BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24181_g2_i7 len=1363 path=[1109:0-253 1363:254-259 1369:260-487
12106:488-620 @1597@!:621-1199 2176:1200-1227 13736:1228-1229
2206:1230-1303 12516:1304-1321 2307:1322-1362]

Length=1363
                                                                      Score     E

ref|XP_009760488.1|  PREDICTED: TMV resistance protein N-like           117   3e-31   
ref|XP_009618291.1|  PREDICTED: TMV resistance protein N-like           110   1e-27   
ref|XP_003624057.1|  TMV resistance protein N                         85.5    6e-23   
ref|XP_004247886.1|  PREDICTED: TMV resistance protein N isoform X2     109   5e-22   
ref|XP_010326869.1|  PREDICTED: TMV resistance protein N isoform X1     109   5e-22   
ref|XP_009773802.1|  PREDICTED: TMV resistance protein N-like           108   6e-22   
ref|XP_006360923.1|  PREDICTED: TMV resistance protein N-like iso...    108   7e-22   
ref|XP_006360922.1|  PREDICTED: TMV resistance protein N-like iso...    108   7e-22   
ref|XP_006360962.1|  PREDICTED: TMV resistance protein N-like           108   1e-21   
ref|XP_006478473.1|  PREDICTED: TMV resistance protein N-like         90.5    7e-21   
ref|XP_010244457.1|  PREDICTED: TMV resistance protein N-like           105   1e-20   
ref|XP_002524855.1|  ATP binding protein, putative                      104   1e-20   Ricinus communis
ref|XP_008359988.1|  PREDICTED: TMV resistance protein N-like         87.0    1e-20   
ref|XP_009607519.1|  PREDICTED: putative disease resistance prote...  97.4    2e-20   
ref|XP_009597750.1|  PREDICTED: TMV resistance protein N-like           103   4e-20   
ref|XP_006360971.1|  PREDICTED: TMV resistance protein N-like           103   5e-20   
ref|XP_009607520.1|  PREDICTED: putative disease resistance prote...  95.5    8e-20   
ref|XP_009605717.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    102   9e-20   
ref|XP_009760885.1|  PREDICTED: TMV resistance protein N-like           102   1e-19   
ref|XP_008371343.1|  PREDICTED: TMV resistance protein N-like         98.6    1e-18   
ref|XP_009758995.1|  PREDICTED: TMV resistance protein N-like iso...  98.6    1e-18   
ref|XP_006370856.1|  hypothetical protein POPTR_0019s00950g           82.0    1e-18   
ref|XP_006360964.1|  PREDICTED: TMV resistance protein N-like         98.6    2e-18   
ref|XP_009366532.1|  PREDICTED: TMV resistance protein N-like         97.8    2e-18   
ref|XP_008345881.1|  PREDICTED: TMV resistance protein N-like         98.2    2e-18   
ref|XP_009589492.1|  PREDICTED: TMV resistance protein N-like         97.4    4e-18   
ref|XP_006380157.1|  hypothetical protein POPTR_0008s22430g           97.1    4e-18   
ref|XP_002530627.1|  TMV resistance protein N, putative               97.1    5e-18   Ricinus communis
emb|CDK13058.1|  TIR-NBS-LRR disease resistance protein               97.1    6e-18   
gb|KHN06859.1|  TMV resistance protein N                              84.0    6e-18   
ref|XP_006586027.1|  PREDICTED: TMV resistance protein N-like         84.0    7e-18   
ref|XP_006360969.1|  PREDICTED: TMV resistance protein N-like         96.7    8e-18   
ref|XP_009364579.1|  PREDICTED: TMV resistance protein N-like         96.3    8e-18   
ref|XP_009758997.1|  PREDICTED: TMV resistance protein N-like         96.3    8e-18   
gb|AES86811.2|  disease resistance protein (TIR-NBS-LRR class)        96.7    8e-18   
ref|XP_008362922.1|  PREDICTED: TMV resistance protein N-like         96.3    9e-18   
ref|XP_003604614.1|  TIR-NBS-LRR RCT1-like resistance protein         96.3    9e-18   
ref|XP_009779815.1|  PREDICTED: TMV resistance protein N-like         95.9    1e-17   
gb|AAQ93074.1|  putative TIR-NBS type R protein 4                     95.5    1e-17   Malus baccata [shan jing zi]
gb|AAQ93076.1|  putative TIR-NBS type R protein 4                     95.5    1e-17   Malus baccata [shan jing zi]
ref|XP_008237412.1|  PREDICTED: TMV resistance protein N-like         68.2    1e-17   
emb|CDK13057.1|  TIR-NBS-LRR disease resistance protein               95.9    1e-17   
ref|XP_011003906.1|  PREDICTED: TMV resistance protein N-like iso...  95.9    1e-17   
emb|CDK13060.1|  TIR-NBS-LRR disease resistance protein               95.5    2e-17   
ref|XP_011003907.1|  PREDICTED: TMV resistance protein N-like iso...  95.5    2e-17   
gb|ABB82029.1|  TIR-NBS disease resistance-like protein               88.6    2e-17   Populus trichocarpa [western balsam poplar]
ref|XP_009363980.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  67.0    2e-17   
ref|XP_010536050.1|  PREDICTED: TMV resistance protein N-like         94.7    3e-17   
ref|XP_003598881.1|  TMV resistance protein N                         94.7    3e-17   
ref|XP_006441827.1|  hypothetical protein CICLE_v100236471mg          93.6    4e-17   
gb|AES69132.2|  disease resistance protein (TIR-NBS-LRR class)        94.4    4e-17   
ref|XP_007210009.1|  hypothetical protein PRUPE_ppa016162mg           94.4    4e-17   
ref|XP_010263317.1|  PREDICTED: TMV resistance protein N-like iso...  94.0    5e-17   
ref|XP_010263318.1|  PREDICTED: TMV resistance protein N-like iso...  94.0    5e-17   
ref|XP_006576577.1|  PREDICTED: TMV resistance protein N-like iso...  94.0    5e-17   
gb|KEH25115.1|  disease resistance protein (TIR-NBS-LRR class)        94.4    5e-17   
ref|XP_010263319.1|  PREDICTED: TMV resistance protein N-like iso...  93.6    5e-17   
ref|XP_006586404.1|  PREDICTED: TMV resistance protein N-like         94.0    6e-17   
ref|XP_008222869.1|  PREDICTED: TMV resistance protein N-like         93.6    6e-17   
emb|CDK13053.1|  TIR-NBS-LRR disease resistance protein               94.0    6e-17   
ref|XP_008344076.1|  PREDICTED: TMV resistance protein N-like         71.6    7e-17   
ref|XP_008344077.1|  PREDICTED: TMV resistance protein N-like         72.0    7e-17   
ref|XP_006371041.1|  hypothetical protein POPTR_0019s02900g           86.7    7e-17   
gb|ABM55687.1|  TIR-NBS-LRR class disease resistance protein          93.2    8e-17   (Populus tomentosa x Populus bolleana) x Populus tomentosa
ref|XP_002325794.2|  putative LRR disease resistance family protein   88.2    8e-17   Populus trichocarpa [western balsam poplar]
emb|CDK13056.1|  TIR-NBS-LRR disease resistance protein               93.6    8e-17   
ref|XP_009799389.1|  PREDICTED: TMV resistance protein N-like iso...  92.8    9e-17   
ref|XP_009622118.1|  PREDICTED: TMV resistance protein N-like iso...  92.8    9e-17   
ref|XP_009758994.1|  PREDICTED: TMV resistance protein N-like iso...  93.2    9e-17   
ref|XP_004489498.1|  PREDICTED: uncharacterized protein LOC101494533  93.6    1e-16   
emb|CDK13054.1|  TIR-NBS-LRR disease resistance protein               93.2    1e-16   
gb|ACF19651.1|  TIR-NBS-LRR RCT1-like resistance protein              93.2    1e-16   Medicago sativa [alfalfa]
ref|XP_006364954.1|  PREDICTED: TMV resistance protein N-like         93.2    1e-16   
gb|KEH40037.1|  disease resistance protein (TIR-NBS-LRR class), p...  73.2    1e-16   
gb|KDO39974.1|  hypothetical protein CISIN_1g0014582mg                81.6    1e-16   
ref|XP_003589199.1|  Disease resistance protein                       73.2    1e-16   
ref|XP_006576576.1|  PREDICTED: TMV resistance protein N-like iso...  92.8    1e-16   
gb|KEH40038.1|  disease resistance protein (TIR-NBS-LRR class), p...  72.8    2e-16   
ref|XP_010245559.1|  PREDICTED: uncharacterized protein LOC104589071  92.8    2e-16   
ref|XP_011011965.1|  PREDICTED: TMV resistance protein N-like iso...  92.4    2e-16   
gb|ABF81428.1|  TIR-NBS-LRR-TIR type disease resistance protein       92.4    2e-16   Populus trichocarpa [western balsam poplar]
ref|XP_010245185.1|  PREDICTED: TMV resistance protein N-like         92.4    2e-16   
ref|XP_003604611.1|  TIR-NBS-LRR RCT1-like resistance protein         92.4    2e-16   
ref|XP_011011963.1|  PREDICTED: TMV resistance protein N-like iso...  92.4    2e-16   
ref|XP_011015315.1|  PREDICTED: TMV resistance protein N-like         82.0    2e-16   
ref|XP_006387813.1|  hypothetical protein POPTR_0548s002002g          92.0    2e-16   
emb|CDK13059.1|  TIR-NBS-LRR disease resistance protein               92.0    2e-16   
ref|XP_006441734.1|  hypothetical protein CICLE_v10018550mg           78.2    2e-16   
ref|XP_006389214.1|  hypothetical protein POPTR_0035s00335g           91.7    2e-16   
gb|KEH23635.1|  TIR-NBS-LRR class disease resistance protein          91.7    2e-16   
ref|XP_008219411.1|  PREDICTED: TMV resistance protein N-like         91.7    3e-16   
ref|XP_009799386.1|  PREDICTED: TMV resistance protein N-like iso...  91.7    3e-16   
ref|XP_007227381.1|  hypothetical protein PRUPE_ppb015618mg           91.7    3e-16   
ref|XP_004489475.1|  PREDICTED: TMV resistance protein N-like         91.7    3e-16   
ref|XP_006441733.1|  hypothetical protein CICLE_v10024511mg           73.9    3e-16   
gb|AHG28995.1|  NBS-LRR protein                                       91.3    3e-16   
ref|XP_007023140.1|  Disease resistance protein                       74.3    3e-16   
ref|XP_010256441.1|  PREDICTED: TMV resistance protein N-like iso...  91.7    3e-16   
ref|XP_010256443.1|  PREDICTED: TMV resistance protein N-like iso...  91.7    3e-16   
ref|XP_011021443.1|  PREDICTED: TMV resistance protein N-like         91.7    3e-16   
ref|XP_003604607.1|  TIR-NBS-LRR RCT1 resistance protein              91.3    4e-16   
ref|XP_006466584.1|  PREDICTED: TMV resistance protein N-like         74.3    4e-16   
gb|ABF81413.1|  TIR-NBS-LRR type disease resistance protein           91.3    4e-16   Populus trichocarpa [western balsam poplar]
ref|XP_009622115.1|  PREDICTED: TMV resistance protein N-like iso...  91.3    4e-16   
ref|XP_006388699.1|  hypothetical protein POPTR_0117s002101g          91.3    4e-16   
ref|XP_009363725.1|  PREDICTED: TMV resistance protein N-like         91.3    4e-16   
ref|XP_009622117.1|  PREDICTED: TMV resistance protein N-like iso...  91.3    4e-16   
ref|XP_004506794.1|  PREDICTED: TMV resistance protein N-like iso...  91.3    4e-16   
ref|XP_008350156.1|  PREDICTED: TMV resistance protein N-like         91.3    4e-16   
ref|XP_010665467.1|  PREDICTED: TMV resistance protein N-like         91.3    5e-16   
gb|ACF19650.1|  TIR-NBS-LRR RCT1 resistance protein                   91.3    5e-16   Medicago truncatula
ref|XP_008347889.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  90.9    5e-16   
gb|KDO51243.1|  hypothetical protein CISIN_1g0443021mg                73.6    5e-16   
gb|AES86804.2|  disease resistance protein (TIR-NBS-LRR class)        90.9    5e-16   
ref|XP_004506792.1|  PREDICTED: TMV resistance protein N-like iso...  90.9    5e-16   
ref|XP_010263414.1|  PREDICTED: TMV resistance protein N-like         90.9    5e-16   
gb|KEH15880.1|  disease resistance protein (TIR-NBS-LRR class)        90.9    5e-16   
gb|KCW57074.1|  hypothetical protein EUGRSUZ_I02727                   90.9    5e-16   
gb|KEH25086.1|  disease resistance protein (TIR-NBS-LRR class)        90.9    5e-16   
ref|XP_009343054.1|  PREDICTED: TMV resistance protein N-like         90.9    6e-16   
gb|KEH24922.1|  disease resistance protein (TIR-NBS-LRR class)        78.2    6e-16   
gb|KEH25117.1|  disease resistance protein (TIR-NBS-LRR class)        90.9    6e-16   
ref|XP_010030110.1|  PREDICTED: TMV resistance protein N-like         90.9    6e-16   
gb|ABC55465.1|  TIR-NBS disease resistance-like protein               90.1    6e-16   (Populus tomentosa x Populus bolleana) x Populus tomentosa var. truncata
ref|XP_006387517.1|  hypothetical protein POPTR_0907s00010g           90.1    8e-16   
ref|XP_008375888.1|  PREDICTED: TMV resistance protein N-like         90.5    9e-16   
ref|XP_006576565.1|  PREDICTED: TMV resistance protein N-like         90.1    1e-15   
ref|XP_006441719.1|  hypothetical protein CICLE_v10018572mg           74.7    1e-15   
gb|KDP26071.1|  hypothetical protein JCGZ_21104                       90.1    1e-15   
ref|XP_010263365.1|  PREDICTED: TMV resistance protein N-like         89.7    1e-15   
ref|XP_008237532.1|  PREDICTED: TMV resistance protein N-like         89.7    1e-15   
ref|XP_004489499.1|  PREDICTED: TMV resistance protein N-like         89.7    1e-15   
ref|XP_003604566.1|  Disease resistance protein                       89.7    1e-15   
gb|KEH24919.1|  disease resistance protein (TIR-NBS-LRR class)        78.2    1e-15   
gb|AES86763.2|  disease resistance protein (TIR-NBS-LRR class)        89.7    1e-15   
ref|XP_007210739.1|  hypothetical protein PRUPE_ppa021703mg           89.7    1e-15   
ref|XP_009353023.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  90.1    1e-15   
gb|KCW67541.1|  hypothetical protein EUGRSUZ_F01291                   89.7    1e-15   
ref|XP_010060724.1|  PREDICTED: TMV resistance protein N-like         89.4    2e-15   
gb|KDP24990.1|  hypothetical protein JCGZ_23973                       62.8    2e-15   
ref|XP_006607046.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  72.4    2e-15   
ref|XP_007219398.1|  hypothetical protein PRUPE_ppa020421mg           89.4    2e-15   
ref|XP_003557030.2|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  72.4    2e-15   
ref|XP_011032762.1|  PREDICTED: TMV resistance protein N-like iso...  89.0    2e-15   
ref|XP_009355424.1|  PREDICTED: TMV resistance protein N-like         89.0    2e-15   
ref|XP_010263218.1|  PREDICTED: TMV resistance protein N-like iso...  89.0    2e-15   
ref|XP_002307567.2|  hypothetical protein POPTR_0005s22800g           89.0    2e-15   Populus trichocarpa [western balsam poplar]
gb|ABG37662.1|  NBS-LRR type disease resistance-like protein          89.4    2e-15   Populus trichocarpa [western balsam poplar]
ref|XP_010263217.1|  PREDICTED: TMV resistance protein N-like iso...  89.0    2e-15   
ref|XP_008232528.1|  PREDICTED: TMV resistance protein N-like         89.0    2e-15   
ref|XP_008222872.1|  PREDICTED: TMV resistance protein N-like         88.6    2e-15   
ref|XP_008236758.1|  PREDICTED: TMV resistance protein N-like         89.0    2e-15   
ref|XP_009770076.1|  PREDICTED: TMV resistance protein N-like         88.6    3e-15   
ref|XP_003626930.1|  TMV resistance protein N                         89.0    3e-15   
ref|XP_011032761.1|  PREDICTED: TMV resistance protein N-like iso...  88.6    3e-15   
gb|ABF81438.1|  TIR-NBS-LRR-TIR type disease resistance protein       89.0    3e-15   Populus trichocarpa [western balsam poplar]
ref|XP_008237766.1|  PREDICTED: uncharacterized protein LOC103336496  89.0    3e-15   
ref|XP_010263320.1|  PREDICTED: TMV resistance protein N-like         88.6    3e-15   
ref|XP_006389143.1|  hypothetical protein POPTR_0043s00230g           88.6    3e-15   
ref|XP_010263216.1|  PREDICTED: TMV resistance protein N-like iso...  88.6    3e-15   
ref|XP_007201564.1|  hypothetical protein PRUPE_ppa018131mg           88.6    3e-15   
ref|XP_007199382.1|  hypothetical protein PRUPE_ppa025692mg           88.6    3e-15   
ref|XP_006360972.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  88.2    3e-15   
ref|XP_004309289.1|  PREDICTED: TMV resistance protein N-like         87.4    3e-15   
ref|XP_008339257.1|  PREDICTED: probable WRKY transcription facto...  87.8    3e-15   
ref|XP_011032756.1|  PREDICTED: TMV resistance protein N-like iso...  88.6    3e-15   
gb|KHN32817.1|  TMV resistance protein N                              88.6    4e-15   
gb|KCW67532.1|  hypothetical protein EUGRSUZ_F01261                   88.2    4e-15   
gb|ABF81430.1|  TIR-NBS-LRR-TIR type disease resistance protein       88.6    4e-15   Populus trichocarpa [western balsam poplar]
gb|ABF81439.1|  TIR-NBS-LRR-TIR type disease resistance protein       88.2    4e-15   Populus trichocarpa [western balsam poplar]
ref|XP_002514804.1|  TMV resistance protein N, putative               88.2    4e-15   Ricinus communis
ref|XP_006442207.1|  hypothetical protein CICLE_v10024561mg           73.9    4e-15   
gb|KEH25081.1|  disease resistance protein (TIR-NBS-LRR class)        87.8    4e-15   
gb|AGM48481.1|  TIR-NBS-LRR type disease resistance protein           88.2    4e-15   
ref|XP_010263209.1|  PREDICTED: TMV resistance protein N-like iso...  88.2    4e-15   
gb|ABF81433.1|  TIR-NBS-TIR type disease resistance protein           88.2    4e-15   Populus trichocarpa [western balsam poplar]
gb|KDP41073.1|  hypothetical protein JCGZ_03179                       87.8    4e-15   
ref|XP_008219354.1|  PREDICTED: TMV resistance protein N-like         88.2    5e-15   
ref|XP_006389146.1|  hypothetical protein POPTR_0043s00270g           87.8    5e-15   
ref|XP_006389144.1|  hypothetical protein POPTR_0043s00240g           87.8    5e-15   
ref|XP_010060725.1|  PREDICTED: TMV resistance protein N-like         87.4    5e-15   
ref|XP_008244976.1|  PREDICTED: TMV resistance protein N-like         87.8    5e-15   
ref|XP_006373537.1|  hypothetical protein POPTR_0017s14620g           87.8    5e-15   
ref|XP_009354361.1|  PREDICTED: TMV resistance protein N-like         87.8    5e-15   
ref|XP_007199954.1|  hypothetical protein PRUPE_ppa1027179mg          87.8    6e-15   
ref|XP_010263405.1|  PREDICTED: uncharacterized protein LOC104601664  88.2    6e-15   
gb|AES86810.2|  TIR-NBS-LRR class disease resistance protein          87.4    6e-15   
ref|XP_010263207.1|  PREDICTED: TMV resistance protein N-like iso...  87.8    6e-15   
gb|ABF81441.1|  TIR-NBS-LRR-TIR type disease resistance protein       87.8    6e-15   Populus trichocarpa [western balsam poplar]
ref|XP_006441723.1|  hypothetical protein CICLE_v10024485mg           87.8    6e-15   
ref|XP_003604613.1|  TIR-NBS-LRR RCT1-like resistance protein         87.8    6e-15   
ref|XP_006598946.1|  PREDICTED: TMV resistance protein N-like iso...  87.4    6e-15   
gb|KEH23377.1|  disease resistance protein (TIR-NBS-LRR class)        87.4    7e-15   
ref|XP_003624058.1|  TMV resistance protein N                         87.4    7e-15   
ref|XP_003613758.1|  Disease resistance-like protein                  87.4    7e-15   
ref|XP_007044432.1|  Tir-nbs-lrr resistance protein, putative iso...  87.4    7e-15   
ref|XP_007044433.1|  Tir-nbs-lrr resistance protein, putative iso...  87.4    7e-15   
ref|XP_009335301.1|  PREDICTED: TMV resistance protein N-like         87.4    7e-15   
ref|XP_007044430.1|  Tir-nbs-lrr resistance protein, putative iso...  87.4    7e-15   
ref|XP_006598950.1|  PREDICTED: TMV resistance protein N-like iso...  87.4    7e-15   
gb|KHN34011.1|  TMV resistance protein N                              87.4    8e-15   
ref|XP_006583492.1|  PREDICTED: TMV resistance protein N-like         87.4    8e-15   
ref|XP_007044431.1|  Tir-nbs-lrr resistance protein, putative iso...  87.4    8e-15   
ref|XP_006478374.1|  PREDICTED: TMV resistance protein N-like         87.4    8e-15   
gb|ABE99702.1|  TIR-NBS-LRR disease resistance-like protein           87.4    8e-15   Populus trichocarpa [western balsam poplar]
gb|KHN46715.1|  TMV resistance protein N                              87.0    9e-15   
gb|ABB82028.1|  TIR-NBS disease resistance-like protein               87.0    9e-15   Populus trichocarpa [western balsam poplar]
gb|ABF81416.1|  NBS-LRR-TIR type disease resistance protein           87.0    9e-15   Populus trichocarpa [western balsam poplar]
gb|KEH28853.1|  TIR-NBS-LRR class disease resistance protein          84.3    1e-14   
ref|XP_008372274.1|  PREDICTED: TMV resistance protein N-like         86.7    1e-14   
gb|ABF81437.1|  TIR-NBS-LRR-TIR type disease resistance protein       87.0    1e-14   Populus trichocarpa [western balsam poplar]
gb|ABF81414.1|  TIR-NBS-LRR type disease resistance protein           87.0    1e-14   Populus trichocarpa [western balsam poplar]
ref|XP_006373436.1|  hypothetical protein POPTR_0017s13760g           86.7    1e-14   
ref|XP_006371044.1|  hypothetical protein POPTR_0019s029201g          86.7    1e-14   
ref|XP_006492471.1|  PREDICTED: TMV resistance protein N-like iso...  87.0    1e-14   
ref|XP_006495110.1|  PREDICTED: TMV resistance protein N-like         86.7    1e-14   
ref|XP_006370864.1|  hypothetical protein POPTR_0019s01170g           86.7    1e-14   
ref|XP_006385250.1|  hypothetical protein POPTR_0003s02110g           81.6    1e-14   
ref|XP_003622506.1|  TMV resistance protein N                         86.7    1e-14   
emb|CDP07826.1|  unnamed protein product                              68.2    1e-14   
gb|AGV28084.1|  NBS-LRR protein                                       66.6    1e-14   
ref|XP_011001241.1|  PREDICTED: TMV resistance protein N-like         86.7    1e-14   
gb|ABF81431.1|  TIR-NBS-LRR-TIR type disease resistance protein       86.7    1e-14   Populus trichocarpa [western balsam poplar]
ref|XP_010064472.1|  PREDICTED: TMV resistance protein N-like         86.3    1e-14   
gb|KEH25080.1|  disease resistance protein (TIR-NBS-LRR class), p...  86.7    1e-14   
ref|XP_006389205.1|  hypothetical protein POPTR_0035s00260g           86.7    1e-14   
ref|XP_006441744.1|  hypothetical protein CICLE_v10024507mg           86.3    1e-14   
gb|ABE99701.1|  TIR-NBS-LRR disease resistance-like protein           86.3    2e-14   Populus balsamifera [balsam poplar]
ref|XP_007200952.1|  hypothetical protein PRUPE_ppa000577mg           86.3    2e-14   
ref|XP_010555078.1|  PREDICTED: TMV resistance protein N-like         86.3    2e-14   
ref|XP_003618337.1|  Resistance protein                               74.3    2e-14   
ref|XP_010087987.1|  TMV resistance protein N                         86.3    2e-14   
ref|XP_006389210.1|  hypothetical protein POPTR_0035s00310g           85.9    2e-14   
ref|XP_011011966.1|  PREDICTED: TMV resistance protein N-like iso...  86.3    2e-14   
gb|KEH25074.1|  disease resistance protein (TIR-NBS-LRR class)        85.9    2e-14   
gb|KCW67569.1|  hypothetical protein EUGRSUZ_F01321                   85.9    2e-14   
ref|XP_011011967.1|  PREDICTED: TMV resistance protein N-like iso...  86.3    2e-14   
gb|ABF81417.1|  TIR-NBS-LRR type disease resistance protein           86.3    2e-14   Populus trichocarpa [western balsam poplar]
ref|XP_011011969.1|  PREDICTED: TMV resistance protein N-like iso...  86.3    2e-14   
gb|ABF81423.1|  TIR-NBS-LRR-TIR type disease resistance protein       85.9    2e-14   Populus trichocarpa [western balsam poplar]
ref|XP_007134204.1|  hypothetical protein PHAVU_010G028200g           85.9    2e-14   
gb|AEL30375.1|  TIR-NBS-LRR type disease resistance protein           74.3    2e-14   
ref|XP_009374162.1|  PREDICTED: TMV resistance protein N-like         85.5    2e-14   
ref|XP_007134200.1|  hypothetical protein PHAVU_010G027900g           75.1    2e-14   
ref|XP_007226605.1|  hypothetical protein PRUPE_ppa023385mg           85.9    3e-14   
gb|KEH25106.1|  disease resistance protein (TIR-NBS-LRR class), p...  85.9    3e-14   
gb|KDP34368.1|  hypothetical protein JCGZ_11251                       85.5    3e-14   
ref|XP_006389202.1|  hypothetical protein POPTR_0035s00230g           85.1    3e-14   
ref|XP_008227722.1|  PREDICTED: TMV resistance protein N-like         85.5    3e-14   
ref|XP_009374005.1|  PREDICTED: TMV resistance protein N-like         85.5    3e-14   
ref|XP_008236755.1|  PREDICTED: TMV resistance protein N-like         85.5    3e-14   
ref|XP_008371688.1|  PREDICTED: TMV resistance protein N-like         83.2    3e-14   
gb|ABF81427.1|  TIR-NBS-LRR-TIR type disease resistance protein       85.5    3e-14   Populus trichocarpa [western balsam poplar]
gb|ABB82024.1|  TIR-NBS disease resistance-like protein               85.5    3e-14   Populus trichocarpa [western balsam poplar]
ref|XP_008353467.1|  PREDICTED: TMV resistance protein N-like         85.1    3e-14   
ref|XP_008354951.1|  PREDICTED: TMV resistance protein N-like         82.8    3e-14   
ref|XP_011001266.1|  PREDICTED: TMV resistance protein N-like         85.1    4e-14   
ref|XP_008219131.1|  PREDICTED: TMV resistance protein N-like         85.1    4e-14   
ref|XP_008460682.1|  PREDICTED: TMV resistance protein N-like         60.5    4e-14   
ref|XP_002325284.2|  hypothetical protein POPTR_0019s00930g           84.3    4e-14   Populus trichocarpa [western balsam poplar]
ref|XP_007157781.1|  hypothetical protein PHAVU_002G098200g           85.1    4e-14   
ref|XP_009366972.1|  PREDICTED: TMV resistance protein N-like         85.1    4e-14   
ref|XP_006389200.1|  hypothetical protein POPTR_0035s00210g           84.7    4e-14   
gb|ABB82025.1|  TIR-NBS disease resistance-like protein               84.7    4e-14   Populus trichocarpa [western balsam poplar]
dbj|BAJ53239.1|  JHS03A10.2                                           85.1    4e-14   
ref|XP_009347471.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  85.1    4e-14   
ref|XP_009347010.1|  PREDICTED: TMV resistance protein N-like         84.7    4e-14   
ref|XP_009347470.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  85.1    4e-14   
emb|CCW28747.1|  TIR NB-ARC LRR protein                               70.9    4e-14   
gb|KEH29020.1|  disease resistance protein (TIR-NBS-LRR class)        85.1    4e-14   
gb|KEH25109.1|  disease resistance protein (TIR-NBS-LRR class)        85.1    4e-14   
gb|ABF81434.1|  TIR-NBS-TIR type disease resistance protein           85.1    4e-14   Populus trichocarpa [western balsam poplar]
ref|XP_006478471.1|  PREDICTED: TMV resistance protein N-like         84.7    4e-14   
ref|XP_011001267.1|  PREDICTED: TMV resistance protein N-like         84.7    5e-14   
ref|XP_008341704.1|  PREDICTED: probable WRKY transcription facto...  84.0    5e-14   
gb|KDP24993.1|  hypothetical protein JCGZ_23976                       84.7    5e-14   
ref|XP_006596207.1|  PREDICTED: TMV resistance protein N-like         84.7    5e-14   
ref|XP_006368853.1|  hypothetical protein POPTR_0001s13090g           84.7    5e-14   
ref|XP_008352803.1|  PREDICTED: TMV resistance protein N-like         84.7    5e-14   
ref|XP_003604861.1|  Nbs-lrr resistance protein                       85.1    5e-14   
ref|XP_008227723.1|  PREDICTED: probable WRKY transcription facto...  83.2    5e-14   
ref|XP_007161731.1|  hypothetical protein PHAVU_001G093900g           84.7    5e-14   
gb|KEH26775.1|  disease resistance protein (TIR-NBS-LRR class)        84.7    5e-14   
gb|AES87058.2|  disease resistance protein (TIR-NBS-LRR class)        85.1    5e-14   
ref|XP_006441739.1|  hypothetical protein CICLE_v100235052mg          84.7    5e-14   
gb|KEH26762.1|  disease resistance protein (TIR-NBS-LRR class)        84.7    6e-14   
gb|KEH18105.1|  disease resistance protein (TIR-NBS-LRR class)        84.0    6e-14   
gb|KEH26763.1|  disease resistance protein (TIR-NBS-LRR class)        84.3    6e-14   
ref|XP_009373373.1|  PREDICTED: TMV resistance protein N-like iso...  84.3    6e-14   
ref|XP_003619958.1|  Disease resistance-like protein                  84.3    6e-14   
ref|XP_006841040.1|  hypothetical protein AMTR_s00085p00136920        84.7    6e-14   
ref|XP_009348202.1|  PREDICTED: TMV resistance protein N-like         84.0    6e-14   
ref|XP_006478373.1|  PREDICTED: TMV resistance protein N-like         84.3    7e-14   
ref|XP_009373353.1|  PREDICTED: TMV resistance protein N-like iso...  84.0    7e-14   
ref|XP_008376481.1|  PREDICTED: TMV resistance protein N-like         84.3    7e-14   
gb|KEH29794.1|  NB-ARC domain protein                                 84.3    7e-14   
ref|XP_011001242.1|  PREDICTED: TMV resistance protein N-like         84.3    7e-14   
gb|KDO44001.1|  hypothetical protein CISIN_1g002458mg                 84.3    7e-14   
ref|XP_009348201.1|  PREDICTED: TMV resistance protein N-like         84.0    7e-14   
gb|KEH25094.1|  disease resistance protein (TIR-NBS-LRR class)        84.0    7e-14   
gb|KDO44004.1|  hypothetical protein CISIN_1g002458mg                 84.0    8e-14   
gb|KDO44002.1|  hypothetical protein CISIN_1g002458mg                 84.0    8e-14   
gb|KDO44003.1|  hypothetical protein CISIN_1g002458mg                 84.0    8e-14   
ref|XP_007199645.1|  hypothetical protein PRUPE_ppa022914mg           84.0    8e-14   
ref|XP_006446207.1|  hypothetical protein CICLE_v10014074mg           84.3    8e-14   
ref|XP_006604003.1|  PREDICTED: TMV resistance protein N-like iso...  84.0    8e-14   
ref|XP_003625075.1|  TMV resistance protein N                         84.3    8e-14   
ref|XP_010060729.1|  PREDICTED: TMV resistance protein N-like         84.0    8e-14   
gb|KHN01220.1|  TMV resistance protein N                              84.0    8e-14   
ref|XP_007201593.1|  hypothetical protein PRUPE_ppa020855mg           84.0    8e-14   
ref|XP_011011693.1|  PREDICTED: TMV resistance protein N-like         79.0    8e-14   
ref|XP_007134177.1|  hypothetical protein PHAVU_010G026000g           84.0    9e-14   
ref|XP_006471197.1|  PREDICTED: TMV resistance protein N-like iso...  84.0    9e-14   
ref|XP_002321497.2|  hypothetical protein POPTR_0015s04030g           84.0    9e-14   
gb|KEH25116.1|  disease resistance protein (TIR-NBS-LRR class)        84.0    9e-14   
ref|XP_008362185.1|  PREDICTED: TMV resistance protein N-like         81.6    9e-14   
ref|XP_006604005.1|  PREDICTED: TMV resistance protein N-like iso...  84.0    9e-14   
ref|XP_006478366.1|  PREDICTED: TMV resistance protein N-like         84.0    1e-13   
gb|ABD33309.1|  Ribonuclease H                                        84.0    1e-13   
ref|XP_006604006.1|  PREDICTED: TMV resistance protein N-like iso...  84.0    1e-13   
ref|XP_003638277.1|  Cellulose synthase                               84.0    1e-13   
emb|CAD56833.1|  putative resistance gene analogue protein            83.6    1e-13   
gb|KDO65742.1|  hypothetical protein CISIN_1g037332mg                 83.6    1e-13   
ref|XP_008362187.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  82.8    1e-13   
ref|XP_008356051.1|  PREDICTED: TMV resistance protein N-like         83.6    1e-13   
ref|XP_007227216.1|  hypothetical protein PRUPE_ppa018951mg           83.6    1e-13   
ref|XP_006471244.1|  PREDICTED: TMV resistance protein N-like         83.6    1e-13   
gb|KEH19079.1|  disease resistance protein (TIR-NBS-LRR class), p...  83.6    1e-13   
gb|KEH19080.1|  disease resistance protein (TIR-NBS-LRR class), p...  83.6    1e-13   
ref|XP_008236678.1|  PREDICTED: TMV resistance protein N-like         83.2    1e-13   
gb|KHN42294.1|  TMV resistance protein N                              83.6    1e-13   
ref|XP_003626912.1|  Resistance protein                               83.6    2e-13   
ref|XP_006371049.1|  hypothetical protein POPTR_0019s02970g           83.2    2e-13   
gb|ABB82026.1|  TIR-NBS disease resistance-like protein               83.2    2e-13   
ref|XP_009344862.1|  PREDICTED: TMV resistance protein N-like         83.2    2e-13   
gb|KEH25076.1|  disease resistance protein (TIR-NBS-LRR class)        83.2    2e-13   
ref|XP_002325898.2|  hypothetical protein POPTR_0019s07880g           83.2    2e-13   
ref|XP_007201658.1|  hypothetical protein PRUPE_ppa022091mg           83.2    2e-13   
ref|XP_007224738.1|  hypothetical protein PRUPE_ppa024525mg           83.2    2e-13   
ref|XP_011026208.1|  PREDICTED: TMV resistance protein N-like         83.2    2e-13   
ref|XP_008235925.1|  PREDICTED: TMV resistance protein N-like         83.2    2e-13   
ref|XP_006478256.1|  PREDICTED: TMV resistance protein N-like iso...  83.2    2e-13   
gb|KEH25077.1|  disease resistance protein (TIR-NBS-LRR class)        83.2    2e-13   
ref|XP_006470767.1|  PREDICTED: TMV resistance protein N-like         83.2    2e-13   
ref|XP_008246068.1|  PREDICTED: TMV resistance protein N-like         82.8    2e-13   
ref|XP_011012882.1|  PREDICTED: TMV resistance protein N-like         83.2    2e-13   
ref|XP_004510758.1|  PREDICTED: TMV resistance protein N-like         83.2    2e-13   
ref|XP_007134214.1|  hypothetical protein PHAVU_010G028900g           82.8    2e-13   
ref|XP_003516337.1|  PREDICTED: TMV resistance protein N-like iso...  82.8    2e-13   
ref|XP_007151580.1|  hypothetical protein PHAVU_004G058700g           82.8    2e-13   
ref|XP_006573341.1|  PREDICTED: TMV resistance protein N-like iso...  82.8    2e-13   
ref|XP_006441741.1|  hypothetical protein CICLE_v10023905mg           82.8    2e-13   
ref|XP_008342691.1|  PREDICTED: TMV resistance protein N-like         83.2    2e-13   
ref|XP_007200803.1|  hypothetical protein PRUPE_ppa025229mg           82.8    2e-13   
ref|XP_006478252.1|  PREDICTED: TMV resistance protein N-like iso...  82.8    2e-13   
gb|AES86764.2|  TIR-NBS-LRR class disease resistance protein          82.8    2e-13   
ref|XP_003624006.1|  TMV resistance protein N                         82.8    2e-13   
gb|AES96715.2|  disease resistance protein (TIR-NBS-LRR class)        82.8    2e-13   
ref|XP_003627687.1|  NBS resistance protein                           82.4    2e-13   
gb|AHG28994.1|  NBS-LRR protein                                       82.8    2e-13   
ref|XP_007221584.1|  hypothetical protein PRUPE_ppa025848mg           82.8    2e-13   
ref|XP_008237404.1|  PREDICTED: TMV resistance protein N-like         82.8    2e-13   
gb|ABF81459.1|  TIR-NBS type disease resistance protein               82.8    2e-13   
gb|KDO51716.1|  hypothetical protein CISIN_1g001277mg                 82.8    2e-13   
ref|XP_008237406.1|  PREDICTED: TMV resistance protein N-like         82.8    2e-13   
ref|XP_009345023.1|  PREDICTED: TMV resistance protein N-like         82.4    2e-13   
ref|XP_009348253.1|  PREDICTED: TMV resistance protein N-like         82.8    2e-13   
ref|XP_006477663.1|  PREDICTED: putative disease resistance prote...  82.8    2e-13   
ref|XP_006427001.1|  hypothetical protein CICLE_v10024735mg           82.8    2e-13   
ref|XP_006427002.1|  hypothetical protein CICLE_v10024735mg           82.8    2e-13   
ref|XP_003613757.1|  Disease resistance-like protein                  82.4    2e-13   
gb|AFK10157.1|  NBS protein                                           79.0    2e-13   
ref|XP_011012884.1|  PREDICTED: TMV resistance protein N-like         82.4    3e-13   
ref|XP_008237268.1|  PREDICTED: TMV resistance protein N-like         82.4    3e-13   
ref|XP_008364875.1|  PREDICTED: TMV resistance protein N-like         82.4    3e-13   
ref|XP_008379784.1|  PREDICTED: TMV resistance protein N-like         82.4    3e-13   
ref|XP_009348250.1|  PREDICTED: TMV resistance protein N-like iso...  82.8    3e-13   
ref|XP_006494860.1|  PREDICTED: TMV resistance protein N-like         82.4    3e-13   
ref|XP_006495327.1|  PREDICTED: TMV resistance protein N-like         65.5    3e-13   
ref|XP_003636848.1|  Tir-nbs-lrr resistance protein                   82.4    3e-13   
ref|XP_009348856.1|  PREDICTED: TMV resistance protein N-like         82.0    3e-13   
emb|CDX97173.1|  BnaC09g44520D                                        82.4    3e-13   
gb|KEH25073.1|  disease resistance protein (TIR-NBS-LRR class)        82.4    3e-13   
gb|KEH16160.1|  TIR-NBS-LRR class disease resistance protein          82.4    3e-13   
ref|XP_009348251.1|  PREDICTED: TMV resistance protein N-like iso...  82.4    3e-13   
ref|XP_009348249.1|  PREDICTED: TMV resistance protein N-like iso...  82.4    3e-13   
ref|XP_007224412.1|  hypothetical protein PRUPE_ppa021718mg           82.4    3e-13   
ref|XP_011013099.1|  PREDICTED: TMV resistance protein N-like iso...  82.4    3e-13   
gb|KEH25085.1|  disease resistance protein (TIR-NBS-LRR class)        82.0    3e-13   
ref|XP_003636294.1|  Tir-nbs-lrr resistance protein                   82.4    3e-13   
ref|XP_009333593.1|  PREDICTED: TMV resistance protein N-like         82.4    3e-13   
gb|KHN44764.1|  TMV resistance protein N                              82.4    3e-13   
gb|KEH18372.1|  TIR-NBS-LRR class disease resistance protein          82.0    3e-13   
ref|XP_011013098.1|  PREDICTED: TMV resistance protein N-like iso...  82.0    3e-13   
gb|KEH32989.1|  disease resistance protein (TIR-NBS-LRR class), p...  82.0    4e-13   
ref|XP_008231917.1|  PREDICTED: TMV resistance protein N-like         82.0    4e-13   
ref|XP_003636035.1|  Tir-nbs-lrr resistance protein                   82.0    4e-13   
ref|XP_004499788.1|  PREDICTED: TMV resistance protein N-like         82.0    4e-13   
gb|KEH18376.1|  TIR-NBS-LRR class disease resistance protein          81.6    4e-13   
gb|KEH32988.1|  disease resistance protein (TIR-NBS-LRR class), p...  82.0    4e-13   
ref|XP_009345020.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  82.0    4e-13   
ref|XP_008244870.1|  PREDICTED: TMV resistance protein N-like         81.6    5e-13   
ref|XP_010657788.1|  PREDICTED: TMV resistance protein N-like iso...  81.6    5e-13   
ref|XP_010263244.1|  PREDICTED: TMV resistance protein N-like         81.6    5e-13   
ref|XP_010657787.1|  PREDICTED: TMV resistance protein N-like iso...  81.6    5e-13   
ref|XP_006466121.1|  PREDICTED: TMV resistance protein N-like iso...  81.6    5e-13   
ref|XP_002272667.2|  PREDICTED: TMV resistance protein N-like iso...  81.6    5e-13   
ref|XP_004301478.1|  PREDICTED: TMV resistance protein N-like         81.3    5e-13   
ref|XP_006471199.1|  PREDICTED: TMV resistance protein N-like iso...  81.6    5e-13   
ref|XP_010657789.1|  PREDICTED: TMV resistance protein N-like iso...  81.6    6e-13   
ref|XP_006599150.1|  PREDICTED: TMV resistance protein N-like iso...  81.3    6e-13   
ref|XP_002300861.2|  hypothetical protein POPTR_0002s05700g           81.3    6e-13   
ref|XP_002325273.2|  hypothetical protein POPTR_0019s01200g           81.3    6e-13   
ref|XP_009366856.1|  PREDICTED: TMV resistance protein N-like         81.6    6e-13   
ref|XP_003548629.1|  PREDICTED: TMV resistance protein N-like iso...  81.3    6e-13   
ref|XP_004489476.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...  81.3    6e-13   
ref|XP_006478375.1|  PREDICTED: TMV resistance protein N-like         80.5    6e-13   
ref|XP_008236730.1|  PREDICTED: TMV resistance protein N-like iso...  81.3    6e-13   
ref|XP_009371403.1|  PREDICTED: TMV resistance protein N-like         81.3    6e-13   
ref|XP_008353463.1|  PREDICTED: TMV resistance protein N-like         80.9    6e-13   
ref|XP_004510224.1|  PREDICTED: TMV resistance protein N-like         81.3    6e-13   
gb|KHN26944.1|  TMV resistance protein N                              81.3    6e-13   
ref|XP_008244986.1|  PREDICTED: TMV resistance protein N-like         81.3    7e-13   
ref|XP_003526343.1|  PREDICTED: TMV resistance protein N-like         81.3    7e-13   
ref|NP_001235684.1|  disease resistance protein                       80.5    7e-13   
ref|XP_002325283.2|  hypothetical protein POPTR_0019s00900g           81.3    7e-13   
ref|XP_004301464.1|  PREDICTED: TMV resistance protein N-like         81.3    7e-13   
ref|XP_006576517.1|  PREDICTED: TMV resistance protein N-like iso...  81.3    7e-13   
gb|KHN26393.1|  TMV resistance protein N                              81.3    7e-13   
ref|XP_006576516.1|  PREDICTED: TMV resistance protein N-like iso...  80.9    7e-13   
ref|XP_003518448.2|  PREDICTED: TMV resistance protein N-like         81.3    7e-13   
gb|ABH07384.1|  CMR1                                                  81.3    8e-13   
ref|XP_006576515.1|  PREDICTED: TMV resistance protein N-like iso...  80.9    8e-13   
gb|KEH25083.1|  disease resistance protein (TIR-NBS-LRR class)        80.9    8e-13   
ref|XP_006478326.1|  PREDICTED: TMV resistance protein N-like         81.3    8e-13   
gb|KDO37857.1|  hypothetical protein CISIN_1g0011611mg                80.5    8e-13   
gb|KCW74021.1|  hypothetical protein EUGRSUZ_E02649                   80.9    8e-13   
gb|AHG29004.1|  NBS-LRR protein                                       80.9    8e-13   
ref|XP_006441388.1|  hypothetical protein CICLE_v10018571mg           81.3    8e-13   
ref|XP_007135105.1|  hypothetical protein PHAVU_010G101200g           80.9    8e-13   
gb|KDO51239.1|  hypothetical protein CISIN_1g0488311mg                80.5    8e-13   
gb|KEH25082.1|  disease resistance protein (TIR-NBS-LRR class)        80.9    9e-13   
ref|XP_008350782.1|  PREDICTED: TMV resistance protein N-like         80.9    9e-13   
ref|XP_003609597.1|  TIR-NBS-LRR RCT1 resistance protein              80.9    1e-12   
ref|XP_004492775.1|  PREDICTED: TMV resistance protein N-like iso...  80.9    1e-12   
ref|XP_009366896.1|  PREDICTED: TMV resistance protein N-like         80.9    1e-12   
ref|XP_003556672.1|  PREDICTED: putative disease resistance prote...  80.9    1e-12   
ref|XP_006471198.1|  PREDICTED: TMV resistance protein N-like iso...  80.9    1e-12   
ref|XP_007201127.1|  hypothetical protein PRUPE_ppa017276mg           80.9    1e-12   
ref|XP_006466122.1|  PREDICTED: TMV resistance protein N-like iso...  80.9    1e-12   
gb|KDP26901.1|  hypothetical protein JCGZ_18059                       80.9    1e-12   
ref|XP_006389222.1|  hypothetical protein POPTR_0035s00400g           80.9    1e-12   
gb|KEH35118.1|  disease resistance protein (TIR-NBS-LRR class)        80.9    1e-12   
ref|XP_006371047.1|  hypothetical protein POPTR_0019s02950g           80.1    1e-12   
ref|XP_007148814.1|  hypothetical protein PHAVU_005G016500g           80.9    1e-12   
ref|XP_003626904.1|  TMV resistance protein N                         80.5    1e-12   
ref|XP_004492774.1|  PREDICTED: TMV resistance protein N-like iso...  80.5    1e-12   
ref|XP_006471200.1|  PREDICTED: TMV resistance protein N-like iso...  80.5    1e-12   
ref|XP_010433894.1|  PREDICTED: probable WRKY transcription facto...  80.5    1e-12   
ref|XP_002521770.1|  conserved hypothetical protein                   79.7    1e-12   
gb|KDO44265.1|  hypothetical protein CISIN_1g003496mg                 80.5    1e-12   
ref|XP_006478370.1|  PREDICTED: putative disease resistance prote...  80.1    1e-12   
ref|XP_008380645.1|  PREDICTED: TMV resistance protein N-like         80.5    1e-12   
ref|XP_004510228.1|  PREDICTED: TMV resistance protein N-like iso...  80.5    1e-12   
ref|XP_004510227.1|  PREDICTED: TMV resistance protein N-like iso...  80.5    1e-12   
ref|NP_198509.2|  TIR-NBS-LRR class disease resistance protein        80.5    1e-12   
ref|XP_010433889.1|  PREDICTED: probable WRKY transcription facto...  80.5    1e-12   
ref|XP_006471201.1|  PREDICTED: TMV resistance protein N-like iso...  80.1    1e-12   
ref|XP_006389223.1|  hypothetical protein POPTR_0035s00400g           80.5    1e-12   
ref|XP_008236807.1|  PREDICTED: TMV resistance protein N-like         80.5    1e-12   
ref|XP_008387849.1|  PREDICTED: TMV resistance protein N-like         79.3    1e-12   
ref|XP_008350467.1|  PREDICTED: TMV resistance protein N-like         79.3    1e-12   
ref|XP_004510226.1|  PREDICTED: TMV resistance protein N-like iso...  80.1    1e-12   
gb|AFK10156.1|  NBS protein                                           76.6    1e-12   
dbj|BAB11635.1|  TMV resistance protein N                             80.5    1e-12   
gb|KHN11124.1|  TMV resistance protein N                              80.1    1e-12   
ref|XP_008238091.1|  PREDICTED: TMV resistance protein N-like         80.1    1e-12   
ref|XP_007148813.1|  hypothetical protein PHAVU_005G016500g           80.1    1e-12   
ref|XP_008361338.1|  PREDICTED: TMV resistance protein N-like iso...  80.5    1e-12   
ref|XP_006466583.1|  PREDICTED: TMV resistance protein N-like         80.5    1e-12   
ref|XP_007201107.1|  hypothetical protein PRUPE_ppa024462mg           80.1    1e-12   
ref|XP_006440746.1|  hypothetical protein CICLE_v10023985mg           80.1    1e-12   
ref|XP_007158656.1|  hypothetical protein PHAVU_002G171400g           80.1    1e-12   
ref|NP_001119319.1|  TIR-NBS-LRR class disease resistance protein     80.1    1e-12   
ref|XP_008361342.1|  PREDICTED: TMV resistance protein N-like iso...  80.1    1e-12   
ref|XP_009342729.1|  PREDICTED: TMV resistance protein N-like         80.1    2e-12   
ref|XP_008245069.1|  PREDICTED: TMV resistance protein N-like         80.1    2e-12   
ref|XP_008343949.1|  PREDICTED: TMV resistance protein N-like         80.1    2e-12   
ref|XP_008238043.1|  PREDICTED: TMV resistance protein N-like         80.1    2e-12   
ref|XP_002325730.2|  hypothetical protein POPTR_0019s01190g           79.7    2e-12   
ref|XP_002530072.1|  leucine-rich repeat-containing protein, puta...  80.1    2e-12   
ref|XP_008227563.1|  PREDICTED: TMV resistance protein N-like         80.1    2e-12   
ref|XP_010064496.1|  PREDICTED: TMV resistance protein N-like         79.7    2e-12   
ref|XP_006485790.1|  PREDICTED: TMV resistance protein N-like         80.1    2e-12   
ref|XP_006576512.1|  PREDICTED: TMV resistance protein N-like iso...  80.1    2e-12   
gb|KEH35142.1|  disease resistance protein (TIR-NBS-LRR class), p...  80.1    2e-12   
ref|XP_004307463.1|  PREDICTED: TMV resistance protein N-like         80.1    2e-12   
gb|KHN11119.1|  TMV resistance protein N                              79.7    2e-12   
ref|XP_008231887.1|  PREDICTED: TMV resistance protein N-like iso...  80.1    2e-12   
gb|AES71667.2|  disease resistance protein (TIR-NBS-LRR class), p...  80.1    2e-12   



>ref|XP_009760488.1| PREDICTED: TMV resistance protein N-like [Nicotiana sylvestris]
Length=1136

 Score =   117 bits (293),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 103/183 (56%), Gaps = 21/183 (11%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETN----NAMGHFSTIEIRNIVDKCL--INYSCFNWMYSLIPEMGRE  163
            FLD+ CF  K+ +        A G +  +EI  ++DK L  I+ +    +++LI +MGRE
Sbjct  451  FLDIACFCFKVQKSEVVGIFTACGFYPEVEICELIDKSLLAIDENKNLNVHNLIRDMGRE  510

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKN  301
            I+H ESP+  G+RSRLWCP D+ DVLI  KG + +E IVL S               M  
Sbjct  511  IVHRESPDNPGKRSRLWCPKDISDVLIGHKGTKAVEGIVLESSALKDVPFSTKAFEKMAK  570

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFGV  481
            +   +I+ + L G+F++LP K+L+ L W+ CP+K +P  +  + LV L M   N KE   
Sbjct  571  LRLLRINHLQLYGSFQYLP-KSLKYLHWHYCPLKCLPSDFCLENLVILNMSFGNFKESQA  629

Query  482  PLK  490
            PLK
Sbjct  630  PLK  632


 Score = 47.0 bits (110),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 52/104 (50%), Gaps = 14/104 (13%)
 Frame = +3

Query  612  PLK*YFLCHESLDLGWCENLTRTPDFSGAKNLHKLSF-YGSSLEKVHYSNIDLWMQSKID  788
            PLK YF C + L    CENL ++P+F G  +L KLSF Y S+L  +  +  +L     +D
Sbjct  630  PLK-YFKCLKMLVFYSCENLKKSPEFVGLHSLEKLSFGYCSNLMGLDSTIGELKRLRILD  688

Query  789  LWGCERLKKLPSSSVENSGMLTHNFPQFPPNLEDIRLYGCKNLE  920
            +  C  L++LP    E              +LE + LYGC  LE
Sbjct  689  VANCMNLRELPRRICE------------LKSLEILYLYGCSKLE  720



>ref|XP_009618291.1| PREDICTED: TMV resistance protein N-like [Nicotiana tomentosiformis]
Length=1129

 Score =   110 bits (274),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/183 (38%), Positives = 100/183 (55%), Gaps = 21/183 (11%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETN----NAMGHFSTIEIRNIVDKCL--INYSCFNWMYSLIPEMGRE  163
            FLD+  F  KI +        A G +  +EI  ++DK L  I+ +    M++LI +MGRE
Sbjct  447  FLDIAYFFFKIQKSEVVGIFTACGFYPEVEICELIDKSLLTIDENKHLNMHNLIRDMGRE  506

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKN  301
            I+H ESP+  G+RSRLWC  D+ DVLI  KG + +E IVL S               M  
Sbjct  507  IVHRESPDNPGKRSRLWCAKDISDVLIGHKGTKAVEGIVLESSALKEVPFSTKAFEKMAK  566

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFGV  481
            +   +I+ + L G+F++LP K+L+ L W+ CP+K +P  +  + LV L M     KE   
Sbjct  567  LRLLRINHLQLYGSFQYLP-KSLKYLHWHYCPLKCLPSDFCLENLVILNMSFGKFKESQA  625

Query  482  PLK  490
            PLK
Sbjct  626  PLK  628


 Score = 42.0 bits (97),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 70/141 (50%), Gaps = 13/141 (9%)
 Frame = +3

Query  612   PLK*YFLCHESLDLGWCENLTRTPDFSGAKNLHKLSF-YGSSLEKVHYSNIDLWMQSKID  788
             PLK YF C +SL    CE L ++P+F G  +L KLSF Y S+L  +  +  +L     ++
Sbjct  626   PLK-YFKCLKSLVFYSCEYLKKSPEFVGLHSLEKLSFGYCSNLMGLDSTIGELKRLRILN  684

Query  789   LWGCERLKKLPSSSVENSGM------LTHNFPQFPPNLEDIRLYGCKNLEVVSATFPTSL  950
             +  C+ L++LP    E   +            + P +L   +L G K L  V AT  T L
Sbjct  685   VADCKNLRELPRRICELKSLEILYLDSCTKLEELPDDLG--KLEGLKELNAV-ATAITRL  741

Query  951   EGIVLYGCTNLKTLLELPQNL  1013
              G V +   NL+ LL L Q+L
Sbjct  742   PGSVGH-LKNLEMLL-LSQDL  760



>ref|XP_003624057.1| TMV resistance protein N [Medicago truncatula]
 gb|AES80275.1| disease resistance protein (TIR-NBS-LRR class), putative [Medicago 
truncatula]
Length=1122

 Score = 85.5 bits (210),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 89/179 (50%), Gaps = 22/179 (12%)
 Frame = +2

Query  2    FLDLVCF--SHKIPEETN--NAMGHFSTIEIRNIVDKCLINYSCFN---WMYSLIPEMGR  160
            FLD+ CF    KI +  +     G+F  I I+ ++D+ LI     N    M+ L+ EMGR
Sbjct  448  FLDIACFFKGMKIDKVIDILENCGYFPKIIIQVLIDRSLITLDRVNNKLGMHDLLQEMGR  507

Query  161  EIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMK  298
             I+  ESPN  G  SRLW   D+  VL + KG EKI  +VLN              S   
Sbjct  508  NIVFQESPNDPGRCSRLWSKEDIDSVLTKNKGTEKISSVVLNLLQPYEARWSTEAFSKTS  567

Query  299  NMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
             ++   ++E+ L      LP  +L+ L+W  CP+K++      D++V +K+  S I++ 
Sbjct  568  QLKLLNLNEVQLPLGLSCLP-CSLKVLRWRGCPLKTLAQTNQLDEVVDIKLSHSKIEKL  625


 Score = 51.2 bits (121),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 62/199 (31%), Positives = 91/199 (46%), Gaps = 32/199 (16%)
 Frame = +3

Query  588   FYGFYLLNPLK*YFLCHESLDLGWCENLTRTPDFSGAKNLHKLSFYGSS-LEKVHYSNID  764
             ++G Y +  LK        L+L + +NL R PDFSG  NL KL   G S L +VH S + 
Sbjct  626   WHGVYFMEKLK-------YLNLKFSKNLKRLPDFSGVPNLEKLILKGCSILTEVHLSLVH  678

Query  765   LWMQSKIDLWGCERLKKLPS----SSVEN---SGMLTHNF-PQFPPNLEDIRLYGCKNLE  920
                   + L  C+ LK LP     SS++    SG     F P+F   +E++ +   K  +
Sbjct  679   HKKVVVVSLKNCKSLKSLPGKLEMSSLKKLILSGCSEFKFLPEFGEKMENLSILALKGTD  738

Query  921   VVSATFPTSLEGIVLYGCTNL-----KTLLELP---QNLQSLYVFNCESLETVHLPKMLE  1076
             +     P SL  +V  G TNL     K+L+ LP     L SL + N        L ++ +
Sbjct  739   I--RKLPLSLGSLV--GLTNLNLKDCKSLVCLPDTIHGLNSLIILNISGCS--RLCRLPD  792

Query  1077  YVKLTHCKKLKEIQGWENA  1133
              +K   C  LKE+   + A
Sbjct  793   GLKEIQC--LKELHANDTA  809



>ref|XP_004247886.1| PREDICTED: TMV resistance protein N isoform X2 [Solanum lycopersicum]
Length=1048

 Score =   109 bits (272),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 66/182 (36%), Positives = 102/182 (56%), Gaps = 20/182 (11%)
 Frame = +2

Query  2    FLDLVCFSHKIPEE----TNNAMGHFSTIEIRNIVDKCLINYSC-FNWMYSLIPEMGREI  166
            FLD+ C  H   E+    T NA G ++   I  +V + L+   C +  M+ L+ +MGREI
Sbjct  424  FLDITCAFHGCYEDEVTKTLNACGFYTESAISTLVQRNLLQRDCRYLVMHDLVRDMGREI  483

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKNM  304
            +  ESP  SG+RSRL+ P +V DVL   KG E +E++V+                 M N+
Sbjct  484  VRLESPRDSGKRSRLFNPQEVRDVLQGNKGSENVEVLVVERRALKGVKLSIKAFQKMINL  543

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFGVP  484
               +ID++++ G+F+ L  K LR L W  CP+K IP  +  +KLV L M  S++++FG+ 
Sbjct  544  RVLKIDDLYISGDFELLS-KELRWLSWKGCPLKYIPSNFPAEKLVVLNMEGSDVQDFGLN  602

Query  485  LK  490
            L+
Sbjct  603  LQ  604



>ref|XP_010326869.1| PREDICTED: TMV resistance protein N isoform X1 [Solanum lycopersicum]
Length=1050

 Score =   109 bits (272),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 66/182 (36%), Positives = 102/182 (56%), Gaps = 20/182 (11%)
 Frame = +2

Query  2    FLDLVCFSHKIPEE----TNNAMGHFSTIEIRNIVDKCLINYSC-FNWMYSLIPEMGREI  166
            FLD+ C  H   E+    T NA G ++   I  +V + L+   C +  M+ L+ +MGREI
Sbjct  424  FLDITCAFHGCYEDEVTKTLNACGFYTESAISTLVQRNLLQRDCRYLVMHDLVRDMGREI  483

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKNM  304
            +  ESP  SG+RSRL+ P +V DVL   KG E +E++V+                 M N+
Sbjct  484  VRLESPRDSGKRSRLFNPQEVRDVLQGNKGSENVEVLVVERRALKGVKLSIKAFQKMINL  543

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFGVP  484
               +ID++++ G+F+ L  K LR L W  CP+K IP  +  +KLV L M  S++++FG+ 
Sbjct  544  RVLKIDDLYISGDFELLS-KELRWLSWKGCPLKYIPSNFPAEKLVVLNMEGSDVQDFGLN  602

Query  485  LK  490
            L+
Sbjct  603  LQ  604



>ref|XP_009773802.1| PREDICTED: TMV resistance protein N-like [Nicotiana sylvestris]
Length=1064

 Score =   108 bits (271),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 101/182 (55%), Gaps = 20/182 (11%)
 Frame = +2

Query  2    FLDLVCFSHKIPE----ETNNAMGHFSTIEIRNIVDKCLINYSCFNW-MYSLIPEMGREI  166
            FLD+ C  H   E    E  NA G  + I I  +V K L+  + ++  M+ L+ +MGREI
Sbjct  441  FLDIACTFHGFDEHEVTEILNACGFHAKIAIATLVQKHLLQRTPYHLVMHDLVRDMGREI  500

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKNM  304
            +  ESP   G+RSRL+ P +V DVL   +G E +E++ L+                MKN+
Sbjct  501  VRLESPRDPGKRSRLFIPREVRDVLQGNEGSENVEVLKLDRGTLNGVNLSTKAFEQMKNL  560

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFGVP  484
                +DE+H+ G+F  L +K LR L W +CP+K IP  +  + LV L M ES+I+EF + 
Sbjct  561  RVLIMDELHISGDFGLLSKK-LRWLSWKKCPLKCIPSNFPAENLVVLDMRESDIQEFQLN  619

Query  485  LK  490
            L+
Sbjct  620  LQ  621



>ref|XP_006360923.1| PREDICTED: TMV resistance protein N-like isoform X2 [Solanum 
tuberosum]
Length=1066

 Score =   108 bits (271),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 100/182 (55%), Gaps = 20/182 (11%)
 Frame = +2

Query  2    FLDLVCFSHKIPEE----TNNAMGHFSTIEIRNIVDKCLINYSCFNW-MYSLIPEMGREI  166
            FLD+ C  H   E+    T NA G +S   I  +V + L+     N  M+ L+ +MGREI
Sbjct  445  FLDIACAFHGFFEDEVTSTLNACGFYSESAISTLVQRNLLQRDWHNLAMHDLVRDMGREI  504

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKNM  304
            +  ESP  SG+RSRL+ P +V DVL   KG E +E++++                 M N+
Sbjct  505  VRRESPRDSGKRSRLFNPQEVCDVLQGNKGSENVEVLMVERHALKGVKLSTKAFQKMINL  564

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFGVP  484
               +ID++H+ G+F+ L  K LR L W  CP+K IP  +  D+LV L M  SNI+E G+ 
Sbjct  565  RVLKIDDLHISGDFELLS-KELRWLSWEGCPLKCIPSNFPSDQLVFLNMKGSNIQELGLN  623

Query  485  LK  490
            L+
Sbjct  624  LQ  625



>ref|XP_006360922.1| PREDICTED: TMV resistance protein N-like isoform X1 [Solanum 
tuberosum]
Length=1093

 Score =   108 bits (271),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 100/182 (55%), Gaps = 20/182 (11%)
 Frame = +2

Query  2    FLDLVCFSHKIPEE----TNNAMGHFSTIEIRNIVDKCLINYSCFNW-MYSLIPEMGREI  166
            FLD+ C  H   E+    T NA G +S   I  +V + L+     N  M+ L+ +MGREI
Sbjct  445  FLDIACAFHGFFEDEVTSTLNACGFYSESAISTLVQRNLLQRDWHNLAMHDLVRDMGREI  504

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKNM  304
            +  ESP  SG+RSRL+ P +V DVL   KG E +E++++                 M N+
Sbjct  505  VRRESPRDSGKRSRLFNPQEVCDVLQGNKGSENVEVLMVERHALKGVKLSTKAFQKMINL  564

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFGVP  484
               +ID++H+ G+F+ L  K LR L W  CP+K IP  +  D+LV L M  SNI+E G+ 
Sbjct  565  RVLKIDDLHISGDFELLS-KELRWLSWEGCPLKCIPSNFPSDQLVFLNMKGSNIQELGLN  623

Query  485  LK  490
            L+
Sbjct  624  LQ  625



>ref|XP_006360962.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=884

 Score =   108 bits (269),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 67/182 (37%), Positives = 101/182 (55%), Gaps = 20/182 (11%)
 Frame = +2

Query  2    FLDLVCFSHKIPEE----TNNAMGHFSTIEIRNIVDKCLINYSCFNW-MYSLIPEMGREI  166
            FLD+ C      E+    T NA G +S   I  +V + L+  +C    M+ L+ +MGREI
Sbjct  412  FLDIACAFQGFFEDEVTNTLNACGFYSESAISTLVQRNLLQRNCRKLVMHDLVRDMGREI  471

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKNM  304
            +  ESP   G+RSRL+ P +V DVL   KG + +E++V+N                M  +
Sbjct  472  VRMESPRDCGKRSRLFNPQEVLDVLQGNKGSKNVEVLVINQQALKGVKLSTKAFQKMIKL  531

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFGVP  484
               +ID++H+ G+F+ L  K LR L W +CP+K IP  +  +KLV L M  S+I+EFG+ 
Sbjct  532  RVLKIDDLHISGDFELLS-KELRWLSWKKCPLKCIPSNFPAEKLVVLNMEGSDIQEFGLN  590

Query  485  LK  490
            L+
Sbjct  591  LQ  592



>ref|XP_006478473.1| PREDICTED: TMV resistance protein N-like [Citrus sinensis]
Length=1030

 Score = 90.5 bits (223),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 96/195 (49%), Gaps = 30/195 (15%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF    +     +     G    I I  +++K L+     N  WM+ LI EMG +
Sbjct  441  FLDIACFFKWKTRDYVSKILEGCGFSPVIGIEVLIEKSLLTVHENNRLWMHDLIQEMGHQ  500

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN----------------SPM  295
            I+  +SP++ G+RSRLW   DVH VL +  G E +E I+++                S M
Sbjct  501  IVRRQSPDEPGKRSRLWKEADVHHVLSQNAGSEVVEGIMVDDYFFRGNDVHLSAKAFSLM  560

Query  296  KNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
             N+   +I  + L    ++L  + LR L W++ P+KS+P     DK+V+ KM +S I+E 
Sbjct  561  TNLRLLKISNVQLPEGLEYLSNR-LRLLDWHRYPLKSLPSNLQLDKIVEFKMCDSRIEE-  618

Query  476  GVPLKVIWQYFFKFN  520
                  +W+ F   N
Sbjct  619  ------LWKGFKPLN  627


 Score = 38.9 bits (89),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 62/158 (39%), Gaps = 43/158 (27%)
 Frame = +3

Query  594   GFYLLNPLK*YFLCHESLDLGWCENLTRTPDFSGAKNLHKLSFYGSSLEKVHYSNIDLWM  773
             GF  LN L+   L H        ENL +TPDF+   NL  L                   
Sbjct  622   GFKPLNMLRVMKLSHS-------ENLIKTPDFTKVPNLEVL-------------------  655

Query  774   QSKIDLWGCERLKKLPSSSVENSGMLTHNFPQFPPNLEDIRLYGCKNLEVV-SATFPTSL  950
                 DL GC RL+++  S + +  ++  N            L GC +L  +    F  SL
Sbjct  656   ----DLEGCTRLREIHPSLLLHKELILLN------------LKGCTSLTTLPGKIFMESL  699

Query  951   EGIVLYGCTNLKTLLELPQNLQSLYVFNCESLETVHLP  1064
             + ++L GC  LK   ++   ++ L     + ++   LP
Sbjct  700   KTLILSGCLKLKKFPDIVGGMECLQELRLDGIDIKELP  737



>ref|XP_010244457.1| PREDICTED: TMV resistance protein N-like [Nelumbo nucifera]
Length=1278

 Score =   105 bits (261),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/183 (36%), Positives = 102/183 (56%), Gaps = 17/183 (9%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFNWM-YSLIPEMGREI  166
            FLD+ CF      K      ++   F+TI I  ++ +CLI       M + L+ +MGREI
Sbjct  443  FLDIACFFIGMDRKFVVSILDSCNFFATIGISVLIRRCLITIENEQLMMHDLLRDMGREI  502

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNS-----------PMKNMEYN  313
            +  ES  + G+RSRLW   DV +VL   KG +KIE ++ +             MK +   
Sbjct  503  VRKESIGEPGKRSRLWAHEDVLNVLRNDKGTKKIEGLLYSGKYQRLSTKVFEKMKKLRLL  562

Query  314  QIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFGVPLKV  493
            ++D IHLEG+++HLP K L+ L+WNQ P++SIP  +   +LV L+M  SN+++     K+
Sbjct  563  RVDFIHLEGDYQHLP-KQLKWLRWNQFPLESIPADFNLKELVVLEMRCSNLRQVWAETKL  621

Query  494  IWQ  502
            + Q
Sbjct  622  LEQ  624



>ref|XP_002524855.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF37479.1| ATP binding protein, putative [Ricinus communis]
Length=673

 Score =   104 bits (260),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 98/185 (53%), Gaps = 21/185 (11%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF          +  +  G F  I I  ++ + L+     N   M+ L+ +MGRE
Sbjct  449  FLDIACFFIGTDRDYAVKILDGCGFFPEIGISVLIQRSLVTVDSKNKLSMHDLLRDMGRE  508

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKN  301
            I+   SPN+ G+RSRLW   DV DVL  QKG E +E +VL+              + M+ 
Sbjct  509  IVRELSPNQPGKRSRLWFQEDVLDVLSNQKGTEAVEGLVLDVESSRDAVLSTESFANMRY  568

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFGV  481
            +   +I+++HL G ++HL  K LR L W+ CP+K +P  +  D LV L M  SNIKE   
Sbjct  569  LRLLKINKVHLTGCYEHLS-KELRWLCWHSCPLKFLPHNFQLDNLVILDMQYSNIKEVWK  627

Query  482  PLKVI  496
             ++V+
Sbjct  628  EIRVL  632



>ref|XP_008359988.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=823

 Score = 87.0 bits (214),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 97/178 (54%), Gaps = 25/178 (14%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETNNAM------GHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMG  157
            FLD+ CF   I  + N+ +      G ++   I  ++++CL+  +  N   M+ L+ +M 
Sbjct  525  FLDIACFF--IGMDKNDVVQILDGCGFYARTGIEVLLNRCLVTINRENKIMMHDLLRDMD  582

Query  158  REIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------M  295
            R+I+H+E+P+  GE+SRLW P DV+DVLI++ G EKIE + LN P              M
Sbjct  583  RDIVHAENPDFLGEQSRLWHPEDVNDVLIDKSGTEKIEGLALNLPSFEETSFSTEAFRNM  642

Query  296  KNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIK  469
            K +   Q++ + L   ++ L +K LR L W+  P++ IP       +V + M  S+++
Sbjct  643  KRLRLLQLNYVRLARGYQCLSKK-LRWLCWHGFPLEFIPIELCQPNIVAIDMQYSSLR  699


 Score = 41.6 bits (96),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 44/86 (51%), Gaps = 9/86 (10%)
 Frame = +3

Query  573  KFLICFYGFYLLNPLK*YFLCHESLDLGWCENLTRTPDFSGAKNLHKLSFYG-SSLEKVH  749
            + ++C Y + LL+ LK        L+L    NLT++PDFS   NL KL       L KVH
Sbjct  699  RHVLCEY-YGLLDKLK-------ILNLSHSHNLTQSPDFSKFPNLEKLILKDCKRLAKVH  750

Query  750  YSNIDLWMQSKIDLWGCERLKKLPSS  827
             S  DL     ++L  CE LK LP S
Sbjct  751  KSIEDLKSLVVVNLKDCETLKALPRS  776



>ref|XP_009607519.1| PREDICTED: putative disease resistance protein At4g11170 isoform 
X1 [Nicotiana tomentosiformis]
Length=139

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 81/135 (60%), Gaps = 15/135 (11%)
 Frame = +2

Query  131  MYSLIPEMGREIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------  286
            M+ L+ +MGREI+  ES    G+RSRL+ P +V DVL   +G E +E++ ++        
Sbjct  1    MHDLVRDMGREIVRMESSRDPGKRSRLFIPQEVRDVLQGNEGSENVEVLKVDRGTLKGVN  60

Query  287  ------SPMKNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLK  448
                    MKN+    +DE+H+ G+F  L +K LR L W +CP+K IP  +  DKLV L 
Sbjct  61   LSTKAFEQMKNLRVLIMDELHISGDFGLLSKK-LRWLSWKKCPLKYIPSNFPADKLVVLD  119

Query  449  MWESNIKEFGVPLKV  493
            M ES+I+EFG+ ++V
Sbjct  120  MRESDIQEFGLNMQV  134



>ref|XP_009597750.1| PREDICTED: TMV resistance protein N-like [Nicotiana tomentosiformis]
Length=1058

 Score =   103 bits (257),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 68/185 (37%), Positives = 100/185 (54%), Gaps = 26/185 (14%)
 Frame = +2

Query  2    FLDLVCFSHKIPE----ETNNAMGHFSTIEIRNIVDKCLINYSCFNW----MYSLIPEMG  157
            FLD+ C  H   E    E  NA G  + I I  +V K L+  S   W    M+ L+ +MG
Sbjct  441  FLDIACAFHGFDEHEVTEILNACGFHAKIAIATLVQKHLLQKS---WNILEMHDLVRDMG  497

Query  158  REIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPM  295
            RE++  ES    G+RSRL+ P +V DVL   KG +K+E++ ++                M
Sbjct  498  REVVRMESARDPGKRSRLFIPQEVCDVLQGNKGSKKVEVLKVDRRAFEGLNLSTKAFKKM  557

Query  296  KNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
            KN+    +DE+H+ G+F+ L  K LR L W +CP+K IP  +  + LV L M ES+I+EF
Sbjct  558  KNLRVLIMDELHISGDFELLS-KELRWLSWKKCPLKCIPSNFPAENLVVLDMRESDIQEF  616

Query  476  GVPLK  490
             + L+
Sbjct  617  QLNLQ  621



>ref|XP_006360971.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=1394

 Score =   103 bits (256),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 67/182 (37%), Positives = 97/182 (53%), Gaps = 20/182 (11%)
 Frame = +2

Query  2    FLDLVCFSHKIPEE----TNNAMGHFSTIEIRNIVDKCLINYSCFNW-MYSLIPEMGREI  166
            FLD+ C  H   E+    T N  G +    I  +V + L+        M+ L+ +MGREI
Sbjct  302  FLDIACAFHGCDEDEVTKTLNPCGFYCETAIATLVKRHLLQRDRRRLVMHDLVRDMGREI  361

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKNM  304
            +  ESP   G+RSRL  P +V DVL   KG E +E++V+                 M N+
Sbjct  362  VRMESPRDFGKRSRLVNPQEVLDVLQGNKGSENVEILVVERQALKGVKLNTKAFQKMINL  421

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFGVP  484
               +ID++H+ G+F+ L  K LR L W +CP+K IP  +  +KLV L M  SNI+EFG+ 
Sbjct  422  RVLKIDDLHISGDFELLS-KELRWLSWKECPLKCIPSNFPSEKLVVLNMKGSNIQEFGLN  480

Query  485  LK  490
            L+
Sbjct  481  LQ  482



>ref|XP_009607520.1| PREDICTED: putative disease resistance protein At4g11170 isoform 
X2 [Nicotiana tomentosiformis]
Length=135

 Score = 95.5 bits (236),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 80/134 (60%), Gaps = 15/134 (11%)
 Frame = +2

Query  131  MYSLIPEMGREIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------  286
            M+ L+ +MGREI+  ES    G+RSRL+ P +V DVL   +G E +E++ ++        
Sbjct  1    MHDLVRDMGREIVRMESSRDPGKRSRLFIPQEVRDVLQGNEGSENVEVLKVDRGTLKGVN  60

Query  287  ------SPMKNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLK  448
                    MKN+    +DE+H+ G+F  L +K LR L W +CP+K IP  +  DKLV L 
Sbjct  61   LSTKAFEQMKNLRVLIMDELHISGDFGLLSKK-LRWLSWKKCPLKYIPSNFPADKLVVLD  119

Query  449  MWESNIKEFGVPLK  490
            M ES+I+EFG+ ++
Sbjct  120  MRESDIQEFGLNMQ  133



>ref|XP_009605717.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104100237 
[Nicotiana tomentosiformis]
Length=1928

 Score =   102 bits (255),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 99/185 (54%), Gaps = 26/185 (14%)
 Frame = +2

Query  2    FLDLVCFSHKIPE----ETNNAMGHFSTIEIRNIVDKCLINYSCFNW----MYSLIPEMG  157
            FLD+ C  H   E    E  NA G  +   I  +V K L+  S   W    M+ L+ +MG
Sbjct  444  FLDIACAFHGFDEHEVTEILNACGFHAKSAIATLVQKHLLQKS---WNILEMHDLVRDMG  500

Query  158  REIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPM  295
            RE++  ES    G+RSRL+ P +V DVL   KG +K+E++ ++                M
Sbjct  501  REVVRMESARDPGKRSRLFIPQEVCDVLQGNKGSKKVEVLKVDRRAFEGVNLSTKAFKKM  560

Query  296  KNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
            KN+    +DE+H+ G+F+ L  K LR L W +CP+K IP  +  + LV L M ES+I+EF
Sbjct  561  KNLRVLIMDELHISGDFELLS-KVLRWLSWKKCPLKCIPSNFPAENLVALDMQESDIQEF  619

Query  476  GVPLK  490
             + L+
Sbjct  620  QLNLQ  624


 Score = 92.0 bits (227),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 64/183 (35%), Positives = 95/183 (52%), Gaps = 22/183 (12%)
 Frame = +2

Query  2     FLDLVC-----FSHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFNW-MYSLIPEMGRE  163
             FLD+ C       HKI E   NA G  +   I  +V K L+  S     M+ L+ +MGRE
Sbjct  1452  FLDIACAFQGLLEHKITE-ILNACGFHAKSAIATLVQKHLLQRSWHGLVMHDLVRDMGRE  1510

Query  164   IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKN  301
             I+  ES    G+ SRL+ P +V DVL   +G E +E++ ++                MKN
Sbjct  1511  IVSLESARDPGKWSRLFIPQEVRDVLQGNEGSENVEVLKVDPGTLKGVNLSTKAFEQMKN  1570

Query  302   MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFGV  481
             +    +DE+H+ G+F    +K LR L W +CP+K I   +  + LV L M ES+I+EF +
Sbjct  1571  LRVLIMDELHISGDFGLFSKK-LRWLSWKKCPLKCISSNFPAENLVVLDMRESDIQEFRL  1629

Query  482   PLK  490
              L+
Sbjct  1630  NLQ  1632


 Score = 52.4 bits (124),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 59/242 (24%), Positives = 102/242 (42%), Gaps = 57/242 (24%)
 Frame = +3

Query  639   ESLDLGWCENLTRTPDFSGAKNLHKLSFYG-SSLEKVHYSNIDLWMQSKIDLWGCERLKK  815
             + LDL +C+ L  TP+F+G+ +L  L   G SSL ++H S  +L    K+D+  CE+L  
Sbjct  1638  KKLDLSYCKQLRSTPNFNGSLSLEILDLCGCSSLTEIHPSIGNLDRLIKLDMSDCEKLTD  1697

Query  816   LPSS-----SVENSGMLT-HNFPQFPPNLEDIRLYGC-----------------------  908
             LPSS     SV+   +    +    P NL D++   C                       
Sbjct  1698  LPSSICHLISVDXLSISNCSSIKTLPDNLGDMKSLRCLYASYTGIKQLPRSVEMLRNLVA  1757

Query  909   ----------------KNLEVVSATFPTSLEGIVLYGCTNLKTLLELPQNLQSLYVFNCE  1040
                             + +  +  + PT +  + L  C NL    ++P++++SL      
Sbjct  1758  LNVGGQKLEAKRCICGRGVHRIQYSLPTIVSDLSLTYC-NLSE-ADIPRDIRSLSSLAYL  1815

Query  1041  SLETVH---LP------KMLEYVKLTHCKKLKEIQGWENAQFLTRIELRGVPNNIKFSEI  1193
              L       LP      ++LE + L  C+ L+ +    N ++L RIE +   N +K +++
Sbjct  1816  DLSGSSFYCLPFGFSKLRLLEKLSLNDCENLQTLPSVSNLEYLGRIEHKNCQNLVKITDL  1875

Query  1194  IN  1199
              N
Sbjct  1876  DN  1877



>ref|XP_009760885.1| PREDICTED: TMV resistance protein N-like [Nicotiana sylvestris]
Length=1127

 Score =   102 bits (254),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 66/183 (36%), Positives = 100/183 (55%), Gaps = 22/183 (12%)
 Frame = +2

Query  2    FLDLVC-----FSHKIPEETNNAMGHFSTIEIRNIVDKCLINYS-CFNWMYSLIPEMGRE  163
            FLD+ C     F ++I E   NA G  + I I  +V K L+     +  M+ L+ +MGRE
Sbjct  519  FLDIACAFQGLFEYEITE-ILNACGFHAKISIATLVQKHLLQRDDLYLVMHDLVRDMGRE  577

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKN  301
            I+  ES    G+RSRL+ P +V DVL   KG +K+E++ ++                MKN
Sbjct  578  IVRMESARDPGKRSRLFIPQEVCDVLQGNKGSKKVEVLKIDRRAFERQNLSTKAFKKMKN  637

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFGV  481
            +    ++E+H+ G F+ L  K LRCL W +CP+K +P  +  + LV L M ES I+EF +
Sbjct  638  LRVLIMNELHISGGFELLS-KELRCLSWKRCPLKCVPSNFPAENLVVLDMHESAIQEFQL  696

Query  482  PLK  490
             L+
Sbjct  697  NLQ  699



>ref|XP_008371343.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=544

 Score = 98.6 bits (244),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 102/180 (57%), Gaps = 26/180 (14%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETNNAM------GHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMG  157
            FLD+ CF   I  + N+ M      G ++T  I  ++D+CL+  +  N   M+ L+ +MG
Sbjct  91   FLDIACFF--IGMDKNBVMQILDGCGFYATTGIEVLLDRCLVTINRENKIMMHDLLRDMG  148

Query  158  REIIHSESPNKSGERSRLWCPNDVHDVLIEQ-KGMEKIEMIVLNSP--------------  292
            R+I+H+E+P+  GERSRLW P DV+DVLI++ +G EKI+ + LN P              
Sbjct  149  RDIVHAENPDFPGERSRLWLPEDVNDVLIDKSQGTEKIDGLALNLPSLEETSFSTGAFRN  208

Query  293  MKNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKE  472
            MK +   Q++ + L G ++ L +K LR L W+  P++ IP       +V + M  S++K+
Sbjct  209  MKRLRLLQLNYVRLAGGYQCLSKK-LRWLCWHGFPLEFIPIELCQPNIVAIDMRYSSLKQ  267



>ref|XP_009758995.1| PREDICTED: TMV resistance protein N-like isoform X2 [Nicotiana 
sylvestris]
Length=718

 Score = 98.6 bits (244),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 65/182 (36%), Positives = 95/182 (52%), Gaps = 20/182 (11%)
 Frame = +2

Query  2    FLDLVC----FSHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFNW-MYSLIPEMGREI  166
            FLD+ C    F      E  NA G  +   I  +V K L+  S     M+ L+ +MGREI
Sbjct  444  FLDIACAFYGFREDRVTEILNACGFHARSPIATLVQKHLLQRSWHGLVMHDLVRDMGREI  503

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKNM  304
            +  ES    G+RSRL+ P +V DVL   +G E +E++ ++                MKN+
Sbjct  504  VRMESARDPGKRSRLFIPQEVRDVLQGNEGSENVEVLKVDRGTLKGVNLSTKAFEQMKNL  563

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFGVP  484
                +DE+H+ G+F  L +K LR L W +CP+K IP  +    LV L M ES+I+EF + 
Sbjct  564  RVLIMDELHISGDFGLLSKK-LRWLSWKKCPLKCIPSNFPAKNLVVLDMRESDIQEFRLN  622

Query  485  LK  490
            L+
Sbjct  623  LQ  624



>ref|XP_006370856.1| hypothetical protein POPTR_0019s00950g [Populus trichocarpa]
 gb|ERP48653.1| hypothetical protein POPTR_0019s00950g [Populus trichocarpa]
Length=861

 Score = 82.0 bits (201),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 90/178 (51%), Gaps = 21/178 (12%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFNW--MYSLIPEMGRE  163
            FLD+ CF      +   E  +  G F  I I  ++ + L++ +  N   M+ LI +MGRE
Sbjct  217  FLDIACFFIGWDKEYVVEILDGRGFFPDIGIDILIQRSLLSINDENELNMHDLIRDMGRE  276

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKN  301
            I    S +  G+R+R+W   D  DVL  Q G + +E + L+              + M+ 
Sbjct  277  IAREVSYDHPGKRNRIWLLEDALDVLNNQTGTDAVEGLALDVRASTVASLSTKSFTNMRR  336

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
            ++  QI+  HL G++K LP + L  L W +CP+KS+P     + LV L +  SNI+E 
Sbjct  337  LKLLQINGAHLAGSYKLLPNE-LIWLCWLECPMKSLPSDLQLNNLVVLDLQHSNIEEL  393


 Score = 39.7 bits (91),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 59/133 (44%), Gaps = 21/133 (16%)
 Frame = +3

Query  594  GFYLLNPLK*YFLCHESLDLGWCENLTRTPDFSGAKNLHKLSFYG-SSLEKVHYSNIDLW  770
            G  +LN LK        L+L + + L +TP+F G  +L  L     +SL KVH S   L 
Sbjct  396  GTKILNKLK-------ILNLSYSKLLVKTPNFQGLPSLEILKLTACTSLAKVHPSIGHLK  448

Query  771  MQSKIDLWGCERLKKLPSSSVENSGMLTHN---------FPQFPPNLEDIRLYGCKNLEV  923
                ++L GC RLK LP S      + T N          P+F  ++E +  +   ++  
Sbjct  449  RLVSLNLEGCCRLKTLPESICNLKSIETLNISLCSQLEKLPEFLGDMESLTEFCSTSI--  506

Query  924  VSATFPTSLEGIV  962
              A  PT L G+ 
Sbjct  507  --AMLPTPLTGLT  517



>ref|XP_006360964.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=1058

 Score = 98.6 bits (244),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/199 (33%), Positives = 101/199 (51%), Gaps = 37/199 (19%)
 Frame = +2

Query  2    FLDLVCFSHKIPEE----TNNAMGHFSTIEIRNIVDKCLINYSC-FNWMYSLIPEMGREI  166
            FLD+ C  H   E+    T NA G +S   I  ++ + L+   C +  M+ L+ +MGREI
Sbjct  426  FLDITCAFHGCYEDEVTKTLNACGFYSESAISTLIQRNLLQRDCCYLVMHDLVRDMGREI  485

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQK-----------------GMEKIEMIVLN---  286
            +  ESP  SG+RSRL+ P +V DVL   K                 G + +E++V+    
Sbjct  486  VRLESPRDSGKRSRLFNPQEVRDVLQGNKVSKFGLSLFDIHLLIIYGSKNVEVLVVERRA  545

Query  287  -----------SPMKNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDK  433
                         M  +   +ID++H+ G+F+ L  K LR L W  CP+K IP  +  +K
Sbjct  546  LKGVKLSTKAFQKMIKLRVLKIDDLHISGDFELLS-KELRWLSWKGCPLKCIPLNFPAEK  604

Query  434  LVKLKMWESNIKEFGVPLK  490
            LV L M  S++++FG+ L+
Sbjct  605  LVVLNMEGSDVQDFGLNLQ  623



>ref|XP_009366532.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=637

 Score = 97.8 bits (242),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/186 (35%), Positives = 99/186 (53%), Gaps = 22/186 (12%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF    +     +  ++ G  S I IR + DK LI+ S +N  WM+ L+ EMG E
Sbjct  438  FLDIACFFKWKNKARVTKILDSFGFHSDIGIRVLSDKSLISVS-YNMLWMHDLLQEMGWE  496

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKN  301
            I+  ES ++ G+RSRLW   DV+DVL+  KG E IE +VL               S M  
Sbjct  497  IVRQESRSEPGKRSRLWLFEDVYDVLVNNKGTEVIEGLVLTSRADEEVHTSTEAFSKMNK  556

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFGV  481
            +   ++  +HL     +L  + LR L+W+  P +S+P  +  +KL +L +  S I+E   
Sbjct  557  LRMLKLGNVHLSEELTYLSNE-LRVLKWHGYPSRSLPSNFRPEKLFELSLCNSRIEELWK  615

Query  482  PLKVIW  499
             +KV+W
Sbjct  616  VIKVLW  621



>ref|XP_008345881.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=986

 Score = 98.2 bits (243),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 99/179 (55%), Gaps = 25/179 (14%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETN------NAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMG  157
            FLD+ CF   I  + N      +  G ++T  I+ ++D+CLI     N   M+ L+ +MG
Sbjct  267  FLDIACFF--IGMDKNYVIXILDGCGFYATTGIKVLLDRCLITIGIKNKIMMHDLLRDMG  324

Query  158  REIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------M  295
            R+I+H+E+P+   ERSRLW P DV+DVLI++ G EKIE + LN P              M
Sbjct  325  RDIVHAENPDFPXERSRLWXPEDVNDVLIDKAGTEKIEGLALNLPSLEETSFSTEALRNM  384

Query  296  KNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKE  472
            K +   Q++ + L G ++ L +K LR L W+  P++ IP       +V + M  S++K+
Sbjct  385  KRLRLLQLNYVRLXGEYQCLFKK-LRWLCWHGFPLEFIPIELCQPNIVAIDMRYSSLKQ  442



>ref|XP_009589492.1| PREDICTED: TMV resistance protein N-like [Nicotiana tomentosiformis]
Length=1074

 Score = 97.4 bits (241),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 94/177 (53%), Gaps = 20/177 (11%)
 Frame = +2

Query  2    FLDLVCFSHKIPE----ETNNAMGHFSTIEIRNIVDKCLINYSCFNW-MYSLIPEMGREI  166
            FLD+ C  H   E    E  NA G  +   I  +V K L+  S     M+ L+ +MGREI
Sbjct  441  FLDITCAFHGFNEREVTEILNACGFHAKSAIATLVQKHLLQRSWHGLVMHDLVRDMGREI  500

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKNM  304
            +  ES   +G+RSRL+ P +V DVL   +G E +E++ ++                MKN+
Sbjct  501  VRMESTRDAGKRSRLFIPQEVRDVLQGNEGSENVEVLKVDPGTLKGVNLSTKAFEQMKNL  560

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
                I+E+H+ G+F  L +K LR L W +CP+K I   +  + LV L M ES+I+EF
Sbjct  561  RVLIINELHISGDFGLLSKK-LRWLSWKKCPLKCISSNFPAENLVVLDMEESDIQEF  616



>ref|XP_006380157.1| hypothetical protein POPTR_0008s22430g [Populus trichocarpa]
 gb|ERP57954.1| hypothetical protein POPTR_0008s22430g [Populus trichocarpa]
Length=880

 Score = 97.1 bits (240),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 71/188 (38%), Positives = 103/188 (55%), Gaps = 24/188 (13%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETNNAM----GHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGREI  166
            FLD+ CF +   E+    +    G +  I IR +V+K LIN S    WM+ L+ EMGR+I
Sbjct  248  FLDIACFFNGWEEDCVTKLMESSGFYPQIGIRILVEKFLINISDNRVWMHDLLQEMGRQI  307

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNS---------------PMKN  301
            +  ES  + G+R+RLW   DV  VL+   G +K+E IVLNS                MK 
Sbjct  308  VKRESHEEPGKRTRLWLCEDVIHVLLNNTGTDKVEGIVLNSNDEVDGLYLSAESIMKMKR  367

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF--  475
            +   ++  I+L    K+L  + LR L+W + P KS+P  +  DKLV+L M  S+IK+   
Sbjct  368  LRILKLQNINLSQEIKYLSNE-LRYLEWCRYPFKSLPSTFQPDKLVELHMRHSSIKQLWE  426

Query  476  GV-PLKVI  496
            GV PLK++
Sbjct  427  GVRPLKLL  434



>ref|XP_002530627.1| TMV resistance protein N, putative [Ricinus communis]
 gb|EEF31770.1| TMV resistance protein N, putative [Ricinus communis]
Length=1116

 Score = 97.1 bits (240),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 65/187 (35%), Positives = 103/187 (55%), Gaps = 23/187 (12%)
 Frame = +2

Query  2    FLDLVCFSHKIPEE----TNNAMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGREI  166
            FLD+ CF +   ++       + G +  + IR++++K LI  S    WM+ L+ EMGREI
Sbjct  437  FLDIACFFNGEDKDYVIKVLESRGFYPHVGIRDLINKSLITISKERIWMHDLLQEMGREI  496

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNS--------------PMKNM  304
            +  ES  + G+RSRLW   DV+ VL    G E++E IVL+S               MK +
Sbjct  497  VRQESQEEPGKRSRLWLYEDVYHVLSNDTGTEQVEAIVLDSCEQEDEELSAKAFTKMKRL  556

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF--G  478
             + ++  +HL    ++L  K LR L+W++ P KS P  +  ++L++L M  SNIK    G
Sbjct  557  RFLKLRNLHLSEGLEYLSNK-LRYLEWDRYPFKSFPSTFQPNELIELHMRCSNIKHMWKG  615

Query  479  V-PLKVI  496
            + PLK++
Sbjct  616  IKPLKML  622



>emb|CDK13058.1| TIR-NBS-LRR disease resistance protein [Malus domestica]
Length=1190

 Score = 97.1 bits (240),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 99/177 (56%), Gaps = 21/177 (12%)
 Frame = +2

Query  2    FLDLVCFSHKIPE----ETNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF   + +    +  +  G ++T  I  + ++CL+  +  N   M+ L+ +MGR+
Sbjct  531  FLDIACFFIGMDKNDVAQILDGCGFYATTGIELLFNRCLVTINRENKIMMHDLLRDMGRD  590

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKN  301
            I+H+E+P+  GERSRLW P DV+DVLI++ G EKIE + LN P              MK 
Sbjct  591  IVHAENPDFPGERSRLWHPEDVNDVLIDKSGTEKIEGLALNLPSLEETCFSTEAFRNMKR  650

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKE  472
            +   Q++ + L G ++ L +K LR L W+  P++ IP       +V + M  S++++
Sbjct  651  LRLLQLNNVQLAGGYQCLFKK-LRWLCWHGFPLEFIPIELCQPNIVAIDMQYSSLRQ  706



>gb|KHN06859.1| TMV resistance protein N [Glycine soja]
Length=1231

 Score = 84.0 bits (206),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 68/196 (35%), Positives = 97/196 (49%), Gaps = 30/196 (15%)
 Frame = +2

Query  2    FLDLVCF--SHKIPEETN---NAMGHFSTIEIRNIVDKCLINYSCFNW--MYSLIPEMGR  160
            FLD+ CF     + + T+      G      IR ++DK LI    + +  M++L+  MGR
Sbjct  441  FLDIACFFRGSDLKDVTSLLFQGRGFSPEYVIRVLIDKSLIKIDKYGFVRMHNLVENMGR  500

Query  161  EIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MK  298
            EI+  ESP++ G+RSRLW   D+ DVL   KG + IE+I+L+SP              M 
Sbjct  501  EIVKQESPSEPGKRSRLWLYEDIVDVLENDKGTDTIEVIMLHSPKNKEVQWNGSELKKMT  560

Query  299  NMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWES-NIKEF  475
            N++   I+  H      HLP  +LR L+W   P  S+P  +   +LV L +  S NI   
Sbjct  561  NLKLLSIENAHFSRGPVHLP-NSLRVLKWWGYPSPSLPPEFDSRRLVMLDLSNSCNI--M  617

Query  476  GVPLKVIWQYFFKFNS  523
            G  LK     F KF S
Sbjct  618  GKQLK-----FMKFES  628


 Score = 35.4 bits (80),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 82/186 (44%), Gaps = 25/186 (13%)
 Frame = +3

Query  627   FLCHESLD---LGWCENLTRTPDFSGAKNLHKLSFYG-SSLEKVHYSNIDLWMQSKIDLW  794
             F+  ESL    L  C  + +TPD SGA+NL KL      +L +VH S   L   +     
Sbjct  623   FMKFESLSEMVLRGCRFIKQTPDMSGAQNLKKLCLDNCKNLVEVHDSIGLLDKITWFTAV  682

Query  795   GCERLKKLPSS----SVEN-SGMLTHNFPQFPPNLEDIRLYGCKNLEVVSATFP------  941
             GC  L+ LP S    S+E+ S     N    P  LE+++    K L++            
Sbjct  683   GCTNLRILPRSFKLTSLEHLSFKKCSNLQCLPNILEEMK--HVKKLDLCGTAIEELPFSF  740

Query  942   ---TSLEGIVLYGCTNLK----TLLELPQNLQSLYVFNCESLETVHLPKMLEYVKLTHCK  1100
                T L+ +VL  C  L     ++L LP+ L+ L    C     + L K    V+L+  +
Sbjct  741   RKLTGLKYLVLDKCKMLNQIPISILMLPK-LEKLTAIKCGRYANLILGKSEGQVRLSSSE  799

Query  1101  KLKEIQ  1118
              L++++
Sbjct  800   SLRDVR  805



>ref|XP_006586027.1| PREDICTED: TMV resistance protein N-like [Glycine max]
Length=1231

 Score = 84.0 bits (206),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 68/196 (35%), Positives = 97/196 (49%), Gaps = 30/196 (15%)
 Frame = +2

Query  2    FLDLVCF--SHKIPEETN---NAMGHFSTIEIRNIVDKCLINYSCFNW--MYSLIPEMGR  160
            FLD+ CF     + + T+      G      IR ++DK LI    + +  M++L+  MGR
Sbjct  441  FLDIACFFRGSDLKDVTSLLFQGRGFSPEYVIRVLIDKSLIKIDKYGFVRMHNLVENMGR  500

Query  161  EIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MK  298
            EI+  ESP++ G+RSRLW   D+ DVL   KG + IE+I+L+SP              M 
Sbjct  501  EIVKQESPSEPGKRSRLWLYEDIVDVLENDKGTDTIEVIMLHSPKNKEVQWNGSELKKMT  560

Query  299  NMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWES-NIKEF  475
            N++   I+  H      HLP  +LR L+W   P  S+P  +   +LV L +  S NI   
Sbjct  561  NLKLLSIENAHFSRGPVHLP-NSLRVLKWWGYPSPSLPPEFDSRRLVMLDLSNSCNI--M  617

Query  476  GVPLKVIWQYFFKFNS  523
            G  LK     F KF S
Sbjct  618  GKQLK-----FMKFES  628


 Score = 35.4 bits (80),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 82/186 (44%), Gaps = 25/186 (13%)
 Frame = +3

Query  627   FLCHESLD---LGWCENLTRTPDFSGAKNLHKLSFYG-SSLEKVHYSNIDLWMQSKIDLW  794
             F+  ESL    L  C  + +TPD SGA+NL KL      +L +VH S   L   +     
Sbjct  623   FMKFESLSEMVLRGCRFIKQTPDMSGAQNLKKLCLDNCKNLVEVHDSIGLLDKITWFTAV  682

Query  795   GCERLKKLPSS----SVEN-SGMLTHNFPQFPPNLEDIRLYGCKNLEVVSATFP------  941
             GC  L+ LP S    S+E+ S     N    P  LE+++    K L++            
Sbjct  683   GCTNLRILPRSFKLTSLEHLSFKKCSNLQCLPNILEEMK--HVKKLDLCGTAIEELPFSF  740

Query  942   ---TSLEGIVLYGCTNLK----TLLELPQNLQSLYVFNCESLETVHLPKMLEYVKLTHCK  1100
                T L+ +VL  C  L     ++L LP+ L+ L    C     + L K    V+L+  +
Sbjct  741   RKLTGLKYLVLDKCKMLNQIPISILMLPK-LEKLTAIKCGRYANLILGKSEGQVRLSSSE  799

Query  1101  KLKEIQ  1118
              L++++
Sbjct  800   SLRDVR  805



>ref|XP_006360969.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=1712

 Score = 96.7 bits (239),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 68/183 (37%), Positives = 98/183 (54%), Gaps = 22/183 (12%)
 Frame = +2

Query  2     FLDLVCFSHKIPEE----TNNAMGHFSTIEIRNIVDKCLINYSCFNW--MYSLIPEMGRE  163
             FLD+ C  H   E+    T NA G +S   I  +V + L+         M+ L+ EMGRE
Sbjct  1098  FLDIACAFHGCYEDEVAKTLNACGFYSESAISTLVQRNLLQREDRPGLVMHDLVQEMGRE  1157

Query  164   IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKN  301
             I+  ES +  G+RSRL+ P +  DVL   KG E +E++V+                 MK 
Sbjct  1158  IVRMESQD-PGKRSRLFNPLEAIDVLQGNKGSENVEILVVERQALKGVKVSTKAFQKMKY  1216

Query  302   MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFGV  481
             +   +ID++H+ G+F+ L  K LR L W  CP+K IP  +  +KLV L M  SNI+EFG+
Sbjct  1217  LRVLKIDDLHISGDFELLS-KELRWLSWKGCPLKCIPSNFPSEKLVFLNMKGSNIQEFGL  1275

Query  482   PLK  490
              L+
Sbjct  1276  NLQ  1278



>ref|XP_009364579.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=845

 Score = 96.3 bits (238),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 99/177 (56%), Gaps = 21/177 (12%)
 Frame = +2

Query  2    FLDLVCFSHKIPE----ETNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF   + +    +  +  G ++T  I  ++D+CL+     N   M+ L+ +MGR+
Sbjct  169  FLDIACFYIGMDKNDVIQILDGCGFYATTGIEVLLDRCLVTIGRKNKIMMHDLLRDMGRD  228

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKN  301
            I+H+E+P+  GE+SRLW P DV+DVLI++ G EK+E + L+ P              MK 
Sbjct  229  IVHTENPDFPGEQSRLWRPEDVNDVLIDKSGTEKVEGLALDLPSVKEISFSTEAFRNMKR  288

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKE  472
            +   Q++ + L G ++ L +K LR L W+  P++ IP       +V + M  +++K+
Sbjct  289  LRLLQLNYVRLAGGYQCLSKK-LRWLCWHGFPLEFIPIELCQPNIVAIDMRYNSLKQ  344



>ref|XP_009758997.1| PREDICTED: TMV resistance protein N-like [Nicotiana sylvestris]
Length=993

 Score = 96.3 bits (238),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 63/182 (35%), Positives = 96/182 (53%), Gaps = 20/182 (11%)
 Frame = +2

Query  2    FLDLVCFSHKIPE----ETNNAMGHFSTIEIRNIVDKCLINYSC-FNWMYSLIPEMGREI  166
            FLD+ C  H   E    E  NA G  +   I  ++ K L+  S     M+ L+ +MGRE+
Sbjct  376  FLDIACAFHGFNEHEVTEMVNACGFHAKSAIATLIQKHLLQRSLNILEMHDLVRDMGREV  435

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKNM  304
            +  ES    G+RSRL+ P +V  VL   KG +K+E++ ++                MK +
Sbjct  436  VRMESARDPGKRSRLFIPQEVRYVLQGNKGSKKVELLKVDPREFKGVNLSTKAFKKMKTL  495

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFGVP  484
                +DE+H+ G+F+ L  K LR L W +CP+K IP  +  + LV L M ES+I+EF + 
Sbjct  496  RVLIMDELHISGDFELLS-KELRWLSWKKCPLKCIPSNFPAENLVVLDMRESDIQEFQLN  554

Query  485  LK  490
            L+
Sbjct  555  LQ  556



>gb|AES86811.2| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=1113

 Score = 96.7 bits (239),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 64/178 (36%), Positives = 93/178 (52%), Gaps = 25/178 (14%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETNNAM------GHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMG  157
            FLD+ CF   I  + N+ +      G F+ I I  +V++ L+     N   M+ L+ +MG
Sbjct  476  FLDISCFF--IGMDRNDVIRILDGCGFFAGIGISVLVERSLVTVDDKNKLGMHDLLRDMG  533

Query  158  REIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------M  295
            REII  +SP +  E SRLW   DV DVL+E  G + +E + L  P              M
Sbjct  534  REIIREKSPKEPEEHSRLWFHEDVIDVLLEHTGTKAVEGLSLKLPGRSAQRFSTKTFENM  593

Query  296  KNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIK  469
            K +   Q+  + L+G+FKHL RK LR LQWN  P+  IP  ++   LV + +  SNI+
Sbjct  594  KKLRLLQLSGVQLDGDFKHLSRK-LRWLQWNGFPLTCIPSNFYQRNLVSIVLENSNIR  650



>ref|XP_008362922.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=884

 Score = 96.3 bits (238),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 96/174 (55%), Gaps = 21/174 (12%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCLIN--YSCFNWMYSLIPEMGRE  163
            FLD+ CF       I  +  +  G  +TI I  + ++CLI   ++  N M+ L+ EM R 
Sbjct  257  FLDISCFFIGADKDIVTKVLDGCGFSATIGISVLCERCLITVEHNKLN-MHDLLREMARV  315

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP------------MKNME  307
            II  +SP   G+ SRLW   +V +VL  + G E++E + L  P            MK + 
Sbjct  316  IISEKSPCHPGKWSRLWDDREVINVLTNKSGTEEVEGLALRWPYDTDISTEAFANMKKLR  375

Query  308  YNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFF-DKLVKLKMWESNI  466
              Q++E+ L G +KHLP K L  L+W +CP+KSIP  +F  DKLV L+MW+S +
Sbjct  376  LLQLNEVELIGEYKHLP-KELIWLRWEECPLKSIPDDFFSQDKLVVLEMWDSEL  428



>ref|XP_003604614.1| TIR-NBS-LRR RCT1-like resistance protein [Medicago truncatula]
Length=1160

 Score = 96.3 bits (238),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 64/178 (36%), Positives = 93/178 (52%), Gaps = 25/178 (14%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETNNAM------GHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMG  157
            FLD+ CF   I  + N+ +      G F+ I I  +V++ L+     N   M+ L+ +MG
Sbjct  476  FLDISCFF--IGMDRNDVIRILDGCGFFAGIGISVLVERSLVTVDDKNKLGMHDLLRDMG  533

Query  158  REIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------M  295
            REII  +SP +  E SRLW   DV DVL+E  G + +E + L  P              M
Sbjct  534  REIIREKSPKEPEEHSRLWFHEDVIDVLLEHTGTKAVEGLSLKLPGRSAQRFSTKTFENM  593

Query  296  KNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIK  469
            K +   Q+  + L+G+FKHL RK LR LQWN  P+  IP  ++   LV + +  SNI+
Sbjct  594  KKLRLLQLSGVQLDGDFKHLSRK-LRWLQWNGFPLTCIPSNFYQRNLVSIVLENSNIR  650



>ref|XP_009779815.1| PREDICTED: TMV resistance protein N-like [Nicotiana sylvestris]
 ref|XP_009779816.1| PREDICTED: TMV resistance protein N-like [Nicotiana sylvestris]
Length=1050

 Score = 95.9 bits (237),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 97/185 (52%), Gaps = 26/185 (14%)
 Frame = +2

Query  2    FLDLVCFSHKIPE----ETNNAMGHFSTIEIRNIVDKCLINYSCFNW----MYSLIPEMG  157
            FLD+ C  H   E    E  NA G  +   I  +V K L+  S   W    M+ L+ +MG
Sbjct  441  FLDIACAFHGFYEHEVTEMVNACGFHAKSAIATLVQKHLLQRS---WNILEMHDLVRDMG  497

Query  158  REIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNS--------------PM  295
            RE++  ES    G+RSRL+ P++V DVL   KG +K+E++ ++                M
Sbjct  498  REVVRMESARDPGKRSRLFIPHEVRDVLQGNKGSKKVEVLKVDQLAFEGLNLSTKAFKKM  557

Query  296  KNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
            KN+    +DE+H+ G+ + L  K LR L W +CP+K IP  +    LV L M  S+I+EF
Sbjct  558  KNLRVLIMDELHISGDLELLS-KELRWLSWKRCPLKCIPSNFPAVNLVVLDMRGSDIQEF  616

Query  476  GVPLK  490
             + L+
Sbjct  617  QLNLQ  621



>gb|AAQ93074.1| putative TIR-NBS type R protein 4 [Malus baccata]
Length=726

 Score = 95.5 bits (236),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 88/159 (55%), Gaps = 25/159 (16%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETNNAM------GHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMG  157
            FLD+  F   I  + N+ M      G ++T  I  ++D+CL+     N   M+ L+ +MG
Sbjct  543  FLDIAFFF--IGMDKNDVMQILDGCGFYATTGIEVLLDRCLVTIGRKNKIMMHDLLRDMG  600

Query  158  REIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------M  295
            R+I+H+E+P    ERSRLW P DVHDVLI++ G EKIE + LN P              M
Sbjct  601  RDIVHAENPGFPRERSRLWHPKDVHDVLIDKSGTEKIEGLALNLPSLEETSFSTDAFRNM  660

Query  296  KNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIP  412
            K +   Q++ + L G ++ L +K LR L W+  P++ IP
Sbjct  661  KRLRLLQLNYVRLTGGYRCLSKK-LRWLCWHGFPLEFIP  698



>gb|AAQ93076.1| putative TIR-NBS type R protein 4 [Malus baccata]
Length=726

 Score = 95.5 bits (236),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 88/159 (55%), Gaps = 25/159 (16%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETNNAM------GHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMG  157
            FLD+  F   I  + N+ M      G ++T  I  ++D+CL+     N   M+ L+ +MG
Sbjct  543  FLDIAFFF--IGMDKNDVMQILDGCGFYATTGIEVLLDRCLVTIGRKNKIMMHDLLRDMG  600

Query  158  REIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------M  295
            R+I+H+E+P    ERSRLW P DVHDVLI++ G EKIE + LN P              M
Sbjct  601  RDIVHAENPGFPRERSRLWHPKDVHDVLIDKSGTEKIEGLALNLPSLEETSFSTDAFRNM  660

Query  296  KNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIP  412
            K +   Q++ + L G ++ L +K LR L W+  P++ IP
Sbjct  661  KRLRLLQLNYVRLTGGYRCLSKK-LRWLCWHGFPLEFIP  698



>ref|XP_008237412.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=945

 Score = 68.2 bits (165),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 90/186 (48%), Gaps = 20/186 (11%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFNWMYS-LIPEMGREI  166
            FLD+VCF      +  EE  +      +I I N++   LI       M + LI E G E+
Sbjct  224  FLDIVCFFIGMEKERVEEVLDGNDCCPSIAIENLISNSLITILDNKVMMNRLIQETGEEL  283

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKNM  304
            + +ESP   G RSRL  P+D+ +VL   KG + ++ I ++ P              M  +
Sbjct  284  VRAESPGDPGLRSRLSVPDDIRNVLENNKGTKAVQGIDIDFPTFEETEWNSKAFSNMPCV  343

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFGVP  484
             + +I  + +    ++L    L  L+W+  P KS+P G+  +KL +L +   NI++    
Sbjct  344  RFLRIQNVGMAQGPEYL-SDALTHLEWSDYPAKSLPQGFQPNKLHELNLCYGNIEQIWYG  402

Query  485  LKVIWQ  502
            +K +++
Sbjct  403  IKYLYE  408


 Score = 50.4 bits (119),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 79/195 (41%), Gaps = 51/195 (26%)
 Frame = +3

Query  588   FYGFYLLNPLK*YFLCHESLDLGWCENLTRTPDFSGAKNLHKLSFYGS-SLEKVHYSNID  764
             +YG   L  LK       ++++   +NLTR PDFSG  N+ KL F G  SLE++H S   
Sbjct  400   WYGIKYLYELK-------TINVSHSQNLTRMPDFSGTPNIEKLVFEGCISLEEIHPSIHG  452

Query  765   LWMQSKIDLWGCERLKKLPSSSVENSGMLTHNFPQFPPNLEDIRLYGCKNL---------  917
             L     ++L GC  LK LP +    S             LE   L GC N+         
Sbjct  453   LKRLKLLNLKGCTSLKVLPDTMAMKS-------------LERFILSGCSNITKIPDFVVP  499

Query  918   ----------EVVSATFPTSLEGIV------LYGCTNLKTL---LELPQNLQSLYVFNCE  1040
                       E      P S+E +       L  C NLK L   +     L+SL +F C 
Sbjct  500   MDHLWELSLDETDIEGLPLSIEHLTALTLLNLRDCKNLKCLPSDIHKLTALKSLNIFGCS  559

Query  1041  SLETVHLPKMLEYVK  1085
              LE   LP  L  +K
Sbjct  560   RLE--DLPDNLGKIK  572



>emb|CDK13057.1| TIR-NBS-LRR disease resistance protein [Malus domestica]
Length=1174

 Score = 95.9 bits (237),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 100/177 (56%), Gaps = 21/177 (12%)
 Frame = +2

Query  2    FLDLVCFSHKIPE----ETNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF   + +    +  +  G ++T  I+ ++D+CL+  +  N   M+ L+ +MGR+
Sbjct  476  FLDIACFFIGMNKNDVIQILDGCGFYATTGIKVLLDRCLVTINRENKIMMHDLLRDMGRD  535

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKN  301
            I+H+E+P+   ERSRLW P DV+DVLI++ G EKIE + LN P              MK 
Sbjct  536  IVHAENPDFPIERSRLWHPEDVNDVLIDKFGTEKIEGLALNLPSPEETSFSTEAFRNMKR  595

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKE  472
            +   Q++ + L G +++L +K LR L W+  P++ IP        V + M  S++++
Sbjct  596  LRLLQLNYVRLTGQYQYLSKK-LRWLCWHGFPLEFIPIELCQPNTVVIDMQYSSLRQ  651



>ref|XP_011003906.1| PREDICTED: TMV resistance protein N-like isoform X1 [Populus 
euphratica]
Length=1119

 Score = 95.9 bits (237),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 101/186 (54%), Gaps = 22/186 (12%)
 Frame = +2

Query  2    FLDLVCFSHKIPEE--TNNAMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGREIIH  172
            FLD+ CF +   E+  T      +  I IR +VDK LIN S    WM+ L+ EMGR+I+ 
Sbjct  442  FLDIACFFNGWEEDCVTKLMESFYPQIGIRILVDKFLINISDNRVWMHDLLQEMGRQIVK  501

Query  173  SESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNS---------------PMKNME  307
             ES  + G+R+RLW   DV  VL+   G +K+E I LNS                MK + 
Sbjct  502  RESHEEPGKRTRLWLCEDVIHVLLNNTGTDKVEGIFLNSNIEVDGLYLSAESIMKMKRLR  561

Query  308  YNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF--GV  481
              ++  I+L  + K L  + LR L+W + P KS+P  +  DKLV+L M  S+IK+   GV
Sbjct  562  ILKLQNINLSQDIKSLSNE-LRYLEWCRYPFKSLPSTFQPDKLVELHMHHSSIKQLWEGV  620

Query  482  -PLKVI  496
             PLK++
Sbjct  621  RPLKLL  626



>emb|CDK13060.1| TIR-NBS-LRR disease resistance protein [Malus domestica]
Length=1116

 Score = 95.5 bits (236),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 97/177 (55%), Gaps = 21/177 (12%)
 Frame = +2

Query  2    FLDLVCFSHKIPE----ETNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF   + +    +  +  G + T  I  ++++CL+  +  N   M+ L+ +MGR+
Sbjct  437  FLDIACFFIGMDKNDVVQILDGCGFYPTTGIEVLLNRCLVTINRENKIMMHDLLRDMGRD  496

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKN  301
            I+H+E+P+  GERSRLW P D +DVLI + G EKIE + LN P              MK 
Sbjct  497  IVHAENPDLPGERSRLWHPEDANDVLIHKSGTEKIEGLALNLPSLEETSFSTEAFRNMKR  556

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKE  472
            +   Q++ + L G ++ L +K LR L W+  P++ IP       +V + M  S++++
Sbjct  557  LRLLQLNYVQLSGGYQCLSKK-LRWLCWHGFPLEFIPIELCQPNIVAIDMQYSSLRQ  612



>ref|XP_011003907.1| PREDICTED: TMV resistance protein N-like isoform X2 [Populus 
euphratica]
 ref|XP_011003908.1| PREDICTED: TMV resistance protein N-like isoform X2 [Populus 
euphratica]
Length=1094

 Score = 95.5 bits (236),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 101/186 (54%), Gaps = 22/186 (12%)
 Frame = +2

Query  2    FLDLVCFSHKIPEE--TNNAMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGREIIH  172
            FLD+ CF +   E+  T      +  I IR +VDK LIN S    WM+ L+ EMGR+I+ 
Sbjct  417  FLDIACFFNGWEEDCVTKLMESFYPQIGIRILVDKFLINISDNRVWMHDLLQEMGRQIVK  476

Query  173  SESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNS---------------PMKNME  307
             ES  + G+R+RLW   DV  VL+   G +K+E I LNS                MK + 
Sbjct  477  RESHEEPGKRTRLWLCEDVIHVLLNNTGTDKVEGIFLNSNIEVDGLYLSAESIMKMKRLR  536

Query  308  YNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF--GV  481
              ++  I+L  + K L  + LR L+W + P KS+P  +  DKLV+L M  S+IK+   GV
Sbjct  537  ILKLQNINLSQDIKSLSNE-LRYLEWCRYPFKSLPSTFQPDKLVELHMHHSSIKQLWEGV  595

Query  482  -PLKVI  496
             PLK++
Sbjct  596  RPLKLL  601



>gb|ABB82029.1| TIR-NBS disease resistance-like protein [Populus trichocarpa]
Length=1147

 Score = 88.6 bits (218),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 90/179 (50%), Gaps = 22/179 (12%)
 Frame = +2

Query  2    FLDLVCF-----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGR  160
            FLD+ CF        + +      G+   +++  +  + LI  +      M+ L+ +MGR
Sbjct  440  FLDIACFFIDRKKEYVAKVLGARCGYNPEVDLETLRGRSLIKVNAIGKITMHDLLRDMGR  499

Query  161  EIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMK  298
            E++   SP + G+R+R+W   D  +VL +QKG + +E + L+              + MK
Sbjct  500  EVVRETSPKEPGKRTRIWNQEDAWNVLEQQKGTDVVEGLALDVKASEAKSLSTGSFAKMK  559

Query  299  NMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
             +   QI+ +HL G+FK L R+ L  + W QCP+K  P  + FD L  L M  SN+K+ 
Sbjct  560  RLNLLQINGVHLTGSFKLLSRE-LMLICWLQCPLKYFPSDFTFDNLDVLDMQYSNLKKL  617


 Score = 29.3 bits (64),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 46/109 (42%), Gaps = 19/109 (17%)
 Frame = +3

Query  594  GFYLLNPLK*YFLCHESLDLGWCENLTRTPDFSGAKNLHKLSFYGSSLEKVHYSNIDLWM  773
            G  +LN LK   L H        +NL +TP+   +          SSL +VH S  +L  
Sbjct  620  GKKILNRLKIINLSHS-------QNLIKTPNLHSSSLKKLKLKGCSSLVEVHQSIGNLTS  672

Query  774  QSKIDLWGCERLKKLPSSSVENSGMLTHNFPQFPPNLEDIRLYGCKNLE  920
               ++L GC RLK LP S V               +L+ + + GC  LE
Sbjct  673  LIFLNLEGCWRLKILPESIVN------------VKSLKRLNISGCSQLE  709



>ref|XP_009363980.1| PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1-like 
[Pyrus x bretschneideri]
Length=1704

 Score = 67.0 bits (162),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/176 (31%), Positives = 84/176 (48%), Gaps = 28/176 (16%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGREI  166
            FLD+ CF          +  +  G F++I I  + ++CL+       +M+ L+ EM + I
Sbjct  454  FLDISCFFIGKDKDYVTKVLDGCGFFASIGIIVLRERCLVTVEGNKLYMHDLLREMAKVI  513

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP------------------  292
            I  +     G+ SRLW   +  +VL  + G E++E + LN P                  
Sbjct  514  ISEKFLGHPGKWSRLWNRQEAAEVLRTKSGTEEVEGLALNFPNPWPRSSSLPSFSTEAFA  573

Query  293  -MKNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFD--KLVKLKM  451
             MK + +  + ++ L G +KHLP K L  L W   P+KSIP   FFD  +LV L+M
Sbjct  574  NMKKLRFLHLKDVQLNGEYKHLP-KELIWLCWVGFPLKSIP-DDFFDQPRLVVLEM  627


 Score = 50.4 bits (119),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 69/246 (28%), Positives = 102/246 (41%), Gaps = 59/246 (24%)
 Frame = +3

Query  573   KFLICFYGFYLLNPLK*YFLCHESLDLGWCENLTRTPDFSGAKNLHKLSFYG-SSLEKVH  749
             K +  + G+ LL  LK        L+L    +L ++P+FS   NL +L      SL ++H
Sbjct  631   KLVQVWEGYKLLERLK-------ILNLSRSYSLIKSPNFSLVPNLEELILEDCGSLSEIH  683

Query  750   YSNIDLWMQSKIDLWGCERLKKLPSS-----SVENSGMLTHNFPQFPPNLEDIRLYGCKN  914
              S   L   S ++L  CE+L  LP       SVE   +L     +F    ED  L   K+
Sbjct  684   PSIGQLQKLSLVNLKECEKLSSLPRDFYKLKSVET--LLLTGCLEFTEMHED--LGEMKS  739

Query  915   LEVVSATFP----------------------------------TSLEGIVLYGCTNLKTL  992
             L ++ A F                                   T LE + L GC  L+T+
Sbjct  740   LRILKADFTGVRQIPSSTVKLRNLTLLDLGWNYFHTLPSLSGLTKLETLGLNGCLYLRTI  799

Query  993   LELPQNLQSLYVFNCESLETVHLPKMLEYVKLTHCK-----KLKEIQGWENA-QFLTRIE  1154
              +LP NL+ LY  NC +LET  +P   E   +T  K     KL  + G + +  F+T I+
Sbjct  800   SDLPTNLKFLYAANCPALET--MPNFSEMSNMTELKVSDSPKLTVVPGLDKSLNFMTLID  857

Query  1155  LRGVPN  1172
             +    N
Sbjct  858   MSNCTN  863


 Score = 56.6 bits (135),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 70/134 (52%), Gaps = 12/134 (9%)
 Frame = +3

Query  942   TSLEGIVLYGCTNLKTLLELPQNLQSLYVFNCESLETV----HLPKMLEYVKLTHCKKLK  1109
             T LE + L  C NL+T+ +LP NL+ LY  NC +LET+     + KM E +K+    KL 
Sbjct  1140  TKLETLRLNDCFNLRTIPDLPTNLKFLYAANCPALETMPNFSEMSKMRE-LKVRDSPKLI  1198

Query  1110  EIQGWENA-QFLTRIELRGVPNNI-KFSEIINKVLKVSKLNSNIEFEGYLPNNETLSWIK  1283
             E+ G + +  F+T I++    N I  F + I +          + +  ++P+     W +
Sbjct  1199  EVPGLDKSLNFMTLIDMSNCTNLIADFGKNILQGWTSCGFGGILLYGNFVPD-----WFE  1253

Query  1284  FEENGSSISFQWPP  1325
             F  +G+++SF  PP
Sbjct  1254  FVNHGNTVSFDIPP  1267



>ref|XP_010536050.1| PREDICTED: TMV resistance protein N-like [Tarenaya hassleriana]
Length=1142

 Score = 94.7 bits (234),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 56/177 (32%), Positives = 95/177 (54%), Gaps = 20/177 (11%)
 Frame = +2

Query  2    FLDLVCFSHKIPEE----TNNAMGHFSTIEIRNIVDKCLIN-YSCFNWMYSLIPEMGREI  166
            FLD+ CF  ++ ++      +  G    I +R ++++CL++ Y     M+ LI +MGREI
Sbjct  434  FLDIACFFVRMDKDYVTYILDGCGLSPDIGLRVLMERCLVSVYDNKLVMHDLIRDMGREI  493

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKNM  304
            +  +SP   G+RSRLW P+DV DVL +  G E +E + L               S ++ +
Sbjct  494  VREQSPKSRGKRSRLWDPDDVIDVLTKYSGTESVEGLSLKCQDLDAGYLDAEAFSNLREL  553

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
               Q+  + ++G++ H P K LR L W+  P++ IP  ++   LV + M  SN++ F
Sbjct  554  RLLQLGYVQIQGSYLHFP-KGLRWLSWHGFPLEFIPSEFYLRTLVVMDMRYSNLRRF  609



>ref|XP_003598881.1| TMV resistance protein N [Medicago truncatula]
Length=1270

 Score = 94.7 bits (234),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 87/177 (49%), Gaps = 21/177 (12%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF          E  N  G F+ I I  ++++ L+     N   M+ LI +MGRE
Sbjct  559  FLDVCCFFIGKDRDYVTEILNGCGLFAGIGIAVLIERSLLKVEKNNKLGMHDLIRDMGRE  618

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKN  301
            I+   S N  GERSRLW   D H VL +  G +K+E ++LN                M+N
Sbjct  619  IVRGSSTNDPGERSRLWLHEDAHSVLTKNTGTQKVEGLILNLQSKGRDSFSTNVFQQMQN  678

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKE  472
            M   Q+D + L G F HL  K LR + W +     IP  ++   LV L++  SN+K+
Sbjct  679  MRLLQLDCVDLTGEFAHL-SKQLRWVNWQRSTFNCIPKDFYQGNLVVLELKFSNVKQ  734



>ref|XP_006441827.1| hypothetical protein CICLE_v100236471mg, partial [Citrus clementina]
 gb|ESR55067.1| hypothetical protein CICLE_v100236471mg, partial [Citrus clementina]
Length=526

 Score = 93.6 bits (231),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 64/175 (37%), Positives = 95/175 (54%), Gaps = 20/175 (11%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETNN-------AMGHFSTIEIRNIVDKCLINYSCFNW--MYSLIPEM  154
            FLD+ CF   + EE  +       A G F+ + +R ++DK LI  S  N   M+ L+ +M
Sbjct  240  FLDIACF---LKEERRDQVLSFLDACGFFAEMGLRVLIDKSLITISHSNTITMHDLLQDM  296

Query  155  GREIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN-SPMKNMEYNQIDEIH  331
            GREII  ES +  GERSRLW   D+++VL +  G EKIE I L+ S M+ + + +     
Sbjct  297  GREIIRKESIHYPGERSRLWHHKDIYEVLTKNMGTEKIEGICLDMSKMRKLRFLKFYSSS  356

Query  332  LEG-------NFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
            + G       +F+      LR L W+  P+KS+P     +KLV L+M  SNI++ 
Sbjct  357  INGENKCKISDFQGPEFAELRYLHWHGYPLKSLPSNIHLEKLVLLEMPRSNIQQL  411



>gb|AES69132.2| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=1161

 Score = 94.4 bits (233),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 87/177 (49%), Gaps = 21/177 (12%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF          E  N  G F+ I I  ++++ L+     N   M+ LI +MGRE
Sbjct  450  FLDVCCFFIGKDRDYVTEILNGCGLFAGIGIAVLIERSLLKVEKNNKLGMHDLIRDMGRE  509

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKN  301
            I+   S N  GERSRLW   D H VL +  G +K+E ++LN                M+N
Sbjct  510  IVRGSSTNDPGERSRLWLHEDAHSVLTKNTGTQKVEGLILNLQSKGRDSFSTNVFQQMQN  569

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKE  472
            M   Q+D + L G F HL  K LR + W +     IP  ++   LV L++  SN+K+
Sbjct  570  MRLLQLDCVDLTGEFAHL-SKQLRWVNWQRSTFNCIPKDFYQGNLVVLELKFSNVKQ  625



>ref|XP_007210009.1| hypothetical protein PRUPE_ppa016162mg [Prunus persica]
 gb|EMJ11208.1| hypothetical protein PRUPE_ppa016162mg [Prunus persica]
Length=1108

 Score = 94.4 bits (233),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 66/179 (37%), Positives = 94/179 (53%), Gaps = 22/179 (12%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFNW--MYSLIPEMGRE  163
            FLD+ CF    +     +   +   F  I IR ++DK L+  +  N   M+ L+ +MG+E
Sbjct  458  FLDIACFFKGENKDDIVDILRSCDLFPVISIRVLIDKSLLAINEHNMLTMHDLLEDMGKE  517

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKN  301
            I+  ESPN+ GERSRLW   DV +VL +Q G  ++  I++N P              MKN
Sbjct  518  IVREESPNEPGERSRLWFHKDVCEVLTKQTGTSRVRGIMINMPEKNEICLSAEAFSRMKN  577

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFG  478
            + Y       L GN   LP + LR L W + P++S+P  +  +KLV LKM  SNI  FG
Sbjct  578  LRYLINLNARLIGNID-LPNE-LRLLNWYKYPLQSLPSNFQPEKLVALKMPSSNISRFG  634



>ref|XP_010263317.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nelumbo 
nucifera]
Length=754

 Score = 94.0 bits (232),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 93/177 (53%), Gaps = 21/177 (12%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETN----NAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF + + +++          F  I    ++ +CLI  +  N  WM+ ++ +MGR+
Sbjct  463  FLDIACFFNGMDKDSAITILGGCDFFPEIGTSFLLRRCLITINEKNELWMHDMLRDMGRQ  522

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKN  301
            +++ ESP + G+RSRLW   D +DVL +  G E IE ++L+ P              M  
Sbjct  523  VVYEESPEEPGKRSRLWFYKDAYDVLTKNLGTEAIEGLILDLPRSRTLHLSVEAFSRMNK  582

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKE  472
            +   Q+  +H+ G+++  P + LR L W+  P K IP  +  DKLV L +  S I++
Sbjct  583  LRLLQLKNVHVTGSYEKFP-QDLRWLCWHGFPSKFIPTNFNLDKLVSLDLQHSRIRQ  638



>ref|XP_010263318.1| PREDICTED: TMV resistance protein N-like isoform X2 [Nelumbo 
nucifera]
Length=741

 Score = 94.0 bits (232),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 93/177 (53%), Gaps = 21/177 (12%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETN----NAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF + + +++          F  I    ++ +CLI  +  N  WM+ ++ +MGR+
Sbjct  450  FLDIACFFNGMDKDSAITILGGCDFFPEIGTSFLLRRCLITINEKNELWMHDMLRDMGRQ  509

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKN  301
            +++ ESP + G+RSRLW   D +DVL +  G E IE ++L+ P              M  
Sbjct  510  VVYEESPEEPGKRSRLWFYKDAYDVLTKNLGTEAIEGLILDLPRSRTLHLSVEAFSRMNK  569

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKE  472
            +   Q+  +H+ G+++  P + LR L W+  P K IP  +  DKLV L +  S I++
Sbjct  570  LRLLQLKNVHVTGSYEKFP-QDLRWLCWHGFPSKFIPTNFNLDKLVSLDLQHSRIRQ  625



>ref|XP_006576577.1| PREDICTED: TMV resistance protein N-like isoform X2 [Glycine 
max]
Length=851

 Score = 94.0 bits (232),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 67/197 (34%), Positives = 101/197 (51%), Gaps = 32/197 (16%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETNNAM------GHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMG  157
            FLD+ CF   I  + N+AM      G F+   IR +V++ L+     N   M+ L+ +MG
Sbjct  458  FLDIACFF--IGMDRNDAMCILNGCGLFAENGIRVLVERSLVTVDDKNKLGMHDLLRDMG  515

Query  158  REIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------M  295
            REII ++SP    ERSRLW   DV DVL ++ G + IE + L  P              M
Sbjct  516  REIIRAKSPKDLEERSRLWFNEDVLDVLAKKTGTKTIEGLALKLPLTNSNCFSTEAFKEM  575

Query  296  KNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
            K +   Q+  + L+G+F++L  K LR L WN  P+K IP  +    LV +++  SN+   
Sbjct  576  KKLRLLQLAGVQLDGDFEYLS-KDLRWLCWNGFPLKCIPKNFHQGSLVSIELENSNV---  631

Query  476  GVPLKVIWQYFFKFNSS  526
                K++W+     N+S
Sbjct  632  ----KLVWKEAQNMNTS  644



>gb|KEH25115.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=1366

 Score = 94.4 bits (233),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 93/178 (52%), Gaps = 25/178 (14%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETN------NAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMG  157
            FLD+ CF   I  + N      N    F+ I +  +V++ L+     N   M+ L+ +MG
Sbjct  744  FLDIACFF--IGMDRNDVIHILNGSELFAEIGVSVLVERSLVTVDDRNRLAMHDLLRDMG  801

Query  158  REIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------M  295
            REI+  +SP +  ERSRLW  NDV DVL EQ G + +E + L  P              M
Sbjct  802  REIVREKSPKEPEERSRLWFNNDVLDVLSEQTGTKAVEGLALKLPTTDEKCFSTKAFKKM  861

Query  296  KNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIK  469
            K +   Q+  + L+G+F++L R  +R L WN  P+K IP  ++   LV +++  SN+K
Sbjct  862  KKLRLLQLAGLQLDGDFEYLSR-NVRWLSWNAFPLKCIPSSFYQGNLVSIELVNSNVK  918



>ref|XP_010263319.1| PREDICTED: TMV resistance protein N-like isoform X3 [Nelumbo 
nucifera]
Length=629

 Score = 93.6 bits (231),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 93/177 (53%), Gaps = 21/177 (12%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETN----NAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF + + +++          F  I    ++ +CLI  +  N  WM+ ++ +MGR+
Sbjct  338  FLDIACFFNGMDKDSAITILGGCDFFPEIGTSFLLRRCLITINEKNELWMHDMLRDMGRQ  397

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKN  301
            +++ ESP + G+RSRLW   D +DVL +  G E IE ++L+ P              M  
Sbjct  398  VVYEESPEEPGKRSRLWFYKDAYDVLTKNLGTEAIEGLILDLPRSRTLHLSVEAFSRMNK  457

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKE  472
            +   Q+  +H+ G+++  P + LR L W+  P K IP  +  DKLV L +  S I++
Sbjct  458  LRLLQLKNVHVTGSYEKFP-QDLRWLCWHGFPSKFIPTNFNLDKLVSLDLQHSRIRQ  513



>ref|XP_006586404.1| PREDICTED: TMV resistance protein N-like, partial [Glycine max]
Length=999

 Score = 94.0 bits (232),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 69/196 (35%), Positives = 101/196 (52%), Gaps = 40/196 (20%)
 Frame = +2

Query  2    FLDLVCF--SHKIPEETN--NAMGHFSTIEIRNIVDKCLINY----------SCFNWMYS  139
            FLD+ CF    K    T   NA G  + I I+N++DK LI            SC + M+ 
Sbjct  437  FLDIACFFKGQKGDSVTKVLNACGFSADIGIKNLLDKALITTTTDMHDSTTDSCID-MHD  495

Query  140  LIPEMGREIIHSESPNKSGERSRLWCPNDVHDVLIEQKG----------MEKIEMIVLNS  289
            LI EMGR I+  ES +  G+RSRLW P +V+DVL    G          M +I+ I L+S
Sbjct  496  LIQEMGRGIVREESIDNPGQRSRLWDPEEVNDVLTNNTGTGAIQGIWLEMSQIQDIKLSS  555

Query  290  ----PMKNME----------YNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFF  427
                 M N+           + +I+ ++L    + LP+K LR L WN CP++S+P  +  
Sbjct  556  KSFRKMPNLRLLAFQSLNGNFKRINSVYLPKGLEFLPKK-LRYLGWNGCPLESLPSTFCP  614

Query  428  DKLVKLKMWESNIKEF  475
            +KLV+L M  SN+++ 
Sbjct  615  EKLVELSMRYSNVQKL  630



>ref|XP_008222869.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=874

 Score = 93.6 bits (231),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 68/194 (35%), Positives = 94/194 (48%), Gaps = 25/194 (13%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSC-FNWMYSLIPEMGREI  166
            FLDL CF    S +   ET  A        I  +++K  ++    + WM+ L+ EMG++I
Sbjct  448  FLDLACFFKGKSRRYAIETLEACDLNPRYGIEVLIEKAHVSVEGDYIWMHDLLEEMGKDI  507

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP---------------MKN  301
            +H ESP + GERSRLW   D+  VL    G  +I  IVLNSP               MKN
Sbjct  508  VHQESPTEPGERSRLWSYEDIEHVLANNTGTNEITRIVLNSPEREDEIFLDVDCFSKMKN  567

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFGV  481
            ++   I    L G+  +LP  +LR L W+ CP +S P  +   +L  L M  + IK+ G 
Sbjct  568  LKIFIIYNTCLYGDIHYLP-NSLRVLDWHGCPFQSFPPKFNPKELKVLNMPRNCIKQLGE  626

Query  482  PLKVIWQYFFKFNS  523
             LK    Y  K  S
Sbjct  627  GLK----YLTKLTS  636



>emb|CDK13053.1| TIR-NBS-LRR disease resistance protein [Malus domestica]
Length=1183

 Score = 94.0 bits (232),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 98/177 (55%), Gaps = 21/177 (12%)
 Frame = +2

Query  2    FLDLVCFSHKIPE----ETNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF   + +    +  +  G ++T  I  ++D+CL+  +  N   M+ L+ +MGR+
Sbjct  500  FLDIACFFIGMDKNDVIQILDGCGFYATTGIEVLLDRCLVTINRENKIMMHDLLRDMGRD  559

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKN  301
            I+H+E+P+  GERSRLW   DV+DVLI++ G EKIE + LN P              MK 
Sbjct  560  IVHAENPDFPGERSRLWHSEDVNDVLIDKFGTEKIEGLALNLPSPEETSFSTKAFRNMKR  619

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKE  472
            +   Q++ + L G ++   +K LR L W+  P++ IP       +V + M  S++++
Sbjct  620  LRLLQLNYVRLTGGYQCFSKK-LRWLCWHGFPLEFIPIELCQPNIVVIDMQYSSLRQ  675



>ref|XP_008344076.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=666

 Score = 71.6 bits (174),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 60/183 (33%), Positives = 86/183 (47%), Gaps = 32/183 (17%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETN------NAMGHFSTIEIRNIVDKCLINYSCFNW-MYSLIPEMGR  160
            FLD+ CF   I E+ +      +  G  +TI I  + ++CLI        M+ L+ EM R
Sbjct  217  FLDISCFF--IGEDKDYVAKILDRCGFSATIGISVLRERCLITVEQNKLNMHDLLREMAR  274

Query  161  EIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP----------------  292
             I+  +S    G+ SRLW   +   VL  + G E++E + LN P                
Sbjct  275  VIVSEKSLGHPGKWSRLWNCKEAAKVLRNKSGTEEVEGLALNFPYPWPRSSRMPSFSTEA  334

Query  293  ---MKNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFD--KLVKLKMWE  457
               MK + +  +  + L G +KHLP K L  L W  CP+KSIP   FFD  +LV L M  
Sbjct  335  FANMKKLRFLHLKYVQLNGEYKHLP-KELIWLCWEGCPLKSIP-DDFFDQQRLVVLDMQS  392

Query  458  SNI  466
            S +
Sbjct  393  SKL  395


 Score = 44.3 bits (103),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 62/266 (23%), Positives = 98/266 (37%), Gaps = 74/266 (28%)
 Frame = +3

Query  573   KFLICFYGFYLLNPLK*YFLCHESLDLGWCENLTRTPDFSGAKNLHKLSFYG-SSLEKVH  749
             K +  + G+ LL  LK        L+L    +L ++PDFS    L +L      SL ++H
Sbjct  394   KLVQVWEGYKLLKRLK-------ILNLSHSLSLIKSPDFSQVPYLEELILENCGSLSEIH  446

Query  750   YSNIDLWMQSKIDLWGCERLKKLPSS--------------------------------SV  833
              S   L   S ++L  CE+L+ LP                                   +
Sbjct  447   PSIGQLKRLSLVNLKECEKLRSLPRDFYKLKYVKTLLLNDCLEFREVHEDLGEMISLRIL  506

Query  834   ENSGMLTHNFPQFPPNLEDIRLYGCKNLEVVSATFPTSL---------------------  950
             E         P     L+++ L     +++     P  L                     
Sbjct  507   EAEHTAIREIPSSTVRLKNLTLLSLNGVKLAHDAIPHDLGSLISLQVLDLRGNDFHILPS  566

Query  951   -------EGIVLYGCTNLKTLLELPQNLQSLYVFNCESLETV----HLPKMLEYVKLTHC  1097
                    E + L  C NL T+ +LP NL+ LY  NC +LETV     +  M E +K+   
Sbjct  567   LSGLTKLETLRLNDCFNLHTIPDLPTNLKFLYAANCPALETVPNFSEMSNMRE-LKVNDS  625

Query  1098  KKLKEIQGWENA-QFLTRIELRGVPN  1172
              KL E+ G + + +F+T I++    N
Sbjct  626   SKLTEVPGLDKSLKFMTLIDMSNCTN  651



>ref|XP_008344077.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=919

 Score = 72.0 bits (175),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 60/183 (33%), Positives = 86/183 (47%), Gaps = 32/183 (17%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETN------NAMGHFSTIEIRNIVDKCLINYSCFNW-MYSLIPEMGR  160
            FLD+ CF   I E+ +      +  G  +TI I  + ++CLI        M+ L+ EM R
Sbjct  454  FLDISCFF--IGEDKDYVAKILDRCGFSATIGISVLRERCLITVEQNKLNMHDLLREMAR  511

Query  161  EIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP----------------  292
             I+  +S    G+ SRLW   +   VL  + G E++E + LN P                
Sbjct  512  VIVSEKSLGHPGKWSRLWNCKEAAKVLRNKSGTEEVEGLALNFPYPWPRSSRMPSFSTEA  571

Query  293  ---MKNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFD--KLVKLKMWE  457
               MK + +  +  + L G +KHLP K L  L W  CP+KSIP   FFD  +LV L M  
Sbjct  572  FANMKKLRFLHLKYVQLNGEYKHLP-KELIWLCWEGCPLKSIP-DDFFDQQRLVVLDMQS  629

Query  458  SNI  466
            S +
Sbjct  630  SKL  632


 Score = 44.3 bits (103),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 62/266 (23%), Positives = 98/266 (37%), Gaps = 74/266 (28%)
 Frame = +3

Query  573   KFLICFYGFYLLNPLK*YFLCHESLDLGWCENLTRTPDFSGAKNLHKLSFYG-SSLEKVH  749
             K +  + G+ LL  LK        L+L    +L ++PDFS    L +L      SL ++H
Sbjct  631   KLVQVWEGYKLLKRLK-------ILNLSHSLSLIKSPDFSQVPYLEELILENCGSLSEIH  683

Query  750   YSNIDLWMQSKIDLWGCERLKKLPSS--------------------------------SV  833
              S   L   S ++L  CE+L+ LP                                   +
Sbjct  684   PSIGQLKRLSLVNLKECEKLRSLPRDFYKLKYVKTLLLNDCLEFREVHEDLGEMISLRIL  743

Query  834   ENSGMLTHNFPQFPPNLEDIRLYGCKNLEVVSATFPTSL---------------------  950
             E         P     L+++ L     +++     P  L                     
Sbjct  744   EAEHTAIREIPSSTVRLKNLTLLSLNGVKLAHDAIPHDLGSLISLQVLDLRGNDFHILPS  803

Query  951   -------EGIVLYGCTNLKTLLELPQNLQSLYVFNCESLETV----HLPKMLEYVKLTHC  1097
                    E + L  C NL T+ +LP NL+ LY  NC +LETV     +  M E +K+   
Sbjct  804   LSGLTKLETLRLNDCFNLHTIPDLPTNLKFLYAANCPALETVPNFSEMSNMRE-LKVNDS  862

Query  1098  KKLKEIQGWENA-QFLTRIELRGVPN  1172
              KL E+ G + + +F+T I++    N
Sbjct  863   SKLTEVPGLDKSLKFMTLIDMSNCTN  888



>ref|XP_006371041.1| hypothetical protein POPTR_0019s02900g [Populus trichocarpa]
 gb|ERP48838.1| hypothetical protein POPTR_0019s02900g [Populus trichocarpa]
Length=1147

 Score = 86.7 bits (213),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 53/179 (30%), Positives = 88/179 (49%), Gaps = 22/179 (12%)
 Frame = +2

Query  2    FLDLVCF-----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGR  160
            FLD+ CF        + +      G+   +++  +  + LI  +      M+ L+ +MGR
Sbjct  440  FLDIACFFIDRKKEYVAKVLGARCGYNPEVDLETLRGRSLIKVNAIGKITMHDLLRDMGR  499

Query  161  EIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMK  298
            E++   SP + G+R+R+W   D  +VL +QKG + +E + L+              + MK
Sbjct  500  EVVRETSPKEPGKRTRIWNQEDAWNVLEQQKGTDVVEGLALDVKASEAKSLSTGSFAKMK  559

Query  299  NMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
             +   QI+ +HL G+FK L R+ L  + W QCP+   P  +  D L  L M  SN+KE 
Sbjct  560  RLNLLQINGVHLTGSFKLLSRE-LMLICWLQCPLVYFPSDFTIDNLAVLDMQYSNLKEL  617


 Score = 29.3 bits (64),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 37/80 (46%), Gaps = 7/80 (9%)
 Frame = +3

Query  594  GFYLLNPLK*YFLCHESLDLGWCENLTRTPDFSGAKNLHKLSFYGSSLEKVHYSNIDLWM  773
            G  +LN LK   L H        +NL +TP+   +          SSL +VH S  +L  
Sbjct  620  GKKILNRLKIINLSHS-------QNLIKTPNLHSSSLKKLKLKGCSSLVEVHQSIGNLTS  672

Query  774  QSKIDLWGCERLKKLPSSSV  833
               ++L GC RLK LP S V
Sbjct  673  LIFLNLEGCWRLKILPESIV  692



>gb|ABM55687.1| TIR-NBS-LRR class disease resistance protein [(Populus tomentosa 
x Populus bolleana) x Populus tomentosa]
Length=678

 Score = 93.2 bits (230),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 91/179 (51%), Gaps = 22/179 (12%)
 Frame = +2

Query  2    FLDLVCF-----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGR  160
            FLD+ CF        + +      G+   +++  + ++ LI  +CF    M+ L  +MGR
Sbjct  476  FLDIACFFIDRKKEYVAKVLGARCGYNPEVDLETLRERSLIKVNCFGKITMHDLFRDMGR  535

Query  161  EIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMK  298
            E++   SP + G+R+R+W   D  +VL +QKG + +E + L+              + MK
Sbjct  536  EVVRESSPKEPGKRTRIWNQEDAWNVLQQQKGTDVVEGLTLDVRASEAKSLSARSFAKMK  595

Query  299  NMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
             +   QI+ +HL G+FK L  K L  + W QCP+K +P  +  D LV L    SN+KE 
Sbjct  596  CLNLLQINGVHLTGSFKLLS-KELMWICWLQCPLKYLPSDFILDNLVVLDTQYSNLKEL  653



>ref|XP_002325794.2| putative LRR disease resistance family protein [Populus trichocarpa]
 gb|EEF00176.2| putative LRR disease resistance family protein [Populus trichocarpa]
Length=401

 Score = 88.2 bits (217),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 53/179 (30%), Positives = 90/179 (50%), Gaps = 22/179 (12%)
 Frame = +2

Query  2    FLDLVCF-----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGR  160
            F+D+ CF        + +      G+   +++  +  + LI         M+ L+ +MGR
Sbjct  48   FVDIACFFIDRKKEYVAKVLGARCGYNPEVDLETLRGRSLIKVDAIGKITMHDLLRDMGR  107

Query  161  EIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMK  298
            E++   SP + G+R+R+W   D  +VL +QKG + +E + L+              + MK
Sbjct  108  EVVRETSPKEPGKRTRIWNQEDAWNVLEQQKGTDVVEGLALDVRASKAKSLSAGLFAKMK  167

Query  299  NMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
             +   QI+E HL G+FK L ++ +R + W QCP+K  P  + FD L  L M  SN+K+ 
Sbjct  168  CLNLLQINEAHLTGSFKLLSKELMR-ICWLQCPLKYFPSDFTFDNLDVLDMQYSNLKKL  225


 Score = 27.7 bits (60),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 41/79 (52%), Gaps = 9/79 (11%)
 Frame = +3

Query  594  GFYLLNPLK*YFLCHESLDLGWCENLTRTPDFSGAKNLHKLSFYG-SSLEKVHYSNIDLW  770
            G  +LN LK + L H        +NL +TP+   + +L KL   G SSL +VH S  +L 
Sbjct  228  GKKILNRLKIFNLSHS-------QNLIKTPNLYNS-SLEKLKLKGCSSLVEVHQSIGNLM  279

Query  771  MQSKIDLWGCERLKKLPSS  827
              + ++L GC  LK L  S
Sbjct  280  NLAFLNLEGCWCLKILLES  298



>emb|CDK13056.1| TIR-NBS-LRR disease resistance protein, partial [Malus domestica]
Length=1220

 Score = 93.6 bits (231),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 100/177 (56%), Gaps = 21/177 (12%)
 Frame = +2

Query  2    FLDLVCFSHKIPE----ETNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF   + +    +  +  G +ST  I  ++++CL+  +  N   M+ L+ +MGR+
Sbjct  528  FLDIACFFIGMDKNDVVQILDGCGFYSTTGIEVLLNRCLVTINRENKIMMHDLLRDMGRD  587

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKN  301
            I+++E+P+  GERSRLW P DV+DVLI++ G +KIE + L+ P              MK 
Sbjct  588  IVYAENPDFPGERSRLWHPEDVNDVLIDKSGTKKIEGLALDLPSLEETSFSTEVFRNMKR  647

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKE  472
            +   Q++ + L G ++ L +K LR L W+  P++ IP       +V + M  S++++
Sbjct  648  LRLLQLNYVRLSGGYQCLSKK-LRWLCWHGFPLEFIPIELCQPNIVVIDMQYSSLRQ  703



>ref|XP_009799389.1| PREDICTED: TMV resistance protein N-like isoform X2 [Nicotiana 
sylvestris]
Length=712

 Score = 92.8 bits (229),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 99/192 (52%), Gaps = 20/192 (10%)
 Frame = +2

Query  2    FLDLVCFSHKIPE----ETNNAMGHFSTIEIRNIVDKCLINYS-CFNWMYSLIPEMGREI  166
            FLD+ C  H   E    E  NA G  +   I  +V K L+     +  M+ L+ +MGREI
Sbjct  444  FLDIACAFHGFYEHEVTEILNACGFHAKSAIATLVQKHLLQRDDLYLVMHDLVRDMGREI  503

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKNM  304
            +  ES     +RSRL+ P +V DVL   KG +K+E++ ++                M+N+
Sbjct  504  VRLESTRYPEKRSRLFIPQEVCDVLQGNKGSKKVEVLKVDRRAFKGVNLSTKAFKKMENL  563

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFGVP  484
                +DE+H+ G+F  L  K L+ L W +CP+  IP  +  + LV L M ES+I+EF + 
Sbjct  564  RVLIMDELHISGDFGMLS-KELKWLSWKKCPLNCIPSNFPAENLVVLDMQESDIQEFRLN  622

Query  485  LKVIWQYFFKFN  520
            L+   + + K N
Sbjct  623  LQDHLEIYLKCN  634



>ref|XP_009622118.1| PREDICTED: TMV resistance protein N-like isoform X3 [Nicotiana 
tomentosiformis]
Length=678

 Score = 92.8 bits (229),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 99/192 (52%), Gaps = 20/192 (10%)
 Frame = +2

Query  2    FLDLVCFSHKIPE----ETNNAMGHFSTIEIRNIVDKCLINYS-CFNWMYSLIPEMGREI  166
            FLD+ C  H   E    E  NA G  +   I  +V K L+     +  M+ L+ +MGREI
Sbjct  441  FLDIACAFHGFYEREVTEILNACGFHAKSAIATLVQKHLLQRDDLYLVMHDLVRDMGREI  500

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKNM  304
            +  ES     +RSRL+ P +V DVL   KG +K+E++ ++                M+N+
Sbjct  501  VRLESTRYPEKRSRLFIPQEVCDVLQGNKGSKKVEVLKVDRRAFKGVNLSTKAFKKMENL  560

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFGVP  484
                +DE+H+ G+F  L  K L+ L W +CP+  IP  +  + LV L M ES+I+EF + 
Sbjct  561  RVLIMDELHISGDFGMLS-KELKWLSWKKCPLNCIPSNFPAENLVVLDMQESDIQEFRLN  619

Query  485  LKVIWQYFFKFN  520
            L+   + + K N
Sbjct  620  LQDHLEIYLKCN  631



>ref|XP_009758994.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nicotiana 
sylvestris]
Length=1045

 Score = 93.2 bits (230),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 63/182 (35%), Positives = 94/182 (52%), Gaps = 20/182 (11%)
 Frame = +2

Query  2    FLDLVC----FSHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFNW-MYSLIPEMGREI  166
            FLD+ C    F      E  NA G  +   I  +V K L+  S     M+ L+ +MGREI
Sbjct  444  FLDIACAFYGFREDRVTEILNACGFHARSPIATLVQKHLLQRSWHGLVMHDLVRDMGREI  503

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKNM  304
            +  ES    G+RSRL+ P +V DVL   +G E +E++ ++                MKN+
Sbjct  504  VRMESARDPGKRSRLFIPQEVRDVLQGNEGSENVEVLKVDPGTLKGVNLSTKAFEQMKNL  563

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFGVP  484
                I+E+H+ G+F  L +K L+ L W  CP+K IP  +  + LV L M  SN++EF + 
Sbjct  564  RVLIINELHISGDFGLLSKK-LKWLSWQNCPLKYIPSNFPSENLVVLDMSGSNMQEFRLN  622

Query  485  LK  490
            L+
Sbjct  623  LQ  624


 Score = 53.1 bits (126),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 40/150 (27%), Positives = 71/150 (47%), Gaps = 35/150 (23%)
 Frame = +3

Query  639   ESLDLGWCENLTRTPDFSGAKNLHKLSFYG-SSLEKVHYSNIDLWMQSKIDLWGCERLKK  815
             + L+L +CE L RTP+F+G+++L  L   G SSL ++H S  +L    K+D+  CE+L+ 
Sbjct  630   KKLNLSYCEQLRRTPNFNGSRSLETLLLGGCSSLTEIHPSIGNLDRLIKLDMSRCEKLRD  689

Query  816   LPSSSVENSGMLTHNFPQFPPNLEDIRLYGCKNLEVVSATFPTSLEGIVLYGCTNLKTLL  995
             LPSS  +                                    SLE + ++ C+++KTL 
Sbjct  690   LPSSICQ----------------------------------LISLEELFIHHCSSIKTLP  715

Query  996   ELPQNLQSLYVFNCESLETVHLPKMLEYVK  1085
             +   +++SL     +      LP+ +E ++
Sbjct  716   DNLGDMKSLTFLYADDTGIKQLPRSVEMLR  745



>ref|XP_004489498.1| PREDICTED: uncharacterized protein LOC101494533 [Cicer arietinum]
Length=2185

 Score = 93.6 bits (231),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/178 (35%), Positives = 91/178 (51%), Gaps = 25/178 (14%)
 Frame = +2

Query  2     FLDLVCFSHKIPEETN------NAMGHFSTIEIRNIVDKCLINYSCFNW--MYSLIPEMG  157
             FLD+ CF   I  + N      N    ++ I I  +V++ L+N    N   M+ L+ +MG
Sbjct  1589  FLDIACFF--IGMDRNDVIHILNGCELYAEIGINVLVERSLVNVDDRNRLRMHDLLRDMG  1646

Query  158   REIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSPMKN------------  301
             REII  +SP + GERSRLW   DV DVL EQ G + +E + L  P  N            
Sbjct  1647  REIIREKSPKEPGERSRLWFSKDVFDVLYEQTGTKVVEGLALVLPRANAKCFSTKVFKKM  1706

Query  302   --MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIK  469
               +    +  + L+G+F++L R  LR L WN  P+  IP  ++   LV +++  SNIK
Sbjct  1707  MRLRLLNLAGVQLDGDFEYLSR-NLRWLSWNGFPLACIPTSFYLGNLVSIELENSNIK  1763


 Score = 84.0 bits (206),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 90/178 (51%), Gaps = 25/178 (14%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETN------NAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMG  157
            FLD+ CF   I  + N      N  G F+ I I  ++++ L+     N   M+ L+ +MG
Sbjct  467  FLDVACFF--IGMDRNDVTLILNGCGLFAKIGISILIERSLVTVDDKNKLGMHDLLRDMG  524

Query  158  REIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------M  295
            REII  +SP +  ER RLW   DV  VL EQ G + I+ + L  P              M
Sbjct  525  REIIREKSPEELEERCRLWFHEDVFHVLSEQTGTKAIKGMALKLPSANAKCYSTKSFKKM  584

Query  296  KNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIK  469
            K +   Q+  + L+G+F++L R  LR L W+   +  IP  ++ + LV L++  SN+K
Sbjct  585  KRLRLLQLAGVKLDGDFEYLSR-NLRWLSWHGFSLTHIPTNFYRENLVSLELENSNVK  641



>emb|CDK13054.1| TIR-NBS-LRR disease resistance protein [Malus domestica]
Length=1207

 Score = 93.2 bits (230),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 97/177 (55%), Gaps = 21/177 (12%)
 Frame = +2

Query  2    FLDLVCFSHKIPE----ETNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF   + +    +  +  G ++T  I  ++++CL+  +  N   M+ L+ +MGR+
Sbjct  528  FLDIACFFIGMDKNDVVQILDGCGFYATTGIEVLLNRCLVTINRENKIMMHDLLRDMGRD  587

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKN  301
            I+H+E+P+  GERSRLW   D +DVLI + G EKIE + LN P              MK 
Sbjct  588  IVHAENPDVPGERSRLWHLEDANDVLINKSGTEKIEGLALNLPSLEETSFSTEAFRNMKR  647

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKE  472
            +   Q++ + L G ++ L +K LR L W+  P++ IP       +V + M  S++++
Sbjct  648  LRLLQLNYVQLSGGYQCLSKK-LRWLCWHGFPLEFIPIELCQPNIVAIDMQYSSLRQ  703



>gb|ACF19651.1| TIR-NBS-LRR RCT1-like resistance protein [Medicago sativa]
Length=1125

 Score = 93.2 bits (230),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 90/176 (51%), Gaps = 21/176 (12%)
 Frame = +2

Query  2    FLDLVCFSHKIPE----ETNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF   +      +  N  G F+ I I  +V++ L+     N   M+ L+ +MGRE
Sbjct  490  FLDIACFFIGMDRNDVIQILNGCGFFAEIGISVLVERSLVTVDDKNKLGMHDLLRDMGRE  549

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKN  301
            II  +SP +  ERSRLW   DV DVL E  G + +E + L  P              MK 
Sbjct  550  IIREKSPMEPEERSRLWFQEDVLDVLSEHTGTKAVEGLTLKLPGHNAQRFSTKAFENMKK  609

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIK  469
            +   Q+  + L+G+FK+L R  LR L WN  P+  +P  ++   +V +++  SN+K
Sbjct  610  LRLLQLSGVQLDGDFKYLSR-NLRWLHWNGFPLTCLPSNFYQRNIVSIELENSNVK  664



>ref|XP_006364954.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=1064

 Score = 93.2 bits (230),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 65/177 (37%), Positives = 96/177 (54%), Gaps = 22/177 (12%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETNNAM----GHFSTIEIRNIVDKCL--INYSCFNWMYSLIPEMGRE  163
            FLD+ CF     +E  + +    G F  I I  +++K L  IN S    +++LI +MGRE
Sbjct  435  FLDIACFLEGWDKEDVSKVLSSCGFFPEIGINVLIEKSLATINESNQLSLHNLIRDMGRE  494

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKN  301
            I+  ES    G+RSRLW P+D+ D++   KG EK+E + L  P              MKN
Sbjct  495  IVRRES-KYPGDRSRLWDPDDIRDLITRHKGGEKVEALKLEEPVFKDMRVSTKGFSKMKN  553

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKE  472
            +   QID + LEG+FK +  + LR L+W+ C ++  P     DKLV L +  S++KE
Sbjct  554  LRLLQIDHLPLEGSFKDMFTE-LRVLKWHHCHLEHFPSDLHPDKLVILDVKYSSLKE  609


 Score = 56.6 bits (135),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 70/142 (49%), Gaps = 17/142 (12%)
 Frame = +3

Query  624   YFLCHESLDLGWCENLTRTPDFSGAKNLHKLSFYG-SSLEKVHYSNIDLWMQSKIDLWGC  800
             +  C + +DL +CE+L RT DF+G+  L KL F G SSL +VH S   L +   +D  GC
Sbjct  615   HLRCLKIMDLSYCESLMRTSDFTGSPMLEKLVFRGCSSLTEVHSSIGYLEVLVYLDFTGC  674

Query  801   ERLKKLPSSSVENSGMLTHNFPQFPPNLEDIRLYGCKNLEVVSATFPTSLEGIVLYGC-T  977
             ++L+ LP S  +              +LE + L  C NL+ + A          LY   T
Sbjct  675   KKLEGLPDSICKLK------------SLEKLYLSDCTNLQQLPADMGNLRRLTALYVMGT  722

Query  978   NLKTL---LELPQNLQSLYVFN  1034
             ++K L     L +NLQ L V N
Sbjct  723   SIKQLPVSFGLLKNLQLLEVGN  744


 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 87/209 (42%), Gaps = 42/209 (20%)
 Frame = +3

Query  816   LPSSSVENSGMLTHNFPQFPPNLEDI-----RLYGCKNLEVVSATFPT---------SLE  953
             LPSS +    +     P F     DI     RL+  + L++    F +         +L+
Sbjct  770   LPSSIINLPSLEVLKVPFFNLCQRDIPNCLGRLFSLQVLDLSGNNFHSLPFTLSHLSNLK  829

Query  954   GIVLYGCTNLKTLLELPQNLQSLYVFNCESLETVHLPKM-----LEYVKLTHCKKLKEIQ  1118
              + LYGC NL  L +LP NL+ L   NC SLE   LP +     L+ +    C KL EI+
Sbjct  830   TLRLYGCPNLLMLPDLPCNLEELCTRNCRSLEM--LPDLSSANRLQLLDFCDCSKLIEIR  887

Query  1119  GWENAQFLTRIELRGVPNNIKFSEIINKVLKVSKLNSNIEFEGYLPN--------NETLS  1274
             G EN ++L            K+   I  +L  + L+         PN        NE  S
Sbjct  888   GLENLKYL------------KYMNAIGCMLTKNPLSEGFFKANSAPNGVNVFLHCNEIPS  935

Query  1275  WIKFEENGSSISFQWPPLISNLEFLEICI  1361
             W  +   GSSIS   P  +   EFL + +
Sbjct  936   WFGYRVVGSSISLIVPRYMEQ-EFLGMIV  963



>gb|KEH40037.1| disease resistance protein (TIR-NBS-LRR class), putative [Medicago 
truncatula]
Length=1580

 Score = 73.2 bits (178),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 82/169 (49%), Gaps = 20/169 (12%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETNNAMGHFSTIE-----IRNIVDKCLINY--SCFNWMYSLIPEMGR  160
            FLD+ C          N M H    +     ++ +V+K LI    S    ++ +I +MG+
Sbjct  396  FLDIACCFKGYDLTIVNKMLHAHHGDNMEDHMQVLVEKSLIKITESRSVTLHDVIEDMGK  455

Query  161  EIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSPM---------KNMEYN  313
            EI+  ESP + G+RSRLWCP D+  VL E  G  KIE+I L+S +         K ME N
Sbjct  456  EIVRQESPKEPGKRSRLWCPEDIVQVLEENTGTSKIEIIYLDSSIEVKWDEEAFKKME-N  514

Query  314  QIDEIHLEGNFKHLPR---KTLRCLQWNQCPVKSIPFGYFFDKLVKLKM  451
                I   G F   P+    +LR L+W + P   +P  ++  KL   K+
Sbjct  515  LRTLIIRHGAFSESPKYLPNSLRILEWRKYPSGGVPSDFYPKKLAICKI  563


 Score = 42.0 bits (97),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/221 (27%), Positives = 97/221 (44%), Gaps = 21/221 (10%)
 Frame = +3

Query  561   LLIQKFLICFYGFYLLNPLK*YFLCHESLDLGWCENLTRTPDFSGAKNLHKLSF-YGSSL  737
             L I K    F  F   + LK  F   + L++  C  L R PD SG  NL +LSF Y  +L
Sbjct  558   LAICKIAFDFTSFVWGDFLKKKFQNMKVLNIDNCGFLARMPDISGLLNLEELSFQYCENL  617

Query  738   EKVHYSNIDLWMQSKIDLWG-CERLKKLPS-----------SSVENSGMLTHNFPQFPPN  881
               +  S + L  + KI   G C++LK LP            S +++     H    F   
Sbjct  618   ITMDDS-VGLLAKLKILRVGSCKKLKSLPPLKLVSLEELDLSYIDSLESFPHVVDGFLNK  676

Query  882   LEDIRLYGCKNLEVVSATFPTSLEGIVLYGCTNLK----TLLELPQNLQSLYVFNCESLE  1049
             L+ + +  C  +  +      SLE + L  C +L+     +  L + L+ L V  C +++
Sbjct  677   LQTLSVKNCNTIRSIPPLKMASLEELNLLYCDSLECFPLVVDGLLEKLKILRVIGCSNIK  736

Query  1050  TVHLPKM--LEYVKLTHCKKLKEIQGWENAQFLTRIELRGV  1166
             ++   K+  LE + L++C  L       +  FL +++L  V
Sbjct  737   SIPPFKLTSLEELDLSYCNSLTSFPVIVDG-FLDKLKLLSV  776



>gb|KDO39974.1| hypothetical protein CISIN_1g0014582mg, partial [Citrus sinensis]
Length=507

 Score = 81.6 bits (200),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 88/180 (49%), Gaps = 23/180 (13%)
 Frame = +2

Query  2    FLDLVCFSHKIPEE--TN--NAMGHFSTIEIRNIVDKCLIN-YSCFNWMYSLIPEMGREI  166
            FLD+ CF      +  TN     G    I IR +++KCLI  ++   WM+ L+ E+G++I
Sbjct  246  FLDIACFFKGNDRDYVTNFLEGCGFHPVIGIRVLIEKCLITVHNNTLWMHDLLQELGQQI  305

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN-----------------SPM  295
            +  +SP + G+RSRLW   +V  VL E  G E +E IVL+                 S M
Sbjct  306  VQRQSPEELGKRSRLWKEEEVCHVLTESTGTELVEGIVLDNYHHENEVYLCASAKAFSKM  365

Query  296  KNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
             N+   +I  + L    ++L  + LR L W   P+K +P     DK +++ M  S I E 
Sbjct  366  TNLRLLKICNLQLPNGLEYLSNR-LRLLGWRGYPLKFLPSNLQMDKTIEIYMCYSRIGEL  424


 Score = 33.5 bits (75),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 28/55 (51%), Gaps = 8/55 (15%)
 Frame = +3

Query  594  GFYLLNPLK*YFLCHESLDLGWCENLTRTPDFSGAKNLHKLSFYG-SSLEKVHYS  755
            G   L+ LK   L H        ENL R PDF+GA NL KL   G + L ++H S
Sbjct  427  GIKHLDKLKVMILSHS-------ENLIRMPDFTGAPNLEKLILEGCTRLYEIHPS  474



>ref|XP_003589199.1| Disease resistance protein [Medicago truncatula]
 gb|AES59450.1| disease resistance protein (TIR-NBS-LRR class), putative [Medicago 
truncatula]
Length=1613

 Score = 73.2 bits (178),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 82/169 (49%), Gaps = 20/169 (12%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETNNAMGHFSTIE-----IRNIVDKCLINY--SCFNWMYSLIPEMGR  160
            FLD+ C          N M H    +     ++ +V+K LI    S    ++ +I +MG+
Sbjct  429  FLDIACCFKGYDLTIVNKMLHAHHGDNMEDHMQVLVEKSLIKITESRSVTLHDVIEDMGK  488

Query  161  EIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSPM---------KNMEYN  313
            EI+  ESP + G+RSRLWCP D+  VL E  G  KIE+I L+S +         K ME N
Sbjct  489  EIVRQESPKEPGKRSRLWCPEDIVQVLEENTGTSKIEIIYLDSSIEVKWDEEAFKKME-N  547

Query  314  QIDEIHLEGNFKHLPR---KTLRCLQWNQCPVKSIPFGYFFDKLVKLKM  451
                I   G F   P+    +LR L+W + P   +P  ++  KL   K+
Sbjct  548  LRTLIIRHGAFSESPKYLPNSLRILEWRKYPSGGVPSDFYPKKLAICKI  596


 Score = 42.0 bits (97),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/221 (27%), Positives = 97/221 (44%), Gaps = 21/221 (10%)
 Frame = +3

Query  561   LLIQKFLICFYGFYLLNPLK*YFLCHESLDLGWCENLTRTPDFSGAKNLHKLSF-YGSSL  737
             L I K    F  F   + LK  F   + L++  C  L R PD SG  NL +LSF Y  +L
Sbjct  591   LAICKIAFDFTSFVWGDFLKKKFQNMKVLNIDNCGFLARMPDISGLLNLEELSFQYCENL  650

Query  738   EKVHYSNIDLWMQSKIDLWG-CERLKKLPS-----------SSVENSGMLTHNFPQFPPN  881
               +  S + L  + KI   G C++LK LP            S +++     H    F   
Sbjct  651   ITMDDS-VGLLAKLKILRVGSCKKLKSLPPLKLVSLEELDLSYIDSLESFPHVVDGFLNK  709

Query  882   LEDIRLYGCKNLEVVSATFPTSLEGIVLYGCTNLK----TLLELPQNLQSLYVFNCESLE  1049
             L+ + +  C  +  +      SLE + L  C +L+     +  L + L+ L V  C +++
Sbjct  710   LQTLSVKNCNTIRSIPPLKMASLEELNLLYCDSLECFPLVVDGLLEKLKILRVIGCSNIK  769

Query  1050  TVHLPKM--LEYVKLTHCKKLKEIQGWENAQFLTRIELRGV  1166
             ++   K+  LE + L++C  L       +  FL +++L  V
Sbjct  770   SIPPFKLTSLEELDLSYCNSLTSFPVIVDG-FLDKLKLLSV  809



>ref|XP_006576576.1| PREDICTED: TMV resistance protein N-like isoform X1 [Glycine 
max]
Length=1128

 Score = 92.8 bits (229),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 64/178 (36%), Positives = 94/178 (53%), Gaps = 25/178 (14%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETNNAM------GHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMG  157
            FLD+ CF   I  + N+AM      G F+   IR +V++ L+     N   M+ L+ +MG
Sbjct  458  FLDIACFF--IGMDRNDAMCILNGCGLFAENGIRVLVERSLVTVDDKNKLGMHDLLRDMG  515

Query  158  REIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------M  295
            REII ++SP    ERSRLW   DV DVL ++ G + IE + L  P              M
Sbjct  516  REIIRAKSPKDLEERSRLWFNEDVLDVLAKKTGTKTIEGLALKLPLTNSNCFSTEAFKEM  575

Query  296  KNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIK  469
            K +   Q+  + L+G+F++L  K LR L WN  P+K IP  +    LV +++  SN+K
Sbjct  576  KKLRLLQLAGVQLDGDFEYLS-KDLRWLCWNGFPLKCIPKNFHQGSLVSIELENSNVK  632



>gb|KEH40038.1| disease resistance protein (TIR-NBS-LRR class), putative [Medicago 
truncatula]
Length=1436

 Score = 72.8 bits (177),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 64/119 (54%), Gaps = 13/119 (11%)
 Frame = +2

Query  131  MYSLIPEMGREIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSPM-----  295
            ++ +I +MG+EI+  ESP + G+RSRLWCP D+  VL E  G  KIE+I L+S +     
Sbjct  302  LHDVIEDMGKEIVRQESPKEPGKRSRLWCPEDIVQVLEENTGTSKIEIIYLDSSIEVKWD  361

Query  296  ----KNMEYNQIDEIHLEGNFKHLPR---KTLRCLQWNQCPVKSIPFGYFFDKLVKLKM  451
                K ME N    I   G F   P+    +LR L+W + P   +P  ++  KL   K+
Sbjct  362  EEAFKKME-NLRTLIIRHGAFSESPKYLPNSLRILEWRKYPSGGVPSDFYPKKLAICKI  419


 Score = 42.0 bits (97),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/221 (27%), Positives = 97/221 (44%), Gaps = 21/221 (10%)
 Frame = +3

Query  561   LLIQKFLICFYGFYLLNPLK*YFLCHESLDLGWCENLTRTPDFSGAKNLHKLSF-YGSSL  737
             L I K    F  F   + LK  F   + L++  C  L R PD SG  NL +LSF Y  +L
Sbjct  414   LAICKIAFDFTSFVWGDFLKKKFQNMKVLNIDNCGFLARMPDISGLLNLEELSFQYCENL  473

Query  738   EKVHYSNIDLWMQSKIDLWG-CERLKKLPS-----------SSVENSGMLTHNFPQFPPN  881
               +  S + L  + KI   G C++LK LP            S +++     H    F   
Sbjct  474   ITMDDS-VGLLAKLKILRVGSCKKLKSLPPLKLVSLEELDLSYIDSLESFPHVVDGFLNK  532

Query  882   LEDIRLYGCKNLEVVSATFPTSLEGIVLYGCTNLK----TLLELPQNLQSLYVFNCESLE  1049
             L+ + +  C  +  +      SLE + L  C +L+     +  L + L+ L V  C +++
Sbjct  533   LQTLSVKNCNTIRSIPPLKMASLEELNLLYCDSLECFPLVVDGLLEKLKILRVIGCSNIK  592

Query  1050  TVHLPKM--LEYVKLTHCKKLKEIQGWENAQFLTRIELRGV  1166
             ++   K+  LE + L++C  L       +  FL +++L  V
Sbjct  593   SIPPFKLTSLEELDLSYCNSLTSFPVIVDG-FLDKLKLLSV  632



>ref|XP_010245559.1| PREDICTED: uncharacterized protein LOC104589071 [Nelumbo nucifera]
Length=2320

 Score = 92.8 bits (229),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 90/177 (51%), Gaps = 20/177 (11%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETNNAM----GHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF   + +   + +    G FS I +  +    L++ +  N   M+ L+ +MGRE
Sbjct  427  FLDIACFFIGMDKNYVSRILLGCGFFSDIGLSFLTRLSLVSINNKNELRMHDLLRDMGRE  486

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKN  301
            I+  E P+  G+RSRLW P DV  VL  QKG E+IE +V+N P              M  
Sbjct  487  IVRKECPDSPGKRSRLWDPEDVRVVLTRQKGTEEIEGLVVNFPQPEDSLWSSKAFADMSK  546

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKE  472
            +   Q++ + L G+F+H     L  L W+  P KS+P  +  + LV L M  S I++
Sbjct  547  LRLLQLNYVQLSGDFRHFSTNKLSWLCWHGFPYKSMPTSFHLENLVILDMQHSTIRK  603


 Score = 84.0 bits (206),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 85/177 (48%), Gaps = 20/177 (11%)
 Frame = +2

Query  2     FLDLVCFSHKIPEETNNAMGH----FSTIEIRNIVDKCL--INYSCFNWMYSLIPEMGRE  163
             FLD+ CF   +     + + H    F  I +  +    L  INY     M+ L+ +MGRE
Sbjct  1587  FLDIACFFIGMDRNYVSKILHGCDFFPEIGLSILTRLSLVSINYKNQLRMHDLLRDMGRE  1646

Query  164   IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKN  301
             I+  + P+   +RSRLW P+DV  VL  Q G  +IE +V+N P              M  
Sbjct  1647  IVREKYPDSPEKRSRLWDPDDVRVVLTRQNGTAEIEGLVVNFPQPKDSQWSTKAFADMSK  1706

Query  302   MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKE  472
             +   Q++ + L G+F+H     L  L W+  P KSIP  +  + LV L M  S I++
Sbjct  1707  LRLLQLNYVQLRGDFRHFSTNELSWLCWHGFPYKSIPTSFHLENLVILDMQYSTIRK  1763



>ref|XP_011011965.1| PREDICTED: TMV resistance protein N-like isoform X2 [Populus 
euphratica]
Length=1270

 Score = 92.4 bits (228),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 68/190 (36%), Positives = 97/190 (51%), Gaps = 26/190 (14%)
 Frame = +2

Query  2    FLDLVCF--SHKIPEETN--NAMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGREI  166
            FLD+ CF    KI   T    + G  + I I  +++K LI+ S    WM++L+  MG+EI
Sbjct  445  FLDIACFLMGFKIDRITRILESRGFHAGIGIPVLIEKSLISVSRDQVWMHNLLQIMGKEI  504

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKNM  304
            +  ESP + G RSRLW   DV   L++  G EKIE I L+ P              M  +
Sbjct  505  VRCESPEEPGRRSRLWTYEDVCLALMDSTGKEKIEAIFLDMPGIKEAQWNMKAFSKMSKL  564

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF---  475
               +ID + L    + L  K LR L+W+  P KS+P G   D+LV+L M  S+I++    
Sbjct  565  RLLKIDSVQLSEGPEDLSNK-LRFLEWHSYPSKSLPAGLQVDELVELHMANSSIEQLWYG  623

Query  476  ---GVPLKVI  496
                V LK+I
Sbjct  624  CKSAVNLKII  633



>gb|ABF81428.1| TIR-NBS-LRR-TIR type disease resistance protein [Populus trichocarpa]
Length=1246

 Score = 92.4 bits (228),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 66/190 (35%), Positives = 98/190 (52%), Gaps = 26/190 (14%)
 Frame = +2

Query  2    FLDLVCF--SHKIPEETN--NAMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGREI  166
            FLD+ CF    KI   T   +  G  ++I I  ++++ LI+ S    WM++L+ +MG+EI
Sbjct  494  FLDIACFLKGFKIDRITRILDGRGFHASIGIPVLIERSLISVSRDQVWMHNLLQKMGKEI  553

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKNM  304
            I  ESP + G RSRLW   DV   L++  G EK+E I L+ P              M  +
Sbjct  554  IRRESPEEPGRRSRLWTYKDVCLALMDNTGKEKVEAIFLDMPGIKEARWNMKAFSKMSRL  613

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF---  475
               +ID + L    + L    LR L+W+  P KS+P G   D+LV+L M  SN+++    
Sbjct  614  RLLKIDNVQLFEGPEDLS-NNLRFLEWHSYPSKSLPAGLQVDELVELHMANSNLEQLWYG  672

Query  476  ---GVPLKVI  496
                V LK+I
Sbjct  673  CKSAVNLKII  682



>ref|XP_010245185.1| PREDICTED: TMV resistance protein N-like [Nelumbo nucifera]
Length=1120

 Score = 92.4 bits (228),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/180 (34%), Positives = 96/180 (53%), Gaps = 18/180 (10%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETN----NAMGHFSTIEIRNIVDKCLINYSCFNW-MYSLIPEMGREI  166
            FLD+ CF   + ++      +  G+ + I I  ++ K L+        M+ LI +MGREI
Sbjct  461  FLDIACFFIGMNKDYAIRILDGCGYSTNIGIGVLIRKSLLTVEVNKLGMHDLIRDMGREI  520

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN------------SPMKNMEY  310
            +  ESP K G RSRLW   D+H VL++  G E ++ +VL+            + MK ++ 
Sbjct  521  VRQESPEKPGNRSRLWDHEDIHQVLLKHSGTEAVKGLVLSRLFDEQFSTRTFAEMKELKL  580

Query  311  NQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFGVPLK  490
             Q++ I L+G +++L R  LR L W+  P+K IP     ++LV L +  S +KE  V LK
Sbjct  581  LQLNYICLKGTYQYLSRD-LRWLCWHGFPLKYIPSDLHLERLVVLDIQYSKLKEIKVHLK  639


 Score = 53.9 bits (128),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 71/132 (54%), Gaps = 3/132 (2%)
 Frame = +3

Query  948   LEGIVLYGCTNLKTLLELPQNLQSLYVFNCESLETVHL--PKMLEYVKLTHCKKLKEIQG  1121
             L+ + L GC+ L+TL +LP ++ +LY+  C +LE++++   + +++  L +C KL +++ 
Sbjct  874   LKLLQLRGCSRLQTLAQLPSSVHTLYLTKCPALESLNISGSEGIQFFHLMNCNKLVQVRI  933

Query  1122  WENAQFLTRIELRGVPNNIKFSEIINKVLKVSKLNSNIEFEGYLPNNETLSWIKFEENGS  1301
                 +   ++ + G  NN+  S   N +  + +  +   F+ +LP +E   W  ++  G 
Sbjct  934   PRRLKSEGKLVMSGC-NNLMHSCRKNLLNLLQETFTTNRFDIFLPGSEIPDWFSYQNMGP  992

Query  1302  SISFQWPPLISN  1337
              +SF+ P  +  
Sbjct  993   KVSFEVPSFVGR  1004



>ref|XP_003604611.1| TIR-NBS-LRR RCT1-like resistance protein [Medicago truncatula]
 gb|AES86808.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=1116

 Score = 92.4 bits (228),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/187 (34%), Positives = 93/187 (50%), Gaps = 28/187 (15%)
 Frame = +2

Query  2    FLDLVCFSHKIPE----ETNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF   +      +  N  G F+ I I  +V++ L+     N   M+ L+ +MGRE
Sbjct  492  FLDIACFFIGMDRNDVIQILNGCGLFAEIGISVLVERSLVTVDGKNKLGMHDLLRDMGRE  551

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKN  301
            II  +SP +  ERSRLW   DV DVL E  G + +E + L  P              MK 
Sbjct  552  IIREKSPMEPEERSRLWFHEDVLDVLSEHTGTKTVEGLTLKLPGRSAQRFSTKAFKKMKK  611

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFGV  481
            +   Q+    L+G+FK+L RK LR L WN  P+  IP  +    +V +++  SN+     
Sbjct  612  LRLLQLSGAQLDGDFKYLSRK-LRWLHWNGFPLTCIPSKFRQRNIVSIELENSNV-----  665

Query  482  PLKVIWQ  502
              K++WQ
Sbjct  666  --KLVWQ  670



>ref|XP_011011963.1| PREDICTED: TMV resistance protein N-like isoform X1 [Populus 
euphratica]
 ref|XP_011011964.1| PREDICTED: TMV resistance protein N-like isoform X1 [Populus 
euphratica]
Length=1270

 Score = 92.4 bits (228),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 68/190 (36%), Positives = 97/190 (51%), Gaps = 26/190 (14%)
 Frame = +2

Query  2    FLDLVCF--SHKIPEETN--NAMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGREI  166
            FLD+ CF    KI   T    + G  + I I  +++K LI+ S    WM++L+  MG+EI
Sbjct  445  FLDIACFLMGFKIDRITRILESRGFHAGIGIPVLIEKSLISVSRDQVWMHNLLQIMGKEI  504

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKNM  304
            +  ESP + G RSRLW   DV   L++  G EKIE I L+ P              M  +
Sbjct  505  VRCESPEEPGRRSRLWTYEDVCLALMDSTGKEKIEAIFLDMPGIKEAQWNMKAFSKMSKL  564

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF---  475
               +ID + L    + L  K LR L+W+  P KS+P G   D+LV+L M  S+I++    
Sbjct  565  RLLKIDSVQLSEGPEDLSNK-LRFLEWHSYPSKSLPAGLQVDELVELHMANSSIEQLWYG  623

Query  476  ---GVPLKVI  496
                V LK+I
Sbjct  624  CKSAVNLKII  633



>ref|XP_011015315.1| PREDICTED: TMV resistance protein N-like [Populus euphratica]
Length=1140

 Score = 82.0 bits (201),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 92/182 (51%), Gaps = 18/182 (10%)
 Frame = +2

Query  2    FLDLVC-FSHKIPEETNNAMGH----FSTIEIRNIVDKCLINYSCFNW--MYSLIPEMGR  160
            FLD+ C F     E   N +G        +  R ++ + LI    +N   M+ ++ +MGR
Sbjct  450  FLDIACYFVGGDKEYVANIVGARYDCHPEVAFRTLIGRSLITIDTWNMLSMHDILRKMGR  509

Query  161  EIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN----------SPMKNMEY  310
            EII   S N  G  SR+  P D ++VL ++ G + +E + L+          + M+ ++ 
Sbjct  510  EIIRQRSRNHPGNCSRIVLPKDAYNVLSKEMGTDAVEGLALDVQESFSTKSFTKMRRLKL  569

Query  311  NQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFGVPLK  490
             QI   +L G++  LP K L  L W+ CP+KS+P  +  + LV L M ESN+++     K
Sbjct  570  LQIKRANLVGSYSLLP-KELIWLCWSGCPLKSLPSDFHLNDLVILDMQESNVRKLWKGTK  628

Query  491  VI  496
            ++
Sbjct  629  IL  630


 Score = 32.3 bits (72),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 49/107 (46%), Gaps = 14/107 (13%)
 Frame = +3

Query  594  GFYLLNPLK*YFLCHESLDLGWCENLTRTPDFSGAKNLHKLSFYG-SSLEKVHYSNIDLW  770
            G  +LN LK        L+L +   LT+TP+F G  +L +L      SL +VH S  +L 
Sbjct  626  GTKILNKLK-------ILNLSYSMYLTKTPNFRGLSSLERLVLTECQSLVEVHQSIGNLK  678

Query  771  MQSKIDLWGCERLKKLPSSSVENSGMLTHN------FPQFPPNLEDI  893
                ++L  C+ LK LP S      + T N        + P +L DI
Sbjct  679  SLVLLNLEVCDSLKTLPESMGNLKSLQTLNVTKCIQLEKLPESLGDI  725



>ref|XP_006387813.1| hypothetical protein POPTR_0548s002002g, partial [Populus trichocarpa]
 gb|ERP46727.1| hypothetical protein POPTR_0548s002002g, partial [Populus trichocarpa]
Length=1170

 Score = 92.0 bits (227),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 66/190 (35%), Positives = 98/190 (52%), Gaps = 26/190 (14%)
 Frame = +2

Query  2    FLDLVCF--SHKIPEETN--NAMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGREI  166
            FLD+ CF    KI   T   +  G  ++I I  ++++ LI+ S    WM++L+ +MG+EI
Sbjct  418  FLDIACFLKGFKIDRITRILDGRGFHASIGIPVLIERSLISVSRDQVWMHNLLQKMGKEI  477

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKNM  304
            I  ESP + G RSRLW   DV   L++  G EK+E I L+ P              M  +
Sbjct  478  IRRESPEEPGRRSRLWTYKDVCLALMDNTGKEKVEAIFLDMPGIKEARWNMKAFSKMSRL  537

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF---  475
               +ID + L    + L    LR L+W+  P KS+P G   D+LV+L M  SN+++    
Sbjct  538  RLLKIDNVQLFEGPEDLS-NNLRFLEWHSYPSKSLPAGLQVDELVELHMANSNLEQLWYG  596

Query  476  ---GVPLKVI  496
                V LK+I
Sbjct  597  CKSAVNLKII  606



>emb|CDK13059.1| TIR-NBS-LRR disease resistance protein [Malus domestica]
Length=1182

 Score = 92.0 bits (227),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 98/177 (55%), Gaps = 21/177 (12%)
 Frame = +2

Query  2    FLDLVCFSHKIPE----ETNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF   + +    +  +  G ++T  I  + ++CL+  +  N   M+ L+ +MGR+
Sbjct  502  FLDIACFFIGMDKNDVVQILDGCGFYATTGIEVLFNRCLVTINRENKIMMHDLLRDMGRD  561

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKN  301
            I+H+E+P+   ERSRLW P DV+DVLI++ G EKIE + LN P              MK 
Sbjct  562  IVHAENPDFPRERSRLWHPEDVNDVLIDKFGTEKIEGLALNLPSPEETSFSTKAFRNMKR  621

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKE  472
            +   Q++ + L G ++ L +K LR L W+  P++ IP       +V + M  S++++
Sbjct  622  LRLLQLNYVRLTGGYQCLSKK-LRWLCWHGFPLEFIPIELCQPNIVVIDMQYSSLRQ  677



>ref|XP_006441734.1| hypothetical protein CICLE_v10018550mg [Citrus clementina]
 gb|ESR54974.1| hypothetical protein CICLE_v10018550mg [Citrus clementina]
Length=1231

 Score = 78.2 bits (191),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 87/180 (48%), Gaps = 23/180 (13%)
 Frame = +2

Query  2    FLDLVCFSHKIPEE--TN--NAMGHFSTIEIRNIVDKCLIN-YSCFNWMYSLIPEMGREI  166
            FLD+ CF      +  TN     G    I IR +++KCLI  ++   WM+ L+ E+G++I
Sbjct  432  FLDVACFFKGNDRDYVTNFLEGCGFHPVIGIRVLIEKCLITVHNNTLWMHDLLQELGQQI  491

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN-----------------SPM  295
            +  +SP + G+RSRLW   +V  VL E  G E +E IVL+                 S M
Sbjct  492  VQRQSPEEPGKRSRLWKEEEVCHVLTESTGTELVEGIVLDNYHLQNEVYLCASAKAFSKM  551

Query  296  KNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
             N+   +I    L    ++L    LR L W+  P+K +P     DK +++ M  S I E 
Sbjct  552  TNLRLLKICNPQLPNGLEYLS-NWLRLLDWHGYPLKFLPSNLQMDKTIEINMSYSRIGEL  610


 Score = 35.8 bits (81),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 57/144 (40%), Gaps = 43/144 (30%)
 Frame = +3

Query  594   GFYLLNPLK*YFLCHESLDLGWCENLTRTPDFSGAKNLHKLSFYGSSLEKVHYSNIDLWM  773
             G   L+ LK   L H        ENL R PDF+GA NL KL                   
Sbjct  613   GIKRLDKLKVMILSHS-------ENLIRMPDFTGAPNLEKLI------------------  647

Query  774   QSKIDLWGCERLKKLPSSSVENSGMLTHNFPQFPPNLEDIRLYGCKNLEVV-SATFPTSL  950
                  L GC RL ++  S      +L HN       L  + +  C +L  +       SL
Sbjct  648   -----LEGCTRLYEIHPS------LLLHN------KLIILNMKDCTSLITLPGKILMKSL  690

Query  951   EGIVLYGCTNLKTLLELPQNLQSL  1022
             E +VL GC+ LK   ++  +++ L
Sbjct  691   EKLVLSGCSKLKKFPDIVGSMECL  714



>ref|XP_006389214.1| hypothetical protein POPTR_0035s00335g [Populus trichocarpa]
 gb|ERP48128.1| hypothetical protein POPTR_0035s00335g [Populus trichocarpa]
Length=728

 Score = 91.7 bits (226),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 65/191 (34%), Positives = 98/191 (51%), Gaps = 27/191 (14%)
 Frame = +2

Query  2    FLDLVCFS-----HKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGRE  163
            FLD+ CF       +I    +   G  + I I  ++++ LI+ S    WM++L+ +MG+E
Sbjct  442  FLDIACFLKGFKIDRITRILDGWRGFHTGIGIPVLIERSLISVSRDQVWMHNLLQKMGQE  501

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKN  301
            II  ESP++ G RSRLW   DV   L++  G EKIE I L+ P              M  
Sbjct  502  IIRRESPDEPGRRSRLWTYEDVCLALMDNTGKEKIEAIFLDMPGIKEAQWNMEAFSKMSR  561

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF--  475
            +   +ID + L    + L  + LR L+W+  P KS+P G   D+LV+L M  S+I++   
Sbjct  562  LRLLKIDNVQLSEGPEDLSNE-LRFLEWHSYPSKSLPAGLQVDELVELHMANSSIEQLWY  620

Query  476  ----GVPLKVI  496
                 V LK+I
Sbjct  621  GCKSAVNLKII  631



>gb|KEH23635.1| TIR-NBS-LRR class disease resistance protein [Medicago truncatula]
Length=692

 Score = 91.7 bits (226),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 92/178 (52%), Gaps = 25/178 (14%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETN------NAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMG  157
            FLD+ CF   I  + N      N    F+ I +  +V++ L+     N   M+ L+ +MG
Sbjct  95   FLDIACFF--IGMDRNDVIHILNGSELFAEIGVSVLVERSLVTVDDRNRLGMHDLLRDMG  152

Query  158  REIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------M  295
            REII  +SP +  ERSRLW   DV DVL EQ G + +E + L  P              M
Sbjct  153  REIIREKSPKELEERSRLWFNKDVADVLSEQTGTKAVEGLALKLPRTNGKRFSTKAFKKM  212

Query  296  KNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIK  469
            K +   Q+  + L+G+F++L  K LR L WN  P+  IP  ++ + LV +++  SN+K
Sbjct  213  KRLRLLQLAGVQLDGDFEYLS-KNLRWLSWNGFPLTCIPSSFYQENLVSIELENSNVK  269



>ref|XP_008219411.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=976

 Score = 91.7 bits (226),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 58/168 (35%), Positives = 89/168 (53%), Gaps = 20/168 (12%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCLI-NYSCFNWMYSLIPEMGREI  166
            FLD+ CF          ET +A G ++ I I  +V+K L+ N     WM+ LI EMGREI
Sbjct  440  FLDIACFFNWKGKDRVRETLDACGFYADIGIYVLVEKSLLTNSDGILWMHDLIQEMGREI  499

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKNM  304
            I  ESP+  G RSRLW   D+  VL E  G + IE I+++              S M  +
Sbjct  500  IRRESPDDLGRRSRLWRRKDIDQVLSENTGKDTIEGIMVHPFELELVTANARSFSMMNKL  559

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLK  448
             Y +++ + L    ++LP  +LR L+W + P+K +P  +  + L++L+
Sbjct  560  RYLKLNNVDLSNGLEYLP-DSLRILEWPKFPLKYLPSSFNPEDLIELE  606



>ref|XP_009799386.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nicotiana 
sylvestris]
Length=787

 Score = 91.7 bits (226),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 95/182 (52%), Gaps = 20/182 (11%)
 Frame = +2

Query  2    FLDLVCFSHKIPE----ETNNAMGHFSTIEIRNIVDKCLINYS-CFNWMYSLIPEMGREI  166
            FLD+ C  H   E    E  NA G  +   I  +V K L+     +  M+ L+ +MGREI
Sbjct  444  FLDIACAFHGFYEHEVTEILNACGFHAKSAIATLVQKHLLQRDDLYLVMHDLVRDMGREI  503

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKNM  304
            +  ES     +RSRL+ P +V DVL   KG +K+E++ ++                M+N+
Sbjct  504  VRLESTRYPEKRSRLFIPQEVCDVLQGNKGSKKVEVLKVDRRAFKGVNLSTKAFKKMENL  563

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFGVP  484
                +DE+H+ G+F  L  K L+ L W +CP+  IP  +  + LV L M ES+I+EF + 
Sbjct  564  RVLIMDELHISGDFGMLS-KELKWLSWKKCPLNCIPSNFPAENLVVLDMQESDIQEFRLN  622

Query  485  LK  490
            L+
Sbjct  623  LQ  624



>ref|XP_007227381.1| hypothetical protein PRUPE_ppb015618mg [Prunus persica]
 gb|EMJ28580.1| hypothetical protein PRUPE_ppb015618mg [Prunus persica]
Length=1098

 Score = 91.7 bits (226),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 90/172 (52%), Gaps = 20/172 (12%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCLI-NYSCFNWMYSLIPEMGREI  166
            FLD+ CF          ET +A G ++ I I  +V+K L+ N     WM+ LI EMGREI
Sbjct  440  FLDIACFFNWKGKDRVRETLDACGFYADIGIYVLVEKSLLTNSDGILWMHDLIQEMGREI  499

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKNM  304
            +  ESP+  G +SRLW   DV  VL E  G + IE I+++              S M  +
Sbjct  500  VRRESPDDLGRQSRLWRRKDVDQVLSENTGKDTIEGIMVHPFELELVTANARSFSMMNKL  559

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWES  460
             Y +++ + L    ++LP  +LR L+W + P+K +P  +  + L++L M  S
Sbjct  560  RYLKLNNVDLSNGLEYLP-DSLRILEWPKFPLKYLPSSFNPEDLIELNMHHS  610



>ref|XP_004489475.1| PREDICTED: TMV resistance protein N-like [Cicer arietinum]
Length=1136

 Score = 91.7 bits (226),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 91/176 (52%), Gaps = 21/176 (12%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETN----NAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF   +         N  G F+ I I  +V++ L+     N   M+ L+ +MGRE
Sbjct  495  FLDIACFLIGLDRNDVILILNGCGLFAEIGISVLVERSLVTVDDKNKLGMHDLLRDMGRE  554

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKN  301
            II  +SP +  ERSRLW  +DV  VL E+ G + +E + LN P              MK 
Sbjct  555  IIREKSPKEPEERSRLWFHDDVVGVLSERIGTKAVEGLALNLPIASSKCFSTKAFKKMKR  614

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIK  469
            +   Q+  + L+G+F++L R  LR L WN  P+  IP  ++   LV +++  SNI+
Sbjct  615  LRLLQLGGVQLDGDFEYLSR-NLRWLCWNGFPLTCIPSNFYQGNLVSIELVNSNIR  669



>ref|XP_006441733.1| hypothetical protein CICLE_v10024511mg, partial [Citrus clementina]
 gb|ESR54973.1| hypothetical protein CICLE_v10024511mg, partial [Citrus clementina]
Length=1066

 Score = 73.9 bits (180),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/181 (29%), Positives = 84/181 (46%), Gaps = 24/181 (13%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF    +     +     G    I I  +++K L+     N   M+ L+ E+G+ 
Sbjct  438  FLDVACFFKWKNRDGVTKILEGCGFSPVIGIEVLIEKSLLTVDDNNTLGMHDLLQELGQL  497

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN-----------------SP  292
            I+  +SP + G+RSR+W   +V  VL    G E +E I++N                 S 
Sbjct  498  IVTRQSPEEPGKRSRIWREEEVRQVLTNNTGGEVVEGIIVNAYFPENEVYLSASAKAFSQ  557

Query  293  MKNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKE  472
            M N+   +I  + L    ++L  + LR L W + P+KS+P     D++V  KM  S I+E
Sbjct  558  MTNLRLLKISNVQLPRGLEYLSNR-LRLLDWRRYPLKSLPSNLQLDEIVGFKMCYSRIEE  616

Query  473  F  475
             
Sbjct  617  L  617


 Score = 40.0 bits (92),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/165 (28%), Positives = 66/165 (40%), Gaps = 45/165 (27%)
 Frame = +3

Query  573   KFLICFYGFYLLNPLK*YFLCHESLDLGWCENLTRTPDFSGAKNLHKLSFYGSSLEKVHY  752
             K L CF     LN L+   L H        ENL +TPDF+   NL +L            
Sbjct  622   KLLFCFQ--QPLNMLRLMKLSH-------SENLIKTPDFTKVPNLEEL------------  660

Query  753   SNIDLWMQSKIDLWGCERLKKLPSSSVENSGMLTHNFPQFPPNLEDIRLYGCKNLEVVSA  932
                        DL GC RL+++  S      +L HN       L  + L GC +L  +  
Sbjct  661   -----------DLEGCTRLREIHQS------LLRHN------KLILLNLKGCTSLTTLPG  697

Query  933   -TFPTSLEGIVLYGCTNLKTLLELPQNLQSLYVFNCESLETVHLP  1064
               F  SL+ +VL GC  L+ L  +  +++ L     +  +   LP
Sbjct  698   EIFMKSLKTLVLSGCLKLRKLPRVVGSMECLRELLLDETDIKKLP  742



>gb|AHG28995.1| NBS-LRR protein [Cicer arietinum]
Length=695

 Score = 91.3 bits (225),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 65/177 (37%), Positives = 93/177 (53%), Gaps = 24/177 (14%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETN------NAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMG  157
            FLD+ CF   I  + N      N  G F+ I I  +V++ L+     N   M+ L+ +MG
Sbjct  225  FLDIACFF--IGMDRNDVIHILNGCGFFAEIGISILVERSLVTVDDKNKLGMHDLLRDMG  282

Query  158  REIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN-SP------------MK  298
            REII  +SP +  +R RLW   DV DVL EQ G + +E +VL  +P            MK
Sbjct  283  REIIREKSPKELEKRCRLWFNEDVLDVLSEQTGTQAVEGVVLKLTPNAKCFSTKAFENMK  342

Query  299  NMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIK  469
             +   Q+  + L+G+FK+L R  LR L WN  P+  IP  +   KLV +++  SNIK
Sbjct  343  KLRLLQLAGVQLDGDFKYLSR-NLRWLCWNGFPLTCIPTKFDQGKLVSIELENSNIK  398



>ref|XP_007023140.1| Disease resistance protein [Theobroma cacao]
 gb|EOY25762.1| Disease resistance protein [Theobroma cacao]
Length=1501

 Score = 74.3 bits (181),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 83/160 (52%), Gaps = 19/160 (12%)
 Frame = +2

Query  50   NAMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGREIIHSESPNKSGERSRLWCPND  226
            +  G+ + I +  ++++ LI       WM+ L+ EMGR I+  +SPN+ G+R RL   +D
Sbjct  458  DGCGYRAGIGLPVLIERSLITVEDNKIWMHDLLQEMGRNIVRQKSPNEPGKRCRLSEESD  517

Query  227  VHDVLIEQKGMEKIEMIVLNSP-----------------MKNMEYNQIDEIHLEGNFKHL  355
            VH VL +  G E IE +V+NS                  MK +    + ++    +  +L
Sbjct  518  VHQVLTQNSGTEAIEGMVINSTIWEQKETFTLNADAFSKMKKLRLLMVHDLLKSCDLTYL  577

Query  356  PRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
              + LR L+W+  P+KS+P+ +  D LV L + +S I++ 
Sbjct  578  SNE-LRLLEWSGWPLKSLPWDFQPDNLVTLLLPDSCIQQL  616


 Score = 39.7 bits (91),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/193 (27%), Positives = 71/193 (37%), Gaps = 45/193 (23%)
 Frame = +3

Query  594   GFYLLNPLK*YFLCHESLDLGWCENLTRTPDFSGAKNLHKLSFYGSSLEKVHYSNIDLWM  773
             G  LLN LK        LDL     L RTPDF+  KNL  L                   
Sbjct  619   GDRLLNKLK-------FLDLQGSRKLIRTPDFTRIKNLESL-------------------  652

Query  774   QSKIDLWGCERLKKLPSSSVENSGMLTHNFPQFPPNLEDIRLYGCKNLEVVSATFPT-SL  950
                 +L GC  L            +  H    F P L+ + L  C +L  +S      SL
Sbjct  653   ----NLEGCTNL------------VHVHPSIAFLPKLKLLNLSNCVSLRSLSINNEMESL  696

Query  951   EGIVLYGCTNLKTLLELPQNLQSLYVFNCESLETVHLPKMLEYVKLTHCKKLKEIQGWEN  1130
             E ++L GC NLK + E+   ++ L   + +      LP  +  +       L      EN
Sbjct  697   ETLILSGCKNLKRISEITGKMKHLRDLHLDGTSVEELPSSVGNLSSLKVLNLSGCSVLEN  756

Query  1131  A--QFLTRIELRG  1163
             +   FL RI  +G
Sbjct  757   SPPSFLQRIYKKG  769



>ref|XP_010256441.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010256442.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nelumbo 
nucifera]
Length=1120

 Score = 91.7 bits (226),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 62/185 (34%), Positives = 94/185 (51%), Gaps = 21/185 (11%)
 Frame = +2

Query  2    FLDLVCFSHKIPEE----TNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF  +I +E      ++ G FS I I  +  + L+     N   M+ L+ +MGRE
Sbjct  462  FLDIACFFIRIEKEDVVTVLDSCGFFSEIGISVLARRSLLIIDEKNELRMHDLVRDMGRE  521

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKN  301
            I+  E+P +  ERSRLW   D   VL +  G  K+E + LN P              M N
Sbjct  522  IVREEAPKEPEERSRLWYHEDAFQVLTKHTGTRKVEGLALNFPKWEETHVGAKAFAKMHN  581

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFGV  481
            +   +++ +++EG F++LP K LR L W   P++SIP  +    LV L M  S IK+   
Sbjct  582  LRLLKVNYVNIEGGFEYLP-KELRWLYWFGFPLRSIPMEFNLQNLVVLDMQYSRIKKVWT  640

Query  482  PLKVI  496
              K++
Sbjct  641  ETKLL  645



>ref|XP_010256443.1| PREDICTED: TMV resistance protein N-like isoform X2 [Nelumbo 
nucifera]
Length=1116

 Score = 91.7 bits (226),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 62/185 (34%), Positives = 94/185 (51%), Gaps = 21/185 (11%)
 Frame = +2

Query  2    FLDLVCFSHKIPEE----TNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF  +I +E      ++ G FS I I  +  + L+     N   M+ L+ +MGRE
Sbjct  462  FLDIACFFIRIEKEDVVTVLDSCGFFSEIGISVLARRSLLIIDEKNELRMHDLVRDMGRE  521

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKN  301
            I+  E+P +  ERSRLW   D   VL +  G  K+E + LN P              M N
Sbjct  522  IVREEAPKEPEERSRLWYHEDAFQVLTKHTGTRKVEGLALNFPKWEETHVGAKAFAKMHN  581

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFGV  481
            +   +++ +++EG F++LP K LR L W   P++SIP  +    LV L M  S IK+   
Sbjct  582  LRLLKVNYVNIEGGFEYLP-KELRWLYWFGFPLRSIPMEFNLQNLVVLDMQYSRIKKVWT  640

Query  482  PLKVI  496
              K++
Sbjct  641  ETKLL  645



>ref|XP_011021443.1| PREDICTED: TMV resistance protein N-like [Populus euphratica]
Length=1349

 Score = 91.7 bits (226),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 68/190 (36%), Positives = 96/190 (51%), Gaps = 26/190 (14%)
 Frame = +2

Query  2    FLDLVCF--SHKIPEETN--NAMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGREI  166
            FLD+ CF    KI   T    + G  + I I  +++K LI+ S    WM+ L+  MG+EI
Sbjct  506  FLDIACFLMGFKIDRITRILESRGFHAGIGIPVLIEKSLISVSRDQVWMHHLLQIMGKEI  565

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKNM  304
            +  ESP + G RSRLW   DV   L++  G EKIE I L+ P              M  +
Sbjct  566  VRCESPEEPGRRSRLWTYEDVCLALMDSTGKEKIEAIFLDMPGIKEAQWNMKAFSKMSKL  625

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF---  475
               +ID + L    + L  K LR L+W+  P KS+P G   D+LV+L M  S+I++    
Sbjct  626  RLLKIDSVQLSEGPEDLSDK-LRFLEWHSYPSKSLPAGLQVDELVELHMANSSIEQLWYG  684

Query  476  ---GVPLKVI  496
                V LK+I
Sbjct  685  CKSAVNLKII  694



>ref|XP_003604607.1| TIR-NBS-LRR RCT1 resistance protein [Medicago truncatula]
 gb|KEH28850.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=936

 Score = 91.3 bits (225),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 60/178 (34%), Positives = 92/178 (52%), Gaps = 25/178 (14%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETN------NAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMG  157
            FLD+ CF   I  + N      N  G F+ I I  +V++ L+     N   M+ L+ +MG
Sbjct  465  FLDIACFF--IGMDRNDVIHILNGSGFFAEIGISVLVERSLVTVDDKNKLGMHDLLRDMG  522

Query  158  REIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------M  295
            REII  +SP +  ERSRLW  +DV DVL E  G + +E + L  P              M
Sbjct  523  REIIREKSPMEPEERSRLWFHDDVLDVLSEHTGTKAVEGLTLKMPCHSAQRFSTKTFENM  582

Query  296  KNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIK  469
            K +   Q+  + L+G+FK++ R  L+ L WN  P++ IP  ++   +V +++  SN K
Sbjct  583  KKLRLLQLSGVQLDGDFKYISRN-LKWLHWNGFPLRCIPSNFYQRNIVSIELENSNAK  639



>ref|XP_006466584.1| PREDICTED: TMV resistance protein N-like [Citrus sinensis]
Length=1225

 Score = 74.3 bits (181),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 52/180 (29%), Positives = 87/180 (48%), Gaps = 23/180 (13%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF    +     +     G F  I I  ++++ L+     N   M+ L+ E+G+ 
Sbjct  395  FLDVACFFKQKNRDYVTKILEGYGFFPVIGIEVLIERSLLTVDDCNTLGMHDLLQELGQL  454

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN----------------SPM  295
            I+  +S  + G+RSRLW   +V  VL +  G E +E ++++                S M
Sbjct  455  IVTRQSLEEPGKRSRLWRQEEVRHVLTKNAGSEVVEGMIIDDHFFPENEMHLSAKAFSLM  514

Query  296  KNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
             N+   +I  + L    ++L  K LR L W+Q P+KS+P     DK+V+ +M  S I+E 
Sbjct  515  TNLRLLKIGNVQLPKGLEYLSNK-LRLLVWHQYPLKSLPSNLQLDKIVEFEMCYSRIEEL  573


 Score = 39.3 bits (90),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 83/210 (40%), Gaps = 50/210 (24%)
 Frame = +3

Query  594   GFYLLNPLK*YFLCHESLDLGWCENLTRTPDFSGAKNLHKLSFYGSSLEKVHYSNIDLWM  773
             G   LN LK   L H        ENL +TP+F    NL  L                   
Sbjct  576   GIKPLNTLKVMKLSHS-------ENLIKTPNFIEVPNLEVL-------------------  609

Query  774   QSKIDLWGCERLKKLPSSSVENSGMLTHNFPQFPPNLEDIRLYGCKNLEVVSA-TFPTSL  950
                 DL GC RL+++ SS V ++ ++  N            L GC +L  +    F  SL
Sbjct  610   ----DLEGCTRLREIHSSLVRHNKLILLN------------LKGCTSLTTLPGEIFMKSL  653

Query  951   EGIVLYGCTNLKTLLELPQNLQSLYVFNCESLETVHLPKMLEYVK------LTHCKKLKE  1112
             + +VL GC  L+    +  +++ L     +  +   +P  +E++       L +CK L  
Sbjct  654   KTLVLSGCLKLRKFPHVGGSMECLQELFLDETDIKEMPLSIEHLSGLILLTLKYCKNLSS  713

Query  1113  IQ-GWENAQFLTRIELRGVPNNIKFSEIIN  1199
             +     + + L  ++L G     KF +I+ 
Sbjct  714   LPVTISSLKCLRNLKLSGCSKLKKFPQIVG  743



>gb|ABF81413.1| TIR-NBS-LRR type disease resistance protein [Populus trichocarpa]
Length=1152

 Score = 91.3 bits (225),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 65/191 (34%), Positives = 97/191 (51%), Gaps = 27/191 (14%)
 Frame = +2

Query  2    FLDLVCFS-----HKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGRE  163
            FLD+ CF       +I    +   G  + I I  ++++ LI+ S    WM++L+ +MG+E
Sbjct  419  FLDIACFLKGFKIDRITRILDGWRGFHTGIGIPVLIERSLISVSRDQVWMHNLLQKMGQE  478

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKN  301
            II  ESP++ G RSRLW   DV   L++  G EKIE I L+ P              M  
Sbjct  479  IIRRESPDEPGRRSRLWTYEDVCLALMDNTGKEKIEAIFLDMPGIKEAQWNMKAFSKMSR  538

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF--  475
            +   +ID + L    + L    LR L+W+  P KS+P G   D+LV+L M  SN+++   
Sbjct  539  LRLLKIDNMQLSEGPEDLS-NNLRFLEWHSYPSKSLPAGLQVDELVELHMANSNLEQLWY  597

Query  476  ----GVPLKVI  496
                 V LK+I
Sbjct  598  GCKSAVKLKII  608



>ref|XP_009622115.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nicotiana 
tomentosiformis]
Length=970

 Score = 91.3 bits (225),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 95/182 (52%), Gaps = 20/182 (11%)
 Frame = +2

Query  2    FLDLVCFSHKIPE----ETNNAMGHFSTIEIRNIVDKCLINYS-CFNWMYSLIPEMGREI  166
            FLD+ C  H   E    E  NA G  +   I  +V K L+     +  M+ L+ +MGREI
Sbjct  441  FLDIACAFHGFYEREVTEILNACGFHAKSAIATLVQKHLLQRDDLYLVMHDLVRDMGREI  500

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKNM  304
            +  ES     +RSRL+ P +V DVL   KG +K+E++ ++                M+N+
Sbjct  501  VRLESTRYPEKRSRLFIPQEVCDVLQGNKGSKKVEVLKVDRRAFKGVNLSTKAFKKMENL  560

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFGVP  484
                +DE+H+ G+F  L  K L+ L W +CP+  IP  +  + LV L M ES+I+EF + 
Sbjct  561  RVLIMDELHISGDFGMLS-KELKWLSWKKCPLNCIPSNFPAENLVVLDMQESDIQEFRLN  619

Query  485  LK  490
            L+
Sbjct  620  LQ  621


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 81/166 (49%), Gaps = 21/166 (13%)
 Frame = +3

Query  639   ESLDLGWCENLTRTPDFSGAKNLHKLSFYG-SSLEKVHYSNIDLWMQSKIDLWGCERLKK  815
             + LDL +C+ L  TPDF+G+ +L  L  YG SSL ++H S  +L    K+ + GCE+L  
Sbjct  627   KKLDLSYCKQLRSTPDFNGSLSLETLYLYGCSSLTEIHPSIGNLDRLIKLYMRGCEKLTD  686

Query  816   LPSSSVENSGMLTHNFPQ------FPPNLEDIR----LYGCKNLEVVSATFPTSLEGIVL  965
             LPSS  +   + + +          P NL D++    LY  +   +     P S+E +  
Sbjct  687   LPSSICQLISLDSLDIDDCSSIKILPDNLGDMKSLRSLYASR---MGIKQLPRSVEML--  741

Query  966   YGCTNLKTLLELPQNLQSLYVFNCESLETVH--LPKMLEYVKLTHC  1097
                 NL+TL    Q L++    +   +  +   LP  + Y+ LT+C
Sbjct  742   ---RNLRTLSAGGQKLEAKRSISGRGVHRIQYSLPTFVSYLSLTYC  784



>ref|XP_006388699.1| hypothetical protein POPTR_0117s002101g, partial [Populus trichocarpa]
 gb|ERP47613.1| hypothetical protein POPTR_0117s002101g, partial [Populus trichocarpa]
Length=754

 Score = 91.3 bits (225),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 65/191 (34%), Positives = 97/191 (51%), Gaps = 27/191 (14%)
 Frame = +2

Query  2    FLDLVCFS-----HKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGRE  163
            FLD+ CF       +I    +   G  + I I  ++++ LI+ S    WM++L+ +MG+E
Sbjct  97   FLDIACFLKGFKIDRITRILDGWRGFHTGIGIPVLIERSLISVSRDQVWMHNLLQKMGQE  156

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKN  301
            II  ESP++ G RSRLW   DV   L++  G EKIE I L+ P              M  
Sbjct  157  IIRRESPDEPGRRSRLWTYEDVCLALMDNTGKEKIEAIFLDMPGIKEAQWNMKAFSKMSR  216

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF--  475
            +   +ID + L    + L    LR L+W+  P KS+P G   D+LV+L M  SN+++   
Sbjct  217  LRLLKIDNMQLSEGPEDL-SNNLRFLEWHSYPSKSLPAGLQVDELVELHMANSNLEQLWY  275

Query  476  ----GVPLKVI  496
                 V LK+I
Sbjct  276  GCKSAVKLKII  286



>ref|XP_009363725.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=930

 Score = 91.3 bits (225),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 89/181 (49%), Gaps = 24/181 (13%)
 Frame = +2

Query  2    FLDLVCFSHKIPE----ETNNAMGHFSTIEIRNIVDKCLINYS--CFNWMYSLIPEMGRE  163
            FLD+ CF   + E    E  ++ G +  I IR ++D+ L+  +      M+ L+ EMGR+
Sbjct  439  FLDIACFFKGMREDYAIEILHSCGFYPDIGIRVLIDRALLTVTRNGVLEMHDLLEEMGRK  498

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVL---NSPMKNMEYNQIDEI--  328
            I+H ES  + G RSRLW   DVH V+ +  G E +E I+L   NS    +     D +  
Sbjct  499  IVHQESTKEPGRRSRLWSYEDVHHVITKNTGTETVESIILDLWNSDEGCLIVEAFDRMTK  558

Query  329  ------------HLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKE  472
                        HL G  K L  + LRCL W+  P+KS+P  + F+ LV L M  S I  
Sbjct  559  LRLLKISAHGIQHLTGPLKFLSSE-LRCLSWSGFPLKSLPSNFQFENLVGLDMQYSLIDR  617

Query  473  F  475
             
Sbjct  618  L  618


 Score = 57.0 bits (136),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 89/199 (45%), Gaps = 42/199 (21%)
 Frame = +3

Query  645   LDLGWCENLTRTPDFSGAKNLHKLSFYGS-SLEKVHYSNIDLWMQSKIDLWGCERLKKLP  821
             ++L +C+ L  TPDF+   NL +L      SL +VH S   L     +DL GC+ LK LP
Sbjct  631   INLSYCQCLKETPDFTNVPNLERLIVQSCISLVEVHLSISTLTNLVLLDLNGCKELKILP  690

Query  822   S-------SSVENSGMLT-HNFPQFPPNLEDIR--------------------------L  899
             S        + + SG  +   FP+    +E +                           L
Sbjct  691   SKIRMKSLKTFDLSGCSSLEMFPEISEGIEGLEELDLTGSKIKELPMSINNLTGLSHLNL  750

Query  900   YGCKNLEVV-SATFPTSLEGIVLYGCTNLKTLLELPQNLQSLYVFNCESLETVHLP----  1064
              GCK L+ + S+    SL+ I LYGC++L+   E+ + ++ L V +    +   LP    
Sbjct  751   LGCKKLKSLPSSIRMKSLKTINLYGCSSLEKFPEISEVIEGLKVLDLSRSKIKELPSSIN  810

Query  1065  --KMLEYVKLTHCKKLKEI  1115
               + L ++KL  CK+LK +
Sbjct  811   NLRGLNHLKLNSCKELKSL  829



>ref|XP_009622117.1| PREDICTED: TMV resistance protein N-like isoform X2 [Nicotiana 
tomentosiformis]
Length=966

 Score = 91.3 bits (225),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 95/182 (52%), Gaps = 20/182 (11%)
 Frame = +2

Query  2    FLDLVCFSHKIPE----ETNNAMGHFSTIEIRNIVDKCLINYS-CFNWMYSLIPEMGREI  166
            FLD+ C  H   E    E  NA G  +   I  +V K L+     +  M+ L+ +MGREI
Sbjct  441  FLDIACAFHGFYEREVTEILNACGFHAKSAIATLVQKHLLQRDDLYLVMHDLVRDMGREI  500

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKNM  304
            +  ES     +RSRL+ P +V DVL   KG +K+E++ ++                M+N+
Sbjct  501  VRLESTRYPEKRSRLFIPQEVCDVLQGNKGSKKVEVLKVDRRAFKGVNLSTKAFKKMENL  560

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFGVP  484
                +DE+H+ G+F  L  K L+ L W +CP+  IP  +  + LV L M ES+I+EF + 
Sbjct  561  RVLIMDELHISGDFGMLS-KELKWLSWKKCPLNCIPSNFPAENLVVLDMQESDIQEFRLN  619

Query  485  LK  490
            L+
Sbjct  620  LQ  621


 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 81/166 (49%), Gaps = 21/166 (13%)
 Frame = +3

Query  639   ESLDLGWCENLTRTPDFSGAKNLHKLSFYG-SSLEKVHYSNIDLWMQSKIDLWGCERLKK  815
             + LDL +C+ L  TPDF+G+ +L  L  YG SSL ++H S  +L    K+ + GCE+L  
Sbjct  627   KKLDLSYCKQLRSTPDFNGSLSLETLYLYGCSSLTEIHPSIGNLDRLIKLYMRGCEKLTD  686

Query  816   LPSSSVENSGMLTHNFPQ------FPPNLEDIR----LYGCKNLEVVSATFPTSLEGIVL  965
             LPSS  +   + + +          P NL D++    LY  +   +     P S+E +  
Sbjct  687   LPSSICQLISLDSLDIDDCSSIKILPDNLGDMKSLRSLYASR---MGIKQLPRSVEML--  741

Query  966   YGCTNLKTLLELPQNLQSLYVFNCESLETVH--LPKMLEYVKLTHC  1097
                 NL+TL    Q L++    +   +  +   LP  + Y+ LT+C
Sbjct  742   ---RNLRTLSAGGQKLEAKRSISGRGVHRIQYSLPTFVSYLSLTYC  784



>ref|XP_004506794.1| PREDICTED: TMV resistance protein N-like isoform X3 [Cicer arietinum]
Length=1020

 Score = 91.3 bits (225),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 65/177 (37%), Positives = 93/177 (53%), Gaps = 24/177 (14%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETN------NAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMG  157
            FLD+ CF   I  + N      N  G F+ I I  +V++ L+     N   M+ L+ +MG
Sbjct  526  FLDIACFF--IGMDRNDVIHILNGCGFFAEIGISILVERSLVTVDDKNKLGMHDLLRDMG  583

Query  158  REIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN-SP------------MK  298
            REII  +SP +  +R RLW   DV DVL EQ G + +E +VL  +P            MK
Sbjct  584  REIIREKSPKELEKRCRLWFNEDVLDVLSEQTGTQAVEGVVLKLTPNAKCFSTKAFENMK  643

Query  299  NMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIK  469
             +   Q+  + L+G+FK+L R  LR L WN  P+  IP  +   KLV +++  SNIK
Sbjct  644  KLRLLQLAGVQLDGDFKYLSR-NLRWLCWNGFPLTCIPTKFDQGKLVSIELENSNIK  699



>ref|XP_008350156.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=1272

 Score = 91.3 bits (225),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 94/179 (53%), Gaps = 24/179 (13%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETN-----NAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGR  160
            FLD+ CF  K+  +       ++ G  S I IR ++DK LI+ S +N  WM+ L+ EMG 
Sbjct  493  FLDIACF-FKLKNKARVTKILDSFGFHSDIGIRVLIDKSLISVS-YNMLWMHDLLQEMGW  550

Query  161  EIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMK  298
            EI+  ES  + G+RSRLW   DV+DVL+  KG E IE  VL               S M 
Sbjct  551  EIVRQESRKEPGKRSRLWLFEDVYDVLVNNKGTEVIEGXVLTSRADXEVHTSTEAFSKMN  610

Query  299  NMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
             +   ++  +HL     +L  + LR L+W+  P +S+P  +  +KL +L +  S I+E 
Sbjct  611  KLRMLKLGNVHLSEELTYLSNE-LRVLKWHGYPSRSLPSNFQPEKLFELSLCNSRIEEL  668



>ref|XP_010665467.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1134

 Score = 91.3 bits (225),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 98/197 (50%), Gaps = 40/197 (20%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETNNAM---GHFS-TIEIRNIVDKCLINYSC-FNWMYSLIPEMGREI  166
            FLD+ CF    P++ +  +    HF   + +R + DKCLI  S  F WM+ L+ EMGREI
Sbjct  443  FLDIACFFKGQPKDISTRILYACHFHPEVGMRVLSDKCLITLSGRFIWMHDLLQEMGREI  502

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQ--KGMEKIEMIVLNSPM---------------  295
            +   SP + G+ SRLW P D++ VL      G + IE I+L+  M               
Sbjct  503  VRQTSPKEPGKWSRLWDPEDIYRVLTRNTVSGTKTIEGIILDLNMPKSKQIEFTAEAFKM  562

Query  296  ----------KNMEYNQID-------EIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYF  424
                      ++ EY   +       ++H  G+F+  P   LR LQW+  P++S+P  + 
Sbjct  563  MKELRLLKVHQDAEYAGTEGQAVTAPKVHFSGDFE-FPSYELRYLQWDGYPLESLPSNFH  621

Query  425  FDKLVKLKMWESNIKEF  475
             ++LV+LK   SNIK+ 
Sbjct  622  GEELVELKFRSSNIKQL  638



>gb|ACF19650.1| TIR-NBS-LRR RCT1 resistance protein [Medicago truncatula]
Length=1098

 Score = 91.3 bits (225),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 60/178 (34%), Positives = 92/178 (52%), Gaps = 25/178 (14%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETN------NAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMG  157
            FLD+ CF   I  + N      N  G F+ I I  +V++ L+     N   M+ L+ +MG
Sbjct  465  FLDIACFF--IGMDRNDVIHILNGSGFFAEIGISVLVERSLVTVDDKNKLGMHDLLRDMG  522

Query  158  REIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------M  295
            REII  +SP +  ERSRLW  +DV DVL E  G + +E + L  P              M
Sbjct  523  REIIREKSPMEPEERSRLWFHDDVLDVLSEHTGTKAVEGLTLKMPCHSAQRFSTKTFENM  582

Query  296  KNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIK  469
            K +   Q+  + L+G+FK++ R  L+ L WN  P++ IP  ++   +V +++  SN K
Sbjct  583  KKLRLLQLSGVQLDGDFKYISRN-LKWLHWNGFPLRCIPSNFYQRNIVSIELENSNAK  639



>ref|XP_008347889.1| PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1-like 
[Malus domestica]
Length=1043

 Score = 90.9 bits (224),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 64/185 (35%), Positives = 89/185 (48%), Gaps = 31/185 (17%)
 Frame = +2

Query  2    FLDLVCFSHKIPE----ETNNAMGHFSTIEIRNIVDKCLINYSCFNW-----MYSLIPEM  154
            FLD+ CF   + +    E  +  G +    IR ++D+ LI  S   W     M+  + EM
Sbjct  441  FLDIACFFKGMQKNYAIEIMDGCGFYPHSGIRVLIDRALIXVS---WRGXLEMHDSLQEM  497

Query  155  GREIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSPMK-----NMEY---  310
            GREI+  ES  + G RSRLW   DVH VL +  G E +E I+L+  +      N E    
Sbjct  498  GREIVRQESIKEPGRRSRLWSYGDVHHVLTQNTGTEAVESIILDLSISDEVCLNAEAFDX  557

Query  311  ----------NQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWES  460
                      +  D+ HL G  K L R+ LRCL W+  P+KS+P  + F  LV L M  S
Sbjct  558  MXQLRLLRXSHSYDKQHLIGXLKFLSRE-LRCLYWHGSPLKSLPSNFQFKNLVDLDMQYS  616

Query  461  NIKEF  475
             I+  
Sbjct  617  RIERL  621



>gb|KDO51243.1| hypothetical protein CISIN_1g0443021mg, partial [Citrus sinensis]
Length=481

 Score = 73.6 bits (179),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 52/180 (29%), Positives = 87/180 (48%), Gaps = 23/180 (13%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF    +     +     G F  I I  ++++ L+     N   M+ L+ E+G+ 
Sbjct  19   FLDVACFFKQKNRDYVTKILEGYGFFPVIGIEVLIERSLLTVDDCNTLGMHDLLQELGQL  78

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN----------------SPM  295
            I+  +S  + G+RSRLW   +V  VL +  G E +E ++++                S M
Sbjct  79   IVTRQSLEEPGKRSRLWRQEEVRHVLTKNAGSEVVEGMIIDDHFFPENEMHLSAKAFSLM  138

Query  296  KNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
             N+   +I  + L    ++L  K LR L W+Q P+KS+P     DK+V+ +M  S I+E 
Sbjct  139  TNLRLLKIGNVQLPKGLEYLSNK-LRLLVWHQYPLKSLPSNLQLDKIVEFEMCYSRIEEL  197


 Score = 39.7 bits (91),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 83/210 (40%), Gaps = 50/210 (24%)
 Frame = +3

Query  594   GFYLLNPLK*YFLCHESLDLGWCENLTRTPDFSGAKNLHKLSFYGSSLEKVHYSNIDLWM  773
             G   LN LK   L H        ENL +TP+F    NL  L                   
Sbjct  200   GIKPLNTLKVMKLSHS-------ENLIKTPNFIEVPNLEVL-------------------  233

Query  774   QSKIDLWGCERLKKLPSSSVENSGMLTHNFPQFPPNLEDIRLYGCKNLEVVSA-TFPTSL  950
                 DL GC RL+++ SS V ++ ++  N            L GC +L  +    F  SL
Sbjct  234   ----DLEGCTRLREIHSSLVRHNKLILLN------------LKGCTSLTTLPGEIFMKSL  277

Query  951   EGIVLYGCTNLKTLLELPQNLQSLYVFNCESLETVHLPKMLEYVK------LTHCKKLKE  1112
             + +VL GC  L+    +  +++ L     +  +   +P  +E++       L +CK L  
Sbjct  278   KTLVLSGCLKLRKFPHVGGSMECLQELFLDETDIKEMPLSIEHLSGLILLTLKYCKNLSS  337

Query  1113  IQ-GWENAQFLTRIELRGVPNNIKFSEIIN  1199
             +     + + L  ++L G     KF +I+ 
Sbjct  338   LPVTISSLKCLRTLKLSGCSKLKKFPQIVG  367



>gb|AES86804.2| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=1098

 Score = 90.9 bits (224),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 60/178 (34%), Positives = 92/178 (52%), Gaps = 25/178 (14%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETN------NAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMG  157
            FLD+ CF   I  + N      N  G F+ I I  +V++ L+     N   M+ L+ +MG
Sbjct  465  FLDIACFF--IGMDRNDVIHILNGSGFFAEIGISVLVERSLVTVDDKNKLGMHDLLRDMG  522

Query  158  REIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------M  295
            REII  +SP +  ERSRLW  +DV DVL E  G + +E + L  P              M
Sbjct  523  REIIREKSPMEPEERSRLWFHDDVLDVLSEHTGTKAVEGLTLKMPCHSAQRFSTKTFENM  582

Query  296  KNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIK  469
            K +   Q+  + L+G+FK++ R  L+ L WN  P++ IP  ++   +V +++  SN K
Sbjct  583  KKLRLLQLSGVQLDGDFKYISRN-LKWLHWNGFPLRCIPSNFYQRNIVSIELENSNAK  639



>ref|XP_004506792.1| PREDICTED: TMV resistance protein N-like isoform X1 [Cicer arietinum]
 ref|XP_004506793.1| PREDICTED: TMV resistance protein N-like isoform X2 [Cicer arietinum]
Length=1159

 Score = 90.9 bits (224),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 65/177 (37%), Positives = 93/177 (53%), Gaps = 24/177 (14%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETN------NAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMG  157
            FLD+ CF   I  + N      N  G F+ I I  +V++ L+     N   M+ L+ +MG
Sbjct  526  FLDIACFF--IGMDRNDVIHILNGCGFFAEIGISILVERSLVTVDDKNKLGMHDLLRDMG  583

Query  158  REIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN-SP------------MK  298
            REII  +SP +  +R RLW   DV DVL EQ G + +E +VL  +P            MK
Sbjct  584  REIIREKSPKELEKRCRLWFNEDVLDVLSEQTGTQAVEGVVLKLTPNAKCFSTKAFENMK  643

Query  299  NMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIK  469
             +   Q+  + L+G+FK+L R  LR L WN  P+  IP  +   KLV +++  SNIK
Sbjct  644  KLRLLQLAGVQLDGDFKYLSR-NLRWLCWNGFPLTCIPTKFDQGKLVSIELENSNIK  699



>ref|XP_010263414.1| PREDICTED: TMV resistance protein N-like [Nelumbo nucifera]
Length=1134

 Score = 90.9 bits (224),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 64/185 (35%), Positives = 92/185 (50%), Gaps = 27/185 (15%)
 Frame = +2

Query  2    FLDLVCF------SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMG  157
            FLD+ CF       H I     +  G FS   I +++ K L+     N   M+  I +MG
Sbjct  445  FLDIACFFIGMDRDHVI--RILDGCGFFSETGINDLIRKSLLKVGENNELRMHDQIRDMG  502

Query  158  REIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN------------SPMKN  301
            REII  +SP + G RSRLW   DVH VL +  G E +E ++L+              M N
Sbjct  503  REIIREKSPKEPGSRSRLWYHEDVHHVLTQHSGTEAVEGLILSKIIDETLSTKAFEKMHN  562

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNI----K  469
            +   Q++ IHL+G++++ P K LR L W+  P++ IP     + LV L M  S +    K
Sbjct  563  LRLLQLNHIHLKGSYEYFP-KNLRWLCWHGFPLRYIPTNIHLESLVILDMQYSKMEQVWK  621

Query  470  EFGVP  484
            E  VP
Sbjct  622  EIKVP  626


 Score = 52.0 bits (123),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 77/273 (28%), Positives = 114/273 (42%), Gaps = 58/273 (21%)
 Frame = +3

Query  624   YFLCHESLDLGWCENLTRTPDFSGAKNLHKLSFYGSSLEKVH-----YSNIDLWMQSKID  788
             Y    E LDL  C NL  +   S   NL       SSL+ +H     +SN+   M     
Sbjct  748   YLSSLERLDLSHC-NLPESAIPSDLGNL-------SSLKVLHLSYNNFSNLPASMN----  795

Query  789   LWGCERLKKLPSSSVENSGMLTHNFPQFPPNLEDIRLYGCKNLEVVSATFP-TSLEGIVL  965
                  RL +L    +EN   L  + P+ PP+L+ +   GC +LE +S     TSL  + L
Sbjct  796   -----RLSQLKEIFLENCRRL-QSIPELPPSLQLLNANGCTSLETISNLGSLTSLTTLRL  849

Query  966   ----------------------YGCTNLKTLLELPQNLQSLYVFNCESLETVHLPKMLEY  1079
                                     C  L+TLL LP  L  L +  C S+E ++L  +   
Sbjct  850   CKTSIYNLPSIAQLSHLGYLEIKECPKLQTLLGLPSYLLRLNLEGCTSIERLNLSNLRLL  909

Query  1080  VK--LTHCKKLKEIQGWENAQFLTRIELRGVPNNIKFSEIINKVLKVSK---------LN  1226
                 +T+C +L EIQ     +  +R+ + G  NN+ FS   N +  +           L 
Sbjct  910   SDFYVTNCTELAEIQLPATLEH-SRVIVVGGCNNLSFSSRNNLLSLLQGQRQQQRFDVLF  968

Query  1227  SNIEFEGYLPNNETLSWIKFEENGSSISFQWPP  1325
                 F+ +LP +E    IK++  GS ISF+ PP
Sbjct  969   PQKRFDIFLPGSEIPEGIKYQSMGSVISFEVPP  1001



>gb|KEH15880.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=1117

 Score = 90.9 bits (224),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 85/177 (48%), Gaps = 21/177 (12%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF          E  N  G F+ I I  ++++ L+     N   M+ LI +MGRE
Sbjct  416  FLDVCCFFIGKDKDYVTEILNGCGLFADIGIAVLIERSLLKVEKNNKLGMHDLIRDMGRE  475

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKN  301
            I+   S    GERSRLW   D HDVL    G +K+E ++LN                M+N
Sbjct  476  IVRGSSIKDPGERSRLWFHEDAHDVLTNNTGTQKVEGLILNLQIKGKDSFSTNVFQQMQN  535

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKE  472
            M   Q+D + L G F HL  K LR + W +     IP  +    LV L++  SN+K+
Sbjct  536  MRLLQLDCVDLTGEFAHLS-KQLRWVNWQRSTFSCIPNDFHQGNLVVLELKFSNVKQ  591



>gb|KCW57074.1| hypothetical protein EUGRSUZ_I02727 [Eucalyptus grandis]
Length=1116

 Score = 90.9 bits (224),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 65/183 (36%), Positives = 91/183 (50%), Gaps = 20/183 (11%)
 Frame = +2

Query  2    FLDLVCFSHKIPEE----TNNAMGHFSTIEIRNIVDKCLINYSCFNW-MYSLIPEMGREI  166
            FLD+ CF +   ++      +A   F  I IR ++DK LI+       M+ L+ EMGREI
Sbjct  434  FLDIACFFNGADQDYVMKVFDACNFFPDIGIRVLLDKSLISIELNKLSMHDLLREMGREI  493

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMI----------VLNSP----MKNM  304
            +  ESPN  GERSRLW   D+ DVL E  G  K+E I           LN+     M+ +
Sbjct  494  VRKESPNNPGERSRLWYSEDIIDVLTENLGTNKVEAIKLVLAGTEEVYLNAKAFKRMRRL  553

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFGVP  484
                I   ++ G+F +L    LR + W   P+ S+P  +   KLV L M  S IK+ G  
Sbjct  554  RVLIIHNAYVSGDFNYLS-NNLRWIDWEGYPLPSLPANFHPKKLVGLFMPHSYIKDLGQG  612

Query  485  LKV  493
             K+
Sbjct  613  YKI  615



>gb|KEH25086.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=1085

 Score = 90.9 bits (224),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 62/189 (33%), Positives = 96/189 (51%), Gaps = 32/189 (17%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETN------NAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMG  157
            FLD+ CF   I  + N      N    F+ I +  +V++ L+     N   M+ L+ +MG
Sbjct  476  FLDIACFF--IGMDRNDVIHILNGSEFFAEIGVSVLVERSLVTVDDRNKLQMHDLLRDMG  533

Query  158  REIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------M  295
            REI+  +SP +  ERSRLW   DV DVL E+ G + +E + L  P              M
Sbjct  534  REIVREKSPKEPEERSRLWFNKDVIDVLSEKTGTKAVEGLALKLPTANGKCFSTKAFKEM  593

Query  296  KNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
            K +   Q+  + LEG+F++L R  L  L WN  P+K IP  ++ + LV +++  SN+   
Sbjct  594  KKLRLLQLASVQLEGDFEYLSR-NLIWLSWNGFPLKCIPSSFYQENLVSIELVNSNV---  649

Query  476  GVPLKVIWQ  502
                KV+W+
Sbjct  650  ----KVVWK  654



>ref|XP_009343054.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=1239

 Score = 90.9 bits (224),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 94/178 (53%), Gaps = 22/178 (12%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF    +     +  ++ G  S I IR + DK LI+ S +N  WM+ L+ EMG E
Sbjct  438  FLDIACFFKWKNKARVTKILDSFGFHSDIGIRVLSDKSLISVS-YNMLWMHDLLQEMGWE  496

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKN  301
            I+  ES ++ G+RSRLW   DV+DVL+  KG E +E +VL               S M  
Sbjct  497  IVRQESRSEPGKRSRLWLFEDVYDVLVNNKGTEVVEGLVLTSRADEEVHTSTEAFSKMNK  556

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
            +   ++  +HL     +L  + LR L+W+  P +S+P  +  +KL +L +  S I+E 
Sbjct  557  LRMLKLGNVHLSEELTYLSNE-LRVLKWHGYPSRSLPSNFRPEKLFELSLCNSRIEEL  613



>gb|KEH24922.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=780

 Score = 78.2 bits (191),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 63/198 (32%), Positives = 91/198 (46%), Gaps = 25/198 (13%)
 Frame = +2

Query  2    FLDLVCFSHKIP-EETNNAMGHFSTIEIRN----IVDKCLINY--SCFNWMYSLIPEMGR  160
            FLD+ CF      EE  + +    T  I+N    +V+K LI     C   ++ LI EMG+
Sbjct  305  FLDIACFFKGCRLEEFQDILDAHYTYCIKNHIGVLVEKSLIKIIGGCVT-LHDLIEEMGK  363

Query  161  EIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN----------------SP  292
            EI+  ESP + G+RSRLW   D+  VL    G  KIE++ LN                  
Sbjct  364  EIVRQESPKEPGKRSRLWSHEDIVPVLHANSGTRKIEILYLNFSLSKEEEVEWKGDELKK  423

Query  293  MKNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKE  472
            M+N+    I         +HLP   LR L W + P +++P  +F  KL   ++ ES++  
Sbjct  424  MENLRTIIIRNCPFSKGCQHLP-NGLRVLDWPKYPSENLPSDFFPRKLSICRLRESSLTT  482

Query  473  FGVPLKVIWQYFFKFNSS  526
            F  P        F F+SS
Sbjct  483  FEFPSSSKVGVMFSFSSS  500


 Score = 34.7 bits (78),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 51/115 (44%), Gaps = 9/115 (8%)
 Frame = +3

Query  567  IQKFLICFYGFYLLNPLK*YFLCHESLDLGWCENLTRTPDFSGAKNLHKLSFYG-SSLEK  743
            I  F      FY L      FLC   L+L   ++LT+  D SG  NL  LSF   S+L  
Sbjct  509  ITHFFSSLSLFYFLQK----FLCMRELNLDHNQSLTQILDISGLLNLEILSFRDCSNLIT  564

Query  744  VHYSNIDLWMQSKIDLWGCERLKKLPSSSVEN--SGMLTH--NFPQFPPNLEDIR  896
            +H S   L     +++ GC +L   P   + +     L+H  N   FP  L D++
Sbjct  565  IHNSIGFLNKLKILNVTGCSKLSSFPPIKLTSLLKLELSHCNNLKSFPEILGDMK  619



>gb|KEH25117.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=951

 Score = 90.9 bits (224),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 89/180 (49%), Gaps = 25/180 (14%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETN------NAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMG  157
            FLD+ CF   I +E N      N    F+   IR +V++ L+     N   M+ L+ +MG
Sbjct  441  FLDIACFF--IGKERNDVIHILNGCRLFAEDGIRVLVERSLVYIDDDNKLGMHDLLRDMG  498

Query  158  REIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------M  295
            REII +  P    E SRLW P DV  VL  Q G + IE + L  P              M
Sbjct  499  REIICNNPPKDPEEHSRLWLPEDVDGVLARQTGTKAIEGLTLKLPRDSAKCYSTVAFKKM  558

Query  296  KNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
            K +   ++  + L+GNF+HL R  LR L WN  P+  IP  ++   LV +++  SN+K+ 
Sbjct  559  KKLRLLELAGVQLDGNFEHLSR-NLRWLSWNGFPLSCIPTNFYQANLVSIELENSNVKDL  617



>ref|XP_010030110.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=1151

 Score = 90.9 bits (224),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 65/183 (36%), Positives = 91/183 (50%), Gaps = 20/183 (11%)
 Frame = +2

Query  2    FLDLVCFSHKIPEE----TNNAMGHFSTIEIRNIVDKCLINYSCFNW-MYSLIPEMGREI  166
            FLD+ CF +   ++      +A   F  I IR ++DK LI+       M+ L+ EMGREI
Sbjct  434  FLDIACFFNGADQDYVMKVFDACNFFPDIGIRVLLDKSLISIELNKLSMHDLLREMGREI  493

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMI----------VLNSP----MKNM  304
            +  ESPN  GERSRLW   D+ DVL E  G  K+E I           LN+     M+ +
Sbjct  494  VRKESPNNPGERSRLWYSEDIIDVLTENLGTNKVEAIKLVLAGTEEVYLNAKAFKRMRRL  553

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFGVP  484
                I   ++ G+F +L    LR + W   P+ S+P  +   KLV L M  S IK+ G  
Sbjct  554  RVLIIHNAYVSGDFNYLS-NNLRWIDWEGYPLPSLPANFHPKKLVGLFMPHSYIKDLGQG  612

Query  485  LKV  493
             K+
Sbjct  613  YKI  615



>gb|ABC55465.1| TIR-NBS disease resistance-like protein [(Populus tomentosa x 
Populus bolleana) x Populus tomentosa var. truncata]
 gb|ABC55466.1| TIR-NBS disease resistance-like protein [(Populus tomentosa x 
Populus bolleana) x Populus tomentosa var. truncata]
Length=642

 Score = 90.1 bits (222),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 91/179 (51%), Gaps = 22/179 (12%)
 Frame = +2

Query  2    FLDLVCF-----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGR  160
            FLD+ CF        + +      G+   +++  + ++ LI  + F    M+ L+ +MGR
Sbjct  440  FLDIACFFIDRKKEYVAKVLGARCGYNPEVDLETLRERSLIKVNGFGKITMHDLLRDMGR  499

Query  161  EIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMK  298
            EI+   SP + G+R+R+W   D  +VL +QKG + +E + L+              + MK
Sbjct  500  EIVRESSPKEPGKRTRIWNQEDAWNVLEQQKGTDVVEGLTLDVRASEAKSLSTRSFAKMK  559

Query  299  NMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
             +   QI+ +HL G+FK L  K L  + W QCP+K +P  +  D LV L    SN+KE 
Sbjct  560  CLNLLQINGVHLTGSFKLLS-KELMWICWLQCPLKYLPSDFILDNLVVLDTQYSNLKEL  617



>ref|XP_006387517.1| hypothetical protein POPTR_0907s00010g [Populus trichocarpa]
 gb|ERP46431.1| hypothetical protein POPTR_0907s00010g [Populus trichocarpa]
Length=767

 Score = 90.1 bits (222),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 66/190 (35%), Positives = 97/190 (51%), Gaps = 26/190 (14%)
 Frame = +2

Query  2    FLDLVCF--SHKIPEETN--NAMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGREI  166
            FLD+ CF    KI   T    + G  + I I  ++++ LI+ S    WM++L+  MG+EI
Sbjct  259  FLDIACFLMGFKIDRITRILESRGFHAGIGIPVLIERSLISVSRDQVWMHNLLQIMGKEI  318

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKNM  304
            +  ESP + G RSRLW   DV   L++  G EKIE I L+ P              M  +
Sbjct  319  VRCESPEEPGRRSRLWTYEDVCLALMDNTGKEKIEAIFLDMPGIKEAQWNMKAFSKMTKL  378

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF---  475
               +I+ + L    + L  K LR L+W+  P KS+P G   D+LV+L M  S+I++    
Sbjct  379  RLLKINNVQLSEGLEDLSNK-LRFLEWHSYPSKSLPAGLQVDELVELHMANSSIEQLWYG  437

Query  476  ---GVPLKVI  496
                V LK+I
Sbjct  438  CKSAVNLKII  447



>ref|XP_008375888.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=1213

 Score = 90.5 bits (223),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 59/179 (33%), Positives = 94/179 (53%), Gaps = 23/179 (13%)
 Frame = +2

Query  2    FLDLVCF-----SHKIPEETNNAMGHFSTIEIRNIVDKCLIN-YSCFNWMYSLIPEMGRE  163
            FLD+ CF      + I     +  GH   I    + +KCL+  +    WM+ LI ++G E
Sbjct  441  FLDIACFFKGEDKYHITRILESRYGHCPIIHFIVLTEKCLLTTFGRKLWMHDLIEQLGWE  500

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN---------------SPMK  298
            I+  E P ++G+RSRLW P D+  +L+  +G   ++ + LN               S MK
Sbjct  501  IVSREHP-EAGKRSRLWLPKDIVPLLVHNRGTTSVQGVFLNFEKEKEIKLRVNDPFSEMK  559

Query  299  NMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
             ++Y +I   +   N K+L  + L  L+W++CP+ S+P G+  DKLV+LKM  S IK+ 
Sbjct  560  KLKYLKIWNGNFSVNTKYLSNE-LALLEWHECPLNSLPSGFESDKLVELKMNSSCIKQL  617



>ref|XP_006576565.1| PREDICTED: TMV resistance protein N-like [Glycine max]
Length=1127

 Score = 90.1 bits (222),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/178 (35%), Positives = 93/178 (52%), Gaps = 25/178 (14%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETN------NAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMG  157
            FLD+ CF   I  + N      N  G F+   IR +V++ L+     N   M+ L+ +MG
Sbjct  490  FLDIACFF--IGMDRNDVICILNGCGLFAEHGIRVLVERSLVTVDDKNKLGMHDLLRDMG  547

Query  158  REIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------M  295
            REII ++SP +  ERSRLW   DV DVL ++ G + +E + L  P              M
Sbjct  548  REIIRAKSPKEPEERSRLWFHEDVLDVLSKETGTKAVEGLTLMLPRTNTKCLSTTAFKKM  607

Query  296  KNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIK  469
            K +   Q+  + L G+FK+L R  LR L W+  P+K IP  ++   LV +++  SN+K
Sbjct  608  KKLRLLQLAGVQLAGDFKNLSRD-LRWLCWHGFPLKCIPTDFYQGSLVSIELENSNVK  664



>ref|XP_006441719.1| hypothetical protein CICLE_v10018572mg [Citrus clementina]
 gb|ESR54959.1| hypothetical protein CICLE_v10018572mg [Citrus clementina]
Length=1173

 Score = 74.7 bits (182),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/196 (30%), Positives = 92/196 (47%), Gaps = 31/196 (16%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF          +  +       I I  +++K LI     N  WM+ L+ E+G++
Sbjct  441  FLDVACFFNLEDRDYVTKVLDGCDFSPVIGIEVLINKSLITILNDNTLWMHDLLQELGQQ  500

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN-----------------SP  292
            I+  +SP + G+RSRLW   +V  VLIE  G E +E IV++                 S 
Sbjct  501  IVQRQSPEEPGKRSRLWKEEEVCHVLIENTGSEIVEGIVIDHCSPNKEVHLSAPSKAFSK  560

Query  293  MKNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKE  472
            M N+   +I  + L    ++L  K L+ L+W+  P++S+P     DK  +L M  S I+E
Sbjct  561  MINLRLLKIRNVQLPEGLEYLSNK-LKLLEWHGYPLESLPSNLQLDKTFELNMCYSLIEE  619

Query  473  FGVPLKVIWQYFFKFN  520
                   +W+ F   N
Sbjct  620  -------LWKGFKPLN  628


 Score = 37.4 bits (85),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 64/162 (40%), Gaps = 43/162 (27%)
 Frame = +3

Query  594   GFYLLNPLK*YFLCHESLDLGWCENLTRTPDFSGAKNLHKLSFYGSSLEKVHYSNIDLWM  773
             GF  LN LK   L H        ++L +TPDF+G  NL +L                   
Sbjct  623   GFKPLNKLKVMKLSHS-------QHLIKTPDFTGVPNLEELI------------------  657

Query  774   QSKIDLWGCERLKKLPSSSVENSGMLTHNFPQFPPNLEDIRLYGCKNLEVVSA-TFPTSL  950
                  L GC RL ++  S V +  ++T N            L  C +L  +    F  SL
Sbjct  658   -----LEGCTRLHEIHPSLVLHKKVITLN------------LKDCTSLTTLPGNVFMKSL  700

Query  951   EGIVLYGCTNLKTLLELPQNLQSLYVFNCESLETVHLPKMLE  1076
             + +VL GC+ L    E+ ++++ L     +      +P  +E
Sbjct  701   KTLVLSGCSKLIKFPEILRSMEDLSELFLDGTSITEVPSSIE  742



>gb|KDP26071.1| hypothetical protein JCGZ_21104 [Jatropha curcas]
Length=1112

 Score = 90.1 bits (222),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/186 (34%), Positives = 97/186 (52%), Gaps = 29/186 (16%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFN---WMYSLIPEMGR  160
            FLD+ CF         +   N  G F+ I IR ++DK LI  S  N    M+ L+ +MGR
Sbjct  434  FLDIACFFKGEDRTRVQRILNGCGFFADIGIRCLLDKSLITVSSDNNKLGMHDLLQQMGR  493

Query  161  EIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN-SPMKNME----------  307
             I+  E  ++ GERSRLW P DV+ VL  +KG   +E I L+ S ++++E          
Sbjct  494  NIVCLECIHQPGERSRLWIPEDVYLVLTREKGTGNVEGISLDKSKIRDIELSPTVFESMY  553

Query  308  ----------YNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWE  457
                      +    +I+L    + LP + LR L W++ P+KS+P  +  +KL++L+M E
Sbjct  554  NLRLLEFHNPFTSEVKIYLPKGLQFLPNE-LRFLCWDKYPLKSLPPSFCAEKLMELRMPE  612

Query  458  SNIKEF  475
            S +KE 
Sbjct  613  SQLKEL  618



>ref|XP_010263365.1| PREDICTED: TMV resistance protein N-like [Nelumbo nucifera]
Length=893

 Score = 89.7 bits (221),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/196 (31%), Positives = 101/196 (52%), Gaps = 32/196 (16%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETN----NAMGHFSTIEIRNIVDKCLINYSCFN---WMYSLIPEMGR  160
            FLD+ CF + + ++      +A G +  I I  +  K L+    +N    M++L+ +MGR
Sbjct  450  FLDISCFFNGMDKDYATIILDACGFYPKIGISVLTSKSLVRIDGYNNKLRMHNLLQDMGR  509

Query  161  EIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP----------------  292
            E++  ESP + G RSRLW  +D +DV+ + +G ++IE ++L  P                
Sbjct  510  EVVRGESPQEPGRRSRLWSWDDAYDVMTKHEGTKRIEGLILEPPEGHKCFGEPLLLSTEA  569

Query  293  ---MKNMEYNQIDEIHLEG-NFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWES  460
               M N+   ++  + L G ++++L  K LR L W  CP+KSIP  +    LV L+M  S
Sbjct  570  FKRMSNLRLLKLQNVTLVGRSYRYLSEK-LRWLCWPFCPLKSIPVDFRLSHLVVLEMKSS  628

Query  461  NIKEFGV----PLKVI  496
             +++  V    PL V+
Sbjct  629  RLQQVWVEGMQPLSVL  644



>ref|XP_008237532.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=682

 Score = 89.7 bits (221),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 94/194 (48%), Gaps = 25/194 (13%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYS-CFNWMYSLIPEMGREI  166
            FLD+ CF    S     E   A    +   I  +V+K LI+    + WM+ L+ EMG++I
Sbjct  245  FLDIACFFKGKSKMHVTEILVACDPEAGYSIEVLVEKALISVERGYIWMHDLLEEMGKDI  304

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP---------------MKN  301
            +  ESP++ G RSRLW   D+  VL    G +KI  I+LNSP               MKN
Sbjct  305  VQQESPDELGGRSRLWSHEDIEHVLTNDTGTKKITGIMLNSPKKDYEIFLNVDCFSKMKN  364

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFGV  481
            ++      + L G+  +LP   LR L W +CP++S P  +    L  L +  S IK+ G 
Sbjct  365  LKIFMNYNVRLYGDIGYLP-NMLRVLDWYRCPLQSFPPKFHPKGLGLLNLPYSRIKQLGE  423

Query  482  PLKVIWQYFFKFNS  523
             LK    +F K  S
Sbjct  424  GLK----HFTKLTS  433



>ref|XP_004489499.1| PREDICTED: TMV resistance protein N-like [Cicer arietinum]
Length=715

 Score = 89.7 bits (221),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 91/178 (51%), Gaps = 25/178 (14%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETN------NAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMG  157
            FLD+ CF   I  + N      N  G ++   I+ +V++ L+     N   M+ L+ +MG
Sbjct  123  FLDIACFF--IGMDRNDVIHILNGCGLYAEFGIKVLVERSLVTVDDKNKLGMHDLLRDMG  180

Query  158  REIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------M  295
            REII  ESP    +RSRLW   DV +VL  Q G   +E + L  P              M
Sbjct  181  REIIRKESPKAPEKRSRLWFSKDVQNVLSRQTGTNVVEGLTLMLPRTNAKCFSTKAFKEM  240

Query  296  KNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIK  469
             ++   Q+  + L+G+FKHL  + LR L WN   + SIP  ++ +KLV +++  SNIK
Sbjct  241  TSLRLLQLAGVQLDGDFKHL-FENLRWLSWNGFSLTSIPTHFYQEKLVSIELENSNIK  297



>ref|XP_003604566.1| Disease resistance protein [Medicago truncatula]
Length=1161

 Score = 89.7 bits (221),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 90/178 (51%), Gaps = 25/178 (14%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETN------NAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMG  157
            FLD+ CF   I  + N      N  G F+ I I  +V++ L+     N   M+ L+ +MG
Sbjct  528  FLDIACF--LIGMDRNDVILILNGCGLFAEIGISVLVERSLVTVDDKNKLGMHDLLRDMG  585

Query  158  REIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------M  295
            REII  +SP +  ERSRLW   DV D+L E  G + +E + L  P              M
Sbjct  586  REIIREKSPMEPEERSRLWYHEDVIDILSEHTGTKAVEGLTLKLPGRSAQRFSTEAFKKM  645

Query  296  KNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIK  469
            K +   Q+    L+G+FK+L  K LR L WN  P+  IP  ++   +V +++  SN+K
Sbjct  646  KKLRLLQLSGAQLDGDFKYLS-KQLRWLHWNGFPLTCIPSNFYQRNIVSIELENSNVK  702



>gb|KEH24919.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=1205

 Score = 78.2 bits (191),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/198 (32%), Positives = 91/198 (46%), Gaps = 25/198 (13%)
 Frame = +2

Query  2    FLDLVCFSHKIP-EETNNAMGHFSTIEIRN----IVDKCLINY--SCFNWMYSLIPEMGR  160
            FLD+ CF      EE  + +    T  I+N    +V+K LI     C   ++ LI EMG+
Sbjct  587  FLDIACFFKGCRLEEFQDILDAHYTYCIKNHIGVLVEKSLIKIIGGCVT-LHDLIEEMGK  645

Query  161  EIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN----------------SP  292
            EI+  ESP + G+RSRLW   D+  VL    G  KIE++ LN                  
Sbjct  646  EIVRQESPKEPGKRSRLWSHEDIVPVLHANSGTRKIEILYLNFSLSKEEEVEWKGDELKK  705

Query  293  MKNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKE  472
            M+N+    I         +HLP   LR L W + P +++P  +F  KL   ++ ES++  
Sbjct  706  MENLRTIIIRNCPFSKGCQHLP-NGLRVLDWPKYPSENLPSDFFPRKLSICRLRESSLTT  764

Query  473  FGVPLKVIWQYFFKFNSS  526
            F  P        F F+SS
Sbjct  765  FEFPSSSKVGVMFSFSSS  782


 Score = 33.9 bits (76),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 51/115 (44%), Gaps = 9/115 (8%)
 Frame = +3

Query  567  IQKFLICFYGFYLLNPLK*YFLCHESLDLGWCENLTRTPDFSGAKNLHKLSFYG-SSLEK  743
            I  F      FY L      FLC   L+L   ++LT+  D SG  NL  LSF   S+L  
Sbjct  791  ITHFFSSLSLFYFLQK----FLCMRELNLDHNQSLTQILDISGLLNLEILSFRDCSNLIT  846

Query  744  VHYSNIDLWMQSKIDLWGCERLKKLPSSSVEN--SGMLTH--NFPQFPPNLEDIR  896
            +H S   L     +++ GC +L   P   + +     L+H  N   FP  L D++
Sbjct  847  IHNSIGFLNKLKILNVTGCSKLSSFPPIKLTSLLKLELSHCNNLKSFPEILGDMK  901



>gb|AES86763.2| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=1137

 Score = 89.7 bits (221),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 90/178 (51%), Gaps = 25/178 (14%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETN------NAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMG  157
            FLD+ CF   I  + N      N  G F+ I I  +V++ L+     N   M+ L+ +MG
Sbjct  504  FLDIACF--LIGMDRNDVILILNGCGLFAEIGISVLVERSLVTVDDKNKLGMHDLLRDMG  561

Query  158  REIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------M  295
            REII  +SP +  ERSRLW   DV D+L E  G + +E + L  P              M
Sbjct  562  REIIREKSPMEPEERSRLWYHEDVIDILSEHTGTKAVEGLTLKLPGRSAQRFSTEAFKKM  621

Query  296  KNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIK  469
            K +   Q+    L+G+FK+L  K LR L WN  P+  IP  ++   +V +++  SN+K
Sbjct  622  KKLRLLQLSGAQLDGDFKYLS-KQLRWLHWNGFPLTCIPSNFYQRNIVSIELENSNVK  678



>ref|XP_007210739.1| hypothetical protein PRUPE_ppa021703mg [Prunus persica]
 gb|EMJ11938.1| hypothetical protein PRUPE_ppa021703mg [Prunus persica]
Length=1104

 Score = 89.7 bits (221),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 65/178 (37%), Positives = 89/178 (50%), Gaps = 22/178 (12%)
 Frame = +2

Query  2    FLDLVCFSHKIPEET----NNAMGHFSTIEIRNIVDKCL--INYSCFNWMYSLIPEMGRE  163
            FLD+ CF     ++       +   F  I I+ ++DK L  IN      M+ L+ +MG+E
Sbjct  455  FLDIACFFKGEDKDQIVDILRSCDLFPIISIKVLIDKSLLVINEHNMLTMHDLLEDMGKE  514

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKN  301
            I+  ESP + GERSRLW   DV+ VL EQ G  K+  I++N P              MKN
Sbjct  515  IVRQESPTEPGERSRLWFHEDVYHVLTEQTGSTKVRGILINMPKKNDISMSAEAFSRMKN  574

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
            + Y       L GN   LP + LR L W + P++S+P  +   KLV LKM  SNI   
Sbjct  575  LRYLINLNASLTGNID-LPNE-LRLLNWYRYPLQSLPSNFHPKKLVALKMPSSNISRL  630



>ref|XP_009353023.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103944316 
[Pyrus x bretschneideri]
Length=2516

 Score = 90.1 bits (222),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/180 (34%), Positives = 97/180 (54%), Gaps = 26/180 (14%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETNNAM------GHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMG  157
            FLD+ CF   I  + N+ M      G  +   I  ++D+CL+  +  N   M+ L+ +MG
Sbjct  529  FLDIACFF--IGMDKNDVMQILDGCGLHAKTGIEVLLDRCLVTINGENKIMMHDLLRDMG  586

Query  158  REIIHSESPNKSGERSRLWCPNDVHDVLIEQ-KGMEKIEMIVLNSP--------------  292
            R+I+H+E PN  G++SRLW P DV+DVLI++ +G  KIE + LN P              
Sbjct  587  RDIVHAEKPNFPGKQSRLWRPEDVNDVLIDKSQGTGKIEGLALNLPSLDEASFSTEAFRN  646

Query  293  MKNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKE  472
            MK +   Q++ + L G ++ L  K LR L W+  P++ IP       +V + M  S++K+
Sbjct  647  MKRLRLLQLNYVRLAGGYQCLS-KNLRWLCWHGFPLEVIPIELCQPNIVAIDMQYSSLKQ  705


 Score = 79.0 bits (193),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 57/180 (32%), Positives = 95/180 (53%), Gaps = 26/180 (14%)
 Frame = +2

Query  2     FLDLVCFSHKIPEETNNAM------GHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMG  157
             F D+ CF   I  + N+ M      G ++T  ++ ++D+CL+  +  N   M+ L+ +MG
Sbjct  1807  FCDISCFF--IGMDKNDVMQILDGCGFYATAGLKVLLDRCLVTVNTKNKIMMHDLLRDMG  1864

Query  158   REIIHSESPNKSGERSRLWCPNDVHDVLIEQ-KGMEKIEMIVLNSP--------------  292
             R+I+ +E+     ERSRLW P DV  VLI++ +G EKIE + L+ P              
Sbjct  1865  RDIVRAENSKFPKERSRLWRPEDVKAVLIDKSQGTEKIEGLALDLPSVEEISFSTEAFTN  1924

Query  293   MKNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKE  472
             MK++   Q+  + L G ++ L +K LR L +   P++ IP       LV + M  S++K+
Sbjct  1925  MKSLRLLQLKYVRLTGGYQCLSKK-LRWLCYRGFPLEFIPKDLCQPNLVAIDMRYSSLKQ  1983



>gb|KCW67541.1| hypothetical protein EUGRSUZ_F01291, partial [Eucalyptus grandis]
Length=1027

 Score = 89.7 bits (221),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 90/177 (51%), Gaps = 20/177 (11%)
 Frame = +2

Query  2    FLDLVCF--SHKIPEETN--NAMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGREI  166
            FLD+ C+    + P  TN  +  G ++ I I  +V++ LI       WM+ L+ EM  EI
Sbjct  442  FLDIACYFKGKEKPYVTNVLDNCGLYADIGIEVLVNRALIQIVGNKLWMHDLLQEMAWEI  501

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKNM  304
            +  ESP + GERSR+W   DV  +L +  G  K+++IVL S               M N+
Sbjct  502  VRRESPEEPGERSRVWLFEDVCHILSKNSGTGKVKVIVLQSGDNRIVHLNGEPFANMTNL  561

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
                +   HL   FKHL  + LR L+W+ C +KS P  +  + L++L M +S ++  
Sbjct  562  RILDVRATHLSSGFKHLSNE-LRLLRWDNCSLKSFPPSFLLENLLELHMQDSLLRSL  617



>ref|XP_010060724.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=1194

 Score = 89.4 bits (220),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 90/177 (51%), Gaps = 20/177 (11%)
 Frame = +2

Query  2    FLDLVCF--SHKIPEETN--NAMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGREI  166
            FLD+ C+    + P  TN  +  G ++ I I  +V++ LI       WM+ L+ EM  EI
Sbjct  442  FLDIACYFKGKEKPYVTNVLDNCGLYADIGIEVLVNRALIQIVGNKLWMHDLLQEMAWEI  501

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKNM  304
            +  ESP + GERSR+W   DV  +L +  G  K+++IVL S               M N+
Sbjct  502  VRRESPEEPGERSRVWLFEDVCHILSKNSGTGKVKVIVLQSGDNRIVHLNGEPFANMTNL  561

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
                +   HL   FKHL  + LR L+W+ C +KS P  +  + L++L M +S ++  
Sbjct  562  RILDVRATHLSSGFKHLSNE-LRLLRWDNCSLKSFPPSFLLENLLELHMQDSLLRSL  617



>gb|KDP24990.1| hypothetical protein JCGZ_23973 [Jatropha curcas]
Length=692

 Score = 62.8 bits (151),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/183 (29%), Positives = 87/183 (48%), Gaps = 22/183 (12%)
 Frame = +2

Query  2    FLDLVCF--SHKIPEETNNAMGHFSTI--EIRNIVDKCLINYSCFNW-----MYSLIPEM  154
            FLD+ CF     + +      G+FS++   I  ++D+CLI  S   W     ++ L+ EM
Sbjct  164  FLDVACFFTGKNLDDIITILDGYFSSVYLTINTLIDRCLITVS---WDKRLEVHDLLQEM  220

Query  155  GREIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSPMKNMEYNQIDEIHL  334
            GR+I++ ES  +   RSRLW P D+  +L+E KG E IE I L+         + D    
Sbjct  221  GRKIVNDESI-RPENRSRLWNPEDIRHILLENKGTEAIEGICLDLSKARKICLRCDAFAG  279

Query  335  EGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF--GVPLKVIWQYF  508
              N ++L         +    +      +  + LV L+M ES +K+   GV + ++   F
Sbjct  280  MHNLRYLKF-------YKSEDITHGGANFCAENLVVLEMPESRVKKHWTGVQVSMLTYLF  332

Query  509  FKF  517
             +F
Sbjct  333  SRF  335


 Score = 48.5 bits (114),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/219 (27%), Positives = 100/219 (46%), Gaps = 39/219 (18%)
 Frame = +3

Query  624   YFLCHESLDLGWCENLTRTPDFSGAKNLHKLSF-YGSSLEKVHYSNIDLWMQSKIDLWGC  800
             Y +  + +DL W E L + PD S A N+ K++    +SL ++H S   L     + L  C
Sbjct  365   YLVNLKQIDLSWSEYLIKIPDLSKAINIQKINLQVCTSLVELHSSTQHLKKLEFLSLSCC  424

Query  801   ERLKKLPS---SSVENSGMLTHNFP-QFPPN------LEDIRLYGCKNLEVVSATFPTSL  950
               ++ +PS   S V     L+++   +  P       L+ +RL G  NL      FP   
Sbjct  425   VNVRSIPSSINSKVIRCVDLSYSLKVKRCPEILSWKFLKLLRLEGMSNL----IKFPDIA  480

Query  951   EGIVLYGC-----TNLKTLLELP------QNLQSLYVFNCESLETVHLPKMLE-----YV  1082
                +  GC      N + LL LP      ++L+ LY+ NC  LE+   P++LE      +
Sbjct  481   ATEISSGCDELSMVNCEKLLSLPSSICKWKSLKYLYLSNCSKLES--FPEILEPMNLVEI  538

Query  1083  KLTHCKKLKEI-QGWENAQFLTRIELRG-----VPNNIK  1181
              +  CK LK +     N ++L  + L+G     +P++I+
Sbjct  539   DMNKCKNLKRLPNSIYNLKYLESLYLKGTAIEEIPSSIE  577



>ref|XP_006607046.1| PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1-like 
isoform X2 [Glycine max]
Length=1027

 Score = 72.4 bits (176),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 88/195 (45%), Gaps = 21/195 (11%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFNW-MYSLIPEMGREI  166
            FLD+ CF          E  +  G  ++I I+ +++  LI        M+ L+ +MGREI
Sbjct  426  FLDVCCFFIGKDRTYVTEILDGCGLHASIGIKVLIEHSLIKVEKNKLGMHPLLRDMGREI  485

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKNM  304
            +   S N+ G+R+RLW   DV DVL    G E I+ + +                 MK +
Sbjct  486  VCESSKNEPGKRNRLWFQKDVLDVLTNNTGTETIQGLAVKLHFTSRDSFEAYSFEKMKGL  545

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF-GV  481
               Q+D + L GN+ +L  K L+ + W   P+K IP  +  + ++ +    S ++     
Sbjct  546  RLLQLDHVQLSGNYGYLS-KQLKWICWRGFPLKYIPNNFHLEGVIAIDFKYSKLRLLWKT  604

Query  482  PLKVIWQYFFKFNSS  526
            P  + W  F   + S
Sbjct  605  PQVLPWLKFLNLSHS  619


 Score = 38.9 bits (89),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 33/60 (55%), Gaps = 1/60 (2%)
 Frame = +3

Query  645  LDLGWCENLTRTPDFSGAKNLHKLSFYGS-SLEKVHYSNIDLWMQSKIDLWGCERLKKLP  821
            L+L   +NLT TPDFS   +L KL      SL KVH S  DL     I+L GC  L+ LP
Sbjct  614  LNLSHSKNLTETPDFSKLTSLEKLILRNCPSLCKVHQSIGDLHNLILINLKGCTSLRNLP  673



>ref|XP_007219398.1| hypothetical protein PRUPE_ppa020421mg, partial [Prunus persica]
 gb|EMJ20597.1| hypothetical protein PRUPE_ppa020421mg, partial [Prunus persica]
Length=880

 Score = 89.4 bits (220),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 64/184 (35%), Positives = 94/184 (51%), Gaps = 24/184 (13%)
 Frame = +2

Query  2    FLDLVCF------SHKIPEETNNAMGHFSTIEIRNIVDKCLINY-SCFNWMYSLIPEMGR  160
            FLD+ CF      S+ I    +  +     IE+  +++K LI   +   WM+ LI EMG+
Sbjct  445  FLDIACFFKGKSRSYVIEVLESCELNPKYGIEV--LIEKALITIENNLLWMHDLIEEMGK  502

Query  161  EIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MK  298
            EI+  ESP + G+RSRLW P DV+ VL E  G +K++ IV+  P              MK
Sbjct  503  EIVRQESPTEPGKRSRLWFPEDVYHVLTENTGTDKVKGIVVQCPKSDDIRLNATSFSKMK  562

Query  299  NMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFG  478
            N++        L G+ ++LP + L  L W  CP++S P  +   KL KL M  S++   G
Sbjct  563  NLKLFINCNARLFGDVEYLPNE-LMFLDWPGCPLQSFPANFNPKKLFKLNMPRSHLTRLG  621

Query  479  VPLK  490
              LK
Sbjct  622  EGLK  625



>ref|XP_003557030.2| PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1-like 
isoform X1 [Glycine max]
Length=1070

 Score = 72.4 bits (176),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 88/195 (45%), Gaps = 21/195 (11%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFNW-MYSLIPEMGREI  166
            FLD+ CF          E  +  G  ++I I+ +++  LI        M+ L+ +MGREI
Sbjct  469  FLDVCCFFIGKDRTYVTEILDGCGLHASIGIKVLIEHSLIKVEKNKLGMHPLLRDMGREI  528

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKNM  304
            +   S N+ G+R+RLW   DV DVL    G E I+ + +                 MK +
Sbjct  529  VCESSKNEPGKRNRLWFQKDVLDVLTNNTGTETIQGLAVKLHFTSRDSFEAYSFEKMKGL  588

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF-GV  481
               Q+D + L GN+ +L  K L+ + W   P+K IP  +  + ++ +    S ++     
Sbjct  589  RLLQLDHVQLSGNYGYLS-KQLKWICWRGFPLKYIPNNFHLEGVIAIDFKYSKLRLLWKT  647

Query  482  PLKVIWQYFFKFNSS  526
            P  + W  F   + S
Sbjct  648  PQVLPWLKFLNLSHS  662


 Score = 38.9 bits (89),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 33/60 (55%), Gaps = 1/60 (2%)
 Frame = +3

Query  645  LDLGWCENLTRTPDFSGAKNLHKLSFYGS-SLEKVHYSNIDLWMQSKIDLWGCERLKKLP  821
            L+L   +NLT TPDFS   +L KL      SL KVH S  DL     I+L GC  L+ LP
Sbjct  657  LNLSHSKNLTETPDFSKLTSLEKLILRNCPSLCKVHQSIGDLHNLILINLKGCTSLRNLP  716



>ref|XP_011032762.1| PREDICTED: TMV resistance protein N-like isoform X5 [Populus 
euphratica]
Length=846

 Score = 89.0 bits (219),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 96/184 (52%), Gaps = 20/184 (11%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETNNAM----GHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF     ++   ++    G F    I  ++ +CL+     N   M+ L+ +MGRE
Sbjct  439  FLDIACFFIGYNKDYIMSILEDCGFFPADGINTLMRRCLLKVGPDNKLSMHDLLRDMGRE  498

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP-------------MKNM  304
            I+  ES    GERSRLW   DV DV+ ++ G + +E ++LN P             MK +
Sbjct  499  IVRQESSTDPGERSRLWRQEDVIDVITDRMGTKAVEGLILNLPGLKQSFSTEAFKKMKKL  558

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFGVP  484
               Q++ I LEG+++++  K LR L W + P+KSIP   + + L+ L M  S++ +F   
Sbjct  559  RLLQLNCICLEGSYEYISTK-LRWLCWLEFPLKSIPPDLYLETLIALDMRYSSLHQFSEE  617

Query  485  LKVI  496
             K +
Sbjct  618  TKAL  621



>ref|XP_009355424.1| PREDICTED: TMV resistance protein N-like, partial [Pyrus x bretschneideri]
Length=930

 Score = 89.0 bits (219),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/185 (34%), Positives = 88/185 (48%), Gaps = 31/185 (17%)
 Frame = +2

Query  2    FLDLVCFSHKIPE----ETNNAMGHFSTIEIRNIVDKCLINYSCFNW-----MYSLIPEM  154
            FLD+ CF   + +    E  +  G +    IR ++D+ LI  S   W     M+  + EM
Sbjct  441  FLDIACFFKGMQKDYAIEIMDGCGFYPHTGIRVLIDRALITVS---WRGELEMHDSLQEM  497

Query  155  GREIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SP  292
            GREI+  ES  + G RSRLW   DVH VL +  G E +E I+L+                
Sbjct  498  GREIVRQESIKEPGRRSRLWSYGDVHHVLTQNTGTEAVESIILDLSNSDEVCLNAEAFDS  557

Query  293  MKNMEYNQID----EIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWES  460
            M  +   +I     + HL G+ K L  + LRCL W   P+KS+P  + F  LV L M  S
Sbjct  558  MTQLRLLRISHSYGKQHLIGHLKFLSHE-LRCLSWPGSPLKSLPSNFQFKNLVDLDMQYS  616

Query  461  NIKEF  475
             I++ 
Sbjct  617  RIEQL  621



>ref|XP_010263218.1| PREDICTED: TMV resistance protein N-like isoform X3 [Nelumbo 
nucifera]
Length=774

 Score = 89.0 bits (219),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 94/178 (53%), Gaps = 21/178 (12%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETN----NAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF     ++      ++ G  S I IR++  K L+  +  N   M++LI EMG+E
Sbjct  447  FLDIACFFVGTKKDYAIKILDSCGFSSEIGIRSLTGKSLVTINEKNEIGMHNLIQEMGKE  506

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKN  301
            I+  ESP   G+R RL    DVH +L +  G   IE +V+               + M+ 
Sbjct  507  IVREESPRNPGKRRRLGNSQDVHGILTKNMGTGAIEGLVIENSDGLINELNAEAFAAMQK  566

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
            + + +++ +HL G+++HLPR +LR L W+  P++++P  +  + L  L M  S IK+ 
Sbjct  567  LRFLKLNHVHLMGSYEHLPR-SLRWLCWHGFPLENLPTKFHLENLSILDMQYSRIKQL  623



>ref|XP_002307567.2| hypothetical protein POPTR_0005s22800g [Populus trichocarpa]
 gb|EEE94563.2| hypothetical protein POPTR_0005s22800g [Populus trichocarpa]
Length=915

 Score = 89.0 bits (219),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 99/189 (52%), Gaps = 20/189 (11%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETNNAM----GHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF     ++   ++    G F    I  ++ +C++     N   M+ L+ +MGRE
Sbjct  220  FLDIACFFIGFNKDYIMSILEDCGFFPADGINTLMRRCIVKVGPDNKLSMHDLLRDMGRE  279

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP-------------MKNM  304
            I+  ES    GERSRLW   DV DV+ ++ G + +E ++LN P             MK +
Sbjct  280  IVRQESSTDPGERSRLWRQEDVIDVITDRMGTKAVEGLILNLPGLKQSFSTKAFKKMKKL  339

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFGVP  484
               Q++ I LEG+++++  K LR L W + P+KSIP   + + L+ L M  S++ +F   
Sbjct  340  RLLQLNCICLEGSYEYISTK-LRWLCWLEFPLKSIPPDLYLETLIALDMRYSSLHQFSEE  398

Query  485  LKVIWQYFF  511
            +K + +  F
Sbjct  399  IKSLKKLKF  407



>gb|ABG37662.1| NBS-LRR type disease resistance-like protein [Populus trichocarpa]
Length=1138

 Score = 89.4 bits (220),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 64/190 (34%), Positives = 96/190 (51%), Gaps = 26/190 (14%)
 Frame = +2

Query  2    FLDLVCFSHKIPEE----TNNAMGHFSTIEIRNIVDKCLIN-YSCFNWMYSLIPEMGREI  166
            FLD+ CF     ++      ++ G  + I I  ++++ LI+ Y    WM++L+  MG+EI
Sbjct  80   FLDIACFLKGFKKDRITRILDSCGFNAGIGIPVLIERSLISVYGDQVWMHNLLQIMGKEI  139

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKNM  304
            +  E P + G+RSRLW   DV   L++  G EKIE I L+ P              M  +
Sbjct  140  VRCEDPKEPGKRSRLWTYEDVSLALMDNTGKEKIEAIFLDMPGIKEAQWNMKAFSKMSRL  199

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF---  475
               +ID + L    + L  K LR L+W+  P KS+P G   D LV+L M  S+I++    
Sbjct  200  RLLKIDNVQLSEGPEDL-SKELRFLEWHSYPSKSLPAGLQVDGLVELHMANSSIEQLWYG  258

Query  476  ---GVPLKVI  496
                V LKVI
Sbjct  259  CKSAVNLKVI  268



>ref|XP_010263217.1| PREDICTED: TMV resistance protein N-like isoform X2 [Nelumbo 
nucifera]
Length=846

 Score = 89.0 bits (219),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 94/178 (53%), Gaps = 21/178 (12%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETN----NAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF     ++      ++ G  S I IR++  K L+  +  N   M++LI EMG+E
Sbjct  447  FLDIACFFVGTKKDYAIKILDSCGFSSEIGIRSLTGKSLVTINEKNEIGMHNLIQEMGKE  506

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKN  301
            I+  ESP   G+R RL    DVH +L +  G   IE +V+               + M+ 
Sbjct  507  IVREESPRNPGKRRRLGNSQDVHGILTKNMGTGAIEGLVIENSDGLINELNAEAFAAMQK  566

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
            + + +++ +HL G+++HLPR +LR L W+  P++++P  +  + L  L M  S IK+ 
Sbjct  567  LRFLKLNHVHLMGSYEHLPR-SLRWLCWHGFPLENLPTKFHLENLSILDMQYSRIKQL  623



>ref|XP_008232528.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=1085

 Score = 89.0 bits (219),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 65/194 (34%), Positives = 95/194 (49%), Gaps = 25/194 (13%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSC-FNWMYSLIPEMGREI  166
            FLD+ CF    S     +   A    +   I  +++K LI+    + WM+ L+  MG++I
Sbjct  446  FLDIACFFKGKSRMRLTKIVVACDPRARYSIEVLMEKALISVEGDYIWMHDLLEAMGKDI  505

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP---------------MKN  301
            +  ESP++ G RSRLW   D+  VL    G EKI  I+LNSP               MKN
Sbjct  506  VQQESPDEPGGRSRLWSHEDIEHVLTNDTGTEKITGIMLNSPEMDYEIFLDVDCFSKMKN  565

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFGV  481
            ++      + L GN  +LP   LR L W++CP++S P  +    LV L +  S+IK+   
Sbjct  566  LKIFMNYNVCLSGNIGYLP-SMLRVLDWHRCPLQSFPPNFRPKGLVVLNLPCSHIKQLRE  624

Query  482  PLKVIWQYFFKFNS  523
             LK    +F K  S
Sbjct  625  GLK----HFTKLTS  634



>ref|XP_008222872.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=869

 Score = 88.6 bits (218),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 96/195 (49%), Gaps = 26/195 (13%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFNW--MYSLIPEMGRE  163
            FLD+ CF    S     ET  A        I  +++K LI+    ++  M+ L+ EMGR+
Sbjct  443  FLDIACFFKGKSRNYVIETLEACDLSPRYGIEVLIEKALISVEHGDYIRMHDLLEEMGRD  502

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSPMKNME-YNQID------  322
            I+  ESP ++G RSRLW   DV  VL    G +KI  I+LNSP K+ E +  ID      
Sbjct  503  IVEQESPTEAGGRSRLWFHEDVEHVLTNNTGKKKITGIMLNSPKKDYEIFMDIDCFSKMK  562

Query  323  --------EIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFG  478
                     + L G+  +LP   LR L W +CP++S P  +    LV L +  S IK+ G
Sbjct  563  NLKIFMNYNVCLFGDIGYLP-NMLRVLYWYRCPLQSFPPNFRPKGLVVLNLPCSRIKQLG  621

Query  479  VPLKVIWQYFFKFNS  523
              LK    +F K  S
Sbjct  622  EGLK----HFTKLTS  632



>ref|XP_008236758.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=1053

 Score = 89.0 bits (219),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 61/181 (34%), Positives = 93/181 (51%), Gaps = 25/181 (14%)
 Frame = +2

Query  2    FLDLVCF------SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFNW--MYSLIPEMG  157
            FLD+ CF      ++ I       +     IE+  +++K L+     N   M+ L+ EMG
Sbjct  446  FLDIACFFKGKGKNYVINMLEGCDLNPIYGIEV--LIEKALLYVDHVNRICMHDLVEEMG  503

Query  158  REIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------M  295
            REI+  ESPN+ G+RSRLW   DV+ VL E  G + I+ I++N P              M
Sbjct  504  REIVRHESPNEPGKRSRLWFHKDVYRVLTENTGTDTIQKIMVNLPEPYEIRLSAKSFTKM  563

Query  296  KNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
            KN++       H  G   +L    LR L W +CP+K++P  +   KLV+LK+ +S I++ 
Sbjct  564  KNLQLFINCNAHFSGEVGYLS-NDLRFLDWPECPLKALPSSFNPKKLVELKLRDSRIEQL  622

Query  476  G  478
            G
Sbjct  623  G  623



>ref|XP_009770076.1| PREDICTED: TMV resistance protein N-like [Nicotiana sylvestris]
Length=829

 Score = 88.6 bits (218),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/184 (34%), Positives = 98/184 (53%), Gaps = 22/184 (12%)
 Frame = +2

Query  2    FLDLVCFSHKIP----EETNNAMGHFSTIEIRNIVDKCLINYSCFNW-MYSLIPEMGREI  166
            FLD+ C  H        E  NA G  +   I  +V K L+  S ++  M+ L+ +MGREI
Sbjct  204  FLDIACAFHGFDGHEVTEILNACGFRAKSAIATLVQKHLLQRSMYHLVMHDLVRDMGREI  263

Query  167  IHSESPNKSGERSRLWCPNDVHDVLI-EQKGMEKIEMIVLN--------------SPMKN  301
            +  ESP    +RSRL+ P +V DVL   ++G E +E++ ++                MKN
Sbjct  264  VRLESPRDPAKRSRLFIPQEVRDVLQGNEQGSENVEVLKVDRGTLNGVNLSTKAFEQMKN  323

Query  302  MEYNQI-DEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFG  478
            +    I DE+++ G+F  L  + LR L W +CP+K IP  +  + LV + M +S+I+EF 
Sbjct  324  LRVLIINDELYISGDFGLLSNR-LRWLSWKKCPLKCIPSNFPAENLVVIDMRKSDIQEFQ  382

Query  479  VPLK  490
            + L+
Sbjct  383  LNLQ  386



>ref|XP_003626930.1| TMV resistance protein N [Medicago truncatula]
 gb|AET01406.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=1091

 Score = 89.0 bits (219),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 86/177 (49%), Gaps = 21/177 (12%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF          E  N  G ++ I I  ++D+ L+     N   M+ LI +MGRE
Sbjct  446  FLDICCFFIGKDRAYVTEILNGCGLYADIGIAVLIDRSLLKVEKNNKLGMHDLIRDMGRE  505

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKN  301
            I+   S  + G+RSRLW   DVHDVL +  G E +E ++ N                MK 
Sbjct  506  IVRESSAREPGKRSRLWFHEDVHDVLAKNTGTETVEALIFNLQRTGRGSFSTNTFQDMKK  565

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKE  472
            +   Q+D + L G+F +L  K LR + W +     +P  +  + LV  ++  SN+K+
Sbjct  566  LRLLQLDRVDLTGDFGYLS-KQLRWVNWQRSTFNFVPNDFDQENLVAFELKYSNVKQ  621



>ref|XP_011032761.1| PREDICTED: TMV resistance protein N-like isoform X4 [Populus 
euphratica]
Length=930

 Score = 88.6 bits (218),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 98/189 (52%), Gaps = 20/189 (11%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETNNAM----GHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF     ++   ++    G F    I  ++ +CL+     N   M+ L+ +MGRE
Sbjct  439  FLDIACFFIGYNKDYIMSILEDCGFFPADGINTLMRRCLLKVGPDNKLSMHDLLRDMGRE  498

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP-------------MKNM  304
            I+  ES    GERSRLW   DV DV+ ++ G + +E ++LN P             MK +
Sbjct  499  IVRQESSTDPGERSRLWRQEDVIDVITDRMGTKAVEGLILNLPGLKQSFSTEAFKKMKKL  558

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFGVP  484
               Q++ I LEG+++++  K LR L W + P+KSIP   + + L+ L M  S++ +F   
Sbjct  559  RLLQLNCICLEGSYEYISTK-LRWLCWLEFPLKSIPPDLYLETLIALDMRYSSLHQFSEE  617

Query  485  LKVIWQYFF  511
             K + +  F
Sbjct  618  TKSLKKLKF  626



>gb|ABF81438.1| TIR-NBS-LRR-TIR type disease resistance protein [Populus trichocarpa]
Length=1524

 Score = 89.0 bits (219),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 64/190 (34%), Positives = 96/190 (51%), Gaps = 26/190 (14%)
 Frame = +2

Query  2    FLDLVCFSHKIPEE----TNNAMGHFSTIEIRNIVDKCLIN-YSCFNWMYSLIPEMGREI  166
            FLD+ CF     ++      ++ G  + I I  ++++ LI+ Y    WM++L+  MG+EI
Sbjct  534  FLDIACFLKGFKKDRITRILDSCGFNAGIGIPVLIERSLISVYGDQVWMHNLLQIMGKEI  593

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKNM  304
            +  E P + G+RSRLW   DV   L++  G EKIE I L+ P              M  +
Sbjct  594  VRCEDPKEPGKRSRLWTYEDVSLALMDNTGKEKIEAIFLDMPGIKEAQWNMKAFSKMSRL  653

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF---  475
               +ID + L    + L  K LR L+W+  P KS+P G   D LV+L M  S+I++    
Sbjct  654  RLLKIDNVQLSEGPEDLS-KELRFLEWHSYPSKSLPAGLQVDGLVELHMANSSIEQLWYG  712

Query  476  ---GVPLKVI  496
                V LKVI
Sbjct  713  CKSAVNLKVI  722



>ref|XP_008237766.1| PREDICTED: uncharacterized protein LOC103336496 [Prunus mume]
Length=3764

 Score = 89.0 bits (219),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 92/178 (52%), Gaps = 21/178 (12%)
 Frame = +2

Query  2     FLDLVCF-----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFNW-MYSLIPEMGRE  163
             FLD+ CF       ++ +   +  G+   I+I+ ++DK L+        M+ LI E+G E
Sbjct  2974  FLDIACFFKGEDKDRVAKILESGCGYCPDIDIKVLIDKSLVTLVGRKLCMHDLIQELGWE  3033

Query  164   IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKN  301
             I+  E     G+RSRLW P D+  VL++ KG + IE I LN              S M N
Sbjct  3034  IVRRECREDPGKRSRLWLPKDIIPVLVQNKGTDTIEGIFLNSLKQEDVDLNANSFSKMSN  3093

Query  302   MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
             +   +I  +    + ++L  + L+ L+W+ CP+ S+P  +  DKLV+LKM  S +K+ 
Sbjct  3094  LRLLRICNVASPRSIEYLSSE-LQLLEWHACPLNSLPSNFQSDKLVELKMHLSRVKQL  3150


 Score = 86.3 bits (212),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 92/178 (52%), Gaps = 21/178 (12%)
 Frame = +2

Query  2     FLDLVCF-----SHKIPEETNNAMGHFSTIEIRNIVDKCLIN-YSCFNWMYSLIPEMGRE  163
             FLD+ CF       ++ +   +  G+   I+I+ +++K LI  +     M+ LI E+G E
Sbjct  1281  FLDIACFFKGEDKDRVAKILESGCGYSPDIDIKVLIEKSLITLFGKKLCMHDLIQELGWE  1340

Query  164   IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKN  301
             I+  E     G+RSRLW P D+  VL + KG + IE I LN P              M N
Sbjct  1341  IVRRECREDPGKRSRLWLPKDIIPVLAKNKGTDTIEGIFLNLPKQEEIHLNADSFSKMSN  1400

Query  302   MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
             +   +I  +   G+ ++L  + L+ L+W+ CP+  +P  +  DKLV+LKM  S +K+ 
Sbjct  1401  LRLLRICNVASPGSIEYLSNE-LQLLEWHACPLNYLPSNFQSDKLVELKMHLSCVKQL  1457


 Score = 70.5 bits (171),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 68/137 (50%), Gaps = 17/137 (12%)
 Frame = +2

Query  128   WMYSLIPEMGREIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN-------  286
             WM+  + E+GR+I+  E P+K G  SRLW   D H VL +  G E+IE IVL+       
Sbjct  2373  WMHDSLQELGRQIVLREFPDKPGWCSRLWFHEDAHHVLSKNTGREEIEGIVLHPALIQGY  2432

Query  287   ---------SPMKNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLV  439
                      S M    Y +I  + L    + LP  +LR L+W   P+   P  +  +KL+
Sbjct  2433  RCMQNAKSFSKMVKPRYLKISNVSLYNGLEDLP-NSLRTLKWTGYPLTYFPSHFNPEKLL  2491

Query  440   KLKMWESNIKEFGVPLK  490
             +LKM  S IK F +  K
Sbjct  2492  ELKMCHSCIKHFQMGTK  2508



>ref|XP_010263320.1| PREDICTED: TMV resistance protein N-like [Nelumbo nucifera]
Length=1151

 Score = 88.6 bits (218),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 61/186 (33%), Positives = 98/186 (53%), Gaps = 22/186 (12%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETN----NAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF   + ++      ++ G FS   I  ++ + L+  +  N   M+ LI +MGR 
Sbjct  441  FLDIACFFIGMDKDYAVKILDSCGFFSEFGINVLIRRFLLTINEKNELRMHDLIRDMGRR  500

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVL-NSP--------------MK  298
            I+H ESP + G+RSRLW   DVHDVL +  G E+++ + L N P              M 
Sbjct  501  IVHEESPKEPGKRSRLWFHKDVHDVLTKSTGTEEVQGLSLRNLPRSSRVCCSAEALRKMH  560

Query  299  NMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFG  478
             +   Q+  + + G+F+H  R+ LR L W+  P+K IP  ++ + LV L M  S +++  
Sbjct  561  KLRLLQLHFVDITGDFRHCSRE-LRWLCWHGFPLKFIPSKFYLENLVVLDMQRSKLEKVW  619

Query  479  VPLKVI  496
              LKV+
Sbjct  620  KELKVL  625



>ref|XP_006389143.1| hypothetical protein POPTR_0043s00230g, partial [Populus trichocarpa]
 gb|ERP48057.1| hypothetical protein POPTR_0043s00230g, partial [Populus trichocarpa]
Length=793

 Score = 88.6 bits (218),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 93/177 (53%), Gaps = 20/177 (11%)
 Frame = +2

Query  2    FLDLVCF--SHKIPEETN--NAMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGREI  166
            FLD+ CF    KI   T   +  G  ++I I  ++++ LI+ S    WM++L+ +MG+EI
Sbjct  276  FLDIACFLKGFKIDRITRILDGRGFHASIGIPVLIERSLISVSRDQVWMHNLLQKMGKEI  335

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKNM  304
            I  ESP + G RSRLW   DV   L++  G EKIE I L+ P              M  +
Sbjct  336  IRRESPEEPGRRSRLWTYKDVCLALMDNIGKEKIEAIFLDMPGIKEAQWNMEAFSKMSRL  395

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
               +I+ + L    + L  K LR L+W+  P KS+P     D+LV+L M  S+I++ 
Sbjct  396  RLLKINNVQLSEGPEDLSNK-LRFLEWHSYPSKSLPASLQVDELVELHMANSSIEQL  451



>ref|XP_010263216.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nelumbo 
nucifera]
Length=922

 Score = 88.6 bits (218),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 94/178 (53%), Gaps = 21/178 (12%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETN----NAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF     ++      ++ G  S I IR++  K L+  +  N   M++LI EMG+E
Sbjct  447  FLDIACFFVGTKKDYAIKILDSCGFSSEIGIRSLTGKSLVTINEKNEIGMHNLIQEMGKE  506

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKN  301
            I+  ESP   G+R RL    DVH +L +  G   IE +V+               + M+ 
Sbjct  507  IVREESPRNPGKRRRLGNSQDVHGILTKNMGTGAIEGLVIENSDGLINELNAEAFAAMQK  566

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
            + + +++ +HL G+++HLPR +LR L W+  P++++P  +  + L  L M  S IK+ 
Sbjct  567  LRFLKLNHVHLMGSYEHLPR-SLRWLCWHGFPLENLPTKFHLENLSILDMQYSRIKQL  623



>ref|XP_007201564.1| hypothetical protein PRUPE_ppa018131mg [Prunus persica]
 gb|EMJ02763.1| hypothetical protein PRUPE_ppa018131mg [Prunus persica]
Length=1093

 Score = 88.6 bits (218),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 96/184 (52%), Gaps = 23/184 (13%)
 Frame = +2

Query  2    FLDLVCF-----SHKIPEETNNAMGHFSTIEIRNIVDKCLIN-YSCFNWMYSLIPEMGRE  163
            FLD+  F      +++     +  GH   I I+ ++DKCL+  +    WM+ LI ++G E
Sbjct  443  FLDIAFFFKGEDKYRVTRILESCYGHCPVIHIKVLMDKCLLTPFGRKLWMHDLIQKLGWE  502

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN---------------SPMK  298
            I+  E  +++G+ SRLW PND++ VL+   GM  ++ + LN               S MK
Sbjct  503  IVRQEH-SEAGKHSRLWLPNDINPVLVNNTGMTVVQGVFLNFQKNEDINLSVNDPFSEMK  561

Query  299  NMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFG  478
            N+   +I      G  K+L  + L  L+W++CP+  +P  +  DKLV+LKM  S IK+  
Sbjct  562  NLRLLKIWNGDFFGKAKYLSNQ-LALLEWHECPLNCLPSEFESDKLVELKMHSSRIKQLW  620

Query  479  VPLK  490
              +K
Sbjct  621  TGVK  624



>ref|XP_007199382.1| hypothetical protein PRUPE_ppa025692mg [Prunus persica]
 gb|EMJ00581.1| hypothetical protein PRUPE_ppa025692mg [Prunus persica]
Length=1136

 Score = 88.6 bits (218),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 61/181 (34%), Positives = 93/181 (51%), Gaps = 25/181 (14%)
 Frame = +2

Query  2    FLDLVCF------SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFNW--MYSLIPEMG  157
            FLD+ CF      ++ I       +     IE+  +++K L+     N   M+ L+ EMG
Sbjct  440  FLDIACFFKGKGKNYVIKMLEGCDLNPIYGIEV--LIEKALLYVDRRNRICMHDLVEEMG  497

Query  158  REIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------M  295
            REI+  ESPN+ G+RSRLW   DV+ VL E  G + I+ I++N P              M
Sbjct  498  REIVRHESPNEPGKRSRLWFHKDVYRVLTENTGTDTIQKIMVNLPEPYEIRLSAKSFTKM  557

Query  296  KNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
            KN++       H  G   +L    LR L W +CP+K++P  +   KLV+LK+ +S I++ 
Sbjct  558  KNLQLFINCNAHFSGEVGYLS-NDLRFLDWPECPLKALPSSFNPKKLVELKLRDSRIEQL  616

Query  476  G  478
            G
Sbjct  617  G  617



>ref|XP_006360972.1| PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1-like 
[Solanum tuberosum]
Length=773

 Score = 88.2 bits (217),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 79/134 (59%), Gaps = 16/134 (12%)
 Frame = +2

Query  131  MYSLIPEMGREIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------  286
            M+ L+ EMGREI+  ES +  G+RSRL+ P +V DVL   KG +K+E++V+         
Sbjct  240  MHDLVQEMGREIVRMESQD-PGKRSRLFNPQEVIDVLQGNKGSKKVEILVVERQALKGVK  298

Query  287  ------SPMKNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLK  448
                    M N+   +ID +H+ G+F+ L  K LR L W  CP+K +P  +  +KLV L 
Sbjct  299  LSTKVFQKMINLRVLKIDHLHISGDFELLS-KELRWLSWKGCPLKCVPSNFPSEKLVFLN  357

Query  449  MWESNIKEFGVPLK  490
            M  SNI+EFG+ L+
Sbjct  358  MKGSNIQEFGLNLQ  371



>ref|XP_004309289.1| PREDICTED: TMV resistance protein N-like [Fragaria vesca subsp. 
vesca]
Length=422

 Score = 87.4 bits (215),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 90/180 (50%), Gaps = 25/180 (14%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETNNAM------GHFSTIEIRNIVDKCLINYSCFNW-MYSLIPEMGR  160
            FLD+ CF     E+ +  +      G F  I+I  +++K ++  S     M+ LI ++GR
Sbjct  241  FLDIACFFK--GEDKDRVIRILEGHGSFPDIDIEVLIEKSMVTMSRNKLGMHDLIQDLGR  298

Query  161  EIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSPMKN-------------  301
            EI+  E P + G+RSRLW P D+  VL   K  + ++ I L    KN             
Sbjct  299  EIVRQECPEEPGKRSRLWIPKDIIRVLKRSKATDAVQSIYLQCAKKNDVVHSINDAFSVM  358

Query  302  --MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
              +   +ID +   GN  +L  + L+ L+W++CP  S P  +  DKLV++ M+ S IK+ 
Sbjct  359  DRLRLLKIDNLKFSGNISYLSNE-LQYLEWHECPFDSFPSDFQPDKLVEVHMYFSRIKQL  417



>ref|XP_008339257.1| PREDICTED: probable WRKY transcription factor 19 [Malus domestica]
Length=503

 Score = 87.8 bits (216),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 79/153 (52%), Gaps = 16/153 (10%)
 Frame = +2

Query  80   IRNIVDKCLINYSCFN-WMYSLIPEMGREIIHSESPNKSGERSRLWCPNDVHDVLIEQKG  256
            I  + DK +IN    N WM+ L+ EMG+EII  E P + GERSRLW   DV+ VL E+ G
Sbjct  65   IEVLTDKAMINIKGNNIWMHDLLEEMGKEIISQELPTELGERSRLWFHEDVYCVLTEKTG  124

Query  257  MEKIEMIVLN---------------SPMKNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQ  391
              KI+ I++N               S MKN++   I      G+        LR L W +
Sbjct  125  TNKIKGIMVNLVEPDDEICLSAKSFSEMKNLQLLFIRNARFSGDHVAYLSNELRLLDWPE  184

Query  392  CPVKSIPFGYFFDKLVKLKMWESNIKEFGVPLK  490
            CP++++P  +   KLV+L M  S + + G  LK
Sbjct  185  CPLQALPSTFNPRKLVELNMPRSRLLQLGEGLK  217



>ref|XP_011032756.1| PREDICTED: TMV resistance protein N-like isoform X1 [Populus 
euphratica]
 ref|XP_011032757.1| PREDICTED: TMV resistance protein N-like isoform X1 [Populus 
euphratica]
 ref|XP_011032758.1| PREDICTED: TMV resistance protein N-like isoform X1 [Populus 
euphratica]
Length=1151

 Score = 88.6 bits (218),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 98/189 (52%), Gaps = 20/189 (11%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETNNAM----GHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF     ++   ++    G F    I  ++ +CL+     N   M+ L+ +MGRE
Sbjct  439  FLDIACFFIGYNKDYIMSILEDCGFFPADGINTLMRRCLLKVGPDNKLSMHDLLRDMGRE  498

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP-------------MKNM  304
            I+  ES    GERSRLW   DV DV+ ++ G + +E ++LN P             MK +
Sbjct  499  IVRQESSTDPGERSRLWRQEDVIDVITDRMGTKAVEGLILNLPGLKQSFSTEAFKKMKKL  558

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFGVP  484
               Q++ I LEG+++++  K LR L W + P+KSIP   + + L+ L M  S++ +F   
Sbjct  559  RLLQLNCICLEGSYEYISTK-LRWLCWLEFPLKSIPPDLYLETLIALDMRYSSLHQFSEE  617

Query  485  LKVIWQYFF  511
             K + +  F
Sbjct  618  TKSLKKLKF  626



>gb|KHN32817.1| TMV resistance protein N [Glycine soja]
Length=1149

 Score = 88.6 bits (218),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 60/174 (34%), Positives = 87/174 (50%), Gaps = 22/174 (13%)
 Frame = +2

Query  2    FLDLVCF--SHKIPEETNNAMGHFS---TIEIRNIVDKCLINYSCFN--WMYSLIPEMGR  160
            FLD+ C    +++ E       H        I  ++DK LI   CF    ++ LI +MG+
Sbjct  439  FLDIACCFKGYRLSEVKEILFSHHGFCPQYGIGVLIDKSLIKIDCFGNVTLHDLIEDMGK  498

Query  161  EIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN---------SPMKNMEYN  313
            EI+  ESP +   RSRLWCP D+  VL E KG  +I+MI L+           M   E N
Sbjct  499  EIVRRESPEEPENRSRLWCPEDIVQVLEENKGTSRIQMIALDYLNYEEVEWDGMAFKEMN  558

Query  314  QIDEIHLEGNF-----KHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWES  460
             +  + + G       KHLP  +LR L+W + P  S+PF +   KLV L++ +S
Sbjct  559  NLKTLIIRGGCFTTGPKHLP-NSLRVLEWRRYPSPSLPFDFNPKKLVSLQLPDS  611



>gb|KCW67532.1| hypothetical protein EUGRSUZ_F01261, partial [Eucalyptus grandis]
Length=810

 Score = 88.2 bits (217),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 88/172 (51%), Gaps = 20/172 (12%)
 Frame = +2

Query  2    FLDLVCF--SHKIP--EETNNAMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGREI  166
            FLD+ CF   ++ P   E  +  G ++ I I+ +VDK LI       WM+ L+ EM  EI
Sbjct  390  FLDIDCFFKGNEKPYVTEVLDKCGFYADIGIKVLVDKSLIQIVGNKLWMHDLLQEMAWEI  449

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKNM  304
            +  ESP + GERSR+W   DV  +L +  G  K++ IVL S               M N+
Sbjct  450  VRRESPEEPGERSRVWLFEDVVHILSKNSGTGKVKAIVLQSRDHRTVHLNGESFTNMTNL  509

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWES  460
                I  IHL   FK+L  + LR L+W+ C +KS P  +    LV+L M +S
Sbjct  510  RLLDICAIHLSSRFKNLSNE-LRLLRWDNCSLKSFPPSFLPKNLVELHMQDS  560



>gb|ABF81430.1| TIR-NBS-LRR-TIR type disease resistance protein [Populus trichocarpa]
Length=1282

 Score = 88.6 bits (218),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 93/177 (53%), Gaps = 20/177 (11%)
 Frame = +2

Query  2    FLDLVCF--SHKIPEETN--NAMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGREI  166
            FLD+ CF    KI   T   +  G  ++I I  ++++ LI+ S    WM++L+ +MG+EI
Sbjct  481  FLDIACFLKGFKIDRITRILDGRGFHASIGIPVLIERSLISVSRDQVWMHNLLQKMGKEI  540

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKNM  304
            I  ESP + G RSRLW   DV   L++  G EKIE I L+ P              M  +
Sbjct  541  IRRESPEEPGRRSRLWTYKDVCLALMDNIGKEKIEAIFLDMPGIKEAQWNMEAFSKMSRL  600

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
               +I+ + L    + L  K LR L+W+  P KS+P     D+LV+L M  S+I++ 
Sbjct  601  RLLKINNVQLSEGPEDLSNK-LRFLEWHSYPSKSLPASLQVDELVELHMANSSIEQL  656



>gb|ABF81439.1| TIR-NBS-LRR-TIR type disease resistance protein [Populus trichocarpa]
Length=1178

 Score = 88.2 bits (217),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 62/190 (33%), Positives = 97/190 (51%), Gaps = 26/190 (14%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETNNAM----GHFSTIEIRNIVDKCLIN-YSCFNWMYSLIPEMGREI  166
            FLD+ CF     ++    +    G  ++I I  ++++ LI+ Y    WM++L+  MG+EI
Sbjct  578  FLDIACFLKGFKKDRITRILDRCGFNASIGIPVLIERSLISVYRDQVWMHNLLQIMGKEI  637

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKNM  304
            +  ESP + G RSRLW   DV   L++  G EKIE I L+ P              M  +
Sbjct  638  VRCESPEEPGRRSRLWTYEDVCLALMDNTGKEKIEAIFLDMPGIKEAQWNMKAFSKMSKL  697

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF---  475
               +ID + +    + L  K LR L+W+ CP KS+P     D+LV+L M  S++++    
Sbjct  698  RLLKIDNMQVSEGPEDLSNK-LRFLEWHSCPSKSLPADLQVDELVELHMANSSLEQLWYG  756

Query  476  ---GVPLKVI  496
                V LK+I
Sbjct  757  CKSAVNLKII  766



>ref|XP_002514804.1| TMV resistance protein N, putative [Ricinus communis]
 gb|EEF47358.1| TMV resistance protein N, putative [Ricinus communis]
Length=1082

 Score = 88.2 bits (217),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 99/188 (53%), Gaps = 25/188 (13%)
 Frame = +2

Query  2    FLDLVCF-----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGRE  163
            FLD+ CF      H + +   +  G ++ I IR ++ K LI  +    WM+ L+ EMGR+
Sbjct  437  FLDIACFFKGEDKHYVVKVLESC-GFYAEIGIRVLLSKSLITITNDRIWMHDLLQEMGRD  495

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNS--------------PMKN  301
            I+      + G RSRLW   DV  VL    G E++E IVL+S               M+ 
Sbjct  496  IVRRSCYEEPGRRSRLWLYKDVSHVLSNDTGTEQVEGIVLDSCEQEDKHLSAKAFMKMRK  555

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF--  475
            +   ++  + L G+ ++L  K LR L+W + P +S+P  +  DKLV+L +  SNI++   
Sbjct  556  LRLLKLRNVRLSGSLEYLSNK-LRYLEWEEYPFRSLPSTFQPDKLVELHLPSSNIQQLWK  614

Query  476  GV-PLKVI  496
            G+ PLK++
Sbjct  615  GMKPLKML  622



>ref|XP_006442207.1| hypothetical protein CICLE_v10024561mg, partial [Citrus clementina]
 gb|ESR55447.1| hypothetical protein CICLE_v10024561mg, partial [Citrus clementina]
Length=914

 Score = 73.9 bits (180),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 77/133 (58%), Gaps = 7/133 (5%)
 Frame = +2

Query  131  MYSLIPEMGREIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSPMKNM--  304
            M+ L+ EMG+ I+  ES  + G+  RLW  NDV+ VL + KG +KIE I L+  ++    
Sbjct  485  MHDLLQEMGQTIVRQESLKEPGKHGRLWDHNDVYHVLKKNKGTDKIEGIFLDLLLRFYMP  544

Query  305  EYNQI----DEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKE  472
            EYN +     ++HL+   ++LP + LR L W+Q P+K++P  +  + L++L +  S +++
Sbjct  545  EYNGVPIMSSKVHLDQGLEYLPEE-LRYLHWHQYPLKTLPLDFEPENLIELNLPYSKVEQ  603

Query  473  FGVPLKVIWQYFF  511
                 KV +  + 
Sbjct  604  IWEGKKVSYSRYL  616


 Score = 36.2 bits (82),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 47/93 (51%), Gaps = 8/93 (9%)
 Frame = +3

Query  567  IQKF----LICFYGFYLLN--PLK*YFLCHESLDLGWCENLTRTPDFSGAKNLHKLSFYG  728
            IQ F    ++C  G   L   P   +F+C  +++L +C NLT  P  +G  N+  L    
Sbjct  646  IQNFNHLSMLCLEGCQSLRSFPSNLHFVCPVTINLSYCVNLTEFPQITG--NIANLHLGE  703

Query  729  SSLEKVHYSNIDLWMQSKIDLWGCERLKKLPSS  827
            +++E+V  S   L    ++ L  C RLK++ +S
Sbjct  704  TAIEEVPSSIHCLTNLKELSLINCTRLKRVSTS  736



>gb|KEH25081.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=721

 Score = 87.8 bits (216),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 58/178 (33%), Positives = 89/178 (50%), Gaps = 25/178 (14%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETN------NAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMG  157
            FLD+ CF   I  + N      N    ++ I I  ++++ L+     N   M+ L+ +M 
Sbjct  470  FLDIACFF--IGMDRNDVIHILNGCELYAEIGINVLLERSLVTVDDMNRLGMHDLLRDMA  527

Query  158  REIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------M  295
            REII  ESP +   RSRLW   DV +VL EQ G + +E +VL  P              M
Sbjct  528  REIIREESPKEVENRSRLWFSTDVLNVLSEQTGTKVVEALVLKLPISSSKCFSTKAFKKM  587

Query  296  KNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIK  469
              +   Q+  + L+G+F+++ R  LR L WN  P+  IP  ++   LV +++  SNIK
Sbjct  588  TRLRLLQLTGVQLDGDFEYISR-NLRWLSWNGFPLTCIPTSFYLGNLVSIELENSNIK  644



>gb|AGM48481.1| TIR-NBS-LRR type disease resistance protein [Malus domestica]
Length=908

 Score = 88.2 bits (217),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 62/183 (34%), Positives = 88/183 (48%), Gaps = 26/183 (14%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETNNAM----GHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF   + ++   A+    G +  + IR ++D+ LI  S      M  L+ EMGRE
Sbjct  593  FLDIACFFKGMDKDYATAILDGCGFYPHMGIRVLIDRALITVSQLGNLEMPDLLVEMGRE  652

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN-----------SPMKNME-  307
            I+  ES  + G RSRLW   DVH VL +    E +E I+L+               NM  
Sbjct  653  IVRQESIREPGRRSRLWNYKDVHHVLTQNTATEAVESIILDLSNSDNVCLNAEAFANMTR  712

Query  308  -------YNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNI  466
                   +N   E HL G+ K L R+ LRCL W+  P++S+P    F  LV + M  S I
Sbjct  713  LRLLKIGHNHFGEQHLIGHLKFLFRE-LRCLSWHGFPLESLPSNCQFKNLVDIDMRYSLI  771

Query  467  KEF  475
            +  
Sbjct  772  ERL  774



>ref|XP_010263209.1| PREDICTED: TMV resistance protein N-like isoform X2 [Nelumbo 
nucifera]
Length=977

 Score = 88.2 bits (217),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 92/177 (52%), Gaps = 21/177 (12%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETN----NAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF   + ++       + G FS I I ++V + LI  +  N   M+ L+ +M +E
Sbjct  451  FLDIACFFVGMDKDYAIGIWESCGFFSKIGISDLVQRSLITINERNELVMHDLLRDMAKE  510

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSPMKN--------------  301
            I+  ES   SG+RSRLW   DV+DVL    G E IE ++LN P  N              
Sbjct  511  IVCEESFKDSGKRSRLWFHKDVYDVLTGNMGTEAIEGLILNLPTSNDLYLSTEAFAKMPK  570

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKE  472
            +   Q++ +HL G++ +  R+ LR L W+  P++ IP  +  + L+ L +  SNI +
Sbjct  571  LRLLQLNNVHLRGSYGNFSRE-LRWLCWHGFPLECIPTDFHIENLLALDLQHSNITQ  626



>gb|ABF81433.1| TIR-NBS-TIR type disease resistance protein [Populus trichocarpa]
Length=1446

 Score = 88.2 bits (217),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 66/190 (35%), Positives = 96/190 (51%), Gaps = 26/190 (14%)
 Frame = +2

Query  2    FLDLVCF--SHKIPEETN--NAMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGREI  166
            FLD+ CF    KI   T    + G  + I I  ++++ LI+ S    WM++L+  MG+EI
Sbjct  473  FLDIACFLMGFKIDRITRILESRGFHAGIGIPVLIERSLISVSRDQVWMHNLLQIMGKEI  532

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKNM  304
            +  ESP + G RSRLW   DV   L++  G EKIE I L+ P              M  +
Sbjct  533  VRCESPEEPGRRSRLWTYEDVCLALMDSTGKEKIEAIFLDMPGIKEAQWNMEAFSKMSKL  592

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF---  475
               +I+ + L    + L  K LR L+W+  P KS+P G   D+LV+L M  S I++    
Sbjct  593  RLLKINNVQLSEGPEDLSNK-LRFLEWHSYPSKSLPAGLQVDELVELHMANSRIEQLWYG  651

Query  476  ---GVPLKVI  496
                V LK+I
Sbjct  652  CKSAVNLKII  661



>gb|KDP41073.1| hypothetical protein JCGZ_03179 [Jatropha curcas]
Length=807

 Score = 87.8 bits (216),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 67/200 (34%), Positives = 102/200 (51%), Gaps = 32/200 (16%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETN-----NAMGHFSTIEIRNIVDKCLINYSCFNW--MYSLIPEMGR  160
            FLD+ CF  K  + T      N  G F+ I I  ++DK LI  S  N   M+ L+ +MGR
Sbjct  436  FLDIACF-FKGEDRTRIQSILNGCGFFADIGISRLLDKSLITISSNNQLEMHDLLQQMGR  494

Query  161  EIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN-SPMKNME----------  307
             I+  E  ++ GERSRLW P DV+ VL  +KG   IE I L+ S ++++E          
Sbjct  495  NIVCLECIHQPGERSRLWIPQDVYLVLKREKGTGNIEGISLDKSKIRDIELSPTVFERMY  554

Query  308  ----------YNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWE  457
                      +    +I+L    + LP + LR L+W++ P KS+P  +  +KL++L M E
Sbjct  555  NLRLLEFHNPFTSELKIYLPKGLQFLPDE-LRFLRWDKYPSKSLPTSFCAEKLMELHMRE  613

Query  458  SNIKEF--GVPLKVIWQYFF  511
            S ++E   GV  + I    +
Sbjct  614  SQLRELWNGVQSRYIGAKMY  633



>ref|XP_008219354.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=1153

 Score = 88.2 bits (217),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 92/178 (52%), Gaps = 21/178 (12%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCL--INYSCFNWMYSLIPEMGRE  163
            FLD+ CF          ET +A G  S I IR +V+K L  IN S    M+ L+ +MGRE
Sbjct  440  FLDIACFFNGKGKDRVRETLDACGLCSDIAIRVLVEKSLLTINPSGTLLMHDLLQDMGRE  499

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKN  301
            I+  ES ++ G+RSRLW   DV+ VL +  G E IE IVL+              S MK 
Sbjct  500  IVRQESLDEPGKRSRLWRSEDVNHVLSKNTGTEAIEGIVLHQVEPRVVCANANSFSMMKR  559

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
            + +  I+ + L    ++LP  +LR L W Q P+KS+P  +    L +L M  S I+  
Sbjct  560  LRFLVINNVDLLNKLEYLP-NSLRILDWLQFPLKSLPPSFNPKNLHELNMRNSCIEHL  616



>ref|XP_006389146.1| hypothetical protein POPTR_0043s00270g [Populus trichocarpa]
 gb|ERP48060.1| hypothetical protein POPTR_0043s00270g [Populus trichocarpa]
Length=935

 Score = 87.8 bits (216),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 63/190 (33%), Positives = 97/190 (51%), Gaps = 26/190 (14%)
 Frame = +2

Query  2    FLDLVCFSHKIPEE----TNNAMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGREI  166
            FLD+ CF     ++      ++ G  + I  + +++K LI+ S    WM++L+  MG+EI
Sbjct  246  FLDIACFLKGFKKDRIIRILDSCGFHAHIGTQVLIEKSLISVSRDQVWMHNLLQIMGKEI  305

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKNM  304
            +  ESP + G RSRLW   DV   L++  G EKIE I L+ P              M  +
Sbjct  306  VRCESPEEPGRRSRLWTYEDVCLALMDNTGKEKIEAIFLDIPGIKEAQWNMKAFSKMSKL  365

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF---  475
               +I+ + L    + L  K LR L+W+  P KS+P G   D+LV+L M  S+I++    
Sbjct  366  RLLKINNVQLSEGPEDLSNK-LRFLEWHSYPSKSLPAGLQVDELVELHMANSSIEQLWYG  424

Query  476  ---GVPLKVI  496
                V LK+I
Sbjct  425  YKSAVKLKII  434



>ref|XP_006389144.1| hypothetical protein POPTR_0043s00240g [Populus trichocarpa]
 gb|ERP48058.1| hypothetical protein POPTR_0043s00240g [Populus trichocarpa]
Length=1063

 Score = 87.8 bits (216),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 63/190 (33%), Positives = 96/190 (51%), Gaps = 26/190 (14%)
 Frame = +2

Query  2    FLDLVCFSHKIPEE----TNNAMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGREI  166
            FLD+ CF     ++      ++ G  + I  + +++K LI+ S    WM++L+  MG+EI
Sbjct  283  FLDIACFLKGFKKDRIIRILDSCGFHAHIGTQVLIEKSLISVSRDQVWMHNLLQIMGKEI  342

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKNM  304
            +  ESP + G RSRLW   DV   L++  G EKIE I L+ P              M  +
Sbjct  343  VRCESPEEPGRRSRLWTYADVCLALMDNTGKEKIEAIFLDMPGIKEAQWNMKAFSKMSRL  402

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF---  475
               +ID + L    + L    LR L+W+  P KS+P G   D+LV+L M  SN+++    
Sbjct  403  RLLKIDNMQLSEGPEDLS-NNLRFLEWHSYPSKSLPAGLQVDELVELHMANSNLEQLWYG  461

Query  476  ---GVPLKVI  496
                V LK+I
Sbjct  462  CKSAVNLKII  471



>ref|XP_010060725.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
 ref|XP_010060726.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=667

 Score = 87.4 bits (215),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 58/172 (34%), Positives = 88/172 (51%), Gaps = 20/172 (12%)
 Frame = +2

Query  2    FLDLVCF--SHKIP--EETNNAMGHFSTIEIRNIVDKCLIN-YSCFNWMYSLIPEMGREI  166
            FLD+ C+   ++ P   E  +  G ++ I I  +V++ LI       WM+ L+ EM  EI
Sbjct  442  FLDIACYFKGNEKPYVAEVLDNCGLYADIGIEVLVNRALIQIVDNTMWMHDLLQEMAWEI  501

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKNM  304
            +  ESP + GERSR+W   DV  +L +  G  K+++IVL S               M N+
Sbjct  502  VRRESPGEPGERSRVWLFEDVFHILSKNSGTGKVKVIVLQSGDYRTVHLNGEPFTNMTNL  561

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWES  460
                +  IHL  +F HL  + LR L+W+ C +KS P  +    L+KL M +S
Sbjct  562  RILDVHAIHLSSSFNHLSNE-LRLLRWDNCSLKSFPPTFLPKNLLKLHMQDS  612



>ref|XP_008244976.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=1135

 Score = 87.8 bits (216),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 93/175 (53%), Gaps = 21/175 (12%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF         ++  +  G F+ IEI  ++ +CL+  S  N   M+ L+ +MGRE
Sbjct  443  FLDISCFFIGKDKNYVKQILDGCGFFAEIEISVLLQRCLVTVSERNKLTMHDLLRDMGRE  502

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKN  301
            ++  +SP + G+ SRLW   D+ DVL +  G E+IE + LN              + M+ 
Sbjct  503  VVREKSPKEPGKCSRLWHKEDIKDVLAKHCGTEEIEGVTLNLLRSDDVSFSTKAFANMQR  562

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNI  466
            +   Q++ + L G++++L  K LR L W+  P+K IP  +   KLV + +  SN+
Sbjct  563  LRLLQLNYVQLTGSYEYLT-KELRWLCWHGLPLKFIPNSFHQQKLVAIDLRYSNL  616


 Score = 56.6 bits (135),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 86/172 (50%), Gaps = 24/172 (14%)
 Frame = +3

Query  897   LYGCKNLEVVSATF---PTSLEGI------VLYGCTNLKTLLELPQNLQSLYVFNCESLE  1049
             L+  + L + S +F   P+SL G+      +L  C NL  + +LP NL+SL   NC SLE
Sbjct  815   LFSLQELNLQSNSFRSLPSSLNGLSKLRRLILDYCANLNAIPDLPNNLKSLEARNCTSLE  874

Query  1050  TV-HLPKM--LEYVKLTHCKKLKEIQGWEN-AQFLTRIELRGVPNNIKFSEIINKVLKVS  1217
              + +L ++  ++ + LT+C KL EI G     + L  I + G  N       I   LK +
Sbjct  875   RIPNLSEISNMDTLSLTNCSKLIEIPGLVKLLKSLRFIRMEGCSN-------ITDALKEN  927

Query  1218  KLN--SNIEFEG-YLPNNETLSWIKFEENGSSISFQWPPLIS-NLEFLEICI  1361
              L   +   F G +LP N    W  + + G+S+ F+ P  I  NL+ L +CI
Sbjct  928   ILQGWTVSGFGGIFLPGNNIPEWFPYVDEGASVFFEVPQNIGCNLKELIVCI  979



>ref|XP_006373537.1| hypothetical protein POPTR_0017s14620g [Populus trichocarpa]
 gb|ERP51334.1| hypothetical protein POPTR_0017s14620g [Populus trichocarpa]
Length=990

 Score = 87.8 bits (216),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 66/190 (35%), Positives = 96/190 (51%), Gaps = 26/190 (14%)
 Frame = +2

Query  2    FLDLVCF--SHKIPEETN--NAMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGREI  166
            FLD+ CF    KI   T    + G  + I I  ++++ LI+ S    WM++L+  MG+EI
Sbjct  220  FLDIACFLMGFKIDRITRILESRGFHAGIGIPVLIERSLISVSRDQVWMHNLLQIMGKEI  279

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKNM  304
            +  ESP + G RSRLW   DV   L++  G EKIE I L+ P              M  +
Sbjct  280  VRCESPEEPGRRSRLWTYEDVCLALMDSTGKEKIEAIFLDMPGIKEAQWNMEAFSKMSKL  339

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF---  475
               +I+ + L    + L  K LR L+W+  P KS+P G   D+LV+L M  S I++    
Sbjct  340  RLLKINNVQLSEGPEDLSNK-LRFLEWHSYPSKSLPAGLQVDELVELHMANSRIEQLWYG  398

Query  476  ---GVPLKVI  496
                V LK+I
Sbjct  399  CKSAVNLKII  408



>ref|XP_009354361.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=1187

 Score = 87.8 bits (216),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 60/190 (32%), Positives = 96/190 (51%), Gaps = 34/190 (18%)
 Frame = +2

Query  2    FLDLVCF------SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMG  157
            FL + CF      SH +     N    ++ + I+N++D+CL+     N   M+ LI +MG
Sbjct  446  FLHIACFLIGRNKSHIV--RILNGCDFYTIVGIQNLLDRCLVTIDGCNNVQMHDLIRDMG  503

Query  158  REIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN-----------------  286
            REI++ ES  + G+RSRLWC  D  +VL E+ G EKI+ +VL+                 
Sbjct  504  REIVNHES-EEPGKRSRLWCHKDSFEVLKEKIGTEKIQGLVLDMHMHPVNNSINTNETVL  562

Query  287  -----SPMKNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKM  451
                   M N++   +  + L+G +   P   LR L W Q P+ SIP  +  +K+V L+M
Sbjct  563  ETNAFERMHNLQLLHLSHVRLDGCYADFP-TGLRWLCWLQFPLDSIPIDFSLEKVVLLEM  621

Query  452  WESNIKEFGV  481
              S++++ G 
Sbjct  622  QYSSLRQVGT  631



>ref|XP_007199954.1| hypothetical protein PRUPE_ppa1027179mg, partial [Prunus persica]
 gb|EMJ01153.1| hypothetical protein PRUPE_ppa1027179mg, partial [Prunus persica]
Length=1081

 Score = 87.8 bits (216),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 92/178 (52%), Gaps = 21/178 (12%)
 Frame = +2

Query  2    FLDLVCF-----SHKIPEETNNAMGHFSTIEIRNIVDKCLIN-YSCFNWMYSLIPEMGRE  163
            FLD+ CF       ++ +   +  G+   I+I+ +++K LI  +     M+ LI E+G E
Sbjct  449  FLDIACFFKGEDKDRVAKILESGCGYSPDIDIKVLIEKSLITLFGKKLCMHDLIQELGWE  508

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKN  301
            I+  E     G+RSRLW P D+  VL + KG + IE I LN P              M N
Sbjct  509  IVRQECREDPGKRSRLWLPKDIIPVLAKNKGTDTIEGIFLNLPKQEEIHLNADSFSKMSN  568

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
            +   +I  +   G+ ++L  + L+ L+W+ CP+  +P  +  DKLV+LKM  S +K+ 
Sbjct  569  LRLLRICNVASPGSIEYLSNE-LQLLEWHACPLNYLPSKFQSDKLVELKMHLSRVKQL  625



>ref|XP_010263405.1| PREDICTED: uncharacterized protein LOC104601664 [Nelumbo nucifera]
Length=2291

 Score = 88.2 bits (217),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 71/130 (55%), Gaps = 16/130 (12%)
 Frame = +2

Query  131   MYSLIPEMGREIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP------  292
             M+ L+ +MGREI+  ESP + G RSRLW   D+ DVL +Q+G   +E IVL         
Sbjct  1623  MHDLLRDMGREIVREESPKEPGRRSRLWFHKDIFDVLTKQRGTNAVEGIVLEDSSGFIDA  1682

Query  293   ---------MKNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKL  445
                      M  +   Q++ +HL G F+HLPR+ LR L W+  P+  +P  ++ + LV L
Sbjct  1683  YMSTEAFAMMHKLRLLQLNYVHLSGGFEHLPRE-LRWLCWHGFPLNFLPMDFYPENLVAL  1741

Query  446   KMWESNIKEF  475
              +  S +K+ 
Sbjct  1742  DLQHSKLKQL  1751


 Score = 76.3 bits (186),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 52/149 (35%), Positives = 79/149 (53%), Gaps = 18/149 (12%)
 Frame = +2

Query  77   EIRNIVDKCLINYSCFN--WMYSLIPEMGREIIHSESPNKSGERSRLWCPNDVHDVLIEQ  250
            EI  +V K L+  +  N   M+ L+ +MGREI+  ESP + G+RSRLW   D H VL + 
Sbjct  471  EIGILVRKSLLTVNENNELRMHDLLRDMGREIVREESPKEPGKRSRLWFHEDAHYVLEKC  530

Query  251  KGMEKIEMIVLNS---------------PMKNMEYNQIDEIHLEGNFKHLPRKTLRCLQW  385
            K  EKI+ IVL S                MK +   ++D + L G+++H+  + LR L W
Sbjct  531  KATEKIQGIVLESLSRTGNLQLTTEAFDRMKKLRLLRMDYVTLTGSYEHVSGE-LRWLCW  589

Query  386  NQCPVKSIPFGYFFDKLVKLKMWESNIKE  472
            +  P+  +P  +  + LV L M  S +K+
Sbjct  590  HGFPLTFLPSNFNLENLVALDMQHSRLKQ  618


 Score = 60.1 bits (144),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 60/215 (28%), Positives = 99/215 (46%), Gaps = 39/215 (18%)
 Frame = +3

Query  807   LKKLPSSSVENSGMLTHNFPQFPPNLEDIRLYGCKNLEVVS-------------------  929
             L  L S  +EN   L  + P+ P +L  + + GC ++E +S                   
Sbjct  1922  LSHLQSLRMENCTRLK-SLPELPSSLALLYIDGCTSMERLSNLERLTSLLELSLRKNNFY  1980

Query  930   -----ATFPTSLEGIVLYGCTNLKTLLELPQNLQSLYVFNCESLETV-HLPKM--LEYVK  1085
                   +  + LE + L  C NL++L ELP +L +LY   C S++ + +L  +  L  + 
Sbjct  1981  NLPDGISRLSQLEILRLENCKNLQSLPELPSSLGALYADGCISMKRLSNLSNLQNLSALL  2040

Query  1086  LTHCKKLKEIQGWENAQFLTRIEL---RGVPNNIKFSEIINKVLKVSKLNSNIEFEGYLP  1256
             L +C +L +IQG E  + + RI +     + N  K     N +L V  L    +F+ +L 
Sbjct  2041  LNNCSRLVDIQGLERLESIQRIHMDRCNSLSNTFK-----NTLLPV--LQERGKFDIFLY  2093

Query  1257  NNETLSWIKFEENGSSISFQWPPLISN-LEFLEIC  1358
              NE   W   ++ GS ISF+ P L+   ++ L IC
Sbjct  2094  GNEVPDWFDHQKMGSVISFEVPTLLDRKIQGLTIC  2128



>gb|AES86810.2| TIR-NBS-LRR class disease resistance protein [Medicago truncatula]
Length=881

 Score = 87.4 bits (215),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 88/176 (50%), Gaps = 21/176 (12%)
 Frame = +2

Query  2    FLDLVCFSHKIPE----ETNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF   +         N  G F+ I I  +V++ L+     N   M+ L+ +MGRE
Sbjct  359  FLDISCFFIGMDRNDVIRILNGCGFFAEIGISVLVERSLVMVDDKNKLGMHDLLRDMGRE  418

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKN  301
            II  +SP +  E SRLW   DV DVL+E  G + +E +    P              MK 
Sbjct  419  IIREKSPKEPEEHSRLWFHEDVLDVLLEHTGTKAVEGLTFKMPGRSTQRFSTKAFENMKK  478

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIK  469
            +   Q+  + L+G+FK+L R  LR L WN  P+  IP  ++   +V +++  S++K
Sbjct  479  LRLLQLSGVQLDGDFKYLSRN-LRWLHWNGFPLACIPSNFYQRNIVSIELENSSVK  533



>ref|XP_010263207.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010263208.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nelumbo 
nucifera]
Length=1186

 Score = 87.8 bits (216),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 92/177 (52%), Gaps = 21/177 (12%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETN----NAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF   + ++       + G FS I I ++V + LI  +  N   M+ L+ +M +E
Sbjct  451  FLDIACFFVGMDKDYAIGIWESCGFFSKIGISDLVQRSLITINERNELVMHDLLRDMAKE  510

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSPMKN--------------  301
            I+  ES   SG+RSRLW   DV+DVL    G E IE ++LN P  N              
Sbjct  511  IVCEESFKDSGKRSRLWFHKDVYDVLTGNMGTEAIEGLILNLPTSNDLYLSTEAFAKMPK  570

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKE  472
            +   Q++ +HL G++ +  R+ LR L W+  P++ IP  +  + L+ L +  SNI +
Sbjct  571  LRLLQLNNVHLRGSYGNFSRE-LRWLCWHGFPLECIPTDFHIENLLALDLQHSNITQ  626


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 67/262 (26%), Positives = 109/262 (42%), Gaps = 52/262 (20%)
 Frame = +3

Query  639   ESLDLGWCENLTRTPDFSGAKNLHKLSFYGSSLEKVHYSNIDLWMQSKI-DLWGCERLKK  815
             + L+   C  +   P+     +L +L+   S+L  +  S+I+   Q KI  L  C RLK 
Sbjct  813   KGLNAEGCTAMEILPNLGKLSSLKELNLCKSNLCSLP-SSINCISQLKILRLENCTRLKS  871

Query  816   LPSSSVENSGMLTHNFPQFPPNLEDIRLYGCKNLEVVS------------------ATFP  941
             +P                 P +L+ ++  GC +LE +S                     P
Sbjct  872   IP---------------DLPSSLKCLKADGCTSLEKMSNIGSLTSLQELSLCRSNFCRLP  916

Query  942   TS------LEGIVLYGCTNLKTLLELPQNLQSLYVFNCESLETVHLP-----KMLEYVKL  1088
             ++      L+ + L  CT L +L ELP NL++LY   C S+E   LP     K L  + L
Sbjct  917   SNINLLSQLQILRLENCTRLNSLPELPSNLEALYADGCTSME--RLPNLSNLKNLSILFL  974

Query  1089  THCKKLKEIQGWENAQFLTRIELRGVPNNIKFSEIINKVLKVSKLNSNIEFEGYLPNNET  1268
               C  L EIQG E    +  I +    NN+  +    K+      + + + + + P  + 
Sbjct  975   NDCNMLIEIQGLERLDSIRCIHMDRC-NNLTNT---FKMTFFQGFHESRKLDIFFPGGDI  1030

Query  1269  LSWIKFEENGSSISFQWPPLIS  1334
               W   +  GSSIS  +PP++ 
Sbjct  1031  PDWFNSQRMGSSISICFPPVLD  1052



>gb|ABF81441.1| TIR-NBS-LRR-TIR type disease resistance protein [Populus trichocarpa]
 gb|ABF81445.1| TIR-NBS-LRR-TIR type disease resistance protein [Populus trichocarpa]
Length=1378

 Score = 87.8 bits (216),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 63/190 (33%), Positives = 97/190 (51%), Gaps = 26/190 (14%)
 Frame = +2

Query  2    FLDLVCFSHKIPEE----TNNAMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGREI  166
            FLD+ CF     ++      ++ G  + I  + +++K LI+ S    WM++L+  MG+EI
Sbjct  504  FLDIACFLKGFKKDRIIRILDSCGFHAHIGTQVLIEKSLISVSRDQVWMHNLLQIMGKEI  563

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKNM  304
            +  ESP + G RSRLW   DV   L++  G EKIE I L+ P              M  +
Sbjct  564  VRCESPEEPGRRSRLWTYEDVCLALMDNTGKEKIEAIFLDIPGIKEAQWNMKAFSKMSKL  623

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF---  475
               +I+ + L    + L  K LR L+W+  P KS+P G   D+LV+L M  S+I++    
Sbjct  624  RLLKINNVQLSEGPEDLSNK-LRFLEWHSYPSKSLPAGLQVDELVELHMANSSIEQLWYG  682

Query  476  ---GVPLKVI  496
                V LK+I
Sbjct  683  YKSAVKLKII  692



>ref|XP_006441723.1| hypothetical protein CICLE_v10024485mg, partial [Citrus clementina]
 gb|ESR54963.1| hypothetical protein CICLE_v10024485mg, partial [Citrus clementina]
Length=1022

 Score = 87.8 bits (216),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 89/180 (49%), Gaps = 23/180 (13%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF    +     +     G    I I  +++K L+     N  WM+ LI EMG +
Sbjct  433  FLDIACFFKWKTRDYVSKILEGCGFSPVIGIEVLIEKSLLTVHENNRLWMHDLIQEMGHQ  492

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN----------------SPM  295
            I+  +SP++ G+RSRLW   DVH VL +  G E +E I+++                S M
Sbjct  493  IVRRQSPDEPGKRSRLWKEADVHHVLSQNTGSEVVEGIMVDDYFLRGNDVHLSAKAFSLM  552

Query  296  KNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
             N+   +I  + L    ++L  + LR L W++ P+KS+P     DK V+ KM  S I+E 
Sbjct  553  TNLRLLKISNVQLPEGLEYLSNR-LRLLDWHRYPLKSLPSNLQLDKTVEFKMCYSRIEEL  611



>ref|XP_003604613.1| TIR-NBS-LRR RCT1-like resistance protein [Medicago truncatula]
Length=1637

 Score = 87.8 bits (216),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 90/178 (51%), Gaps = 25/178 (14%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETN------NAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMG  157
            FLD+ CF   I  + N      N  G F+ I I  +V++ L+     N   M+ L+ +MG
Sbjct  359  FLDISCFF--IGMDRNDVIRILNGCGFFAEIGISVLVERSLVMVDDKNKLGMHDLLRDMG  416

Query  158  REIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------M  295
            REII  +SP +  E SRLW   DV DVL+E  G + +E +    P              M
Sbjct  417  REIIREKSPKEPEEHSRLWFHEDVLDVLLEHTGTKAVEGLTFKMPGRSTQRFSTKAFENM  476

Query  296  KNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIK  469
            K +   Q+  + L+G+FK+L R  LR L WN  P+  IP  ++   +V +++  S++K
Sbjct  477  KKLRLLQLSGVQLDGDFKYLSR-NLRWLHWNGFPLACIPSNFYQRNIVSIELENSSVK  533


 Score = 83.2 bits (204),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 92/186 (49%), Gaps = 21/186 (11%)
 Frame = +2

Query  2     FLDLVCFSHKIPEETN----NAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
             FLD+ CF   I         N+   F+ I I+ +V++ L+     N   M+ L+ +MGRE
Sbjct  1417  FLDIACFFIGIDRNDVICILNSCRLFTEIGIKVLVERSLVIVDDKNKLGMHDLLRDMGRE  1476

Query  164   IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKN  301
             II  +SP +  ERSRLW   DV DVL +  G + +E +    P              MK 
Sbjct  1477  IIREKSPKEPEERSRLWFHGDVLDVLSKHTGTKVVEGLTFKMPGRSAQRFSTKAFENMKK  1536

Query  302   MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFGV  481
             +   Q+  + L+G+FK+L R  L+ L WN  P+  I   ++   LV + +  SN+K    
Sbjct  1537  LRLLQLSGVQLDGDFKYLSR-NLKWLHWNGFPLTCIASNFYQRNLVSVVLENSNVKLVWK  1595

Query  482   PLKVIW  499
              +++I+
Sbjct  1596  EMQIIY  1601



>ref|XP_006598946.1| PREDICTED: TMV resistance protein N-like isoform X1 [Glycine 
max]
 ref|XP_006598947.1| PREDICTED: TMV resistance protein N-like isoform X2 [Glycine 
max]
 ref|XP_006598948.1| PREDICTED: TMV resistance protein N-like isoform X3 [Glycine 
max]
 ref|XP_006598949.1| PREDICTED: TMV resistance protein N-like isoform X4 [Glycine 
max]
Length=1162

 Score = 87.4 bits (215),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 90/180 (50%), Gaps = 23/180 (13%)
 Frame = +2

Query  2    FLDLVCFSHKIP-EETNNAM---GHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF   +  +E  N +   G+   I I  ++++CL+         M+ L+ EMGR 
Sbjct  456  FLDIACFFKGMDIDEVKNILKNCGYHPEIGIDILIERCLVTLDRMKKLGMHDLLQEMGRN  515

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN----------------SPM  295
            I+  ESPN  G+RSRLW   D+  VL + KG ++I+ IVLN                S  
Sbjct  516  IVFQESPNDPGKRSRLWSQKDIDYVLTKNKGTDEIQGIVLNLVQPCDYEGRWSTEAFSKT  575

Query  296  KNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
              ++   + ++ L      LP  +L+ L W  CP+K++P     D++V LK+  S I++ 
Sbjct  576  SQLKLLMLCDMQLPRGLNCLP-SSLKVLHWRGCPLKTLPLNNKLDEVVDLKLPHSRIEQL  634


 Score = 57.0 bits (136),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 85/165 (52%), Gaps = 18/165 (11%)
 Frame = +3

Query  639   ESLDLGWCENLTRTPDFSGAKNLHKLSFYG-SSLEKVHYSNIDLWMQSKIDLWGCERLKK  815
             +S++L + +NL ++PDF GA NL  L   G +SL +VH S +     + ++L  C+RLK 
Sbjct  645   KSINLSFSKNLKQSPDFGGAPNLESLVLEGCTSLTEVHPSLVRHKKLAMMNLKDCKRLKT  704

Query  816   LPS----SSVEN---SGMLTHNF-PQFPPNLEDIRLYGCKNLEVVSATFPTSLEGIV---  962
             LPS    SS+++   SG     + P+F  ++E + +   +   +  A  P+SL  +V   
Sbjct  705   LPSKMEMSSLKDLNLSGCSEFKYLPEFGESMEHLSVLSLEGTAI--AKLPSSLGCLVGLA  762

Query  963   ---LYGCTNLKTLLELPQNLQSLYVFNCESLETVH-LPKMLEYVK  1085
                L  C NL  L +   NL SL V N      +  LP+ L+ +K
Sbjct  763   HLYLKNCKNLVCLPDTFHNLNSLIVLNVSGCSKLGCLPEGLKEIK  807



>gb|KEH23377.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=1134

 Score = 87.4 bits (215),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 60/188 (32%), Positives = 95/188 (51%), Gaps = 29/188 (15%)
 Frame = +2

Query  2    FLDLVCFSHKIP-EETNNAM---GHFSTIEIRNIVDKCLINYSCFN---WMYSLIPEMGR  160
            FLD+ CF   +  ++  N +   G+   I I+ ++D+ LI     N    M+ L+ EMGR
Sbjct  441  FLDISCFFKGMKRDKVINILENCGYHPEITIQVLIDRSLITLDRVNNKLGMHDLLQEMGR  500

Query  161  EIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMK  298
             I+  ESPN  G+RSRLW   D+  VL + KG EKI  +VLN              S   
Sbjct  501  NIVIQESPNDPGKRSRLWSKEDIDRVLTKNKGTEKISSVVLNSLQPYEARWSTEAFSMAT  560

Query  299  NMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFG  478
             ++   ++E+HL      LP  +L+ L+W  CP+K++      D++V +K+  S      
Sbjct  561  QIKLLSLNEVHLPLGLSCLP-SSLKVLRWRGCPLKTLAQTNQLDEVVDIKLSHSQ-----  614

Query  479  VPLKVIWQ  502
              L+++WQ
Sbjct  615  --LELLWQ  620



>ref|XP_003624058.1| TMV resistance protein N [Medicago truncatula]
 gb|AES80276.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=1127

 Score = 87.4 bits (215),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 92/188 (49%), Gaps = 29/188 (15%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETN----NAMGHFSTIEIRNIVDKCLINYSCFN---WMYSLIPEMGR  160
            FLD+ CF   +  +         G+   I I+ ++D+ LI     N    M+ L+ EMGR
Sbjct  441  FLDISCFFKGMKRDKVINILENCGYHPEITIQVLIDRSLITLDRVNNKLGMHDLLQEMGR  500

Query  161  EIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMK  298
             I+  ESPN  G+RSRLW   D+  VL + KG EKI  +VLN              S   
Sbjct  501  NIVIQESPNDPGKRSRLWSKEDIDRVLTKNKGTEKISSVVLNSLQPYEARWSTEAFSMAT  560

Query  299  NMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFG  478
             ++   ++E+HL      LP  +L+ L+W  CP+K++      D++V +K+  S      
Sbjct  561  QIKLLSLNEVHLPLGLSCLP-SSLKVLRWRGCPLKTLAQTNQLDEVVDIKLSHSQ-----  614

Query  479  VPLKVIWQ  502
              L+++WQ
Sbjct  615  --LELLWQ  620



>ref|XP_003613758.1| Disease resistance-like protein [Medicago truncatula]
 gb|AES96716.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=1095

 Score = 87.4 bits (215),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 93/174 (53%), Gaps = 21/174 (12%)
 Frame = +2

Query  2    FLDLVCF--SHKIPEETN---NAMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGRE  163
            FLD+ CF   +K+ +  N   +  G+     ++ ++DK LI  + +   ++ +I +MGRE
Sbjct  446  FLDITCFFKGYKLSDVMNILHSGRGYAPDYAVQVLIDKSLIKMNEYRVRIHDMIEDMGRE  505

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN-----------SPMKNMEY  310
            I+  ESP+K G RSRLW   D+  VL E KG +K E+IVLN           + +KNME 
Sbjct  506  IVRLESPSKPGGRSRLWFTKDILHVLKENKGSDKTEIIVLNLLKDKEVQWDGNALKNMEN  565

Query  311  NQ---IDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESN  463
             +   I++        HLP K+LR L+W   P  S+P  Y   KLV L + +S 
Sbjct  566  LKILVIEKTRFSRGPNHLP-KSLRVLKWFDYPESSLPAHYNPKKLVILDLSDST  618



>ref|XP_007044432.1| Tir-nbs-lrr resistance protein, putative isoform 3 [Theobroma 
cacao]
 gb|EOY00264.1| Tir-nbs-lrr resistance protein, putative isoform 3 [Theobroma 
cacao]
Length=1353

 Score = 87.4 bits (215),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 59/185 (32%), Positives = 90/185 (49%), Gaps = 30/185 (16%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETNNAMGHF------STIEIRNIVDKCLINYSCFN--WMYSLIPEMG  157
            FLD+ C    +  +  + +  F      + I IR + +K LI ++  +  WM+  + +MG
Sbjct  441  FLDIACLFVNMEMKREDMIDIFKGCDFKAEIAIRVLEEKSLIKFTGNDSLWMHDQLRDMG  500

Query  158  REIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN-----------------  286
            R+I+  +     G RSRLW  ND+  VL   KG   IE IV++                 
Sbjct  501  RQIVKDKDSGDLGMRSRLWARNDIMTVLENYKGTRSIEGIVMDKRKFVKKPGTGKEVVIY  560

Query  287  ----SPMKNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMW  454
                  M N+   QI+ + LEGNFK LPR+ L+ LQW  C +K++P  +   KL  L + 
Sbjct  561  TKSFESMVNLRLLQINHVKLEGNFKLLPRE-LKWLQWQGCALKTLPSDFCPQKLAVLDLS  619

Query  455  ESNIK  469
            ES I+
Sbjct  620  ESKIE  624



>ref|XP_007044433.1| Tir-nbs-lrr resistance protein, putative isoform 4 [Theobroma 
cacao]
 gb|EOY00265.1| Tir-nbs-lrr resistance protein, putative isoform 4 [Theobroma 
cacao]
Length=1167

 Score = 87.4 bits (215),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 59/185 (32%), Positives = 90/185 (49%), Gaps = 30/185 (16%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETNNAMGHF------STIEIRNIVDKCLINYSCFN--WMYSLIPEMG  157
            FLD+ C    +  +  + +  F      + I IR + +K LI ++  +  WM+  + +MG
Sbjct  441  FLDIACLFVNMEMKREDMIDIFKGCDFKAEIAIRVLEEKSLIKFTGNDSLWMHDQLRDMG  500

Query  158  REIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN-----------------  286
            R+I+  +     G RSRLW  ND+  VL   KG   IE IV++                 
Sbjct  501  RQIVKDKDSGDLGMRSRLWARNDIMTVLENYKGTRSIEGIVMDKRKFVKKPGTGKEVVIY  560

Query  287  ----SPMKNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMW  454
                  M N+   QI+ + LEGNFK LPR+ L+ LQW  C +K++P  +   KL  L + 
Sbjct  561  TKSFESMVNLRLLQINHVKLEGNFKLLPRE-LKWLQWQGCALKTLPSDFCPQKLAVLDLS  619

Query  455  ESNIK  469
            ES I+
Sbjct  620  ESKIE  624



>ref|XP_009335301.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=1026

 Score = 87.4 bits (215),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 94/192 (49%), Gaps = 28/192 (15%)
 Frame = +2

Query  2    FLDLVCF--SHKIP--EETNNAMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGREI  166
            FLD+ CF   + +    E         TI I+ +V+K LI        M+ L+ EMG+EI
Sbjct  445  FLDIACFFKGYDVAYVTEILQCCDLNPTIGIQLLVEKALITIDGTRIMMHDLLEEMGKEI  504

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP---------------MKN  301
            +  ESPN+ G+RSRLW P DV+ VL E  G   I+ I++  P               MKN
Sbjct  505  VRQESPNEPGKRSRLWFPEDVYSVLTENTGTNTIKGIIVKVPKPYNHICLNAKSFSKMKN  564

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFGV  481
            +++    +    G+F +L  + LR LQW +C ++S+P  +   KL KL M  S I     
Sbjct  565  LKFFVNCDALFSGDFDYLSNE-LRWLQWPKCSLRSLPSNFHPKKLYKLDMPRSCITR---  620

Query  482  PLKVIWQYFFKF  517
                +W+ F  F
Sbjct  621  ----LWEGFKAF  628



>ref|XP_007044430.1| Tir-nbs-lrr resistance protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY00262.1| Tir-nbs-lrr resistance protein, putative isoform 1 [Theobroma 
cacao]
Length=1382

 Score = 87.4 bits (215),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 59/185 (32%), Positives = 90/185 (49%), Gaps = 30/185 (16%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETNNAMGHF------STIEIRNIVDKCLINYSCFN--WMYSLIPEMG  157
            FLD+ C    +  +  + +  F      + I IR + +K LI ++  +  WM+  + +MG
Sbjct  441  FLDIACLFVNMEMKREDMIDIFKGCDFKAEIAIRVLEEKSLIKFTGNDSLWMHDQLRDMG  500

Query  158  REIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN-----------------  286
            R+I+  +     G RSRLW  ND+  VL   KG   IE IV++                 
Sbjct  501  RQIVKDKDSGDLGMRSRLWARNDIMTVLENYKGTRSIEGIVMDKRKFVKKPGTGKEVVIY  560

Query  287  ----SPMKNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMW  454
                  M N+   QI+ + LEGNFK LPR+ L+ LQW  C +K++P  +   KL  L + 
Sbjct  561  TKSFESMVNLRLLQINHVKLEGNFKLLPRE-LKWLQWQGCALKTLPSDFCPQKLAVLDLS  619

Query  455  ESNIK  469
            ES I+
Sbjct  620  ESKIE  624



>ref|XP_006598950.1| PREDICTED: TMV resistance protein N-like isoform X5 [Glycine 
max]
Length=1156

 Score = 87.4 bits (215),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 90/180 (50%), Gaps = 23/180 (13%)
 Frame = +2

Query  2    FLDLVCFSHKIP-EETNNAM---GHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF   +  +E  N +   G+   I I  ++++CL+         M+ L+ EMGR 
Sbjct  450  FLDIACFFKGMDIDEVKNILKNCGYHPEIGIDILIERCLVTLDRMKKLGMHDLLQEMGRN  509

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN----------------SPM  295
            I+  ESPN  G+RSRLW   D+  VL + KG ++I+ IVLN                S  
Sbjct  510  IVFQESPNDPGKRSRLWSQKDIDYVLTKNKGTDEIQGIVLNLVQPCDYEGRWSTEAFSKT  569

Query  296  KNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
              ++   + ++ L      LP  +L+ L W  CP+K++P     D++V LK+  S I++ 
Sbjct  570  SQLKLLMLCDMQLPRGLNCLP-SSLKVLHWRGCPLKTLPLNNKLDEVVDLKLPHSRIEQL  628


 Score = 56.6 bits (135),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 85/165 (52%), Gaps = 18/165 (11%)
 Frame = +3

Query  639   ESLDLGWCENLTRTPDFSGAKNLHKLSFYG-SSLEKVHYSNIDLWMQSKIDLWGCERLKK  815
             +S++L + +NL ++PDF GA NL  L   G +SL +VH S +     + ++L  C+RLK 
Sbjct  639   KSINLSFSKNLKQSPDFGGAPNLESLVLEGCTSLTEVHPSLVRHKKLAMMNLKDCKRLKT  698

Query  816   LPS----SSVEN---SGMLTHNF-PQFPPNLEDIRLYGCKNLEVVSATFPTSLEGIV---  962
             LPS    SS+++   SG     + P+F  ++E + +   +   +  A  P+SL  +V   
Sbjct  699   LPSKMEMSSLKDLNLSGCSEFKYLPEFGESMEHLSVLSLEGTAI--AKLPSSLGCLVGLA  756

Query  963   ---LYGCTNLKTLLELPQNLQSLYVFNCESLETVH-LPKMLEYVK  1085
                L  C NL  L +   NL SL V N      +  LP+ L+ +K
Sbjct  757   HLYLKNCKNLVCLPDTFHNLNSLIVLNVSGCSKLGCLPEGLKEIK  801



>gb|KHN34011.1| TMV resistance protein N [Glycine soja]
Length=1163

 Score = 87.4 bits (215),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 93/188 (49%), Gaps = 31/188 (16%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFNW--MYSLIPEMGRE  163
            FLD+ CF    S     +  N     + I IR+++DK LI  +  N   M+ LI EMGRE
Sbjct  447  FLDIACFLKGQSRDHVTKILNDCDFSADIGIRSLLDKALITTTYSNCIDMHDLIQEMGRE  506

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMI----------------------  277
            ++  ES    G+RSRLW P +++DVL   +G   +E I                      
Sbjct  507  VVREESVKFPGQRSRLWDPVEIYDVLTNNRGTAAVEGIWLDMTQITHINLSSKVFRKMPN  566

Query  278  --VLNSPMKNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKM  451
              +L     N +  +I+ ++L    + LP K LR L WN  P++S+P  +F +KLV+L M
Sbjct  567  LRLLTFKSHNGDSERINSVYLPKGLEFLP-KNLRYLGWNGYPLESLPSRFFPEKLVELSM  625

Query  452  WESNIKEF  475
              SN+++ 
Sbjct  626  PYSNVEKL  633



>ref|XP_006583492.1| PREDICTED: TMV resistance protein N-like [Glycine max]
Length=1171

 Score = 87.4 bits (215),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 93/188 (49%), Gaps = 31/188 (16%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFNW--MYSLIPEMGRE  163
            FLD+ CF    S     +  N     + I IR+++DK LI  +  N   M+ LI EMGRE
Sbjct  447  FLDIACFLKGQSRDHVTKILNDCDFSADIGIRSLLDKALITTTYSNCIDMHDLIQEMGRE  506

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMI----------------------  277
            ++  ES    G+RSRLW P +++DVL   +G   +E I                      
Sbjct  507  VVREESVKFPGQRSRLWDPVEIYDVLTNNRGTAAVEGIWLDMTQITHINLSSKVFRKMPN  566

Query  278  --VLNSPMKNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKM  451
              +L     N +  +I+ ++L    + LP K LR L WN  P++S+P  +F +KLV+L M
Sbjct  567  LRLLTFKSHNGDSERINSVYLPKGLEFLP-KNLRYLGWNGYPLESLPSRFFPEKLVELSM  625

Query  452  WESNIKEF  475
              SN+++ 
Sbjct  626  PYSNVEKL  633



>ref|XP_007044431.1| Tir-nbs-lrr resistance protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOY00263.1| Tir-nbs-lrr resistance protein, putative isoform 2 [Theobroma 
cacao]
Length=1172

 Score = 87.4 bits (215),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 59/185 (32%), Positives = 90/185 (49%), Gaps = 30/185 (16%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETNNAMGHF------STIEIRNIVDKCLINYSCFN--WMYSLIPEMG  157
            FLD+ C    +  +  + +  F      + I IR + +K LI ++  +  WM+  + +MG
Sbjct  441  FLDIACLFVNMEMKREDMIDIFKGCDFKAEIAIRVLEEKSLIKFTGNDSLWMHDQLRDMG  500

Query  158  REIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN-----------------  286
            R+I+  +     G RSRLW  ND+  VL   KG   IE IV++                 
Sbjct  501  RQIVKDKDSGDLGMRSRLWARNDIMTVLENYKGTRSIEGIVMDKRKFVKKPGTGKEVVIY  560

Query  287  ----SPMKNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMW  454
                  M N+   QI+ + LEGNFK LPR+ L+ LQW  C +K++P  +   KL  L + 
Sbjct  561  TKSFESMVNLRLLQINHVKLEGNFKLLPRE-LKWLQWQGCALKTLPSDFCPQKLAVLDLS  619

Query  455  ESNIK  469
            ES I+
Sbjct  620  ESKIE  624



>ref|XP_006478374.1| PREDICTED: TMV resistance protein N-like [Citrus sinensis]
Length=1348

 Score = 87.4 bits (215),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 90/178 (51%), Gaps = 21/178 (12%)
 Frame = +2

Query  2    FLDLVCF-SHKIPEETNNAMGHFS-TIEIRNIVDKCLINYSCFN--WMYSLIPEMGREII  169
            FLD+ CF   K  +  +  +      I I  +++K L+     N  WM+ LI EMGR+I+
Sbjct  441  FLDIACFFKRKTKDYVSKILDSCGFDIGISVLIEKSLLTVRENNRLWMHDLIQEMGRQIV  500

Query  170  HSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN----------------SPMKN  301
              +SP++ G+RSRLW   DVH VL +  G E +E I+++                S M N
Sbjct  501  RRQSPDEPGKRSRLWKEADVHHVLSQNTGSEVVEGIMVDDYFFRGNDVHLSAKAFSLMTN  560

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
            +   +I  + L    ++L  + LR L W++ P+KS+P     DK V  KM  S I+E 
Sbjct  561  LRLLKISNVQLPEGLEYLSNE-LRLLDWHRYPLKSLPSNLQLDKTVDFKMCYSRIEEL  617



>gb|ABE99702.1| TIR-NBS-LRR disease resistance-like protein [Populus trichocarpa]
Length=1142

 Score = 87.4 bits (215),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 88/179 (49%), Gaps = 22/179 (12%)
 Frame = +2

Query  2    FLDLVCF-----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGR  160
            FLD+ CF        + +      G+    ++  + ++ LI    F    M+ L+ +MGR
Sbjct  466  FLDIACFFIGRNKEYVAKVLEARCGYNPEDDLGTLSERSLIKVDAFGKISMHDLLRDMGR  525

Query  161  EIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNS--------------PMK  298
            +IIH ESP   G+RSR+W   D  +VL +  G E +E + L++               M+
Sbjct  526  DIIHKESPGHPGKRSRIWQREDAWNVLNKHMGTEVVEGLALDARASEDKSLSTGSFTKMR  585

Query  299  NMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
             ++  QI+ +HL G FK L  + L  + W +CP+KS P     D LV L M  SNIKE 
Sbjct  586  FLKLLQINGVHLTGPFKLLSEE-LIWICWLECPLKSFPSDLMLDNLVVLDMQHSNIKEL  643


 Score = 58.9 bits (141),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 80/163 (49%), Gaps = 16/163 (10%)
 Frame = +3

Query  879   NLEDIRLYGCKNLEVVSA-TFPTSLEGIVLYGCTNLKTLLELPQNLQSLYVFNCESLETV  1055
             +L+++ L G K L + S  +  T L+ + +  C+NL ++ ELP +L+ LY  +C S++ V
Sbjct  844   SLQELNLSGNKFLSLPSGISVLTKLQHLRVQNCSNLVSISELPSSLEKLYADSCRSMKRV  903

Query  1056  HLP---KMLEYVKLTHCKKLKEIQGWE----NAQFLTRIELRGVPNNIKFSEIINKVLKV  1214
              LP   K    + L  C  L EIQG E    +   +       + NN K S +  + L+ 
Sbjct  904   CLPIQSKTNPILSLEGCGNLIEIQGMEGLSNHGWVIFSSGCCDLSNNSKKSFV--EALRS  961

Query  1215  SKLNSNIEFE-GYLPNNETLSWIKFEENGSSISFQWPPLISNL  1340
                   I F+ G +P     SW+ F   GSS+SF  PP+   L
Sbjct  962   GGYGYQIHFDGGTMP-----SWLSFHGEGSSLSFHVPPVFQGL  999



>gb|KHN46715.1| TMV resistance protein N [Glycine soja]
Length=1077

 Score = 87.0 bits (214),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 90/180 (50%), Gaps = 23/180 (13%)
 Frame = +2

Query  2    FLDLVCFSHKIP-EETNNAM---GHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF   +  +E  N +   G+   I I  ++++CL+         M+ L+ EMGR 
Sbjct  371  FLDIACFFKGMDIDEVKNILKNCGYHPEIGIDILIERCLVTLDRMKKLGMHDLLQEMGRN  430

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN----------------SPM  295
            I+  ESPN  G+RSRLW   D+  VL + KG ++I+ IVLN                S  
Sbjct  431  IVFQESPNDPGKRSRLWSQKDIDYVLTKNKGTDEIQGIVLNLVQPCDYEGRWSTEAFSKT  490

Query  296  KNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
              ++   + ++ L      LP  +L+ L W  CP+K++P     D++V LK+  S I++ 
Sbjct  491  SQLKLLMLCDMQLPRGLNCLP-SSLKVLHWRGCPLKTLPLNNKLDEVVDLKLPHSRIEQL  549


 Score = 57.0 bits (136),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 85/165 (52%), Gaps = 18/165 (11%)
 Frame = +3

Query  639   ESLDLGWCENLTRTPDFSGAKNLHKLSFYG-SSLEKVHYSNIDLWMQSKIDLWGCERLKK  815
             +S++L + +NL ++PDF GA NL  L   G +SL +VH S +     + ++L  C+RLK 
Sbjct  560   KSINLSFSKNLKQSPDFGGAPNLESLVLEGCTSLTEVHPSLVRHKKLAMMNLKDCKRLKT  619

Query  816   LPS----SSVEN---SGMLTHNF-PQFPPNLEDIRLYGCKNLEVVSATFPTSLEGIV---  962
             LPS    SS+++   SG     + P+F  ++E + +   +   +  A  P+SL  +V   
Sbjct  620   LPSKMEMSSLKDLNLSGCSEFKYLPEFGESMEHLSVLSLEGTAI--AKLPSSLGCLVGLA  677

Query  963   ---LYGCTNLKTLLELPQNLQSLYVFNCESLETVH-LPKMLEYVK  1085
                L  C NL  L +   NL SL V N      +  LP+ L+ +K
Sbjct  678   HLYLKNCKNLVCLPDTFHNLNSLIVLNVSGCSKLGCLPEGLKEIK  722



>gb|ABB82028.1| TIR-NBS disease resistance-like protein [Populus trichocarpa]
Length=885

 Score = 87.0 bits (214),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 55/178 (31%), Positives = 90/178 (51%), Gaps = 21/178 (12%)
 Frame = +2

Query  2    FLDLVCF-----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGRE  163
            FLD+ CF        + +      G+   ++++ + ++ LI        M+ L+ +MGRE
Sbjct  381  FLDIACFFIDRKKEYVAKVLGARCGYNPEVDLQTLHERSLIKVLGETVTMHDLLRDMGRE  440

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKN  301
            ++  +SP + GER+R+W   D  +VL +QKG + +E + L+              + MK 
Sbjct  441  VVREKSPKQPGERTRIWNQEDAWNVLEQQKGTDVVEGLALDVRASEAKSLSAGSFAEMKC  500

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
            +   QI+ +HL G+FK L  K L  + W QCP+K  P  +  D L  L M  SN+KE 
Sbjct  501  LNLLQINGVHLTGSFKLLS-KELMWICWLQCPLKYFPSDFTLDNLAVLDMQYSNLKEL  557



>gb|ABF81416.1| NBS-LRR-TIR type disease resistance protein [Populus trichocarpa]
Length=925

 Score = 87.0 bits (214),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 60/177 (34%), Positives = 92/177 (52%), Gaps = 20/177 (11%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETNN----AMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGREI  166
            FLD+ CF     ++       + G  + I I  ++++ LI+ S    WM+ L+  MG+EI
Sbjct  277  FLDIACFLKGFKKDRITRILESRGFHAGIGIPVLIERSLISVSRDQVWMHDLLQIMGKEI  336

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP-MKNMEYN----------  313
            +  ESP + G RSRLW   DV   L++  G EKIE I L+ P +K+ ++N          
Sbjct  337  VRCESPEEPGRRSRLWTYEDVCLALMDNTGKEKIEAIFLDMPGIKDAQWNMEAFSKMSKL  396

Query  314  ---QIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
               +I+ + L    + L  K LR L+W   P KS+P G   D+LV+L M  SN+ + 
Sbjct  397  RLLKINNVQLSEGPEDLSNK-LRFLEWYSYPSKSLPAGLQVDELVELHMANSNLDQL  452



>gb|KEH28853.1| TIR-NBS-LRR class disease resistance protein [Medicago truncatula]
Length=299

 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 94/191 (49%), Gaps = 22/191 (12%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETN----NAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF   I         N+   F+ I I+ +V++ L+     N   M+ L+ +MGRE
Sbjct  109  FLDIACFFIGIDRNDVICILNSCRLFTEIGIKVLVERSLVIVDDKNKLGMHDLLRDMGRE  168

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKN  301
            II  +SP +  ERSRLW   DV DVL +  G + +E +    P              MK 
Sbjct  169  IIREKSPKEPEERSRLWFHGDVLDVLSKHTGTKVVEGLTFKMPGRSAQRFSTKAFENMKK  228

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFGV  481
            +   Q+  + L+G+FK+L R  L+ L WN  P+  I   ++   LV + +  SN+K    
Sbjct  229  LRLLQLSGVQLDGDFKYLSR-NLKWLHWNGFPLTCIASNFYQRNLVSVVLENSNVKLVWK  287

Query  482  PLKV-IWQYFF  511
             ++V IW + +
Sbjct  288  EMQVLIWSWMY  298



>ref|XP_008372274.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=628

 Score = 86.7 bits (213),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 61/187 (33%), Positives = 90/187 (48%), Gaps = 22/187 (12%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF          +   + G  + + I  +V K L+N    +   M+ L+ EM +E
Sbjct  441  FLDIACFFIGWKKSFAIQILESCGMNARLSIEVLVKKALLNVDEDDKIQMHDLVQEMAKE  500

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP---------------MK  298
            I+  +S    G RSRLW   DVH VL E  G ++IE I+L+SP               MK
Sbjct  501  IVRQQSLVVPGRRSRLWDYEDVHHVLTENSGTDQIEGIMLDSPEDSEAIPLNDESFLKMK  560

Query  299  NMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFG  478
            N+   +    H+ G   +LP  TLR L W+  P +S+P  ++  KLV L M  S +    
Sbjct  561  NLRVLKFRGAHICGEVPYLP-NTLRVLDWHGFPSQSLPSIFYPKKLVVLDMCRSGVSYLW  619

Query  479  VPLKVIW  499
              LKV++
Sbjct  620  KDLKVLY  626



>gb|ABF81437.1| TIR-NBS-LRR-TIR type disease resistance protein [Populus trichocarpa]
Length=1289

 Score = 87.0 bits (214),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 62/190 (33%), Positives = 97/190 (51%), Gaps = 26/190 (14%)
 Frame = +2

Query  2    FLDLVCFSHKIPEE----TNNAMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGREI  166
            FLD+ CF     ++      ++ G  + I  + +++K LI+ S    WM++L+  MG+EI
Sbjct  566  FLDIACFLKGFKKDRIIRILDSCGFHAHIGTQVLIEKSLISVSRDQVWMHNLLQIMGKEI  625

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKNM  304
            +  ESP + G RSRLW   DV   L++  G EKIE I L+ P              M  +
Sbjct  626  VRCESPEEPGRRSRLWTYEDVCLALMDNTGKEKIEAIFLDMPGIKESQWNIEAFSKMSRL  685

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF---  475
               +I+ + L    + L  K L+ L+W+  P KS+P G   D+LV+L M  SN+++    
Sbjct  686  RLLKINNVQLSEGPEDLSNK-LQFLEWHSYPSKSLPVGLQVDQLVELHMANSNLEQLWYG  744

Query  476  ---GVPLKVI  496
                V LK+I
Sbjct  745  CKSAVNLKII  754



>gb|ABF81414.1| TIR-NBS-LRR type disease resistance protein [Populus trichocarpa]
Length=1282

 Score = 87.0 bits (214),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 90/177 (51%), Gaps = 20/177 (11%)
 Frame = +2

Query  2    FLDLVCF--SHKIPEETN--NAMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGREI  166
            FLD+ CF    KI   T    + G  + I I  ++++ LI+ S    WM++L+  MG+EI
Sbjct  516  FLDIACFLKGFKIDRITRILQSRGFHAGIGIPVLIERSLISVSRDQVWMHNLLQIMGKEI  575

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKNM  304
            +  ESP + G RSRLW   DV   L++  G EKIE I  + P              M  +
Sbjct  576  VRCESPEEPGRRSRLWTYEDVCLALMDNTGKEKIEAIFFDMPGIKEAQWNMKAFSKMSRL  635

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
               +ID + L    ++L  K L  L+W+  P KS+P G   D+LV+L M  SN+ + 
Sbjct  636  RLLKIDNVQLSEGPENLSNKLL-FLEWHSYPSKSLPAGLQVDELVELHMANSNLDQL  691



>ref|XP_006373436.1| hypothetical protein POPTR_0017s13760g, partial [Populus trichocarpa]
 gb|ERP51233.1| hypothetical protein POPTR_0017s13760g, partial [Populus trichocarpa]
Length=725

 Score = 86.7 bits (213),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 62/190 (33%), Positives = 97/190 (51%), Gaps = 26/190 (14%)
 Frame = +2

Query  2    FLDLVCFSHKIPEE----TNNAMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGREI  166
            FLD+ CF     ++      ++ G  + I  + +++K LI+ S    WM++L+  MG+EI
Sbjct  258  FLDIACFLKGFKKDRIIRILDSCGFHAHIGTQVLIEKSLISVSRDQVWMHNLLQIMGKEI  317

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKNM  304
            +  ESP + G RSRLW   DV   L++  G EKIE I L+ P              M  +
Sbjct  318  VRCESPEEPGRRSRLWTYEDVCLALMDNTGKEKIEAIFLDMPGIKESQWNIEAFSKMSRL  377

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF---  475
               +I+ + L    + L  K L+ L+W+  P KS+P G   D+LV+L M  SN+++    
Sbjct  378  RLLKINNVQLSEGPEDLSNK-LQFLEWHSYPSKSLPVGLQVDQLVELHMANSNLEQLWYG  436

Query  476  ---GVPLKVI  496
                V LK+I
Sbjct  437  CKSAVNLKII  446



>ref|XP_006371044.1| hypothetical protein POPTR_0019s029201g, partial [Populus trichocarpa]
 gb|ERP48841.1| hypothetical protein POPTR_0019s029201g, partial [Populus trichocarpa]
Length=719

 Score = 86.7 bits (213),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/178 (31%), Positives = 89/178 (50%), Gaps = 21/178 (12%)
 Frame = +2

Query  2    FLDLVCF-----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGRE  163
            FLD+ CF        + +      G+   ++++ + ++ LI        M+ L+ +MGRE
Sbjct  95   FLDIACFFIDRRKEYVAKLLEARCGYNPEVDLQTLHERSLIKVLGETVTMHDLLRDMGRE  154

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKN  301
            ++   SP + G+R+R+W   D  +VL +QKG E +E + L+              + MK 
Sbjct  155  VVRESSPKEPGKRTRIWNQGDAWNVLEQQKGTEVVEGLKLDVRASEAKSLITGSFAKMKC  214

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
            +   QI+  HL G+FKHL  K L  + W+ CP+K  P  +  D L  L M  SN+KE 
Sbjct  215  LNLLQINGAHLTGSFKHL-SKVLMWICWHDCPLKYFPSDFTLDNLAVLDMQYSNLKEL  271



>ref|XP_006492471.1| PREDICTED: TMV resistance protein N-like isoform X1 [Citrus sinensis]
 ref|XP_006492472.1| PREDICTED: TMV resistance protein N-like isoform X2 [Citrus sinensis]
 ref|XP_006492473.1| PREDICTED: TMV resistance protein N-like isoform X3 [Citrus sinensis]
Length=1242

 Score = 87.0 bits (214),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/178 (33%), Positives = 91/178 (51%), Gaps = 21/178 (12%)
 Frame = +2

Query  2    FLDLVCF-SHKIPEETNNAMGHFS---TIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF   K  +     + +      I I  +++K L+    FN  WM+ L+ EMGR+
Sbjct  442  FLDIACFYKGKYIDYVTKILNYCDFDPIIGIGGLIEKSLLTVDDFNGLWMHDLLQEMGRQ  501

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKN  301
            I+  +SP + G RSRLW   DV  VL +  G + IE+IV +              S M N
Sbjct  502  IVRRQSPQEPGNRSRLWEEADVCHVLSQNTGTDAIEVIVFDCFSNKEMHFSAKAFSNMTN  561

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
            +   QI  + L G+ ++L  + LR L W + P++S+P     DKL++L +  S+I+  
Sbjct  562  LRVLQILYVQLLGDLEYLSNE-LRFLDWKRYPLRSLPSNSRLDKLIELNIPHSSIEHL  618


 Score = 53.5 bits (127),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 91/202 (45%), Gaps = 43/202 (21%)
 Frame = +3

Query  645   LDLGWCENLTRTPDFSGAKNLHKLSFYGSSLEKVHYSNIDLWMQSKIDLWGCERLKKLPS  824
             + L   ENL RTPDF+GA NL +L                        L GC RL ++  
Sbjct  631   MSLKHSENLIRTPDFTGAPNLEQLI-----------------------LEGCTRLHEIHP  667

Query  825   SSVENSGMLTHNFPQFPPNLEDIRLYGCKNLEVVSA-TFPTSLEGIVLYGCTNLKTLLEL  1001
             S      +L H    F      + L GC +L  + A  F  SLE +VL GC  LK   ++
Sbjct  668   S------LLVHKKLIF------LNLKGCTSLTTLPAKIFMKSLETLVLSGCLKLKKFPDI  715

Query  1002  PQNLQSLYVFNCESLETVHLPKMLE----YVKLT--HCKKLKEIQGWENA-QFLTRIELR  1160
               +++ L   + +  +   LP  +E     V+LT   CK L+ I    +A ++L+ + L 
Sbjct  716   VGSMECLQELHLDETDVKELPPSIELLSGLVRLTLYGCKNLERIPSTISALKYLSTLNLS  775

Query  1161  GVPNNIKFSEIINKVLKVSKLN  1226
             G+    +F EI+  + ++ +L+
Sbjct  776   GLLKFREFPEIVESMEQLLELH  797



>ref|XP_006495110.1| PREDICTED: TMV resistance protein N-like [Citrus sinensis]
Length=924

 Score = 86.7 bits (213),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 90/180 (50%), Gaps = 23/180 (13%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF    +     +  ++ G    I I  +++K L+     N  WM+ LI EMG +
Sbjct  100  FLDIACFFKWKTRDYVSKILDSCGFEPIIGISVLIEKSLLTIRENNRLWMHDLIQEMGHQ  159

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN----------------SPM  295
            I+  +SP++ G+RSRLW   DVH VL +  G E +E I+++                S M
Sbjct  160  IVRRQSPDEPGKRSRLWKEADVHHVLSQNTGSEVVEGIMVDDDFFRGNDVHLSAEAFSLM  219

Query  296  KNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
             N+   +I  + L    ++L  + LR L W + P+KS+P     DK V+ KM  S I+E 
Sbjct  220  TNLRLLKISNVQLPEGLEYLSNR-LRLLDWYRYPLKSLPSNLHLDKTVEFKMCYSRIEEL  278



>ref|XP_006370864.1| hypothetical protein POPTR_0019s01170g [Populus trichocarpa]
 gb|ERP48661.1| hypothetical protein POPTR_0019s01170g [Populus trichocarpa]
Length=1058

 Score = 86.7 bits (213),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/178 (31%), Positives = 90/178 (51%), Gaps = 21/178 (12%)
 Frame = +2

Query  2    FLDLVCF-----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGRE  163
            FLD+ CF        + +      G+   ++++ + ++ LI        M+ L+ +MGRE
Sbjct  477  FLDIACFFIDRKKEYVAKVLGARCGYNPEVDLQTLHERSLIKVLGETVTMHDLLRDMGRE  536

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKN  301
            ++  +SP + GER+R+W   D  +VL +QKG + +E + L+              + MK 
Sbjct  537  VVREKSPKQPGERTRIWNQEDAWNVLEQQKGTDVVEGLALDVRASEAKSLSAGSFAEMKC  596

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
            +   QI+ +HL G+FK L  K L  + W QCP+K  P  +  D L  L M  SN+KE 
Sbjct  597  LNLLQINGVHLTGSFKLLS-KELMWICWLQCPLKYFPSDFTLDNLAVLDMQYSNLKEL  653



>ref|XP_006385250.1| hypothetical protein POPTR_0003s02110g [Populus trichocarpa]
 gb|ABB82031.1| TIR-NBS disease resistance-like protein [Populus trichocarpa]
 gb|ERP63047.1| hypothetical protein POPTR_0003s02110g [Populus trichocarpa]
Length=1146

 Score = 81.6 bits (200),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/178 (31%), Positives = 89/178 (50%), Gaps = 21/178 (12%)
 Frame = +2

Query  2    FLDLVCFSHKIPEE-TNNAMG----HFSTIEIRNIVDKCLIN-YSCFNWMYSLIPEMGRE  163
            FLD+ CF   + +E     +G    +   + +  + ++ L+  +     M+ L+ +MGRE
Sbjct  477  FLDIACFFIDVEKEYVAKLLGARCRYNPEVVLETLRERSLVKVFGDMVTMHDLLRDMGRE  536

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKN  301
            ++   SP + G+R+R+W   D  +VL +QKG + +E + L+              + MK 
Sbjct  537  VVCKASPKEPGKRTRIWNQKDAWNVLEQQKGTDVVEGLALDVRASEAKSLSTGSFAKMKR  596

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
            +   QI+  HL G+FK L  K L  + W QCP K  P  +  D LV L M  SN+KE 
Sbjct  597  LNLLQINGAHLTGSFKLLS-KELMWICWLQCPSKYFPSDFTLDNLVVLDMQYSNLKEL  653


 Score = 26.9 bits (58),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 50/110 (45%), Gaps = 21/110 (19%)
 Frame = +3

Query  594  GFYLLNPLK*YFLCHESLDLGWCENLTRTPDFSGAKNLHKLSFYG-SSLEKVHYSNIDLW  770
            G  +LN LK   L H        ++L +TP+   + +L KL   G SSL  VH S  +L 
Sbjct  656  GKKILNRLKIINLSHS-------QHLIKTPNLHSS-SLEKLILKGCSSLVDVHQSIGNLT  707

Query  771  MQSKIDLWGCERLKKLPSSSVENSGMLTHNFPQFPPNLEDIRLYGCKNLE  920
                ++L GC  LK LP  S+ N             +LE + + GC  LE
Sbjct  708  SLVFLNLEGCWSLKILP-KSIGNV-----------KSLETLNISGCSQLE  745



>ref|XP_003622506.1| TMV resistance protein N [Medicago truncatula]
 gb|KEH18830.1| disease resistance protein (TIR-NBS-LRR class), putative [Medicago 
truncatula]
Length=1137

 Score = 86.7 bits (213),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 88/179 (49%), Gaps = 22/179 (12%)
 Frame = +2

Query  2    FLDLVCF--SHKIPE--ETNNAMGHFSTIEIRNIVDKCLINYSCFN---WMYSLIPEMGR  160
            FLD+ CF     I E  E     G+   I I  ++++ L      +   WM+ L+ EMGR
Sbjct  447  FLDIACFFKGMDIDEVIEILEGCGYHPKIGIDILIERSLATLDRGDNKLWMHDLLQEMGR  506

Query  161  EIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMK  298
             I+  ESPN  G+RSRLW   DV  VL + KG +KI+ I ++              S + 
Sbjct  507  NIVFEESPNDPGKRSRLWSQKDVDQVLRQNKGTDKIQGIAMDLVQPYEASWKIEAFSKIS  566

Query  299  NMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
             +   ++ EI L       P  +LR L W+ CP++++P      ++V +K++ S I++ 
Sbjct  567  QLRLLKLCEIKLPLGLNRFP-SSLRVLDWSGCPLRTLPLTNHLVEIVAIKLYRSKIEQL  624



>emb|CDP07826.1| unnamed protein product [Coffea canephora]
Length=1159

 Score = 68.2 bits (165),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/177 (31%), Positives = 86/177 (49%), Gaps = 20/177 (11%)
 Frame = +2

Query  2    FLDLVCF-SHKIPEETNNAMGHFS---TIEIRNIVDKCLINYSCFN-WMYSLIPEMGREI  166
            FLD+ CF   K  E     +  F+    I I+ +++K LI  S     M+ LI EMG +I
Sbjct  446  FLDIACFFKGKKKENIARVLDSFNFYPHIGIKVLIEKSLITVSKGRILMHPLIQEMGWQI  505

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEM--IVLNSP------------MKNM  304
            +  ++P + G+ SRLW   D+ DVL   +  E +E   + L++P            M  +
Sbjct  506  VREKAPEEPGKHSRLWVDEDICDVLARDRVTENVEGLWLHLSTPKYVAIKNEAFEKMIKL  565

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
               +I   ++     HLP + +R L W+  P KS+P  +  +KLV +K+  S I E 
Sbjct  566  RLLKIHNAYVSRGPNHLPNE-IRWLNWHGYPSKSLPDSFQAEKLVGIKLQNSRIIEL  621


 Score = 40.4 bits (93),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/183 (29%), Positives = 77/183 (42%), Gaps = 29/183 (16%)
 Frame = +3

Query  594   GFYLLNPLK*YFLCHESLDLGWCENLTRTPDFSGAKNLHKLSFYG-SSLEKVHYSNIDLW  770
             G   LN LK   L H        + L RTPDF+G  +L +L     SSL ++H     L 
Sbjct  624   GIKFLNKLKFINLSHS-------QKLLRTPDFTGIPSLERLVLENCSSLIEIHSPAGYLK  676

Query  771   MQSKIDLWGCERLKKLPSSSVENSGMLTHNFPQFPPNLEDIRLYGCKNL-EVVSATFPTS  947
                 ++L  C  L++LP   +  S             LE I L GC  + E      P +
Sbjct  677   SLKLLNLRNCTSLRRLPKQILLES-------------LEVIILSGCSKVDEFPEIMGPMN  723

Query  948   LEGIVLYGCTNLKTLLELPQNLQSLYVFN---CESL----ETVHLPKMLEYVKLTHCKKL  1106
                 V +  T +K L    +NL +L V N   C+SL     ++   K L+ + L+ C KL
Sbjct  724   HLRAVYWEATAVKELPPSIENLTALVVLNLSYCKSLASLPSSISKLKCLKALILSGCSKL  783

Query  1107  KEI  1115
               +
Sbjct  784   GRL  786



>gb|AGV28084.1| NBS-LRR protein [Malus domestica]
Length=1095

 Score = 66.6 bits (161),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 84/198 (42%), Gaps = 49/198 (25%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFNW-MYSLIPEMGREI  166
            FLD+ CF          +  +  G F+T  I  + ++CL+        M+ L+ EM R I
Sbjct  494  FLDISCFFIGRDKDYVAKVLDGCGFFATGGISVLRERCLVTVEGNKLTMHDLLREMARVI  553

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP------------------  292
            I  +S +  G+ SRLW   +V DVL  + G  +IE + L  P                  
Sbjct  554  ISEKSLDCPGKWSRLWNRQEVTDVLTNKSGTGEIEGLALYFPKETKIASFSTKAFAIMKK  613

Query  293  ------------------------MKNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPV  400
                                    MK +   Q+  + L+G +KHLP K L  L+W  CP+
Sbjct  614  LSLLALLFRKETKIASFSTKAFAKMKKLRLLQLSNVELKGEYKHLP-KELIWLRWEGCPL  672

Query  401  KSIPFGYFFD-KLVKLKM  451
            KS+P  +F   +LV L+M
Sbjct  673  KSLPDDFFNQPRLVVLEM  690


 Score = 42.0 bits (97),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/204 (28%), Positives = 86/204 (42%), Gaps = 30/204 (15%)
 Frame = +3

Query  573   KFLICFYGFYLLNPLK*YFLCHESLDLGWCENLTRTPDFSGAKNLHKLSFYGS-SLEKVH  749
             K +  + GF  L+ LK       +LDL W ++L ++PDFS   NL +L      +L ++H
Sbjct  694   KLVQVWKGFKSLHNLK-------TLDLSWSDSLQKSPDFSQVPNLEELILEACINLSEIH  746

Query  750   YSNIDLWMQSKIDLWGCERLKKLPSS-----SVENSGMLTHNFPQFPPNLEDI-RLYGCK  911
              S   L   S ++L  C +L  LP       SVE   +L +N  QF    EDI  +   +
Sbjct  747   PSIGHLKRLSLVNLKWCNKLISLPRDFYKLKSVET--LLLNNSYQFREVHEDIGEMISLR  804

Query  912   NLEVVSATFPTSLEGIVLYGCTNLKTLLELPQNLQSLYVFNCESLETVHLPKMLEYVKLT  1091
              LE            IV  G  NL T L L   ++            + LP  L  + LT
Sbjct  805   TLEARGTAIREVPPSIV--GLKNL-TRLSLEGTMRG-----------IQLPHSLREIDLT  850

Query  1092  HCKKLKEIQGWENAQFLTRIELRG  1163
             +      I+   +  +L  + L+G
Sbjct  851   YGALDDAIKDLGSLIYLQHLHLQG  874



>ref|XP_011001241.1| PREDICTED: TMV resistance protein N-like [Populus euphratica]
Length=933

 Score = 86.7 bits (213),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 62/179 (35%), Positives = 91/179 (51%), Gaps = 22/179 (12%)
 Frame = +2

Query  2    FLDLVCF-SHKIPEETNNAM----GHFSTIEIRNIVDKCLI--NYSCFNWMYSLIPEMGR  160
            FLD+ CF   +  E   N +    G+    ++  + ++ LI  N S    M+ L+ +MGR
Sbjct  476  FLDIACFFIGRNKEYVANVLEVRCGYHPEDDLGTLSERSLIKVNASGKISMHDLLRDMGR  535

Query  161  EIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMK  298
            EI+H ESPN  G+RSR+W   D  +VL +QKG   +E IVL+                M+
Sbjct  536  EIVHKESPNHPGKRSRIWQCEDAWNVLSKQKGTNAVEGIVLDVRSSEDKSVSTRSFKKMR  595

Query  299  NMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
             ++  QI+ +HL G F  L  + L  + W +CP+K  P     D +V L M  SNIKE 
Sbjct  596  CLKLLQINGVHLTGPFTLLSEE-LIWICWLECPLKYFPSNLTLDNVVVLDMQYSNIKEL  653



>gb|ABF81431.1| TIR-NBS-LRR-TIR type disease resistance protein [Populus trichocarpa]
 gb|ABF81454.1| TIR-NBS-LRR type disease resistance protein [Populus trichocarpa]
Length=918

 Score = 86.7 bits (213),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 96/190 (51%), Gaps = 26/190 (14%)
 Frame = +2

Query  2    FLDLVCF--SHKIPEETN--NAMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGREI  166
            FLD+ CF    KI   T    + G  + I I  ++++ LI+ S    WM++L+  MG+EI
Sbjct  368  FLDIACFLMGFKIDRITRILESRGFNAGIGISVLIERSLISVSRDQVWMHNLLQIMGKEI  427

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKNM  304
            +  ESP + G RSRLW   DV   L++  G EKIE I L+ P              M  +
Sbjct  428  VRCESPEEPGRRSRLWTYKDVCLALMDNTGKEKIEAIFLDMPGIKEAQWNMKAFSKMSRL  487

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF---  475
               +I  + L    + L  + LR L+WN  P KS+P  +  D+LV+L M  S+I++    
Sbjct  488  RLLKIHNVQLSEGPEALSNE-LRFLEWNSYPSKSLPACFQMDELVELHMANSSIEQLWYG  546

Query  476  ---GVPLKVI  496
                V LK+I
Sbjct  547  YKSAVNLKII  556



>ref|XP_010064472.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=722

 Score = 86.3 bits (212),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/172 (34%), Positives = 83/172 (48%), Gaps = 20/172 (12%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGREI  166
            FLD+ CF          E  +  G ++ I I+ +VDK LI       WM+ L+ EM  EI
Sbjct  398  FLDIACFFKGKEKSYVTEVLDNCGLYADIGIKVLVDKSLIQIIGNKLWMHDLLQEMAWEI  457

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKNM  304
            +  ESP + G+RSR+W   DV +VL +  G  K++ IVL S               M N+
Sbjct  458  VRQESPEEPGQRSRIWLFEDVCNVLSKNSGTGKVKAIVLQSGDYRTVRLNGESFSNMTNL  517

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWES  460
                +  IH    FK L  + LR L+W+ C +KS P  +    LV+  M +S
Sbjct  518  RLLHVRAIHFSSGFKQLSNE-LRMLRWDNCNLKSFPPSFLPKNLVEFHMQDS  568



>gb|KEH25080.1| disease resistance protein (TIR-NBS-LRR class), putative [Medicago 
truncatula]
Length=1513

 Score = 86.7 bits (213),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/179 (34%), Positives = 91/179 (51%), Gaps = 26/179 (15%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETN------NAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMG  157
            FL++ CF   I  +TN      N  G F+ I I  ++++ L+     +   M+ L+ +MG
Sbjct  818  FLNIACFF--IDMDTNDVTHILNGCGLFAEIGISILIERSLVTVDAKDRLGMHDLLRDMG  875

Query  158  REIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSPMKN------------  301
            REII  ESP    ER RLW   DV DVL +Q G + I+ + L  P  N            
Sbjct  876  REIIREESPEVFEERCRLWFHEDVLDVLSKQTGTKSIKGLALKLPRANAKCLSTKAFKEM  935

Query  302  ---MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIK  469
               +   Q+D + L+G+F+ L R  LR L WN  P+  IP  ++ + LV +++  SN+K
Sbjct  936  TTRLRLLQLDGVKLDGDFEILSR-NLRWLCWNGFPLTHIPTDFYRESLVSIELENSNVK  993



>ref|XP_006389205.1| hypothetical protein POPTR_0035s00260g [Populus trichocarpa]
 gb|ERP48119.1| hypothetical protein POPTR_0035s00260g [Populus trichocarpa]
Length=1144

 Score = 86.7 bits (213),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/177 (34%), Positives = 92/177 (52%), Gaps = 20/177 (11%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETNN----AMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGREI  166
            FLD+ CF     ++       + G  + I I  ++++ LI+ S    WM+ L+  MG+EI
Sbjct  285  FLDIACFLKGFKKDRITRILESRGFHAGIGIPVLIERSLISVSRDQVWMHDLLQIMGKEI  344

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP-MKNMEYN----------  313
            +  ESP + G RSRLW   DV   L++  G EKIE I L+ P +K+ ++N          
Sbjct  345  VRCESPEEPGRRSRLWTYEDVCLALMDNTGKEKIEAIFLDMPGIKDAQWNMEAFSKMSKL  404

Query  314  ---QIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
               +I+ + L    + L  K LR L+W   P KS+P G   D+LV+L M  SN+ + 
Sbjct  405  RLLKINNVQLSEGPEDLSNK-LRFLEWYSYPSKSLPAGLQVDELVELHMANSNLDQL  460



>ref|XP_006441744.1| hypothetical protein CICLE_v10024507mg [Citrus clementina]
 gb|ESR54984.1| hypothetical protein CICLE_v10024507mg [Citrus clementina]
Length=1026

 Score = 86.3 bits (212),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 89/178 (50%), Gaps = 21/178 (12%)
 Frame = +2

Query  2    FLDLVCF-SHKIPEETNNAMGHFS---TIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF   K  +     + +      I I +++ K L+    FN  WM+ L+ EMGR+
Sbjct  226  FLDIACFYKGKYIDYVTKILNYCDFDPIIGIGSLIQKSLVTVDDFNGLWMHDLLQEMGRQ  285

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKN  301
            I+   SP + G RSRLW   DV  VL +  G + +E+I+ +              S M N
Sbjct  286  IVRRHSPQEPGNRSRLWEEADVCHVLSQNTGTDAVEVIIFDRFSNKEMHFSAQAFSNMTN  345

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
            +   QI  + L G+ ++L  + LR L W + P KS+P     DKL++L +  S+I+  
Sbjct  346  LRVLQIHYVQLLGDLEYLSNE-LRLLDWKRYPSKSLPSNLRLDKLIELNIPHSSIEHL  402



>gb|ABE99701.1| TIR-NBS-LRR disease resistance-like protein [Populus balsamifera]
Length=1116

 Score = 86.3 bits (212),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 88/179 (49%), Gaps = 22/179 (12%)
 Frame = +2

Query  2    FLDLVCF-----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGR  160
            FLD+ CF        + +      G+    ++  + ++ LI    F    M+ L+ +MGR
Sbjct  476  FLDIACFFIGRNKEYVAKVLEARCGYNPEDDLGTLSERSLIKVDAFGKISMHDLLRDMGR  535

Query  161  EIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNS--------------PMK  298
            +IIH ESP   G+RSR+W   D  +VL +  G E +E + L++               M+
Sbjct  536  DIIHKESPGHPGKRSRIWQREDAWNVLNKHMGTEVVEGLALDARASEDKSLSTGSFTKMR  595

Query  299  NMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
             ++  QI+ +HL G FK L  + L  + W +CP+KS P     D LV L M  SNIKE 
Sbjct  596  FLKLLQINGVHLTGPFKLLSEE-LIWICWLECPLKSFPSDLMLDNLVVLDMQYSNIKEL  653



>ref|XP_007200952.1| hypothetical protein PRUPE_ppa000577mg [Prunus persica]
 gb|EMJ02151.1| hypothetical protein PRUPE_ppa000577mg [Prunus persica]
Length=1089

 Score = 86.3 bits (212),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 91/188 (48%), Gaps = 24/188 (13%)
 Frame = +2

Query  2    FLDLVCFSHKIPE----ETNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF   + +    E           ++  +V+K LIN +     WM+ LI EMG+E
Sbjct  437  FLDIACFFKGVGKDYVIEILEGCDLNPKYDLEVLVEKALINITEEGRIWMHDLIEEMGKE  496

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP-----------------  292
            ++  ESP + G+RSRLW   DV  VL E  G +KI+ I++  P                 
Sbjct  497  VVRQESPTEPGKRSRLWFHEDVDHVLTENTGTDKIKGIMVKLPAGLESDEICLNAKSFSK  556

Query  293  MKNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKE  472
            MKN+         L G   +LP + LR L+W + P++S+P  +   KLV L M  S I +
Sbjct  557  MKNLRILLNRNARLSGEVDYLPNE-LRLLRWPEYPLQSLPANFNPKKLVGLTMPRSRILQ  615

Query  473  FGVPLKVI  496
              + LK +
Sbjct  616  LDLELKSL  623



>ref|XP_010555078.1| PREDICTED: TMV resistance protein N-like [Tarenaya hassleriana]
Length=844

 Score = 86.3 bits (212),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 84/164 (51%), Gaps = 17/164 (10%)
 Frame = +2

Query  32   IPEETN-NAMGHFSTIEIRNIVDKCLINYSCFNWM-YSLIPEMGREIIHSESPNKSGERS  205
            IPEE N +  G    I +  +  +CLI       M + LI +MGR I+  +SP   G+RS
Sbjct  370  IPEELNTDGCGLCPDIGLSELTGRCLIEVQDNKLMMHDLIRDMGRFIVKEKSPKNCGKRS  429

Query  206  RLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKNMEYNQIDEIHLEGN  343
            RLW  +DV DVL +  G EK+E + LN              S M+ +   Q++ + L+G+
Sbjct  430  RLWDADDVIDVLTKYSGTEKVEGLSLNAQPPDMESLDAKALSNMRELRLLQLNRVQLKGS  489

Query  344  FKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
            + + P K LR L W+  P K IP  +F   L  + M  SN++ F
Sbjct  490  YANFP-KGLRWLCWHGFPFKFIPAEFFQRNLAVMDMHYSNLRRF  532



>ref|XP_003618337.1| Resistance protein [Medicago truncatula]
Length=1205

 Score = 74.3 bits (181),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 62/198 (31%), Positives = 89/198 (45%), Gaps = 25/198 (13%)
 Frame = +2

Query  2    FLDLVCFSHKIP-EETNNAMGHFSTIEIRN----IVDKCLINY--SCFNWMYSLIPEMGR  160
            FLD+ CF      EE  + +    T  I+N    +V+K LI     C   ++ LI EMG+
Sbjct  587  FLDIACFFKGCRLEEFQDILDAHYTYCIKNHIGVLVEKSLIKIIGGCVT-LHDLIEEMGK  645

Query  161  EIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN----------------SP  292
            EI+  ESP + G+RSRLW   D+  VL    G  KIE++ LN                  
Sbjct  646  EIVRQESPKEPGKRSRLWSHEDIVPVLHANSGTRKIEILYLNFSLSKEEEVEWKGDELKK  705

Query  293  MKNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKE  472
            M+N+    I         +HLP   LR L W + P ++    +F  KL   ++ ES++  
Sbjct  706  MENLRTIIIRNCPFSKGCQHLP-NGLRVLDWPKYPSENFTSDFFPRKLSICRLRESSLTT  764

Query  473  FGVPLKVIWQYFFKFNSS  526
            F  P        F F+SS
Sbjct  765  FEFPSSSKVGVMFSFSSS  782


 Score = 33.9 bits (76),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 51/115 (44%), Gaps = 9/115 (8%)
 Frame = +3

Query  567  IQKFLICFYGFYLLNPLK*YFLCHESLDLGWCENLTRTPDFSGAKNLHKLSFYG-SSLEK  743
            I  F      FY L      FLC   L+L   ++LT+  D SG  NL  LSF   S+L  
Sbjct  791  ITHFFSSLSLFYFLQK----FLCMRELNLDHNQSLTQILDISGLLNLEILSFRDCSNLIT  846

Query  744  VHYSNIDLWMQSKIDLWGCERLKKLPSSSVEN--SGMLTH--NFPQFPPNLEDIR  896
            +H S   L     +++ GC +L   P   + +     L+H  N   FP  L D++
Sbjct  847  IHNSIGFLNKLKILNVTGCSKLSSFPPIKLTSLLKLELSHCNNLKSFPEILGDMK  901



>ref|XP_010087987.1| TMV resistance protein N [Morus notabilis]
 gb|EXB30997.1| TMV resistance protein N [Morus notabilis]
Length=1129

 Score = 86.3 bits (212),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/176 (33%), Positives = 93/176 (53%), Gaps = 21/176 (12%)
 Frame = +2

Query  2    FLDLVCFSHKIPE----ETNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF   +      +  +  G F+ I I  ++ +CL+  +  N   M+ L+ +MGR+
Sbjct  442  FLDISCFFVGMDRNYVLQILDGCGFFAEIGISVLLQRCLVTINEENKLTMHGLLRDMGRD  501

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKN  301
            I+  ESP + G+RSRLW   DV DVL ++ G +KIE + L               + M+ 
Sbjct  502  IVRKESPKELGKRSRLWHQEDVIDVLTKETGTQKIEGLSLKRERHNIVGFNTQAFAIMQG  561

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIK  469
            +   Q+  + L G++++L  K LR L W+  P+K IP  ++   LV L M  SN+K
Sbjct  562  LRLLQLYYVKLNGSYEYLS-KELRWLCWHGFPMKFIPNEFYLGNLVALNMKYSNLK  616



>ref|XP_006389210.1| hypothetical protein POPTR_0035s00310g [Populus trichocarpa]
 gb|ERP48124.1| hypothetical protein POPTR_0035s00310g [Populus trichocarpa]
Length=658

 Score = 85.9 bits (211),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 91/177 (51%), Gaps = 20/177 (11%)
 Frame = +2

Query  2    FLDLVCF--SHKIPEETN--NAMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGREI  166
            FLD+ CF    KI   T    + G  + I I  ++++ LI+ S    WM++L+  MG+EI
Sbjct  220  FLDIACFLMGFKIDRITRILESRGFNAGIGISVLIERSLISVSRDQVWMHNLLQIMGKEI  279

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKNM  304
            +  ESP + G RSRLW   DV   L++  G EKIE I L+ P              M  +
Sbjct  280  VRCESPEEPGRRSRLWTYKDVCLALMDNTGKEKIEAIFLDMPGIKEAQWNMKAFSKMSRL  339

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
               +I  + L    + L  + LR L+WN  P KS+P  +  D+LV+L M  S+I++ 
Sbjct  340  RLLKIHNVQLSEGPEALSNE-LRFLEWNSYPSKSLPACFQMDELVELHMANSSIEQL  395



>ref|XP_011011966.1| PREDICTED: TMV resistance protein N-like isoform X1 [Populus 
euphratica]
Length=1740

 Score = 86.3 bits (212),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 96/190 (51%), Gaps = 26/190 (14%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETNN----AMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGREI  166
            FLD+ CF     ++       + G  + I +  ++++ LI+ S    WM++L+  MG+EI
Sbjct  748  FLDIACFLKGFKKDRITRILESRGFHAGIGLPILIERSLISVSRDQVWMHNLLQIMGKEI  807

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKNM  304
            +  ESP + G RSRLW   DV   L++  G EKIE I L+ P              M  +
Sbjct  808  VRCESPEEPGRRSRLWTYEDVCLALMDNTGKEKIEAIFLDMPGIKEAQWNMEAFSKMSKL  867

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF---  475
               +ID + L    + L  K LR L+W+  P KS+P G   D+LV+L M  +++++    
Sbjct  868  RLLKIDNVQLSEGPEDLSNK-LRFLEWHSYPSKSLPAGLQVDELVELHMANTSLEQLWYG  926

Query  476  ---GVPLKVI  496
                V LK+I
Sbjct  927  CKSAVNLKII  936



>gb|KEH25074.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=1045

 Score = 85.9 bits (211),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 87/176 (49%), Gaps = 22/176 (13%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETN----NAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF   +         N    F+ I +  +V++ L+     N   M+ L+ +MGRE
Sbjct  436  FLDIACFFIGMDRNDVTLILNGCELFAEIGVSVLVERSLVTVDDRNKLGMHDLLRDMGRE  495

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKN  301
            II  +S    G RSRLW   DV DVL EQ G + +E + L  P              M+ 
Sbjct  496  IIREKSEEPEG-RSRLWFDKDVFDVLSEQNGTKVVEGLALKLPRENAKCFSTKAFKKMEK  554

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIK  469
            +   Q+  + L+G+F+HL R  LR L WN  P+  IP  ++   LV +++  SNIK
Sbjct  555  LRLLQLAGVQLDGDFEHLSR-NLRWLSWNGFPLTCIPSSFYQGNLVSIELVNSNIK  609



>gb|KCW67569.1| hypothetical protein EUGRSUZ_F01321, partial [Eucalyptus grandis]
Length=1008

 Score = 85.9 bits (211),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/172 (35%), Positives = 84/172 (49%), Gaps = 20/172 (12%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGREI  166
            FLD+ CF          E  +  G ++ I I+ +VDK LI       WM+ L+ EM  EI
Sbjct  384  FLDIACFFKGKEKLYVTEVLDKCGFYADIGIKVLVDKSLIQIVGNKLWMHDLLQEMAWEI  443

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKNM  304
            +  ES  + GERSR+W   DV  +L +  G  K++ IVL S               M N+
Sbjct  444  VRRESLEEQGERSRVWLFEDVVHILSKNSGTGKVKAIVLQSRDPRTVHLNGESFTNMTNL  503

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWES  460
                I  +HL   FKHL  + LR L+W+ C +KS P  +    LV+L M +S
Sbjct  504  RLLDICAMHLSSRFKHLSNE-LRLLRWDNCSLKSFPPCFLPKNLVELHMQDS  554



>ref|XP_011011967.1| PREDICTED: TMV resistance protein N-like isoform X2 [Populus 
euphratica]
Length=1738

 Score = 86.3 bits (212),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 96/190 (51%), Gaps = 26/190 (14%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETNN----AMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGREI  166
            FLD+ CF     ++       + G  + I +  ++++ LI+ S    WM++L+  MG+EI
Sbjct  746  FLDIACFLKGFKKDRITRILESRGFHAGIGLPILIERSLISVSRDQVWMHNLLQIMGKEI  805

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKNM  304
            +  ESP + G RSRLW   DV   L++  G EKIE I L+ P              M  +
Sbjct  806  VRCESPEEPGRRSRLWTYEDVCLALMDNTGKEKIEAIFLDMPGIKEAQWNMEAFSKMSKL  865

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF---  475
               +ID + L    + L  K LR L+W+  P KS+P G   D+LV+L M  +++++    
Sbjct  866  RLLKIDNVQLSEGPEDLSNK-LRFLEWHSYPSKSLPAGLQVDELVELHMANTSLEQLWYG  924

Query  476  ---GVPLKVI  496
                V LK+I
Sbjct  925  CKSAVNLKII  934



>gb|ABF81417.1| TIR-NBS-LRR type disease resistance protein [Populus trichocarpa]
Length=1867

 Score = 86.3 bits (212),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 62/190 (33%), Positives = 95/190 (50%), Gaps = 26/190 (14%)
 Frame = +2

Query  2     FLDLVCFSHKIPEETNN----AMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGREI  166
             FLD+ CF     ++       + G  + I I  ++++ LI+ S    WM+ L+  MG+EI
Sbjct  1262  FLDIACFLKGFKKDRITRILESRGFHAGIGIPVLIERSLISVSRDQVWMHDLLQIMGKEI  1321

Query  167   IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKNM  304
             +  ESP + G RSRLW   DV   L++  G EKIE I L+ P              M  +
Sbjct  1322  VRCESPEEPGRRSRLWTYEDVCLALMDNTGKEKIEAIFLDMPGIKEAQWNMKAFSKMSRL  1381

Query  305   EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF---  475
                +I+ + L    + L  + LR L+W+  P KS+P G   D+LV+L M  S+I++    
Sbjct  1382  RLLKINNLQLSKGPEDLSNQ-LRFLEWHSYPSKSLPAGLQVDELVELHMANSSIEQLWYG  1440

Query  476   ---GVPLKVI  496
                 V LK+I
Sbjct  1441  YKSAVNLKII  1450



>ref|XP_011011969.1| PREDICTED: TMV resistance protein N-like isoform X3 [Populus 
euphratica]
Length=1737

 Score = 86.3 bits (212),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 96/190 (51%), Gaps = 26/190 (14%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETNN----AMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGREI  166
            FLD+ CF     ++       + G  + I +  ++++ LI+ S    WM++L+  MG+EI
Sbjct  748  FLDIACFLKGFKKDRITRILESRGFHAGIGLPILIERSLISVSRDQVWMHNLLQIMGKEI  807

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKNM  304
            +  ESP + G RSRLW   DV   L++  G EKIE I L+ P              M  +
Sbjct  808  VRCESPEEPGRRSRLWTYEDVCLALMDNTGKEKIEAIFLDMPGIKEAQWNMEAFSKMSKL  867

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF---  475
               +ID + L    + L  K LR L+W+  P KS+P G   D+LV+L M  +++++    
Sbjct  868  RLLKIDNVQLSEGPEDLSNK-LRFLEWHSYPSKSLPAGLQVDELVELHMANTSLEQLWYG  926

Query  476  ---GVPLKVI  496
                V LK+I
Sbjct  927  CKSAVNLKII  936



>gb|ABF81423.1| TIR-NBS-LRR-TIR type disease resistance protein [Populus trichocarpa]
Length=1359

 Score = 85.9 bits (211),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 98/190 (52%), Gaps = 26/190 (14%)
 Frame = +2

Query  2    FLDLVCFSHKIPEE----TNNAMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGREI  166
            FLD+ CF     ++      ++ G  + I  + +++K LI+ S    WM++L+  MG+EI
Sbjct  765  FLDIACFLKGFKKDRIIRILDSCGFHAHIGTQVLIEKSLISVSRDQVWMHNLLQIMGKEI  824

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKNM  304
            +  ESP + G RSRLW   DV   L++  G EKIE I L+ P              M  +
Sbjct  825  VRCESPEEPGRRSRLWTYADVCLALMDNTGKEKIEAIFLDMPGIKESQWNMESFSKMSRL  884

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF---  475
               +I+ + L    + +  K L+ L+W+  P+KS+P G   D+LV+L M  S+I++    
Sbjct  885  RLLKINNVQLSEGPEDISNK-LQFLEWHSYPLKSLPVGLQVDQLVELHMANSSIEQLWYG  943

Query  476  ---GVPLKVI  496
                V LK+I
Sbjct  944  YKSAVNLKII  953



>ref|XP_007134204.1| hypothetical protein PHAVU_010G028200g [Phaseolus vulgaris]
 gb|ESW06198.1| hypothetical protein PHAVU_010G028200g [Phaseolus vulgaris]
Length=1052

 Score = 85.9 bits (211),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 85/176 (48%), Gaps = 21/176 (12%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF          E  N+ G  + I I  ++++ L+     N   M+ L+ +MGRE
Sbjct  454  FLDICCFFIGKERGYVTEILNSCGLHADIGITVLIERSLVRIEENNKLGMHDLVRDMGRE  513

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKN  301
            II   SP   G+RSRLW   DV DVL    G + IE + L                 MK 
Sbjct  514  IIRHSSPKDPGKRSRLWFHEDVLDVLTNNTGRDTIEGLALKLHGTGRDCFEASAFKEMKR  573

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIK  469
            ++  ++D + L G+F HL  K LR + W   P+K IP  ++   +V + +  SN+K
Sbjct  574  LKLLKLDSVQLTGSFAHLS-KQLRWICWRGFPLKYIPVNFYQRSVVAINLKHSNLK  628



>gb|AEL30375.1| TIR-NBS-LRR type disease resistance protein [Arachis hypogaea]
Length=932

 Score = 74.3 bits (181),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/177 (30%), Positives = 89/177 (50%), Gaps = 23/177 (13%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFNW------MYSLIPE  151
            FLD+ CF    S     +     GH + I I  ++++ L+      +      M+ LI E
Sbjct  416  FLDISCFFKGRSRDYATKILKLCGHHAEIGIDILINRSLVTIEQDKYGEDTLKMHDLIEE  475

Query  152  MGREIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSPMKNMEYN------  313
            MG+ I++ ESP+ + +RSRLWC +D+  VL + K  +    IVL      + +N      
Sbjct  476  MGKLIVNQESPDDASKRSRLWCEDDIDLVLRQNKETKATRSIVLYDKRDELYWNDLAFSN  535

Query  314  --QIDEIHLEGN----FKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNI  466
              Q+  + L+G       ++P  TLR L WN CP++++PF     +LV++ ++ S I
Sbjct  536  ICQLKLLILDGVKSPILCNIP-CTLRVLHWNGCPMETLPFTDEHYELVEIDLYLSKI  591


 Score = 33.1 bits (74),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/215 (24%), Positives = 82/215 (38%), Gaps = 56/215 (26%)
 Frame = +3

Query  561   LLIQKFLICFYGFYLLNPLK*YFLCHESLDLGWCENLTRTPDFSGAKNLHKLSFYGSSLE  740
             L + K +  ++G   L  LK        L+L    NL +TPD SGA NL  L        
Sbjct  586   LYLSKIVHVWHGKKFLEKLK-------YLNLSNSHNLKQTPDLSGAPNLETL--------  630

Query  741   KVHYSNIDLWMQSKIDLWGCERLKKLPSSSVENSGMLTHNFPQFPPNLEDIRLYGCKNLE  920
                            DL  C  L  +  S       L H+      NL ++ L  C +L+
Sbjct  631   ---------------DLSCCSELNDIHQS-------LIHH-----KNLLELNLIKCGSLQ  663

Query  921   VVSATFP-TSLEGIVLYGCTNLKTLLELPQNLQSLYVFNCESLETVHLPKM------LEY  1079
              +      +SL+ + LY C +L+ L +  + ++ L +          LP        L  
Sbjct  664   TLGDKLEMSSLKELDLYECNSLRKLPKFGECMKRLSILTLSCTGITELPTTVGNLVGLSE  723

Query  1080  VKLTHCKKL----KEIQGWENAQFLTRIELRGVPN  1172
             + L  CK+L      I G ++   LT +++   PN
Sbjct  724   LDLQGCKRLTCLPDTISGLKS---LTALDVSDCPN  755



>ref|XP_009374162.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=748

 Score = 85.5 bits (210),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 88/172 (51%), Gaps = 20/172 (12%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYS-CFNWMYSLIPEMGREI  166
            FLD+ CF          ET +A G ++ I +  +V+K L+  S     M+ L+ EMGREI
Sbjct  439  FLDIACFFNLKDKNRVRETLDACGFYAEIGLAVLVEKSLLTISDGIMSMHDLLQEMGREI  498

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNS--------------PMKNM  304
            +  ESP+  G RSRLW   DV  VL +  G E IE I+++                M  +
Sbjct  499  VRRESPDDPGRRSRLWRREDVDQVLRKNTGQETIEGIMVHPFELELVTANARSFLMMNKL  558

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWES  460
             Y +++ + L     +LP  +LR L+W + P+KS+P  +  + L++L +  S
Sbjct  559  RYLKLNNVVLSNGLDYLP-NSLRILEWPEFPLKSLPSSFSPEDLLELNLHHS  609



>ref|XP_007134200.1| hypothetical protein PHAVU_010G027900g [Phaseolus vulgaris]
 gb|ESW06194.1| hypothetical protein PHAVU_010G027900g [Phaseolus vulgaris]
Length=947

 Score = 75.1 bits (183),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 90/196 (46%), Gaps = 22/196 (11%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF          E  N  G  + I IR ++++ LI     N   M+ L+ EMGRE
Sbjct  387  FLDVCCFFIGKDRGYVTEILNGCGLHADIGIRVLIERGLIKVEGNNKLQMHPLLREMGRE  446

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKN  301
            II    PN+  +RSRLW  +DV DVL +  G E  + + L                 MK 
Sbjct  447  IIRQSCPNEPEKRSRLWFQDDVQDVLKKNTGTEATQGLSLKLHLTSRDCFKARAFKKMKR  506

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIK-EFG  478
            +   Q+D + L G++ ++  K LR + W     + +P  +  + ++ + +  S+++  + 
Sbjct  507  LRLLQLDHVQLTGDYGYIS-KQLRWISWQGFRFEYVPNNFHMENVIAIDLKHSHLQLVWK  565

Query  479  VPLKVIWQYFFKFNSS  526
             P  V W  F   + S
Sbjct  566  QPQVVKWLKFLNLSHS  581


 Score = 32.3 bits (72),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 30/60 (50%), Gaps = 1/60 (2%)
 Frame = +3

Query  645  LDLGWCENLTRTPDFSGAKNLHKLSFYGS-SLEKVHYSNIDLWMQSKIDLWGCERLKKLP  821
            L+L   + L  TPDFSG  +L KL      SL KVH S  DL     I+L  C  L  LP
Sbjct  576  LNLSHSKFLRETPDFSGLPSLEKLILKDCPSLCKVHQSIGDLRNLLLINLKDCTSLSNLP  635



>ref|XP_007226605.1| hypothetical protein PRUPE_ppa023385mg [Prunus persica]
 gb|EMJ27804.1| hypothetical protein PRUPE_ppa023385mg [Prunus persica]
Length=1103

 Score = 85.9 bits (211),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 65/178 (37%), Positives = 91/178 (51%), Gaps = 21/178 (12%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCL--INYSCFNWMYSLIPEMGRE  163
            FLD+ CF          ET +A G  S I I  +V+K L  IN S    M+ L+ +MGRE
Sbjct  438  FLDIACFFNGKGKDRVRETLDACGLCSDIAIHVLVEKSLLTINPSGTLLMHDLLQDMGRE  497

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKN  301
            I+  ES ++ G+RSRLW   DV+ VL +  G E IE IVL+              S MK 
Sbjct  498  IVRRESLDEPGKRSRLWRSEDVNHVLSKNTGTEAIEGIVLHQVEPRVVCANANSFSMMKR  557

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
            + +  I+ + L    ++LP  +LR L W Q P+KS+P  +    L +L M  S I+  
Sbjct  558  LRFLVINNVDLLNKLEYLP-NSLRILDWLQFPLKSLPPSFNPKNLHELNMRNSCIEHL  614



>gb|KEH25106.1| disease resistance protein (TIR-NBS-LRR class), putative [Medicago 
truncatula]
Length=1160

 Score = 85.9 bits (211),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/176 (33%), Positives = 88/176 (50%), Gaps = 21/176 (12%)
 Frame = +2

Query  2    FLDLVCFSHKIPE----ETNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF   +      +  N  G F+ I I  +V++ L+     N   M+ L+ +MGRE
Sbjct  520  FLDIACFFIGMDRNDVIQILNGCGLFAEIGISVLVERSLVIVDSKNKLGMHDLLRDMGRE  579

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKN  301
            I+  +SP + GERSRL    DV DVL EQ G + +E + L                 M  
Sbjct  580  IVREKSPKELGERSRLCFKEDVLDVLSEQTGTQAVEGLALKLLKGDANRFRTKAFEKMNK  639

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIK  469
            +   Q+  + L+G+F +L RK LR L WN  P++ IP  +    LV ++   S++K
Sbjct  640  LRLLQLSGVQLDGDFDYLSRK-LRWLCWNGFPLRCIPKNFDQGNLVSMEFENSSVK  694



>gb|KDP34368.1| hypothetical protein JCGZ_11251 [Jatropha curcas]
Length=912

 Score = 85.5 bits (210),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 65/182 (36%), Positives = 91/182 (50%), Gaps = 29/182 (16%)
 Frame = +2

Query  2    FLDLVCF--------SHKIPEETNNAMGHFSTIEIRNIVDKCL--INYSCFNWMYSLIPE  151
            FLD+ CF          KI E+     G F  I I  ++ + L  I+Y     M+ L+ +
Sbjct  444  FLDIACFFTCKDKDSVLKILEDC----GFFPEIGISVLIQRSLLTIDYENRLIMHDLLRD  499

Query  152  MGREIIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------S  289
            MGREII   SPN  G+RSRLW   DV  VL  Q+G + IE I L+              +
Sbjct  500  MGREIIREMSPNHPGKRSRLWFHEDVLKVLKRQEGTDVIEGIALDTRATKEVTLSIESFA  559

Query  290  PMKNMEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIK  469
              +N+   QI+ ++L G  +H   + LR L W++CP +S+P     D LV L+M  SNI 
Sbjct  560  ETRNLRLLQINAVNLTGEQEH-RFEDLRWLCWHECPFESLPPNLQLDNLVVLEMQCSNIT  618

Query  470  EF  475
            E 
Sbjct  619  EI  620



>ref|XP_006389202.1| hypothetical protein POPTR_0035s00230g [Populus trichocarpa]
 gb|ERP48116.1| hypothetical protein POPTR_0035s00230g [Populus trichocarpa]
Length=726

 Score = 85.1 bits (209),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 62/190 (33%), Positives = 95/190 (50%), Gaps = 26/190 (14%)
 Frame = +2

Query  2    FLDLVCFSHKIPEETNN----AMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGREI  166
            FLD+ CF     ++       + G  + I I  ++++ LI+ S    WM+ L+  MG+EI
Sbjct  220  FLDIACFLKGFKKDRITRILESRGFHAGIGIPVLIERSLISVSRDQVWMHDLLQIMGKEI  279

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP--------------MKNM  304
            +  ESP + G RSRLW   DV   L++  G EKIE I L+ P              M  +
Sbjct  280  VRCESPEEPGRRSRLWTYEDVCLALMDNTGKEKIEAIFLDMPGIKEAQWNMKAFSKMSRL  339

Query  305  EYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF---  475
               +I+ + L    + L  + LR L+W+  P KS+P G   D+LV+L M  S+I++    
Sbjct  340  RLLKINNLQLSKGPEDLSNQ-LRFLEWHSYPSKSLPAGLQVDELVELHMANSSIEQLWYG  398

Query  476  ---GVPLKVI  496
                V LK+I
Sbjct  399  CKSAVNLKII  408



>ref|XP_008227722.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=1233

 Score = 85.5 bits (210),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 62/183 (34%), Positives = 89/183 (49%), Gaps = 21/183 (11%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFN-WMYSLIPEMGREI  166
            FLD+ CF    S     E   A    +   I  +V+K LI+   +  WM+ L+ +MG++I
Sbjct  443  FLDIACFFKGKSKMHVTEILVACDPKAGYSIEVLVEKALISVEGYYIWMHDLLEQMGKDI  502

Query  167  IHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLNSP---------------MKN  301
            +  ESP++ G RSRLW   D+  VL    G +KI  I+LNSP               MKN
Sbjct  503  VQQESPDELGGRSRLWSHEDIEHVLTNDTGTKKITGIMLNSPKEDYEIFLNVDCFSKMKN  562

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEFGV  481
            ++      + L G+  +LP   LR L W  CP++S P  +    L  L +  S IK+ G 
Sbjct  563  LKIFMNYNVFLSGDIGYLP-NMLRVLDWYSCPLQSFPPKFHPKGLRLLNLPYSPIKQRGE  621

Query  482  PLK  490
             LK
Sbjct  622  GLK  624



>ref|XP_009374005.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=1093

 Score = 85.5 bits (210),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 93/178 (52%), Gaps = 21/178 (12%)
 Frame = +2

Query  2    FLDLVCF----SHKIPEETNNAMGHFSTIEIRNIVDKCLINYSCFN--WMYSLIPEMGRE  163
            FLD+ CF    +     E   A G  + I I  +V+K L+  +      M+ L+ EMG+E
Sbjct  513  FLDIACFFSGEAKDQVREVLEASGFNAHIGIDVLVEKSLLTVNSVGELSMHDLLQEMGQE  572

Query  164  IIHSESPNKSGERSRLWCPNDVHDVLIEQKGMEKIEMIVLN--------------SPMKN  301
            I+  ESP+  G+RSRLW  +D++ VL E  G E IE I+++              S MK 
Sbjct  573  IVRRESPDDPGKRSRLWRRDDINHVLSENTGTETIECIIMDPDEQGAVQVNAKSFSMMKK  632

Query  302  MEYNQIDEIHLEGNFKHLPRKTLRCLQWNQCPVKSIPFGYFFDKLVKLKMWESNIKEF  475
            + Y ++ +  L    ++LP  +LR L W+  P+K++P  +  + LV+L+M  S ++  
Sbjct  633  LRYLKLYDTTLSNGLEYLP-NSLRFLIWHNFPLKTLPSSFCPEHLVELRMIFSRLEHL  689



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3607887660968