L    
Sbjct  20   IFKESIRVMLLHPTHFHSISIFLFSPLPISLFISHFLTRSSPQLPFSTTSITDHLL----  75

Query  246  GFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALGDQ----ELPKRSLF  413
                  E + +L    S+T+    +  P +++F LL +A  +Q + D      L  R L 
Sbjct  76   ------EHYGVLPQLASKTLIHIIICFPSSITFGLLGQAATVQLVSDSYNGINLNGRRLL  129

Query  414  SCLPRIHSPLLLTQLCNSFLVLSANATCFILLL-------FAFNLADEFGFSSPRFELFL  572
                     LL T      L+L A    F+  L       FA+ +            + L
Sbjct  130  VRSGAAWIKLLRTCFWE-LLILLALWVIFVATLVSVPGTLFAYGICSRM----LGLRVIL  184

Query  573  SVSGALLCSIILANTFTICNLALVLSGREATG-GFTAILKACVLIKGRTGTALSLALPIN  749
               GA  C +  A+   + NLA VL+  E+   GF +++KA  ++ GR  TAL +AL  N
Sbjct  185  GFLGAPFC-LAFAHLVVVANLAKVLAVLESECCGFKSLVKASNMMAGRQQTALVMALLSN  243

Query  750  MAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
            M +  V+ LF++++ +       GIS    EG ++  MY+ +LV DT+    F  +C+
Sbjct  244  MGLGLVQCLFEFKMSK-------GIS--FWEGPMLVSMYSTVLVFDTVTTVVFYYACK  292



>ref|XP_008790177.1| PREDICTED: uncharacterized protein LOC103707457, partial [Phoenix 
dactylifera]
Length=206

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 71/136 (52%), Gaps = 11/136 (8%)
 Frame = +3

Query  552  PRFELFLSVSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALS  731
            P   ++ ++   L+ S++ A+T  +CNLA V+S  E   G  A++++  LIKG+T   L 
Sbjct  58   PEIVVYPALFTVLVFSMVYAHTIIVCNLASVISVLEDVLGPQALVRSIHLIKGQTQAGLL  117

Query  732  LALPINMAMAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFL  911
            + L   + MA VE LF++R+  + +      SS   EG L+  MY+ +++ D ++   F 
Sbjct  118  IFLGSAIGMAFVEGLFEHRVKTLSYGDG---SSRLWEGPLLVLMYSFVVLTDYMMSAVFY  174

Query  912  RSCE--------GDCH  935
             +C         GD H
Sbjct  175  FTCRSSSMGVLSGDGH  190



>ref|XP_008654136.1| PREDICTED: uncharacterized protein LOC103634377 [Zea mays]
 tpg|DAA63444.1| TPA: hypothetical protein ZEAMMB73_146456 [Zea mays]
Length=331

 Score = 55.5 bits (132),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 62/109 (57%), Gaps = 3/109 (3%)
 Frame = +3

Query  597  SIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEAL  776
            S++ A+T  ICNL  V++  E   G  A+ ++  L++G+T   L + L   + +A VE L
Sbjct  197  SVVYAHTIIICNLGGVIAVLEEVAGINALRRSVQLMRGQTHVGLLIFLGSTIGLAFVEGL  256

Query  777  FQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
            F++R+  + +      SS   EG L+  MY++++++D+++   F  +C 
Sbjct  257  FEHRVKTLSYGDG---SSRLWEGPLLVLMYSVVMLVDSMMSAVFYFTCR  302



>ref|XP_011012331.1| PREDICTED: uncharacterized protein LOC105116603 [Populus euphratica]
Length=293

 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 64/115 (56%), Gaps = 11/115 (10%)
 Frame = +3

Query  582  GALLCSIILANTFTICNLALVLSGREATG-GFTAILKACVLIKGRTGTALSLALPINMAM  758
            GA  C +  A+   + NLA VL+  E+   GF +++KA  ++ GR  TAL +AL  NM +
Sbjct  188  GAPFC-LAFAHLVVVANLAKVLAVLESECCGFRSLVKASNMMAGRQQTALVMALLSNMGL  246

Query  759  AAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
              VE LF++++ +       GIS    EG ++  MY+ +LV DT+    F  +C+
Sbjct  247  GLVEFLFEFKMSK-------GIS--FWEGPMLVSMYSTVLVFDTVTNVVFYYACK  292



>ref|XP_006658763.1| PREDICTED: uncharacterized protein LOC102716517 [Oryza brachyantha]
Length=153

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 60/109 (55%), Gaps = 3/109 (3%)
 Frame = +3

Query  597  SIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEAL  776
            S+  A+T  +CNL  V+S  E   G  A+ ++  L++G+T   L + L   + +A VE L
Sbjct  20   SVAYAHTIIVCNLGGVISVLEDIAGVNALRRSVQLMRGQTHVGLLIFLGSTIGLAFVEGL  79

Query  777  FQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
            F++R+  + +      SS   EG L+  MY+ ++++D+++   F  +C 
Sbjct  80   FEHRVKTLSYGDG---SSRLWEGPLLVLMYSFVMLIDSMMSVVFYFTCR  125



>ref|XP_004958201.1| PREDICTED: uncharacterized protein LOC101756977 [Setaria italica]
Length=331

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 61/109 (56%), Gaps = 3/109 (3%)
 Frame = +3

Query  597  SIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEAL  776
            S++ A+T  ICNL  V++  E   G  A+ ++  L++G+T   L + L   + +A VE L
Sbjct  197  SVVYAHTIIICNLGGVIAVLEEVAGINALRRSVQLMRGQTHVGLLIFLGSTIGLAFVEGL  256

Query  777  FQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
            F++R+  + +      SS   EG L+  MY+ ++++D+++   F  +C 
Sbjct  257  FEHRVKTLSYGDG---SSRLWEGPLLVLMYSFVMLIDSMMSAVFYFTCR  302



>ref|XP_002460962.1| hypothetical protein SORBIDRAFT_02g038260 [Sorghum bicolor]
 gb|EER97483.1| hypothetical protein SORBIDRAFT_02g038260 [Sorghum bicolor]
Length=331

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 61/109 (56%), Gaps = 3/109 (3%)
 Frame = +3

Query  597  SIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEAL  776
            S++ A+T  ICNL  V++  E   G  A+ ++  L++G+T   L + L   + +A VE L
Sbjct  197  SVVYAHTIIICNLGGVIAVLEEVAGVNALRRSVQLMRGQTHVGLLIFLGSTIGLAFVEGL  256

Query  777  FQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
            F++R+  + +      SS   EG L+  MY+ ++++D+++   F  +C 
Sbjct  257  FEHRVKTLSYGDG---SSRLWEGPLLVLMYSFVMLIDSMMSAVFYFTCR  302



>ref|XP_003562770.1| PREDICTED: uncharacterized protein LOC100824049 [Brachypodium 
distachyon]
Length=332

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 61/109 (56%), Gaps = 3/109 (3%)
 Frame = +3

Query  597  SIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEAL  776
            S++ A+T  +CNL  V+S  E   G  A+ ++  L++G+T   L + L   + +A VE L
Sbjct  198  SVVYAHTIIVCNLGGVISVLEDVAGVNALRRSVQLMRGQTHVGLLIFLVSTIGLAFVEGL  257

Query  777  FQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
            F++R+  + +      SS   EG L+  MY+ ++++D+++   F  +C 
Sbjct  258  FEHRVKTLSYGDG---SSRLWEGPLLILMYSFVMLVDSMMSTVFYFTCR  303



>gb|EAZ04574.1| hypothetical protein OsI_26726 [Oryza sativa Indica Group]
Length=153

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/132 (27%), Positives = 67/132 (51%), Gaps = 14/132 (11%)
 Frame = +3

Query  597  SIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEAL  776
            S+  A+T  +CNL  V++  E   G +A+ ++  L++G+T   L + L   + +A VE L
Sbjct  20   SVAYAHTIIVCNLGGVIAVLEDIAGVSALRRSVQLMRGQTHVGLLIFLGSTIGLAFVEGL  79

Query  777  FQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHIDQYRRL  956
            F++R+  + +      SS   EG L+  MY+ ++++D+++   F  +C            
Sbjct  80   FEHRVKTLSYGDG---SSRLWEGPLLVLMYSFVMLIDSMMSVVFYFTCR-----------  125

Query  957  PSHVEIEEDNNA  992
             S +EI +D   
Sbjct  126  SSSMEILDDEGG  137



>ref|XP_009619962.1| PREDICTED: uncharacterized protein LOC104111872 [Nicotiana tomentosiformis]
Length=360

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 75/296 (25%), Positives = 141/296 (48%), Gaps = 19/296 (6%)
 Frame = +3

Query  60   SAAKIFRRSVFCFLQKFQFFTTTAVVLAFPYAASVLVFQSFVPSSPFLAMIHARIHTLFD  239
            +A +I R +V         F   A +L  P +A VL   + + +   +  +  R+  +  
Sbjct  48   NALEILRETVRILRYNSIGFMAIAALLICPVSAVVL--SNVLVNHSLVKRLTIRLLLVSK  105

Query  240  AAGFPSSSEFFTILNLKLSQTVAISFLALPFTLSFFLLSKACVIQALG----DQELPKRS  407
            ++G P    F  +   K S+ V  + +  P  ++  LLSKA ++ ++      ++   + 
Sbjct  106  SSGLPLMP-FIKLSCQKFSEVVISAVMCFPLYVTLSLLSKAAIVYSVDCTYSRKKFDSQK  164

Query  408  LFSCLPRIHSPLLLTQLCNSFLVLSANATCFILLLFAFNLADE----FGFSSPRFELFLS  575
             +  + +I   +++T L     V +  + CF L +             GF  P   L+ +
Sbjct  165  FYVIMTKIWKRVVVTYLW----VCTVISGCFTLFVVLVVSVSSVFSIMGFP-PDLILYPA  219

Query  576  VSGALLCSIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMA  755
            +   ++ SIILAN   ICN+A+V+S  E   G  A+L++  LIKG+T   L + L   + 
Sbjct  220  MVVGMIFSIILANAIIICNIAIVISVLEDESGPQALLRSSSLIKGQTQVGLLIFLGSTIG  279

Query  756  MAAVEALFQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
            MA VE LF++R+  + +      SS   EG L+  +Y+ ++++D+++   F  SC+
Sbjct  280  MAIVEGLFEHRVKTISYGDG---SSRLWEGPLLVLLYSFVMLIDSMMSTVFYFSCK  332



>dbj|BAC55692.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAC65918.1| hypothetical protein [Oryza sativa Japonica Group]
Length=332

 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/132 (27%), Positives = 67/132 (51%), Gaps = 14/132 (11%)
 Frame = +3

Query  597  SIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEAL  776
            S+  A+T  +CNL  V++  E   G +A+ ++  L++G+T   L + L   + +A VE L
Sbjct  199  SVAYAHTIIVCNLGGVIAVLEDIAGVSALRRSVQLMRGQTHVGLLIFLGSTIGLAFVEGL  258

Query  777  FQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCEGDCHIDQYRRL  956
            F++R+  + +      SS   EG L+  MY+ ++++D+++   F  +C            
Sbjct  259  FEHRVKTLSYGDG---SSRLWEGPLLVLMYSFVMLIDSMMSVVFYFTCRS----------  305

Query  957  PSHVEIEEDNNA  992
             S +EI +D   
Sbjct  306  -SSMEILDDEGG  316



>gb|EAZ40524.1| hypothetical protein OsJ_24980 [Oryza sativa Japonica Group]
Length=273

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 61/109 (56%), Gaps = 3/109 (3%)
 Frame = +3

Query  597  SIILANTFTICNLALVLSGREATGGFTAILKACVLIKGRTGTALSLALPINMAMAAVEAL  776
            S+  A+T  +CNL  V++  E   G +A+ ++  L++G+T   L + L   + +A VE L
Sbjct  140  SVAYAHTIIVCNLGGVIAVLEDIAGVSALRRSVQLMRGQTHVGLLIFLGSTIGLAFVEGL  199

Query  777  FQYRIVRVYHHAKTGISSVALEGMLIAYMYAILLVLDTIVVCFFLRSCE  923
            F++R+  + +      SS   EG L+  MY+ ++++D+++   F  +C 
Sbjct  200  FEHRVKTLSYGDG---SSRLWEGPLLVLMYSFVMLIDSMMSVVFYFTCR  245



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3237541576564