BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24178_g1_i1 len=2051 path=[2092:0-252 2345:253-319 2412:320-367
2460:368-392 2485:393-457 2550:458-562 2655:563-629 2722:630-709
2802:710-756 10517:757-767 2860:768-839 2932:840-846 2939:847-877
2970:878-1287 3380:1288-1325 3418:1326-1432 3525:1433-1456
4784:1457-1572 3665:1573-1573 3666:1574-1601 6018:1602-1767
6184:1768-1800 6217:1801-2050]

Length=2051
                                                                      Score     E

ref|XP_009631811.1|  PREDICTED: beta-glucosidase 40                     733   0.0      
ref|XP_009802933.1|  PREDICTED: beta-glucosidase 40-like                733   0.0      
ref|XP_006365136.1|  PREDICTED: beta-glucosidase 40-like                716   0.0      
gb|EYU28848.1|  hypothetical protein MIMGU_mgv1a004935mg                716   0.0      
ref|XP_007045907.1|  Beta glucosidase 40 isoform 1                      716   0.0      
ref|XP_004228406.1|  PREDICTED: beta-glucosidase 40                     712   0.0      
emb|CDP00417.1|  unnamed protein product                                704   0.0      
ref|XP_006437961.1|  hypothetical protein CICLE_v10031299mg             702   0.0      
ref|XP_006484173.1|  PREDICTED: beta-glucosidase 40-like                702   0.0      
ref|XP_011075589.1|  PREDICTED: beta-glucosidase 6                      701   0.0      
ref|XP_009115373.1|  PREDICTED: beta-glucosidase 40                     698   0.0      
dbj|BAO04176.1|  hypothetical protein                                   697   0.0      
emb|CDX85027.1|  BnaC05g20280D                                          696   0.0      
ref|XP_002512097.1|  beta-glucosidase, putative                         696   0.0      Ricinus communis
ref|XP_006307269.1|  hypothetical protein CARUB_v10008883mg             696   0.0      
ref|XP_002893397.1|  hypothetical protein ARALYDRAFT_472753             695   0.0      
ref|XP_010499028.1|  PREDICTED: beta-glucosidase 40                     694   0.0      
gb|KDP41287.1|  hypothetical protein JCGZ_15694                         694   0.0      
ref|XP_003607794.1|  Beta-glucosidase                                   692   0.0      
ref|XP_010477846.1|  PREDICTED: beta-glucosidase 40-like                692   0.0      
ref|XP_010649498.1|  PREDICTED: beta-glucosidase 40-like                691   0.0      
ref|XP_010460295.1|  PREDICTED: beta-glucosidase 40-like                691   0.0      
ref|NP_173978.1|  beta glucosidase 40                                   690   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006415932.1|  hypothetical protein EUTSA_v10007404mg             690   0.0      
ref|XP_007224102.1|  hypothetical protein PRUPE_ppa015619mg             690   0.0      
gb|AAM61600.1|  beta-glucosidase, putative                              689   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KHN20526.1|  Beta-glucosidase 40                                     688   0.0      
gb|KGN47642.1|  hypothetical protein Csa_6G366400                       687   0.0      
emb|CBI27265.3|  unnamed protein product                                689   0.0      
ref|XP_009110017.1|  PREDICTED: beta-glucosidase 40-like                688   0.0      
ref|XP_009416570.1|  PREDICTED: beta-glucosidase 6-like                 688   0.0      
ref|XP_010066854.1|  PREDICTED: beta-glucosidase 40                     688   0.0      
ref|XP_010258106.1|  PREDICTED: beta-glucosidase 6                      687   0.0      
ref|XP_010521462.1|  PREDICTED: beta-glucosidase 40-like isoform X2     687   0.0      
ref|XP_003556662.1|  PREDICTED: beta-glucosidase 40                     687   0.0      
ref|XP_009406318.1|  PREDICTED: beta-glucosidase 6-like                 686   0.0      
ref|XP_010551390.1|  PREDICTED: beta-glucosidase 40                     686   0.0      
emb|CDY61627.1|  BnaA08g19770D                                          686   0.0      
ref|XP_010259408.1|  PREDICTED: beta-glucosidase 40-like                686   0.0      
ref|XP_004144181.1|  PREDICTED: beta-glucosidase 40-like                685   0.0      
ref|XP_008445464.1|  PREDICTED: beta-glucosidase 40                     684   0.0      
gb|KFK44575.1|  hypothetical protein AALP_AA1G275600                    684   0.0      
ref|XP_004985213.1|  PREDICTED: beta-glucosidase 6-like                 684   0.0      
ref|XP_007157842.1|  hypothetical protein PHAVU_002G102800g             684   0.0      
ref|XP_010680724.1|  PREDICTED: beta-glucosidase 40                     684   0.0      
emb|CDY20561.1|  BnaC07g12280D                                          683   0.0      
ref|XP_009406319.1|  PREDICTED: beta-glucosidase 6-like                 683   0.0      
ref|XP_010521461.1|  PREDICTED: beta-glucosidase 40-like isoform X1     681   0.0      
ref|XP_009775819.1|  PREDICTED: beta-glucosidase 40-like isoform X1     681   0.0      
ref|XP_006651165.1|  PREDICTED: beta-glucosidase 6-like                 681   0.0      
emb|CBI27264.3|  unnamed protein product                                681   0.0      
ref|XP_004985215.1|  PREDICTED: beta-glucosidase 6-like                 679   0.0      
gb|EEC74750.1|  hypothetical protein OsI_10506                          679   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_011012221.1|  PREDICTED: beta-glucosidase 40                     678   0.0      
ref|NP_001049358.1|  Os03g0212800                                       678   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_002465651.1|  hypothetical protein SORBIDRAFT_01g043030          677   0.0      Sorghum bicolor [broomcorn]
ref|XP_009356385.1|  PREDICTED: beta-glucosidase 40                     677   0.0      
ref|XP_008221519.1|  PREDICTED: beta-glucosidase 40-like                677   0.0      
ref|NP_001268161.1|  beta-glucosidase precursor                         677   0.0      
pdb|3GNO|A  Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-gl...    676   0.0      
gb|EEE58575.1|  hypothetical protein OsJ_09895                          677   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010936327.1|  PREDICTED: beta-glucosidase 6 isoform X2           676   0.0      
pdb|3WBE|A  Chain A, Rice Os3bglu6 Beta-glucosidase E178q Mutant ...    675   0.0      
pdb|3WBA|A  Chain A, Rice Os3bglu6 E178q With Covalent Glucosyl M...    675   0.0      
ref|XP_008658979.1|  PREDICTED: uncharacterized protein LOC100502...    675   0.0      
ref|XP_008389423.1|  PREDICTED: beta-glucosidase 40-like                674   0.0      
ref|XP_008644530.1|  PREDICTED: hypothetical protein isoform X1         674   0.0      
ref|XP_002311330.1|  hydroxyisourate hydrolase family protein           674   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_003561900.1|  PREDICTED: beta-glucosidase 6                      674   0.0      
ref|XP_010936326.1|  PREDICTED: beta-glucosidase 6 isoform X1           673   0.0      
ref|XP_010109366.1|  Beta-glucosidase 40                                672   0.0      
ref|XP_004297254.1|  PREDICTED: beta-glucosidase 40-like isoform 2      672   0.0      
gb|AHC04401.1|  beta-glucosidase 1                                      671   0.0      
ref|XP_002316096.2|  hydroxyisourate hydrolase family protein           671   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004505367.1|  PREDICTED: beta-glucosidase 40-like                669   0.0      
ref|XP_011018305.1|  PREDICTED: beta-glucosidase 40-like isoform X1     669   0.0      
ref|XP_008792724.1|  PREDICTED: beta-glucosidase 6                      664   0.0      
ref|XP_006437962.1|  hypothetical protein CICLE_v10031299mg             662   0.0      
ref|XP_008339824.1|  PREDICTED: beta-glucosidase 40                     663   0.0      
gb|KDO81803.1|  hypothetical protein CISIN_1g0105881mg                  660   0.0      
gb|EYU28849.1|  hypothetical protein MIMGU_mgv1a004939mg                661   0.0      
ref|XP_006661692.1|  PREDICTED: beta-glucosidase 34-like                660   0.0      
gb|EPS59761.1|  hypothetical protein M569_15044                         660   0.0      
ref|XP_004985214.1|  PREDICTED: beta-glucosidase 6-like                 659   0.0      
ref|XP_004490145.1|  PREDICTED: beta-glucosidase 40-like                659   0.0      
ref|XP_009775820.1|  PREDICTED: beta-glucosidase 40-like isoform X2     658   0.0      
gb|EEC66726.1|  hypothetical protein OsI_33062                          659   0.0      Oryza sativa Indica Group [Indian rice]
ref|NP_001064347.1|  Os10g0323500                                       658   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|AES96995.2|  beta-glucosidase                                        653   0.0      
ref|XP_010521463.1|  PREDICTED: beta-glucosidase 40-like isoform X3     651   0.0      
ref|XP_003574944.1|  PREDICTED: beta-glucosidase 34-like                647   0.0      
gb|AAK92581.1|AC074354_15  Putative beta-glucosidase                    645   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_003517829.1|  PREDICTED: beta-glucosidase 40-like                643   0.0      
gb|EMS46293.1|  Beta-glucosidase 34                                     638   0.0      
ref|XP_004297253.1|  PREDICTED: beta-glucosidase 40-like isoform 1      639   0.0      
gb|EMT21383.1|  Beta-glucosidase 6                                      634   0.0      
ref|XP_007153535.1|  hypothetical protein PHAVU_003G043600g             624   0.0      
ref|XP_009775821.1|  PREDICTED: beta-glucosidase 6-like isoform X3      621   0.0      
ref|XP_008390041.1|  PREDICTED: beta-glucosidase 40-like                619   0.0      
tpg|DAA44054.1|  TPA: hypothetical protein ZEAMMB73_095768              607   0.0      
ref|XP_009775822.1|  PREDICTED: beta-glucosidase 40-like isoform X4     605   0.0      
ref|XP_008789189.1|  PREDICTED: beta-glucosidase 25 isoform X1          602   0.0      
ref|XP_010910029.1|  PREDICTED: beta-glucosidase 25 isoform X1          600   0.0      
ref|XP_011018314.1|  PREDICTED: beta-glucosidase 40-like isoform X2     595   0.0      
ref|XP_010910030.1|  PREDICTED: beta-glucosidase 25 isoform X2          592   0.0      
gb|KHG19061.1|  Beta-glucosidase 40 -like protein                       589   0.0      
gb|EYU19188.1|  hypothetical protein MIMGU_mgv1a004736mg                592   0.0      
dbj|BAJ98823.1|  predicted protein                                      591   0.0      
ref|XP_009414547.1|  PREDICTED: beta-glucosidase 25-like                592   0.0      
ref|XP_011095298.1|  PREDICTED: putative beta-glucosidase 41 isof...    590   0.0      
ref|XP_006360112.1|  PREDICTED: putative beta-glucosidase 41-like       588   0.0      
ref|XP_009615935.1|  PREDICTED: putative beta-glucosidase 41            588   0.0      
emb|CDY64930.1|  BnaCnng45520D                                          588   0.0      
gb|KDO81804.1|  hypothetical protein CISIN_1g0105881mg                  583   0.0      
ref|XP_009769966.1|  PREDICTED: putative beta-glucosidase 41            587   0.0      
emb|CDY42461.1|  BnaA10g08370D                                          587   0.0      
ref|XP_008226795.1|  PREDICTED: putative beta-glucosidase 41 isof...    586   0.0      
ref|XP_010267844.1|  PREDICTED: putative beta-glucosidase 41 isof...    586   0.0      
ref|XP_009119981.1|  PREDICTED: putative beta-glucosidase 41            585   0.0      
gb|KDP39010.1|  hypothetical protein JCGZ_00767                         587   0.0      
ref|XP_010448300.1|  PREDICTED: putative beta-glucosidase 41 isof...    585   0.0      
ref|XP_008658980.1|  PREDICTED: uncharacterized protein LOC100502...    582   0.0      
ref|XP_004244167.1|  PREDICTED: putative beta-glucosidase 41            584   0.0      
ref|XP_010694291.1|  PREDICTED: putative beta-glucosidase 41            584   0.0      
ref|XP_010448292.1|  PREDICTED: putative beta-glucosidase 41 isof...    584   0.0      
ref|XP_010482861.1|  PREDICTED: putative beta-glucosidase 41 isof...    584   0.0      
ref|XP_004294322.1|  PREDICTED: putative beta-glucosidase 41-like...    583   0.0      
ref|XP_008643498.1|  PREDICTED: hypothetical protein isoform X2         583   0.0      
ref|XP_011048252.1|  PREDICTED: putative beta-glucosidase 41 isof...    583   0.0      
ref|XP_002866052.1|  glycosyl hydrolase family 1 protein                583   0.0      
ref|XP_006851185.1|  hypothetical protein AMTR_s00043p00189470          582   0.0      
ref|XP_004966274.1|  PREDICTED: beta-glucosidase 25-like                582   0.0      
ref|XP_009418476.1|  PREDICTED: beta-glucosidase 25-like                583   0.0      
ref|XP_003527305.1|  PREDICTED: beta-glucosidase 25-like isoform X1     582   0.0      
gb|KFK27066.1|  hypothetical protein AALP_AA8G330000                    582   0.0      
gb|KHG13868.1|  Putative beta-glucosidase 41 -like protein              580   0.0      
sp|Q0DA21.2|BGL25_ORYSJ  RecName: Full=Beta-glucosidase 25; Short...    579   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_007021150.1|  Beta glucosidase 41 isoform 1                      579   0.0      
ref|XP_006656393.1|  PREDICTED: beta-glucosidase 25-like isoform X1     578   0.0      
ref|NP_200268.3|  beta glucosidase 41                                   580   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KEH30766.1|  glycoside hydrolase family 1 protein                    578   0.0      
ref|XP_010443033.1|  PREDICTED: putative beta-glucosidase 41            576   0.0      
ref|XP_010539264.1|  PREDICTED: putative beta-glucosidase 41 isof...    575   0.0      
ref|XP_004294321.1|  PREDICTED: putative beta-glucosidase 41-like...    576   0.0      
ref|XP_002437464.1|  hypothetical protein SORBIDRAFT_10g027600          575   0.0      Sorghum bicolor [broomcorn]
ref|XP_006475282.1|  PREDICTED: putative beta-glucosidase 41-like       575   0.0      
ref|XP_010644313.1|  PREDICTED: putative beta-glucosidase 41            575   0.0      
ref|XP_010062938.1|  PREDICTED: putative beta-glucosidase 41            574   0.0      
ref|XP_008365874.1|  PREDICTED: putative beta-glucosidase 41            574   0.0      
gb|AES89992.2|  beta-glucosidase                                        570   0.0      
ref|XP_008454582.1|  PREDICTED: beta-glucosidase 25 isoform X1          574   0.0      
ref|XP_004151969.1|  PREDICTED: putative beta-glucosidase 41-like       573   0.0      
ref|XP_004505421.1|  PREDICTED: putative beta-glucosidase 41-like       571   0.0      
gb|KHN28382.1|  Putative beta-glucosidase 41                            570   0.0      
emb|CBI20471.3|  unnamed protein product                                573   0.0      
emb|CDP05824.1|  unnamed protein product                                570   0.0      
gb|EYU28850.1|  hypothetical protein MIMGU_mgv1a004939mg                568   0.0      
ref|XP_010092278.1|  Putative beta-glucosidase 41                       569   0.0      
ref|XP_007133036.1|  hypothetical protein PHAVU_011G145900g             568   0.0      
ref|XP_003607795.1|  Beta-glucosidase                                   560   0.0      
ref|XP_010539263.1|  PREDICTED: putative beta-glucosidase 41 isof...    558   0.0      
ref|XP_006370585.1|  linamarase family protein                          557   0.0      
ref|XP_008454583.1|  PREDICTED: beta-glucosidase 25 isoform X2          552   0.0      
ref|XP_010267845.1|  PREDICTED: putative beta-glucosidase 41 isof...    550   0.0      
gb|AFW89226.1|  hypothetical protein ZEAMMB73_293984                    548   0.0      
ref|XP_002960920.1|  hypothetical protein SELMODRAFT_163822             550   0.0      
dbj|BAB09336.1|  beta-glucosidase                                       550   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010267846.1|  PREDICTED: putative beta-glucosidase 41 isof...    544   0.0      
ref|XP_008226796.1|  PREDICTED: putative beta-glucosidase 41 isof...    543   0.0      
gb|AFW69121.1|  hypothetical protein ZEAMMB73_597791                    543   0.0      
ref|XP_002967091.1|  hypothetical protein SELMODRAFT_169039             542   0.0      
ref|XP_002464163.1|  hypothetical protein SORBIDRAFT_01g013360          538   0.0      Sorghum bicolor [broomcorn]
ref|XP_002530914.1|  beta-glucosidase, putative                         539   0.0      Ricinus communis
gb|EPS70537.1|  hypothetical protein M569_04221                         533   0.0      
ref|XP_004160275.1|  PREDICTED: putative beta-glucosidase 41-like       535   3e-180   
gb|EMT00549.1|  Beta-glucosidase 6                                      534   1e-179   
ref|XP_011095300.1|  PREDICTED: putative beta-glucosidase 41 isof...    530   2e-178   
ref|XP_008454584.1|  PREDICTED: putative beta-glucosidase 41 isof...    530   3e-178   
ref|XP_007045908.1|  Beta glucosidase 40 isoform 2                      524   2e-177   
gb|EMS61848.1|  Beta-glucosidase 25                                     534   6e-177   
ref|XP_002990785.1|  hypothetical protein SELMODRAFT_185578             526   7e-177   
ref|XP_002988358.1|  hypothetical protein SELMODRAFT_183841             525   1e-176   
ref|XP_002979705.1|  hypothetical protein SELMODRAFT_153534             525   3e-176   
ref|XP_002974513.1|  hypothetical protein SELMODRAFT_149851             523   1e-175   
ref|XP_003614037.1|  Beta-glucosidase                                   520   3e-175   
ref|XP_002960251.1|  hypothetical protein SELMODRAFT_75234              521   4e-175   
ref|XP_006582224.1|  PREDICTED: beta-glucosidase 25-like isoform X2     514   1e-172   
ref|XP_006845279.1|  hypothetical protein AMTR_s00005p00266150          512   1e-171   
ref|XP_010533966.1|  PREDICTED: beta-glucosidase 44-like                511   7e-171   
ref|XP_002967460.1|  hypothetical protein SELMODRAFT_267120             509   4e-170   
ref|XP_010487722.1|  PREDICTED: beta-glucosidase 44-like                509   4e-170   
ref|XP_006430653.1|  hypothetical protein CICLE_v10013421mg             509   6e-170   
ref|XP_002988359.1|  hypothetical protein SELMODRAFT_127964             507   2e-169   
ref|XP_010910031.1|  PREDICTED: beta-glucosidase 25 isoform X3          503   3e-169   
ref|XP_009113531.1|  PREDICTED: beta-glucosidase 43                     506   4e-169   
gb|KDO63131.1|  hypothetical protein CISIN_1g036937mg                   506   4e-169   
ref|XP_010465882.1|  PREDICTED: beta-glucosidase 44                     506   5e-169   
ref|XP_008789190.1|  PREDICTED: putative beta-glucosidase 41 isof...    502   5e-169   
ref|NP_188436.1|  beta-glucosidase 44                                   506   5e-169   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006482389.1|  PREDICTED: beta-glucosidase 44-like                506   6e-169   
ref|XP_002960254.1|  hypothetical protein SELMODRAFT_163827             506   6e-169   
emb|CDY18494.1|  BnaA01g27010D                                          506   6e-169   
ref|XP_006406654.1|  hypothetical protein EUTSA_v10020536mg             506   6e-169   
ref|XP_006430655.1|  hypothetical protein CICLE_v10013521mg             506   7e-169   
gb|ABR17739.1|  unknown                                                 505   1e-168   Picea sitchensis
gb|AEV76986.1|  beta-glucosidase 4                                      504   2e-168   
gb|KFK39134.1|  beta-glucosidase 44                                     505   2e-168   
ref|XP_006297463.1|  hypothetical protein CARUB_v10013483mg             505   2e-168   
ref|XP_002883106.1|  beta-glucosidase                                   504   3e-168   
gb|AGS43007.1|  beta-D-glucoside glucohydrolase                         504   4e-168   
ref|XP_002883107.1|  glycosyl hydrolase family 1 protein                504   5e-168   
ref|XP_010487721.1|  PREDICTED: beta-glucosidase 43                     503   6e-168   
emb|CDX95557.1|  BnaC01g34490D                                          503   9e-168   
gb|AIP98403.1|  beta-glucosidase                                        503   1e-167   
ref|XP_006353826.1|  PREDICTED: beta-glucosidase 44-like                502   1e-167   
sp|Q9ZT64.1|CBG_PINCO  RecName: Full=Coniferin beta-glucosidase; ...    503   1e-167   Pinus contorta
ref|XP_010506359.1|  PREDICTED: beta-glucosidase 44-like                502   3e-167   
ref|XP_002986009.1|  hypothetical protein SELMODRAFT_271823             501   3e-167   
ref|XP_006832849.1|  hypothetical protein AMTR_s00095p00053110          501   5e-167   
ref|NP_001043156.1|  Os01g0508000                                       501   5e-167   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004252272.1|  PREDICTED: beta-glucosidase 44-like isoform X1     501   6e-167   
ref|XP_009113523.1|  PREDICTED: beta-glucosidase 44                     501   8e-167   
ref|NP_001234620.1|  beta-mannosidase enzyme precursor                  501   9e-167   
gb|KFK39133.1|  beta-glucosidase 44                                     500   1e-166   
ref|XP_006482391.1|  PREDICTED: beta-glucosidase 44-like                501   1e-166   
emb|CDX95558.1|  BnaC01g34500D                                          499   1e-166   
gb|EAY74244.1|  hypothetical protein OsI_02124                          500   1e-166   Oryza sativa Indica Group [Indian rice]
ref|XP_007036679.1|  B-S glucosidase 44 isoform 1                       500   2e-166   
gb|KDO63132.1|  hypothetical protein CISIN_1g046891mg                   499   5e-166   
gb|KDP41124.1|  hypothetical protein JCGZ_03615                         499   6e-166   
ref|XP_006430656.1|  hypothetical protein CICLE_v10013386mg             499   6e-166   
ref|XP_002281407.1|  PREDICTED: beta-glucosidase 44                     498   7e-166   Vitis vinifera
ref|XP_006482390.1|  PREDICTED: beta-glucosidase 44-like                498   8e-166   
ref|XP_006652405.1|  PREDICTED: beta-glucosidase 12-like                498   9e-166   
ref|XP_006341563.1|  PREDICTED: beta-glucosidase 44-like                498   1e-165   
ref|XP_010097587.1|  Beta-glucosidase 44                                498   1e-165   
ref|XP_002533126.1|  beta-glucosidase, putative                         498   1e-165   Ricinus communis
tpg|DAA44055.1|  TPA: hypothetical protein ZEAMMB73_095768              493   1e-165   
ref|XP_008218659.1|  PREDICTED: beta-glucosidase 12-like                499   2e-165   
ref|XP_006644213.1|  PREDICTED: beta-glucosidase 1-like                 497   2e-165   
ref|XP_003562544.1|  PREDICTED: beta-glucosidase 26                     497   2e-165   
ref|XP_002512138.1|  beta-glucosidase, putative                         496   3e-165   Ricinus communis
gb|KDO62878.1|  hypothetical protein CISIN_1g010049mg                   497   3e-165   
ref|XP_004295227.1|  PREDICTED: beta-glucosidase 13-like                497   3e-165   
ref|XP_003534146.1|  PREDICTED: beta-glucosidase 44                     496   4e-165   
gb|AES67732.2|  glycoside hydrolase family 1 protein                    496   4e-165   
emb|CAN74265.1|  hypothetical protein VITISV_040977                     496   5e-165   Vitis vinifera
ref|XP_010034459.1|  PREDICTED: beta-glucosidase 44-like                496   5e-165   
ref|XP_009757932.1|  PREDICTED: beta-glucosidase 44-like                496   7e-165   
ref|XP_006490742.1|  PREDICTED: beta-glucosidase 44-like                496   8e-165   
gb|ACD65509.2|  beta-glucosidase D4                                     496   8e-165   Lotus japonicus
ref|XP_010265850.1|  PREDICTED: beta-glucosidase 12-like                496   8e-165   
ref|XP_003528968.1|  PREDICTED: beta-glucosidase 44-like                495   1e-164   
gb|KEH30276.1|  cyanogenic beta-glucosidase, putative                   495   1e-164   
ref|XP_006451662.1|  hypothetical protein CICLE_v10008010mg             495   1e-164   
gb|ACD65511.1|  beta-glucosidase D7                                     495   2e-164   Lotus japonicus
ref|XP_003540006.1|  PREDICTED: beta-glucosidase 12-like                495   2e-164   
ref|XP_008811965.1|  PREDICTED: beta-glucosidase 1-like isoform X1      494   2e-164   
ref|XP_007207081.1|  hypothetical protein PRUPE_ppa024434mg             495   2e-164   
ref|XP_010031859.1|  PREDICTED: beta-glucosidase 24-like                494   3e-164   
gb|ACN41025.1|  unknown                                                 494   3e-164   Picea sitchensis
ref|XP_002322085.1|  glycosyl hydrolase family 1 family protein         494   4e-164   Populus trichocarpa [western balsam poplar]
ref|XP_007033096.1|  B-S glucosidase 44                                 493   6e-164   
ref|XP_011008770.1|  PREDICTED: beta-glucosidase 12-like                493   6e-164   
gb|KCW83987.1|  hypothetical protein EUGRSUZ_B00860                     492   7e-164   
ref|XP_011000474.1|  PREDICTED: beta-glucosidase 44-like                493   8e-164   
ref|XP_010032630.1|  PREDICTED: beta-glucosidase 44-like                493   1e-163   
ref|XP_008243590.1|  PREDICTED: beta-glucosidase 12-like                493   1e-163   
gb|KCW51256.1|  hypothetical protein EUGRSUZ_J00833                     493   1e-163   
ref|XP_010243804.1|  PREDICTED: beta-glucosidase 44-like                493   1e-163   
ref|XP_002981889.1|  hypothetical protein SELMODRAFT_268527             493   1e-163   
ref|XP_010044984.1|  PREDICTED: beta-glucosidase 12-like                493   2e-163   
ref|XP_006369422.1|  hypothetical protein POPTR_0001s23070g             493   2e-163   
ref|XP_011013402.1|  PREDICTED: beta-glucosidase 12-like                493   2e-163   
ref|XP_003597481.1|  Beta-glucosidase D4                                492   2e-163   
ref|XP_009600118.1|  PREDICTED: beta-glucosidase 44-like                492   2e-163   
ref|XP_004486932.1|  PREDICTED: beta-glucosidase 12-like                492   3e-163   
ref|XP_002448027.1|  hypothetical protein SORBIDRAFT_06g019840          491   3e-163   Sorghum bicolor [broomcorn]
gb|ABW76288.1|  beta-glucosidase G3                                     491   3e-163   Medicago truncatula
ref|XP_001765414.1|  predicted protein                                  490   4e-163   
ref|XP_002979904.1|  hypothetical protein SELMODRAFT_268319             491   4e-163   
gb|AFZ78535.1|  beta-glucosidase                                        491   5e-163   
ref|XP_002513440.1|  beta-glucosidase, putative                         491   5e-163   
gb|KEH30278.1|  cyanogenic beta-glucosidase, putative                   491   5e-163   
ref|XP_011008768.1|  PREDICTED: beta-glucosidase 12-like isoform X1     491   5e-163   
ref|XP_010686092.1|  PREDICTED: beta-glucosidase 44-like                491   6e-163   
ref|XP_008453769.1|  PREDICTED: beta-glucosidase 44-like                491   6e-163   
ref|XP_007152698.1|  hypothetical protein PHAVU_004G151800g             492   6e-163   
gb|EPS65829.1|  beta-mannosidase                                        489   6e-163   
gb|AES76414.2|  glycoside hydrolase family 1 protein                    491   6e-163   
dbj|BAB02019.1|  beta-glucosidase                                       490   7e-163   
gb|KCW83982.1|  hypothetical protein EUGRSUZ_B00859                     491   7e-163   
ref|XP_003620203.1|  Beta-glucosidase D4                                491   7e-163   
ref|XP_004515053.1|  PREDICTED: beta-glucosidase 12-like isoform X1     491   9e-163   
ref|XP_004163493.1|  PREDICTED: beta-glucosidase 44-like                490   9e-163   
ref|XP_011084444.1|  PREDICTED: beta-glucosidase 44-like                490   1e-162   
ref|XP_009624185.1|  PREDICTED: beta-glucosidase 44-like                490   1e-162   
ref|XP_009347765.1|  PREDICTED: beta-glucosidase 44-like                490   1e-162   
ref|XP_004982055.1|  PREDICTED: beta-glucosidase 7-like isoform X1      489   1e-162   
ref|XP_007133703.1|  hypothetical protein PHAVU_011G201700g             490   1e-162   
dbj|BAG13451.1|  beta-glucosidase                                       491   1e-162   
ref|XP_003620196.1|  Beta-glucosidase D2                                490   1e-162   
ref|XP_011014103.1|  PREDICTED: beta-glucosidase 12-like                490   1e-162   
gb|ACU24532.1|  unknown                                                 489   1e-162   
ref|XP_004982056.1|  PREDICTED: beta-glucosidase 7-like isoform X2      489   1e-162   
ref|XP_002322086.2|  hypothetical protein POPTR_0015s04280g             490   2e-162   
gb|KDP20205.1|  hypothetical protein JCGZ_07925                         489   2e-162   
ref|XP_006439050.1|  hypothetical protein CICLE_v10031262mg             489   2e-162   
ref|XP_004515054.1|  PREDICTED: beta-glucosidase 12-like isoform X2     490   2e-162   
ref|XP_006482830.1|  PREDICTED: beta-glucosidase 12-like                489   2e-162   
ref|XP_006658055.1|  PREDICTED: beta-glucosidase 26-like                489   2e-162   
ref|NP_188435.2|  beta glucosidase 43                                   489   2e-162   
ref|XP_002272413.2|  PREDICTED: beta-glucosidase 44-like                491   2e-162   
ref|XP_010032621.1|  PREDICTED: beta-glucosidase 44-like                489   2e-162   
gb|KHG12317.1|  Beta-glucosidase 44 -like protein                       488   3e-162   
ref|XP_007014882.1|  Beta-glucosidase 17                                489   3e-162   
ref|XP_007207700.1|  hypothetical protein PRUPE_ppa024193mg             489   3e-162   
ref|XP_011008769.1|  PREDICTED: beta-glucosidase 12-like isoform X2     489   3e-162   
ref|XP_006369420.1|  hypothetical protein POPTR_0001s23050g             488   3e-162   
ref|XP_009394432.1|  PREDICTED: beta-glucosidase 1-like                 489   4e-162   
ref|XP_002461141.1|  hypothetical protein SORBIDRAFT_02g041550          489   4e-162   
ref|XP_006384235.1|  hypothetical protein POPTR_0004s10900g             489   4e-162   
gb|KDP25142.1|  hypothetical protein JCGZ_22677                         489   4e-162   
gb|KCW83981.1|  hypothetical protein EUGRSUZ_B00859                     488   6e-162   
ref|XP_009343017.1|  PREDICTED: beta-glucosidase 12-like                488   6e-162   
ref|XP_008457084.1|  PREDICTED: beta-glucosidase 44-like                488   6e-162   
ref|XP_008462973.1|  PREDICTED: beta-glucosidase 44-like                488   6e-162   
ref|XP_004958541.1|  PREDICTED: beta-glucosidase 26-like                489   6e-162   
ref|XP_003539051.1|  PREDICTED: beta-glucosidase 12-like                488   7e-162   
ref|XP_008350605.1|  PREDICTED: beta-glucosidase 12-like                488   8e-162   
ref|NP_001142124.1|  uncharacterized protein LOC100274288 precursor     488   8e-162   
gb|AGV54748.1|  beta-glucosidase 44-like protein                        488   8e-162   
gb|KCW83979.1|  hypothetical protein EUGRSUZ_B00859                     488   9e-162   
gb|KCW87125.1|  hypothetical protein EUGRSUZ_B03653                     488   9e-162   
ref|XP_008374823.1|  PREDICTED: beta-glucosidase 44-like                488   1e-161   
ref|XP_006369423.1|  linamarase family protein                          488   1e-161   
ref|XP_004149144.1|  PREDICTED: beta-glucosidase 44-like                487   1e-161   
ref|XP_003597509.1|  Beta-glucosidase D2                                488   1e-161   
ref|XP_004137494.1|  PREDICTED: beta-glucosidase 44-like                487   1e-161   
ref|XP_004161840.1|  PREDICTED: beta-glucosidase 44-like                487   1e-161   
ref|XP_006371008.1|  hypothetical protein POPTR_0019s02590g             488   1e-161   
ref|XP_009775825.1|  PREDICTED: beta-glucosidase 40-like isoform X6     484   1e-161   
emb|CDM80087.1|  unnamed protein product                                487   1e-161   
ref|XP_007208264.1|  hypothetical protein PRUPE_ppa015887mg             487   2e-161   
ref|XP_009775824.1|  PREDICTED: beta-glucosidase 40-like isoform X5     484   2e-161   
gb|KEH30275.1|  cyanogenic beta-glucosidase, putative                   488   2e-161   
ref|XP_008385230.1|  PREDICTED: beta-glucosidase 12-like                488   2e-161   
gb|KCW83978.1|  hypothetical protein EUGRSUZ_B00859                     487   2e-161   
ref|XP_009799689.1|  PREDICTED: beta-glucosidase 44-like                487   2e-161   
ref|XP_002965185.1|  hypothetical protein SELMODRAFT_167232             487   2e-161   
gb|AFZ78536.1|  beta-glucosidase                                        487   2e-161   
ref|XP_003540705.1|  PREDICTED: beta-glucosidase 12-like                487   2e-161   
ref|XP_010257514.1|  PREDICTED: beta-glucosidase 44-like isoform X2     488   2e-161   
ref|XP_004299545.1|  PREDICTED: beta-glucosidase 44-like                486   3e-161   
dbj|BAJ93012.1|  predicted protein                                      486   3e-161   
ref|XP_004512738.1|  PREDICTED: beta-glucosidase 44-like                486   3e-161   
ref|XP_003546992.2|  PREDICTED: cyanogenic beta-glucosidase-like ...    486   4e-161   
gb|ABY48758.1|  glycosylhydrolase 1                                     486   4e-161   
ref|XP_007150413.1|  hypothetical protein PHAVU_005G151400g             484   5e-161   
gb|EMT08337.1|  Beta-glucosidase 44                                     486   5e-161   
ref|XP_008450458.1|  PREDICTED: beta-glucosidase 12-like                486   5e-161   
gb|KCW83977.1|  hypothetical protein EUGRSUZ_B00859                     486   6e-161   
ref|XP_010044986.1|  PREDICTED: beta-glucosidase 13-like                486   8e-161   
gb|AFZ78537.1|  beta-glucosidase                                        485   8e-161   
ref|XP_008226797.1|  PREDICTED: putative beta-glucosidase 41 isof...    483   8e-161   
gb|ACL52625.1|  unknown                                                 485   1e-160   
ref|XP_002962270.1|  hypothetical protein SELMODRAFT_76384              485   1e-160   
ref|XP_002285582.1|  PREDICTED: beta-glucosidase 12-like                485   1e-160   
ref|XP_010943553.1|  PREDICTED: beta-glucosidase 12-like isoform X1     485   1e-160   
ref|XP_006652406.1|  PREDICTED: beta-glucosidase 13-like                484   1e-160   
ref|XP_004490615.1|  PREDICTED: beta-glucosidase 12-like                485   1e-160   
ref|XP_006651730.1|  PREDICTED: beta-glucosidase 7-like                 483   2e-160   
ref|XP_003539053.1|  PREDICTED: beta-glucosidase 12-like                485   2e-160   
ref|XP_010267847.1|  PREDICTED: putative beta-glucosidase 41 isof...    481   2e-160   
gb|ACF07998.1|  beta-glucosidase                                        484   2e-160   
ref|XP_011037887.1|  PREDICTED: beta-glucosidase 24-like                485   2e-160   
ref|XP_001753376.1|  predicted protein                                  483   3e-160   
ref|XP_007207911.1|  hypothetical protein PRUPE_ppa019573mg             484   3e-160   
ref|XP_008240180.1|  PREDICTED: beta-glucosidase 44-like                484   3e-160   
ref|XP_003620192.1|  Beta-glucosidase                                   483   4e-160   
ref|XP_007150405.1|  hypothetical protein PHAVU_005G150600g             483   4e-160   
ref|XP_008233045.1|  PREDICTED: beta-glucosidase 12-like                483   4e-160   
ref|XP_008229217.1|  PREDICTED: beta-glucosidase 12-like                483   5e-160   
ref|XP_009347257.1|  PREDICTED: beta-glucosidase 13-like                483   5e-160   
gb|AAL07491.1|AF414608_1  prunasin hydrolase isoform PH I precursor     483   5e-160   
ref|XP_011039106.1|  PREDICTED: beta-glucosidase 44-like                483   6e-160   
ref|XP_003537944.1|  PREDICTED: beta-glucosidase 12-like isoform 1      483   6e-160   
gb|KCW83975.1|  hypothetical protein EUGRSUZ_B00859                     483   6e-160   
ref|XP_008811966.1|  PREDICTED: beta-glucosidase 1-like isoform X2      483   7e-160   
gb|AAA93032.1|  prunasin hydrolase isoform PH I precursor               484   8e-160   
gb|KHN25274.1|  Beta-glucosidase 24                                     483   8e-160   
ref|XP_001771505.1|  predicted protein                                  484   8e-160   
gb|AFK35893.1|  unknown                                                 483   8e-160   
ref|XP_007208454.1|  hypothetical protein PRUPE_ppa003856mg             484   9e-160   
ref|XP_010032608.1|  PREDICTED: beta-glucosidase 44-like                483   9e-160   
ref|XP_010448307.1|  PREDICTED: putative beta-glucosidase 41 isof...    479   1e-159   
ref|XP_010267073.1|  PREDICTED: beta-glucosidase 12-like isoform X1     483   1e-159   
ref|XP_008810053.1|  PREDICTED: beta-glucosidase 1-like                 482   1e-159   
ref|XP_006845278.1|  hypothetical protein AMTR_s00005p00265850          481   1e-159   
ref|XP_003597482.1|  Beta-glucosidase D4                                482   2e-159   
emb|CAH66811.1|  OSIGBa0135C13.6                                        483   2e-159   
ref|XP_008241169.1|  PREDICTED: beta-glucosidase 12-like                482   2e-159   
ref|NP_001051013.1|  Os03g0703000                                       482   2e-159   
ref|XP_007014814.1|  Beta-glucosidase 17 isoform 2                      482   2e-159   
ref|XP_009379420.1|  PREDICTED: beta-glucosidase 12-like isoform X2     482   2e-159   
ref|XP_010482862.1|  PREDICTED: putative beta-glucosidase 41 isof...    479   2e-159   
ref|XP_009415571.1|  PREDICTED: beta-glucosidase 24-like                482   2e-159   
ref|XP_007208652.1|  hypothetical protein PRUPE_ppa020368mg             482   2e-159   
ref|XP_007206744.1|  hypothetical protein PRUPE_ppa025067mg             482   2e-159   
ref|XP_007036681.1|  B-S glucosidase 44 isoform 3                       483   2e-159   
ref|XP_009357133.1|  PREDICTED: beta-glucosidase 12-like                482   2e-159   
ref|XP_007150414.1|  hypothetical protein PHAVU_005G151500g             482   2e-159   
ref|XP_002277732.1|  PREDICTED: beta-glucosidase 12-like                481   2e-159   
gb|AAA91166.1|  beta-glucosidase                                        482   2e-159   
gb|AAA93234.2|  amygdalin hydrolase isoform AH I precursor              483   2e-159   
gb|ACF35791.1|  beta-mannosidase/beta-glucosidase                       480   2e-159   
ref|XP_003579957.1|  PREDICTED: LOW QUALITY PROTEIN: beta-glucosi...    481   2e-159   
gb|AAL07489.1|AF414606_1  amygdalin hydrolase isoform AH I precursor    482   2e-159   
sp|Q7XKV5.2|BGL11_ORYSJ  RecName: Full=Beta-glucosidase 11; Short...    482   3e-159   
ref|XP_009410330.1|  PREDICTED: beta-glucosidase 24-like isoform X2     481   3e-159   
ref|NP_001148821.1|  LOC100282438 precursor                             481   3e-159   
ref|XP_007206382.1|  hypothetical protein PRUPE_ppa017981mg             481   3e-159   
ref|XP_009355662.1|  PREDICTED: cyanogenic beta-glucosidase-like ...    481   3e-159   
ref|XP_008366162.1|  PREDICTED: beta-glucosidase 24-like                482   3e-159   
pdb|4JIE|A  Chain A, Structural Analysis And Insights Into Glycon...    481   3e-159   
ref|XP_002964840.1|  hypothetical protein SELMODRAFT_83357              482   3e-159   
ref|XP_008372964.1|  PREDICTED: beta-glucosidase 12-like                481   3e-159   
ref|XP_010257596.1|  PREDICTED: beta-glucosidase 44-like isoform X3     481   3e-159   
ref|XP_003563435.2|  PREDICTED: beta-glucosidase 25                     478   3e-159   
ref|XP_010916341.1|  PREDICTED: beta-glucosidase 1-like                 481   3e-159   
pdb|2RGL|A  Chain A, Rice Bglu1 Beta-Glucosidase, A Plant Exogluc...    480   4e-159   
ref|XP_010257433.1|  PREDICTED: beta-glucosidase 44-like isoform X1     482   4e-159   
ref|XP_006650460.1|  PREDICTED: beta-glucosidase 8-like                 483   4e-159   
gb|AAA87339.1|  beta-glucosidase                                        481   4e-159   
ref|XP_003539378.1|  PREDICTED: beta-glucosidase 12-like                481   5e-159   
dbj|BAJ90056.1|  predicted protein                                      480   5e-159   
gb|EYU40222.1|  hypothetical protein MIMGU_mgv1a004735mg                481   5e-159   
ref|XP_003539050.1|  PREDICTED: beta-glucosidase 12-like                481   5e-159   
ref|XP_006299658.1|  hypothetical protein CARUB_v10015846mg             480   6e-159   
ref|XP_009379419.1|  PREDICTED: beta-glucosidase 12-like isoform X1     481   6e-159   
ref|XP_007220683.1|  hypothetical protein PRUPE_ppa020067mg             480   6e-159   
gb|ACD65510.1|  beta-glucosidase D2                                     481   6e-159   
sp|A3BMZ5.1|BGL26_ORYSJ  RecName: Full=Beta-glucosidase 26; Short...    480   6e-159   
ref|XP_006439047.1|  hypothetical protein CICLE_v10031209mg             481   7e-159   
gb|AAA84906.3|  beta-glucosidase                                        480   7e-159   
ref|XP_008224309.1|  PREDICTED: beta-glucosidase 12-like                481   7e-159   
ref|XP_007209912.1|  hypothetical protein PRUPE_ppa004380mg             480   8e-159   
ref|XP_004490157.1|  PREDICTED: beta-glucosidase 12-like isoform X1     480   8e-159   
ref|XP_007220362.1|  hypothetical protein PRUPE_ppa015970mg             480   9e-159   
ref|XP_004151252.1|  PREDICTED: beta-glucosidase 24-like                480   1e-158   
pdb|3F4V|A  Chain A, Semi-Active E176q Mutant Of Rice Bglu1, A Pl...    479   1e-158   
gb|KEH30294.1|  glycoside hydrolase family 1 protein                    481   1e-158   
ref|XP_007152084.1|  hypothetical protein PHAVU_004G100700g             479   1e-158   
ref|XP_007221103.1|  hypothetical protein PRUPE_ppa017484mg             479   1e-158   
gb|ABC55717.1|  beta-mannosidase 2                                      479   1e-158   
ref|XP_001769105.1|  predicted protein                                  480   1e-158   
ref|XP_010265852.1|  PREDICTED: beta-glucosidase 12-like                479   1e-158   
gb|KEH16707.1|  glycoside hydrolase family 1 protein                    479   2e-158   
ref|XP_006439048.1|  hypothetical protein CICLE_v10031209mg             480   2e-158   
ref|XP_002961770.1|  hypothetical protein SELMODRAFT_76748              480   2e-158   
ref|XP_008245651.1|  PREDICTED: beta-glucosidase 12-like                479   2e-158   
ref|XP_006845277.1|  hypothetical protein AMTR_s00005p00265710          478   2e-158   
ref|XP_009355663.1|  PREDICTED: cyanogenic beta-glucosidase-like ...    479   2e-158   
ref|XP_006431835.1|  hypothetical protein CICLE_v10004010mg             479   2e-158   
ref|XP_002464026.1|  hypothetical protein SORBIDRAFT_01g010825          481   2e-158   
pdb|3SCR|A  Chain A, Crystal Structure Of Rice Bglu1 E386s Mutant       478   2e-158   
ref|XP_003559508.1|  PREDICTED: beta-glucosidase 7-like                 479   2e-158   
ref|XP_008450457.1|  PREDICTED: cyanogenic beta-glucosidase-like        479   2e-158   
pdb|3SCP|A  Chain A, Crystal Structure Of Rice Bglu1 E386a Mutant       478   3e-158   
ref|XP_004154675.1|  PREDICTED: beta-glucosidase 12-like                479   3e-158   
ref|XP_008385153.1|  PREDICTED: beta-glucosidase 12-like                479   3e-158   
ref|XP_007131974.1|  hypothetical protein PHAVU_011G056100g             479   3e-158   
ref|NP_001280983.1|  beta-glucosidase 12-like precursor                 479   3e-158   
pdb|3SCW|A  Chain A, Crystal Structure Of Rice Bglu1 E386gY341A M...    478   3e-158   
gb|KGN66450.1|  hypothetical protein Csa_1G611270                       479   3e-158   
ref|XP_009379423.1|  PREDICTED: beta-glucosidase 12-like                479   3e-158   
ref|XP_002299251.1|  Cyanogenic beta-glucosidase precursor family...    479   3e-158   
ref|XP_009364758.1|  PREDICTED: beta-glucosidase 13-like                479   4e-158   
ref|XP_006471035.1|  PREDICTED: beta-glucosidase 44-like                478   4e-158   
gb|KHN21873.1|  Beta-glucosidase 24                                     479   4e-158   
pdb|3SCN|A  Chain A, Crystal Structure Of Rice Bglu1 E386g Mutant       477   4e-158   
gb|AII20122.1|  beta-glucosidase                                        478   4e-158   
ref|XP_008454585.1|  PREDICTED: putative beta-glucosidase 41 isof...    476   4e-158   
emb|CBI24835.3|  unnamed protein product                                484   4e-158   
gb|AAL06338.1|AF411928_1  prunasin hydrolase isoform PH B precursor     478   6e-158   
gb|ABC55716.1|  beta-mannosidase 3                                      477   6e-158   
pdb|3SCV|A  Chain A, Crystal Structure Of Rice Bglu1 E386gS334A M...    477   6e-158   
ref|XP_008243589.1|  PREDICTED: beta-glucosidase 13-like                478   6e-158   
ref|XP_009394053.1|  PREDICTED: beta-glucosidase 26-like                477   6e-158   
gb|ADP02192.1|  putative non-cyanogenic beta-glucosidase                478   6e-158   
ref|XP_001769442.1|  predicted protein                                  476   7e-158   
ref|XP_002992401.1|  hypothetical protein SELMODRAFT_135249             476   7e-158   
ref|XP_004490158.1|  PREDICTED: beta-glucosidase 12-like isoform X2     478   7e-158   
ref|XP_007222245.1|  hypothetical protein PRUPE_ppa003891mg             479   8e-158   
ref|XP_007217246.1|  hypothetical protein PRUPE_ppa003831mg             479   8e-158   
ref|XP_008228992.1|  PREDICTED: beta-glucosidase 12-like                478   8e-158   
ref|XP_007133707.1|  hypothetical protein PHAVU_011G202000g             478   1e-157   
emb|CDM83785.1|  unnamed protein product                                477   1e-157   
ref|XP_004507124.1|  PREDICTED: beta-glucosidase 12-like                477   1e-157   
ref|XP_008229698.1|  PREDICTED: beta-glucosidase 12-like                477   1e-157   



>ref|XP_009631811.1| PREDICTED: beta-glucosidase 40 [Nicotiana tomentosiformis]
Length=505

 Score =   733 bits (1892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/486 (71%), Positives = 405/486 (83%), Gaps = 6/486 (1%)
 Frame = +2

Query  488   GLQICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNA  667
             G     AQNISR +FP+GFVFGTAS+AYQFEGAVKEDGRG TIWD F+H+ GKV DFSN 
Sbjct  19    GFHTYSAQNISRNNFPKGFVFGTASSAYQFEGAVKEDGRGPTIWDKFSHSFGKVVDFSNG  78

Query  668   DVAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLAN  847
             DVAVDQYH+Y EDI+LMKDMGMDAYRFSIAW+RIFPNGTG++NQAGVDHYN LI+ALLAN
Sbjct  79    DVAVDQYHQYPEDIQLMKDMGMDAYRFSIAWTRIFPNGTGEINQAGVDHYNKLINALLAN  138

Query  848   GIEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSI  1027
             GI+PYVTLYH+DLPQALE++YNGWL+ Q+IKDFA YAETCF  FGDRVK W+TINEP ++
Sbjct  139   GIQPYVTLYHWDLPQALEDKYNGWLSPQIIKDFAIYAETCFQKFGDRVKNWITINEPHTV  198

Query  1028  TVLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGG  1207
              + G+D+G+ APG CSI   + C  GNSATEPY V H+LLLAHA  VDIY+RKY+  Q G
Sbjct  199   AIQGFDVGLQAPGRCSILLKVFCRAGNSATEPYIVTHNLLLAHATVVDIYKRKYKPIQHG  258

Query  1208  KITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFS  1387
              I I +++FWYEPLTNS  DI+A QRAI+F L W+LEPV+ G YP S+++RVG+RLPKFS
Sbjct  259   SIGISLDTFWYEPLTNSKDDIEATQRAIEFNLDWYLEPVILGRYPSSMVNRVGNRLPKFS  318

Query  1388  AAESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERA  1567
              AESAL+KGSYD++G+NHYTTWYAS   TNI+G  L+D+L DSG  TLPFKGL PI ERA
Sbjct  319   PAESALVKGSYDFIGINHYTTWYASKNKTNIIGALLNDSLADSGAITLPFKGLTPIAERA  378

Query  1568  NAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDD------AKTDGLNDIKRIRYHRD  1729
             +++WLYIVP+G+R+LMNYIK KYGNPL+ ITENGMDD      ++ D L D KRI+YH +
Sbjct  379   SSIWLYIVPQGIRSLMNYIKQKYGNPLIIITENGMDDSNNALTSRQDALKDTKRIKYHNE  438

Query  1730  YLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWF  1909
             YL +LLA+IKEDGCNVKGYF WSLMDNWEW  GFSSRFGLYYVDY DNL+R PK S  WF
Sbjct  439   YLTNLLASIKEDGCNVKGYFVWSLMDNWEWAAGFSSRFGLYYVDYKDNLKRYPKNSVNWF  498

Query  1910  KNFLAS  1927
             KNFL S
Sbjct  499   KNFLGS  504



>ref|XP_009802933.1| PREDICTED: beta-glucosidase 40-like [Nicotiana sylvestris]
Length=505

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/480 (72%), Positives = 404/480 (84%), Gaps = 6/480 (1%)
 Frame = +2

Query  506   AQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQ  685
             AQNISR +FP+GFVFGTAS+AYQFEGAVKEDGRG TIWD F+H+ GKV DFSN DVAVDQ
Sbjct  25    AQNISRNNFPKGFVFGTASSAYQFEGAVKEDGRGPTIWDKFSHSFGKVLDFSNGDVAVDQ  84

Query  686   YHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYV  865
             YH+Y EDI+LMKDMGMDAYRFSIAW+RIFPNG+G++NQAGVDHYN LI+ALLANGI+PYV
Sbjct  85    YHKYPEDIQLMKDMGMDAYRFSIAWTRIFPNGSGEINQAGVDHYNKLINALLANGIQPYV  144

Query  866   TLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYD  1045
             TLYH+DLPQALE++YNGWL+ Q+IKDFA YAETCF  FGDRVK W+TINEP ++ + G+D
Sbjct  145   TLYHWDLPQALEDKYNGWLSPQIIKDFAIYAETCFQKFGDRVKNWITINEPHTVAIQGFD  204

Query  1046  LGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVV  1225
             +G+ APG CSI   + C  GNSATEPY V H+LLLAHA+ VDIY+RKY   Q G I I +
Sbjct  205   VGLQAPGRCSILLKIFCRAGNSATEPYIVTHNLLLAHASVVDIYKRKYNPIQHGSIGISL  264

Query  1226  ESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESAL  1405
             ++FWYEPLTNS  DI+A QRAI+F L W+LEP+M G YP S+++RVG RLPKFS AESAL
Sbjct  265   DTFWYEPLTNSKDDIEATQRAIEFNLDWYLEPIMLGRYPSSMVNRVGSRLPKFSPAESAL  324

Query  1406  LKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLY  1585
             +KGSYD++G+NHYTTWYAS   TNI+G+ L+D+L DSG  TLPFKGL PI ERA+++WLY
Sbjct  325   VKGSYDFIGINHYTTWYASKNKTNIIGVLLNDSLADSGAITLPFKGLTPIAERASSIWLY  384

Query  1586  IVPRGMRNLMNYIKDKYGNPLVFITENGMDD------AKTDGLNDIKRIRYHRDYLKSLL  1747
             IVP+G+R+LMNYIK KYGNPL+ ITENGMDD      ++ D L D KRI+YH +YL +LL
Sbjct  385   IVPQGIRSLMNYIKQKYGNPLIIITENGMDDSNNALVSRQDALKDTKRIKYHNEYLTNLL  444

Query  1748  AAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
             AAIKEDGCNVKGYF WSLMDNWEW  GFSSRFGLYYVDY DNL+R PK S  WFKNFL S
Sbjct  445   AAIKEDGCNVKGYFVWSLMDNWEWAAGFSSRFGLYYVDYKDNLKRYPKNSVNWFKNFLGS  504



>ref|XP_006365136.1| PREDICTED: beta-glucosidase 40-like [Solanum tuberosum]
Length=505

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/480 (70%), Positives = 397/480 (83%), Gaps = 6/480 (1%)
 Frame = +2

Query  506   AQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQ  685
             AQNISR +FP  FVFGTAS+AYQFEGAVKEDGRG TIWD F+H+ GKV DFSN DVAVDQ
Sbjct  25    AQNISRNNFPRDFVFGTASSAYQFEGAVKEDGRGQTIWDKFSHSFGKVIDFSNGDVAVDQ  84

Query  686   YHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYV  865
             YHRY ED++LMKDMGMDAYRFSIAW+RIFPNGTG++NQAGVDHYN LI+ALLA+GI+PY+
Sbjct  85    YHRYPEDVQLMKDMGMDAYRFSIAWARIFPNGTGEINQAGVDHYNKLINALLAHGIKPYI  144

Query  866   TLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYD  1045
             TLYH+DLPQALE++YNGWL+ Q+I+DFA YAETCF  FGDRVK W+TINEP ++ + G+D
Sbjct  145   TLYHWDLPQALEDKYNGWLSPQIIEDFAIYAETCFKKFGDRVKNWITINEPHTVAIQGFD  204

Query  1046  LGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVV  1225
             +G+ APG CSI    LC  GNSATEPY V H+LLLAHA  VDIY++KY+  Q G I I +
Sbjct  205   VGLQAPGRCSILLRALCRAGNSATEPYIVTHNLLLAHATVVDIYKKKYKPTQHGSIGISL  264

Query  1226  ESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESAL  1405
             +SFWYEPLTNS  DI+A QRAI+F L W+LEPV+ G YP S++ RVG RLPKFS  ESAL
Sbjct  265   DSFWYEPLTNSKDDIEATQRAIEFNLDWYLEPVILGRYPSSMVERVGSRLPKFSPTESAL  324

Query  1406  LKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLY  1585
             +KGSYD++G+NHYTTWYAS   TNI+G  L+D++ DSG  TLPFKG+ PI +RA++VWLY
Sbjct  325   VKGSYDFIGINHYTTWYASKNKTNIIGALLNDSVADSGAITLPFKGIKPIADRASSVWLY  384

Query  1586  IVPRGMRNLMNYIKDKYGNPLVFITENGMDD------AKTDGLNDIKRIRYHRDYLKSLL  1747
             IVP G+R+L+NYIK KY NPL+ ITENGMDD      ++ D L D KRI YH DYL +LL
Sbjct  385   IVPHGIRSLLNYIKQKYENPLIIITENGMDDSNNIFTSRKDTLKDTKRINYHNDYLTNLL  444

Query  1748  AAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
             AAIKEDGCNVKGYF WSLMDNWEW  GFSSRFGLYYVDY DNL+R PK+S  WFKNFL S
Sbjct  445   AAIKEDGCNVKGYFVWSLMDNWEWAAGFSSRFGLYYVDYKDNLKRYPKDSVNWFKNFLGS  504



>gb|EYU28848.1| hypothetical protein MIMGU_mgv1a004935mg [Erythranthe guttata]
Length=503

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/485 (70%), Positives = 403/485 (83%), Gaps = 6/485 (1%)
 Frame = +2

Query  491   LQICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNAD  670
             + IC +QNISRASFP+GFVFGTAS+AYQ+EGAVKEDGRG TIWDTFAH+ GKV DFSNAD
Sbjct  19    IPICCSQNISRASFPKGFVFGTASSAYQYEGAVKEDGRGQTIWDTFAHSFGKVVDFSNAD  78

Query  671   VAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANG  850
             VA DQYHRY EDI+LMKDMGMDAYRFSIAWSRIFPNGTG++NQAG+ HYNNLIDALL+NG
Sbjct  79    VANDQYHRYNEDIQLMKDMGMDAYRFSIAWSRIFPNGTGEINQAGIKHYNNLIDALLSNG  138

Query  851   IEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSIT  1030
             IEPYVTLYH+DLPQ+L +RY GWL+ Q IKD+AAYAETCF  FGDRVK W+T NEP    
Sbjct  139   IEPYVTLYHWDLPQSLHDRYTGWLSPQSIKDYAAYAETCFKEFGDRVKNWITFNEPHIFA  198

Query  1031  VLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGK  1210
             V GYD+G+ APG CSI  H  C  GNSATEPY VAH++LL+HA  VDIY++KYQ KQ G 
Sbjct  199   VQGYDVGLQAPGRCSILLHAFCGAGNSATEPYIVAHNVLLSHATVVDIYKKKYQRKQHGA  258

Query  1211  ITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSA  1390
             I I ++SFWYEP +NS AD+ A QRAIDF+LGWFLEP++ G+YP+S+ +RV +RLP+FS 
Sbjct  259   IGISLDSFWYEPASNSYADMQATQRAIDFHLGWFLEPLILGDYPKSMRTRVENRLPRFSQ  318

Query  1391  AESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERAN  1570
             A+S+ LKG++D++G+NHYTTWYA    TNIMG+  +DT++DSG  TLP     PI ++A+
Sbjct  319   AQSSQLKGAFDFIGINHYTTWYARENSTNIMGVLFNDTVSDSGALTLPIVIGKPIFDKAS  378

Query  1571  AVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDY  1732
             +VWLYIVP G+R+LMNYIK KYGNPL+ ITENGMDD  +      D L D KRI+YH DY
Sbjct  379   SVWLYIVPHGIRSLMNYIKQKYGNPLILITENGMDDGNSPFTSIKDALKDEKRIKYHNDY  438

Query  1733  LKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFK  1912
             L +LLAAIKEDGCNV+GYFAWSLMDNWEW  G+SSRFGLYYVDY+D L+R  K+S KWFK
Sbjct  439   LTNLLAAIKEDGCNVRGYFAWSLMDNWEWGAGYSSRFGLYYVDYNDKLKRYAKDSVKWFK  498

Query  1913  NFLAS  1927
             NFLA+
Sbjct  499   NFLAT  503



>ref|XP_007045907.1| Beta glucosidase 40 isoform 1 [Theobroma cacao]
 gb|EOY01739.1| Beta glucosidase 40 isoform 1 [Theobroma cacao]
Length=506

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/483 (70%), Positives = 402/483 (83%), Gaps = 6/483 (1%)
 Frame = +2

Query  497   ICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVA  676
             +  +QNISRASFP+GFVFGTAS+++Q+EGAVKEDGRG TIWD F+HT GK+ D SNADVA
Sbjct  23    LSQSQNISRASFPKGFVFGTASSSFQYEGAVKEDGRGPTIWDKFSHTFGKIIDGSNADVA  82

Query  677   VDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIE  856
             VDQYHRY EDI LMKDMGMDAYRFSIAWSRIFPNGTG++NQAGVDHYNNLI+ALLA GIE
Sbjct  83    VDQYHRYTEDIRLMKDMGMDAYRFSIAWSRIFPNGTGEINQAGVDHYNNLINALLAKGIE  142

Query  857   PYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVL  1036
             PYVTLYH+DLPQALE+RYNGWLN Q+IKDFA +AETCF IFGDRVK W+T NEP + TV 
Sbjct  143   PYVTLYHWDLPQALEDRYNGWLNPQIIKDFAMFAETCFQIFGDRVKHWITFNEPHTFTVQ  202

Query  1037  GYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKIT  1216
             GYD+G+ APG CSI   L+C  GNSATEPY VAH++LL+HA   DIYR+KY+AKQ G + 
Sbjct  203   GYDVGLQAPGRCSIILRLICKAGNSATEPYIVAHNVLLSHATVADIYRKKYKAKQHGSVG  262

Query  1217  IVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAE  1396
             +  +  WYEP TNS  + +A QRA DF LGWFL+P++ G+YP S+ISRVG+RLP+FS AE
Sbjct  263   VSFDVMWYEPETNSTENTEAAQRAQDFQLGWFLDPLIFGDYPSSMISRVGNRLPRFSKAE  322

Query  1397  SALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAV  1576
             SALLKGS D++G+NHYTT+YA +  TN +G  L+D++ DSG FT PFK   PIG++AN++
Sbjct  323   SALLKGSLDFVGINHYTTYYARANATNALGTILNDSIADSGAFTAPFKNGKPIGDKANSI  382

Query  1577  WLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLK  1738
             WLYIVP GMR+LMNYIK+KYGNP V ITENGMDD+ +      D L D KRI+YH DYL 
Sbjct  383   WLYIVPSGMRSLMNYIKEKYGNPPVIITENGMDDSNSIFNSIKDALKDEKRIKYHNDYLT  442

Query  1739  SLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNF  1918
             +LLAAIKEDGCNVKGYF WSL+DNWEW  G++SRFGLY+VDY DNL+R  K+S +WFKNF
Sbjct  443   NLLAAIKEDGCNVKGYFVWSLLDNWEWGAGYTSRFGLYFVDYKDNLKRYAKDSVQWFKNF  502

Query  1919  LAS  1927
             LAS
Sbjct  503   LAS  505



>ref|XP_004228406.1| PREDICTED: beta-glucosidase 40 [Solanum lycopersicum]
Length=507

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/480 (71%), Positives = 394/480 (82%), Gaps = 6/480 (1%)
 Frame = +2

Query  506   AQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQ  685
             AQN SR +FP  FVFGTAS+AYQFEGAVKEDGRG TIWD F+H+ GKV DFSN DVAVDQ
Sbjct  27    AQNFSRNNFPRDFVFGTASSAYQFEGAVKEDGRGQTIWDKFSHSFGKVIDFSNGDVAVDQ  86

Query  686   YHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYV  865
             YHRYLEDI+LMKDMGMDAYRFSIAW+RIFPNGTG++NQAGVDHYN  I+ALLANGI+PYV
Sbjct  87    YHRYLEDIQLMKDMGMDAYRFSIAWARIFPNGTGEINQAGVDHYNKFINALLANGIKPYV  146

Query  866   TLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYD  1045
             TLYH+DLPQALE++Y GWL+ Q+I+DFA YAETCF  FGDRVK W+TINEP ++ V G+D
Sbjct  147   TLYHWDLPQALEDKYTGWLSPQIIEDFAIYAETCFKKFGDRVKNWITINEPHTVAVQGFD  206

Query  1046  LGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVV  1225
             +G+ APG CSI    LC  GNSATEPY V H+LLLAHA AVDIY++KY+  Q G I I +
Sbjct  207   VGLQAPGRCSILLRALCRAGNSATEPYIVTHNLLLAHATAVDIYKKKYKPTQHGSIGISL  266

Query  1226  ESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESAL  1405
             +SFWYEPLTNS  DI+A QRAI+F L W+LEPV+ G YP S++ RVG RLPKFS  ESAL
Sbjct  267   DSFWYEPLTNSKDDIEATQRAIEFNLDWYLEPVILGRYPSSMVERVGSRLPKFSPTESAL  326

Query  1406  LKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLY  1585
             +KGSYD++G+NHYTTWYAS   TNI+G  L+D++ DSG  TLPFKG+ PI +RA+++WLY
Sbjct  327   VKGSYDFIGINHYTTWYASKNKTNIIGALLNDSVADSGAITLPFKGIKPIADRASSIWLY  386

Query  1586  IVPRGMRNLMNYIKDKYGNPLVFITENGMDDA------KTDGLNDIKRIRYHRDYLKSLL  1747
             IVP G+R+L+NYIK KY NPL+ ITENGMDDA      +   L D KRI YH DYL +LL
Sbjct  387   IVPSGIRSLLNYIKQKYENPLIIITENGMDDANSIFTSREHTLKDTKRINYHNDYLTNLL  446

Query  1748  AAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
              AIKEDGCNVKGYF WSLMDNWEW  GFSSRFGLYYVDY DNL+R PK+S  WFKNFL S
Sbjct  447   DAIKEDGCNVKGYFVWSLMDNWEWAAGFSSRFGLYYVDYKDNLKRYPKDSVNWFKNFLGS  506



>emb|CDP00417.1| unnamed protein product [Coffea canephora]
Length=531

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/486 (68%), Positives = 395/486 (81%), Gaps = 7/486 (1%)
 Frame = +2

Query  488   GLQICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNA  667
             GL+ C  Q I+R SFP+GFVFGTAS+AYQ+EGAVK DGRG T+WD FAH+ GKV DFSNA
Sbjct  46    GLRTCLGQ-INRGSFPKGFVFGTASSAYQYEGAVKADGRGPTVWDKFAHSFGKVLDFSNA  104

Query  668   DVAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLAN  847
             DVAVDQYHRY ED++LMKDMGMDAYRFSIAW+R+FPNGTG+LNQAGVDHYN LID LLAN
Sbjct  105   DVAVDQYHRYNEDVQLMKDMGMDAYRFSIAWTRLFPNGTGELNQAGVDHYNTLIDTLLAN  164

Query  848   GIEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSI  1027
             GIEPYVT+YH+DLPQAL+++YNGWL+ Q+I DFA +AETCF  FGDRVK W+T NEP + 
Sbjct  165   GIEPYVTIYHWDLPQALQDKYNGWLSPQIINDFAVFAETCFQKFGDRVKHWITFNEPHTF  224

Query  1028  TVLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGG  1207
              V GYD+G+ APG CSI  H  C  GNSATEPY V H++LLAH+   DIY+RKY+  Q G
Sbjct  225   AVQGYDVGLQAPGRCSILLHAFCTAGNSATEPYIVGHNVLLAHSTVADIYKRKYKPTQKG  284

Query  1208  KITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFS  1387
              I I +++FWYEP +NS  DI A +RAIDF LGWFLEP++ G+YP S+ +RVG RLP+FS
Sbjct  285   SIGISLDTFWYEPASNSTEDIQATKRAIDFNLGWFLEPLIVGDYPSSMRTRVGKRLPQFS  344

Query  1388  AAESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERA  1567
               +S  LKGS D++G+NHYTTWYA +  TNI+G  L+D+L DSG  TLPFKGL PIG+RA
Sbjct  345   QVQSLALKGSLDFVGINHYTTWYAKNNSTNIIGDLLNDSLADSGAITLPFKGLQPIGDRA  404

Query  1568  NAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRD  1729
             N++WLYIVPRG+R+LMNYIK  YGNPLV ITENGMDD  +      + L+D KRI+YH D
Sbjct  405   NSIWLYIVPRGIRSLMNYIKQTYGNPLVIITENGMDDGNSPFNSIQNALHDEKRIKYHND  464

Query  1730  YLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWF  1909
             YL +LLAA+KEDGCNV+GYF WSL+DNWEW  G++SRFGLYYVDY D L+R  K+S KWF
Sbjct  465   YLTNLLAAVKEDGCNVQGYFVWSLLDNWEWGAGYTSRFGLYYVDYKDKLKRYAKDSVKWF  524

Query  1910  KNFLAS  1927
             KNFL +
Sbjct  525   KNFLTA  530



>ref|XP_006437961.1| hypothetical protein CICLE_v10031299mg [Citrus clementina]
 gb|ESR51201.1| hypothetical protein CICLE_v10031299mg [Citrus clementina]
Length=506

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/486 (68%), Positives = 395/486 (81%), Gaps = 7/486 (1%)
 Frame = +2

Query  488   GLQICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNA  667
             G+Q C +Q I+RASFP+GFVFGTAS+A+Q+EGAVKEDGRG T+WDTF+HT GK+ D SNA
Sbjct  20    GIQTCSSQ-INRASFPKGFVFGTASSAFQYEGAVKEDGRGPTVWDTFSHTFGKILDNSNA  78

Query  668   DVAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLAN  847
             DVAVDQYHRY ED++LMKDMGMDAYRFSIAWSRIFPNGTG++NQAGVDHYN LIDALLA 
Sbjct  79    DVAVDQYHRYPEDVQLMKDMGMDAYRFSIAWSRIFPNGTGQINQAGVDHYNKLIDALLAK  138

Query  848   GIEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSI  1027
             GIEPYVTLYH+DLPQAL+++Y GWL+RQ+I DFA YAETCF  FGDRVK W+T NEP + 
Sbjct  139   GIEPYVTLYHWDLPQALDDKYKGWLDRQIINDFATYAETCFQKFGDRVKHWITFNEPHTF  198

Query  1028  TVLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGG  1207
             T+ GYD+G+ APG CSI  HL C  GNSATEPY VAH+ LL HA   DIYR+KY+AKQGG
Sbjct  199   TIQGYDVGLQAPGRCSILLHLFCRAGNSATEPYIVAHNALLTHAKVADIYRKKYKAKQGG  258

Query  1208  KITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFS  1387
              + I  +  WYE  +NS  D +A QRA DF LGWFL+P+M G+YP S+ +RVG RLP+F+
Sbjct  259   SLGIAFDVIWYESASNSTEDAEATQRAQDFQLGWFLDPLMFGDYPSSMRNRVGSRLPRFT  318

Query  1388  AAESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERA  1567
             ++E+ALLKGS D++G+NHYTT+YA    TN++G+ L+D+L D+G  T+PFK   PI +RA
Sbjct  319   SSEAALLKGSLDFVGINHYTTFYAQRNATNLIGVVLNDSLADAGALTIPFKNGKPIADRA  378

Query  1568  NAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRD  1729
             N++WLYIVPRGMR+LMNYIK KY NP V ITENGMDD         + L D KRI+YH D
Sbjct  379   NSIWLYIVPRGMRSLMNYIKQKYRNPTVIITENGMDDPNNRFTPIKEALKDDKRIKYHND  438

Query  1730  YLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWF  1909
             YL +LLAAIKEDGCNVKGYF WSL+DNWEW  G++SRFGLY+VDY DN +R PK S +WF
Sbjct  439   YLTNLLAAIKEDGCNVKGYFVWSLLDNWEWAAGYTSRFGLYFVDYKDNQKRYPKNSVQWF  498

Query  1910  KNFLAS  1927
             KNFL S
Sbjct  499   KNFLNS  504



>ref|XP_006484173.1| PREDICTED: beta-glucosidase 40-like [Citrus sinensis]
Length=506

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/486 (68%), Positives = 395/486 (81%), Gaps = 7/486 (1%)
 Frame = +2

Query  488   GLQICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNA  667
             G+Q C +Q I+RASFP+GFVFGTAS+A+Q+EGAVKEDGRG T+WDTF+HT GK+ D SNA
Sbjct  20    GIQTCSSQ-INRASFPKGFVFGTASSAFQYEGAVKEDGRGPTVWDTFSHTFGKILDNSNA  78

Query  668   DVAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLAN  847
             DVAVDQYHRY ED++LMKDMGMDAYRFSIAWSRIFPNGTG++NQAGVDHYN LIDALLA 
Sbjct  79    DVAVDQYHRYPEDVQLMKDMGMDAYRFSIAWSRIFPNGTGQINQAGVDHYNKLIDALLAK  138

Query  848   GIEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSI  1027
             GIEPYVTLYH+DLPQAL+++Y GWL+RQ+I DFA YAETCF  FGDRVK W+T NEP + 
Sbjct  139   GIEPYVTLYHWDLPQALDDKYKGWLDRQIINDFATYAETCFQKFGDRVKHWITFNEPHTF  198

Query  1028  TVLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGG  1207
             T+ GYD+G+ APG CSI  HL C  GNSATEPY VAH+ LL HA   DIYR+KY+AKQGG
Sbjct  199   TIQGYDVGLQAPGRCSILLHLFCRAGNSATEPYIVAHNALLTHAKVADIYRKKYKAKQGG  258

Query  1208  KITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFS  1387
              + I  +  WYE  +NS  D +A QRA DF LGWFL+P+M G+YP S+ +RVG RLP+F+
Sbjct  259   SLGIAFDVIWYESASNSTEDAEATQRAQDFQLGWFLDPLMFGDYPSSMRNRVGSRLPRFT  318

Query  1388  AAESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERA  1567
             ++E+ALLKGS D++G+NHYTT+YA    TN++G+ L+D+L D+G  T+PFK   PI +RA
Sbjct  319   SSEAALLKGSLDFVGINHYTTFYAQRNATNLIGVVLNDSLADAGALTIPFKNGKPIADRA  378

Query  1568  NAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRD  1729
             N++WLYIVPRGMR+LMNYIK KY NP V ITENGMDD         + L D KRI+YH D
Sbjct  379   NSIWLYIVPRGMRSLMNYIKQKYRNPTVIITENGMDDPNNRFTPTKEALKDDKRIKYHND  438

Query  1730  YLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWF  1909
             YL +LLAAIKEDGCNVKGYF WSL+DNWEW  G++SRFGLY+VDY DN +R PK S +WF
Sbjct  439   YLTNLLAAIKEDGCNVKGYFVWSLLDNWEWAAGYTSRFGLYFVDYKDNQKRYPKNSVQWF  498

Query  1910  KNFLAS  1927
             KNFL S
Sbjct  499   KNFLNS  504



>ref|XP_011075589.1| PREDICTED: beta-glucosidase 6 [Sesamum indicum]
Length=514

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/513 (67%), Positives = 412/513 (80%), Gaps = 7/513 (1%)
 Frame = +2

Query  410   MLLRKGIIVSSPPSLKvvvfvfvvvvGLQICGAQNI-SRASFPEGFVFGTASAAYQFEGA  586
             ML+RK    ++   + +++F++VV VG+  C AQNI SR SFP+GFVFGTAS+A+Q+EGA
Sbjct  2     MLVRKCNNNNNNNIIGLIIFMYVVGVGIPTCFAQNIISRGSFPKGFVFGTASSAFQYEGA  61

Query  587   VKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHRYLEDIELMKDMGMDAYRFSIAWSR  766
             VKEDGRG TIWD FAH+ GKV DFSNADVA DQYH Y  DI+LMKDMGMDAYRFSIAWSR
Sbjct  62    VKEDGRGPTIWDKFAHSFGKVIDFSNADVANDQYHLYTGDIQLMKDMGMDAYRFSIAWSR  121

Query  767   IFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLYHYDLPQALENRYNGWLNRQVIKDF  946
             I+PNGTG +NQAG+DHYN LIDALLANGI+PYVTLYH+DLPQ+LE+ Y GWL+ Q IKDF
Sbjct  122   IYPNGTGVINQAGIDHYNKLIDALLANGIQPYVTLYHWDLPQSLEDGYKGWLSPQSIKDF  181

Query  947   AAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGVHAPGHCSIFFHLLCPTGNSATEPY  1126
             A YAETCF  FGDRVK W+T NEP +  V GYD+G+ APG CSI     C  GNSATEPY
Sbjct  182   ATYAETCFKAFGDRVKYWITFNEPHTFAVQGYDVGLQAPGRCSILLRTFCTVGNSATEPY  241

Query  1127  FVahhlllahaaaVDIYRRKYQAKQGGKITIVVESFWYEPLTNSPADIDAKQRAIDFYLG  1306
              V H++LL+HA  VDIY+RKYQ KQ G I I ++SFWYEP TN+ ADI A QRA+DF LG
Sbjct  242   IVGHNVLLSHATVVDIYKRKYQPKQKGSIGITLDSFWYEPATNTSADIQAAQRAVDFNLG  301

Query  1307  WFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKGSYDYLGVNHYTTWYASSTDTNIMG  1486
             WF+EP++ G+YPRS+ +RVG RLPKFS A+SA +KG++D++G+NHYTTWYA+  +TNI+G
Sbjct  302   WFIEPLIRGDYPRSMRARVGTRLPKFSQAQSAQVKGAFDFIGINHYTTWYANENNTNIIG  361

Query  1487  LFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVPRGMRNLMNYIKDKYGNPLVFITEN  1666
             + L+D+L DSG FTLP     P+ +RAN++WLYIVP G+R+LMNYI+ KY NPLV ITEN
Sbjct  362   VLLNDSLADSGAFTLPIALGRPVHDRANSIWLYIVPDGIRSLMNYIRQKYDNPLVIITEN  421

Query  1667  GMDDAKT------DGLNDIKRIRYHRDYLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVG  1828
             GMDD  +      + L D KRI+YH DYL SLLAAIKEDGCNV+GYF WSL+DNWEW  G
Sbjct  422   GMDDGNSPFVSIKNALKDEKRIKYHNDYLTSLLAAIKEDGCNVRGYFVWSLLDNWEWGAG  481

Query  1829  FSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
             FSSRFGLYYVDY DNL+R  K+S  WFKNFLAS
Sbjct  482   FSSRFGLYYVDYKDNLKRYAKDSVTWFKNFLAS  514



>ref|XP_009115373.1| PREDICTED: beta-glucosidase 40 [Brassica rapa]
 emb|CDY16165.1| BnaA09g28990D [Brassica napus]
Length=508

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/483 (67%), Positives = 397/483 (82%), Gaps = 7/483 (1%)
 Frame = +2

Query  497   ICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVA  676
             +C AQ+ISR SFP+GFVFGTAS+A+Q EGAVKE+GRG TIWDTF+H  GK+TDFSNAD+A
Sbjct  25    VC-AQDISRGSFPKGFVFGTASSAFQHEGAVKEEGRGPTIWDTFSHAFGKITDFSNADIA  83

Query  677   VDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIE  856
             VDQYHRY ED++LMK+MGMDAYRFSI+W+RIFPNG G++N+AG+DHYN LI+ALLA GIE
Sbjct  84    VDQYHRYEEDVQLMKNMGMDAYRFSISWARIFPNGVGQINEAGIDHYNKLINALLAKGIE  143

Query  857   PYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVL  1036
             PYVTLYH+DLPQAL +RY GWLN Q+I DFAAYAE CF  FGDRVK W+T NEP +  + 
Sbjct  144   PYVTLYHWDLPQALHDRYLGWLNPQIINDFAAYAEVCFQRFGDRVKHWITFNEPHTFAIQ  203

Query  1037  GYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKIT  1216
             GYD+G+ APG C+I F L C +GNS+TEPY V H++LL HA   DIYR+KY+AKQGG + 
Sbjct  204   GYDVGLQAPGRCTILFKLTCRSGNSSTEPYIVGHNVLLTHATVSDIYRKKYKAKQGGSLG  263

Query  1217  IVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAE  1396
             I  +  WYEP +N   DI+A QRA DF LGWFL+P+M G+YP S+ SRVG RLP F+ ++
Sbjct  264   IAFDVMWYEPESNKTEDIEAAQRAQDFQLGWFLDPLMFGDYPSSMRSRVGSRLPVFTGSQ  323

Query  1397  SALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAV  1576
             SAL+KGS D++G+NHYTT+YA + DTN++G  LHD ++DSGT TLPFKGL  IG+RA+++
Sbjct  324   SALMKGSLDFVGINHYTTYYARNNDTNLIGTLLHDAVSDSGTVTLPFKGLNAIGDRASSI  383

Query  1577  WLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDD------AKTDGLNDIKRIRYHRDYLK  1738
             WLYIVPRGMR+LMNY+K +YGNP VFITENGMDD      ++ + L D KRI+YH DYL 
Sbjct  384   WLYIVPRGMRSLMNYVKQRYGNPPVFITENGMDDSNNVLISREEALKDAKRIKYHHDYLS  443

Query  1739  SLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNF  1918
             SL AAIKEDGCNVKGYFAWSL+DNWEW  G+SSRFGLY+VDY D L+R PK+S +WF +F
Sbjct  444   SLQAAIKEDGCNVKGYFAWSLLDNWEWAAGYSSRFGLYFVDYRDKLKRYPKDSVRWFTSF  503

Query  1919  LAS  1927
             L S
Sbjct  504   LNS  506



>dbj|BAO04176.1| hypothetical protein [Delphinium grandiflorum]
Length=507

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/480 (69%), Positives = 396/480 (83%), Gaps = 6/480 (1%)
 Frame = +2

Query  506   AQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQ  685
             +  I+R SFP+GFVFGTAS+AYQ+EGAVKE GRG T+WDTFAH  GK+ DFSNADVAVDQ
Sbjct  27    SSEINRTSFPKGFVFGTASSAYQYEGAVKEGGRGPTVWDTFAHKFGKIADFSNADVAVDQ  86

Query  686   YHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYV  865
             YH Y EDI+LMKDMGMDAYRFSIAWSRIFPNGTG++NQAGVD+YNNLI+ALLA GIEPYV
Sbjct  87    YHLYAEDIQLMKDMGMDAYRFSIAWSRIFPNGTGEINQAGVDYYNNLINALLAKGIEPYV  146

Query  866   TLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYD  1045
             TLYH+DLPQALE+RY GWLN Q+IKD+A +A+TCF  FGDRVK W+T NEP + ++ GYD
Sbjct  147   TLYHWDLPQALEDRYTGWLNPQIIKDYAVFADTCFQKFGDRVKHWMTFNEPHTFSIQGYD  206

Query  1046  LGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVV  1225
             +G+ APG CSI  H++C  GNSATEPY VAH+ LL+HA AVDIYR+KY++KQ G + I  
Sbjct  207   VGLQAPGRCSILAHIVCRAGNSATEPYIVAHNALLSHATAVDIYRKKYKSKQKGSLGIAF  266

Query  1226  ESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESAL  1405
             +  W+EP TNS  DI+A QRA DF LGWFL+P++ G+YP S+  RVG+RLP FS A+S+L
Sbjct  267   DVMWFEPATNSTEDIEATQRAQDFQLGWFLDPLVFGDYPSSMRKRVGNRLPTFSQAQSSL  326

Query  1406  LKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLY  1585
             LKGS D++G+NHYTT+YA    T+I+G  L+D+L DSG  TLPF+GL PIG+RA+++WLY
Sbjct  327   LKGSLDFVGINHYTTYYAKHNSTSIIGRLLNDSLADSGAVTLPFRGLKPIGDRASSIWLY  386

Query  1586  IVPRGMRNLMNYIKDKYGNPLVFITENGMDDAK------TDGLNDIKRIRYHRDYLKSLL  1747
             IVPRGMR+LMNYIK KYGNP V ITENGMDD         + L D KRI+YH DYL++LL
Sbjct  387   IVPRGMRSLMNYIKQKYGNPPVIITENGMDDPNDPFKPLKECLKDEKRIKYHHDYLENLL  446

Query  1748  AAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
             A+I EDGCNVKGYFAWSLMDNWEW  GF+SRFGLY+VDY DNL+R PK+S +WFK FL S
Sbjct  447   ASITEDGCNVKGYFAWSLMDNWEWAAGFTSRFGLYFVDYKDNLKRYPKDSVQWFKKFLTS  506



>emb|CDX85027.1| BnaC05g20280D [Brassica napus]
Length=508

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/483 (67%), Positives = 395/483 (82%), Gaps = 7/483 (1%)
 Frame = +2

Query  497   ICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVA  676
             +C AQ+ISR SFP+GFVFGTAS+A+Q EGAVKE+GRG TIWDTF+HT GK+TDFSNADVA
Sbjct  25    VC-AQDISRGSFPKGFVFGTASSAFQHEGAVKEEGRGPTIWDTFSHTFGKITDFSNADVA  83

Query  677   VDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIE  856
             VDQYHRY ED++LMK+MGMDAYRFSI+W+RIFPNG G++N+AG+DHYN LI+ALLA GIE
Sbjct  84    VDQYHRYEEDVQLMKNMGMDAYRFSISWARIFPNGVGQINEAGIDHYNKLINALLAKGIE  143

Query  857   PYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVL  1036
             PYVTLYH+DLPQAL +RY GWLN Q+I DFAAYAE CF  FGDRVK W+T NEP +  + 
Sbjct  144   PYVTLYHWDLPQALHDRYLGWLNPQIINDFAAYAEVCFQRFGDRVKHWITFNEPHTFAIQ  203

Query  1037  GYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKIT  1216
             GYD+G+ APG C+I F L C +GNS+TEPY V H++LL HA   DIYR+KY+AKQGG + 
Sbjct  204   GYDVGLQAPGRCTILFKLTCRSGNSSTEPYIVGHNVLLTHATVSDIYRKKYKAKQGGSLG  263

Query  1217  IVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAE  1396
             +  +  WYEP +N   DI+A QRA DF LGWFL+P+M G+YP S+ SRVG RLP F+ ++
Sbjct  264   VAFDVMWYEPESNKTEDIEAAQRAQDFQLGWFLDPLMFGDYPSSMRSRVGSRLPVFTGSQ  323

Query  1397  SALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAV  1576
             SAL+KGS D++G+NHYTT+YA + DTN++G  LHD ++DSGT TLPFKGL  IG+RA+++
Sbjct  324   SALMKGSLDFVGINHYTTYYARNNDTNLIGTLLHDAVSDSGTVTLPFKGLNAIGDRASSI  383

Query  1577  WLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDD------AKTDGLNDIKRIRYHRDYLK  1738
             WLYIVPRGMR+LMNY+K +YGNP VFITENGMDD      +    L D KRI+YH DYL 
Sbjct  384   WLYIVPRGMRSLMNYVKQRYGNPPVFITENGMDDPNNVLISTEAALKDAKRIKYHHDYLS  443

Query  1739  SLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNF  1918
             SL AAIKEDGCNVKGYF WSL+DNWEW  G+SSRFGLY+VDY D L+R PK+S +WF +F
Sbjct  444   SLQAAIKEDGCNVKGYFVWSLLDNWEWAAGYSSRFGLYFVDYRDKLKRYPKDSVRWFTSF  503

Query  1919  LAS  1927
             L S
Sbjct  504   LNS  506



>ref|XP_002512097.1| beta-glucosidase, putative [Ricinus communis]
 gb|EEF50766.1| beta-glucosidase, putative [Ricinus communis]
Length=504

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/485 (67%), Positives = 394/485 (81%), Gaps = 6/485 (1%)
 Frame = +2

Query  491   LQICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNAD  670
             +Q C +Q I+RASFP+GFVFGTAS+A+Q+EGAVKEDGRG ++WDTF+H+ GK+ DFSNAD
Sbjct  19    IQSCLSQQINRASFPKGFVFGTASSAFQYEGAVKEDGRGPSVWDTFSHSFGKILDFSNAD  78

Query  671   VAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANG  850
             VAVDQYHR+ EDI+LMKDMGMDAYRFSI+W RI+PNGTG +NQ GVDHYNNLI+ALLA G
Sbjct  79    VAVDQYHRFAEDIQLMKDMGMDAYRFSISWPRIYPNGTGAINQPGVDHYNNLINALLAAG  138

Query  851   IEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSIT  1030
             IEPYVTLYH+DLPQAL++RY GWL+ Q+IKDFA +AETCF  FGDRVK W+T NEP + T
Sbjct  139   IEPYVTLYHWDLPQALDDRYKGWLSPQIIKDFAIFAETCFREFGDRVKHWITFNEPHTFT  198

Query  1031  VLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGK  1210
             + GYD+G+ APG CSI  HLLC  GNSATEPY VAH++LL H   VDIYR+KY+A Q G 
Sbjct  199   IQGYDVGLQAPGRCSILLHLLCTAGNSATEPYIVAHNVLLTHGTVVDIYRKKYKATQRGS  258

Query  1211  ITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSA  1390
             + I ++  W+ P +NS  DI+A QRA DF LGWF+EP++ G+YP S+ SRVGDRLPKFS 
Sbjct  259   VGISLDVMWFIPASNSTKDIEATQRAQDFQLGWFIEPLIFGDYPSSIRSRVGDRLPKFSK  318

Query  1391  AESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERAN  1570
              E AL+KGS D++G+NHYTT+YAS +    +   L+D+L DSG  TLPFKGL PIG+RAN
Sbjct  319   PEVALVKGSLDFVGINHYTTYYASESSGGPINKILNDSLADSGATTLPFKGLKPIGDRAN  378

Query  1571  AVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAK------TDGLNDIKRIRYHRDY  1732
             +VWLYIVP GMR+LMNYIK+KYGN  + ITENGMDD         D L D KRI+YH DY
Sbjct  379   SVWLYIVPEGMRSLMNYIKNKYGNIPIVITENGMDDPNDLLKPVKDALKDEKRIKYHNDY  438

Query  1733  LKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFK  1912
             L +LLA+IKEDGCNVKGYF WSL+DNWEW  G++SRFGLY+VDY D L+R PK+S KWFK
Sbjct  439   LTNLLASIKEDGCNVKGYFVWSLLDNWEWAAGYTSRFGLYFVDYKDKLKRYPKDSVKWFK  498

Query  1913  NFLAS  1927
             NFL S
Sbjct  499   NFLTS  503



>ref|XP_006307269.1| hypothetical protein CARUB_v10008883mg [Capsella rubella]
 gb|EOA40167.1| hypothetical protein CARUB_v10008883mg [Capsella rubella]
Length=512

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/484 (66%), Positives = 394/484 (81%), Gaps = 6/484 (1%)
 Frame = +2

Query  494   QICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADV  673
             + C   +ISR SFP+GFVFGTAS+A+Q EGAVK DGRG TIWDTF+HT GK+TDFSNADV
Sbjct  27    KTCICADISRGSFPKGFVFGTASSAFQHEGAVKADGRGPTIWDTFSHTFGKITDFSNADV  86

Query  674   AVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGI  853
             AVDQYHRY ED++LMK+MGMDAYRFSI+W+RIFPNG G++N+AG+DHYN LIDALLA GI
Sbjct  87    AVDQYHRYEEDVQLMKNMGMDAYRFSISWTRIFPNGVGQINEAGIDHYNKLIDALLAKGI  146

Query  854   EPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITV  1033
             EPYVTLYH+DLPQAL +RY GWLN Q+I DFAAYAE CF  FGDRVK W+T NEP +  +
Sbjct  147   EPYVTLYHWDLPQALHDRYLGWLNPQIINDFAAYAEVCFQRFGDRVKHWITFNEPHTFAI  206

Query  1034  LGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKI  1213
              GYD+G+ APG C+I F L C +GNS+TEPY V H+++L HA   D+Y++KY+AKQGG +
Sbjct  207   QGYDVGLQAPGRCTILFKLTCRSGNSSTEPYIVGHNVILTHATVSDLYKKKYKAKQGGSL  266

Query  1214  TIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAA  1393
              I  +  W+EP +N   DI+A QRA DF LGWFL+P+M G+YP S+ SRVG RLP F+ +
Sbjct  267   GIAFDVMWFEPESNKTEDIEAAQRAQDFQLGWFLDPLMFGDYPSSMRSRVGSRLPVFTKS  326

Query  1394  ESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANA  1573
             +SAL+KGS D++G+NHYTT+YA +  TN++G  LHD ++DSGT TLPFKGL  IG+RA++
Sbjct  327   QSALVKGSLDFVGINHYTTYYARNNATNLIGTLLHDAISDSGTVTLPFKGLSAIGDRASS  386

Query  1574  VWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDA------KTDGLNDIKRIRYHRDYL  1735
             +WLYIVPRGMR+LMNY+K +YGNP VFITENGMDDA      + D L D KRI+YH DYL
Sbjct  387   IWLYIVPRGMRSLMNYVKQRYGNPPVFITENGMDDANNFLISRKDALKDSKRIKYHHDYL  446

Query  1736  KSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKN  1915
              SL A+IKEDGCNVKGYF WSL+DNWEW  G+SSRFGLY+VDY DNL+R PK+S +WF +
Sbjct  447   SSLQASIKEDGCNVKGYFVWSLLDNWEWAAGYSSRFGLYFVDYRDNLKRYPKDSVQWFTS  506

Query  1916  FLAS  1927
             FL S
Sbjct  507   FLNS  510



>ref|XP_002893397.1| hypothetical protein ARALYDRAFT_472753 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69656.1| hypothetical protein ARALYDRAFT_472753 [Arabidopsis lyrata subsp. 
lyrata]
Length=509

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/484 (67%), Positives = 393/484 (81%), Gaps = 6/484 (1%)
 Frame = +2

Query  494   QICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADV  673
             + C   +ISR SFP+GFVFGTAS+A+Q+EGAVK +GRG TIWDTF+HT GK+TDFSNADV
Sbjct  24    KTCICADISRGSFPKGFVFGTASSAFQYEGAVKAEGRGPTIWDTFSHTFGKITDFSNADV  83

Query  674   AVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGI  853
             AVDQYHRY ED++LMK+MGMDAYRFSI+W+RIFPNG G++N+AG+DHYN LI+ALLA GI
Sbjct  84    AVDQYHRYEEDVQLMKNMGMDAYRFSISWTRIFPNGVGQINEAGIDHYNKLINALLAKGI  143

Query  854   EPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITV  1033
             EPYVTLYH+DLPQAL +RY GWLN Q+I DFAAYAE CF  FGDRVK W+T NEP +  +
Sbjct  144   EPYVTLYHWDLPQALHDRYLGWLNPQIINDFAAYAEVCFQRFGDRVKHWITFNEPHTFAI  203

Query  1034  LGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKI  1213
              GYD+G+ APG C+I F L C  GNS+TEPY V H+++L HA   DIYR+KY+AKQGG +
Sbjct  204   QGYDVGLQAPGRCTILFKLTCRAGNSSTEPYIVGHNVILTHATVSDIYRKKYKAKQGGSL  263

Query  1214  TIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAA  1393
              I  +  W+EP +N   DI+A QRA DF LGWFL+P+M G+YP S+ SRVG RLP F+ +
Sbjct  264   GIAFDVMWFEPESNKTEDIEAAQRAQDFQLGWFLDPLMFGDYPSSMRSRVGSRLPVFTGS  323

Query  1394  ESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANA  1573
             +SAL+KGS D++G+NHYTT+YA +  TN++G  LHD ++DSGT TLPFKGL  IG+RA++
Sbjct  324   QSALVKGSLDFVGINHYTTYYARNNATNLIGTLLHDAISDSGTVTLPFKGLSTIGDRASS  383

Query  1574  VWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDD------AKTDGLNDIKRIRYHRDYL  1735
             +WLYIVPRGMR+LMNYIK +YGNP VFITENGMDD      ++ D L D KRIRYH DYL
Sbjct  384   IWLYIVPRGMRSLMNYIKHRYGNPPVFITENGMDDPNSILISRKDALKDAKRIRYHHDYL  443

Query  1736  KSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKN  1915
              SL A+IKEDGCNVKGYF WSL+DNWEW  G+SSRFGLY+VDY DNL+R PK+S  WF +
Sbjct  444   SSLQASIKEDGCNVKGYFVWSLLDNWEWAAGYSSRFGLYFVDYRDNLKRYPKDSVHWFTS  503

Query  1916  FLAS  1927
             FL S
Sbjct  504   FLNS  507



>ref|XP_010499028.1| PREDICTED: beta-glucosidase 40 [Camelina sativa]
Length=511

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/484 (67%), Positives = 393/484 (81%), Gaps = 6/484 (1%)
 Frame = +2

Query  494   QICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADV  673
             + C   +ISR SFP+GFVFGTAS+A+Q EGAVK DGRG TIWDTF+HT GK+TDFSNADV
Sbjct  26    KTCICADISRGSFPKGFVFGTASSAFQHEGAVKADGRGPTIWDTFSHTFGKITDFSNADV  85

Query  674   AVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGI  853
             AVDQYHRY ED++LMK+MGMDAYRFSI+WSRIFPNG G++N+AG+DHYN LIDALLA GI
Sbjct  86    AVDQYHRYEEDVQLMKNMGMDAYRFSISWSRIFPNGVGQINEAGIDHYNKLIDALLAKGI  145

Query  854   EPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITV  1033
             EPYVTLYH+DLPQAL +RY GWLN Q+I DFAAYAE CF  FGDRVK W+T NEP +  +
Sbjct  146   EPYVTLYHWDLPQALHDRYLGWLNPQIINDFAAYAEVCFQRFGDRVKHWLTFNEPHTFAI  205

Query  1034  LGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKI  1213
              GYD+G+ APG C+I F L C +GNS+TEPY V H++LL HA   DIYR+KY+AKQGG +
Sbjct  206   QGYDVGLQAPGRCTILFKLTCRSGNSSTEPYIVGHNVLLTHATVSDIYRKKYKAKQGGSL  265

Query  1214  TIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAA  1393
              I  +  W+EP +N   DI+A QRA DF LGWFL+P M G+YP S+ SRVG RLP F+ +
Sbjct  266   GIAFDVMWFEPESNKTEDIEAAQRAQDFQLGWFLDPFMFGDYPSSMRSRVGSRLPLFTKS  325

Query  1394  ESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANA  1573
             +SAL+KGS D++G+NHYTT+YA +  TN++G  LHD ++DSGT TLPFKGL  IG+RA++
Sbjct  326   QSALVKGSLDFVGINHYTTYYARNNGTNLIGTLLHDAISDSGTVTLPFKGLTAIGDRASS  385

Query  1574  VWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDD------AKTDGLNDIKRIRYHRDYL  1735
             +WLYIVPRGMR+LMNYIK +YGNP VFITENGMDD      ++ D L D KRI+YH DYL
Sbjct  386   IWLYIVPRGMRSLMNYIKHRYGNPPVFITENGMDDSNNFLISRKDALKDAKRIKYHHDYL  445

Query  1736  KSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKN  1915
              +L A+IKEDGCNVKGYF WSL+DNWEW  G+SSRFGLY+VDY DNL+R PK+S +WF +
Sbjct  446   SNLQASIKEDGCNVKGYFVWSLLDNWEWAAGYSSRFGLYFVDYRDNLKRYPKDSVQWFTS  505

Query  1916  FLAS  1927
             FL S
Sbjct  506   FLNS  509



>gb|KDP41287.1| hypothetical protein JCGZ_15694 [Jatropha curcas]
Length=507

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/483 (67%), Positives = 397/483 (82%), Gaps = 6/483 (1%)
 Frame = +2

Query  497   ICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVA  676
             IC AQ+I+R SFP+GFVFGTAS+A+Q+EGAVKEDGRG ++WD F+H+ GK+ DFSNADVA
Sbjct  24    ICLAQSINRGSFPKGFVFGTASSAFQYEGAVKEDGRGPSVWDKFSHSFGKILDFSNADVA  83

Query  677   VDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIE  856
             VD YHR+ EDI+LMKDMGMDAYRFSI+WSRI+PNGTG +NQAG+DHYN +I+ALLA GI 
Sbjct  84    VDHYHRFNEDIQLMKDMGMDAYRFSISWSRIYPNGTGTINQAGIDHYNKVINALLAAGIV  143

Query  857   PYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVL  1036
             PYVTLYH+DLPQAL++RYNGWL+ Q+IKDFA +AETCF  FGDRVK W+T NEP + T+ 
Sbjct  144   PYVTLYHWDLPQALDDRYNGWLSPQIIKDFATFAETCFREFGDRVKHWITFNEPHTFTIQ  203

Query  1037  GYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKIT  1216
             GYD+G+ APG CSI  HL C  GNSATEPY VAH++LL+H    DIYR+KY+AKQGG I 
Sbjct  204   GYDVGLQAPGRCSIILHLFCRAGNSATEPYIVAHNVLLSHGTVADIYRKKYKAKQGGSIG  263

Query  1217  IVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAE  1396
             I ++  W+EP +NS  DI+A QRA DF LGWF+EP++ G+YP S+ +RVGDRLPKFS +E
Sbjct  264   IALDVMWFEPASNSTEDIEATQRAQDFQLGWFIEPLIFGDYPSSMRTRVGDRLPKFSKSE  323

Query  1397  SALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAV  1576
             +AL+KGS D++G+NHYTT++A    TNI+   L+D+L+DSG  TLPFKGL PI +RA+++
Sbjct  324   AALVKGSLDFVGINHYTTYFAEHNSTNIINSLLNDSLSDSGANTLPFKGLKPIADRASSI  383

Query  1577  WLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAK------TDGLNDIKRIRYHRDYLK  1738
             WLYIVP GMR+LMNYIK KYGN  + ITENGMDD         + L D KRI+YH DYL 
Sbjct  384   WLYIVPEGMRSLMNYIKRKYGNIPIIITENGMDDPNDPLKPIKEALKDEKRIKYHNDYLT  443

Query  1739  SLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNF  1918
             +LLA+IKEDGCNVKGYF WSL+DNWEW  G++SRFGLY+VDY+D L+R PK+S KWFKNF
Sbjct  444   NLLASIKEDGCNVKGYFVWSLLDNWEWAAGYTSRFGLYFVDYNDKLKRYPKDSVKWFKNF  503

Query  1919  LAS  1927
             L S
Sbjct  504   LTS  506



>ref|XP_003607794.1| Beta-glucosidase [Medicago truncatula]
 gb|AES89991.1| beta-glucosidase [Medicago truncatula]
Length=505

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/483 (67%), Positives = 391/483 (81%), Gaps = 7/483 (1%)
 Frame = +2

Query  491   LQICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNAD  670
             +Q C +  ISRA+FP GF+FGTAS+A+Q+EGAVKEDGRG ++WDTF+HT GKVTDFSNAD
Sbjct  20    IQTCLSAEISRANFPHGFIFGTASSAFQYEGAVKEDGRGPSVWDTFSHTFGKVTDFSNAD  79

Query  671   VAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANG  850
             VAVDQYHRY EDI+LMKD+GMDAYRFSI+WSRI+PNG+G +NQAG+DHYN  I+ALLA G
Sbjct  80    VAVDQYHRYEEDIQLMKDLGMDAYRFSISWSRIYPNGSGAINQAGIDHYNKFINALLAKG  139

Query  851   IEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSIT  1030
             IEPYVTLYH+DLPQAL+++Y GWL+  +IKDFA YAETCF  FGDRVK W+T NEP + T
Sbjct  140   IEPYVTLYHWDLPQALDDKYKGWLSTDIIKDFATYAETCFQKFGDRVKHWITFNEPHTFT  199

Query  1031  VLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGK  1210
               GYD+G+ APG CSI  HL C  GNSATEPY VAH++LL HAA  DIYR+KY+  QGG 
Sbjct  200   TQGYDVGLQAPGRCSILLHLFCRAGNSATEPYIVAHNVLLTHAAVADIYRKKYKNTQGGS  259

Query  1211  ITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSA  1390
             + I  +  WYEP TN+  DI A QRA DF LGWFL+P+M G+YP S+ SRVG+RLPKFS+
Sbjct  260   LGIAFDVIWYEPATNTKEDIAAAQRAQDFQLGWFLDPLMFGDYPSSMRSRVGNRLPKFSS  319

Query  1391  AESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERAN  1570
             +E+AL+KGS D++G+NHYTT+YA +  TN++G+ LHD++ DSG  TLPF G   I ERAN
Sbjct  320   SEAALVKGSLDFVGINHYTTFYARNNSTNLIGILLHDSIADSGAITLPFNGTKAIAERAN  379

Query  1571  AVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDD------AKTDGLNDIKRIRYHRDY  1732
             ++WLYIVP+ MR LMNYIK KYGNP VFITENGMDD      +K D L D KRIRY   Y
Sbjct  380   SIWLYIVPQSMRTLMNYIKQKYGNPPVFITENGMDDPNNIFISKKDALKDEKRIRYFSGY  439

Query  1733  LKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFK  1912
             L  L A+IK DGCNVKGYFAWSL+DNWEW  G+SSRFGLY+VDY DNL+R PK+S +WFK
Sbjct  440   LSYLQASIK-DGCNVKGYFAWSLLDNWEWAAGYSSRFGLYFVDYRDNLKRYPKQSVQWFK  498

Query  1913  NFL  1921
             NFL
Sbjct  499   NFL  501



>ref|XP_010477846.1| PREDICTED: beta-glucosidase 40-like [Camelina sativa]
Length=510

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/484 (67%), Positives = 391/484 (81%), Gaps = 6/484 (1%)
 Frame = +2

Query  494   QICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADV  673
             + C   +ISR SFP+GFVFGTAS+A+Q EGAV  DGRG TIWDTF+HT GK+TDFSNADV
Sbjct  25    KTCICADISRGSFPKGFVFGTASSAFQHEGAVNADGRGPTIWDTFSHTFGKITDFSNADV  84

Query  674   AVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGI  853
             AVDQYHRY ED++LMK+MGMDAYRFSI+WSRIFPNGTG++N+AG+DHYN LIDALLA GI
Sbjct  85    AVDQYHRYEEDVQLMKNMGMDAYRFSISWSRIFPNGTGQINEAGIDHYNKLIDALLAKGI  144

Query  854   EPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITV  1033
             EPYVTLYH+DLPQAL + Y GWL+ Q+  DFAAYAE CF  FGDRVK W+T NEP +  +
Sbjct  145   EPYVTLYHWDLPQALHDEYFGWLSPQITNDFAAYAEVCFQRFGDRVKHWLTFNEPHTFAI  204

Query  1034  LGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKI  1213
              GYD+G+ APG CSI F L C +GNS+TEPY V H++LL HA   DIYR+KY+AKQGG +
Sbjct  205   QGYDVGLQAPGRCSILFKLTCRSGNSSTEPYIVGHNVLLTHATVSDIYRKKYKAKQGGSL  264

Query  1214  TIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAA  1393
              I  +  W+EP +N   DI+A QRA DF LGWFL+P+M G+YP S+ SRVG RLP F+ +
Sbjct  265   GIAFDVMWFEPESNKTEDIEAAQRAQDFQLGWFLDPLMFGDYPSSMRSRVGSRLPLFTKS  324

Query  1394  ESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANA  1573
             +SAL+KGS DY+G+NHYTT+YA   +TN++G  LHD ++DSGT TLPFKGL  IG+RAN+
Sbjct  325   QSALVKGSLDYVGINHYTTYYARHNNTNLIGTLLHDAISDSGTVTLPFKGLSAIGDRANS  384

Query  1574  VWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDD------AKTDGLNDIKRIRYHRDYL  1735
             +WLYIVPRGMR+LMNYIK +YGNP VFITENGMDD      ++ D L D KRI+YH DYL
Sbjct  385   IWLYIVPRGMRSLMNYIKHRYGNPPVFITENGMDDSNNFLISRKDALKDAKRIKYHHDYL  444

Query  1736  KSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKN  1915
              +L A+I EDGCNVKGYF WSL+DNWEW  G+SSRFGLY+VDY DNL+R PK+S +WF +
Sbjct  445   SNLQASITEDGCNVKGYFVWSLLDNWEWAAGYSSRFGLYFVDYGDNLKRYPKDSVQWFTS  504

Query  1916  FLAS  1927
             FL S
Sbjct  505   FLNS  508



>ref|XP_010649498.1| PREDICTED: beta-glucosidase 40-like [Vitis vinifera]
Length=505

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/486 (67%), Positives = 395/486 (81%), Gaps = 7/486 (1%)
 Frame = +2

Query  491   LQICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNAD  670
             L+ C ++NI+R SFP+GFVFGTAS+A+Q+EGAVKED RG ++WD F+HT GK+ DFSNAD
Sbjct  19    LRPCLSENITRGSFPKGFVFGTASSAFQYEGAVKEDERGLSVWDNFSHTAGKILDFSNAD  78

Query  671   VAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANG  850
             VAVD YH Y +D++LMK+MGMDAYRFSI+WSRIFP+GTGK+NQAGVDHYN LI+AL+A G
Sbjct  79    VAVDHYHLYPDDVQLMKNMGMDAYRFSISWSRIFPDGTGKINQAGVDHYNRLINALIAEG  138

Query  851   IEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSIT  1030
             IEPYVTLYH+DLPQAL+++YNGWL+ Q+IKDFA YAETCF  FGDRVK W+T NEP + T
Sbjct  139   IEPYVTLYHWDLPQALQDKYNGWLDPQIIKDFALYAETCFQQFGDRVKHWITFNEPHTFT  198

Query  1031  VLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGK  1210
             V GYD+G+HAPGHCSI   L C  GNSATEPY VAHH+LL+HA   DIYR+KY+AKQ G 
Sbjct  199   VQGYDVGLHAPGHCSILLRLFCRAGNSATEPYIVAHHVLLSHATVADIYRKKYKAKQMGS  258

Query  1211  ITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSA  1390
             + +  +  W+EP TNS  DI+A QRA DF LGWF++P+M G+YP+S+  RVG RLP F+ 
Sbjct  259   LGVAFDVIWFEPKTNSTEDIEATQRAQDFQLGWFIDPLMFGDYPKSMKYRVGSRLPNFTR  318

Query  1391  AESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPF-KGLMPIGERA  1567
              ES LLKGS D++G+NHYTT+YA S  TN++G  L+D+L DSG  TLPF K   PIG+RA
Sbjct  319   DESTLLKGSLDFVGINHYTTFYAESNATNLIGFLLNDSLADSGAITLPFSKDGQPIGDRA  378

Query  1568  NAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRD  1729
             N++WLYIVPRGMR+LMNYIK KYGNP V ITENGMDD         D L D KRI+YH D
Sbjct  379   NSIWLYIVPRGMRSLMNYIKQKYGNPPVIITENGMDDGNNPLTPIKDALKDDKRIKYHDD  438

Query  1730  YLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWF  1909
             YL+SLLA+IKEDGCNVKGYF WSL+DNWEW  GF+SRFGL++VDY D L+R PK S +WF
Sbjct  439   YLQSLLASIKEDGCNVKGYFVWSLLDNWEWGAGFTSRFGLFFVDYKDKLKRYPKNSVQWF  498

Query  1910  KNFLAS  1927
             KNFL S
Sbjct  499   KNFLNS  504



>ref|XP_010460295.1| PREDICTED: beta-glucosidase 40-like [Camelina sativa]
Length=510

 Score =   691 bits (1782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/484 (66%), Positives = 392/484 (81%), Gaps = 6/484 (1%)
 Frame = +2

Query  494   QICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADV  673
             + C   +ISR SFP+GFVFGTAS+A+Q EGAV  DGRG TIWDTF+HT GK+TDFSNADV
Sbjct  25    KTCFCADISRGSFPKGFVFGTASSAFQHEGAVNADGRGPTIWDTFSHTFGKITDFSNADV  84

Query  674   AVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGI  853
             AVDQYHRY ED++LMK+MG+DAYRFSI+WSRIFPNG G++N+AG+DHYN LIDALLA GI
Sbjct  85    AVDQYHRYEEDVQLMKNMGVDAYRFSISWSRIFPNGVGQINEAGIDHYNKLIDALLAKGI  144

Query  854   EPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITV  1033
             EPYVTLYH+DLPQAL +RY GWLN Q+I DFAAYAE CF  FGDRVK W+T NEP +  +
Sbjct  145   EPYVTLYHWDLPQALHDRYLGWLNSQIINDFAAYAELCFQRFGDRVKHWLTFNEPHTFAI  204

Query  1034  LGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKI  1213
              GYD+G+ APG C+I F L C +GNS+TEPY V H++LL HA   DIYR+ Y+AKQGG +
Sbjct  205   QGYDVGLQAPGRCTILFKLTCRSGNSSTEPYIVGHNVLLTHATVSDIYRKNYKAKQGGSL  264

Query  1214  TIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAA  1393
              I  +  W+EP +N   DI+A QRA DF LGWFL+P+M G+YP S+ SRVG RLP F+ +
Sbjct  265   GIAFDVMWFEPESNKTEDIEAAQRAQDFQLGWFLDPLMFGDYPSSMRSRVGSRLPLFTKS  324

Query  1394  ESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANA  1573
             +SAL+KGS D++G+NHYTT+YA +  TN++G  LHD ++DSGT TLPFKGL  IG+RA++
Sbjct  325   QSALVKGSLDFVGINHYTTYYARNNGTNLIGTLLHDAISDSGTVTLPFKGLTAIGDRASS  384

Query  1574  VWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDD------AKTDGLNDIKRIRYHRDYL  1735
             +WLYIVPRGMR+LMNYIK +YGNP VFITENGMDD      ++ D L D KRI+YH DYL
Sbjct  385   IWLYIVPRGMRSLMNYIKHRYGNPPVFITENGMDDSNNFLISRKDALKDAKRIKYHHDYL  444

Query  1736  KSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKN  1915
              +L A+IKEDGCNVKGYF WSL+DNWEW  G+SSRFGLY+VDY DNL+R PK+S +WF +
Sbjct  445   SNLQASIKEDGCNVKGYFVWSLLDNWEWAAGYSSRFGLYFVDYRDNLKRYPKDSVQWFTS  504

Query  1916  FLAS  1927
             FL S
Sbjct  505   FLNS  508



>ref|NP_173978.1| beta glucosidase 40 [Arabidopsis thaliana]
 sp|Q9FZE0.1|BGL40_ARATH RecName: Full=Beta-glucosidase 40; Short=AtBGLU40; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF98564.1|AC013427_7 Strong similarity to beta-glucosidase (BGQ60) from Hordeum vulgare 
gb|L41869 and is a member of the Glycosyl hydrolase PF|00232 
family. ESTs gb|AV561121, gb|AV565991 come from this 
gene [Arabidopsis thaliana]
 gb|AAK76601.1| putative beta-glucosidase [Arabidopsis thaliana]
 gb|AAN13179.1| putative beta-glucosidase [Arabidopsis thaliana]
 gb|AEE30704.1| beta glucosidase 40 [Arabidopsis thaliana]
Length=510

 Score =   690 bits (1781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/484 (66%), Positives = 391/484 (81%), Gaps = 6/484 (1%)
 Frame = +2

Query  494   QICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADV  673
             + C   +ISR SFP+GFVFGTAS+A+Q EGAVK +GRG TIWDTF+HT GK+TDFSNADV
Sbjct  25    KTCICADISRGSFPKGFVFGTASSAFQHEGAVKAEGRGPTIWDTFSHTFGKITDFSNADV  84

Query  674   AVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGI  853
             AVDQYHRY ED++LMK+MGMDAYRFSI+W+RIFPNG G +N+AG+DHYN LI+ALLA GI
Sbjct  85    AVDQYHRYEEDVQLMKNMGMDAYRFSISWTRIFPNGVGHINEAGIDHYNKLINALLAKGI  144

Query  854   EPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITV  1033
             EPYVTLYH+DLPQAL +RY GWLN Q+I DFAAYAE CF  FGDRVK W+T NEP +  +
Sbjct  145   EPYVTLYHWDLPQALHDRYLGWLNPQIINDFAAYAEVCFQRFGDRVKHWITFNEPHTFAI  204

Query  1034  LGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKI  1213
              GYD+G+ APG C+I F L C  GNS+TEPY V H+++L HA   DIYR+KY+AKQGG +
Sbjct  205   QGYDVGLQAPGRCTILFKLTCREGNSSTEPYIVGHNVILTHATVSDIYRKKYKAKQGGSL  264

Query  1214  TIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAA  1393
              I  +  W+EP +N   DI+A QRA DF LGWFL+P+M G+YP S+ SRVG RLP F+ +
Sbjct  265   GIAFDVMWFEPESNKTEDIEAAQRAQDFQLGWFLDPLMFGDYPSSMRSRVGSRLPVFTGS  324

Query  1394  ESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANA  1573
             +S+L+KGS D++G+NHYTT+YA +  TN++G  LHD ++DSGT TLPFKGL  IG+RA++
Sbjct  325   QSSLVKGSLDFVGINHYTTYYARNNATNLIGTLLHDAVSDSGTVTLPFKGLSTIGDRASS  384

Query  1574  VWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDD------AKTDGLNDIKRIRYHRDYL  1735
             +WLYIVPRGMR+LMNYIK +YGNP VFITENGMDD      ++ D L D KRI+YH DYL
Sbjct  385   IWLYIVPRGMRSLMNYIKHRYGNPPVFITENGMDDPNSILISRKDALKDAKRIKYHHDYL  444

Query  1736  KSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKN  1915
              SL A+IKEDGCNVKGYF WSL+DNWEW  G+SSRFGLY+VDY DNL+R PK+S  WF +
Sbjct  445   SSLQASIKEDGCNVKGYFVWSLLDNWEWAAGYSSRFGLYFVDYRDNLKRYPKDSVHWFTS  504

Query  1916  FLAS  1927
             FL S
Sbjct  505   FLNS  508



>ref|XP_006415932.1| hypothetical protein EUTSA_v10007404mg [Eutrema salsugineum]
 gb|ESQ34285.1| hypothetical protein EUTSA_v10007404mg [Eutrema salsugineum]
Length=508

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/484 (66%), Positives = 391/484 (81%), Gaps = 6/484 (1%)
 Frame = +2

Query  494   QICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADV  673
             + C   +ISR SFP GFVFGTAS+A+Q EGAVKE+GRG TIWDTF+HT GK+TDFSNADV
Sbjct  23    KTCICADISRGSFPNGFVFGTASSAFQHEGAVKEEGRGPTIWDTFSHTFGKITDFSNADV  82

Query  674   AVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGI  853
             AVDQYHRY ED++LMK+MGMDAYRFSI+W+RIFPNG G++N+AG+DHYN LI+ALLA GI
Sbjct  83    AVDQYHRYEEDVQLMKNMGMDAYRFSISWARIFPNGVGQINEAGIDHYNKLINALLAKGI  142

Query  854   EPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITV  1033
             EPYVTLYH+DLPQ L +RY GWLN Q+I DFAAYAE CF  FGDRVK W+T NEP +  +
Sbjct  143   EPYVTLYHWDLPQGLHDRYLGWLNPQIINDFAAYAEVCFQRFGDRVKHWITFNEPHTFAI  202

Query  1034  LGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKI  1213
              GYD+G+ APG CSI F L C +GNS+TEPY V H+++L HA   DIY++KY+AKQGG +
Sbjct  203   QGYDVGLQAPGRCSILFKLTCRSGNSSTEPYIVGHNVILTHATVSDIYKKKYKAKQGGSL  262

Query  1214  TIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAA  1393
              I  +  WYEP +N   DI+A QRA DF LGWFL+P+M G+YP S+ SRVG RLP F+ +
Sbjct  263   GIAFDVMWYEPESNKTEDIEASQRAQDFQLGWFLDPLMFGDYPSSMRSRVGSRLPVFTGS  322

Query  1394  ESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANA  1573
             +SAL+KGS D++G+NHYTT+YA +  TN++G  LHD ++DSGT TLPFKGL  IG+RA++
Sbjct  323   QSALMKGSLDFVGINHYTTYYARNNATNLIGTLLHDAVSDSGTVTLPFKGLSAIGDRASS  382

Query  1574  VWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDA------KTDGLNDIKRIRYHRDYL  1735
             +WLYIVPRGM++LMNY+K +YGNP VFITENGMDD+      + + L D KRIRYH DYL
Sbjct  383   IWLYIVPRGMKSLMNYVKQRYGNPPVFITENGMDDSNNILIPRNEALKDTKRIRYHHDYL  442

Query  1736  KSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKN  1915
              +L AAIKEDGCNVKGYF WSL+DNWEW  G+SSRFGLY+VDY D L+R PK+S  WF +
Sbjct  443   SNLQAAIKEDGCNVKGYFVWSLLDNWEWAAGYSSRFGLYFVDYRDKLKRYPKDSVHWFTS  502

Query  1916  FLAS  1927
             FL S
Sbjct  503   FLNS  506



>ref|XP_007224102.1| hypothetical protein PRUPE_ppa015619mg [Prunus persica]
 gb|EMJ25301.1| hypothetical protein PRUPE_ppa015619mg [Prunus persica]
Length=516

 Score =   690 bits (1781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/480 (68%), Positives = 391/480 (81%), Gaps = 6/480 (1%)
 Frame = +2

Query  506   AQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQ  685
             + +I+RASFP+GFVFGTAS+A+Q+EGAVKEDGRG + WDTF+HT GK++DFSNADVAVDQ
Sbjct  36    SDDINRASFPKGFVFGTASSAFQYEGAVKEDGRGPSTWDTFSHTFGKISDFSNADVAVDQ  95

Query  686   YHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYV  865
             YH Y  D++LMKDMGMDAYRFSI+WSRIFPNGTG++NQAGVDHYNNLI++LLA GIEPYV
Sbjct  96    YHLYNGDVQLMKDMGMDAYRFSISWSRIFPNGTGQINQAGVDHYNNLINSLLAKGIEPYV  155

Query  866   TLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYD  1045
             TLYH+DLPQALE++YNGWLN Q+IKD+A YA+TCF  FGDRVK W+T NEP + ++ GYD
Sbjct  156   TLYHWDLPQALEDKYNGWLNPQIIKDYATYADTCFQKFGDRVKHWITFNEPHTFSIQGYD  215

Query  1046  LGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVV  1225
             +G+ APG CSI  HL C  GNSATEPY V H+++L+HA   DIYRRKY++KQ G +    
Sbjct  216   VGLQAPGRCSILLHLFCRAGNSATEPYIVGHNVILSHATVADIYRRKYKSKQHGSVGASF  275

Query  1226  ESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESAL  1405
             +  WYEP TNS AD++A +RA DF LGWFLEP + G+YP S+ SRVG RLP FS +E+AL
Sbjct  276   DVIWYEPETNSTADVEAAKRAQDFQLGWFLEPFIFGDYPSSMRSRVGSRLPTFSKSEAAL  335

Query  1406  LKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLY  1585
             LKGS D++G+NHYTT+YA +  T+ +G  L+D+L DSG  TLPFK   PIG+RAN++WLY
Sbjct  336   LKGSLDFVGINHYTTFYARNDTTDFIGGLLNDSLADSGAITLPFKNGKPIGDRANSIWLY  395

Query  1586  IVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLKSLL  1747
             IVP GMR LMNYIK KYGNP V ITENGMDD  +      D L D KRI+YH  YL +LL
Sbjct  396   IVPEGMRKLMNYIKHKYGNPPVIITENGMDDPNSPFISLKDALKDAKRIKYHHGYLTNLL  455

Query  1748  AAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
             A+IKEDGCNVKGYFAWSL+DNWEW  GFSSRFGLY+VDY D L+R PK+S +WF NFL S
Sbjct  456   ASIKEDGCNVKGYFAWSLLDNWEWAAGFSSRFGLYFVDYKDKLKRYPKDSVQWFTNFLTS  515



>gb|AAM61600.1| beta-glucosidase, putative [Arabidopsis thaliana]
Length=498

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/484 (66%), Positives = 391/484 (81%), Gaps = 6/484 (1%)
 Frame = +2

Query  494   QICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADV  673
             + C   +ISR SFP+GFVFGTAS+A+Q EGAVK +GRG TIWDTF+HT GK+TDFSNADV
Sbjct  13    KTCICADISRGSFPKGFVFGTASSAFQHEGAVKAEGRGPTIWDTFSHTFGKITDFSNADV  72

Query  674   AVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGI  853
             AVDQYHRY ED++LMK+MGMDAYRFSI+W+RIFPNG G +N+AG+DHYN LI+ALLA GI
Sbjct  73    AVDQYHRYEEDVQLMKNMGMDAYRFSISWTRIFPNGVGHINEAGIDHYNKLINALLAKGI  132

Query  854   EPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITV  1033
             EPYVTLYH+DLPQAL +RY GWLN Q+I DFAAYAE CF  FGDRVK W+T NEP +  +
Sbjct  133   EPYVTLYHWDLPQALHDRYLGWLNPQIINDFAAYAEVCFQRFGDRVKHWITFNEPHTFAI  192

Query  1034  LGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKI  1213
              GYD+G+ APG C+I F L C  GNS+TEPY V H+++L HA   DIYR+KY+AKQGG +
Sbjct  193   QGYDVGLQAPGRCTILFKLTCREGNSSTEPYIVGHNVILTHATVSDIYRKKYKAKQGGSL  252

Query  1214  TIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAA  1393
              I  +  W+EP +N   DI+A QRA DF LGWFL+P+M G+YP S+ SRVG RLP F+ +
Sbjct  253   GIAFDVMWFEPESNKTEDIEAAQRAQDFQLGWFLDPLMFGDYPSSMRSRVGSRLPVFTGS  312

Query  1394  ESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANA  1573
             +S+L+KGS D++G+NHYTT+YA +  TN++G  LHD ++DSGT TLPFKGL  IG+RA++
Sbjct  313   QSSLVKGSLDFVGINHYTTYYARNNATNLIGTLLHDAVSDSGTVTLPFKGLSTIGDRASS  372

Query  1574  VWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDD------AKTDGLNDIKRIRYHRDYL  1735
             +WLYIVPRGMR+LMNYIK +YGNP VFITENGMDD      ++ D L D KRI+YH DYL
Sbjct  373   IWLYIVPRGMRSLMNYIKHRYGNPPVFITENGMDDPNSILISRKDALKDAKRIKYHHDYL  432

Query  1736  KSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKN  1915
              SL A+IKEDGCNVKGYF WSL+DNWEW  G+SSRFGLY+VDY DNL+R PK+S  WF +
Sbjct  433   SSLQASIKEDGCNVKGYFVWSLLDNWEWAAGYSSRFGLYFVDYRDNLKRYPKDSVHWFTS  492

Query  1916  FLAS  1927
             FL S
Sbjct  493   FLNS  496



>gb|KHN20526.1| Beta-glucosidase 40 [Glycine soja]
Length=503

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/483 (67%), Positives = 390/483 (81%), Gaps = 8/483 (2%)
 Frame = +2

Query  491   LQICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNAD  670
             +QIC ++ I+R +FP GFVFGTAS+A+Q+EGAVKEDGRG ++WDTF+HT GK+ DFSNAD
Sbjct  19    IQICSSE-INRGNFPNGFVFGTASSAFQYEGAVKEDGRGPSVWDTFSHTFGKIIDFSNAD  77

Query  671   VAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANG  850
             VAVDQYHRY EDI+LMKDMGMDAYRFSI+WSRIFPNG G++NQAGVDHYN LI+ALLA G
Sbjct  78    VAVDQYHRYEEDIQLMKDMGMDAYRFSISWSRIFPNGYGQINQAGVDHYNKLINALLAKG  137

Query  851   IEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSIT  1030
             IEPYVTLYH+DLPQALEN+Y+GWLN  +I DFA YAETCF  FGDRVK W+T NEP +  
Sbjct  138   IEPYVTLYHWDLPQALENKYSGWLNASIIMDFATYAETCFQKFGDRVKHWITFNEPHTFA  197

Query  1031  VLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGK  1210
               GYD+G+ APG CSI  HL C  GNSATEPY VAH++LL+HA   DIYR+KY+  QGG 
Sbjct  198   TQGYDVGLQAPGRCSILLHLFCRAGNSATEPYIVAHNVLLSHATVADIYRKKYKKIQGGS  257

Query  1211  ITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSA  1390
             + +  +  WYEPLTN+  DIDA QRA DF LGWFL+P+M G+YP S+ +RVG RLPKFS 
Sbjct  258   LGVAFDVIWYEPLTNTKEDIDAAQRAQDFQLGWFLDPLMFGDYPSSMRTRVGSRLPKFSQ  317

Query  1391  AESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERAN  1570
             +E+AL+KGS D++G+NHYTT+YA    TN++G  LHD++ DSG  TLPF G   I ERA+
Sbjct  318   SEAALVKGSLDFVGINHYTTFYAKDNSTNLIGTLLHDSIADSGAVTLPFNGTKAISERAS  377

Query  1571  AVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDY  1732
             ++WLYIVP+ MR+LM YIK KYGNP V+ITENGMDD  +      D L D KRIRYH  Y
Sbjct  378   SIWLYIVPQSMRSLMIYIKQKYGNPPVYITENGMDDPNSIFISIKDALKDEKRIRYHTGY  437

Query  1733  LKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFK  1912
             L  LLA+IK DGCNVKGYF WSL+DNWEW+ G++SRFGLY+VDY DNL+R PK+S +WFK
Sbjct  438   LSYLLASIK-DGCNVKGYFVWSLLDNWEWSAGYTSRFGLYFVDYKDNLKRYPKQSVEWFK  496

Query  1913  NFL  1921
             NFL
Sbjct  497   NFL  499



>gb|KGN47642.1| hypothetical protein Csa_6G366400 [Cucumis sativus]
Length=489

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/486 (68%), Positives = 391/486 (80%), Gaps = 7/486 (1%)
 Frame = +2

Query  488   GLQICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNA  667
             G+QIC AQ ISR+SFP GFVFGTAS+A+Q+EGAVK+DGRG TIWDTF+HT GKV DFSNA
Sbjct  5     GVQICSAQ-ISRSSFPSGFVFGTASSAFQYEGAVKDDGRGPTIWDTFSHTFGKVLDFSNA  63

Query  668   DVAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLAN  847
             DV VDQYHRY EDI+LMKDMGMDAYRFSIAWSRIFPNG G++N AGV HYNN I+ALLAN
Sbjct  64    DVTVDQYHRYPEDIKLMKDMGMDAYRFSIAWSRIFPNGNGEVNDAGVAHYNNFINALLAN  123

Query  848   GIEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSI  1027
             GIEPYVTLYH+DLPQALE++Y GWL+ Q+I DFA +AETCF  FGDRVK W+T NEP + 
Sbjct  124   GIEPYVTLYHWDLPQALEDKYTGWLSPQIINDFAVFAETCFQKFGDRVKHWITFNEPHTF  183

Query  1028  TVLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGG  1207
                GYDLG+ APG CSI  H+ C  GNSATEPY V H+LLL+HA   DIYRRKY+  Q G
Sbjct  184   ATQGYDLGLQAPGRCSILGHITCRDGNSATEPYIVGHNLLLSHATVSDIYRRKYKRIQKG  243

Query  1208  KITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFS  1387
              I + ++  W+EP +NS  DIDA +RA DF LGWFL P++ G+YP S+ SRVG RLP FS
Sbjct  244   VIGMSLDVIWFEPGSNSTEDIDAAKRAQDFQLGWFLNPLIFGDYPTSMRSRVGGRLPTFS  303

Query  1388  AAESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERA  1567
              +++AL+KGS D++G+NHYTT+YA    +NI+G  L+DT+ DSG  T+PFKGL  I ERA
Sbjct  304   PSQAALVKGSQDFVGINHYTTFYAYHNRSNIIGATLNDTIADSGALTVPFKGLKTIAERA  363

Query  1568  NAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAK------TDGLNDIKRIRYHRD  1729
             N++WLYIVPRGMR+LMNYIK+ YGNPLV ITENGMDD         + L D KRIRYH  
Sbjct  364   NSIWLYIVPRGMRSLMNYIKNNYGNPLVIITENGMDDPNDPFKPIKEALKDEKRIRYHNG  423

Query  1730  YLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWF  1909
             YL +LLA+IKEDGCNVKGYF WSL+DNWEW  GFSSRFGLY+VDY D L+R PK+S +WF
Sbjct  424   YLTNLLASIKEDGCNVKGYFVWSLLDNWEWAAGFSSRFGLYFVDYKDKLKRYPKDSVQWF  483

Query  1910  KNFLAS  1927
             KNFLAS
Sbjct  484   KNFLAS  489



>emb|CBI27265.3| unnamed protein product [Vitis vinifera]
Length=526

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/485 (67%), Positives = 393/485 (81%), Gaps = 6/485 (1%)
 Frame = +2

Query  491   LQICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNAD  670
             L+ C ++NI+R SFP+GFVFGTAS+A+Q+EGAVKED RG ++WD F+HT GK+ DFSNAD
Sbjct  41    LRPCLSENITRGSFPKGFVFGTASSAFQYEGAVKEDERGLSVWDNFSHTAGKILDFSNAD  100

Query  671   VAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANG  850
             VAVD YH Y +D++LMK+MGMDAYRFSI+WSRIFP+GTGK+NQAGVDHYN LI+AL+A G
Sbjct  101   VAVDHYHLYPDDVQLMKNMGMDAYRFSISWSRIFPDGTGKINQAGVDHYNRLINALIAEG  160

Query  851   IEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSIT  1030
             IEPYVTLYH+DLPQAL+++YNGWL+ Q+IKDFA YAETCF  FGDRVK W+T NEP + T
Sbjct  161   IEPYVTLYHWDLPQALQDKYNGWLDPQIIKDFALYAETCFQQFGDRVKHWITFNEPHTFT  220

Query  1031  VLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGK  1210
             V GYD+G+HAPGHCSI   L C  GNSATEPY VAHH+LL+HA   DIYR+KY+AKQ G 
Sbjct  221   VQGYDVGLHAPGHCSILLRLFCRAGNSATEPYIVAHHVLLSHATVADIYRKKYKAKQMGS  280

Query  1211  ITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSA  1390
             + +  +  W+EP TNS  DI+A QRA DF LGWF++P+M G+YP+S+  RVG RLP F+ 
Sbjct  281   LGVAFDVIWFEPKTNSTEDIEATQRAQDFQLGWFIDPLMFGDYPKSMKYRVGSRLPNFTR  340

Query  1391  AESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERAN  1570
              ES LLKGS D++G+NHYTT+YA S  TN++G  L+D+L DSG  TL  K   PIG+RAN
Sbjct  341   DESTLLKGSLDFVGINHYTTFYAESNATNLIGFLLNDSLADSGAITLRDKDGQPIGDRAN  400

Query  1571  AVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDY  1732
             ++WLYIVPRGMR+LMNYIK KYGNP V ITENGMDD         D L D KRI+YH DY
Sbjct  401   SIWLYIVPRGMRSLMNYIKQKYGNPPVIITENGMDDGNNPLTPIKDALKDDKRIKYHDDY  460

Query  1733  LKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFK  1912
             L+SLLA+IKEDGCNVKGYF WSL+DNWEW  GF+SRFGL++VDY D L+R PK S +WFK
Sbjct  461   LQSLLASIKEDGCNVKGYFVWSLLDNWEWGAGFTSRFGLFFVDYKDKLKRYPKNSVQWFK  520

Query  1913  NFLAS  1927
             NFL S
Sbjct  521   NFLNS  525



>ref|XP_009110017.1| PREDICTED: beta-glucosidase 40-like [Brassica rapa]
Length=512

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/483 (66%), Positives = 393/483 (81%), Gaps = 7/483 (1%)
 Frame = +2

Query  497   ICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVA  676
             IC A+ ISR SFP+GFVFGTAS+A+Q EGAVKEDGRG TIWDTF+HT GK+TDFSNADVA
Sbjct  29    IC-AEEISRGSFPKGFVFGTASSAFQHEGAVKEDGRGPTIWDTFSHTFGKITDFSNADVA  87

Query  677   VDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIE  856
             VDQYHRY ED++LMK+MGMDAYRFSI+W+RIFPNG G++N+AG+DHYN LI+ALLA GIE
Sbjct  88    VDQYHRYEEDVQLMKNMGMDAYRFSISWARIFPNGVGQINEAGIDHYNKLINALLAKGIE  147

Query  857   PYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVL  1036
             PYVTLYH+DLPQAL +RY GWLN Q+I DFAAYAE CF  FGDRVK W+T NEP + ++ 
Sbjct  148   PYVTLYHWDLPQALHDRYLGWLNPQIINDFAAYAEVCFQRFGDRVKHWITFNEPHTFSIQ  207

Query  1037  GYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKIT  1216
             GYD+G+ APG CSI F L C +GNS+TEPY V H+++L HA   DIYR+KY+A QGG + 
Sbjct  208   GYDVGLQAPGRCSILFKLTCRSGNSSTEPYIVGHNVILTHATVSDIYRKKYKATQGGSLG  267

Query  1217  IVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAE  1396
             I  +  WYEP +N+  D++A QRA DF LGWFL+P+M G+YP S+ SRVG RLP  + ++
Sbjct  268   IAFDVMWYEPESNNREDMEAAQRAQDFQLGWFLDPLMFGDYPSSMRSRVGSRLPVLTGSQ  327

Query  1397  SALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAV  1576
             S L+KGS D++G+NHYTT+YA +  TN++G  LHD ++DSGT TLPFKGL  IG+RA+++
Sbjct  328   SNLIKGSLDFVGINHYTTYYARNNATNLIGTLLHDAISDSGTVTLPFKGLSAIGDRASSI  387

Query  1577  WLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDA------KTDGLNDIKRIRYHRDYLK  1738
             WLYIVPRGMR+LMNY+K +YGNP V+ITENGMDD+      + + L D KRIRYH DYL 
Sbjct  388   WLYIVPRGMRSLMNYVKHRYGNPPVYITENGMDDSNSILIPRKETLKDAKRIRYHHDYLS  447

Query  1739  SLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNF  1918
             SL AAIKEDGCNVKGYF WSL+DNWEW  G+SSRFGLY+VDY D L+R PK+S  WF +F
Sbjct  448   SLQAAIKEDGCNVKGYFVWSLLDNWEWAAGYSSRFGLYFVDYRDKLKRYPKDSVHWFTSF  507

Query  1919  LAS  1927
             L S
Sbjct  508   LNS  510



>ref|XP_009416570.1| PREDICTED: beta-glucosidase 6-like [Musa acuminata subsp. malaccensis]
Length=505

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/477 (68%), Positives = 391/477 (82%), Gaps = 6/477 (1%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             +SR SFP+GFVFGTAS++YQ+EGAVKEDGRG T+WD FAH+ GKV DFSNADVAVDQYHR
Sbjct  28    LSRGSFPKGFVFGTASSSYQYEGAVKEDGRGRTVWDAFAHSFGKVIDFSNADVAVDQYHR  87

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             Y EDI+LMKDMGMDAYRFSIAWSRIFPNGTG +NQAG+DHYN LIDALLANGIEPYVTLY
Sbjct  88    YHEDIQLMKDMGMDAYRFSIAWSRIFPNGTGVVNQAGIDHYNKLIDALLANGIEPYVTLY  147

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             H+DLPQAL +RYNGWL+RQ+I+D+A YAETCF  FGDRVK W+T+NEP +  V G+D+G+
Sbjct  148   HWDLPQALADRYNGWLDRQIIEDYANYAETCFKAFGDRVKHWMTLNEPHTFAVQGFDVGL  207

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
              APG CSI   L C  GNSATEPY VAH++LL+HA   DIYRRKY+  Q G + I  ++ 
Sbjct  208   QAPGRCSIPLLLFCRAGNSATEPYVVAHNVLLSHATVSDIYRRKYKQNQQGSVGIAFDAM  267

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             W+EP+++SP DIDA QRA DF  GWF++P+  G+YP S+ +RVG+RLPKFS AE+AL+KG
Sbjct  268   WFEPMSDSPTDIDATQRAQDFQFGWFMDPLFFGDYPSSMRTRVGNRLPKFSTAEAALVKG  327

Query  1415  SYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVP  1594
             S D++GVNHYTT+YA    TNI+G+ L+DTL DSG  TLPFK    IG+RA+++WLYIVP
Sbjct  328   SLDFVGVNHYTTYYAKHNSTNIIGILLNDTLADSGAITLPFKDGKAIGDRASSIWLYIVP  387

Query  1595  RGMRNLMNYIKDKYGNPLVFITENGMDD------AKTDGLNDIKRIRYHRDYLKSLLAAI  1756
             +G+R LMNYIK +YGNP+V ITENGMDD      +  D L D KRIRYH DYL +L A+I
Sbjct  388   QGIRRLMNYIKQRYGNPVVIITENGMDDFNNPFISIKDALKDDKRIRYHNDYLSNLSASI  447

Query  1757  KEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
             ++DGCNV+GYFAWSL+DNWEW  G++SRFGLY++DY+DNL+R PK S  WFK  L S
Sbjct  448   RQDGCNVQGYFAWSLLDNWEWAAGYTSRFGLYFIDYNDNLKRYPKNSVDWFKKLLKS  504



>ref|XP_010066854.1| PREDICTED: beta-glucosidase 40 [Eucalyptus grandis]
 gb|KCW64896.1| hypothetical protein EUGRSUZ_G02458 [Eucalyptus grandis]
Length=511

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/487 (66%), Positives = 398/487 (82%), Gaps = 8/487 (2%)
 Frame = +2

Query  491   LQICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNAD  670
             +  C A  I R+SFP+GFVFGTAS+A+Q+EGAVKEDGRG ++WDTF+H  GKV D SNAD
Sbjct  24    VHACCADAIGRSSFPKGFVFGTASSAFQYEGAVKEDGRGPSVWDTFSHQFGKVIDLSNAD  83

Query  671   VAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANG  850
             VAVDQYHR+ EDI+LMKDMGMDAYRFSI+WSRIFPNG+G++NQAGVDHYNNLI+ALLA G
Sbjct  84    VAVDQYHRFNEDIQLMKDMGMDAYRFSISWSRIFPNGSGQINQAGVDHYNNLINALLAKG  143

Query  851   IEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSIT  1030
             IEPYVTL+H+DLPQALE++YNGWL+ Q+IKDFA YAETCF  FGDRVK WVT NEP ++ 
Sbjct  144   IEPYVTLFHWDLPQALEDKYNGWLDPQIIKDFATYAETCFQKFGDRVKHWVTFNEPHTLA  203

Query  1031  VLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGK  1210
             + GYD+G+ APG CSI  HL C  GNSATEPY V H++LL+HA AVD+YR+KY+ KQ G 
Sbjct  204   IQGYDVGLQAPGRCSILLHLFCRAGNSATEPYIVGHNILLSHATAVDVYRKKYKQKQHGS  263

Query  1211  ITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSA  1390
             I +  +  W+ P TNS  DI+A QRA+DF  GWF+EP++ G YP S+ISRVG RLP  S+
Sbjct  264   IGVAFDVMWFVPRTNSTDDIEATQRALDFQFGWFIEPLIFGNYPSSMISRVGSRLPAISS  323

Query  1391  AESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKG--LMPIGER  1564
             +ESALLKGS D++G+NHYTT+Y S+  ++++G  L D+L+DSG+ TLPF+   L PIG+R
Sbjct  324   SESALLKGSLDFVGINHYTTYYGSNDTSDVIGSLLKDSLSDSGSVTLPFRDGILNPIGDR  383

Query  1565  ANAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAK------TDGLNDIKRIRYHR  1726
             A+++WLYIVP+G+R+LMNYIK KYGNP V ITENGMDD         + L D KRI+YH 
Sbjct  384   ASSIWLYIVPQGLRSLMNYIKTKYGNPPVIITENGMDDPNPPLINIKEALKDEKRIKYHN  443

Query  1727  DYLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKW  1906
             DYL +LLA+IKEDGCNVKGYF WSL+DNWEW  G++SRFGLY+VDY+D L+R PK+S +W
Sbjct  444   DYLTNLLASIKEDGCNVKGYFVWSLLDNWEWAAGYTSRFGLYFVDYNDKLKRYPKDSVQW  503

Query  1907  FKNFLAS  1927
             FKNFL S
Sbjct  504   FKNFLKS  510



>ref|XP_010258106.1| PREDICTED: beta-glucosidase 6 [Nelumbo nucifera]
Length=507

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/487 (66%), Positives = 390/487 (80%), Gaps = 8/487 (2%)
 Frame = +2

Query  491   LQICGAQ--NISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSN  664
             +Q C +Q   I+R SFP+GFVFGTAS++YQFEGAVKEDGRG T+WDT+AH  GKV DFSN
Sbjct  20    IQSCCSQVTQINRGSFPKGFVFGTASSSYQFEGAVKEDGRGKTVWDTYAHKFGKVVDFSN  79

Query  665   ADVAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLA  844
             ADVAVDQYHRY EDI LMKDMG DAYRFSIAWSRIFP+G+G++NQAG+DHY+ LIDALLA
Sbjct  80    ADVAVDQYHRYNEDIVLMKDMGTDAYRFSIAWSRIFPDGSGEINQAGIDHYDKLIDALLA  139

Query  845   NGIEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRS  1024
              GIEPYVTLYH+DLPQAL ++YNGWL+ Q+IKDFA YAETCF  FGDRVK W+T NEP +
Sbjct  140   QGIEPYVTLYHWDLPQALADKYNGWLDPQIIKDFAVYAETCFQNFGDRVKHWITFNEPHT  199

Query  1025  ITVLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQG  1204
               + GYD+G+HAPG CS+  HL CP GNSATEPY V H++LL+HA    IYR+KY+  Q 
Sbjct  200   FAIQGYDVGLHAPGRCSVLLHLFCPAGNSATEPYIVGHNVLLSHATVAQIYRKKYKPTQQ  259

Query  1205  GKITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKF  1384
             G + I  +  WYEP+++S  DI+A QRA DF  GWF++P+ +G+YP S+ SRVG RLP F
Sbjct  260   GSVGISFDVMWYEPMSDSAEDIEATQRAQDFQFGWFMDPLFSGDYPISMRSRVGRRLPTF  319

Query  1385  SAAESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGER  1564
             S AE+AL+KGS D++G+NHYTTWYA    TNI+ L L+DTL+DSGT TLP+K    IG++
Sbjct  320   SEAEAALVKGSLDFVGINHYTTWYAKDNSTNILSLLLNDTLSDSGTVTLPWKHGKAIGDK  379

Query  1565  ANAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHR  1726
             A++VWLYIVP+G+R LMNYIK KYGNP V ITENGMDDA        + L D KRI YH 
Sbjct  380   ASSVWLYIVPQGIRKLMNYIKQKYGNPTVIITENGMDDANNPFISIKNALKDEKRINYHN  439

Query  1727  DYLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKW  1906
             DYL +LLA+I+EDGCNVKGYF WSL+DNWEW  G++SRFGLY+VDY D L+R PK S +W
Sbjct  440   DYLTNLLASIREDGCNVKGYFVWSLLDNWEWAAGYTSRFGLYFVDYKDKLKRYPKHSVQW  499

Query  1907  FKNFLAS  1927
             FKNFL +
Sbjct  500   FKNFLTT  506



>ref|XP_010521462.1| PREDICTED: beta-glucosidase 40-like isoform X2 [Tarenaya hassleriana]
Length=507

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/478 (67%), Positives = 393/478 (82%), Gaps = 6/478 (1%)
 Frame = +2

Query  512   NISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYH  691
             +I+RASFP GFVFGTASAA+Q+EGAVKEDGRG ++WDTF+HT GK+ DFSNADVAVDQYH
Sbjct  27    DINRASFPNGFVFGTASAAFQYEGAVKEDGRGPSVWDTFSHTLGKIADFSNADVAVDQYH  86

Query  692   RYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTL  871
             RY EDI+LMK+MGMDAYRFSI+W+RIFPNGTG++NQAG+DHYN LI+ALLA GI+PYVTL
Sbjct  87    RYEEDIQLMKNMGMDAYRFSISWTRIFPNGTGQINQAGIDHYNKLINALLAQGIQPYVTL  146

Query  872   YHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLG  1051
             YH+DLPQAL +RYNGWL+ Q+I D+A YAE CF  FGDRVK W+T NEP +  + GYD+G
Sbjct  147   YHWDLPQALHDRYNGWLSPQIINDYATYAEVCFENFGDRVKHWITFNEPHTFAIQGYDVG  206

Query  1052  VHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVES  1231
             + APG CSI   L C  GNSATEPY VAH++LL+HA   DIYR+KY+AKQGG + I  + 
Sbjct  207   LQAPGRCSILLRLFCRGGNSATEPYIVAHNVLLSHATVSDIYRKKYKAKQGGWLGIAFDV  266

Query  1232  FWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLK  1411
              WYEP TN+  DI+A QRA DF LGWFL+P+M G+YP S+ SRVG RLP+F+A+E+A++K
Sbjct  267   IWYEPETNTREDIEAAQRAQDFQLGWFLDPLMFGDYPNSMRSRVGKRLPRFTASEAAMVK  326

Query  1412  GSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIV  1591
             GS D++G+NHYTT+YA +  TN++G  L+D + DSG FT+PFKGL  IG+RAN++WLYIV
Sbjct  327   GSLDFVGINHYTTYYARNNKTNLIGTLLNDAIADSGAFTVPFKGLQTIGDRANSIWLYIV  386

Query  1592  PRGMRNLMNYIKDKYGNPLVFITENGMDD------AKTDGLNDIKRIRYHRDYLKSLLAA  1753
             P+GMRNLMNYI+ +YGNP V ITENGMDD      ++ + L D KRIRYH DYL +L AA
Sbjct  387   PQGMRNLMNYIRIRYGNPPVIITENGMDDPNNILISRENALKDEKRIRYHHDYLSNLQAA  446

Query  1754  IKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
             I EDGCNVKGYF WSL+DNWEW  G++SRFGLY+VDY DNL+R PK S +WF +FL S
Sbjct  447   ISEDGCNVKGYFVWSLLDNWEWAAGYTSRFGLYFVDYRDNLKRYPKNSVRWFTSFLNS  504



>ref|XP_003556662.1| PREDICTED: beta-glucosidase 40 [Glycine max]
Length=503

 Score =   687 bits (1772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/483 (67%), Positives = 390/483 (81%), Gaps = 8/483 (2%)
 Frame = +2

Query  491   LQICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNAD  670
             +QIC ++ I+R +FP GFVFGTAS+A+Q+EGAVKEDGRG ++WDTF+HT GK+ DFSNAD
Sbjct  19    IQICSSE-INRGNFPNGFVFGTASSAFQYEGAVKEDGRGPSVWDTFSHTFGKIIDFSNAD  77

Query  671   VAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANG  850
             VAVDQYHRY EDI+LMKDMGMDAYRFSI+WSRIFPNG G++NQAGVDHYN LI+ALLA G
Sbjct  78    VAVDQYHRYEEDIQLMKDMGMDAYRFSISWSRIFPNGYGQINQAGVDHYNKLINALLAKG  137

Query  851   IEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSIT  1030
             IEPYVTLYH+DLPQALEN+Y+GWLN  +I DFA YAETCF  FGDRVK W+T NEP +  
Sbjct  138   IEPYVTLYHWDLPQALENKYSGWLNASIIMDFATYAETCFQKFGDRVKHWITFNEPHTFA  197

Query  1031  VLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGK  1210
               GYD+G+ APG CSI  HL C  GNSATEPY VAH++LL+HA   DIYR+KY+  QGG 
Sbjct  198   TQGYDVGLQAPGRCSILLHLFCRAGNSATEPYIVAHNVLLSHATVADIYRKKYKKIQGGS  257

Query  1211  ITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSA  1390
             + +  +  WYEPLTN+  DIDA QRA DF LGWFL+P+M G+YP S+ +RVG RLPKFS 
Sbjct  258   LGVAFDVIWYEPLTNTKEDIDAAQRAQDFQLGWFLDPLMFGDYPSSMRTRVGSRLPKFSQ  317

Query  1391  AESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERAN  1570
             +E+AL+KGS D++G+NHYTT+YA    TN++G  LHD++ DSG  TLPF G   I ERA+
Sbjct  318   SEAALVKGSLDFVGINHYTTFYAKDNSTNLIGTLLHDSIADSGAVTLPFNGTKAISERAS  377

Query  1571  AVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDY  1732
             ++WLYIVP+ M++LM YIK KYGNP V+ITENGMDD  +      D L D KRIRYH  Y
Sbjct  378   SIWLYIVPQSMKSLMIYIKQKYGNPPVYITENGMDDPNSIFISIKDALKDEKRIRYHTGY  437

Query  1733  LKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFK  1912
             L  LLA+IK DGCNVKGYF WSL+DNWEW+ G++SRFGLY+VDY DNL+R PK+S +WFK
Sbjct  438   LSYLLASIK-DGCNVKGYFVWSLLDNWEWSAGYTSRFGLYFVDYKDNLKRYPKQSVEWFK  496

Query  1913  NFL  1921
             NFL
Sbjct  497   NFL  499



>ref|XP_009406318.1| PREDICTED: beta-glucosidase 6-like [Musa acuminata subsp. malaccensis]
Length=506

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/484 (67%), Positives = 395/484 (82%), Gaps = 8/484 (2%)
 Frame = +2

Query  500   CGAQN--ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADV  673
             C AQ   +SR+SFPEGFVFGTAS++YQ+EGAV+EDG+G T+WD FAHT GKV DFSNADV
Sbjct  22    CLAQGGGLSRSSFPEGFVFGTASSSYQYEGAVEEDGKGRTVWDVFAHTFGKVIDFSNADV  81

Query  674   AVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGI  853
             AVDQYHR+ EDI LMKDMGMDAYRFSIAWSRIFPNGTG++NQAG+DHYN LI+ALLANGI
Sbjct  82    AVDQYHRFDEDILLMKDMGMDAYRFSIAWSRIFPNGTGEVNQAGIDHYNKLINALLANGI  141

Query  854   EPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITV  1033
             EPYVTLYH+DLPQALE+RY+GW++ ++I+D+A YAETCF  FGDRVK W+T NEP +  +
Sbjct  142   EPYVTLYHWDLPQALEDRYDGWIDPRIIQDYADYAETCFKAFGDRVKHWMTFNEPHTFAI  201

Query  1034  LGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKI  1213
              GYD+G+ APG CS F  LLC  GNSATEPY VAH++LL+HA   DIYRRKY+ KQ G +
Sbjct  202   QGYDVGLQAPGRCSAFLRLLCRAGNSATEPYIVAHNVLLSHATVSDIYRRKYKQKQQGSL  261

Query  1214  TIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAA  1393
              I  +  WYEP+TNS  DIDA QRA DF  GWF++P+  G+YP S+  RVG+RLP+F+ A
Sbjct  262   GIAFDVMWYEPMTNSSEDIDATQRAQDFQFGWFMDPLFFGDYPSSMRKRVGNRLPRFTTA  321

Query  1394  ESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANA  1573
             E+AL+KGS D++GVNHYTT+YA    TNI+G+ L+DTL DSG  TLPFK    IG+RA++
Sbjct  322   EAALVKGSLDFVGVNHYTTYYAKHNSTNIIGILLNDTLADSGAMTLPFKNGKAIGDRASS  381

Query  1574  VWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDD------AKTDGLNDIKRIRYHRDYL  1735
             +WLYIVP+G+R+LMN+IK KYGNP+V ITENGMDD      +    LND KRIRYH DYL
Sbjct  382   IWLYIVPQGLRSLMNHIKQKYGNPVVIITENGMDDFNNPFISIKHALNDDKRIRYHNDYL  441

Query  1736  KSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKN  1915
              +LLA+I+EDGCNV+GYFAWSL+DNWEW  G++SRFGLY+VDY D L+R PK+S  WFKN
Sbjct  442   LNLLASIREDGCNVQGYFAWSLLDNWEWAAGYTSRFGLYFVDYKDKLKRYPKKSVTWFKN  501

Query  1916  FLAS  1927
              L S
Sbjct  502   LLKS  505



>ref|XP_010551390.1| PREDICTED: beta-glucosidase 40 [Tarenaya hassleriana]
 ref|XP_010551391.1| PREDICTED: beta-glucosidase 40 [Tarenaya hassleriana]
Length=515

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/484 (66%), Positives = 390/484 (81%), Gaps = 6/484 (1%)
 Frame = +2

Query  494   QICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADV  673
             + C   +I R SFPEGFVFGTAS+A+Q+EGAVKEDGRG ++WDTF+H  GK+ D SNADV
Sbjct  28    KTCMCADIGRGSFPEGFVFGTASSAFQYEGAVKEDGRGPSVWDTFSHAFGKIVDSSNADV  87

Query  674   AVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGI  853
             AVDQYHRY ED++LMK+MGMDAYRFSI+WSRIFPNGTG++NQAG+DHYN LI+ALLA GI
Sbjct  88    AVDQYHRYEEDVQLMKNMGMDAYRFSISWSRIFPNGTGQINQAGIDHYNKLINALLAKGI  147

Query  854   EPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITV  1033
             +PYVTLYH+DLPQALE+RYNGWL+ Q+I DFA YAE CF  FGDRVK W+T NEP +  +
Sbjct  148   QPYVTLYHWDLPQALEDRYNGWLSPQIINDFAIYAEVCFKNFGDRVKHWITFNEPHNFAI  207

Query  1034  LGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKI  1213
              GYD+G+ APG CSI   L C  GNS+TEPY VAH++LL+HA   DIYR+KY+  QGG +
Sbjct  208   QGYDVGLQAPGRCSILLKLFCRVGNSSTEPYIVAHNVLLSHATVSDIYRKKYKGNQGGSL  267

Query  1214  TIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAA  1393
              I ++  WYEP TN+  DI+A QRA DF LGWFL+P+M G+YP S+ +RVG RLPKF+ +
Sbjct  268   GIALDVVWYEPETNTTEDIEAAQRAQDFQLGWFLDPLMFGDYPNSMRTRVGKRLPKFTQS  327

Query  1394  ESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANA  1573
             ++ LLKGS D++G+NHYTT YA +  TN++G  L+D + DSGT T P KGL PIG+RAN+
Sbjct  328   QTDLLKGSLDFVGINHYTTNYARNNKTNLIGTLLNDAIADSGTSTGPLKGLQPIGDRANS  387

Query  1574  VWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDD------AKTDGLNDIKRIRYHRDYL  1735
             +WLYIVPRGMR+LMNYIK +YGNPLV ITENGMDD      ++ + L D KRI+YH DYL
Sbjct  388   IWLYIVPRGMRSLMNYIKQRYGNPLVIITENGMDDPNSILISRENALKDEKRIKYHHDYL  447

Query  1736  KSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKN  1915
              SL AAIKEDGCNV+GYFAWSL+DNWEW  G++SRFGLY+VDY+DNL+R PK S  WF  
Sbjct  448   SSLQAAIKEDGCNVRGYFAWSLLDNWEWAAGYTSRFGLYFVDYNDNLKRYPKHSVHWFTT  507

Query  1916  FLAS  1927
             FL S
Sbjct  508   FLNS  511



>emb|CDY61627.1| BnaA08g19770D [Brassica napus]
Length=502

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/484 (67%), Positives = 394/484 (81%), Gaps = 8/484 (2%)
 Frame = +2

Query  497   ICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVA  676
             IC A+ ISR SFP+GFVFGTAS+A+Q EGAVKEDGRG TIWDTF+HT GK+TDFSNADVA
Sbjct  18    IC-AEEISRGSFPKGFVFGTASSAFQHEGAVKEDGRGPTIWDTFSHTFGKITDFSNADVA  76

Query  677   VDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANG-I  853
             VDQYHRY ED++LMK+MGMDAYRFSI+W+RIFPNG G++N+AG+DHYN LI+ALLA G I
Sbjct  77    VDQYHRYEEDVQLMKNMGMDAYRFSISWARIFPNGVGQINEAGIDHYNKLINALLAKGRI  136

Query  854   EPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITV  1033
             EPYVTLYH+DLPQAL +RY GWLN Q+I DFAAYAE CF  FGDRVK W+T NEP + ++
Sbjct  137   EPYVTLYHWDLPQALHDRYLGWLNPQIINDFAAYAEVCFQRFGDRVKHWITFNEPHTFSI  196

Query  1034  LGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKI  1213
              GYD+G+ APG CSI F L C +GNS+TEPY V H+++L HA   DIYR+KY+A QGG +
Sbjct  197   QGYDVGLQAPGRCSILFKLTCRSGNSSTEPYIVGHNVILTHATVSDIYRKKYKATQGGSL  256

Query  1214  TIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAA  1393
              I  +  WYEP +N+  D++A QRA DF LGWFL+P+M G+YP S+ SRVG RLP F+ +
Sbjct  257   GIAFDVMWYEPESNNREDMEAAQRAQDFQLGWFLDPLMFGDYPSSMRSRVGSRLPVFTGS  316

Query  1394  ESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANA  1573
             +S L+KGS D++G+NHYTT+YA +  TN++G  LHD ++DSGT TLPFKGL  IG+RA++
Sbjct  317   QSNLIKGSLDFVGINHYTTYYARNNATNLIGTLLHDAISDSGTVTLPFKGLSAIGDRASS  376

Query  1574  VWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDA------KTDGLNDIKRIRYHRDYL  1735
             +WLYIVPRGMR+LMNY+K +YGNP V+ITENGMDD+      + + L D KRIRYH DYL
Sbjct  377   IWLYIVPRGMRSLMNYVKHRYGNPPVYITENGMDDSNSILIPRKETLKDAKRIRYHHDYL  436

Query  1736  KSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKN  1915
              SL AAIKEDGCNVKGYF WSL+DNWEW  G+SSRFGLY+VDY D L+R PK+S  WF +
Sbjct  437   SSLQAAIKEDGCNVKGYFVWSLLDNWEWAAGYSSRFGLYFVDYRDKLKRYPKDSVHWFTS  496

Query  1916  FLAS  1927
             FL S
Sbjct  497   FLNS  500



>ref|XP_010259408.1| PREDICTED: beta-glucosidase 40-like [Nelumbo nucifera]
Length=508

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/478 (67%), Positives = 385/478 (81%), Gaps = 6/478 (1%)
 Frame = +2

Query  512   NISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYH  691
              I+RASFP+GFVFGTAS+AYQ+EGAV+EDGRG T+WDTFAH+ GK+ DFSNADVAVDQYH
Sbjct  30    QINRASFPKGFVFGTASSAYQYEGAVEEDGRGKTVWDTFAHSFGKIADFSNADVAVDQYH  89

Query  692   RYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTL  871
             R+ EDI+LMKDMGMD YRFSIAWSRIFPNG+G++NQAGVDHYNNLI+ALLA GIEPY+TL
Sbjct  90    RFNEDIQLMKDMGMDVYRFSIAWSRIFPNGSGEINQAGVDHYNNLINALLAKGIEPYITL  149

Query  872   YHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLG  1051
             YH+DLPQAL ++Y GWL+ Q+IKDF  YAETCF  FGDRVK W+T NEP +  + GYD+G
Sbjct  150   YHWDLPQALADKYKGWLDPQIIKDFTVYAETCFQKFGDRVKHWITFNEPHTFAIQGYDVG  209

Query  1052  VHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVES  1231
             + APG CSI   L C  GNSATEPY V HH+LL+HA   DIYR+KY+ KQ G + I  + 
Sbjct  210   LQAPGRCSILLRLFCRAGNSATEPYIVGHHVLLSHATVADIYRKKYKQKQHGSVGIAFDV  269

Query  1232  FWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLK  1411
              W+EP+T+S  DI+A QRA DF  GWF+EP+  GEYP S+ SRVG RLP FS AE+AL+K
Sbjct  270   MWFEPMTDSAKDIEAAQRAQDFQFGWFMEPLFYGEYPSSMRSRVGSRLPIFSKAEAALVK  329

Query  1412  GSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIV  1591
             GS D++G+NHYTT+YA    TNI+G  L+D+L DSG  TLP+K    IG+RA++VWLYIV
Sbjct  330   GSLDFVGINHYTTYYAKDNSTNIVGFVLNDSLADSGAITLPWKSGKAIGDRASSVWLYIV  389

Query  1592  PRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLKSLLAA  1753
             P G+R LMNYIK KYGNP V ITENGMDDA        D L D KRI+YH DYL +LLA+
Sbjct  390   PEGIRKLMNYIKIKYGNPTVIITENGMDDANNPLISIKDALKDEKRIKYHNDYLTNLLAS  449

Query  1754  IKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
             IKEDGCNVKGYF WSL+DNWEWT G+ SRFG+Y+VDY DNL+R PK+S +WFK+FL S
Sbjct  450   IKEDGCNVKGYFVWSLLDNWEWTAGYKSRFGVYFVDYKDNLKRYPKDSVQWFKSFLTS  507



>ref|XP_004144181.1| PREDICTED: beta-glucosidase 40-like [Cucumis sativus]
 ref|XP_004169704.1| PREDICTED: beta-glucosidase 40-like [Cucumis sativus]
Length=507

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/484 (68%), Positives = 389/484 (80%), Gaps = 7/484 (1%)
 Frame = +2

Query  494   QICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADV  673
             QIC AQ ISR+SFP GFVFGTAS+A+Q+EGAVK+DGRG TIWDTF+HT GKV DFSNADV
Sbjct  25    QICSAQ-ISRSSFPSGFVFGTASSAFQYEGAVKDDGRGPTIWDTFSHTFGKVLDFSNADV  83

Query  674   AVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGI  853
              VDQYHRY EDI+LMKDMGMDAYRFSIAWSRIFPNG G++N AGV HYNN I+ALLANGI
Sbjct  84    TVDQYHRYPEDIKLMKDMGMDAYRFSIAWSRIFPNGNGEVNDAGVAHYNNFINALLANGI  143

Query  854   EPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITV  1033
             EPYVTLYH+DLPQALE++Y GWL+ Q+I DFA +AETCF  FGDRVK W+T NEP +   
Sbjct  144   EPYVTLYHWDLPQALEDKYTGWLSPQIINDFAVFAETCFQKFGDRVKHWITFNEPHTFAT  203

Query  1034  LGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKI  1213
              GYDLG+ APG CSI  H+ C  GNSATEPY V H+LLL+HA   DIYRRKY+  Q G I
Sbjct  204   QGYDLGLQAPGRCSILGHITCRDGNSATEPYIVGHNLLLSHATVSDIYRRKYKRIQKGVI  263

Query  1214  TIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAA  1393
              + ++  W+EP +NS  DIDA +RA DF LGWFL P++ G+YP S+ SRVG RLP FS +
Sbjct  264   GMSLDVIWFEPGSNSTEDIDAAKRAQDFQLGWFLNPLIFGDYPTSMRSRVGGRLPTFSPS  323

Query  1394  ESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANA  1573
             ++AL+KGS D++G+NHYTT+YA    +NI+G  L+DT+ DSG  T+PFKGL  I ERAN+
Sbjct  324   QAALVKGSQDFVGINHYTTFYAYHNRSNIIGATLNDTIADSGALTVPFKGLKTIAERANS  383

Query  1574  VWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAK------TDGLNDIKRIRYHRDYL  1735
             +WLYIVPRGMR+LMNYIK+ YGNPLV ITENGMDD         + L D KRIRYH  YL
Sbjct  384   IWLYIVPRGMRSLMNYIKNNYGNPLVIITENGMDDPNDPFKPIKEALKDEKRIRYHNGYL  443

Query  1736  KSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKN  1915
              +LLA+IKEDGCNVKGYF WSL+DNWEW  GFSSRFGLY+VDY D L+R PK+S +WFKN
Sbjct  444   TNLLASIKEDGCNVKGYFVWSLLDNWEWAAGFSSRFGLYFVDYKDKLKRYPKDSVQWFKN  503

Query  1916  FLAS  1927
             FLAS
Sbjct  504   FLAS  507



>ref|XP_008445464.1| PREDICTED: beta-glucosidase 40 [Cucumis melo]
 ref|XP_008445465.1| PREDICTED: beta-glucosidase 40 [Cucumis melo]
Length=507

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/486 (67%), Positives = 394/486 (81%), Gaps = 7/486 (1%)
 Frame = +2

Query  488   GLQICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNA  667
             G+QIC AQ I+R+SFP GFVFGTAS+A+Q+EGA+KEDGRG TIWD F+H+ GKV DFSNA
Sbjct  23    GIQICSAQ-ITRSSFPSGFVFGTASSAFQYEGALKEDGRGPTIWDKFSHSFGKVVDFSNA  81

Query  668   DVAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLAN  847
             DVAVDQYHRY EDI+LMKDMGMDAYRFSIAWSRIFPNG+G++N+AGV HYNN I+ALLAN
Sbjct  82    DVAVDQYHRYPEDIKLMKDMGMDAYRFSIAWSRIFPNGSGEINEAGVAHYNNFINALLAN  141

Query  848   GIEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSI  1027
             GI+PYVTLYH+DLPQALE++Y GWL+ Q+I DFA +AETCF  FGDRVK W+T NEP + 
Sbjct  142   GIQPYVTLYHWDLPQALEDKYTGWLSPQIINDFAVFAETCFQKFGDRVKHWITFNEPHTF  201

Query  1028  TVLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGG  1207
                GYDLG+ APG CSI  H+ C  GNSATEPY V H+LLL+HA   DIYRRKY+  Q G
Sbjct  202   ATQGYDLGLQAPGRCSILGHITCRDGNSATEPYIVGHNLLLSHATVSDIYRRKYKRIQKG  261

Query  1208  KITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFS  1387
              I + ++  W+EP +NS  DI+A +RA DF LGWFL P++ G+YP S+ SRVG RLP FS
Sbjct  262   VIGMSLDVIWFEPGSNSTEDIEAAKRAQDFQLGWFLNPLIFGDYPTSMRSRVGGRLPTFS  321

Query  1388  AAESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERA  1567
              +++AL+KGS D++G+NHYTT+YA    +NI+G+ L+D++ DSG  T+PFKGL  I ERA
Sbjct  322   PSQAALVKGSQDFVGINHYTTFYAYHNRSNIIGVTLNDSIADSGALTVPFKGLKTIAERA  381

Query  1568  NAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAK------TDGLNDIKRIRYHRD  1729
             N++WLYIVPRG+R+LMNYIK+ YGNPLV ITENGMDD         + L D KRIRYH  
Sbjct  382   NSIWLYIVPRGLRSLMNYIKNNYGNPLVIITENGMDDPNDPFKPIKEALKDEKRIRYHNG  441

Query  1730  YLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWF  1909
             YL +LLA+IKEDGCNVKGYF WSL+DNWEW  GFSSRFGLY+VDY D L+R PK+S +WF
Sbjct  442   YLTNLLASIKEDGCNVKGYFVWSLLDNWEWAAGFSSRFGLYFVDYKDKLKRYPKDSVQWF  501

Query  1910  KNFLAS  1927
             KNFLAS
Sbjct  502   KNFLAS  507



>gb|KFK44575.1| hypothetical protein AALP_AA1G275600 [Arabis alpina]
Length=501

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/485 (65%), Positives = 388/485 (80%), Gaps = 6/485 (1%)
 Frame = +2

Query  491   LQICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNAD  670
             +  C  ++ISR SFP GFVFGTAS+A+Q EGAVK +GRG TIWDTF+HT G +TDFSNAD
Sbjct  15    VNTCICEDISRGSFPNGFVFGTASSAFQHEGAVKAEGRGPTIWDTFSHTFGLITDFSNAD  74

Query  671   VAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANG  850
             VAVDQYHRY ED++LMK+MGMDAYRFSI+W+RIFPNG G++N+AG+DHYN LI+ALLA G
Sbjct  75    VAVDQYHRYEEDVQLMKNMGMDAYRFSISWTRIFPNGVGQINEAGIDHYNKLINALLAKG  134

Query  851   IEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSIT  1030
             IEPYVTLYH+DLPQAL +RY GWLN Q+I DFAAYAE CF  FGDRVK W+T NEP +  
Sbjct  135   IEPYVTLYHWDLPQALHDRYLGWLNPQIINDFAAYAELCFQRFGDRVKHWITFNEPHTFA  194

Query  1031  VLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGK  1210
             + GYD+G+ APG C+I F L C  GNS+TEPY V H+++L HA   +IYR+ Y+AKQGG 
Sbjct  195   IQGYDVGLQAPGRCTILFKLTCRAGNSSTEPYIVGHNVILTHATVSNIYRKNYKAKQGGS  254

Query  1211  ITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSA  1390
             + I  +  WYEP +N   DI+A QRA DF LGWFL+P+M G+YP S+ SRVG RLP F+ 
Sbjct  255   LGIAFDVMWYEPESNKTEDIEAAQRAQDFQLGWFLDPLMFGDYPSSMRSRVGSRLPVFTG  314

Query  1391  AESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERAN  1570
             ++ AL+KGS D++G+NHYTT+YA +  TN++G  LHD ++DSGT TLPFKGL  IG+RAN
Sbjct  315   SQPALVKGSLDFVGINHYTTYYARNNATNLIGTLLHDAISDSGTVTLPFKGLSTIGDRAN  374

Query  1571  AVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDD------AKTDGLNDIKRIRYHRDY  1732
             ++WLYIVPRGMR+LMNYIK +YGNP VFITENGMDD      ++ + L D KRIRYH DY
Sbjct  375   SIWLYIVPRGMRSLMNYIKHRYGNPPVFITENGMDDPNSILISRKEALKDTKRIRYHHDY  434

Query  1733  LKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFK  1912
             L SL A+IKEDGCNVKGYF WSL+DNWEW  G+SSRFGLY+VD+ D L+R PK+S  WF 
Sbjct  435   LSSLQASIKEDGCNVKGYFVWSLLDNWEWAAGYSSRFGLYFVDFRDKLKRYPKDSVHWFT  494

Query  1913  NFLAS  1927
             +FL S
Sbjct  495   SFLNS  499



>ref|XP_004985213.1| PREDICTED: beta-glucosidase 6-like [Setaria italica]
Length=520

 Score =   684 bits (1766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/478 (66%), Positives = 394/478 (82%), Gaps = 7/478 (1%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             ++R SFP+GFVFGTA+AAYQ+EGAVK DGRG TIWDTFAHT GK++DFSNADVAVDQYHR
Sbjct  42    LTRGSFPKGFVFGTAAAAYQYEGAVKVDGRGQTIWDTFAHTFGKISDFSNADVAVDQYHR  101

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             + ED++LM DMGMDAYRFSIAWSRIFPNGTG++NQAG+DHYN +I+ALL+ GI+PYVTLY
Sbjct  102   FQEDVQLMADMGMDAYRFSIAWSRIFPNGTGQVNQAGIDHYNKVINALLSKGIQPYVTLY  161

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             H+DLPQALE+RYNGWL+RQ++ DFAAYAETCF  FGDRVK W+TINEP ++ V GYD G+
Sbjct  162   HWDLPQALEDRYNGWLDRQIVNDFAAYAETCFKAFGDRVKHWITINEPHTVAVQGYDAGL  221

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
             HAPG CS+  HL C +GNS TEPY VAH+ +LAHA   DIYRRKY+A Q G++ I  +  
Sbjct  222   HAPGRCSVLLHLYCKSGNSGTEPYIVAHNFILAHATVSDIYRRKYKATQNGQLGIAFDVI  281

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             WYEP+TNS  DI+A +RA +F LGWF +P   G+YP ++ +RV +RLPKF+A E+AL+KG
Sbjct  282   WYEPMTNSTIDIEATKRAQEFQLGWFADPFFFGDYPATMRTRVAERLPKFTAEEAALVKG  341

Query  1415  SYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPF-KGLMPIGERANAVWLYIV  1591
             + D++G+NHYTT+Y    DTNI+G+ L+DTL D+GT +LPF K   PIG+RAN++WLYIV
Sbjct  342   ALDFVGINHYTTFYTRHNDTNIIGVLLNDTLADTGTISLPFDKNGKPIGDRANSIWLYIV  401

Query  1592  PRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLKSLLAA  1753
             P GMR LMNY+K++Y +P V+ITENGMDD+        D L D KRI+YH DYL +L A+
Sbjct  402   PSGMRKLMNYVKERYNSPPVYITENGMDDSNNPFTSIKDALKDSKRIKYHNDYLTNLAAS  461

Query  1754  IKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
             IKEDGC+V+GYFAWSL+DNWEW  G++SRFGLY+VDY DNL+R PK S +WFK+ L+S
Sbjct  462   IKEDGCDVRGYFAWSLLDNWEWAAGYTSRFGLYFVDYRDNLKRYPKNSVQWFKSLLSS  519



>ref|XP_007157842.1| hypothetical protein PHAVU_002G102800g [Phaseolus vulgaris]
 gb|ESW29836.1| hypothetical protein PHAVU_002G102800g [Phaseolus vulgaris]
Length=503

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/483 (67%), Positives = 391/483 (81%), Gaps = 8/483 (2%)
 Frame = +2

Query  491   LQICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNAD  670
             ++IC ++ I+R +FP GFVFGTAS+A+Q+EGAVKEDGRG ++WD F+HT GK+ DFSNAD
Sbjct  19    MRICKSE-INRQNFPNGFVFGTASSAFQYEGAVKEDGRGPSVWDKFSHTFGKILDFSNAD  77

Query  671   VAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANG  850
             VAVDQYHRY ED++LMKDMGMDAYRFSI+WSRIFPNG+G++NQAGVDHYN LI+ALLA G
Sbjct  78    VAVDQYHRYEEDVQLMKDMGMDAYRFSISWSRIFPNGSGQINQAGVDHYNKLINALLAKG  137

Query  851   IEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSIT  1030
             IEPYVTLYH+DLPQALE++YNGWLN  +IKDF+ YAETCF  FGDRVK W+T NEP +  
Sbjct  138   IEPYVTLYHWDLPQALEDKYNGWLNTSIIKDFSTYAETCFQKFGDRVKHWITFNEPHTFA  197

Query  1031  VLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGK  1210
               GYD+G+ APG CSI  HL C  GNSATEPY VAH++LL+HAA  DIYR+KY++ Q G 
Sbjct  198   TQGYDVGLQAPGRCSILLHLFCRAGNSATEPYIVAHNVLLSHAAVADIYRKKYKSIQKGS  257

Query  1211  ITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSA  1390
             + I  +  WYEP TN+  +IDA QRA DF LGWFL+P+M G+YP S+ SRVG RLPKFS 
Sbjct  258   LGIAFDVIWYEPETNTQENIDAAQRAQDFQLGWFLDPLMFGDYPSSMRSRVGSRLPKFSQ  317

Query  1391  AESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERAN  1570
              E++L+KGS D++G+NHYTT+YA +  TNI+G  LHD++ DSGT TLPF G   I ERAN
Sbjct  318   FEASLVKGSLDFVGINHYTTFYARNNSTNIIGTLLHDSVADSGTVTLPFNGTKAISERAN  377

Query  1571  AVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDY  1732
             ++WLYIVP+ MR+LM YIK KYGNP +FITENGMDD  +      D L D KRIRYH DY
Sbjct  378   SIWLYIVPQSMRSLMIYIKQKYGNPSIFITENGMDDPNSPFISIKDALKDEKRIRYHSDY  437

Query  1733  LKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFK  1912
             L  LLA+IKE GCNVKGYF WSL+DNWEW+ G+SSRFGLY+VDY D  +R PK+S +WFK
Sbjct  438   LSYLLASIKE-GCNVKGYFVWSLLDNWEWSAGYSSRFGLYFVDYKDKQKRYPKQSVQWFK  496

Query  1913  NFL  1921
             +FL
Sbjct  497   SFL  499



>ref|XP_010680724.1| PREDICTED: beta-glucosidase 40 [Beta vulgaris subsp. vulgaris]
Length=513

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/481 (68%), Positives = 386/481 (80%), Gaps = 7/481 (1%)
 Frame = +2

Query  500   CGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAV  679
             C + N++R SFP+ FVFGTAS+AYQ+EGAVKEDGRG  +WDTFAH  GKV DFSNADVA 
Sbjct  29    CSSTNVTRKSFPKSFVFGTASSAYQYEGAVKEDGRGPCVWDTFAHRLGKVIDFSNADVAN  88

Query  680   DQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEP  859
             D YHRYLED++LMKD+G+ AYRFSI+W+RIFPNGTGK+NQAGVDHYNNLI+ALLANGI+P
Sbjct  89    DHYHRYLEDVKLMKDLGVSAYRFSISWTRIFPNGTGKINQAGVDHYNNLINALLANGIQP  148

Query  860   YVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLG  1039
             YVT++H+D PQALE+ Y  WL+ Q++ DF AYAET +  FGDRVK W+T+NEP ++   G
Sbjct  149   YVTMFHWDTPQALEDAYKSWLSPQIVNDFGAYAETLYQKFGDRVKHWITLNEPHTVAAQG  208

Query  1040  YDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITI  1219
             YD+G+ APG CSI  HL C  GNSATEPY VAHHLLLAHA AV+IYR KYQ KQ G I  
Sbjct  209   YDIGIFAPGRCSILLHLFCRAGNSATEPYIVAHHLLLAHATAVNIYRTKYQRKQRGTIGA  268

Query  1220  VVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAES  1399
               +  WYEP TN+  DI+A QRA DF LGWFL+P+M G+YP S+  RVGDRLPKFSAAES
Sbjct  269   AFDVMWYEPATNTIEDIEAAQRAQDFQLGWFLDPLMFGDYPSSMRERVGDRLPKFSAAES  328

Query  1400  ALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPF-KGLMPIGERANAV  1576
             +LLKGS D++G+NHYTT+YA +  TNI+G  L+D L DSGT TLPF     PIGERANA+
Sbjct  329   SLLKGSLDFVGINHYTTYYARNNKTNIIGFLLNDALADSGTITLPFGHDGKPIGERANAI  388

Query  1577  WLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLK  1738
             WLYIVPRGMR LMNYIK KYGNP+VFITENGMDD  +      D L D KRIRY   YL+
Sbjct  389   WLYIVPRGMRELMNYIKHKYGNPIVFITENGMDDGNSIFKSLEDALKDEKRIRYFNGYLE  448

Query  1739  SLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNF  1918
             +L AAIKEDGCNVKGYFAWSL+DNWEW  G++SRFGLYYVDY +N +R PK S +WFKNF
Sbjct  449   NLAAAIKEDGCNVKGYFAWSLLDNWEWAAGYTSRFGLYYVDYKNNQKRYPKNSVQWFKNF  508

Query  1919  L  1921
              
Sbjct  509   F  509



>emb|CDY20561.1| BnaC07g12280D [Brassica napus]
Length=509

 Score =   683 bits (1763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/484 (66%), Positives = 393/484 (81%), Gaps = 7/484 (1%)
 Frame = +2

Query  497   IC-GAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADV  673
             IC  AQ+ISR SFP+GFVFGTAS+A+Q+EGAVKE GRG TIWDTF+HT GK+TDFSNADV
Sbjct  24    ICIRAQDISRGSFPKGFVFGTASSAFQYEGAVKEGGRGPTIWDTFSHTFGKITDFSNADV  83

Query  674   AVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGI  853
             AVDQYHRY ED++LMK+MGMDAYRFSI+W+RIFPNG G++N+AG++HYN LIDALLA GI
Sbjct  84    AVDQYHRYEEDVQLMKNMGMDAYRFSISWARIFPNGVGQINEAGINHYNKLIDALLAKGI  143

Query  854   EPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITV  1033
             EPYVTLYH+DLPQAL +RY GWLN Q+I DFAAYAE CF  FGDRVK W+T NEP++ ++
Sbjct  144   EPYVTLYHWDLPQALHDRYLGWLNPQIINDFAAYAEVCFQRFGDRVKHWITFNEPQTFSI  203

Query  1034  LGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKI  1213
              GY +G+ APG CSI F L C +GNS+TEPY V H+++L+HA   DIYR+KY+AKQGG +
Sbjct  204   HGYAIGLQAPGRCSILFKLTCRSGNSSTEPYIVGHNVILSHATVSDIYRKKYKAKQGGSL  263

Query  1214  TIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAA  1393
              +     W+EP +N   DI+A QRA DF LGWFL+P+M G+YP S+ SRVG RLP F+ +
Sbjct  264   GLAFNVAWFEPESNKTEDIEAAQRAQDFQLGWFLDPLMFGDYPSSMRSRVGSRLPVFTGS  323

Query  1394  ESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANA  1573
             +S L+KGS D++G+NHYTT+YA +  TN+MG  L    +DSGT T PFKG+ PIG+RAN+
Sbjct  324   QSVLVKGSLDFVGINHYTTYYARNNATNLMGTVLDGAFSDSGTVTQPFKGVTPIGDRANS  383

Query  1574  VWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDD------AKTDGLNDIKRIRYHRDYL  1735
             +WLYIVPRGMR++MNY+K +YGNP VFITENGMDD       + + L D KRIRYH DYL
Sbjct  384   LWLYIVPRGMRSVMNYVKHRYGNPQVFITENGMDDPNNILIPREEALKDGKRIRYHHDYL  443

Query  1736  KSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKN  1915
              +L AAIKEDGCNVKGYFAWSL+DNWEW  G+SSRFGLY+VDY DNL+R PK+S  WF +
Sbjct  444   SNLQAAIKEDGCNVKGYFAWSLLDNWEWASGYSSRFGLYFVDYRDNLKRYPKDSVHWFTS  503

Query  1916  FLAS  1927
             FL S
Sbjct  504   FLNS  507



>ref|XP_009406319.1| PREDICTED: beta-glucosidase 6-like [Musa acuminata subsp. malaccensis]
Length=505

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/477 (67%), Positives = 388/477 (81%), Gaps = 6/477 (1%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             +SR SFP+GFVFGTAS++YQ+EGAV+EDGRG T+WDTFAH+ GKV DFSNADVAVDQYHR
Sbjct  28    LSRGSFPQGFVFGTASSSYQYEGAVEEDGRGKTVWDTFAHSFGKVIDFSNADVAVDQYHR  87

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             + +DI+LM DMGMDAYRFSIAWSRI PNG G++NQAG+DHYN  I+ALLA GI+PYVTLY
Sbjct  88    FHDDIQLMADMGMDAYRFSIAWSRILPNGAGEVNQAGIDHYNEEINALLAKGIQPYVTLY  147

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             H+DLPQAL++RYNGW++RQ+I+DFA YAE CF  FGDRVK W+T NEP +  + GYD+G+
Sbjct  148   HWDLPQALQDRYNGWIDRQIIEDFANYAEICFKAFGDRVKHWITFNEPHTFAIQGYDVGL  207

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
             HAPG CS   H LC  GNSATEPY VAHH+LL+HA   DIYRRKY+  Q G I +  +  
Sbjct  208   HAPGRCSTLLHFLCRAGNSATEPYTVAHHVLLSHATVSDIYRRKYKKTQQGSIGMAFDVM  267

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             W+EP+T+SP DIDA QRA+DF LGW ++P+  GEYPRS+ +RVG+RLP+FSAAE+AL+KG
Sbjct  268   WFEPMTDSPEDIDATQRAMDFQLGWLMDPLFVGEYPRSMRTRVGERLPRFSAAEAALVKG  327

Query  1415  SYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVP  1594
             S D++GVNHYTT+YA    TNI+G  L+DTL DSGT TLPFK    IG++A+++WLYIVP
Sbjct  328   SLDFVGVNHYTTYYAKHNSTNILGFLLNDTLADSGTITLPFKDGKAIGDKASSIWLYIVP  387

Query  1595  RGMRNLMNYIKDKYGNPLVFITENGMDD------AKTDGLNDIKRIRYHRDYLKSLLAAI  1756
             +G+R+LMNYIKDKY NP V ITENGMDD      +    L D KRI+YH DYL +L A+I
Sbjct  388   QGIRSLMNYIKDKYYNPSVIITENGMDDFNNPFISIEHALKDDKRIKYHGDYLSNLAASI  447

Query  1757  KEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
             +EDGCNVKGYF WSL+DNWEW  G++SRFGLY+VDY DNL+R PK S  WFKN L S
Sbjct  448   REDGCNVKGYFVWSLLDNWEWAAGYTSRFGLYFVDYKDNLKRYPKNSVNWFKNLLRS  504



>ref|XP_010521461.1| PREDICTED: beta-glucosidase 40-like isoform X1 [Tarenaya hassleriana]
Length=512

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/483 (66%), Positives = 393/483 (81%), Gaps = 11/483 (2%)
 Frame = +2

Query  512   NISRASFPEGFVFGTASAAYQ-----FEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVA  676
             +I+RASFP GFVFGTASAA+Q     +EGAVKEDGRG ++WDTF+HT GK+ DFSNADVA
Sbjct  27    DINRASFPNGFVFGTASAAFQGNLLQYEGAVKEDGRGPSVWDTFSHTLGKIADFSNADVA  86

Query  677   VDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIE  856
             VDQYHRY EDI+LMK+MGMDAYRFSI+W+RIFPNGTG++NQAG+DHYN LI+ALLA GI+
Sbjct  87    VDQYHRYEEDIQLMKNMGMDAYRFSISWTRIFPNGTGQINQAGIDHYNKLINALLAQGIQ  146

Query  857   PYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVL  1036
             PYVTLYH+DLPQAL +RYNGWL+ Q+I D+A YAE CF  FGDRVK W+T NEP +  + 
Sbjct  147   PYVTLYHWDLPQALHDRYNGWLSPQIINDYATYAEVCFENFGDRVKHWITFNEPHTFAIQ  206

Query  1037  GYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKIT  1216
             GYD+G+ APG CSI   L C  GNSATEPY VAH++LL+HA   DIYR+KY+AKQGG + 
Sbjct  207   GYDVGLQAPGRCSILLRLFCRGGNSATEPYIVAHNVLLSHATVSDIYRKKYKAKQGGWLG  266

Query  1217  IVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAE  1396
             I  +  WYEP TN+  DI+A QRA DF LGWFL+P+M G+YP S+ SRVG RLP+F+A+E
Sbjct  267   IAFDVIWYEPETNTREDIEAAQRAQDFQLGWFLDPLMFGDYPNSMRSRVGKRLPRFTASE  326

Query  1397  SALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAV  1576
             +A++KGS D++G+NHYTT+YA +  TN++G  L+D + DSG FT+PFKGL  IG+RAN++
Sbjct  327   AAMVKGSLDFVGINHYTTYYARNNKTNLIGTLLNDAIADSGAFTVPFKGLQTIGDRANSI  386

Query  1577  WLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDD------AKTDGLNDIKRIRYHRDYLK  1738
             WLYIVP+GMRNLMNYI+ +YGNP V ITENGMDD      ++ + L D KRIRYH DYL 
Sbjct  387   WLYIVPQGMRNLMNYIRIRYGNPPVIITENGMDDPNNILISRENALKDEKRIRYHHDYLS  446

Query  1739  SLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNF  1918
             +L AAI EDGCNVKGYF WSL+DNWEW  G++SRFGLY+VDY DNL+R PK S +WF +F
Sbjct  447   NLQAAISEDGCNVKGYFVWSLLDNWEWAAGYTSRFGLYFVDYRDNLKRYPKNSVRWFTSF  506

Query  1919  LAS  1927
             L S
Sbjct  507   LNS  509



>ref|XP_009775819.1| PREDICTED: beta-glucosidase 40-like isoform X1 [Nicotiana sylvestris]
Length=508

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/484 (67%), Positives = 388/484 (80%), Gaps = 7/484 (1%)
 Frame = +2

Query  497   ICGAQ-NISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADV  673
             IC A+ NI+R SFPEGFVFGTASAAYQ+EGAVKEDG G TIWD FAHT GK+ DFSNADV
Sbjct  24    ICLAEENINRRSFPEGFVFGTASAAYQYEGAVKEDGSGPTIWDKFAHTFGKILDFSNADV  83

Query  674   AVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGI  853
             A+D YHR+ EDI+LMKDMGMDA+R SIAWSRIFPNG+GK+NQAGVDHYN +ID+LLANGI
Sbjct  84    ALDHYHRFQEDIQLMKDMGMDAFRLSIAWSRIFPNGSGKINQAGVDHYNKVIDSLLANGI  143

Query  854   EPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITV  1033
             EPYVTLYH+DLP ALE++Y GWL+  +I+DFA YAETCF+ FGDRVK W+T+NEP +   
Sbjct  144   EPYVTLYHWDLPLALEDKYKGWLSPDIIQDFAIYAETCFVAFGDRVKHWITLNEPHNFVQ  203

Query  1034  LGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKI  1213
              GYDLG   PG CSI  H  C  GNS TEPY  AH+ LLAHA AV+IYR+KY+  Q G I
Sbjct  204   QGYDLGSQPPGRCSIILHAFCSEGNSGTEPYIAAHNALLAHATAVNIYRQKYKQNQQGSI  263

Query  1214  TIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAA  1393
              I ++S+WYE  TN   DI+A QRA+DF LGWF+EP++ G YP ++ISR G RLPKFS  
Sbjct  264   GISLDSYWYESATNHKEDIEATQRALDFQLGWFIEPLVFGNYPSTMISRAGSRLPKFSQE  323

Query  1394  ESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANA  1573
             ES+LLKGS+D++G+NHYTTWYA S  TN++G   +DT +DSG   LP +   PI +RAN+
Sbjct  324   ESSLLKGSFDFIGINHYTTWYARSNITNLIGFLFNDTTSDSGATVLPLRLGKPIPDRANS  383

Query  1574  VWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDD------AKTDGLNDIKRIRYHRDYL  1735
             VWL+IVP G+R+LMNYI+ KYGNP + ITENGMDD      ++ D L D KRI+YH+DYL
Sbjct  384   VWLFIVPHGIRSLMNYIRVKYGNPTIIITENGMDDPNSLFISRKDALKDEKRIKYHKDYL  443

Query  1736  KSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKN  1915
              +LLA+I+EDGCNVKGYF WSL+DNWEW  GFSSRFGLYYVDY+DNL+R PK S KWF N
Sbjct  444   TNLLASIREDGCNVKGYFVWSLLDNWEWQEGFSSRFGLYYVDYNDNLKRYPKNSVKWFNN  503

Query  1916  FLAS  1927
             FL+S
Sbjct  504   FLSS  507



>ref|XP_006651165.1| PREDICTED: beta-glucosidase 6-like [Oryza brachyantha]
Length=515

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/484 (65%), Positives = 396/484 (82%), Gaps = 6/484 (1%)
 Frame = +2

Query  494   QICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADV  673
             Q  G   ++R SFPEGFVFGTASAAYQ+EGAVKEDGRG TIWDTFAHT GK+TDFSNADV
Sbjct  31    QQSGGGGLTRGSFPEGFVFGTASAAYQYEGAVKEDGRGQTIWDTFAHTFGKITDFSNADV  90

Query  674   AVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGI  853
             AVDQYHR+ EDI+LM DMGMDAYRFSIAWSRI+PNG G++NQAG+DHYN LI+ALLA GI
Sbjct  91    AVDQYHRFEEDIQLMADMGMDAYRFSIAWSRIYPNGVGQVNQAGIDHYNKLINALLAKGI  150

Query  854   EPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITV  1033
             +PYVTLYH+DLPQALE++Y GWL+RQ++ DFAAYAETCF  FGDRVK+W+T+NEP ++ +
Sbjct  151   QPYVTLYHWDLPQALEDKYTGWLDRQIVDDFAAYAETCFREFGDRVKRWITLNEPHTVAI  210

Query  1034  LGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKI  1213
              GYD G+ APG CS+  HL C  GNS TEPY VAHHL+LAHAAA D+YRRKY+A Q G++
Sbjct  211   QGYDAGLQAPGRCSVLLHLYCKAGNSGTEPYTVAHHLILAHAAAADVYRRKYKATQNGQL  270

Query  1214  TIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAA  1393
              I  +  W+EP++N+  DI+A +RA +F LGWF +P   G+YP ++ +RV +RLP+F+A 
Sbjct  271   GIAFDVMWFEPMSNTTLDIEAAKRAQEFQLGWFADPFFFGDYPATMRARVAERLPRFTAD  330

Query  1394  ESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANA  1573
             E+AL++G+ D++G+NHYTT+Y    +TNI+G  L+DTL D+GT +LPFK   PIG+RAN+
Sbjct  331   EAALVQGALDFVGINHYTTYYTRHNNTNIIGRLLNDTLADTGTVSLPFKNGKPIGDRANS  390

Query  1574  VWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYL  1735
             +WLYIVPRGMR+LMNY+K++Y +P V+ITENGMDD+        D L D KRI+YH DYL
Sbjct  391   IWLYIVPRGMRSLMNYVKERYNSPPVYITENGMDDSNNPFISIKDALKDSKRIKYHNDYL  450

Query  1736  KSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKN  1915
              +L A+IKEDGC+V+GYFAWSL+DNWEW  GFSSRFGLY+VDY DNL+R PK S +WFK 
Sbjct  451   TNLAASIKEDGCDVRGYFAWSLLDNWEWAAGFSSRFGLYFVDYKDNLKRYPKNSVQWFKA  510

Query  1916  FLAS  1927
              L S
Sbjct  511   LLTS  514



>emb|CBI27264.3| unnamed protein product [Vitis vinifera]
Length=565

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/486 (67%), Positives = 390/486 (80%), Gaps = 7/486 (1%)
 Frame = +2

Query  491   LQICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNAD  670
             L+ C ++NI+R SFP+GFVFGTAS+A+Q+EGAVKEDGRG T+WD F+HT GK+ DFSNAD
Sbjct  79    LRQCLSENITRGSFPKGFVFGTASSAFQYEGAVKEDGRGLTVWDNFSHTAGKILDFSNAD  138

Query  671   VAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANG  850
             VAVD YH Y +DI+LMK+MGMDAYRFSI+WSRIFP+GTGK+NQAGVDHYN LI+AL+A G
Sbjct  139   VAVDHYHLYPDDIQLMKNMGMDAYRFSISWSRIFPDGTGKINQAGVDHYNRLINALIAKG  198

Query  851   IEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSIT  1030
             IEPYVTLYH+DLPQ LE++YNGWL+ Q+IKDFA YAETCF  FGDRVK W+T NEP + T
Sbjct  199   IEPYVTLYHWDLPQTLEDKYNGWLDPQIIKDFALYAETCFQQFGDRVKHWITFNEPHTFT  258

Query  1031  VLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGK  1210
             V GYD+G+ APG CSI   L C  GNSATEPY VAHH+LL+HA   DIY +KY+AKQ G 
Sbjct  259   VQGYDIGLQAPGRCSIPLFLFCRAGNSATEPYIVAHHVLLSHATVADIYHKKYKAKQQGS  318

Query  1211  ITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSA  1390
             + +  +  W+EP TNS  DI+A QRA DF LGWF++P+M G+YP+S+   VG RLP F+ 
Sbjct  319   LGVAFDVIWFEPKTNSTEDIEATQRAQDFQLGWFIDPLMYGDYPKSLKDGVGSRLPNFTR  378

Query  1391  AESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPF-KGLMPIGERA  1567
              ESALLKGS D++G+NHYTT+YA     N+ G+ L+D+L DS   TLPF K   PIG+RA
Sbjct  379   DESALLKGSLDFVGINHYTTFYAEYDANNLTGMLLNDSLADSRAITLPFSKDGQPIGDRA  438

Query  1568  NAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRD  1729
             N++WLYIVPRGMR+LMNYIK KYGNP + ITENGMDDA        D L D KRI+YH D
Sbjct  439   NSIWLYIVPRGMRSLMNYIKQKYGNPPIIITENGMDDANNPFIPIKDALKDEKRIKYHND  498

Query  1730  YLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWF  1909
             YL+SLLA+IKEDGCNVKGYF WSL+DNWEW  GF+SRFGL++VDY D L+R PK S +WF
Sbjct  499   YLQSLLASIKEDGCNVKGYFVWSLLDNWEWGAGFTSRFGLFFVDYKDKLKRYPKNSVQWF  558

Query  1910  KNFLAS  1927
             KNFL S
Sbjct  559   KNFLNS  564



>ref|XP_004985215.1| PREDICTED: beta-glucosidase 6-like [Setaria italica]
Length=512

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/488 (65%), Positives = 388/488 (80%), Gaps = 9/488 (2%)
 Frame = +2

Query  491   LQICGAQN---ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFS  661
             LQ C AQ    ++R SFPEGFVFGTAS+AYQ+EGAVKEDGRG T WDTFAHT GKV DFS
Sbjct  24    LQGCIAQGEGALTRGSFPEGFVFGTASSAYQYEGAVKEDGRGKTTWDTFAHTFGKVADFS  83

Query  662   NADVAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALL  841
             NADVA+D YHR+ EDI+LM DMGMDAYRFSIAWSRI PNG G++NQAG+DHYN LIDALL
Sbjct  84    NADVAIDHYHRFEEDIQLMADMGMDAYRFSIAWSRILPNGIGQVNQAGIDHYNKLIDALL  143

Query  842   ANGIEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPR  1021
             A GIEPYVTLYH+DLPQALE+RYNGWL+RQ+I DFAAYAE CF  FGDRVK W+T+NEP 
Sbjct  144   AKGIEPYVTLYHWDLPQALEDRYNGWLDRQIINDFAAYAEICFKAFGDRVKHWITLNEPH  203

Query  1022  SITVLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQ  1201
             ++ + GYD G+ APG CS+  HL C  GNS TEPY VAH+ +LAHA   DIYRR Y+A Q
Sbjct  204   TVAIQGYDDGLQAPGRCSLLLHLYCKAGNSGTEPYIVAHNFILAHATVSDIYRRNYKATQ  263

Query  1202  GGKITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPK  1381
              G++ I  +  W+EP+TN+  +I+A +R  +F LGWF +P   G+YP S+ SRVGDRLPK
Sbjct  264   NGELGIAFDVMWFEPMTNTTINIEAAKRGQEFQLGWFADPFFFGDYPASMRSRVGDRLPK  323

Query  1382  FSAAESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGE  1561
             F+  E+AL+KG+ D++G+NHYTT+Y     TNI+G  LH+TL D+GT +LPF+    IG+
Sbjct  324   FTTDEAALVKGALDFVGINHYTTYYTRHNSTNIIGRLLHNTLADTGTISLPFRNGKAIGD  383

Query  1562  RANAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYH  1723
             RAN++WLYIVP GMR+LMNY+K++Y +P ++ITENGMDD  +      D L D KRI+YH
Sbjct  384   RANSIWLYIVPSGMRSLMNYVKERYNSPPIYITENGMDDGNSPFTSIKDALKDSKRIKYH  443

Query  1724  RDYLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAK  1903
              DYL +L A+IKEDGC+V+GYFAWSL+DNWEWT G+SSRFGLY+VDY DNL+R PK S +
Sbjct  444   NDYLTNLAASIKEDGCDVRGYFAWSLLDNWEWTAGYSSRFGLYFVDYKDNLKRYPKSSVQ  503

Query  1904  WFKNFLAS  1927
             WFK  L+S
Sbjct  504   WFKTLLSS  511



>gb|EEC74750.1| hypothetical protein OsI_10506 [Oryza sativa Indica Group]
Length=521

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/489 (65%), Positives = 396/489 (81%), Gaps = 10/489 (2%)
 Frame = +2

Query  491   LQICGAQN----ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDF  658
             L+ C AQ     ++R SFPEGFVFGTASAAYQ+EGAVKEDGRG TIWDTFAHT GK+TDF
Sbjct  33    LRGCIAQQSGGGLTRGSFPEGFVFGTASAAYQYEGAVKEDGRGQTIWDTFAHTFGKITDF  92

Query  659   SNADVAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDAL  838
             SNADVAVDQYHR+ EDI+LM DMGMDAYRFSIAWSRI+PNG G++NQAG+DHYN LIDAL
Sbjct  93    SNADVAVDQYHRFEEDIQLMADMGMDAYRFSIAWSRIYPNGVGQVNQAGIDHYNKLIDAL  152

Query  839   LANGIEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEP  1018
             LA GI+PYVTLYH+DLPQALE++Y GWL+RQ++ DFAAYAETCF  FGDRVK W+T+NEP
Sbjct  153   LAKGIQPYVTLYHWDLPQALEDKYKGWLDRQIVDDFAAYAETCFREFGDRVKHWITLNEP  212

Query  1019  RSITVLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAK  1198
              ++ + GYD G+ APG CS+  HL C  GNS TEPY VAHH +LAHAAA  IYR KY+A 
Sbjct  213   HTVAIQGYDAGLQAPGRCSVLLHLYCKAGNSGTEPYVVAHHFILAHAAAASIYRTKYKAT  272

Query  1199  QGGKITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLP  1378
             Q G++ I  +  W+EP++N+  DI+A +RA +F LGWF +P   G+YP ++ +RVG+RLP
Sbjct  273   QNGQLGIAFDVMWFEPMSNTTIDIEAAKRAQEFQLGWFADPFFFGDYPATMRARVGERLP  332

Query  1379  KFSAAESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIG  1558
             +F+A E+A++KG+ D++GVNHYTT+Y    +TNI+G  L++TL D+GT +LPFK   PIG
Sbjct  333   RFTADEAAVVKGALDFVGVNHYTTYYTRHNNTNIIGTLLNNTLADTGTVSLPFKNGKPIG  392

Query  1559  ERANAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRY  1720
             +RAN++WLYIVPRGMR+LMNY+K++Y +P V+ITENGMDD+        D L D KRI+Y
Sbjct  393   DRANSIWLYIVPRGMRSLMNYVKERYNSPPVYITENGMDDSNNPFISIKDALKDSKRIKY  452

Query  1721  HRDYLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESA  1900
             H DYL +L A+IKEDGC+V+GYFAWSL+DNWEW  G+SSRFGLY+VDY DNL+R PK S 
Sbjct  453   HNDYLTNLAASIKEDGCDVRGYFAWSLLDNWEWAAGYSSRFGLYFVDYKDNLKRYPKNSV  512

Query  1901  KWFKNFLAS  1927
             +WFK  L +
Sbjct  513   QWFKALLKT  521



>ref|XP_011012221.1| PREDICTED: beta-glucosidase 40 [Populus euphratica]
Length=508

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/482 (66%), Positives = 394/482 (82%), Gaps = 10/482 (2%)
 Frame = +2

Query  512   NISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYH  691
              I+RASFPEGFVFGTAS+A+Q+EGAVK DGRG ++WD F+HT GK+ DFSNADVAVDQYH
Sbjct  26    QINRASFPEGFVFGTASSAFQYEGAVKADGRGPSVWDAFSHTFGKIIDFSNADVAVDQYH  85

Query  692   RYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTL  871
              + EDI+LMKDMGMDAYRFSI+WSRI+PNGTGK+NQAGVDHYN  I+ALLA GIEPYVTL
Sbjct  86    LFDEDIKLMKDMGMDAYRFSISWSRIYPNGTGKINQAGVDHYNKFINALLAQGIEPYVTL  145

Query  872   YHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLG  1051
             YH+DLPQAL++RYNGWL+ Q+IKDFA +AETCF I+GDRVK W+T NEP ++ + GYD+G
Sbjct  146   YHWDLPQALQDRYNGWLSPQIIKDFATFAETCFEIYGDRVKHWITFNEPHTVAIQGYDVG  205

Query  1052  VHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVES  1231
             + APG CSIF H+ C  GNSATEPY VAH++LL+H  A DIYR+KY+AKQ G + I ++ 
Sbjct  206   LQAPGRCSIFLHIFCRAGNSATEPYIVAHNILLSHGTAADIYRKKYKAKQRGSLGISLDV  265

Query  1232  FWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLK  1411
              W+EP TN+  D +A QRA DF LGWF+EP++ G YP ++ +RVGDRLP F+  + AL+K
Sbjct  266   IWFEPATNTTNDTEAAQRAQDFQLGWFIEPLILGNYPITMRNRVGDRLPNFTENDVALVK  325

Query  1412  GSYDYLGVNHYTTWYASSTDT---NIMGLFLHDTLTDSGTFTLPF-KGLMPIGERANAVW  1579
             GS+D++G+NHYTT+YA S D+   +++G  L+D+L DSG  TLPF + L PIG+RA+++W
Sbjct  326   GSFDFVGINHYTTFYARSNDSLFGDLIGKVLNDSLADSGAITLPFGENLKPIGDRASSIW  385

Query  1580  LYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLKS  1741
             LYIVPRGMR+LMNYI+ KYGNP V ITENGMDD         D L D KRI+YH+DYL S
Sbjct  386   LYIVPRGMRSLMNYIRQKYGNPPVIITENGMDDPNNALTPIKDALKDEKRIKYHKDYLAS  445

Query  1742  LLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             LLA+IKEDGCNVKGYF WSL+DNWEW  G++SRFGLY+VDY D L+R PK+S +WFK FL
Sbjct  446   LLASIKEDGCNVKGYFVWSLLDNWEWAAGYTSRFGLYFVDYKDKLKRYPKDSVQWFKKFL  505

Query  1922  AS  1927
              S
Sbjct  506   TS  507



>ref|NP_001049358.1| Os03g0212800 [Oryza sativa Japonica Group]
 sp|Q8L7J2.1|BGL06_ORYSJ RecName: Full=Beta-glucosidase 6; Short=Os3bglu6; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|AAN01354.1| beta-glucosidase [Oryza sativa Japonica Group]
 gb|ABF94615.1| Glycosyl hydrolase family 1 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11272.1| Os03g0212800 [Oryza sativa Japonica Group]
 dbj|BAG99682.1| unnamed protein product [Oryza sativa Japonica Group]
Length=521

 Score =   678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/489 (65%), Positives = 396/489 (81%), Gaps = 10/489 (2%)
 Frame = +2

Query  491   LQICGAQN----ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDF  658
             L+ C AQ     ++R SFPEGFVFGTASAAYQ+EGAVKEDGRG TIWDTFAHT GK+TDF
Sbjct  33    LRGCIAQQSGGGLTRGSFPEGFVFGTASAAYQYEGAVKEDGRGQTIWDTFAHTFGKITDF  92

Query  659   SNADVAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDAL  838
             SNADVAVDQYHR+ EDI+LM DMGMDAYRFSIAWSRI+PNG G++NQAG+DHYN LIDAL
Sbjct  93    SNADVAVDQYHRFEEDIQLMADMGMDAYRFSIAWSRIYPNGVGQVNQAGIDHYNKLIDAL  152

Query  839   LANGIEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEP  1018
             LA GI+PYVTLYH+DLPQALE++Y GWL+RQ++ DFAAYAETCF  FGDRVK W+T+NEP
Sbjct  153   LAKGIQPYVTLYHWDLPQALEDKYKGWLDRQIVDDFAAYAETCFREFGDRVKHWITLNEP  212

Query  1019  RSITVLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAK  1198
              ++ + GYD G+ APG CS+  HL C  GNS TEPY VAHH +LAHAAA  IYR KY+A 
Sbjct  213   HTVAIQGYDAGLQAPGRCSVLLHLYCKAGNSGTEPYVVAHHFILAHAAAASIYRTKYKAT  272

Query  1199  QGGKITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLP  1378
             Q G++ I  +  W+EP++N+  DI+A +RA +F LGWF +P   G+YP ++ +RVG+RLP
Sbjct  273   QNGQLGIAFDVMWFEPMSNTTIDIEAAKRAQEFQLGWFADPFFFGDYPATMRARVGERLP  332

Query  1379  KFSAAESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIG  1558
             +F+A E+A++KG+ D++G+NHYTT+Y    +TNI+G  L++TL D+GT +LPFK   PIG
Sbjct  333   RFTADEAAVVKGALDFVGINHYTTYYTRHNNTNIIGTLLNNTLADTGTVSLPFKNGKPIG  392

Query  1559  ERANAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRY  1720
             +RAN++WLYIVPRGMR+LMNY+K++Y +P V+ITENGMDD+        D L D KRI+Y
Sbjct  393   DRANSIWLYIVPRGMRSLMNYVKERYNSPPVYITENGMDDSNNPFISIKDALKDSKRIKY  452

Query  1721  HRDYLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESA  1900
             H DYL +L A+IKEDGC+V+GYFAWSL+DNWEW  G+SSRFGLY+VDY DNL+R PK S 
Sbjct  453   HNDYLTNLAASIKEDGCDVRGYFAWSLLDNWEWAAGYSSRFGLYFVDYKDNLKRYPKNSV  512

Query  1901  KWFKNFLAS  1927
             +WFK  L +
Sbjct  513   QWFKALLKT  521



>ref|XP_002465651.1| hypothetical protein SORBIDRAFT_01g043030 [Sorghum bicolor]
 gb|EER92649.1| hypothetical protein SORBIDRAFT_01g043030 [Sorghum bicolor]
Length=508

 Score =   677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/486 (64%), Positives = 393/486 (81%), Gaps = 10/486 (2%)
 Frame = +2

Query  500   CGAQN---ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNAD  670
             C AQ    ++R SFP+GFVFGTA+AAYQ+EGAV  DGRG TIWDTFAHT GK++DFSNAD
Sbjct  22    CTAQGGGGLTRGSFPKGFVFGTAAAAYQYEGAVTTDGRGRTIWDTFAHTFGKISDFSNAD  81

Query  671   VAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANG  850
             VAVDQYHR+ ED++LM DMGMDAYRFSIAWSRI PNGTG++NQAG+DHYN +I+ALL+ G
Sbjct  82    VAVDQYHRFEEDVQLMADMGMDAYRFSIAWSRILPNGTGQVNQAGIDHYNKVINALLSKG  141

Query  851   IEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSIT  1030
             I+PYVTLYH+DLPQALE+RYNGWL+RQ++ DFAAYAETCF  FGDRVK W+T+NEP ++ 
Sbjct  142   IQPYVTLYHWDLPQALEDRYNGWLDRQIVNDFAAYAETCFKAFGDRVKHWITLNEPHTVA  201

Query  1031  VLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGK  1210
             + GYD G+HAPG CS+  HL C +GNS TEPY VAH+ +LAHA   DIYRRKY+A Q G+
Sbjct  202   IQGYDAGLHAPGRCSVLLHLYCKSGNSGTEPYIVAHNFILAHATVSDIYRRKYKAAQNGE  261

Query  1211  ITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSA  1390
             + I  +  WYEP+TNS  DI+A +RA +F LGWF EP   G+YP ++ +RVG+RLPKF+A
Sbjct  262   LGIAFDVIWYEPMTNSTIDIEATKRAQEFQLGWFAEPFFFGDYPATMRTRVGERLPKFTA  321

Query  1391  AESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPF-KGLMPIGERA  1567
              E+ L+KG+ D++G+NHYTT+Y    +TNI+G  L+DTL D+GT +LPF K   PIG+RA
Sbjct  322   DEATLVKGALDFMGINHYTTFYTRHNETNIIGRLLNDTLADTGTISLPFDKNGKPIGDRA  381

Query  1568  NAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRD  1729
             N++WLYIVP G+R LMNY+K++Y +P V+ITENGMDD  +      D L D KRI+YH D
Sbjct  382   NSIWLYIVPSGIRKLMNYVKERYNSPTVYITENGMDDGNSPFTSIQDALKDKKRIKYHND  441

Query  1730  YLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWF  1909
             YL ++ A+IKEDGC+V+GYFAWSL+DNWEW  G+SSRFGLY+VDY DNL+R PK S +WF
Sbjct  442   YLSNVAASIKEDGCDVRGYFAWSLLDNWEWAAGYSSRFGLYFVDYKDNLKRYPKNSVQWF  501

Query  1910  KNFLAS  1927
             K  L+S
Sbjct  502   KTLLSS  507



>ref|XP_009356385.1| PREDICTED: beta-glucosidase 40 [Pyrus x bretschneideri]
Length=511

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/487 (67%), Positives = 388/487 (80%), Gaps = 7/487 (1%)
 Frame = +2

Query  488   GLQICGAQ-NISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSN  664
             G   C +  +I+R SFP+GFVFGTAS+A+Q+EGAVKEDGRG +IWDTF+HT GK+ D SN
Sbjct  20    GFSTCLSDLDINRGSFPKGFVFGTASSAFQYEGAVKEDGRGPSIWDTFSHTFGKIADSSN  79

Query  665   ADVAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLA  844
             ADVAVD+YHRY ED++ MKDMGMDAYRFSI+W+RIFPNGTG +NQAGVD+YN LIDALLA
Sbjct  80    ADVAVDEYHRYKEDVQRMKDMGMDAYRFSISWTRIFPNGTGHINQAGVDYYNRLIDALLA  139

Query  845   NGIEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRS  1024
              GIEPYVTLYH+DLPQALE++Y GWLN QVIKDFA YAE CF  FGDRVK W+T NEP +
Sbjct  140   KGIEPYVTLYHWDLPQALEDKYRGWLNPQVIKDFATYAEACFQNFGDRVKHWITFNEPHT  199

Query  1025  ITVLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQG  1204
              ++ GYD+G+ APG CSI   L C  GNSATEPY VAH+++L+H  A DIYRRKY++KQ 
Sbjct  200   FSIQGYDVGLEAPGRCSIPLLLFCRAGNSATEPYIVAHNVILSHGTAADIYRRKYKSKQR  259

Query  1205  GKITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKF  1384
             G +    +  WYE  TNS AD+ A + A DF LGWFL+P M G+YP S+ SRVG RLP F
Sbjct  260   GSVGASFDVIWYESATNSTADVIATKIAQDFQLGWFLDPFMFGDYPSSMRSRVGSRLPTF  319

Query  1385  SAAESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGER  1564
             S +ESAL+KGS D++G+NHYTT+Y S+  T+I+G  L+D+L DSG  TLPFK   PIG+R
Sbjct  320   SKSESALIKGSLDFVGINHYTTFYGSNDTTDIIGHLLNDSLADSGAITLPFKDGKPIGDR  379

Query  1565  ANAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHR  1726
             AN++WLYIVP GMR LMNYIK KYGNPLV ITENGMDD  +      D L D KRI+YH 
Sbjct  380   ANSIWLYIVPEGMRKLMNYIKKKYGNPLVIITENGMDDPNSPFISLKDALKDTKRIKYHH  439

Query  1727  DYLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKW  1906
             DYL +LLA+IKEDGCNVKGYFAWSL+DNWEW  G++SRFGLY+VDY D L+R PK+S +W
Sbjct  440   DYLTNLLASIKEDGCNVKGYFAWSLLDNWEWAAGYTSRFGLYFVDYKDQLKRYPKDSVQW  499

Query  1907  FKNFLAS  1927
             F NFL S
Sbjct  500   FTNFLNS  506



>ref|XP_008221519.1| PREDICTED: beta-glucosidase 40-like [Prunus mume]
Length=519

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/483 (66%), Positives = 387/483 (80%), Gaps = 9/483 (2%)
 Frame = +2

Query  506   AQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHT---PGKVTDFSNADVA  676
             + +I+RASFP+ FVFGTAS+A+Q+EGAVKEDGRG + WD F+HT    GK++DFSNADVA
Sbjct  36    SDDINRASFPKRFVFGTASSAFQYEGAVKEDGRGPSTWDIFSHTFGSAGKISDFSNADVA  95

Query  677   VDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIE  856
             VDQYH Y  D++LMKDMGMDAYRFSI+WSRIFPNGTG++NQAGVDHYN LI+ALLA GIE
Sbjct  96    VDQYHLYNGDVQLMKDMGMDAYRFSISWSRIFPNGTGQINQAGVDHYNKLINALLAKGIE  155

Query  857   PYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVL  1036
             PYVTLYH+DLPQALE++YNGWLN Q+IKDFA YA+TCF  FGDRVK W+T NEP + ++ 
Sbjct  156   PYVTLYHWDLPQALEDKYNGWLNPQIIKDFATYADTCFQKFGDRVKHWITFNEPHTFSIQ  215

Query  1037  GYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKIT  1216
             GYD+G+ APG CSI  HL C  GNSATEPY V H+++L+HA   DIYR KY++KQ G + 
Sbjct  216   GYDVGLEAPGRCSILLHLFCRAGNSATEPYIVGHNVILSHATVADIYRSKYKSKQHGSVG  275

Query  1217  IVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAE  1396
                +  WYEP TNS AD++A +RA DF LGWFLEP + G+YP S+ SRVG RLP FS +E
Sbjct  276   ASFDVIWYEPETNSTADVEAAKRAQDFQLGWFLEPFIFGDYPSSMRSRVGSRLPTFSKSE  335

Query  1397  SALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAV  1576
             +AL+KGS D++G+NHYTT+YA +  T+ +G  L+D+L DSG  TLPFK   PIG+RAN++
Sbjct  336   AALIKGSLDFVGINHYTTFYARNDTTDFIGGLLNDSLADSGAITLPFKNGKPIGDRANSI  395

Query  1577  WLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLK  1738
             WLYIVP GMR LMNYIK KYGNP V ITENGMDD  +      D L D KRI+YH  YL 
Sbjct  396   WLYIVPEGMRKLMNYIKHKYGNPPVIITENGMDDPNSPFISLKDALKDEKRIKYHHGYLT  455

Query  1739  SLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNF  1918
             +LLA+IKEDGCNVKGYFAWSL+DNWEW  GFSSRFGLY+VDY D L+R PK+S +WF NF
Sbjct  456   NLLASIKEDGCNVKGYFAWSLLDNWEWAAGFSSRFGLYFVDYKDKLKRYPKDSVQWFTNF  515

Query  1919  LAS  1927
             L S
Sbjct  516   LTS  518



>ref|NP_001268161.1| beta-glucosidase precursor [Vitis vinifera]
 gb|ADD17684.1| beta-glucosidase [Vitis vinifera]
Length=505

 Score =   677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/486 (66%), Positives = 388/486 (80%), Gaps = 7/486 (1%)
 Frame = +2

Query  491   LQICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNAD  670
             L+ C ++NI+R SFP+GFVFGTAS+A+Q+EGAVKEDGRG T+WD F+HT GK+ DFSNAD
Sbjct  19    LRQCLSENITRGSFPKGFVFGTASSAFQYEGAVKEDGRGLTVWDNFSHTAGKILDFSNAD  78

Query  671   VAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANG  850
             VAVD YH Y +DI+LMK+MGMDAYRFSI+WSRIFP+GTGK+NQAGVDHYN LI+AL+A G
Sbjct  79    VAVDHYHLYPDDIQLMKNMGMDAYRFSISWSRIFPDGTGKINQAGVDHYNRLINALIAKG  138

Query  851   IEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSIT  1030
             IEPY TLYH+DLPQ LE++YNGWL+ Q+IKDFA YAETCF  FGDRVK W+T NEP + T
Sbjct  139   IEPYATLYHWDLPQTLEDKYNGWLDPQIIKDFALYAETCFQQFGDRVKHWITFNEPHTFT  198

Query  1031  VLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGK  1210
             V GYD+G+ APG CSI   L C  GNSATEPY VAHH+LL+HA   DIY +KY+AKQ G 
Sbjct  199   VQGYDIGLQAPGRCSIPLFLFCRAGNSATEPYIVAHHVLLSHATVADIYHKKYKAKQQGS  258

Query  1211  ITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSA  1390
             + +  +  W+EP TNS  DI+A QRA DF LGWF++P+M G+YP+S+   VG RLP F+ 
Sbjct  259   LGVAFDVIWFEPKTNSTEDIEATQRAQDFQLGWFIDPLMYGDYPKSLKDGVGSRLPNFTR  318

Query  1391  AESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPF-KGLMPIGERA  1567
              ESALLKGS D++G+NHYTT+YA     N+ G+ L+D+L DS   TLPF K   PIG+RA
Sbjct  319   DESALLKGSLDFVGINHYTTFYAEYDANNLTGMLLNDSLADSRAITLPFSKDGQPIGDRA  378

Query  1568  NAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRD  1729
             N++WLYIVPRGMR LMNYIK KYGNP + ITENGMDDA        D L D KRI+YH D
Sbjct  379   NSIWLYIVPRGMRRLMNYIKQKYGNPPIIITENGMDDANNPFIPIKDALKDEKRIKYHND  438

Query  1730  YLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWF  1909
             YL+SLLA+IKEDGCNVKGYF WSL+DNWEW  GF+SRFGL++VDY D L+R PK S +WF
Sbjct  439   YLQSLLASIKEDGCNVKGYFVWSLLDNWEWGAGFTSRFGLFFVDYKDKLKRYPKNSVQWF  498

Query  1910  KNFLAS  1927
             KNFL S
Sbjct  499   KNFLNS  504



>pdb|3GNO|A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
 pdb|3GNP|A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-Glucosidase 
With Octyl-Beta- D-Thio-Glucoside
 pdb|3GNR|A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase 
With Covalently Bound 2-deoxy-2-fluoroglucoside To The Catalytic 
Nucleophile E396
Length=488

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/477 (65%), Positives = 391/477 (82%), Gaps = 6/477 (1%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             ++R SFPEGFVFGTASAAYQ+EGAVKEDGRG TIWDTFAHT GK+TDFSNADVAVDQYHR
Sbjct  12    LTRGSFPEGFVFGTASAAYQYEGAVKEDGRGQTIWDTFAHTFGKITDFSNADVAVDQYHR  71

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             + EDI+LM DMGMDAYRFSIAWSRI+PNG G++NQAG+DHYN LIDALLA GI+PYVTLY
Sbjct  72    FEEDIQLMADMGMDAYRFSIAWSRIYPNGVGQVNQAGIDHYNKLIDALLAKGIQPYVTLY  131

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             H+DLPQALE++Y GWL+RQ++ DFAAYAETCF  FGDRVK W+T+NEP ++ + GYD G+
Sbjct  132   HWDLPQALEDKYKGWLDRQIVDDFAAYAETCFREFGDRVKHWITLNEPHTVAIQGYDAGL  191

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
              APG CS+  HL C  GNS TEPY VAHH +LAHAAA  IYR KY+A Q G++ I  +  
Sbjct  192   QAPGRCSVLLHLYCKAGNSGTEPYVVAHHFILAHAAAASIYRTKYKATQNGQLGIAFDVM  251

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             W+EP++N+  DI+A +RA +F LGWF +P   G+YP ++ +RVG+RLP+F+A E+A++KG
Sbjct  252   WFEPMSNTTIDIEAAKRAQEFQLGWFADPFFFGDYPATMRARVGERLPRFTADEAAVVKG  311

Query  1415  SYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVP  1594
             + D++G+NHYTT+Y    +TNI+G  L++TL D+GT +LPFK   PIG+RAN++WLYIVP
Sbjct  312   ALDFVGINHYTTYYTRHNNTNIIGTLLNNTLADTGTVSLPFKNGKPIGDRANSIWLYIVP  371

Query  1595  RGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLKSLLAAI  1756
             RGMR+LMNY+K++Y +P V+ITENGMDD+        D L D KRI+YH DYL +L A+I
Sbjct  372   RGMRSLMNYVKERYNSPPVYITENGMDDSNNPFISIKDALKDSKRIKYHNDYLTNLAASI  431

Query  1757  KEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
             KEDGC+V+GYFAWSL+DNWEW  G+SSRFGLY+VDY DNL+R PK S +WFK  L +
Sbjct  432   KEDGCDVRGYFAWSLLDNWEWAAGYSSRFGLYFVDYKDNLKRYPKNSVQWFKALLKT  488



>gb|EEE58575.1| hypothetical protein OsJ_09895 [Oryza sativa Japonica Group]
Length=521

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/489 (64%), Positives = 396/489 (81%), Gaps = 10/489 (2%)
 Frame = +2

Query  491   LQICGAQN----ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDF  658
             L+ C AQ     ++R SFPEGFVFGTASAAYQ+EGAVKEDGRG TIWDTFAHT GK+TDF
Sbjct  33    LRGCIAQQSGGGLTRGSFPEGFVFGTASAAYQYEGAVKEDGRGQTIWDTFAHTFGKITDF  92

Query  659   SNADVAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDAL  838
             SNADVAVDQYHR+ EDI+LM DMGMDAYRFSIAWSRI+PNG G++NQAG+DHYN LIDAL
Sbjct  93    SNADVAVDQYHRFEEDIQLMADMGMDAYRFSIAWSRIYPNGVGQVNQAGIDHYNKLIDAL  152

Query  839   LANGIEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEP  1018
             LA GI+PYVTLYH+DLPQALE++Y GWL+RQ++ DFAAYAETCF  FGDRVK W+T+NEP
Sbjct  153   LAKGIQPYVTLYHWDLPQALEDKYKGWLDRQIVDDFAAYAETCFREFGDRVKHWITLNEP  212

Query  1019  RSITVLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAK  1198
              ++ + GYD G+ APG CS+  HL C  GNS TEPY VAHH +LAHAAA  IYR KY+A 
Sbjct  213   HTVAIQGYDAGLQAPGRCSVLLHLYCKAGNSGTEPYVVAHHFILAHAAAASIYRTKYKAT  272

Query  1199  QGGKITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLP  1378
             Q G++ I  +  W+EP++N+  DI+A +RA +F LGWF +P   G+YP ++ +R+G+RLP
Sbjct  273   QNGQLGIAFDVMWFEPMSNTTIDIEAAKRAQEFQLGWFADPFFFGDYPATMRARLGERLP  332

Query  1379  KFSAAESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIG  1558
             +F+A E+A++KG+ D++G+NHYTT+Y    +TNI+G  L++TL D+GT +LPFK   PIG
Sbjct  333   RFTADEAAVVKGALDFVGINHYTTYYTRHNNTNIIGTLLNNTLADTGTVSLPFKNGKPIG  392

Query  1559  ERANAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRY  1720
             +RAN++WLYIVPRGMR+LMNY+K++Y +P V+ITENGMDD+        D L D KRI+Y
Sbjct  393   DRANSIWLYIVPRGMRSLMNYVKERYNSPPVYITENGMDDSNNPFISIKDALKDSKRIKY  452

Query  1721  HRDYLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESA  1900
             H DYL +L A+IKEDGC+V+GYFAWSL+DNWEW  G+SSRFGLY+VDY DNL+R PK S 
Sbjct  453   HNDYLTNLAASIKEDGCDVRGYFAWSLLDNWEWAAGYSSRFGLYFVDYKDNLKRYPKNSV  512

Query  1901  KWFKNFLAS  1927
             +WFK  L +
Sbjct  513   QWFKALLKT  521



>ref|XP_010936327.1| PREDICTED: beta-glucosidase 6 isoform X2 [Elaeis guineensis]
Length=504

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/487 (64%), Positives = 390/487 (80%), Gaps = 8/487 (2%)
 Frame = +2

Query  491   LQICGAQN--ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSN  664
             ++ C + N  +SR SFPEGF+FGTAS+AYQ+EGAVKE GRG T+WDTFAH+ GKV DFSN
Sbjct  17    IKRCSSDNGGLSRGSFPEGFIFGTASSAYQYEGAVKEAGRGPTVWDTFAHSFGKVIDFSN  76

Query  665   ADVAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLA  844
             ADVAVDQYHR++ED++LM DMGMDAYRFSIAWSRIFPNGTG++NQAG+DHYN LI+ALLA
Sbjct  77    ADVAVDQYHRFVEDVQLMSDMGMDAYRFSIAWSRIFPNGTGEVNQAGIDHYNKLINALLA  136

Query  845   NGIEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRS  1024
              GIEPYVTLYH+DLPQAL+++YNGWL+RQ+IKD+A YAETCF  FGDRV  W+T NEP +
Sbjct  137   KGIEPYVTLYHWDLPQALQDKYNGWLDRQIIKDYANYAETCFREFGDRVTHWITFNEPHT  196

Query  1025  ITVLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQG  1204
               + GYD+G+ APG CSI   L C  GNSATEPY V H++LL+HA   DIYRRKY+A Q 
Sbjct  197   FAIQGYDVGLQAPGRCSIILRLFCRAGNSATEPYIVGHNVLLSHATVADIYRRKYKATQH  256

Query  1205  GKITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKF  1384
             G + I  +  W+ P+TNS  DIDA QRA DF  GWF++P+  G+YP S+ +RVG+RLPKF
Sbjct  257   GTVGIAFDVMWFIPMTNSSEDIDATQRAQDFQFGWFMDPLFFGDYPSSMRTRVGNRLPKF  316

Query  1385  SAAESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGER  1564
             S AE+AL+KGS D++G+NHYTT+Y+    +NI+ + L+DTL DSG  +LPFK   PIG++
Sbjct  317   STAEAALVKGSLDFVGINHYTTYYSKHNSSNIINILLNDTLADSGAISLPFKYGKPIGDK  376

Query  1565  ANAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAK------TDGLNDIKRIRYHR  1726
             A+++WLYIVP+G R+LMNYIK KYGNP V ITENGMDD         D L D KRI+YH 
Sbjct  377   ASSIWLYIVPQGFRSLMNYIKQKYGNPPVIITENGMDDPNDPFISIKDALKDDKRIKYHH  436

Query  1727  DYLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKW  1906
             DYL +L AAI++DGC+V+GYF WSL+DNWEW  G++SRFGLY+VDY DNL+R PK S +W
Sbjct  437   DYLSNLSAAIRKDGCDVRGYFVWSLLDNWEWAAGYTSRFGLYFVDYKDNLKRYPKNSVQW  496

Query  1907  FKNFLAS  1927
             F+N L S
Sbjct  497   FQNLLKS  503



>pdb|3WBE|A Chain A, Rice Os3bglu6 Beta-glucosidase E178q Mutant In A Covalent 
Complex With Glc From Ga4ge.
Length=489

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/477 (65%), Positives = 391/477 (82%), Gaps = 6/477 (1%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             ++R SFPEGFVFGTASAAYQ+EGAVKEDGRG TIWDTFAHT GK+TDFSNADVAVDQYHR
Sbjct  13    LTRGSFPEGFVFGTASAAYQYEGAVKEDGRGQTIWDTFAHTFGKITDFSNADVAVDQYHR  72

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             + EDI+LM DMGMDAYRFSIAWSRI+PNG G++NQAG+DHYN LIDALLA GI+PYVTLY
Sbjct  73    FEEDIQLMADMGMDAYRFSIAWSRIYPNGVGQVNQAGIDHYNKLIDALLAKGIQPYVTLY  132

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             H+DLPQALE++Y GWL+RQ++ DFAAYAETCF  FGDRVK W+T+N+P ++ + GYD G+
Sbjct  133   HWDLPQALEDKYKGWLDRQIVDDFAAYAETCFREFGDRVKHWITLNQPHTVAIQGYDAGL  192

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
              APG CS+  HL C  GNS TEPY VAHH +LAHAAA  IYR KY+A Q G++ I  +  
Sbjct  193   QAPGRCSVLLHLYCKAGNSGTEPYVVAHHFILAHAAAASIYRTKYKATQNGQLGIAFDVM  252

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             W+EP++N+  DI+A +RA +F LGWF +P   G+YP ++ +RVG+RLP+F+A E+A++KG
Sbjct  253   WFEPMSNTTIDIEAAKRAQEFQLGWFADPFFFGDYPATMRARVGERLPRFTADEAAVVKG  312

Query  1415  SYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVP  1594
             + D++G+NHYTT+Y    +TNI+G  L++TL D+GT +LPFK   PIG+RAN++WLYIVP
Sbjct  313   ALDFVGINHYTTYYTRHNNTNIIGTLLNNTLADTGTVSLPFKNGKPIGDRANSIWLYIVP  372

Query  1595  RGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLKSLLAAI  1756
             RGMR+LMNY+K++Y +P V+ITENGMDD+        D L D KRI+YH DYL +L A+I
Sbjct  373   RGMRSLMNYVKERYNSPPVYITENGMDDSNNPFISIKDALKDSKRIKYHNDYLTNLAASI  432

Query  1757  KEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
             KEDGC+V+GYFAWSL+DNWEW  G+SSRFGLY+VDY DNL+R PK S +WFK  L +
Sbjct  433   KEDGCDVRGYFAWSLLDNWEWAAGYSSRFGLYFVDYKDNLKRYPKNSVQWFKALLKT  489



>pdb|3WBA|A Chain A, Rice Os3bglu6 E178q With Covalent Glucosyl Moiety From 
P-nitrophenyl Glucopyranoside.
Length=489

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/477 (65%), Positives = 391/477 (82%), Gaps = 6/477 (1%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             ++R SFPEGFVFGTASAAYQ+EGAVKEDGRG TIWDTFAHT GK+TDFSNADVAVDQYHR
Sbjct  13    LTRGSFPEGFVFGTASAAYQYEGAVKEDGRGQTIWDTFAHTFGKITDFSNADVAVDQYHR  72

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             + EDI+LM DMGMDAYRFSIAWSRI+PNG G++NQAG+DHYN LIDALLA GI+PYVTLY
Sbjct  73    FEEDIQLMADMGMDAYRFSIAWSRIYPNGVGQVNQAGIDHYNKLIDALLAKGIQPYVTLY  132

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             H+DLPQALE++Y GWL+RQ++ DFAAYAETCF  FGDRVK W+T+N+P ++ + GYD G+
Sbjct  133   HWDLPQALEDKYKGWLDRQIVDDFAAYAETCFREFGDRVKHWITLNQPHTVAIQGYDAGL  192

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
              APG CS+  HL C  GNS TEPY VAHH +LAHAAA  IYR KY+A Q G++ I  +  
Sbjct  193   QAPGRCSVLLHLYCKAGNSGTEPYVVAHHFILAHAAAASIYRTKYKATQNGQLGIAFDVM  252

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             W+EP++N+  DI+A +RA +F LGWF +P   G+YP ++ +RVG+RLP+F+A E+A++KG
Sbjct  253   WFEPMSNTTIDIEAAKRAQEFQLGWFADPFFFGDYPATMRARVGERLPRFTADEAAVVKG  312

Query  1415  SYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVP  1594
             + D++G+NHYTT+Y    +TNI+G  L++TL D+GT +LPFK   PIG+RAN++WLYIVP
Sbjct  313   ALDFVGINHYTTYYTRHNNTNIIGTLLNNTLADTGTVSLPFKNGKPIGDRANSIWLYIVP  372

Query  1595  RGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLKSLLAAI  1756
             RGMR+LMNY+K++Y +P V+ITENGMDD+        D L D KRI+YH DYL +L A+I
Sbjct  373   RGMRSLMNYVKERYNSPPVYITENGMDDSNNPFISIKDALKDSKRIKYHNDYLTNLAASI  432

Query  1757  KEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
             KEDGC+V+GYFAWSL+DNWEW  G+SSRFGLY+VDY DNL+R PK S +WFK  L +
Sbjct  433   KEDGCDVRGYFAWSLLDNWEWAAGYSSRFGLYFVDYKDNLKRYPKNSVQWFKALLKT  489



>ref|XP_008658979.1| PREDICTED: uncharacterized protein LOC100502286 isoform X1 [Zea 
mays]
 gb|AFW89227.1| hypothetical protein ZEAMMB73_293984 [Zea mays]
Length=508

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/477 (65%), Positives = 389/477 (82%), Gaps = 6/477 (1%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             ++R SFP+GFVFGTAS+AYQ+EGAVKEDGRG TIWD FAHT GKV D SNADVAVDQYHR
Sbjct  31    LTRGSFPKGFVFGTASSAYQYEGAVKEDGRGKTIWDKFAHTFGKVADLSNADVAVDQYHR  90

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             + EDI+LM DMGMDAYRFSIAWSRI PNGTG++NQAGVDHYN  IDALL+ GIEPYVTLY
Sbjct  91    FEEDIQLMADMGMDAYRFSIAWSRILPNGTGQVNQAGVDHYNRFIDALLSKGIEPYVTLY  150

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             H+DLPQALE+RYNGWL+RQ++ DFA YAETCF  FGDRV+ WVT+NEP ++ V GYD G+
Sbjct  151   HWDLPQALEDRYNGWLDRQIVYDFAEYAETCFEAFGDRVRHWVTLNEPHTVAVQGYDAGL  210

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
              APG CS+  HL C +G+SATEPY VAH+ +LAHA   D+YR+KY+A Q G++ I  +  
Sbjct  211   QAPGRCSLLLHLYCRSGDSATEPYVVAHNFILAHAKVSDVYRKKYKAAQNGELGIAFDVM  270

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             W+EP+TN+ ADI+A +R  +F LGWF +P   G+YP S+ SRVGDRLP+F+AAE+AL+KG
Sbjct  271   WFEPMTNTTADIEAAKRGQEFQLGWFADPFFFGDYPASMRSRVGDRLPRFTAAEAALVKG  330

Query  1415  SYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVP  1594
             + D++G+NHYTT+Y     T+++G  LH+TL D+GT +LPF+    IG+RAN++WLYIVP
Sbjct  331   ALDFVGINHYTTYYTKHNSTDLVGRLLHNTLADTGTISLPFRNGKAIGDRANSIWLYIVP  390

Query  1595  RGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLKSLLAAI  1756
              GMR+LMNY+K++Y +P +++TENGMDD  +      D L D KR++YH DYL +L A+I
Sbjct  391   SGMRSLMNYVKERYNSPPIYVTENGMDDGNSPFTSIKDALKDSKRVKYHNDYLTNLAASI  450

Query  1757  KEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
             K+D C+V+GYFAWSL+DNWEWT G+SSRFGLY+VDY DNL+R PK S +WFKN LAS
Sbjct  451   KDDACDVRGYFAWSLLDNWEWTAGYSSRFGLYFVDYKDNLKRYPKSSVQWFKNLLAS  507



>ref|XP_008389423.1| PREDICTED: beta-glucosidase 40-like [Malus domestica]
Length=511

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/487 (66%), Positives = 387/487 (79%), Gaps = 7/487 (1%)
 Frame = +2

Query  488   GLQIC-GAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSN  664
             G   C    +I+R SFP+GFVFGTAS+A+Q+EGAVKEDGRG +IWDTF+HT GK+ D SN
Sbjct  20    GFPTCLSDSDINRGSFPKGFVFGTASSAFQYEGAVKEDGRGPSIWDTFSHTFGKIADSSN  79

Query  665   ADVAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLA  844
             ADVAVD+YHRY ED++ MKDMGMDAYRFSI+W+RIFPNGTG +NQAGVD+YN LIDALLA
Sbjct  80    ADVAVDEYHRYKEDVQRMKDMGMDAYRFSISWTRIFPNGTGHINQAGVDYYNRLIDALLA  139

Query  845   NGIEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRS  1024
              GIEPYVTLYH+DLPQALE++Y+GWLN QVIKDFA YA+ CF  FGDRVK W+T NEP +
Sbjct  140   KGIEPYVTLYHWDLPQALEDKYSGWLNPQVIKDFATYADACFQNFGDRVKHWITFNEPHT  199

Query  1025  ITVLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQG  1204
              ++ GYD+G+ APG CSI   L C  GNSATEPY VAH+++L+H  A DIYRRKY++KQ 
Sbjct  200   FSIQGYDVGLEAPGRCSIPLFLFCRAGNSATEPYMVAHNVILSHGTAADIYRRKYKSKQR  259

Query  1205  GKITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKF  1384
             G +    +  WYE  TNS AD+ A + A DF LGWFL+P M G+YP S+ SRVG RLP F
Sbjct  260   GSVGASFDVIWYESATNSTADVXATKIAQDFQLGWFLDPFMFGDYPSSMRSRVGSRLPTF  319

Query  1385  SAAESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGER  1564
             S +ESAL+KGS D++G+NHYTT+Y S+   +I+G  L+D+L DSG  TLPFK   PIG+R
Sbjct  320   SKSESALIKGSLDFVGINHYTTFYGSNDTADIIGHLLNDSLADSGAITLPFKDGKPIGDR  379

Query  1565  ANAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHR  1726
             AN++WLYIVP GMR LMNYIK KYGNPLV ITENGMDD  +      D L D KRI+YH 
Sbjct  380   ANSIWLYIVPEGMRKLMNYIKKKYGNPLVIITENGMDDPNSPFISLKDALKDTKRIKYHH  439

Query  1727  DYLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKW  1906
             DYLK+LLA+IKEDGCNVKGYFAWSL+DNWEW  G++SRFGLY+VDY D L+R PK+S +W
Sbjct  440   DYLKNLLASIKEDGCNVKGYFAWSLLDNWEWAAGYTSRFGLYFVDYKDKLKRYPKDSVQW  499

Query  1907  FKNFLAS  1927
             F  FL S
Sbjct  500   FTXFLNS  506



>ref|XP_008644530.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=523

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/478 (65%), Positives = 391/478 (82%), Gaps = 7/478 (1%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             ++R SFP+GFVFGTA+AAYQ+EGAVK DGRG TIWDTFAHT GK++DFSNADVAVDQYHR
Sbjct  45    LTRGSFPKGFVFGTAAAAYQYEGAVKTDGRGQTIWDTFAHTFGKISDFSNADVAVDQYHR  104

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             + ED++LM DMGMDAYRFSIAWSRI PNGTG++NQAG+DHYN +I+ALL+ GI+PYVTLY
Sbjct  105   FEEDVQLMADMGMDAYRFSIAWSRILPNGTGQVNQAGIDHYNKVINALLSKGIQPYVTLY  164

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             H+DLPQALE+RYNGWL+RQ++ DFAAYAETCF  FGDRVK W+T+NEP ++ V GYD G+
Sbjct  165   HWDLPQALEDRYNGWLDRQIVNDFAAYAETCFKAFGDRVKHWITLNEPHTVAVQGYDAGL  224

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
             HAPG CS+  HL C TGNS TEPY VAH+ +LAHA   D+YRRKY+A Q G++ I  +  
Sbjct  225   HAPGRCSVLLHLYCRTGNSGTEPYIVAHNFILAHATVSDMYRRKYKAAQNGELGIAFDVI  284

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             WYEP+TNS  DI+A +RA +F LGWF +P   G+YP ++ +RVG+RLPKF+A E+AL+KG
Sbjct  285   WYEPMTNSTIDIEATKRAQEFQLGWFADPFFFGDYPATMRARVGERLPKFTADEAALVKG  344

Query  1415  SYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPF-KGLMPIGERANAVWLYIV  1591
             + D++G+NHYTT+Y    DTNI+G  L+DTL D+GT +LPF K   PIG+RAN++WLYIV
Sbjct  345   ALDFMGINHYTTFYTRHNDTNIIGRLLNDTLADTGTISLPFDKNGKPIGDRANSIWLYIV  404

Query  1592  PRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLKSLLAA  1753
             P G+R LMNY+K++Y +P V+ITENGMDD  +      + L D KRI+YH  YL ++ A+
Sbjct  405   PSGIRKLMNYVKERYNSPTVYITENGMDDGNSPFTSLQNALKDSKRIKYHNGYLNNVAAS  464

Query  1754  IKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
             IKEDGC+V+GYFAWSL+DNWEW  G++SRFGLY+VDY DNL+R PK S +WFK  L+S
Sbjct  465   IKEDGCDVRGYFAWSLLDNWEWAAGYTSRFGLYFVDYKDNLKRHPKNSVQWFKTLLSS  522



>ref|XP_002311330.1| hydroxyisourate hydrolase family protein [Populus trichocarpa]
 gb|EEE88697.1| hydroxyisourate hydrolase family protein [Populus trichocarpa]
Length=512

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/521 (63%), Positives = 410/521 (79%), Gaps = 25/521 (5%)
 Frame = +2

Query  410   MLLRKGIIVSSPPSLKvvvfvfvvvvGLQICGAQNISRASFPEGFVFGTASAAYQFEGAV  589
             MLLR+GI +    S+            +Q C +Q I+RASFP+GFVFGTAS+A+Q+EGAV
Sbjct  1     MLLRRGIALVIIVSVAFQ---------IQTCLSQ-INRASFPKGFVFGTASSAFQYEGAV  50

Query  590   KEDGRGATIWDTFAHT-----PGKVTDFSNADVAVDQYHRYLEDIELMKDMGMDAYRFSI  754
             KEDGRG ++WD F+HT      GK+ DFSNADVAVDQYH + EDI+LMKDMGMDAYRFSI
Sbjct  51    KEDGRGPSVWDKFSHTFVIGPAGKIIDFSNADVAVDQYHHFDEDIKLMKDMGMDAYRFSI  110

Query  755   AWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLYHYDLPQALENRYNGWLNRQV  934
             +W+RI+PNGTGK+NQAGVDHYN  I+ALLA GIEPYVTL+H+DLPQAL +RYNGWL+ Q+
Sbjct  111   SWTRIYPNGTGKINQAGVDHYNKFINALLAQGIEPYVTLFHWDLPQALHDRYNGWLSPQI  170

Query  935   IKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGVHAPGHCSIFFHLLCPTGNSA  1114
             IKDFA +AETCF  +GDRVK W+T NEP ++++ GYD+G+ APG CSI  HL C  GNSA
Sbjct  171   IKDFATFAETCFQNYGDRVKNWITFNEPHTVSIQGYDVGLQAPGRCSILLHLFCRAGNSA  230

Query  1115  TEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESFWYEPLTNSPADIDAKQRAID  1294
             TEPY VAH++LL+H AA DIYR+KY+AKQ G + I ++  W+EP TNS  DI+A QRA D
Sbjct  231   TEPYIVAHNMLLSHGAAADIYRKKYKAKQQGSVGISLDVIWFEPATNSTKDIEAAQRAQD  290

Query  1295  FYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKGSYDYLGVNHYTTWYASSTDT  1474
             F LGWF+EP++ G+YP S+ +RVGDRLPKF+  ++AL+KGS D++G+NHYTT+YA S D+
Sbjct  291   FQLGWFIEPLILGDYPISMRNRVGDRLPKFTENDAALVKGSLDFVGINHYTTFYARSNDS  350

Query  1475  ---NIMGLFLHDTLTDSGTFTLPF-KGLMPIGERANAVWLYIVPRGMRNLMNYIKDKYGN  1642
                +++G  L+D++ DSG  TLPF +   PIG+RAN++WLYIVP+GMR+LMN+I+ KYGN
Sbjct  351   LLGDVIGKVLNDSVADSGAITLPFGENKKPIGDRANSIWLYIVPQGMRSLMNHIRQKYGN  410

Query  1643  PLVFITENGMDDAKT------DGLNDIKRIRYHRDYLKSLLAAIKEDGCNVKGYFAWSLM  1804
             P V ITENGMDD         D L D KRI+YH DYL +LLA+IKEDGCNVKGYF WSL+
Sbjct  411   PPVIITENGMDDPNNALTPIKDALKDGKRIKYHNDYLTNLLASIKEDGCNVKGYFVWSLL  470

Query  1805  DNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
             DNWEW  G++SRFGLY+VDY D L+R PK+S +WFK FL S
Sbjct  471   DNWEWAAGYTSRFGLYFVDYKDKLKRYPKDSVQWFKKFLTS  511



>ref|XP_003561900.1| PREDICTED: beta-glucosidase 6 [Brachypodium distachyon]
Length=519

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/485 (63%), Positives = 388/485 (80%), Gaps = 6/485 (1%)
 Frame = +2

Query  491   LQICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNAD  670
             +   G   ++R SFP+GFVFGTASAAYQ+EGAVK DGRG TIWDTFAHT GK+TDFSNAD
Sbjct  34    IAASGGAGLTRGSFPKGFVFGTASAAYQYEGAVKADGRGQTIWDTFAHTFGKITDFSNAD  93

Query  671   VAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANG  850
             VAVDQYHR+ EDI+LM DMGMDAYRFSIAW+RI PNG G++NQAG+DHYN LI+ALLA G
Sbjct  94    VAVDQYHRFEEDIQLMADMGMDAYRFSIAWARILPNGVGQVNQAGIDHYNKLINALLAKG  153

Query  851   IEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSIT  1030
             I+PYVTLYH+DLPQALE++YNGWLNRQ++ DFA YAETCF  FGDRVK W+T+NEP +++
Sbjct  154   IQPYVTLYHWDLPQALEDKYNGWLNRQIVDDFAGYAETCFAAFGDRVKHWITVNEPHTVS  213

Query  1031  VLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGK  1210
             V GYD G+ APG CS+  HL C +GNS TEPY VAH+ +LAHA    IYR KY+A Q G+
Sbjct  214   VQGYDAGLQAPGRCSVLLHLYCKSGNSGTEPYIVAHNFILAHATVSRIYRNKYRATQKGQ  273

Query  1211  ITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSA  1390
             + +  +  WYEP+T+   D++A +RA +F LGWF +P   G+YP ++  RVG+RLP+F+ 
Sbjct  274   LGMAFDVMWYEPMTSRAVDVEAAKRAQEFQLGWFADPFFFGDYPETMRKRVGERLPRFTP  333

Query  1391  AESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERAN  1570
              E+ L+KG+ D++G+NHYTT+Y    DTNI+G   +DTL D+GT +LPF+    IG+RAN
Sbjct  334   EEAELVKGALDFVGINHYTTYYTRQNDTNIIGKLFNDTLADTGTISLPFRNGKAIGDRAN  393

Query  1571  AVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDY  1732
             ++WLYIVPRGMR+LMNY+KD+Y +P V+ITENGMDD  +      D L D KRI+YH DY
Sbjct  394   SIWLYIVPRGMRSLMNYVKDRYNSPPVYITENGMDDGNSPFISLKDALKDSKRIKYHNDY  453

Query  1733  LKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFK  1912
             L +L A+IKEDGC+V+GYFAWSL+DNWEW  G+SSRFGLY+VDY+DNL+R PK S +WFK
Sbjct  454   LTNLAASIKEDGCDVRGYFAWSLLDNWEWAAGYSSRFGLYFVDYNDNLKRYPKNSVQWFK  513

Query  1913  NFLAS  1927
             + L+S
Sbjct  514   SLLSS  518



>ref|XP_010936326.1| PREDICTED: beta-glucosidase 6 isoform X1 [Elaeis guineensis]
Length=504

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/477 (65%), Positives = 385/477 (81%), Gaps = 6/477 (1%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             +SR SFPEGFVFGTAS++YQ+EGAVKE GRG T+WDTFAH+ GKV DFSNADVAVDQYHR
Sbjct  27    LSRGSFPEGFVFGTASSSYQYEGAVKEAGRGPTVWDTFAHSFGKVIDFSNADVAVDQYHR  86

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             ++ED++LM DMGMDAYRFSIAWSRIFPNGTG++NQAG+DHYN LI+ALLA GIEPYVTLY
Sbjct  87    FVEDVQLMSDMGMDAYRFSIAWSRIFPNGTGEVNQAGIDHYNKLINALLAKGIEPYVTLY  146

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             H+DLPQAL+++YNGWL+RQ+IKD+A YAETCF  FGDRV  W+T NEP +  + GYD+G+
Sbjct  147   HWDLPQALQDKYNGWLDRQIIKDYANYAETCFREFGDRVTHWITFNEPHTFAIQGYDVGL  206

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
              APG CSI   L C  GNSATEPY V H++LL+HA   DIYRRKY+A Q G + I  +  
Sbjct  207   QAPGRCSIILRLFCRAGNSATEPYIVGHNVLLSHATVADIYRRKYKATQHGTVGIAFDVM  266

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             W+ P+TNS  DIDA QRA DF  GWF++P+  G+YP S+ +RVG+RLPKFS AE+AL+KG
Sbjct  267   WFIPMTNSSEDIDATQRAQDFQFGWFMDPLFFGDYPSSMRTRVGNRLPKFSTAEAALVKG  326

Query  1415  SYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVP  1594
             S D++G+NHYTT+Y+    +NI+ + L+DTL DSG  +LPFK   PIG++A+++WLYIVP
Sbjct  327   SLDFVGINHYTTYYSKHNSSNIINILLNDTLADSGAISLPFKYGKPIGDKASSIWLYIVP  386

Query  1595  RGMRNLMNYIKDKYGNPLVFITENGMDDAK------TDGLNDIKRIRYHRDYLKSLLAAI  1756
             +G R+LMNYIK KYGNP V ITENGMDD         D L D KRI+YH DYL +L AAI
Sbjct  387   QGFRSLMNYIKQKYGNPPVIITENGMDDPNDPFISIKDALKDDKRIKYHHDYLSNLSAAI  446

Query  1757  KEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
             ++DGC+V+GYF WSL+DNWEW  G++SRFGLY+VDY DNL+R PK S +WF+N L S
Sbjct  447   RKDGCDVRGYFVWSLLDNWEWAAGYTSRFGLYFVDYKDNLKRYPKNSVQWFQNLLKS  503



>ref|XP_010109366.1| Beta-glucosidase 40 [Morus notabilis]
 gb|EXC22071.1| Beta-glucosidase 40 [Morus notabilis]
Length=500

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/485 (66%), Positives = 390/485 (80%), Gaps = 11/485 (2%)
 Frame = +2

Query  491   LQICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNAD  670
             +Q C ++ I+R SFP+GFVFGTAS+AYQ+EGAVKEDGRG ++WDTFAHT GK+ D SNAD
Sbjct  20    IQACFSE-INRGSFPKGFVFGTASSAYQYEGAVKEDGRGPSVWDTFAHTFGKIIDLSNAD  78

Query  671   VAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANG  850
             VAVDQYHRY ED++LMKDMGMDAYRFSI+WSRIFPNGTG++NQAGVD+YN LI+ALLA G
Sbjct  79    VAVDQYHRYEEDVQLMKDMGMDAYRFSISWSRIFPNGTGQINQAGVDYYNKLINALLAKG  138

Query  851   IEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSIT  1030
             IEPYVTLYH+DLPQALE++Y GWL+RQVIKDFA +AETCF  FGDRVK W+T NE  ++ 
Sbjct  139   IEPYVTLYHWDLPQALEDKYKGWLDRQVIKDFALFAETCFQQFGDRVKHWITFNEAYTVA  198

Query  1031  VLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGK  1210
             V GYD+G+ APG CSI  HLLC  GNS+TEPY V H++LL+HA AVDIYR+KY++KQ G 
Sbjct  199   VQGYDVGLQAPGRCSILLHLLCRAGNSSTEPYIVGHNILLSHAVAVDIYRKKYKSKQKGS  258

Query  1211  ITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSA  1390
             I +     W+ P +NS ADI+A QRA DF LGWFL+P+M G+YP ++   VG+RLP FS 
Sbjct  259   IGMSQSVIWFIPASNSTADIEAAQRAQDFQLGWFLDPLMFGDYPSAMRKLVGNRLPTFSK  318

Query  1391  AESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERAN  1570
             +ESALLKGS+D++G+NHYTT+YA     N+    L+DT  DS   T PF+   PI ++A+
Sbjct  319   SESALLKGSFDFVGINHYTTFYA----FNVTLYGLNDTYQDSAALTTPFRNFKPIADKAS  374

Query  1571  AVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDY  1732
             ++WLYIVP GMR+LMNYIK KYGNP V ITENGMDD           L D KRI+YH DY
Sbjct  375   SIWLYIVPEGMRHLMNYIKQKYGNPPVIITENGMDDPNNILIPLKQALKDEKRIKYHNDY  434

Query  1733  LKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFK  1912
             L +LLA+IKEDGCNVKGYF WSL+DNWEW  GF+SRFGLY+VDY+D L+R PK+SAKWFK
Sbjct  435   LTNLLASIKEDGCNVKGYFVWSLLDNWEWAAGFTSRFGLYFVDYNDKLKRYPKDSAKWFK  494

Query  1913  NFLAS  1927
             NFL S
Sbjct  495   NFLTS  499



>ref|XP_004297254.1| PREDICTED: beta-glucosidase 40-like isoform 2 [Fragaria vesca 
subsp. vesca]
Length=503

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/485 (66%), Positives = 391/485 (81%), Gaps = 10/485 (2%)
 Frame = +2

Query  500   CGAQN---ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNAD  670
             C +Q+   I+R SFP+GFVFGTAS+A+Q+EGAVKEDGRG ++WD F+HT GK+TDFSNAD
Sbjct  19    CSSQSNSEINRGSFPKGFVFGTASSAFQYEGAVKEDGRGPSVWDIFSHTFGKITDFSNAD  78

Query  671   VAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANG  850
             VAVDQYH Y  D++LMKDMGMDAYRFSI+WSRIFPNGTG++NQAGVDHYNNLI++LLA G
Sbjct  79    VAVDQYHLYDGDVQLMKDMGMDAYRFSISWSRIFPNGTGQINQAGVDHYNNLINSLLAKG  138

Query  851   IEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSIT  1030
             IEPYVTLYH+DLPQALE+RY GWL+ Q+I+DFA YAETCF  FGDRVK W+T NEP +  
Sbjct  139   IEPYVTLYHWDLPQALEDRYTGWLDAQIIQDFAVYAETCFQKFGDRVKHWITFNEPHTFA  198

Query  1031  VLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGK  1210
             V GYD+G+ APG CS+   L C  GNSATEPY VAH+++L+HA   DIYR+KY+ KQ G 
Sbjct  199   VQGYDVGLQAPGRCSLLGRLFCRAGNSATEPYIVAHNVILSHATVADIYRKKYKPKQRGS  258

Query  1211  ITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSA  1390
             I    +  WY   TNS ADI+A +RA DF LGWFL+P + G+YP S+ SRVG RLPKFS 
Sbjct  259   IGASFDVIWYRSATNSTADIEATERAQDFQLGWFLDPFIFGDYPFSMRSRVGSRLPKFSK  318

Query  1391  AESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERAN  1570
             +ES L+KGS D++G+NHYTT+YAS+  ++I+GL L+D+L+DSG   LPFK    IG++AN
Sbjct  319   SESTLIKGSLDFVGINHYTTFYASNDSSHIIGL-LNDSLSDSGAIALPFKDGKAIGDKAN  377

Query  1571  AVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDY  1732
             ++WLYIVP GMR+LMNYIK KYGNP V ITENGMDD  +      D L D KRI YHRDY
Sbjct  378   SIWLYIVPEGMRSLMNYIKKKYGNPPVLITENGMDDPNSPFISLKDALKDEKRISYHRDY  437

Query  1733  LKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFK  1912
             L +LLA+IKEDGCNV GYFAWSL+DNWEW  G++SRFGLY++DY D L+R PK+S +WFK
Sbjct  438   LSNLLASIKEDGCNVNGYFAWSLLDNWEWGAGYTSRFGLYFIDYKDKLKRYPKDSVQWFK  497

Query  1913  NFLAS  1927
             NFL S
Sbjct  498   NFLTS  502



>gb|AHC04401.1| beta-glucosidase 1 [Fragaria x ananassa]
Length=503

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/485 (66%), Positives = 391/485 (81%), Gaps = 10/485 (2%)
 Frame = +2

Query  500   CGAQN---ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNAD  670
             C +++   I+R SFP+GFVFGTAS+A+Q+EGAVKEDGRG ++WD F+HT GK+TDFSNAD
Sbjct  19    CSSESNSEINRGSFPKGFVFGTASSAFQYEGAVKEDGRGPSVWDIFSHTFGKITDFSNAD  78

Query  671   VAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANG  850
             VAVDQYH Y  D++LMKDMGMDAYRFSI+WSRIFPNGTG++NQAGVDHYNNLI++LLA G
Sbjct  79    VAVDQYHLYDGDVQLMKDMGMDAYRFSISWSRIFPNGTGQINQAGVDHYNNLINSLLAKG  138

Query  851   IEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSIT  1030
             IEPYVTLYH+DLPQALE+RY GWL+ Q+IKDFA YAETCF  FGDRVK W+T NEP +  
Sbjct  139   IEPYVTLYHWDLPQALEDRYTGWLDAQIIKDFAVYAETCFQKFGDRVKHWITFNEPHTFA  198

Query  1031  VLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGK  1210
             V GYD+G+ APG CS+   L C  GNSATEPY VAH+++L+HA   +IYR+KY++KQ G 
Sbjct  199   VQGYDVGLQAPGRCSLLGSLFCRAGNSATEPYIVAHNVILSHATVANIYRKKYKSKQRGS  258

Query  1211  ITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSA  1390
             I    +  WY   TNS ADI+A QRA DF LGWFL+P + G+YP S+ SRVG RLPKFS 
Sbjct  259   IGASFDVIWYRSATNSTADIEATQRAQDFQLGWFLDPFIFGDYPFSMRSRVGSRLPKFSK  318

Query  1391  AESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERAN  1570
             +ES L+KGS D++G+NHYTT+YAS+  ++I+GL L+D+L+DSG  TLPFK    IG++AN
Sbjct  319   SESTLIKGSLDFVGINHYTTFYASNDSSHIIGL-LNDSLSDSGAITLPFKDGKAIGDKAN  377

Query  1571  AVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDY  1732
             ++WLYIVP GMR+L NYIK  YGNP V ITENGMDD  +      D L D KRI YHRDY
Sbjct  378   SIWLYIVPEGMRSLTNYIKKMYGNPPVIITENGMDDPNSPFISLKDALKDEKRISYHRDY  437

Query  1733  LKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFK  1912
             L +LLA+IKEDGCNV GYFAWSL+DNWEW  G++SRFGLY++DY D L+R PK+S +WFK
Sbjct  438   LSNLLASIKEDGCNVNGYFAWSLLDNWEWAAGYTSRFGLYFIDYKDKLKRYPKDSVQWFK  497

Query  1913  NFLAS  1927
             NFL S
Sbjct  498   NFLTS  502



>ref|XP_002316096.2| hydroxyisourate hydrolase family protein [Populus trichocarpa]
 gb|EEF02267.2| hydroxyisourate hydrolase family protein [Populus trichocarpa]
Length=508

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/482 (65%), Positives = 392/482 (81%), Gaps = 10/482 (2%)
 Frame = +2

Query  512   NISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYH  691
              I+RASFP+GFVFGTAS+A+Q+EGAVK DGRG ++WD F+HT GK+ DFSNADVAVDQYH
Sbjct  26    QINRASFPKGFVFGTASSAFQYEGAVKADGRGPSVWDAFSHTFGKIIDFSNADVAVDQYH  85

Query  692   RYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTL  871
              + EDI+LMKDMGMDAYRFSI+WSRI+PNGT K+NQAGVDHYN  I+ALLA GIEPYVTL
Sbjct  86    LFDEDIKLMKDMGMDAYRFSISWSRIYPNGTDKINQAGVDHYNKFINALLAQGIEPYVTL  145

Query  872   YHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLG  1051
             YH+DLPQAL ++YNGWL+ Q+IKDFA +AETCF I+G+RVK W+T NEP ++ + GYD+G
Sbjct  146   YHWDLPQALHDKYNGWLSPQIIKDFATFAETCFEIYGNRVKHWITFNEPHTVAIQGYDVG  205

Query  1052  VHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVES  1231
             + APG CSIF HL C  GNSATEPY VAH++LL+H    DIYR+KY+AKQ G + I ++ 
Sbjct  206   LQAPGRCSIFLHLFCRAGNSATEPYIVAHNILLSHGTVADIYRKKYKAKQRGSLGISLDV  265

Query  1232  FWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLK  1411
              W+EP TN+  DI+A QRA DF LGWF+EP++ G YP ++ +RVGDRLP F+  + AL+K
Sbjct  266   IWFEPATNTTNDIEAAQRAQDFQLGWFIEPLILGNYPITMRNRVGDRLPNFTENDVALVK  325

Query  1412  GSYDYLGVNHYTTWYASSTDT---NIMGLFLHDTLTDSGTFTLPF-KGLMPIGERANAVW  1579
             GS+D++G+NHYTT+YA S D+   +++G  L+D+L DSG  TLPF + L PIG+RA+++W
Sbjct  326   GSFDFVGINHYTTFYARSNDSLFGDLIGKVLNDSLADSGAITLPFGEHLKPIGDRASSIW  385

Query  1580  LYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAK------TDGLNDIKRIRYHRDYLKS  1741
             LYIVPRGMR+LMNYI+ KYGNP V ITENGMDD         D L D KRI+YH+DYL S
Sbjct  386   LYIVPRGMRSLMNYIRQKYGNPPVIITENGMDDPNHAWTPIKDALKDEKRIKYHKDYLAS  445

Query  1742  LLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             LLA+IKEDGCNVKGYF WSL+DNWEW  G++SRFGLY+VDY D L+R PK+S +WFK FL
Sbjct  446   LLASIKEDGCNVKGYFVWSLLDNWEWAAGYTSRFGLYFVDYKDKLKRYPKDSVQWFKKFL  505

Query  1922  AS  1927
              S
Sbjct  506   TS  507



>ref|XP_004505367.1| PREDICTED: beta-glucosidase 40-like [Cicer arietinum]
Length=499

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/481 (66%), Positives = 389/481 (81%), Gaps = 11/481 (2%)
 Frame = +2

Query  497   ICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVA  676
             +C +  ISRA FP GF FGTA++A+Q+EGAVKEDGRG ++WDTF+HT GK++DFSNADVA
Sbjct  20    LCISAAISRADFPNGFQFGTATSAFQYEGAVKEDGRGPSVWDTFSHTFGKISDFSNADVA  79

Query  677   VDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIE  856
             VD YHRY EDI+LMKD+G+DAYRFSI+WSRIFP+G+G++NQAGVDHYN +I++LLANGIE
Sbjct  80    VDHYHRYEEDIQLMKDLGVDAYRFSISWSRIFPSGSGQINQAGVDHYNKVINSLLANGIE  139

Query  857   PYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVL  1036
             PYVTLYH+DLPQALE++Y GWL+ ++IKDF+ YAETCF  FGDRVK W+T NEP + T  
Sbjct  140   PYVTLYHWDLPQALEDKYTGWLSTEIIKDFSTYAETCFQKFGDRVKHWMTFNEPHTFTTQ  199

Query  1037  GYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKIT  1216
             GYDLG+ APG CSI F   C  GNS TEPY VAH++LL+HAA  DIYR+KY+  QGG + 
Sbjct  200   GYDLGIQAPGRCSILF---CRAGNSTTEPYIVAHNVLLSHAAVADIYRKKYKNIQGGSLG  256

Query  1217  IVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAE  1396
             I     WYEP TN+  DI+A QRA DF LGWFL+P+M G+YP S+ SRVG+RLPKFS +E
Sbjct  257   IAFNVIWYEPATNTQKDIEAAQRAQDFQLGWFLDPLMFGDYPSSMRSRVGNRLPKFSPSE  316

Query  1397  SALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAV  1576
             +AL+KGS D++G+NHYTT+YA    TN++G  LH  + DSGT  LPF G  PIGE+AN++
Sbjct  317   AALVKGSLDFVGINHYTTFYARDNSTNLLGA-LHSAIADSGTIALPFNGTKPIGEKANSI  375

Query  1577  WLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLK  1738
             WLYIVP+ MR LMNYIK KYGNP VFITENGMDD  +      D L D KRIRY+  YL 
Sbjct  376   WLYIVPQSMRTLMNYIKQKYGNPPVFITENGMDDPNSIYIPIKDALKDEKRIRYYNGYLS  435

Query  1739  SLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNF  1918
              LLA+IK DGCNVKGYFAWSL+DNWEW+ G++SRFGL+Y+DY DNL+R PK+S +WFKNF
Sbjct  436   YLLASIK-DGCNVKGYFAWSLLDNWEWSSGYTSRFGLFYIDYRDNLKRYPKQSVQWFKNF  494

Query  1919  L  1921
             L
Sbjct  495   L  495



>ref|XP_011018305.1| PREDICTED: beta-glucosidase 40-like isoform X1 [Populus euphratica]
Length=507

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/516 (62%), Positives = 407/516 (79%), Gaps = 20/516 (4%)
 Frame = +2

Query  410   MLLRKGIIVSSPPSLKvvvfvfvvvvGLQICGAQNISRASFPEGFVFGTASAAYQFEGAV  589
             MLLR+GI +         V +      +Q C +Q I+RASFP+GFVFGTAS+A+Q+EGAV
Sbjct  1     MLLRRGIAL---------VIIVSAAFQIQTCLSQ-INRASFPKGFVFGTASSAFQYEGAV  50

Query  590   KEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRI  769
             KEDGRG ++WD F+HT GK+ DFSNADVAVDQ+H + EDI+LMKDMGMDAYRFSI+W+RI
Sbjct  51    KEDGRGPSVWDKFSHTFGKIIDFSNADVAVDQFHHFDEDIKLMKDMGMDAYRFSISWTRI  110

Query  770   FPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLYHYDLPQALENRYNGWLNRQVIKDFA  949
             +PNGTGK+NQAGVDHY   I+ALLA GIEPYVTL+H+DLPQAL +RY+GWL+ Q+IKDFA
Sbjct  111   YPNGTGKINQAGVDHYKKFINALLAQGIEPYVTLFHWDLPQALHDRYSGWLSPQIIKDFA  170

Query  950   AYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYF  1129
              +AETCF  +GDRVK W+T NEP ++++ GYD+G+ APG CSI  HL C  GNSATEPY 
Sbjct  171   TFAETCFQNYGDRVKNWITFNEPHTVSIQGYDVGLQAPGRCSILLHLFCRAGNSATEPYI  230

Query  1130  VahhlllahaaaVDIYRRKYQAKQGGKITIVVESFWYEPLTNSPADIDAKQRAIDFYLGW  1309
             VAH++LL+H AA DIYR+KY+AKQ G + I ++  W+EP TNS  DI+A QRA DF LGW
Sbjct  231   VAHNMLLSHGAAADIYRKKYKAKQQGSVGISLDVIWFEPATNSTKDIEAAQRAQDFQLGW  290

Query  1310  FLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKGSYDYLGVNHYTTWYASSTDT---NI  1480
             F+EP++ G+YP S+ +RVGDRLPKF+  ++AL+KGS D++G+NHYTT+YA S D+   ++
Sbjct  291   FIEPLILGDYPISMRNRVGDRLPKFTKNDAALVKGSLDFVGINHYTTFYARSNDSLLGDV  350

Query  1481  MGLFLHDTLTDSGTFTLPF-KGLMPIGERANAVWLYIVPRGMRNLMNYIKDKYGNPLVFI  1657
             +   L+D++ DSG  TLPF +   PIG+RAN++WLYIVP+GMR+LMN+I+ KYGNP V I
Sbjct  351   IDKVLNDSVADSGAITLPFGENKKPIGDRANSIWLYIVPQGMRSLMNHIRQKYGNPPVII  410

Query  1658  TENGMDDAKT------DGLNDIKRIRYHRDYLKSLLAAIKEDGCNVKGYFAWSLMDNWEW  1819
             TENGMDD         D L D KRIRYH DYL +LLA+IKEDGCNVKGYF WSL+DNWEW
Sbjct  411   TENGMDDPNNALTPIKDALKDRKRIRYHNDYLTNLLASIKEDGCNVKGYFVWSLLDNWEW  470

Query  1820  TVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
               G++SR GL +VDY D L+R PK+SA+WFK FL S
Sbjct  471   AAGYTSRLGLCFVDYKDKLKRYPKDSAQWFKKFLTS  506



>ref|XP_008792724.1| PREDICTED: beta-glucosidase 6 [Phoenix dactylifera]
Length=504

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/487 (64%), Positives = 387/487 (79%), Gaps = 8/487 (2%)
 Frame = +2

Query  491   LQICGAQN--ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSN  664
             ++ C + N  +SR SFP+GF FGTAS++YQ+EGAVKEDGRG T+WD FAH+ GKV DFSN
Sbjct  17    IKRCLSDNGELSRESFPKGFAFGTASSSYQYEGAVKEDGRGPTVWDNFAHSFGKVIDFSN  76

Query  665   ADVAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLA  844
             ADVAVDQYHR+ ED++LM DMGMDAYRFSIAWSRIFPNGTG++NQAG+DHYN LI+ALLA
Sbjct  77    ADVAVDQYHRFEEDVQLMSDMGMDAYRFSIAWSRIFPNGTGEVNQAGIDHYNKLINALLA  136

Query  845   NGIEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRS  1024
              GIEPYVTLYH+DLP AL ++YNGWL+RQ+IKD+A Y ETCF  FGDRVK  +T NEP +
Sbjct  137   KGIEPYVTLYHWDLPLALHDKYNGWLDRQIIKDYANYVETCFREFGDRVKYCITFNEPHT  196

Query  1025  ITVLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQG  1204
               + GYD+G+ APG CSI   L C  GNSATEPY VAH++L+AHA   +IY+ KY+A Q 
Sbjct  197   FAIQGYDVGLQAPGRCSILLRLFCRAGNSATEPYVVAHNVLIAHATVAEIYKTKYKATQH  256

Query  1205  GKITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKF  1384
             G I I  +  W+ P+TNS  DIDA QRA DF  GWF++P+  G+YP S+ +RVG+RLPKF
Sbjct  257   GIIGIAFDVMWFIPMTNSREDIDATQRAQDFQFGWFMDPLFFGDYPSSMRTRVGNRLPKF  316

Query  1385  SAAESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGER  1564
             S AE+AL+KGS D++G+NHYTT+YA    TN++ + L+DTL DSG  TLPFK L PIG++
Sbjct  317   STAEAALIKGSLDFVGINHYTTYYAKHNSTNLINIILNDTLADSGAITLPFKNLKPIGDK  376

Query  1565  ANAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDD------AKTDGLNDIKRIRYHR  1726
             A+++WLYIVP+G R+LMNYIK KYGNP V ITENGMDD      +  D L D KRI+YH 
Sbjct  377   ASSIWLYIVPQGFRSLMNYIKQKYGNPPVIITENGMDDPNNPFISTKDALKDDKRIKYHT  436

Query  1727  DYLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKW  1906
             DYL +L AAI+EDGC+V+GYF WSL+DNWEW  G++SRFGLY+VDY DNL+R PK S +W
Sbjct  437   DYLSNLSAAIREDGCDVRGYFVWSLLDNWEWAAGYTSRFGLYFVDYKDNLKRYPKNSVQW  496

Query  1907  FKNFLAS  1927
             F+N L S
Sbjct  497   FQNLLKS  503



>ref|XP_006437962.1| hypothetical protein CICLE_v10031299mg [Citrus clementina]
 gb|ESR51202.1| hypothetical protein CICLE_v10031299mg [Citrus clementina]
Length=474

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/458 (68%), Positives = 370/458 (81%), Gaps = 6/458 (1%)
 Frame = +2

Query  572   QFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHRYLEDIELMKDMGMDAYRFS  751
             Q+EGAVKEDGRG T+WDTF+HT GK+ D SNADVAVDQYHRY ED++LMKDMGMDAYRFS
Sbjct  15    QYEGAVKEDGRGPTVWDTFSHTFGKILDNSNADVAVDQYHRYPEDVQLMKDMGMDAYRFS  74

Query  752   IAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLYHYDLPQALENRYNGWLNRQ  931
             IAWSRIFPNGTG++NQAGVDHYN LIDALLA GIEPYVTLYH+DLPQAL+++Y GWL+RQ
Sbjct  75    IAWSRIFPNGTGQINQAGVDHYNKLIDALLAKGIEPYVTLYHWDLPQALDDKYKGWLDRQ  134

Query  932   VIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGVHAPGHCSIFFHLLCPTGNS  1111
             +I DFA YAETCF  FGDRVK W+T NEP + T+ GYD+G+ APG CSI  HL C  GNS
Sbjct  135   IINDFATYAETCFQKFGDRVKHWITFNEPHTFTIQGYDVGLQAPGRCSILLHLFCRAGNS  194

Query  1112  ATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESFWYEPLTNSPADIDAKQRAI  1291
             ATEPY VAH+ LL HA   DIYR+KY+AKQGG + I  +  WYE  +NS  D +A QRA 
Sbjct  195   ATEPYIVAHNALLTHAKVADIYRKKYKAKQGGSLGIAFDVIWYESASNSTEDAEATQRAQ  254

Query  1292  DFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKGSYDYLGVNHYTTWYASSTD  1471
             DF LGWFL+P+M G+YP S+ +RVG RLP+F+++E+ALLKGS D++G+NHYTT+YA    
Sbjct  255   DFQLGWFLDPLMFGDYPSSMRNRVGSRLPRFTSSEAALLKGSLDFVGINHYTTFYAQRNA  314

Query  1472  TNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVPRGMRNLMNYIKDKYGNPLV  1651
             TN++G+ L+D+L D+G  T+PFK   PI +RAN++WLYIVPRGMR+LMNYIK KY NP V
Sbjct  315   TNLIGVVLNDSLADAGALTIPFKNGKPIADRANSIWLYIVPRGMRSLMNYIKQKYRNPTV  374

Query  1652  FITENGMDDAKT------DGLNDIKRIRYHRDYLKSLLAAIKEDGCNVKGYFAWSLMDNW  1813
              ITENGMDD         + L D KRI+YH DYL +LLAAIKEDGCNVKGYF WSL+DNW
Sbjct  375   IITENGMDDPNNRFTPIKEALKDDKRIKYHNDYLTNLLAAIKEDGCNVKGYFVWSLLDNW  434

Query  1814  EWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
             EW  G++SRFGLY+VDY DN +R PK S +WFKNFL S
Sbjct  435   EWAAGYTSRFGLYFVDYKDNQKRYPKNSVQWFKNFLNS  472



>ref|XP_008339824.1| PREDICTED: beta-glucosidase 40 [Malus domestica]
Length=511

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/487 (64%), Positives = 383/487 (79%), Gaps = 7/487 (1%)
 Frame = +2

Query  488   GLQIC-GAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSN  664
             G   C  A +I+R SFP+ FVFGTAS+A+Q+EGAVKEDGRG +IWDTF+HT GK+ DFSN
Sbjct  20    GFPTCLSASDINRVSFPKDFVFGTASSAFQYEGAVKEDGRGPSIWDTFSHTFGKIADFSN  79

Query  665   ADVAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLA  844
             ADVA+DQYHRY ED++LMKDMG+DAYRFSI+W+RIFPNGTG++NQAGVD+YN LIDALLA
Sbjct  80    ADVALDQYHRYKEDVQLMKDMGLDAYRFSISWTRIFPNGTGQINQAGVDYYNRLIDALLA  139

Query  845   NGIEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRS  1024
              GIEPYVTLYH+DLPQALE+RYNGWLN Q+IKDFA YA+TCF  FGDRVK W+T NEP +
Sbjct  140   KGIEPYVTLYHWDLPQALEDRYNGWLNPQIIKDFATYADTCFQHFGDRVKHWITFNEPHT  199

Query  1025  ITVLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQG  1204
              +V GY  G+ APG CSI    LC +GNS TEPY VAH+++L+H    DIY+RKY++KQ 
Sbjct  200   FSVHGYASGLQAPGRCSIXRPJLCRSGNSXTEPYMVAHNVILSHGTVADIYKRKYKSKQR  259

Query  1205  GKITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKF  1384
             G +    +  WYEP TNS  D+ A   A +F LGWFL+P + G+YP S+  RVG RLP F
Sbjct  260   GSVGASFDVIWYEPETNSTEDVIATDIAQEFQLGWFLDPFIFGDYPSSMRRRVGSRLPTF  319

Query  1385  SAAESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGER  1564
             S +ES L+KGS D++G+NHYTT+Y  +   +++G  L+ +L+DSG  TLPFK   PIG+R
Sbjct  320   SKSESTLIKGSLDFVGINHYTTFYGKNDTRDLIGGLLNGSLSDSGAITLPFKNWKPIGDR  379

Query  1565  ANAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHR  1726
             AN++WLYIVP GMR LMNYIK KYGNP V ITENGMDD  +      D L D KRI+YH 
Sbjct  380   ANSIWLYIVPEGMRKLMNYIKQKYGNPPVIITENGMDDPNSQFISLKDALRDTKRIKYHH  439

Query  1727  DYLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKW  1906
             DYL +LLA+IK+DGCNV GYFAWSL+DNWEWT GF+SRFGLY+VDY D L+R PK+S +W
Sbjct  440   DYLANLLASIKQDGCNVXGYFAWSLLDNWEWTAGFTSRFGLYFVDYKDKLKRYPKDSVQW  499

Query  1907  FKNFLAS  1927
             F NFL S
Sbjct  500   FTNFLNS  506



>gb|KDO81803.1| hypothetical protein CISIN_1g0105881mg, partial [Citrus sinensis]
Length=459

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/457 (68%), Positives = 369/457 (81%), Gaps = 6/457 (1%)
 Frame = +2

Query  575   FEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHRYLEDIELMKDMGMDAYRFSI  754
             +EGAVKEDGRG T+WDTF+HT GK+ D SNADVAVDQYHRY ED++LMKDMGMDAYRFSI
Sbjct  1     YEGAVKEDGRGPTVWDTFSHTFGKILDNSNADVAVDQYHRYPEDVQLMKDMGMDAYRFSI  60

Query  755   AWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLYHYDLPQALENRYNGWLNRQV  934
             AWSRIFPNGTG++NQAGVDHYN LIDALLA GIEPYVTLYH+DLPQAL+++Y GWL+RQ+
Sbjct  61    AWSRIFPNGTGQINQAGVDHYNKLIDALLAKGIEPYVTLYHWDLPQALDDKYKGWLDRQI  120

Query  935   IKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGVHAPGHCSIFFHLLCPTGNSA  1114
             I DFA YAETCF  FGDRVK W+T NEP + T+ GYD+G+ APG CSI  HL C  GNSA
Sbjct  121   INDFATYAETCFQKFGDRVKHWITFNEPHTFTIQGYDVGLQAPGRCSILLHLFCRAGNSA  180

Query  1115  TEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESFWYEPLTNSPADIDAKQRAID  1294
             TEPY VAH+ LL HA   DIYR+KY+AKQGG + I  +  WYE  +NS  D +A QRA D
Sbjct  181   TEPYIVAHNALLTHAKVADIYRKKYKAKQGGSLGIAFDVIWYESASNSTEDAEATQRAQD  240

Query  1295  FYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKGSYDYLGVNHYTTWYASSTDT  1474
             F LGWFL+P+M G+YP S+ +RVG RLP+F+++E+ALLKGS D++G+NHYTT+YA    T
Sbjct  241   FQLGWFLDPLMFGDYPSSMRNRVGSRLPRFTSSEAALLKGSLDFVGINHYTTFYAQRNAT  300

Query  1475  NIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVPRGMRNLMNYIKDKYGNPLVF  1654
             N++G+ L+D+L D+G  T+PFK   PI +RAN++WLYIVPRGMR+LMNYIK KY NP V 
Sbjct  301   NLIGVVLNDSLADAGALTIPFKNGKPIADRANSIWLYIVPRGMRSLMNYIKQKYRNPTVI  360

Query  1655  ITENGMDDAKT------DGLNDIKRIRYHRDYLKSLLAAIKEDGCNVKGYFAWSLMDNWE  1816
             ITENGMDD         + L D KRI+YH DYL +LLAAIKEDGCNVKGYF WSL+DNWE
Sbjct  361   ITENGMDDPNNRFTPTKEALKDDKRIKYHNDYLTNLLAAIKEDGCNVKGYFVWSLLDNWE  420

Query  1817  WTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
             W  G++SRFGLY+VDY DN +R PK S +WFKNFL S
Sbjct  421   WAAGYTSRFGLYFVDYKDNQKRYPKNSVQWFKNFLNS  457



>gb|EYU28849.1| hypothetical protein MIMGU_mgv1a004939mg [Erythranthe guttata]
Length=503

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/484 (65%), Positives = 387/484 (80%), Gaps = 8/484 (2%)
 Frame = +2

Query  494   QICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADV  673
               C   +ISR SFP+GFVFGTAS+AYQ+EGAVKEDGRG +IWDT+ H+ GKV DFSNADV
Sbjct  22    HTCYGHSISRGSFPKGFVFGTASSAYQYEGAVKEDGRGQSIWDTYVHSYGKVLDFSNADV  81

Query  674   AVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGI  853
             A DQYH Y EDI+LMKDMGMDAYRFSI+WSRI+PNG+G++N+AG+DHYN+LI+ALLANGI
Sbjct  82    ANDQYHLYNEDIQLMKDMGMDAYRFSISWSRIYPNGSGEVNRAGIDHYNDLINALLANGI  141

Query  854   EPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITV  1033
             EPYVTLYH+DLPQ+L +RY GWL+ + IKD+AAYAETCF  FGDRVK W+T NEP + TV
Sbjct  142   EPYVTLYHWDLPQSLHDRYTGWLSTRSIKDYAAYAETCFKEFGDRVKNWITFNEPFTFTV  201

Query  1034  LGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKI  1213
              GY LG+ APG CSIF + +C  GNS+TEPY VAH++LL+H   VDIY++KYQ KQGG I
Sbjct  202   QGYALGIQAPGRCSIFKYTVCGAGNSSTEPYVVAHNVLLSHGKVVDIYKKKYQPKQGGSI  261

Query  1214  TIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAA  1393
              I ++SFW+EP TNS ADI+A QRA+DF+LGWFLEP++ G+YP+S+ +RV +RLP+FS  
Sbjct  262   GITLDSFWFEPATNSSADIEAAQRALDFFLGWFLEPLIFGDYPKSIRNRVENRLPRFSQT  321

Query  1394  ESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANA  1573
             +S+ LKG++D++G+NHYTTWYA   D N         L DSG   L      P+ E A++
Sbjct  322   QSSKLKGAFDFIGINHYTTWYAE--DRNGTNKTTEVLLDDSGVLALSNVVGKPVHETAHS  379

Query  1574  VWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYL  1735
              WLYIVP G+R+LMNYI+ KYGNPLV ITENGMDD  +      D LND KRI+Y+ DYL
Sbjct  380   TWLYIVPHGIRSLMNYIRHKYGNPLVLITENGMDDGNSPSTSINDALNDKKRIKYYNDYL  439

Query  1736  KSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKN  1915
              +LLAAIKEDGCNV GYFAWSL+D+WEW  GF+SRFGLYYVDY+D L+R  K SA WFKN
Sbjct  440   TNLLAAIKEDGCNVGGYFAWSLLDDWEWGAGFTSRFGLYYVDYNDKLKRYAKNSATWFKN  499

Query  1916  FLAS  1927
             FLAS
Sbjct  500   FLAS  503



>ref|XP_006661692.1| PREDICTED: beta-glucosidase 34-like [Oryza brachyantha]
Length=509

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/489 (63%), Positives = 383/489 (78%), Gaps = 12/489 (2%)
 Frame = +2

Query  494   QICGAQN-----ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDF  658
             Q C AQN     ++R SFP+GFVFGTAS+AYQ+EGAVKEDGRG  IWD FAHT GK+ DF
Sbjct  20    QGCDAQNTTGSGLTRGSFPKGFVFGTASSAYQYEGAVKEDGRGPAIWDKFAHTFGKIIDF  79

Query  659   SNADVAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDAL  838
             SNADVAVDQYHR+ EDI+LM DMGMDAYRFSIAWSRIFPNGTG++NQAG+DHYN LI+AL
Sbjct  80    SNADVAVDQYHRFEEDIQLMADMGMDAYRFSIAWSRIFPNGTGQINQAGIDHYNKLINAL  139

Query  839   LANGIEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEP  1018
             LA GIEPYVTLYH+DLPQALE++Y GWL+RQ+I D+A YAETCF  FGDRVK W+T NEP
Sbjct  140   LAKGIEPYVTLYHWDLPQALEDKYTGWLDRQIINDYAVYAETCFKAFGDRVKHWITFNEP  199

Query  1019  RSITVLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAK  1198
              ++ V  YD G+HAPG CS+  HL C  GNS TEPY VAH+++L+HA   DIYR+KY+A 
Sbjct  200   HTVAVQAYDSGMHAPGRCSVLLHLYCKKGNSGTEPYIVAHNMILSHATVSDIYRKKYKAS  259

Query  1199  QGGKITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLP  1378
             Q G + I  +  WYEP++NS AD++A +RA +F LGWF +P   G+YP ++ SRVG RLP
Sbjct  260   QNGSLGISFDVIWYEPMSNSTADVEAAKRAQEFQLGWFADPFFFGDYPATMRSRVGSRLP  319

Query  1379  KFSAAESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIG  1558
             KF+  E+AL+ GS D++G+NHYTT+Y     + ++   L++TL D+ T ++PF+   PIG
Sbjct  320   KFTTTEAALVTGSLDFMGINHYTTFYTKDDQSTVIEKLLNNTLADTATISVPFRNGQPIG  379

Query  1559  ERANAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRY  1720
             ++AN++WLYIVPR MR LMNY+KD+Y  P V+ITENGMDD+ +      D L D KRI+Y
Sbjct  380   DKANSIWLYIVPRSMRILMNYVKDRYNKPTVYITENGMDDSNSPFISLKDALKDNKRIKY  439

Query  1721  HRDYLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESA  1900
             H DYL SL  +I EDGC+V+GYFAWSL+DNWEW+ G++SRFGLY+VDY D  +R PK S 
Sbjct  440   HNDYLTSLADSIWEDGCDVRGYFAWSLLDNWEWSAGYTSRFGLYFVDYKDQ-KRHPKNSV  498

Query  1901  KWFKNFLAS  1927
             KWFKN LAS
Sbjct  499   KWFKNLLAS  507



>gb|EPS59761.1| hypothetical protein M569_15044 [Genlisea aurea]
Length=500

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/481 (65%), Positives = 384/481 (80%), Gaps = 7/481 (1%)
 Frame = +2

Query  506   AQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQ  685
             AQN+SR+ FP+GFVFGTAS+AYQ+EGAVKEDGRG TIWD FAHT GK+ DFS+ADVA DQ
Sbjct  20    AQNMSRSDFPQGFVFGTASSAYQYEGAVKEDGRGQTIWDKFAHTFGKIIDFSDADVASDQ  79

Query  686   YHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYV  865
             YH Y  D++LMKDMGMDAYRFSIAW RI+PNG+G++N AG+ HYNNLI+AL+ANGIEPYV
Sbjct  80    YHLYPSDVQLMKDMGMDAYRFSIAWPRIYPNGSGEINLAGIQHYNNLINALIANGIEPYV  139

Query  866   TLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYD  1045
             TLYH+DLPQALE+RY GWL++++I DF  YAETCF  FGDRVK W+T NEP ++ V GYD
Sbjct  140   TLYHWDLPQALEDRYKGWLSQEIITDFTRYAETCFREFGDRVKNWITFNEPHTVAVQGYD  199

Query  1046  LGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVV  1225
             +G+HAP  CSI     C  GNSATEPY V HH LLAHAAA  +Y+  YQA+QGG+I I +
Sbjct  200   VGLHAPNRCSILLRAFCRAGNSATEPYVVGHHQLLAHAAAAGLYKATYQAEQGGRIGISL  259

Query  1226  ESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESAL  1405
             +SFWYE  TNS  DI A QRAIDF LGWFLEP++ G+YP+++  RVGDRLP+FS A+S  
Sbjct  260   DSFWYESATNSTDDIQAAQRAIDFNLGWFLEPLIVGDYPKTMRDRVGDRLPRFSEADSLR  319

Query  1406  LKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPI-GERANAVWL  1582
             ++GS+D++G+NHYTTW+A    TN+  +FL+D++ DSG  TLPF+    I  ERAN++WL
Sbjct  320   IRGSFDFIGINHYTTWFARDNRTNMGQIFLNDSIADSGAVTLPFRNGKGISAERANSIWL  379

Query  1583  YIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLKSL  1744
             YIVP G+R+LMNYIK+KYGNP V ITENGMDD  +        L D+KRI YHRDYL +L
Sbjct  380   YIVPHGIRSLMNYIKEKYGNPPVIITENGMDDGNSPFVPLKRKLEDVKRINYHRDYLGNL  439

Query  1745  LAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLA  1924
              AAI+EDGC+VKGYF WSL+DNWEW  G++SRFGLYYVDY+D  +R PK S  WF N LA
Sbjct  440   SAAIREDGCDVKGYFVWSLLDNWEWAAGYTSRFGLYYVDYNDARKRHPKASVHWFANLLA  499

Query  1925  S  1927
             S
Sbjct  500   S  500



>ref|XP_004985214.1| PREDICTED: beta-glucosidase 6-like [Setaria italica]
Length=512

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/489 (63%), Positives = 384/489 (79%), Gaps = 9/489 (2%)
 Frame = +2

Query  488   GLQICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNA  667
             G    G   ++R SFPEGFVFGTA++AYQ+EGAVKEDGRG TIWDTFAHT GK++DFSNA
Sbjct  23    GCTAYGGGELTRGSFPEGFVFGTAASAYQYEGAVKEDGRGQTIWDTFAHTLGKISDFSNA  82

Query  668   DVAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLAN  847
             DVAVDQYHR+ +DIELM DMGMDAYRFSIAWSRIFPNGTG++NQAG+DHYN LIDALL+ 
Sbjct  83    DVAVDQYHRFEDDIELMADMGMDAYRFSIAWSRIFPNGTGQVNQAGIDHYNKLIDALLSK  142

Query  848   GIEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSI  1027
              IEPYVTLYH+DLPQALE+RY GWLNR +++DFA YAETCF  FGDRVK W+T+NEP ++
Sbjct  143   EIEPYVTLYHWDLPQALEDRYKGWLNRTIVEDFAVYAETCFKAFGDRVKHWITLNEPHTV  202

Query  1028  TVLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGG  1207
               +GYD G+ APG CS+  HL C +G+S TEPY V H+ +LAHA   DIYRRKY+A Q G
Sbjct  203   ATMGYDTGLEAPGRCSVLLHLHCRSGDSHTEPYIVGHNFILAHATVADIYRRKYKATQRG  262

Query  1208  KITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFS  1387
             ++ I +   WYEP+TN+  DI+A +RA +F LGWF +P   G+YP S+ +R+GDRLPKF+
Sbjct  263   QLGIALNVVWYEPMTNTRTDIEAAKRAQEFQLGWFADPFFFGDYPESMRARIGDRLPKFT  322

Query  1388  AAESALLKGSYDYLGVNHYTTWYASSTDT---NIMGLFLHDTLTDSGTFTLPFKGLMPIG  1558
             A E+AL+KGS D++G+NHYTT Y   ++T     MGL L  T+ D+G  ++PF    P G
Sbjct  323   ADEAALVKGSLDFVGINHYTTHYTMDSNTVSSTAMGLLLDGTMADTGAVSVPFDIKNPTG  382

Query  1559  ERANAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDA------KTDGLNDIKRIRY  1720
             +RAN++WLYIVP GMR +MNY+K++Y +P V+ITENGMDD+      K + L D KRI+Y
Sbjct  383   DRANSLWLYIVPWGMRKVMNYVKERYKSPPVYITENGMDDSNNPLIPKEEALKDSKRIKY  442

Query  1721  HRDYLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESA  1900
             H DYL +L A+IKEDGC+V+GYF WSL+DNWEW  G++SRFGLY+VDY++NL R PK S 
Sbjct  443   HHDYLTNLAASIKEDGCDVRGYFVWSLLDNWEWIAGYTSRFGLYFVDYENNLERCPKSSV  502

Query  1901  KWFKNFLAS  1927
             +WFK  L S
Sbjct  503   QWFKTLLRS  511



>ref|XP_004490145.1| PREDICTED: beta-glucosidase 40-like [Cicer arietinum]
Length=501

 Score =   659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/484 (63%), Positives = 390/484 (81%), Gaps = 8/484 (2%)
 Frame = +2

Query  491   LQICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPG-KVTDFSNA  667
             +++C +Q I+R SFP+ FVFGTAS+A+Q+EGAVKEDGRG ++WDTF+H+ G K+   SNA
Sbjct  18    IRMCVSQ-INRQSFPKDFVFGTASSAFQYEGAVKEDGRGPSVWDTFSHSNGGKILRNSNA  76

Query  668   DVAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLAN  847
             DVAVDQYHR+  D+ +MKDMGMDAYRFSI+W+RIFPNG G +NQAGVDHYN LIDALLA 
Sbjct  77    DVAVDQYHRFEGDVHIMKDMGMDAYRFSISWTRIFPNGFGVVNQAGVDHYNKLIDALLAK  136

Query  848   GIEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSI  1027
             GIEPYVTLYH+DLPQALE++Y GWL+  +IKDFA YAE CF  FGDRVK W+T NEP + 
Sbjct  137   GIEPYVTLYHWDLPQALEDKYKGWLSPLIIKDFATYAEICFQKFGDRVKHWITFNEPHTF  196

Query  1028  TVLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGG  1207
              ++GYD+G+  PG CSI  H LC +GNS+TEPY VAH++L++HA   DIYR+KY+  QGG
Sbjct  197   CMMGYDVGLQPPGRCSILLHKLCSSGNSSTEPYIVAHNVLISHAVVADIYRKKYKKIQGG  256

Query  1208  KITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFS  1387
              + I ++  W+E  TNS  DI+A QRA+DF LGWFL+P++ G+YP+S+ SRVG RLPKFS
Sbjct  257   SVGISLDVIWFESATNSKEDIEATQRALDFTLGWFLDPLIFGDYPKSMKSRVGSRLPKFS  316

Query  1388  AAESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERA  1567
              ++++L+KGS D++G+NHYTT+YA    ++++ + LHD ++DS   TLPF G   IGERA
Sbjct  317   KSQTSLVKGSLDFVGINHYTTFYAMHNGSDLLQVALHDYISDSAALTLPFNGTEIIGERA  376

Query  1568  NAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAK------TDGLNDIKRIRYHRD  1729
             N++WLYIVP+GMR+ MNYIK KYGNPL+ ITENGMDD         D L D KRIRYH D
Sbjct  377   NSLWLYIVPQGMRSTMNYIKQKYGNPLLIITENGMDDPNDPSISINDALKDDKRIRYHND  436

Query  1730  YLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWF  1909
             YL +LLA+IKEDGCNVKGYF WSL+DNWEW  G++SRFGLY++DY+DNL+R PK+S +WF
Sbjct  437   YLNNLLASIKEDGCNVKGYFVWSLLDNWEWQAGYTSRFGLYFIDYNDNLKRYPKKSVEWF  496

Query  1910  KNFL  1921
             KNFL
Sbjct  497   KNFL  500



>ref|XP_009775820.1| PREDICTED: beta-glucosidase 40-like isoform X2 [Nicotiana sylvestris]
Length=499

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/484 (65%), Positives = 380/484 (79%), Gaps = 16/484 (3%)
 Frame = +2

Query  497   ICGAQ-NISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADV  673
             IC A+ NI+R SFPEGFVFGTASAAYQ+EGAVKEDG G TIWD FAHT          DV
Sbjct  24    ICLAEENINRRSFPEGFVFGTASAAYQYEGAVKEDGSGPTIWDKFAHT---------FDV  74

Query  674   AVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGI  853
             A+D YHR+ EDI+LMKDMGMDA+R SIAWSRIFPNG+GK+NQAGVDHYN +ID+LLANGI
Sbjct  75    ALDHYHRFQEDIQLMKDMGMDAFRLSIAWSRIFPNGSGKINQAGVDHYNKVIDSLLANGI  134

Query  854   EPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITV  1033
             EPYVTLYH+DLP ALE++Y GWL+  +I+DFA YAETCF+ FGDRVK W+T+NEP +   
Sbjct  135   EPYVTLYHWDLPLALEDKYKGWLSPDIIQDFAIYAETCFVAFGDRVKHWITLNEPHNFVQ  194

Query  1034  LGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKI  1213
              GYDLG   PG CSI  H  C  GNS TEPY  AH+ LLAHA AV+IYR+KY+  Q G I
Sbjct  195   QGYDLGSQPPGRCSIILHAFCSEGNSGTEPYIAAHNALLAHATAVNIYRQKYKQNQQGSI  254

Query  1214  TIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAA  1393
              I ++S+WYE  TN   DI+A QRA+DF LGWF+EP++ G YP ++ISR G RLPKFS  
Sbjct  255   GISLDSYWYESATNHKEDIEATQRALDFQLGWFIEPLVFGNYPSTMISRAGSRLPKFSQE  314

Query  1394  ESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANA  1573
             ES+LLKGS+D++G+NHYTTWYA S  TN++G   +DT +DSG   LP +   PI +RAN+
Sbjct  315   ESSLLKGSFDFIGINHYTTWYARSNITNLIGFLFNDTTSDSGATVLPLRLGKPIPDRANS  374

Query  1574  VWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDD------AKTDGLNDIKRIRYHRDYL  1735
             VWL+IVP G+R+LMNYI+ KYGNP + ITENGMDD      ++ D L D KRI+YH+DYL
Sbjct  375   VWLFIVPHGIRSLMNYIRVKYGNPTIIITENGMDDPNSLFISRKDALKDEKRIKYHKDYL  434

Query  1736  KSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKN  1915
              +LLA+I+EDGCNVKGYF WSL+DNWEW  GFSSRFGLYYVDY+DNL+R PK S KWF N
Sbjct  435   TNLLASIREDGCNVKGYFVWSLLDNWEWQEGFSSRFGLYYVDYNDNLKRYPKNSVKWFNN  494

Query  1916  FLAS  1927
             FL+S
Sbjct  495   FLSS  498



>gb|EEC66726.1| hypothetical protein OsI_33062 [Oryza sativa Indica Group]
Length=510

 Score =   659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/488 (63%), Positives = 382/488 (78%), Gaps = 11/488 (2%)
 Frame = +2

Query  494   QICGAQN----ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFS  661
             Q C AQN    ++R SFP GFVFGTAS+AYQ+EGAVKEDGRG TIWD FAHT GK+ DFS
Sbjct  22    QGCDAQNTTGGLTRKSFPNGFVFGTASSAYQYEGAVKEDGRGPTIWDKFAHTFGKIIDFS  81

Query  662   NADVAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALL  841
             NADVAVDQYHR+ EDI+LM DMGMDAYRFSIAWSRIFPNGTG++NQAG+DHYN LI+ALL
Sbjct  82    NADVAVDQYHRFEEDIQLMADMGMDAYRFSIAWSRIFPNGTGEVNQAGIDHYNKLINALL  141

Query  842   ANGIEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPR  1021
             A GIEPYVTLYH+DLPQALE++Y GWL+RQ+I D+A YAETCF  FGDRVK W+T NEP 
Sbjct  142   AKGIEPYVTLYHWDLPQALEDKYTGWLDRQIINDYAVYAETCFQAFGDRVKHWITFNEPH  201

Query  1022  SITVLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQ  1201
             ++ V  YD G+HAPG CS+  HL C  GNS TEPY VAH+++L+HA   DIYR+KY+A Q
Sbjct  202   TVAVQAYDSGMHAPGRCSVLLHLYCKKGNSGTEPYIVAHNMILSHATVSDIYRKKYKASQ  261

Query  1202  GGKITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPK  1381
              G++ I  +  WYEP++NS ADI+A +RA +F LGWF +P   G+YP ++ SRVG RLPK
Sbjct  262   NGELGISFDVIWYEPMSNSTADIEAAKRAQEFQLGWFADPFFFGDYPATMRSRVGSRLPK  321

Query  1382  FSAAESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGE  1561
             F+  E+AL+ GS D++G+NHYTT+Y     + ++   L++TL D+ T ++PF+   PIG+
Sbjct  322   FTEKEAALVNGSLDFMGINHYTTFYTKDDQSTVIEKLLNNTLADTATISVPFRNGQPIGD  381

Query  1562  RANAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYH  1723
             RAN++WLYIVPR MR LMNY+KD+Y  P V+ITENGMDD  +      + L D KR +YH
Sbjct  382   RANSIWLYIVPRSMRILMNYVKDRYNKPTVYITENGMDDGNSPFISLKNALKDDKRTKYH  441

Query  1724  RDYLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAK  1903
              DYL +L  +I+EDGC+V+GYFAWSL+DNWEW  G++SRFGLYYVDY  N +R PK S +
Sbjct  442   NDYLTNLADSIREDGCDVRGYFAWSLLDNWEWAAGYTSRFGLYYVDY-KNRKRYPKNSVQ  500

Query  1904  WFKNFLAS  1927
             WFKN LAS
Sbjct  501   WFKNLLAS  508



>ref|NP_001064347.1| Os10g0323500 [Oryza sativa Japonica Group]
 sp|Q339X2.1|BGL34_ORYSJ RecName: Full=Beta-glucosidase 34; Short=Os10bglu34; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|ABB47155.1| Glycosyl hydrolase family 1 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26261.1| Os10g0323500 [Oryza sativa Japonica Group]
 dbj|BAG92457.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE50740.1| hypothetical protein OsJ_31060 [Oryza sativa Japonica Group]
Length=510

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/488 (63%), Positives = 382/488 (78%), Gaps = 11/488 (2%)
 Frame = +2

Query  494   QICGAQN----ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFS  661
             Q C AQN    ++R SFP GFVFGTAS+AYQ+EGAVKEDGRG TIWD FAHT GK+ DFS
Sbjct  22    QGCDAQNTTGGLTRKSFPNGFVFGTASSAYQYEGAVKEDGRGPTIWDKFAHTFGKIIDFS  81

Query  662   NADVAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALL  841
             NADVAVDQYHR+ EDI+LM DMGMDAYRFSI+WSRIFPNGTG++NQAG+DHYN LI+ALL
Sbjct  82    NADVAVDQYHRFEEDIQLMADMGMDAYRFSISWSRIFPNGTGEVNQAGIDHYNKLINALL  141

Query  842   ANGIEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPR  1021
             A GIEPYVTLYH+DLPQALE++Y GWL+RQ+I D+A YAETCF  FGDRVK W+T NEP 
Sbjct  142   AKGIEPYVTLYHWDLPQALEDKYTGWLDRQIINDYAVYAETCFQAFGDRVKHWITFNEPH  201

Query  1022  SITVLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQ  1201
             ++ V  YD G+HAPG CS+  HL C  GNS TEPY VAH+++L+HA   DIYR+KY+A Q
Sbjct  202   TVAVQAYDSGMHAPGRCSVLLHLYCKKGNSGTEPYIVAHNMILSHATVSDIYRKKYKASQ  261

Query  1202  GGKITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPK  1381
              G++ I  +  WYEP++NS ADI+A +RA +F LGWF +P   G+YP ++ SRVG RLPK
Sbjct  262   NGELGISFDVIWYEPMSNSTADIEAAKRAQEFQLGWFADPFFFGDYPATMRSRVGSRLPK  321

Query  1382  FSAAESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGE  1561
             F+  E+AL+ GS D++G+NHYTT+Y     + ++   L++TL D+ T ++PF+   PIG+
Sbjct  322   FTEKEAALVNGSLDFMGINHYTTFYTKDDQSTVIEKLLNNTLADTATISVPFRNGQPIGD  381

Query  1562  RANAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYH  1723
             RAN++WLYIVPR MR LMNY+KD+Y  P V+ITENGMDD  +      + L D KR +YH
Sbjct  382   RANSIWLYIVPRSMRILMNYVKDRYNKPTVYITENGMDDGNSPFISLKNALKDDKRTKYH  441

Query  1724  RDYLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAK  1903
              DYL +L  +I+EDGC+V+GYFAWSL+DNWEW  G++SRFGLYYVDY  N +R PK S +
Sbjct  442   NDYLTNLADSIREDGCDVRGYFAWSLLDNWEWAAGYTSRFGLYYVDY-KNRKRYPKNSVQ  500

Query  1904  WFKNFLAS  1927
             WFKN LAS
Sbjct  501   WFKNLLAS  508



>gb|AES96995.2| beta-glucosidase [Medicago truncatula]
Length=521

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/504 (63%), Positives = 386/504 (77%), Gaps = 28/504 (6%)
 Frame = +2

Query  491   LQICGAQNISRASFPEGFVFGTASAAYQ---------------------FEGAVKEDGRG  607
             +Q+C  Q I+R SFP+GFVFGTAS+A+Q                     +EGAVKEDGRG
Sbjct  18    IQMCLCQ-INRHSFPKGFVFGTASSAFQLSWLERVAVNHKVGGSTPPSSYEGAVKEDGRG  76

Query  608   ATIWDTFAHTPGKVTDFSNADVAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTG  787
              +IWDTF+H PGK+   +N+DVAVDQYHRY  DI+LMKDMGMDAYRFSI+W+RIFPNG+G
Sbjct  77    PSIWDTFSHIPGKIHGNNNSDVAVDQYHRYEGDIQLMKDMGMDAYRFSISWTRIFPNGSG  136

Query  788   KLNQAGVDHYNNLIDALLANGIEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETC  967
              +NQAG+DHYN LIDALLA GIEPYVTLYH+DLPQALE++Y GWL+  +IKDFA YAETC
Sbjct  137   VVNQAGIDHYNKLIDALLAKGIEPYVTLYHWDLPQALEDKYTGWLSPLIIKDFATYAETC  196

Query  968   FLIFGDRVKQWVTINEPRSITVLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhll  1147
             F  FGDRVK W+T NEP +   +GYD+G   PG CSI  H LC +GNSATEPY VAH++L
Sbjct  197   FEKFGDRVKHWITFNEPHTFAWMGYDIGQQPPGRCSILLHHLCRSGNSATEPYIVAHNVL  256

Query  1148  lahaaaVDIYRRKYQAKQGGKITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVM  1327
             L+HA   D+YR+KYQ  QGG + I ++  W E  TNS  DI+A QRA+DF LGWFL+P++
Sbjct  257   LSHAIVADVYRKKYQKIQGGSVGISLDVIWVESATNSKEDIEATQRALDFTLGWFLDPLI  316

Query  1328  TGEYPRSVISRVGDRLPKFSAAESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTL  1507
              G+YP+S+  RVG RLPKFS +E+ L+KGS D++G+NHYTT+YA    T+ +   +HD +
Sbjct  317   FGDYPKSMKIRVGKRLPKFSKSEANLVKGSLDFVGINHYTTFYAMHNATDSLRELVHDYI  376

Query  1508  TDSGTFTLPFKGLMPIGERANAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAK-  1684
             +D G  T+PF G   IG++AN+ WLYIVP+GMR+LMNYIK KY NPLV ITENGMDD   
Sbjct  377   SDIGAVTVPFNGTEIIGDKANSFWLYIVPQGMRSLMNYIKHKYENPLVIITENGMDDPND  436

Query  1685  -----TDGLNDIKRIRYHRDYLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGL  1849
                   D LND KRI+YH DYL +LLA+IKEDGCNVKGYF WSL+DNWEW  GFSSRFGL
Sbjct  437   PSISIKDALNDEKRIKYHNDYLSNLLASIKEDGCNVKGYFVWSLLDNWEWQAGFSSRFGL  496

Query  1850  YYVDYDDNLRRIPKESAKWFKNFL  1921
             Y++DY+DNLRR PK+S +WFKNFL
Sbjct  497   YFIDYNDNLRRYPKKSVEWFKNFL  520



>ref|XP_010521463.1| PREDICTED: beta-glucosidase 40-like isoform X3 [Tarenaya hassleriana]
Length=498

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/483 (64%), Positives = 382/483 (79%), Gaps = 25/483 (5%)
 Frame = +2

Query  512   NISRASFPEGFVFGTASAAYQ-----FEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVA  676
             +I+RASFP GFVFGTASAA+Q     +EGAVKEDGRG ++WDTF+HT GK+ DFSNADVA
Sbjct  27    DINRASFPNGFVFGTASAAFQGNLLQYEGAVKEDGRGPSVWDTFSHTLGKIADFSNADVA  86

Query  677   VDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIE  856
             VDQYHRY EDI+LMK+MGMDAYRFSI+W+RIFPNGTG++NQAG+DHYN LI+ALLA GI+
Sbjct  87    VDQYHRYEEDIQLMKNMGMDAYRFSISWTRIFPNGTGQINQAGIDHYNKLINALLAQGIQ  146

Query  857   PYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVL  1036
             PYVTLYH+DLPQAL +RYNGWL+ Q+I D+A YAE CF  FGDRVK W+T NEP +  + 
Sbjct  147   PYVTLYHWDLPQALHDRYNGWLSPQIINDYATYAEVCFENFGDRVKHWITFNEPHTFAIQ  206

Query  1037  GYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKIT  1216
             GYD+G+ APG CSI   L C  GNSATEPY VAH++LL+HA   DIYR+KY+AKQGG + 
Sbjct  207   GYDVGLQAPGRCSILLRLFCRGGNSATEPYIVAHNVLLSHATVSDIYRKKYKAKQGGWLG  266

Query  1217  IVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAE  1396
             I  +  WYEP TN+  DI+A QRA DF LGWFL+P+M G+YP S+ SRVG RLP+F+A+E
Sbjct  267   IAFDVIWYEPETNTREDIEAAQRAQDFQLGWFLDPLMFGDYPNSMRSRVGKRLPRFTASE  326

Query  1397  SALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAV  1576
             +A++KGS D++G+NHYTT+YA +  TN++G  L+D + DSG FT+PFKGL  IG+RAN++
Sbjct  327   AAMVKGSLDFVGINHYTTYYARNNKTNLIGTLLNDAIADSGAFTVPFKGLQTIGDRANSI  386

Query  1577  WLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDD------AKTDGLNDIKRIRYHRDYLK  1738
             WLYIVP+GMRNLMNYI+ +YGNP V ITENGMDD      ++ + L D KR         
Sbjct  387   WLYIVPQGMRNLMNYIRIRYGNPPVIITENGMDDPNNILISRENALKDEKR---------  437

Query  1739  SLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNF  1918
                  I EDGCNVKGYF WSL+DNWEW  G++SRFGLY+VDY DNL+R PK S +WF +F
Sbjct  438   -----ISEDGCNVKGYFVWSLLDNWEWAAGYTSRFGLYFVDYRDNLKRYPKNSVRWFTSF  492

Query  1919  LAS  1927
             L S
Sbjct  493   LNS  495



>ref|XP_003574944.1| PREDICTED: beta-glucosidase 34-like [Brachypodium distachyon]
Length=515

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/479 (62%), Positives = 382/479 (80%), Gaps = 6/479 (1%)
 Frame = +2

Query  509   QNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQY  688
              N++R SFP+GFVFGTA++AYQ+EGAVKEDGRG  IWD FAHT GK+ DFSNADVAVD Y
Sbjct  36    SNLTRGSFPKGFVFGTAASAYQYEGAVKEDGRGPAIWDKFAHTFGKILDFSNADVAVDHY  95

Query  689   HRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVT  868
             HR+ EDIELM DMG+DAYRFSIAWSRI PNGTG++NQAG+DHYN +I+AL+A GIEPYVT
Sbjct  96    HRFEEDIELMADMGLDAYRFSIAWSRILPNGTGEVNQAGIDHYNKVINALIAKGIEPYVT  155

Query  869   LYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDL  1048
             LYH+DLPQALE++Y G L+RQ+I D+ AYAETCF  FGDRVK W+T NEP ++TV GYD 
Sbjct  156   LYHWDLPQALEDKYMGLLDRQIINDYLAYAETCFEAFGDRVKHWITFNEPHTVTVQGYDS  215

Query  1049  GVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVE  1228
             G+HAPG CS+  HL C  G+S TEPY VAH+++LAHA   D+YR KY+AKQ G++ + ++
Sbjct  216   GIHAPGRCSVLRHLYCKQGSSGTEPYIVAHNIILAHATVSDMYRTKYKAKQNGELGMSLD  275

Query  1229  SFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALL  1408
               WYEP +NS AD++A +RA +F LGWF +P   G+YP ++ SRVG RLP+F+  E+ L+
Sbjct  276   VIWYEPASNSTADVEATKRAQEFQLGWFADPFFFGDYPVTMRSRVGVRLPRFTTKEADLV  335

Query  1409  KGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYI  1588
             KGS D++G+NHYTT+Y    ++  +  FL+DTL DSG+ +LPF+   PIG++AN++WLYI
Sbjct  336   KGSLDFMGINHYTTFYTKDDNSTYIKKFLNDTLADSGSISLPFRDGKPIGDKANSIWLYI  395

Query  1589  VPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLKSLLA  1750
             VP  MR+LMNY+KD+Y  P V+ITENGMDD+ +        L D KRI+YH DY+ +L  
Sbjct  396   VPGSMRSLMNYVKDRYNTPTVYITENGMDDSNSPFISLKKALKDRKRIKYHNDYMTNLAD  455

Query  1751  AIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
             +I+EDGC+V+GYF WSL+DNWEWT G++SRFGLYYVDY DNL+R PK S +WFK+ LAS
Sbjct  456   SIREDGCDVRGYFVWSLLDNWEWTAGYTSRFGLYYVDYRDNLKRYPKNSVQWFKDLLAS  514



>gb|AAK92581.1|AC074354_15 Putative beta-glucosidase [Oryza sativa Japonica Group]
Length=515

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/493 (61%), Positives = 379/493 (77%), Gaps = 16/493 (3%)
 Frame = +2

Query  494   QICGAQN----ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFS  661
             Q C AQN    ++R SFP GFVFGTAS+AYQ+EGAVKEDGRG TIWD FAHT GK+ DFS
Sbjct  22    QGCDAQNTTGGLTRKSFPNGFVFGTASSAYQYEGAVKEDGRGPTIWDKFAHTFGKIIDFS  81

Query  662   NADVAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALL  841
             NADVAVDQYHR+ EDI+LM DMGMDAYRFSI+WSRIFPNGTG++NQAG+DHYN LI+ALL
Sbjct  82    NADVAVDQYHRFEEDIQLMADMGMDAYRFSISWSRIFPNGTGEVNQAGIDHYNKLINALL  141

Query  842   ANGIEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPR  1021
             A GIEPYVTLYH+DLPQALE++Y GWL+RQ+I D+A YAETCF  FGDRVK W+T NEP 
Sbjct  142   AKGIEPYVTLYHWDLPQALEDKYTGWLDRQIINDYAVYAETCFQAFGDRVKHWITFNEPH  201

Query  1022  SITVLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQ  1201
             ++ V  YD G+HAPG CS+  HL C  GNS TEPY VAH+++L+HA   DIYR+KY+A Q
Sbjct  202   TVAVQAYDSGMHAPGRCSVLLHLYCKKGNSGTEPYIVAHNMILSHATVSDIYRKKYKASQ  261

Query  1202  GGKITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPK  1381
              G++ I  +  WYEP++NS ADI+A +RA +F LGWF +P   G+YP ++ SRVG RLPK
Sbjct  262   NGELGISFDVIWYEPMSNSTADIEAAKRAQEFQLGWFADPFFFGDYPATMRSRVGSRLPK  321

Query  1382  FSAAESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGE  1561
             F+  E+AL+ GS D++G+NHYTT+Y     + ++   L++TL D+ T ++PF+   PIG+
Sbjct  322   FTEKEAALVNGSLDFMGINHYTTFYTKDDQSTVIEKLLNNTLADTATISVPFRNGQPIGD  381

Query  1562  RANAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDD-----------AKTDGLNDIK  1708
             RAN++WLYIVPR MR LMNY+KD+Y  P V+ITENG              +  + L D K
Sbjct  382   RANSIWLYIVPRSMRILMNYVKDRYNKPTVYITENGKCTYVICDLFLPFISLKNALKDDK  441

Query  1709  RIRYHRDYLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIP  1888
             R +YH DYL +L  +I+EDGC+V+GYFAWSL+DNWEW  G++SRFGLYYVDY  N +R P
Sbjct  442   RTKYHNDYLTNLADSIREDGCDVRGYFAWSLLDNWEWAAGYTSRFGLYYVDY-KNRKRYP  500

Query  1889  KESAKWFKNFLAS  1927
             K S +WFKN LAS
Sbjct  501   KNSVQWFKNLLAS  513



>ref|XP_003517829.1| PREDICTED: beta-glucosidase 40-like [Glycine max]
Length=495

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/485 (63%), Positives = 382/485 (79%), Gaps = 16/485 (3%)
 Frame = +2

Query  491   LQICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNAD  670
             +QIC ++ I+R SFP+GFVFGTA++A+Q+EGAVKE GRG ++WDTF+H+ GK+ D SNAD
Sbjct  20    IQICLSE-INRQSFPKGFVFGTAASAFQYEGAVKEGGRGLSVWDTFSHSFGKIQDGSNAD  78

Query  671   VAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANG  850
             VAV+QYHRY ED++LMK+MGMDAYRFSI+WSRIFPNGT  +NQ G+DHYN LI+ALLA G
Sbjct  79    VAVNQYHRYDEDVQLMKEMGMDAYRFSISWSRIFPNGTRDINQEGIDHYNKLINALLAKG  138

Query  851   IEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSIT  1030
             IEPYVTLYH+DLPQALE++YNGWL+  +IKDFA YAE CF  FGDRVK W+T NEP +  
Sbjct  139   IEPYVTLYHWDLPQALEDKYNGWLSSLIIKDFATYAEICFQKFGDRVKHWITFNEPHTFA  198

Query  1031  VLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGK  1210
             ++GYDLG+ APG CS+     C  GNSATEPY VAH++L++HA   D+YR+KY+  QGG 
Sbjct  199   MMGYDLGLEAPGRCSV-----CGNGNSATEPYIVAHNVLISHAIVADVYRKKYKKIQGGS  253

Query  1211  ITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSA  1390
             I + ++  W+EP T+S  DI+A  RA+DF LGWFL+P++ G+YP S+ SRVG+RLPKFS 
Sbjct  254   IGMSLDVMWFEPATSSKEDIEATHRALDFQLGWFLDPLIFGDYPTSMRSRVGNRLPKFSK  313

Query  1391  AESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERAN  1570
             ++++LLKGS D++G+NHYTT+YA     NI     HD + DSG FT PF G   IGE+AN
Sbjct  314   SQASLLKGSLDFVGINHYTTFYA----FNIPRSSYHDYIADSGVFTFPFNGTNFIGEKAN  369

Query  1571  AVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAK------TDGLNDIKRIRYHRDY  1732
             ++WLYIVP GMRN MNYIK  YGNP+V +TENGMDD         D L D KRI+YH DY
Sbjct  370   SIWLYIVPHGMRNTMNYIKHTYGNPIVIVTENGMDDPNDPLISIKDALKDEKRIKYHNDY  429

Query  1733  LKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFK  1912
             L +L A+I EDGCNV+GYF WSL+DNWEW  GF+SRFGLY++DY DNL+R PK S +WFK
Sbjct  430   LINLQASITEDGCNVQGYFVWSLLDNWEWQSGFTSRFGLYFIDYKDNLKRYPKHSVEWFK  489

Query  1913  NFLAS  1927
             NFL S
Sbjct  490   NFLKS  494



>gb|EMS46293.1| Beta-glucosidase 34 [Triticum urartu]
Length=512

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/488 (61%), Positives = 380/488 (78%), Gaps = 10/488 (2%)
 Frame = +2

Query  494   QICGAQ-------NISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVT  652
             Q C AQ       N++R SFP+GFVFGTA++AYQ+EGAV  DGRG TIWD FAHT GK+ 
Sbjct  24    QGCNAQTRGSGNGNLTRGSFPKGFVFGTAASAYQYEGAVNVDGRGPTIWDKFAHTFGKIL  83

Query  653   DFSNADVAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLID  832
             DFSNADVAVD YHR+ EDI+LM DMG+DAYRFSIAWSRI PNG G++N AG++HYN +ID
Sbjct  84    DFSNADVAVDHYHRFQEDIQLMADMGLDAYRFSIAWSRILPNGAGEVNPAGINHYNKVID  143

Query  833   ALLANGIEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTIN  1012
             ALLA GI+PYVTLYH+DLPQALE++YNG L+RQ+I D+AAYAETCF  FGDRVK+W+T N
Sbjct  144   ALLAKGIKPYVTLYHWDLPQALEDKYNGLLDRQIINDYAAYAETCFKAFGDRVKRWITFN  203

Query  1013  EPRSITVLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQ  1192
             EP ++ V GYD G+HAPG CS+  HL C  G+S TEPY VAH+++LAHA   DIYR+KY+
Sbjct  204   EPHTVAVQGYDSGIHAPGRCSVLRHLCCKQGSSGTEPYIVAHNIILAHAMVSDIYRKKYK  263

Query  1193  AKQGGKITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDR  1372
             A+Q G++ + ++  WYEP++NS AD++A +RA +F LGWF +P   G+YP ++ SRVG R
Sbjct  264   AEQNGEVGMSLDVIWYEPVSNSTADVEATKRAQEFQLGWFADPFFFGDYPATMRSRVGQR  323

Query  1373  LPKFSAAESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMP  1552
             LP+F   E+ L+KGS D++G+NHYTT+Y     T ++   L+DTL DSG+ +LPF+    
Sbjct  324   LPRFMTKEADLVKGSLDFVGINHYTTFYTKEDHTTVIKYLLNDTLVDSGSVSLPFRNGKA  383

Query  1553  IGERANAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDD---AKTDGLNDIKRIRYH  1723
             IG++AN++WLYIVP  MR LMNY+KD+Y  P V+ITENG +    +    L D KRI YH
Sbjct  384   IGDKANSIWLYIVPGSMRRLMNYVKDRYNTPTVYITENGNNSPFISLKKALKDTKRINYH  443

Query  1724  RDYLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAK  1903
              DYL +L  +I+EDGC+V+GYF WSL+DNWEWT G++SRFGLY+VDY DNL+R PK S +
Sbjct  444   NDYLTNLADSIREDGCDVRGYFVWSLLDNWEWTAGYTSRFGLYFVDYKDNLKRYPKNSVQ  503

Query  1904  WFKNFLAS  1927
             WFKNFLAS
Sbjct  504   WFKNFLAS  511



>ref|XP_004297253.1| PREDICTED: beta-glucosidase 40-like isoform 1 [Fragaria vesca 
subsp. vesca]
 gb|AFU61920.1| beta-glucosidase 1 [Fragaria x ananassa]
Length=615

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/499 (63%), Positives = 386/499 (77%), Gaps = 26/499 (5%)
 Frame = +2

Query  500   CGAQN---ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNAD  670
             C +Q+   I+R SFP+GFVFGTAS+A+Q+EGAVKEDGRG ++WD F+HT GK+TDFSNAD
Sbjct  19    CSSQSNSEINRGSFPKGFVFGTASSAFQYEGAVKEDGRGPSVWDIFSHTFGKITDFSNAD  78

Query  671   VAVDQYH----RYLE----DIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNL  826
             VAVDQYH    R L+    D++LMKDMGMDAYRFSI+WSRIFPNGTG++NQAGVDHYNNL
Sbjct  79    VAVDQYHLYDARLLQPISGDVQLMKDMGMDAYRFSISWSRIFPNGTGQINQAGVDHYNNL  138

Query  827   IDALLANGIEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVT  1006
             I++LLA GIEPYVTLYH+DLPQALE+RY GWL+ Q+I+DFA YAETCF  FGDRVK W+T
Sbjct  139   INSLLAKGIEPYVTLYHWDLPQALEDRYTGWLDAQIIQDFAVYAETCFQKFGDRVKHWIT  198

Query  1007  INEPRSITVLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRK  1186
              NEP +  V GYD+G+ APG CS+   L C  GNSATEPY VAH+++L+HA   DIYR+K
Sbjct  199   FNEPHTFAVQGYDVGLQAPGRCSLLGRLFCRAGNSATEPYIVAHNVILSHATVADIYRKK  258

Query  1187  YQAKQGGKITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVG  1366
             Y+ KQ G I    +  WY   TNS ADI+A +RA DF LGWFL+P + G+YP S+ SRVG
Sbjct  259   YKPKQRGSIGASFDVIWYRSATNSTADIEATERAQDFQLGWFLDPFIFGDYPFSMRSRVG  318

Query  1367  DRLPKFSAAESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTL-----  1531
              RLPKFS +ES L+KGS D++G+NHYTT+YAS+  ++I+GL L+D+L+DSG   L     
Sbjct  319   SRLPKFSKSESTLIKGSLDFVGINHYTTFYASNDSSHIIGL-LNDSLSDSGAIALHSIFV  377

Query  1532  ---PFKGLMPIGERANAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT-----  1687
                 FK    IG++AN++WLYIVP GMR+LMNYIK KYGNP V ITENGMDD  +     
Sbjct  378   LFSAFKDGKAIGDKANSIWLYIVPEGMRSLMNYIKKKYGNPPVLITENGMDDPNSPFISL  437

Query  1688  -DGLNDIKRIRYHRDYLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDY  1864
              D L D KRI YHRDYL +LLA+IKEDGCNV GYFAWSL+DNWEW  G++SRFGLY++DY
Sbjct  438   KDALKDEKRISYHRDYLSNLLASIKEDGCNVNGYFAWSLLDNWEWGAGYTSRFGLYFIDY  497

Query  1865  DDNLRRIPKESAKWFKNFL  1921
              D L+R PK+S     + L
Sbjct  498   KDKLKRYPKDSGLALSSLL  516



>gb|EMT21383.1| Beta-glucosidase 6 [Aegilops tauschii]
Length=512

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/478 (61%), Positives = 376/478 (79%), Gaps = 3/478 (1%)
 Frame = +2

Query  503   GAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVD  682
             G  N++R SFP+GFVFGTA++AYQ+EGAV  DGRG TIWD FAHT GK+ DFSNADVAVD
Sbjct  34    GKDNLTRGSFPKGFVFGTAASAYQYEGAVNVDGRGPTIWDKFAHTFGKILDFSNADVAVD  93

Query  683   QYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPY  862
              YHR+ EDI+LM DMG+DAYRFSIAWSRI PNGTG++NQAG+ HYN +IDALLA  IEPY
Sbjct  94    HYHRFEEDIQLMADMGLDAYRFSIAWSRILPNGTGEVNQAGIVHYNKVIDALLAKEIEPY  153

Query  863   VTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGY  1042
             VTLYH+DLP ALE++YNG L+RQ+I D+AAYAETCF  FGDRVK+W+T NEP ++ V GY
Sbjct  154   VTLYHWDLPLALEDKYNGLLDRQIINDYAAYAETCFKAFGDRVKRWITFNEPHTVAVQGY  213

Query  1043  DLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIV  1222
             D G+HAPG CS+  HL C  G+S TEPY VAH+++LAHA   DIYR+KY+A+Q G++ + 
Sbjct  214   DSGIHAPGRCSVLRHLCCKQGSSGTEPYIVAHNIILAHATVSDIYRKKYKAEQNGEVGMS  273

Query  1223  VESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESA  1402
             ++  WYEP++NS A+++A +RA +F LGWF +P   G+YP ++ SRVG+RLP+F   E+ 
Sbjct  274   LDVIWYEPVSNSTANVEAAKRAQEFQLGWFADPFFFGDYPATMRSRVGERLPRFMTKEAH  333

Query  1403  LLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWL  1582
             L+KGS D++G+NHYTT+Y     + ++   L+DTL DSG+ +LPF+    IG++AN++WL
Sbjct  334   LVKGSLDFVGINHYTTFYTKEDHSTVIKYLLNDTLADSGSVSLPFRNGKAIGDKANSIWL  393

Query  1583  YIVPRGMRNLMNYIKDKYGNPLVFITENGMDD---AKTDGLNDIKRIRYHRDYLKSLLAA  1753
             YIVP  MR LMNY+KD+Y  P V+ITENG +    +    L D KRI YH DYL +L  +
Sbjct  394   YIVPGSMRRLMNYVKDRYNTPTVYITENGNNSPFISLKKALKDSKRINYHNDYLTNLADS  453

Query  1754  IKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
             I+EDGC+V+GYF WSL+DNWEWT G++SRFGLY+VDY DNL+R PK S +WFKN LAS
Sbjct  454   IREDGCDVRGYFVWSLLDNWEWTAGYTSRFGLYFVDYKDNLKRYPKNSVQWFKNLLAS  511



>ref|XP_007153535.1| hypothetical protein PHAVU_003G043600g, partial [Phaseolus vulgaris]
 gb|ESW25529.1| hypothetical protein PHAVU_003G043600g, partial [Phaseolus vulgaris]
Length=453

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/457 (64%), Positives = 364/457 (80%), Gaps = 11/457 (2%)
 Frame = +2

Query  575   FEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHRYLEDIELMKDMGMDAYRFSI  754
             +EGAVKEDGRG ++WDTF+H+ GK+ D SN DVAVDQYHRY ED++LMKD+GMDAYRFSI
Sbjct  1     YEGAVKEDGRGPSVWDTFSHSSGKIVDNSNGDVAVDQYHRYEEDVQLMKDIGMDAYRFSI  60

Query  755   AWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLYHYDLPQALENRYNGWLNRQV  934
             +WSRIFP G+G++NQAG+DHYN LI+ALLA GIEPYVTLYH+DLPQALE++Y GWL+  +
Sbjct  61    SWSRIFPYGSGEINQAGIDHYNKLINALLAKGIEPYVTLYHWDLPQALEDKYKGWLSPFI  120

Query  935   IKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGVHAPGHCSIFFHLLCPTGNSA  1114
             IK+FA YAE CF  FGDRVK W+T NEP +  ++GYD+G+ APG CSI  H LC  GNS+
Sbjct  121   IKEFARYAELCFEKFGDRVKHWITFNEPHTFAMMGYDVGLEAPGRCSILLHQLCRHGNSS  180

Query  1115  TEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESFWYEPLTNSPADIDAKQRAID  1294
             TEPY VAH++L +HA  VDIYR+KY+  QGG I I ++  W EP T+S  DI+A QRA+D
Sbjct  181   TEPYIVAHNVLNSHAVVVDIYRKKYKKIQGGSIGISLDVIWVEPATSSKEDIEAAQRALD  240

Query  1295  FYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKGSYDYLGVNHYTTWYASSTDT  1474
             F LGWFLEP++ G+YP  + SRVG+RLPKFS +++ LLKGS D++G+NHYTT Y  +   
Sbjct  241   FQLGWFLEPLVFGDYPVIMRSRVGNRLPKFSKSQANLLKGSLDFVGINHYTTLYVYN---  297

Query  1475  NIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVPRGMRNLMNYIKDKYGNPLVF  1654
               + + LHD + DSG  TLPF G   IGERAN++WLYIVP+GMR+ +NYIK KYGNPLV 
Sbjct  298   --VAVSLHDYIEDSGVLTLPFNGTNVIGERANSLWLYIVPQGMRSTLNYIKQKYGNPLVI  355

Query  1655  ITENGMDDAK------TDGLNDIKRIRYHRDYLKSLLAAIKEDGCNVKGYFAWSLMDNWE  1816
             +TENGMDD         D L D KRI+YH DYL +LLA+I+EDGCNVKGYFAWSL+DNWE
Sbjct  356   VTENGMDDPNEPSISIKDALKDEKRIKYHNDYLINLLASIEEDGCNVKGYFAWSLLDNWE  415

Query  1817  WTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
             W  GF+SRFGLY++DY DNL+R PK+S +WFKNFL S
Sbjct  416   WQSGFTSRFGLYFIDYKDNLKRYPKQSVQWFKNFLKS  452



>ref|XP_009775821.1| PREDICTED: beta-glucosidase 6-like isoform X3 [Nicotiana sylvestris]
Length=475

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/484 (63%), Positives = 362/484 (75%), Gaps = 40/484 (8%)
 Frame = +2

Query  497   ICGAQ-NISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADV  673
             IC A+ NI+R SFPEGFVFGTASAAYQ+EGAVKEDG G TIWD FAHT GK+ DFSNADV
Sbjct  24    ICLAEENINRRSFPEGFVFGTASAAYQYEGAVKEDGSGPTIWDKFAHTFGKILDFSNADV  83

Query  674   AVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGI  853
             A+D YHR+ EDI+LMKDMGMDA+R SIAWSRIFPNG+GK+NQAGVDHYN +ID+LLANGI
Sbjct  84    ALDHYHRFQEDIQLMKDMGMDAFRLSIAWSRIFPNGSGKINQAGVDHYNKVIDSLLANGI  143

Query  854   EPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITV  1033
             EPYVTLYH+DLP ALE++Y GWL+  +I+DFA YAETCF+ FGDRVK W+T+NEP +   
Sbjct  144   EPYVTLYHWDLPLALEDKYKGWLSPDIIQDFAIYAETCFVAFGDRVKHWITLNEPHNFVQ  203

Query  1034  LGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKI  1213
              GYDLG   PG CSI  H  C  GNS TEPY  AH+ LLAHA AV+IYR+KY+  Q G I
Sbjct  204   QGYDLGSQPPGRCSIILHAFCSEGNSGTEPYIAAHNALLAHATAVNIYRQKYKQNQQGSI  263

Query  1214  TIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAA  1393
              I ++S+WYE  TN   DI+A QRA+DF LGWF+EP++ G YP ++ISR G RLPKFS  
Sbjct  264   GISLDSYWYESATNHKEDIEATQRALDFQLGWFIEPLVFGNYPSTMISRAGSRLPKFSQE  323

Query  1394  ESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANA  1573
             ES+LLK                                 DSG   LP +   PI +RAN+
Sbjct  324   ESSLLK---------------------------------DSGATVLPLRLGKPIPDRANS  350

Query  1574  VWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDD------AKTDGLNDIKRIRYHRDYL  1735
             VWL+IVP G+R+LMNYI+ KYGNP + ITENGMDD      ++ D L D KRI+YH+DYL
Sbjct  351   VWLFIVPHGIRSLMNYIRVKYGNPTIIITENGMDDPNSLFISRKDALKDEKRIKYHKDYL  410

Query  1736  KSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKN  1915
              +LLA+I+EDGCNVKGYF WSL+DNWEW  GFSSRFGLYYVDY+DNL+R PK S KWF N
Sbjct  411   TNLLASIREDGCNVKGYFVWSLLDNWEWQEGFSSRFGLYYVDYNDNLKRYPKNSVKWFNN  470

Query  1916  FLAS  1927
             FL+S
Sbjct  471   FLSS  474



>ref|XP_008390041.1| PREDICTED: beta-glucosidase 40-like [Malus domestica]
Length=484

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/479 (63%), Positives = 362/479 (76%), Gaps = 36/479 (8%)
 Frame = +2

Query  509   QNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQY  688
              +I+R SFP+GFVFGTAS+A+Q+EGAVK DGRG +IWDTF+HT GK+ D SNADVAVD+Y
Sbjct  28    SDINRGSFPKGFVFGTASSAFQYEGAVKVDGRGPSIWDTFSHTFGKIADSSNADVAVDEY  87

Query  689   HRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVT  868
             H Y ED++ MKD+GMDAYRFSI+W+RIFPNGTG +NQAGVD+YN LIDALLA GIEPYVT
Sbjct  88    HHYKEDVQRMKDIGMDAYRFSISWTRIFPNGTGPINQAGVDYYNRLIDALLAKGIEPYVT  147

Query  869   LYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDL  1048
             LYH+DLPQALE++Y+GWLN QVIKDFA YA+ CF  FGDRVK W+T NEP + ++ GYD+
Sbjct  148   LYHWDLPQALEDKYSGWLNPQVIKDFATYADACFQNFGDRVKHWITFNEPHTFSIQGYDV  207

Query  1049  GVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVE  1228
             G+ APG CSI   L C  GNSATEPY VAH+++L+H  A DIYRRKY++KQ G +    +
Sbjct  208   GLEAPGRCSIPXXLFCRAGNSATEPYTVAHNVILSHGTAADIYRRKYKSKQRGSVGASFD  267

Query  1229  SFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALL  1408
               WYE  TNS AD+ A + A DF LGWFL+P M G+YP S+ SRVG RLP FS +ESAL+
Sbjct  268   VIWYESATNSTADVVATKIAQDFQLGWFLDPFMFGDYPSSMRSRVGSRLPTFSKSESALI  327

Query  1409  KGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYI  1588
             KGS D++G+NH                               FK   PIG+RAN++WLYI
Sbjct  328   KGSLDFVGINH------------------------------SFKDGKPIGDRANSIWLYI  357

Query  1589  VPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLKSLLA  1750
             VP GMR LMNYIK KYGNPLV ITENGMDD  +      D L D KRI+YH DYLK+LLA
Sbjct  358   VPEGMRKLMNYIKKKYGNPLVIITENGMDDPNSPFISLKDALKDTKRIKYHHDYLKNLLA  417

Query  1751  AIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
             +IKEDGCNVKGYFAWSL+DNWEW  G++SRFGLY+VDY D L+R PK+S +WF NFL S
Sbjct  418   SIKEDGCNVKGYFAWSLLDNWEWAAGYTSRFGLYFVDYKDKLKRYPKDSVQWFTNFLNS  476



>tpg|DAA44054.1| TPA: hypothetical protein ZEAMMB73_095768 [Zea mays]
Length=468

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/437 (64%), Positives = 354/437 (81%), Gaps = 7/437 (2%)
 Frame = +2

Query  638   PGKVTDFSNADVAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHY  817
             PGK++DFSNADVAVDQYHR+ ED++LM DMGMDAYRFSIAWSRI PNGTG++NQAG+DHY
Sbjct  31    PGKISDFSNADVAVDQYHRFEEDVQLMADMGMDAYRFSIAWSRILPNGTGQVNQAGIDHY  90

Query  818   NNLIDALLANGIEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQ  997
             N +I+ALL+ GI+PYVTLYH+DLPQALE+RYNGWL+RQ++ DFAAYAETCF  FGDRVK 
Sbjct  91    NKVINALLSKGIQPYVTLYHWDLPQALEDRYNGWLDRQIVNDFAAYAETCFKAFGDRVKH  150

Query  998   WVTINEPRSITVLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIY  1177
             W+T+NEP ++ V GYD G+HAPG CS+  HL C TGNS TEPY VAH+ +LAHA   D+Y
Sbjct  151   WITLNEPHTVAVQGYDAGLHAPGRCSVLLHLYCRTGNSGTEPYIVAHNFILAHATVSDMY  210

Query  1178  RRKYQAKQGGKITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVIS  1357
             RRKY+A Q G++ I  +  WYEP+TNS  DI+A +RA +F LGWF +P   G+YP ++ +
Sbjct  211   RRKYKAAQNGELGIAFDVIWYEPMTNSTIDIEATKRAQEFQLGWFADPFFFGDYPATMRA  270

Query  1358  RVGDRLPKFSAAESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPF  1537
             RVG+RLPKF+A E+AL+KG+ D++G+NHYTT+Y    DTNI+G  L+DTL D+GT +LPF
Sbjct  271   RVGERLPKFTADEAALVKGALDFMGINHYTTFYTRHNDTNIIGRLLNDTLADTGTISLPF  330

Query  1538  -KGLMPIGERANAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGL  1696
              K   PIG+RAN++WLYIVP G+R LMNY+K++Y +P V+ITENGMDD  +      + L
Sbjct  331   DKNGKPIGDRANSIWLYIVPSGIRKLMNYVKERYNSPTVYITENGMDDGNSPFTSLQNAL  390

Query  1697  NDIKRIRYHRDYLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNL  1876
              D KRI+YH  YL ++ A+IKEDGC+V+GYFAWSL+DNWEW  G++SRFGLY+VDY DNL
Sbjct  391   KDSKRIKYHNGYLNNVAASIKEDGCDVRGYFAWSLLDNWEWAAGYTSRFGLYFVDYKDNL  450

Query  1877  RRIPKESAKWFKNFLAS  1927
             +R PK S +WFK  L+S
Sbjct  451   KRHPKNSVQWFKTLLSS  467



>ref|XP_009775822.1| PREDICTED: beta-glucosidase 40-like isoform X4 [Nicotiana sylvestris]
Length=452

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/435 (66%), Positives = 346/435 (80%), Gaps = 6/435 (1%)
 Frame = +2

Query  641   GKVTDFSNADVAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYN  820
             GK+ DFSNADVA+D YHR+ EDI+LMKDMGMDA+R SIAWSRIFPNG+GK+NQAGVDHYN
Sbjct  17    GKILDFSNADVALDHYHRFQEDIQLMKDMGMDAFRLSIAWSRIFPNGSGKINQAGVDHYN  76

Query  821   NLIDALLANGIEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQW  1000
              +ID+LLANGIEPYVTLYH+DLP ALE++Y GWL+  +I+DFA YAETCF+ FGDRVK W
Sbjct  77    KVIDSLLANGIEPYVTLYHWDLPLALEDKYKGWLSPDIIQDFAIYAETCFVAFGDRVKHW  136

Query  1001  VTINEPRSITVLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYR  1180
             +T+NEP +    GYDLG   PG CSI  H  C  GNS TEPY  AH+ LLAHA AV+IYR
Sbjct  137   ITLNEPHNFVQQGYDLGSQPPGRCSIILHAFCSEGNSGTEPYIAAHNALLAHATAVNIYR  196

Query  1181  RKYQAKQGGKITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISR  1360
             +KY+  Q G I I ++S+WYE  TN   DI+A QRA+DF LGWF+EP++ G YP ++ISR
Sbjct  197   QKYKQNQQGSIGISLDSYWYESATNHKEDIEATQRALDFQLGWFIEPLVFGNYPSTMISR  256

Query  1361  VGDRLPKFSAAESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFK  1540
              G RLPKFS  ES+LLKGS+D++G+NHYTTWYA S  TN++G   +DT +DSG   LP +
Sbjct  257   AGSRLPKFSQEESSLLKGSFDFIGINHYTTWYARSNITNLIGFLFNDTTSDSGATVLPLR  316

Query  1541  GLMPIGERANAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDD------AKTDGLND  1702
                PI +RAN+VWL+IVP G+R+LMNYI+ KYGNP + ITENGMDD      ++ D L D
Sbjct  317   LGKPIPDRANSVWLFIVPHGIRSLMNYIRVKYGNPTIIITENGMDDPNSLFISRKDALKD  376

Query  1703  IKRIRYHRDYLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRR  1882
              KRI+YH+DYL +LLA+I+EDGCNVKGYF WSL+DNWEW  GFSSRFGLYYVDY+DNL+R
Sbjct  377   EKRIKYHKDYLTNLLASIREDGCNVKGYFVWSLLDNWEWQEGFSSRFGLYYVDYNDNLKR  436

Query  1883  IPKESAKWFKNFLAS  1927
              PK S KWF NFL+S
Sbjct  437   YPKNSVKWFNNFLSS  451



>ref|XP_008789189.1| PREDICTED: beta-glucosidase 25 isoform X1 [Phoenix dactylifera]
Length=497

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/481 (60%), Positives = 360/481 (75%), Gaps = 6/481 (1%)
 Frame = +2

Query  497   ICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVA  676
             +   + +SRA FP GFVFGTAS+AYQFEGAV E  RG +IWDTF   PG++ DFSNA++A
Sbjct  14    MASTKALSRADFPSGFVFGTASSAYQFEGAVNEGKRGDSIWDTFTRRPGRILDFSNAEIA  73

Query  677   VDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIE  856
             VDQYHRY  D +LMKDMGMDAYRFSI+WSRIFPNGTG+ N  G+ HYN+LIDALL  G++
Sbjct  74    VDQYHRYKTDADLMKDMGMDAYRFSISWSRIFPNGTGEPNPEGISHYNSLIDALLEKGLQ  133

Query  857   PYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVL  1036
             PYVTLYH+DLPQ+LE+RY+GWL+RQ+++DF  YA TCF  FGDRVK W+T NEP   ++ 
Sbjct  134   PYVTLYHWDLPQSLEDRYDGWLSRQIVEDFEHYACTCFEAFGDRVKHWITFNEPHGFSIQ  193

Query  1037  GYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKIT  1216
             GYDLG+ APG CSI  HLLC  G S+TEPY VAH++LL+HAA    Y+R ++AKQGG I 
Sbjct  194   GYDLGLQAPGRCSILSHLLCRKGKSSTEPYIVAHNILLSHAAVFHTYKRLFKAKQGGSIG  253

Query  1217  IVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAE  1396
             I ++S WYEP++++  D DA  RA+DF LGWFL+P++ G YPRS+ + VG RLPK ++  
Sbjct  254   IALDSKWYEPISDADEDHDAAHRAMDFELGWFLDPLIFGHYPRSMQNIVGSRLPKITSEM  313

Query  1397  SALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAV  1576
             S  L G+ D++G+NHYTT Y  +    I  L + D  TD+G  T  F+    IGE+A + 
Sbjct  314   SKSLAGTLDFVGINHYTTLYVRNDRIRIWNLVMDDASTDAGVITTSFRHGEMIGEKAASH  373

Query  1577  WLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLK  1738
             WL+IVP G R LM Y+K+KYGNPLV ITENGMDD           L D KRI YHRDYL 
Sbjct  374   WLHIVPWGFRKLMRYVKEKYGNPLVIITENGMDDLNNPFATLDKALEDNKRIHYHRDYLS  433

Query  1739  SLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNF  1918
             +L A I+EDGC+V+GYF WSL+DNWEW  G++ RFGLY+VDY +NL RIPK SAKWF++F
Sbjct  434   NLSAVIREDGCDVRGYFVWSLLDNWEWNSGYTVRFGLYFVDYRNNLTRIPKASAKWFRHF  493

Query  1919  L  1921
             L
Sbjct  494   L  494



>ref|XP_010910029.1| PREDICTED: beta-glucosidase 25 isoform X1 [Elaeis guineensis]
Length=497

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/481 (59%), Positives = 359/481 (75%), Gaps = 6/481 (1%)
 Frame = +2

Query  497   ICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVA  676
             +   + ++RA FP  FVFGTAS+A+QFEGAV E  RG +IWDTF   PG++ DFSNA++A
Sbjct  14    MASTEALTRADFPSDFVFGTASSAFQFEGAVNEGKRGDSIWDTFTRRPGRILDFSNAEIA  73

Query  677   VDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIE  856
             VDQYHRY  D++LMKDMGMDAYRFSI+WSRIFPNGTG+ N  G+ HYN+LIDALL  G++
Sbjct  74    VDQYHRYKTDVDLMKDMGMDAYRFSISWSRIFPNGTGEPNPEGISHYNSLIDALLEKGLQ  133

Query  857   PYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVL  1036
             PYVTLYH+DLPQ+LE+RY+GWL+RQ+++DF  YA TCF  FGDRVK W+T NEP   ++ 
Sbjct  134   PYVTLYHWDLPQSLEDRYDGWLSRQIVEDFEHYARTCFETFGDRVKHWITFNEPHGFSIQ  193

Query  1037  GYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKIT  1216
             GYD G+ APG CSI  HLLC  G S+TEPY VAH++LL+HAAA   Y+R ++AKQ G I 
Sbjct  194   GYDTGLQAPGRCSILSHLLCRKGKSSTEPYIVAHNILLSHAAAFHTYKRNFKAKQDGAIG  253

Query  1217  IVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAE  1396
             I ++S WYEP++++  D DA  RA+DF LGWFL+P++ G YPRS+ + VG RLP  ++  
Sbjct  254   IALDSKWYEPISDADEDQDAAHRAMDFELGWFLDPLIFGHYPRSMQNIVGSRLPNITSKM  313

Query  1397  SALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAV  1576
             S  L G+ D++G+NHYTT Y  +    I  L L D  TD+G     F+    IGERA + 
Sbjct  314   SKSLAGTLDFVGINHYTTLYVRNDRIRIWNLVLDDASTDAGVIATSFRHGEMIGERAASH  373

Query  1577  WLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLK  1738
             WL+IVP G+R LM YIK+KYGNPLV ITENGMDD+          L D KRI YH DYL 
Sbjct  374   WLHIVPWGIRKLMRYIKEKYGNPLVIITENGMDDSNNPFATLDKALEDNKRIHYHNDYLS  433

Query  1739  SLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNF  1918
             +L AA++EDGCNV+GYF WSL+DNWEW  G++ RFGLY+VDY DNL+RIPK S KWFK+F
Sbjct  434   NLSAAVREDGCNVRGYFVWSLLDNWEWNSGYTVRFGLYFVDYRDNLKRIPKASVKWFKHF  493

Query  1919  L  1921
             L
Sbjct  494   L  494



>ref|XP_011018314.1| PREDICTED: beta-glucosidase 40-like isoform X2 [Populus euphratica]
Length=442

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/439 (64%), Positives = 353/439 (80%), Gaps = 10/439 (2%)
 Frame = +2

Query  641   GKVTDFSNADVAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYN  820
             GK+ DFSNADVAVDQ+H + EDI+LMKDMGMDAYRFSI+W+RI+PNGTGK+NQAGVDHY 
Sbjct  3     GKIIDFSNADVAVDQFHHFDEDIKLMKDMGMDAYRFSISWTRIYPNGTGKINQAGVDHYK  62

Query  821   NLIDALLANGIEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQW  1000
               I+ALLA GIEPYVTL+H+DLPQAL +RY+GWL+ Q+IKDFA +AETCF  +GDRVK W
Sbjct  63    KFINALLAQGIEPYVTLFHWDLPQALHDRYSGWLSPQIIKDFATFAETCFQNYGDRVKNW  122

Query  1001  VTINEPRSITVLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYR  1180
             +T NEP ++++ GYD+G+ APG CSI  HL C  GNSATEPY VAH++LL+H AA DIYR
Sbjct  123   ITFNEPHTVSIQGYDVGLQAPGRCSILLHLFCRAGNSATEPYIVAHNMLLSHGAAADIYR  182

Query  1181  RKYQAKQGGKITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISR  1360
             +KY+AKQ G + I ++  W+EP TNS  DI+A QRA DF LGWF+EP++ G+YP S+ +R
Sbjct  183   KKYKAKQQGSVGISLDVIWFEPATNSTKDIEAAQRAQDFQLGWFIEPLILGDYPISMRNR  242

Query  1361  VGDRLPKFSAAESALLKGSYDYLGVNHYTTWYASSTDT---NIMGLFLHDTLTDSGTFTL  1531
             VGDRLPKF+  ++AL+KGS D++G+NHYTT+YA S D+   +++   L+D++ DSG  TL
Sbjct  243   VGDRLPKFTKNDAALVKGSLDFVGINHYTTFYARSNDSLLGDVIDKVLNDSVADSGAITL  302

Query  1532  PF-KGLMPIGERANAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------D  1690
             PF +   PIG+RAN++WLYIVP+GMR+LMN+I+ KYGNP V ITENGMDD         D
Sbjct  303   PFGENKKPIGDRANSIWLYIVPQGMRSLMNHIRQKYGNPPVIITENGMDDPNNALTPIKD  362

Query  1691  GLNDIKRIRYHRDYLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDD  1870
              L D KRIRYH DYL +LLA+IKEDGCNVKGYF WSL+DNWEW  G++SR GL +VDY D
Sbjct  363   ALKDRKRIRYHNDYLTNLLASIKEDGCNVKGYFVWSLLDNWEWAAGYTSRLGLCFVDYKD  422

Query  1871  NLRRIPKESAKWFKNFLAS  1927
              L+R PK+SA+WFK FL S
Sbjct  423   KLKRYPKDSAQWFKKFLTS  441



>ref|XP_010910030.1| PREDICTED: beta-glucosidase 25 isoform X2 [Elaeis guineensis]
Length=492

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/481 (59%), Positives = 358/481 (74%), Gaps = 11/481 (2%)
 Frame = +2

Query  497   ICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVA  676
             +   + ++RA FP  FVFGTAS+A+QFEGAV E  RG +IWDTF   PG++ DFSNA++A
Sbjct  14    MASTEALTRADFPSDFVFGTASSAFQFEGAVNEGKRGDSIWDTFTRRPGRILDFSNAEIA  73

Query  677   VDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIE  856
             VDQYHRY  D++LMKDMGMDAYRFSI+WSRIFPNGTG+ N  G+ HYN+LIDALL  G++
Sbjct  74    VDQYHRYKTDVDLMKDMGMDAYRFSISWSRIFPNGTGEPNPEGISHYNSLIDALLEKGLQ  133

Query  857   PYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVL  1036
             PYVTLYH+DLPQ+LE+RY+GWL+RQ+++DF  YA TCF  FGDRVK W+T NEP   ++ 
Sbjct  134   PYVTLYHWDLPQSLEDRYDGWLSRQIVEDFEHYARTCFETFGDRVKHWITFNEPHGFSIQ  193

Query  1037  GYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKIT  1216
             GYD G+ APG CSI  HLLC  G S+TEPY VAH++LL+HAAA   Y+R ++AKQ G I 
Sbjct  194   GYDTGLQAPGRCSILSHLLCRKGKSSTEPYIVAHNILLSHAAAFHTYKRNFKAKQDGAIG  253

Query  1217  IVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAE  1396
             I ++S WYEP++++  D DA  RA+DF LGWFL+P++ G YPRS+ + VG RLP  ++  
Sbjct  254   IALDSKWYEPISDADEDQDAAHRAMDFELGWFLDPLIFGHYPRSMQNIVGSRLPNITSKM  313

Query  1397  SALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAV  1576
             S  L G+ D++G+NHYTT Y  +    I  L L D  TD+      F+    IGERA + 
Sbjct  314   SKSLAGTLDFVGINHYTTLYVRNDRIRIWNLVLDDASTDAA-----FRHGEMIGERAASH  368

Query  1577  WLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLK  1738
             WL+IVP G+R LM YIK+KYGNPLV ITENGMDD+          L D KRI YH DYL 
Sbjct  369   WLHIVPWGIRKLMRYIKEKYGNPLVIITENGMDDSNNPFATLDKALEDNKRIHYHNDYLS  428

Query  1739  SLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNF  1918
             +L AA++EDGCNV+GYF WSL+DNWEW  G++ RFGLY+VDY DNL+RIPK S KWFK+F
Sbjct  429   NLSAAVREDGCNVRGYFVWSLLDNWEWNSGYTVRFGLYFVDYRDNLKRIPKASVKWFKHF  488

Query  1919  L  1921
             L
Sbjct  489   L  489



>gb|KHG19061.1| Beta-glucosidase 40 -like protein [Gossypium arboreum]
Length=411

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/410 (68%), Positives = 336/410 (82%), Gaps = 6/410 (1%)
 Frame = +2

Query  716   MKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLYHYDLPQA  895
             MKDMGMDAYRFSIAWSRIFPNGTG++NQAGVDHYNN I+ALL  GI+PYVTLYH+DLPQA
Sbjct  1     MKDMGMDAYRFSIAWSRIFPNGTGEINQAGVDHYNNFINALLVAGIQPYVTLYHWDLPQA  60

Query  896   LENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGVHAPGHCS  1075
             LE++YNGWL+ Q+IKDFA YAETCF +FGDRVK W+T NEP + TV GYD+G+ APG CS
Sbjct  61    LEDKYNGWLDPQIIKDFAMYAETCFKLFGDRVKYWITFNEPDTFTVQGYDVGLQAPGRCS  120

Query  1076  IFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESFWYEPLTN  1255
             I  HL C  GNS TEPY VAH++LL+HA+AVDIYR+KY+AKQ G + +     W+EP TN
Sbjct  121   IVLHLFCKAGNSGTEPYIVAHNVLLSHASAVDIYRKKYKAKQHGSVGVSFNVIWFEPETN  180

Query  1256  SPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKGSYDYLGV  1435
             S  D +A QRA DF LGWFL+P+M G+YP S+I+RVG RLP+F+ AESALLKGS D++G+
Sbjct  181   STEDTEAAQRAQDFQLGWFLDPLMFGDYPSSMITRVGSRLPRFTKAESALLKGSLDFVGI  240

Query  1436  NHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVPRGMRNLM  1615
             NHYTT+YA    TN++G  L+DT++DSG FTLPFK   PIG++AN++WLYIVPRGMR+LM
Sbjct  241   NHYTTFYARENKTNLIGSILNDTVSDSGAFTLPFKHGKPIGDKANSIWLYIVPRGMRSLM  300

Query  1616  NYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLKSLLAAIKEDGCNV  1777
             NY+K+KYGNP V +TENGMDD  +      + L D KRI+Y  DYL +LL AIKEDGCNV
Sbjct  301   NYVKEKYGNPPVIVTENGMDDPNSQFISIKNALKDEKRIKYLNDYLTNLLTAIKEDGCNV  360

Query  1778  KGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
             KGYF WSL+DNWEW  G+SSRFGLY++DY DNL+R PK+S KWFKNFL S
Sbjct  361   KGYFVWSLLDNWEWGAGYSSRFGLYFIDYKDNLKRYPKDSVKWFKNFLGS  410



>gb|EYU19188.1| hypothetical protein MIMGU_mgv1a004736mg [Erythranthe guttata]
Length=512

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/482 (59%), Positives = 353/482 (73%), Gaps = 6/482 (1%)
 Frame = +2

Query  500   CGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAV  679
             C  Q+ISRA FP GF FGTAS+AYQFEGAV E  +G +IWDTF   PG++ DFSNA+ AV
Sbjct  24    CDHQSISRADFPVGFTFGTASSAYQFEGAVGEGNKGDSIWDTFIKRPGRILDFSNANTAV  83

Query  680   DQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEP  859
             DQYHR+  DIELMKD+GMDAYRFSI+WSRI PNGTG+ N  G+ +YNNLIDALL  GI+P
Sbjct  84    DQYHRFESDIELMKDLGMDAYRFSISWSRILPNGTGEPNPQGIQYYNNLIDALLIKGIQP  143

Query  860   YVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLG  1039
             + TLYH+DLPQ LE+ Y G+LN Q++KDF  YA  CF  FGDRVK W+T NEP    + G
Sbjct  144   FATLYHWDLPQILEDEYGGFLNNQIVKDFENYACICFKAFGDRVKNWITFNEPHGFAIQG  203

Query  1040  YDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITI  1219
             YDLGV APG CSI  HL+C TG S+ EPY VAH++LLAHAAA   Y+ +++ +QGG + I
Sbjct  204   YDLGVQAPGRCSILGHLICKTGISSVEPYIVAHNILLAHAAAYRTYQTRFKERQGGIVGI  263

Query  1220  VVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAES  1399
              +++ WYEP+++S  DIDA  RA+DF LGWFL+P++ GEYP S+   V +RLPK +   S
Sbjct  264   TLDAKWYEPISDSDEDIDAAARALDFGLGWFLDPLLLGEYPVSMQKLVAERLPKITNETS  323

Query  1400  ALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVW  1579
              LLKGS D++G+NHYTT YA +  T I    + D  +DS   T   K  + IGER+ + W
Sbjct  324   QLLKGSLDFVGINHYTTLYARNDRTRIRKFVMQDASSDSAVITTSSKHGIAIGERSASRW  383

Query  1580  LYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAK------TDGLNDIKRIRYHRDYLKS  1741
             L+IVP G+R L NYIKDKYGNP+V ITENGMDD           L D KRI YHRDYL +
Sbjct  384   LHIVPWGIRKLANYIKDKYGNPVVIITENGMDDPNRSHAELEKALRDDKRIDYHRDYLSN  443

Query  1742  LLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             L AAIKED C+++GYF WSL+DNWEW +G++ RFGLYYVD+ +NL RIPK S  WFKN L
Sbjct  444   LSAAIKEDNCDIRGYFVWSLLDNWEWNMGYTVRFGLYYVDFKNNLTRIPKSSVNWFKNML  503

Query  1922  AS  1927
              S
Sbjct  504   TS  505



>dbj|BAJ98823.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=505

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/480 (59%), Positives = 357/480 (74%), Gaps = 6/480 (1%)
 Frame = +2

Query  506   AQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQ  685
             A+ I RA FP GF FGTAS+AYQ+EGAV E  RG TIWDT A  PG+V DFSNADVAVD 
Sbjct  17    AEAIRRADFPPGFTFGTASSAYQYEGAVNEGQRGPTIWDTLASRPGRVIDFSNADVAVDH  76

Query  686   YHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYV  865
             YHRY ED++LMKD+G+DAYRFSI+W+RIFPNGTGK N+ G+ +YN+LID LL  GI+PYV
Sbjct  77    YHRYKEDVDLMKDIGVDAYRFSISWARIFPNGTGKPNEEGLSYYNSLIDVLLEKGIQPYV  136

Query  866   TLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYD  1045
             TL+H+DLPQALE++Y GWLN Q+++DF  YA TCF  FGDRVK W+TINEP +  + GYD
Sbjct  137   TLFHWDLPQALEDKYGGWLNSQIVEDFVHYASTCFKEFGDRVKHWITINEPHNFAIDGYD  196

Query  1046  LGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVV  1225
              G+ APG CSI  HL C  G S+TEPY VAH++LLAHA     Y++ ++ +QGG I I +
Sbjct  197   FGIQAPGRCSILSHLFCKDGKSSTEPYIVAHNILLAHAGVFHAYKQHFKKEQGGLIGIAL  256

Query  1226  ESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESAL  1405
             +S WYEPL++   D +A  RA+DF LGWFL+P+M G YP S+   VGDRLP+FS  ES L
Sbjct  257   DSKWYEPLSDVDEDREAAARAMDFELGWFLDPLMFGHYPASMQKLVGDRLPQFSNQESQL  316

Query  1406  LKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLY  1585
             + GS D++G+NHYTT YA +    +  L ++D  TD+   T  ++    IGE A + WL+
Sbjct  317   VSGSLDFVGINHYTTVYARNDRMRVRKLIMNDASTDAAVITTAYRHGKRIGETAASSWLH  376

Query  1586  IVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLKSLL  1747
             IVP GM +LM ++KDKYGNP VFITENGMDDA +        L D KRI+YH DY+ +LL
Sbjct  377   IVPWGMFSLMKHVKDKYGNPPVFITENGMDDANSRFSKLETVLQDNKRIQYHNDYMSNLL  436

Query  1748  AAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
              AI+++GCN++GYF WSL+DNWEW  G++ RFGLYY+DYD+NL RIPK S +WF+  LA 
Sbjct  437   DAIRKEGCNIRGYFVWSLLDNWEWNSGYTVRFGLYYIDYDNNLTRIPKASVEWFRQVLAQ  496



>ref|XP_009414547.1| PREDICTED: beta-glucosidase 25-like [Musa acuminata subsp. malaccensis]
Length=527

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/479 (59%), Positives = 358/479 (75%), Gaps = 4/479 (1%)
 Frame = +2

Query  497   ICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVA  676
             I  +  ISRA FP GFVFGTAS+++QFEGAVKE  RG +IWDTF    GK+ DFSNADVA
Sbjct  43    IATSDAISRADFPSGFVFGTASSSFQFEGAVKEGNRGQSIWDTFTKRSGKILDFSNADVA  102

Query  677   VDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIE  856
             VDQYHRY  D++LMKD+GMDAYRFSI+W RIFPNGTG+ NQ G+ +YN LIDAL  NGI+
Sbjct  103   VDQYHRYKTDVDLMKDIGMDAYRFSISWPRIFPNGTGEPNQEGISYYNRLIDALQENGIQ  162

Query  857   PYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVL  1036
             PYVTL+H+DLPQALE+RYNGWL++++I+DF  YA TCF  FGDRVK W+T NEP   ++ 
Sbjct  163   PYVTLFHWDLPQALEDRYNGWLSQEIIQDFEHYAYTCFKAFGDRVKHWITFNEPHGFSIQ  222

Query  1037  GYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKIT  1216
             GYD G+ APG CSI  H+LC  G S+TEPY VAH++LL+HAAA   Y+  ++ KQ G I 
Sbjct  223   GYDTGLQAPGRCSILSHILCRRGKSSTEPYIVAHNILLSHAAAFHTYKLHFKEKQKGAIG  282

Query  1217  IVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAE  1396
             I ++S WYEP++ +  D DA  RA+ F LGWFL+P+M G+YP+++   VGDRLP+F++ +
Sbjct  283   IALDSKWYEPISGTEEDTDAAYRAMKFELGWFLDPLMYGDYPQTMKKLVGDRLPRFTSDD  342

Query  1397  SALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAV  1576
             S  L GS D++G+NHYT+ YA +  T I  L L+D  +D+       +    IGERA + 
Sbjct  343   SESLAGSLDFVGINHYTSLYARNDRTRIRKLILNDASSDAAVIATSTRHGERIGERAASG  402

Query  1577  WLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKTDGLN----DIKRIRYHRDYLKSL  1744
             WL+IVP G+R LMNYIK+ Y NPLV ITENGMDD     L+    D KRIRYH DYL +L
Sbjct  403   WLHIVPWGIRKLMNYIKENYENPLVIITENGMDDPNFTNLDIALKDEKRIRYHADYLSNL  462

Query  1745  LAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
              AAI+EDGCNV GYF WSL+DNWEW  G++ RFGLYYVDY  NL R+PK+S +WFK+FL
Sbjct  463   QAAIREDGCNVHGYFVWSLLDNWEWNSGYTVRFGLYYVDYKKNLTRMPKDSVQWFKHFL  521



>ref|XP_011095298.1| PREDICTED: putative beta-glucosidase 41 isoform X1 [Sesamum indicum]
 ref|XP_011095299.1| PREDICTED: putative beta-glucosidase 41 isoform X1 [Sesamum indicum]
Length=522

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/480 (59%), Positives = 352/480 (73%), Gaps = 6/480 (1%)
 Frame = +2

Query  506   AQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQ  685
              ++ISRA FPEGF FGTAS+AYQFEGAV E  +G +IWDTF   PG++ DFSNAD AVDQ
Sbjct  33    CESISRADFPEGFTFGTASSAYQFEGAVNEGNKGDSIWDTFTRKPGRILDFSNADTAVDQ  92

Query  686   YHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYV  865
             YHR+  DI+LMKD+GMDAYRFSI+WSRI PNGTG+ NQ G+++YNNLIDALL  GI+PY 
Sbjct  93    YHRFKSDIDLMKDLGMDAYRFSISWSRILPNGTGEPNQEGIEYYNNLIDALLDKGIQPYA  152

Query  866   TLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYD  1045
             TLYH+DLPQ LE++Y G L  QV+KDF  YA  CF  FGDRVK W+T NEP  I + GYD
Sbjct  153   TLYHWDLPQILEDKYGGLLTNQVVKDFENYAYICFKAFGDRVKHWMTFNEPHGIAIQGYD  212

Query  1046  LGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVV  1225
             LG+ APG CSI  HL+C  G S+ EPY VAH++LL+HAAA  IY+  ++ +Q GK+ I +
Sbjct  213   LGIQAPGRCSILGHLICKAGKSSVEPYIVAHNILLSHAAAYHIYQNHFKERQQGKVGIAL  272

Query  1226  ESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESAL  1405
             ++ WYEP++N+  DIDA  RA+DF LGWFL+P++ G YP S+   V +RLP+ +   S  
Sbjct  273   DAKWYEPISNADEDIDAAGRAMDFGLGWFLDPLLLGNYPLSMQKLVAERLPEITPETSRF  332

Query  1406  LKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLY  1585
             LKGS D++G+NHYTT YA +  T+   L L D  +DS       K  + IGERA + WL+
Sbjct  333   LKGSLDFVGINHYTTLYARNDRTHFRKLILQDASSDSAVIATSSKHGIAIGERAASSWLH  392

Query  1586  IVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKTD------GLNDIKRIRYHRDYLKSLL  1747
             IVP G+R L NYIKDKYGNP V ITENGMDD K         L D KRI YHRDYL +L 
Sbjct  393   IVPWGIRKLANYIKDKYGNPPVIITENGMDDPKRSHRALPKALQDDKRINYHRDYLSNLS  452

Query  1748  AAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
             AAI++D C+V+GYF WSL+DNWEW +G++ RFGLYYVDY +NL RIPK S  WF+N L +
Sbjct  453   AAIRQDNCDVRGYFVWSLLDNWEWNMGYTVRFGLYYVDYKNNLTRIPKSSVSWFRNMLTT  512



>ref|XP_006360112.1| PREDICTED: putative beta-glucosidase 41-like [Solanum tuberosum]
Length=503

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/483 (58%), Positives = 357/483 (74%), Gaps = 6/483 (1%)
 Frame = +2

Query  497   ICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVA  676
             +  +++ISR+ FPEGF+FGT+S+AYQFEGAV E  +G +IWDTF   PG++ DFSNA+ A
Sbjct  13    LVNSESISRSDFPEGFIFGTSSSAYQFEGAVDEGNKGISIWDTFIKRPGRILDFSNANTA  72

Query  677   VDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIE  856
             VDQYHR+  DI+LMK++GMDAYRFSI+W+RIFPNGTG+ N  G+++YNNLIDALL  GI+
Sbjct  73    VDQYHRFHSDIDLMKNIGMDAYRFSISWTRIFPNGTGEPNPEGIEYYNNLIDALLEKGIQ  132

Query  857   PYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVL  1036
             PYVTL+H+DLPQ LE+ Y G+L+ ++IK+F  YA TCF  FGDRVK W+T NEP   T+ 
Sbjct  133   PYVTLFHWDLPQKLEDSYEGFLSNRIIKEFERYAITCFKAFGDRVKHWITFNEPHGFTIQ  192

Query  1037  GYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKIT  1216
             GYD G+ APG CSI  HL C  G S+ EPY +AH++LL+HAAA   Y + ++A Q GK+ 
Sbjct  193   GYDFGIQAPGRCSILLHLFCRKGKSSVEPYIIAHNILLSHAAAYHAYHKMFKASQRGKVG  252

Query  1217  IVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAE  1396
             I ++S WYEP ++   D  A  RA+DF LGWFL+P++ G YP S+   V +RLPK +  E
Sbjct  253   IALDSKWYEPHSDCEEDRAAASRAMDFGLGWFLDPLLLGNYPLSMQKLVAERLPKITPYE  312

Query  1397  SALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAV  1576
             + LLKGS D+LG+NHYTT YA +     M L  HD  +DS   T P++  + IGE+A + 
Sbjct  313   AKLLKGSIDFLGINHYTTLYARNDRVRTMKLMFHDAYSDSAVLTTPYRRGVAIGEKAASG  372

Query  1577  WLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDD------AKTDGLNDIKRIRYHRDYLK  1738
             WL IVP G+R LMNYIKDKYGNPLV ITENGMD+      A  D L D +RI YHRDYL 
Sbjct  373   WLRIVPWGIRKLMNYIKDKYGNPLVMITENGMDEPNKSHIALNDALQDERRITYHRDYLS  432

Query  1739  SLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNF  1918
             +L AAI+ED CN+KGYF WSL+DNWEW  G++ RFGLY+VD+ +NL R PK SAKWFK+ 
Sbjct  433   NLSAAIREDNCNIKGYFVWSLLDNWEWNSGYTVRFGLYHVDFKNNLTRTPKSSAKWFKSM  492

Query  1919  LAS  1927
             L S
Sbjct  493   LTS  495



>ref|XP_009615935.1| PREDICTED: putative beta-glucosidase 41 [Nicotiana tomentosiformis]
Length=505

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/480 (59%), Positives = 354/480 (74%), Gaps = 6/480 (1%)
 Frame = +2

Query  506   AQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQ  685
             +++ISR+ FPEGFVFGTAS+AYQFEGAV E  +G  IWDTF   PG++ DFSNAD AVDQ
Sbjct  19    SESISRSDFPEGFVFGTASSAYQFEGAVDEGNKGINIWDTFIKRPGRILDFSNADTAVDQ  78

Query  686   YHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYV  865
             YHR+  DIELMK +GMDAYRFSI+W+RIFPNGTG+ N  G+ +YNNLIDALL  GI+PY 
Sbjct  79    YHRFQSDIELMKKIGMDAYRFSISWTRIFPNGTGEPNPEGIQYYNNLIDALLEKGIQPYA  138

Query  866   TLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYD  1045
             TL+H+DLPQ LE+ Y G+L+ ++I +F  YA TCF  FGDRVK W+T NEP   T+ GYD
Sbjct  139   TLFHWDLPQMLEDSYEGFLSNRIIHEFERYAITCFKAFGDRVKHWITFNEPHGFTIQGYD  198

Query  1046  LGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVV  1225
              GV APG CSI FH+ C  G S+ EPY  AH++LL+HAAA   Y +K++A QGGK+ I +
Sbjct  199   SGVQAPGRCSILFHVFCRKGKSSIEPYIAAHNILLSHAAAYHAYHKKFKASQGGKVGIAL  258

Query  1226  ESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESAL  1405
             ++ WYEPL++   D  A  RA+DF LGWFL+P++ G YP S+   V +RLP+ S   S L
Sbjct  259   DAKWYEPLSDCEEDRAAASRAMDFGLGWFLDPLLLGNYPLSMQKLVAERLPEISPEMSKL  318

Query  1406  LKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLY  1585
             LKGS D+LG+NHYTT YA +    I  L L+D  +DS   T PF+  + IG++A + WL 
Sbjct  319   LKGSLDFLGINHYTTLYARNDRARIKKLVLNDAYSDSAVITTPFRRGVAIGDKAASGWLR  378

Query  1586  IVPRGMRNLMNYIKDKYGNPLVFITENGMDD------AKTDGLNDIKRIRYHRDYLKSLL  1747
             IVP G+R LMNYIKDKYGNPLV ITENG+D+      A  D L D  RI YHRDYL +L 
Sbjct  379   IVPWGIRKLMNYIKDKYGNPLVIITENGVDEPNKSYIALNDALQDDSRIIYHRDYLSNLS  438

Query  1748  AAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
             AAI+ED CN+KGYF WSL+DNWEW  G++ RFGLYYVD+ +NL RIPK SAKWFK+ L S
Sbjct  439   AAIREDNCNIKGYFVWSLLDNWEWNSGYTVRFGLYYVDFKNNLTRIPKSSAKWFKSMLTS  498



>emb|CDY64930.1| BnaCnng45520D [Brassica napus]
Length=522

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/484 (57%), Positives = 363/484 (75%), Gaps = 6/484 (1%)
 Frame = +2

Query  494   QICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADV  673
             Q   +++I+R SFP+GFVFGTAS+AYQFEGAV E  +G +IWDTF   PGK+ DFSNAD 
Sbjct  20    QQVSSESITRESFPDGFVFGTASSAYQFEGAVNEGNKGDSIWDTFTKKPGKILDFSNADT  79

Query  674   AVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGI  853
              VDQYHR+  DI+LMKD+GMDAYRFSI+W+RIFPNGTG++N  G+++YN+LID LLA GI
Sbjct  80    TVDQYHRFHSDIDLMKDLGMDAYRFSISWTRIFPNGTGEVNPDGLEYYNSLIDTLLAKGI  139

Query  854   EPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITV  1033
             +PYVTLYH+DLPQALE+RY GWL+RQV+ DF  YA TCF  FGDRVK W+T NEPR +T+
Sbjct  140   KPYVTLYHWDLPQALEDRYEGWLSRQVVDDFERYAFTCFKAFGDRVKYWITFNEPRGLTI  199

Query  1034  LGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKI  1213
              GYD G+ APG CS+  H  C  G S+ EPY VAH++LL+HAAA   Y+R ++ KQGG+I
Sbjct  200   QGYDTGIQAPGRCSLLGHWFCKEGKSSVEPYVVAHNILLSHAAAYHTYQRHFKKKQGGRI  259

Query  1214  TIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAA  1393
              + +++ W+EP+++   D DA +RA+DF +GWF++P++ G+YP S+   V +RLP+ +A 
Sbjct  260   GMSLDAKWFEPMSDCDEDRDAARRAMDFGIGWFMDPLINGDYPASMKRLVEERLPEITAE  319

Query  1394  ESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANA  1573
              S  +KG++D+ G+NHYTT Y  +  T I  L L D  +D+   T  F+G +PIGE+A +
Sbjct  320   MSKTIKGAFDFFGINHYTTLYTRNDRTRIRKLILQDASSDAAVITSSFRGGVPIGEKAGS  379

Query  1574  VWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYL  1735
              WL+IVP G+R L  Y+KD YGNP VFITENGMD+           L D KRI +HRDYL
Sbjct  380   SWLHIVPWGIRKLAVYLKDVYGNPPVFITENGMDEKNNPFKDMEKALQDDKRISFHRDYL  439

Query  1736  KSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKN  1915
              +L AAI++DGC+V+GYF WSL+DNWEW  G++ RFG+YYVDY +NL R+PK SA+WF+ 
Sbjct  440   SNLSAAIRKDGCDVRGYFVWSLLDNWEWNSGYTVRFGIYYVDYKNNLTRVPKASARWFRT  499

Query  1916  FLAS  1927
              L S
Sbjct  500   LLHS  503



>gb|KDO81804.1| hypothetical protein CISIN_1g0105881mg [Citrus sinensis]
 gb|KDO81805.1| hypothetical protein CISIN_1g0105881mg [Citrus sinensis]
Length=412

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/410 (67%), Positives = 327/410 (80%), Gaps = 6/410 (1%)
 Frame = +2

Query  716   MKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLYHYDLPQA  895
             MKDMGMDAYRFSIAWSRIFPNGTG++NQAGVDHYN LIDALLA GIEPYVTLYH+DLPQA
Sbjct  1     MKDMGMDAYRFSIAWSRIFPNGTGQINQAGVDHYNKLIDALLAKGIEPYVTLYHWDLPQA  60

Query  896   LENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGVHAPGHCS  1075
             L+++Y GWL+RQ+I DFA YAETCF  FGDRVK W+T NEP + T+ GYD+G+ APG CS
Sbjct  61    LDDKYKGWLDRQIINDFATYAETCFQKFGDRVKHWITFNEPHTFTIQGYDVGLQAPGRCS  120

Query  1076  IFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESFWYEPLTN  1255
             I  HL C  GNSATEPY VAH+ LL HA   DIYR+KY+AKQGG + I  +  WYE  +N
Sbjct  121   ILLHLFCRAGNSATEPYIVAHNALLTHAKVADIYRKKYKAKQGGSLGIAFDVIWYESASN  180

Query  1256  SPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKGSYDYLGV  1435
             S  D +A QRA DF LGWFL+P+M G+YP S+ +RVG RLP+F+++E+ALLKGS D++G+
Sbjct  181   STEDAEATQRAQDFQLGWFLDPLMFGDYPSSMRNRVGSRLPRFTSSEAALLKGSLDFVGI  240

Query  1436  NHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVPRGMRNLM  1615
             NHYTT+YA    TN++G+ L+D+L D+G  T+PFK   PI +RAN++WLYIVPRGMR+LM
Sbjct  241   NHYTTFYAQRNATNLIGVVLNDSLADAGALTIPFKNGKPIADRANSIWLYIVPRGMRSLM  300

Query  1616  NYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLKSLLAAIKEDGCNV  1777
             NYIK KY NP V ITENGMDD         + L D KRI+YH DYL +LLAAIKEDGCNV
Sbjct  301   NYIKQKYRNPTVIITENGMDDPNNRFTPTKEALKDDKRIKYHNDYLTNLLAAIKEDGCNV  360

Query  1778  KGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
             KGYF WSL+DNWEW  G++SRFGLY+VDY DN +R PK S +WFKNFL S
Sbjct  361   KGYFVWSLLDNWEWAAGYTSRFGLYFVDYKDNQKRYPKNSVQWFKNFLNS  410



>ref|XP_009769966.1| PREDICTED: putative beta-glucosidase 41 [Nicotiana sylvestris]
 ref|XP_009769967.1| PREDICTED: putative beta-glucosidase 41 [Nicotiana sylvestris]
Length=505

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/480 (59%), Positives = 353/480 (74%), Gaps = 6/480 (1%)
 Frame = +2

Query  506   AQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQ  685
             + +ISR+ FPEGF+FGTAS+AYQFEGAV E  +G +IWDTF   PG++ DFSNAD AVDQ
Sbjct  19    SDSISRSDFPEGFIFGTASSAYQFEGAVDEGNKGISIWDTFIKIPGRILDFSNADTAVDQ  78

Query  686   YHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYV  865
             YHR+  DIELMK +GMDAYRFSI+W+RIFPNGTG+ N  G+ +YNNLIDALL  GI+PY 
Sbjct  79    YHRFQSDIELMKKIGMDAYRFSISWTRIFPNGTGEPNPEGIQYYNNLIDALLQKGIQPYA  138

Query  866   TLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYD  1045
             TL+H+DLPQ LE+ Y G+L+ ++I +F  YA TCF  FGDRVK W+T NEP   T+ GYD
Sbjct  139   TLFHWDLPQMLEDLYEGFLSYRIIHEFERYAITCFKAFGDRVKHWITFNEPHGFTIQGYD  198

Query  1046  LGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVV  1225
              GV APG CSI FH+ C  G S+ EPY  AH++LL+HAAA   Y +K++A QGGK+ I +
Sbjct  199   SGVQAPGRCSILFHVYCRKGKSSIEPYIAAHNILLSHAAAYHAYHKKFKASQGGKVGIAL  258

Query  1226  ESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESAL  1405
             ++ WYEPL++   D  A  RA+DF LGWFL+P++ G YP S+   V +RLP+ S   S L
Sbjct  259   DAKWYEPLSDCEEDRAAASRAMDFGLGWFLDPLLLGNYPLSMQKLVAERLPEISPEVSKL  318

Query  1406  LKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLY  1585
             LKGS D+LG+NHYTT YA +    I  L L+D  +DS   T PF+  + IGE+A + WL 
Sbjct  319   LKGSLDFLGINHYTTLYARNDRARIKKLVLNDAYSDSAVITTPFRRGVAIGEKAASGWLR  378

Query  1586  IVPRGMRNLMNYIKDKYGNPLVFITENGMDDAK------TDGLNDIKRIRYHRDYLKSLL  1747
             IVP G+R LMNYIKDKYGNPLV ITENG+D+         D L D  RI YHRDYL +L 
Sbjct  379   IVPWGIRKLMNYIKDKYGNPLVIITENGVDEPNKSRITLNDALQDDSRIIYHRDYLSNLS  438

Query  1748  AAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
             AAI+ED CN+KGYF WSL+DNWEW  G++ RFGLYYVD+ +NL RIPK SAKWFK+ L S
Sbjct  439   AAIREDNCNIKGYFVWSLLDNWEWNSGYTVRFGLYYVDFKNNLTRIPKSSAKWFKSMLMS  498



>emb|CDY42461.1| BnaA10g08370D [Brassica napus]
Length=522

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/484 (57%), Positives = 361/484 (75%), Gaps = 6/484 (1%)
 Frame = +2

Query  494   QICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADV  673
             Q   +++I+R SFP+GFVFGTAS+AYQFEGAV E  +G +IWDTF   PGK+ DFSNAD 
Sbjct  20    QQVSSESITRESFPDGFVFGTASSAYQFEGAVNEGNKGDSIWDTFTKKPGKILDFSNADT  79

Query  674   AVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGI  853
              VDQYHR+  DI+LMKD+GMDAYRFSI+W+RIFPNGTG++N  G+ +YN LID LLA GI
Sbjct  80    TVDQYHRFHSDIDLMKDLGMDAYRFSISWTRIFPNGTGEVNPDGLKYYNTLIDTLLAKGI  139

Query  854   EPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITV  1033
             +PYVTLYH+DLPQALE+RY GWL+RQV+ DF  YA TCF  FGDRVK W+T NEPR +T+
Sbjct  140   KPYVTLYHWDLPQALEDRYEGWLSRQVVDDFERYAFTCFKAFGDRVKYWITFNEPRGLTI  199

Query  1034  LGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKI  1213
              GYD G+ APG CS+  H  C  G S+ EPY VAH++LL+HAAA   Y+R ++ KQGG+I
Sbjct  200   QGYDTGIQAPGRCSLLGHWFCKEGKSSVEPYVVAHNILLSHAAAYHTYQRHFKKKQGGRI  259

Query  1214  TIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAA  1393
              + +++ W+EP+++   D DA +RA+DF +GWF++P++ G+YP S+   V +RLP+ +A 
Sbjct  260   GMSLDAKWFEPMSDCDEDRDAARRAMDFGIGWFMDPLINGDYPASMKRLVEERLPEITAE  319

Query  1394  ESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANA  1573
              S  +KG++D+ G+NHYTT Y  +  T I  L L D  +D+   T  F+G +PIGE+A +
Sbjct  320   MSKTIKGAFDFFGINHYTTLYTRNDRTRIRKLILQDASSDAAVITSSFRGGVPIGEKAGS  379

Query  1574  VWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYL  1735
              WL+IVP G+R L  Y+KD YGNP VFITENGMD+           L D KRI +HRDYL
Sbjct  380   SWLHIVPWGIRKLAVYLKDVYGNPPVFITENGMDEKNNPFIDMEKALQDDKRISFHRDYL  439

Query  1736  KSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKN  1915
              +L AAI++DGC+V+GYF WSL+DNWEW  G++ RFG+YYVDY +NL R+PK SA+WF+ 
Sbjct  440   SNLSAAIRKDGCDVRGYFVWSLLDNWEWNSGYTVRFGIYYVDYKNNLTRVPKASARWFRT  499

Query  1916  FLAS  1927
              L S
Sbjct  500   LLHS  503



>ref|XP_008226795.1| PREDICTED: putative beta-glucosidase 41 isoform X1 [Prunus mume]
Length=514

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/478 (58%), Positives = 356/478 (74%), Gaps = 6/478 (1%)
 Frame = +2

Query  506   AQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQ  685
             +Q+ISRA FP+GFVFGTAS+AYQFEGAV E  +GA++WDTF   PG++ DFSNAD AVDQ
Sbjct  17    SQSISRADFPDGFVFGTASSAYQFEGAVNEGNKGASVWDTFTKEPGRILDFSNADTAVDQ  76

Query  686   YHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYV  865
             YHR+  DI+LMKDMG+DAYRFSI+W RIFPNGTG+ N  G+++YN+LIDALL  GI+P+V
Sbjct  77    YHRFQSDIDLMKDMGVDAYRFSISWPRIFPNGTGEPNSEGINYYNSLIDALLEKGIKPFV  136

Query  866   TLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYD  1045
             TLYH+DLPQ LE+RY GWL+ Q++KDF  YA TCF  FGDRVK W+T NEP +  + GYD
Sbjct  137   TLYHWDLPQVLEDRYEGWLSTQIVKDFEHYAFTCFQTFGDRVKHWITFNEPHNTALQGYD  196

Query  1046  LGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVV  1225
             LG+ APG CSI  HL C  GNS+ EPY VAH++LL+HAAA   Y++ ++A+QGG++ I +
Sbjct  197   LGIQAPGRCSILGHLFCKKGNSSAEPYIVAHNILLSHAAAYHSYQQFFKARQGGQVGIAL  256

Query  1226  ESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESAL  1405
             +  WYEP++++  DIDA  RAIDF LGWFL+P+  G+YP S+   VG RLP+ S A S  
Sbjct  257   DVKWYEPVSDNDEDIDAAHRAIDFSLGWFLDPLFFGKYPLSMKKLVGQRLPEISQAISKF  316

Query  1406  LKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLY  1585
             L GS D++G+NHYTT YA +  T I    + D ++D+     P+K  + IGERA + WL 
Sbjct  317   LVGSLDFVGINHYTTLYARNDRTQIRKFIMQDAISDAAVIITPYKEGVAIGERAASRWLR  376

Query  1586  IVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLKSLL  1747
             IVP G+R L  ++KDKY NP V ITENGMDD           L D KRIR+H DYL +L 
Sbjct  377   IVPWGIRKLARHLKDKYQNPPVIITENGMDDPNKPFIPLEKALKDEKRIRFHGDYLSNLS  436

Query  1748  AAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             AAI++D C+V+GYF WSL+DNWEW +G++ RFGLYYVDY  NL RIPK S +WF+ FL
Sbjct  437   AAIRQDNCDVRGYFVWSLLDNWEWNMGYTVRFGLYYVDYKKNLTRIPKTSVQWFRRFL  494



>ref|XP_010267844.1| PREDICTED: putative beta-glucosidase 41 isoform X1 [Nelumbo nucifera]
Length=504

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/482 (58%), Positives = 359/482 (74%), Gaps = 6/482 (1%)
 Frame = +2

Query  500   CGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAV  679
               ++ ISRA FP+GFVFGTAS+AYQFEGAV E  +GA+IWDTF   PG++ DFSNADVAV
Sbjct  17    SSSKAISRADFPDGFVFGTASSAYQFEGAVNEGNKGASIWDTFTRRPGRIMDFSNADVAV  76

Query  680   DQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEP  859
             DQYHR+  D++LMK++GMDAYRFSI+WSRIFP G+G+LN  G+ +YNNLID+LL  GI+P
Sbjct  77    DQYHRFKTDVDLMKNIGMDAYRFSISWSRIFPEGSGELNTEGIKYYNNLIDSLLEKGIQP  136

Query  860   YVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLG  1039
             YVTLYH+DLPQALE++YNGWL+R+++KDF  +A TCF  FGDRVKQW+T NEP   ++ G
Sbjct  137   YVTLYHWDLPQALEDKYNGWLSRKIVKDFENFAFTCFQAFGDRVKQWITFNEPHGFSLQG  196

Query  1040  YDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITI  1219
             YD G+ APG CSI  HL C  G S+ EPY VAH++LL+HA     Y+  ++ KQGG I I
Sbjct  197   YDTGLQAPGRCSILGHLFCKKGKSSIEPYIVAHNILLSHATVFHTYQLHFKEKQGGFIGI  256

Query  1220  VVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAES  1399
              +++ WYEP++++  D  A QRA+DF +GWFL+P+  G+YP S+ + V  RLP+ ++  S
Sbjct  257   ALDAKWYEPISDADEDKYAAQRAMDFGIGWFLDPLFFGKYPLSMQNLVKHRLPEITSEMS  316

Query  1400  ALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVW  1579
              LL GS D++G+NHYTT YA +    I  L L D  +D+   T   +G + IGE A + W
Sbjct  317   KLLVGSLDFIGLNHYTTLYAHNDQIRIRKLVLQDASSDAAVITTSSRGGIAIGETAASHW  376

Query  1580  LYIVPRGMRNLMNYIKDKYGNPLVFITENGMDD------AKTDGLNDIKRIRYHRDYLKS  1741
             L+IVP G+R L  Y+KDKYGNP VFITENGMDD      A +  L D KRI YHRDYL +
Sbjct  377   LHIVPWGIRKLARYVKDKYGNPPVFITENGMDDPNKPFMALSTALQDNKRISYHRDYLSN  436

Query  1742  LLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             L AAI++DGC+V+GYF WSL+DNWEW  G++ RFGLYY+DY +NL RIPK S +WFK+FL
Sbjct  437   LSAAIRQDGCDVRGYFIWSLLDNWEWNSGYTVRFGLYYIDYKNNLTRIPKASVQWFKSFL  496

Query  1922  AS  1927
               
Sbjct  497   GQ  498



>ref|XP_009119981.1| PREDICTED: putative beta-glucosidase 41 [Brassica rapa]
Length=522

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/484 (57%), Positives = 360/484 (74%), Gaps = 6/484 (1%)
 Frame = +2

Query  494   QICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADV  673
             Q   +++I+R SFP+GFVFGTAS+AYQFEGAV E  +G +IWDTF   PGK+ DFSNAD 
Sbjct  20    QQVSSESITRESFPDGFVFGTASSAYQFEGAVNEGNKGDSIWDTFTKKPGKILDFSNADT  79

Query  674   AVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGI  853
              VDQYHR+  DI+LMKD+GMDAYRFSI+W+RIFPNGTG++N  G+ +YN LID LLA GI
Sbjct  80    TVDQYHRFHSDIDLMKDLGMDAYRFSISWTRIFPNGTGEVNPDGLKYYNTLIDTLLAKGI  139

Query  854   EPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITV  1033
             +PYVTLYH+DLPQALE+RY GWL+RQV+ DF  YA TCF  FGDRVK W+T NEPR +T+
Sbjct  140   KPYVTLYHWDLPQALEDRYEGWLSRQVVDDFERYAFTCFKAFGDRVKYWITFNEPRGLTI  199

Query  1034  LGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKI  1213
              GYD G+ APG CS+  H  C  G S+ EPY VAH++LL+HAAA   Y+R ++ KQGG+I
Sbjct  200   QGYDTGIQAPGRCSLLGHWFCKEGKSSVEPYVVAHNILLSHAAAYHTYQRHFKKKQGGRI  259

Query  1214  TIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAA  1393
              + +++ W+EP+++   D DA +RA+DF +GWF++P++ G+YP S+   V +RLP+ +A 
Sbjct  260   GMSLDAKWFEPMSDCDEDRDAARRAMDFGIGWFMDPLINGDYPASMKRLVEERLPEITAE  319

Query  1394  ESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANA  1573
              S  +KG++D+ G+NHYTT Y  +  T I  L L D  +D+   T  F+G +PIGE+A +
Sbjct  320   MSKTIKGAFDFFGINHYTTLYTRNDRTRIRKLILQDASSDAAVITSSFRGGVPIGEKAGS  379

Query  1574  VWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYL  1735
              WL+IVP G+R L  Y+KD YGNP VFITENGMD+           L D KRI +HRDYL
Sbjct  380   SWLHIVPWGIRKLAVYLKDVYGNPPVFITENGMDEKNNPFIDMEKALQDDKRISFHRDYL  439

Query  1736  KSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKN  1915
              +L A I++DGC+V+GYF WSL+DNWEW  G++ RFG+YYVDY +NL R+PK SA+WF+ 
Sbjct  440   SNLSAGIRKDGCDVRGYFVWSLLDNWEWNSGYTVRFGIYYVDYKNNLTRVPKASARWFRT  499

Query  1916  FLAS  1927
              L S
Sbjct  500   LLHS  503



>gb|KDP39010.1| hypothetical protein JCGZ_00767 [Jatropha curcas]
Length=579

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/482 (58%), Positives = 354/482 (73%), Gaps = 6/482 (1%)
 Frame = +2

Query  494   QICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADV  673
              +    +ISRA FP GF FGTAS+AYQFEGA  E  +GA+IWDTF   PG++ DFSNAD 
Sbjct  92    HLSAESSISRADFPIGFTFGTASSAYQFEGAANEGNKGASIWDTFTRQPGRILDFSNADT  151

Query  674   AVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGI  853
             AVDQYHR+  DI+LMKD+GMDAYRFSI+W RIFPNGTG+ NQ G+D+YN+LIDAL+  GI
Sbjct  152   AVDQYHRFKGDIDLMKDLGMDAYRFSISWPRIFPNGTGEPNQEGIDYYNSLIDALIEKGI  211

Query  854   EPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITV  1033
             +PYVTLYH+DLPQ LE++Y GWLN+Q++KDF  Y  TCF  FGDRVK W+T NEP    +
Sbjct  212   QPYVTLYHWDLPQTLEDKYEGWLNKQIVKDFEYYTFTCFQAFGDRVKNWITFNEPHGFAI  271

Query  1034  LGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKI  1213
              GYD G+ APG CSI  HLLC TGNS+ EPY VAH++LL+HAAA   Y+  ++A Q G+I
Sbjct  272   QGYDTGIQAPGRCSILGHLLCKTGNSSAEPYIVAHNILLSHAAAYHCYQLHFKATQRGQI  331

Query  1214  TIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAA  1393
              I ++S WYEP++    D DA  RA+DF +GWFL+P+  G+YP S+   VG+RLP+ ++ 
Sbjct  332   GIALDSKWYEPISEVGEDKDAANRAMDFAIGWFLDPLFFGKYPASMEKLVGERLPEITSK  391

Query  1394  ESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANA  1573
              S LL GS D++G+NHYTT Y  +  T I  L L D  +D+G  T  ++  + IGERA +
Sbjct  392   MSKLLSGSLDFVGLNHYTTLYVRNDRTRIRKLILQDASSDAGVITTSYRRGVAIGERAAS  451

Query  1574  VWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYL  1735
              WL+IVP G+R L+NY+KDKY NP V ITENGMDD  T        L D KRI YHRDYL
Sbjct  452   RWLHIVPWGIRKLVNYVKDKYRNPPVIITENGMDDPNTPFMSLNKALQDDKRIEYHRDYL  511

Query  1736  KSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKN  1915
              +L AAI++D C+V+GYF WS++DNWEW  G++ RFGLYYVDY +NL RIPK SA WFK+
Sbjct  512   SNLSAAIRQDECDVRGYFVWSVLDNWEWNSGYTVRFGLYYVDYRNNLTRIPKASAHWFKS  571

Query  1916  FL  1921
              L
Sbjct  572   IL  573



>ref|XP_010448300.1| PREDICTED: putative beta-glucosidase 41 isoform X2 [Camelina 
sativa]
Length=529

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/480 (58%), Positives = 359/480 (75%), Gaps = 6/480 (1%)
 Frame = +2

Query  491   LQICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNAD  670
             L    +++ISRA+FP+GFVFGTAS+AYQFEGAVKE  +G +IWDTF   PGK+ DFSNAD
Sbjct  22    LDHVSSESISRANFPDGFVFGTASSAYQFEGAVKEGNKGESIWDTFTKKPGKILDFSNAD  81

Query  671   VAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANG  850
               VDQYHR+  DI+LMKD+ MDAYRFSI+WSRIFPNGTGK+N  GV +YN+LIDALLA G
Sbjct  82    TTVDQYHRFHSDIDLMKDLSMDAYRFSISWSRIFPNGTGKVNPDGVKYYNSLIDALLAKG  141

Query  851   IEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSIT  1030
             I+PYVTLYH+DLPQALE+RY GWL+R+V+ DF  YA TCF  FGDRVK WVT NEP  ++
Sbjct  142   IKPYVTLYHWDLPQALEDRYEGWLSREVVDDFERYAFTCFNAFGDRVKYWVTFNEPHGLS  201

Query  1031  VLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGK  1210
             + GYD G+ APG CS+  H  C  G S+ EPY VAH++LL+HAAA   Y+R ++ KQ G+
Sbjct  202   IQGYDTGIQAPGRCSLLGHWFCKKGTSSVEPYVVAHNILLSHAAAYRTYQRNFKEKQRGQ  261

Query  1211  ITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSA  1390
             I I +++ WYEP+++   D DA +RA+DF +GWF++P++ G+YP S+ S V  RLPK + 
Sbjct  262   IGIALDAKWYEPMSDCDEDKDAARRAMDFGIGWFMDPLINGDYPASMKSLVEKRLPKITP  321

Query  1391  AESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERAN  1570
               S  +KG++D++G+NHYTT YA +  T I  L LHD  +D+   T  ++G + IGERA 
Sbjct  322   EMSKSIKGAFDFMGINHYTTLYARNDRTRIRKLILHDASSDAAVITSSYRGGVAIGERAG  381

Query  1571  AVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDY  1732
             + WL+IVP G+R L  Y+KD YGNP VFITENGMD+           L D KRI YHRDY
Sbjct  382   SSWLHIVPWGIRKLAVYVKDIYGNPPVFITENGMDEKNNPFIDMEKALQDDKRISYHRDY  441

Query  1733  LKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFK  1912
             L +L AAI+ D C+V+GYF WSL+DNWEW  G++ RFG+YY+DY +NL RIPK SA+WF+
Sbjct  442   LSNLSAAIRNDECDVRGYFVWSLLDNWEWNSGYTVRFGIYYIDYKNNLTRIPKASARWFQ  501



>ref|XP_008658980.1| PREDICTED: uncharacterized protein LOC100502286 isoform X2 [Zea 
mays]
Length=453

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/422 (64%), Positives = 341/422 (81%), Gaps = 6/422 (1%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             ++R SFP+GFVFGTAS+AYQ+EGAVKEDGRG TIWD FAHT GKV D SNADVAVDQYHR
Sbjct  31    LTRGSFPKGFVFGTASSAYQYEGAVKEDGRGKTIWDKFAHTFGKVADLSNADVAVDQYHR  90

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             + EDI+LM DMGMDAYRFSIAWSRI PNGTG++NQAGVDHYN  IDALL+ GIEPYVTLY
Sbjct  91    FEEDIQLMADMGMDAYRFSIAWSRILPNGTGQVNQAGVDHYNRFIDALLSKGIEPYVTLY  150

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             H+DLPQALE+RYNGWL+RQ++ DFA YAETCF  FGDRV+ WVT+NEP ++ V GYD G+
Sbjct  151   HWDLPQALEDRYNGWLDRQIVYDFAEYAETCFEAFGDRVRHWVTLNEPHTVAVQGYDAGL  210

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
              APG CS+  HL C +G+SATEPY VAH+ +LAHA   D+YR+KY+A Q G++ I  +  
Sbjct  211   QAPGRCSLLLHLYCRSGDSATEPYVVAHNFILAHAKVSDVYRKKYKAAQNGELGIAFDVM  270

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             W+EP+TN+ ADI+A +R  +F LGWF +P   G+YP S+ SRVGDRLP+F+AAE+AL+KG
Sbjct  271   WFEPMTNTTADIEAAKRGQEFQLGWFADPFFFGDYPASMRSRVGDRLPRFTAAEAALVKG  330

Query  1415  SYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVP  1594
             + D++G+NHYTT+Y     T+++G  LH+TL D+GT +LPF+    IG+RAN++WLYIVP
Sbjct  331   ALDFVGINHYTTYYTKHNSTDLVGRLLHNTLADTGTISLPFRNGKAIGDRANSIWLYIVP  390

Query  1595  RGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLKSLLAAI  1756
              GMR+LMNY+K++Y +P +++TENGMDD  +      D L D KR++YH DYL +L A+I
Sbjct  391   SGMRSLMNYVKERYNSPPIYVTENGMDDGNSPFTSIKDALKDSKRVKYHNDYLTNLAASI  450

Query  1757  KE  1762
             K+
Sbjct  451   KQ  452



>ref|XP_004244167.1| PREDICTED: putative beta-glucosidase 41 [Solanum lycopersicum]
Length=506

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/483 (57%), Positives = 358/483 (74%), Gaps = 6/483 (1%)
 Frame = +2

Query  497   ICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVA  676
             +  +++I+R+ FPEGF+FGTAS+AYQFEGAV E  +G +IWDTF   PG++ DFSNA+ A
Sbjct  16    LVKSESITRSDFPEGFIFGTASSAYQFEGAVDEGNKGISIWDTFIKRPGRILDFSNANTA  75

Query  677   VDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIE  856
             VDQYHR+  DI+LMK++GMDAYRFSI+W+RIFPNGTG+ N  G+++YNNLIDALL  GI+
Sbjct  76    VDQYHRFESDIDLMKNIGMDAYRFSISWTRIFPNGTGEPNPEGIEYYNNLIDALLEKGIQ  135

Query  857   PYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVL  1036
             PYVTL+H+DLPQ LE+ Y G+L+ ++IK+F  YA TCF  FGDRVK W+T NEP   T+ 
Sbjct  136   PYVTLFHWDLPQKLEDSYEGFLSNRIIKEFERYAITCFEAFGDRVKHWITFNEPHGFTIQ  195

Query  1037  GYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKIT  1216
             GYD G+ APG CSI  HL C  GNS+ EPY VAH++LL+HAAA   Y + ++A Q GK+ 
Sbjct  196   GYDFGIQAPGRCSILLHLFCRKGNSSVEPYIVAHNILLSHAAAYHAYHKMFKASQRGKVG  255

Query  1217  IVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAE  1396
             I ++S WYEP ++   D  A  RA+DF LGWFL+P++ G YP S+   V +RLPK +  E
Sbjct  256   IALDSKWYEPRSDCKEDRAAASRAMDFGLGWFLDPLLLGNYPLSMQKLVAERLPKITPYE  315

Query  1397  SALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAV  1576
             + ++KGS D+LG+NHYTT YA +    IM    H+  +DS   T P++  + IGE+A + 
Sbjct  316   AKVIKGSIDFLGINHYTTLYARNDRARIMKFMFHNAYSDSAVVTTPYRRGVAIGEKAASG  375

Query  1577  WLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDD------AKTDGLNDIKRIRYHRDYLK  1738
             WL IVP G+R LMN+IKDKYGNPLV ITENGMD+      A  D L D +RI YHRDYL 
Sbjct  376   WLRIVPWGIRKLMNHIKDKYGNPLVMITENGMDEPNKSHMALDDALQDERRITYHRDYLS  435

Query  1739  SLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNF  1918
             +L AAI+ED CN+KGYF WSL+DNWEW  G++ RFGLY+VD+ +NL R PK SAKWFK+ 
Sbjct  436   NLSAAIREDNCNIKGYFVWSLLDNWEWNSGYTVRFGLYHVDFKNNLTRTPKSSAKWFKSM  495

Query  1919  LAS  1927
             L +
Sbjct  496   LTT  498



>ref|XP_010694291.1| PREDICTED: putative beta-glucosidase 41 [Beta vulgaris subsp. 
vulgaris]
Length=513

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/480 (59%), Positives = 350/480 (73%), Gaps = 6/480 (1%)
 Frame = +2

Query  500   CGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAV  679
               A+ ISR  FP GF+FGTAS+AYQFEGAV E  RG +IWDTF+  PG++ DFS+ADVAV
Sbjct  23    SSAEIISRTDFPHGFIFGTASSAYQFEGAVNEGNRGESIWDTFSRLPGRILDFSHADVAV  82

Query  680   DQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEP  859
             DQYHR+  D+ELMKDMGMDAYRFSI+W RIFPNGTG+ N  G+++YNNLID LL  GI+P
Sbjct  83    DQYHRFKSDVELMKDMGMDAYRFSISWPRIFPNGTGEPNPEGINYYNNLIDTLLEKGIQP  142

Query  860   YVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLG  1039
             YVTLYH+DLPQ LE+RY GWL+ Q+I+DF  YA TCF  FGDRVK W+T NEP   ++ G
Sbjct  143   YVTLYHWDLPQVLEDRYEGWLSNQIIEDFENYASTCFEAFGDRVKYWITFNEPHGFSING  202

Query  1040  YDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITI  1219
             YD GV APG CS   HL C  G S+ EPY VAH++LL+HA     Y++ ++ KQGG I I
Sbjct  203   YDSGVQAPGRCSFLGHLYCKRGQSSIEPYMVAHNILLSHAVVYHTYQKNFKDKQGGSIGI  262

Query  1220  VVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAES  1399
              +++ WYEP+T+   D DA QRA+DF LGWFL+P+  G+YP S+   VG RLP+ S   S
Sbjct  263   ALDAKWYEPITSKKEDQDAAQRAMDFSLGWFLDPLFFGQYPNSMQKLVGSRLPEISPEIS  322

Query  1400  ALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVW  1579
              LLK S D++G+NHYTT YA +  T      L D  TDS   T P+K  +PIGERA + W
Sbjct  323   KLLKKSLDFVGINHYTTLYARNDRTRFRKFVLQDASTDSAVITSPYKFGVPIGERAASRW  382

Query  1580  LYIVPRGMRNLMNYIKDKYGNPLVFITENGMDD------AKTDGLNDIKRIRYHRDYLKS  1741
             L IVP G+R+L  Y++D+Y N  + ITENGMD+      A +D L D KRI +HRDYL +
Sbjct  383   LVIVPWGIRSLTRYVRDRYNNLPMVITENGMDEQDRAHVALSDALQDDKRIDFHRDYLSN  442

Query  1742  LLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             L AAI++D C+V+GYF WSL+DNWEW +G++ RFGLYYVDY +NL RIPK S  WFKNFL
Sbjct  443   LSAAIRQDDCDVRGYFIWSLLDNWEWNLGYTHRFGLYYVDYKNNLTRIPKNSVNWFKNFL  502



>ref|XP_010448292.1| PREDICTED: putative beta-glucosidase 41 isoform X1 [Camelina 
sativa]
Length=529

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/480 (58%), Positives = 358/480 (75%), Gaps = 6/480 (1%)
 Frame = +2

Query  491   LQICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNAD  670
             L    +++ISRA+FP+GFVFGTAS+AYQFEGAVKE  +G +IWDTF   PGK+ DFSNAD
Sbjct  22    LDHVSSESISRANFPDGFVFGTASSAYQFEGAVKEGNKGESIWDTFTKKPGKILDFSNAD  81

Query  671   VAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANG  850
               VDQYHR+  DI+LMKD+ MDAYRFSI+WSRIFPNGTGK+N  GV +YN+LIDALLA G
Sbjct  82    TTVDQYHRFHSDIDLMKDLSMDAYRFSISWSRIFPNGTGKVNPDGVKYYNSLIDALLAKG  141

Query  851   IEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSIT  1030
             I+PYVTLYH+DLPQALE+RY GWL+R+V+ DF  YA TCF  FGDRVK WVT NEP  ++
Sbjct  142   IKPYVTLYHWDLPQALEDRYEGWLSREVVDDFERYAFTCFNAFGDRVKYWVTFNEPHGLS  201

Query  1031  VLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGK  1210
             + GYD G+ APG CS+  H  C  G S+ EPY VAH++LL+HAAA   Y+R ++ KQ G+
Sbjct  202   IQGYDTGIQAPGRCSLLGHWFCKKGTSSVEPYVVAHNILLSHAAAYRTYQRNFKEKQRGQ  261

Query  1211  ITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSA  1390
             I I +++ WYEP+++   D DA +RA+DF +GWF++P++ G+YP S+ S V  RLPK + 
Sbjct  262   IGIALDAKWYEPMSDCDEDKDAARRAMDFGIGWFMDPLINGDYPASMKSLVEKRLPKITP  321

Query  1391  AESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERAN  1570
               S  +KG++D++G+NHYTT YA +  T I  L LHD  +D+   T  ++G + IGERA 
Sbjct  322   EMSKSIKGAFDFMGINHYTTLYARNDRTRIRKLILHDASSDAAVITSSYRGGVAIGERAG  381

Query  1571  AVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDY  1732
             + WL+IVP G+R L  Y+KD YGNP VFITENGMD+           L D KRI YHRDY
Sbjct  382   SSWLHIVPWGIRKLAVYVKDIYGNPPVFITENGMDEKNNPFIDMEKALQDDKRISYHRDY  441

Query  1733  LKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFK  1912
             L +L AAI+ D C+V+GYF WSL+DNWEW  G++ RFG+YY+DY +NL RIPK SA WF+
Sbjct  442   LSNLSAAIRNDECDVRGYFVWSLLDNWEWNSGYTVRFGIYYIDYKNNLTRIPKASATWFQ  501



>ref|XP_010482861.1| PREDICTED: putative beta-glucosidase 41 isoform X1 [Camelina 
sativa]
Length=529

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/480 (58%), Positives = 358/480 (75%), Gaps = 6/480 (1%)
 Frame = +2

Query  491   LQICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNAD  670
             L    +++ISRA FP+GFVFGTAS+AYQFEGAVKE  +G +IWDTF   PGK+ DFSNAD
Sbjct  22    LDHVSSESISRAKFPDGFVFGTASSAYQFEGAVKEGNKGESIWDTFTKKPGKILDFSNAD  81

Query  671   VAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANG  850
               VDQYHR+  DI+LMKD+ MDAYRFSI+WSRIFPNGTGK+N  GV +YN+LIDALLA G
Sbjct  82    TTVDQYHRFHSDIDLMKDLSMDAYRFSISWSRIFPNGTGKVNPDGVKYYNSLIDALLAKG  141

Query  851   IEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSIT  1030
             I+PYVTLYH+DLPQALE+RY GWL+R+V+ DF  YA TCF  FGDRVK WVT NEP  ++
Sbjct  142   IKPYVTLYHWDLPQALEDRYEGWLSREVVDDFERYAFTCFKAFGDRVKYWVTFNEPHGLS  201

Query  1031  VLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGK  1210
             + GYD G+ APG CS+  H  C  G S+ EPY VAH++LL+HAAA   Y+R ++ KQ G+
Sbjct  202   IQGYDTGIQAPGRCSLLGHWFCKKGTSSVEPYVVAHNILLSHAAAYHTYQRNFKEKQRGQ  261

Query  1211  ITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSA  1390
             I I +++ WYEP+++   D DA +RA+DF +GWF++P++ G+YP S+ S V +RLPK   
Sbjct  262   IGIALDAKWYEPMSDCDEDKDAARRAMDFGIGWFMDPLINGDYPASMKSLVEERLPKIKP  321

Query  1391  AESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERAN  1570
               S  +KG++D++G+NHYTT YA +  + I  L LHD  +D+   T  ++G + IGERA 
Sbjct  322   EMSKSIKGAFDFMGINHYTTLYARNDRSRIRKLILHDASSDAAVITSSYRGGVAIGERAG  381

Query  1571  AVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDY  1732
             + WL+IVP G+R L  Y+KD YGNP VFITENGMD+           L D KRI +HRDY
Sbjct  382   SSWLHIVPWGIRKLAVYVKDIYGNPPVFITENGMDEKNNPFIDMEKALQDDKRISFHRDY  441

Query  1733  LKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFK  1912
             L +L AAI+ D C+V+GYF WSL+DNWEW  G++ RFG+YY+DY +NL RIPK SA+WF+
Sbjct  442   LSNLSAAIRNDECDVRGYFVWSLLDNWEWNSGYTVRFGIYYIDYKNNLTRIPKASARWFQ  501



>ref|XP_004294322.1| PREDICTED: putative beta-glucosidase 41-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=513

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/478 (58%), Positives = 350/478 (73%), Gaps = 6/478 (1%)
 Frame = +2

Query  506   AQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQ  685
             +Q++SRA FPEGFVFGTAS+AYQFEGAV E  +GA++WDTF   PGK+ DFSNAD AVDQ
Sbjct  17    SQSLSRADFPEGFVFGTASSAYQFEGAVNEGNKGASVWDTFTKVPGKILDFSNADTAVDQ  76

Query  686   YHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYV  865
             YHR+  D++LMKDMG++AYRFSI+W RIFPNGTG  N  G+ +YN+LID+LL  GI+P+V
Sbjct  77    YHRFQGDVDLMKDMGVNAYRFSISWPRIFPNGTGAPNSEGISYYNSLIDSLLEKGIQPFV  136

Query  866   TLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYD  1045
             TLYH+DLPQ LE++Y GWL+ Q++KDF  YA TCF  FGDRVK W+T NEP    +  YD
Sbjct  137   TLYHWDLPQMLEDKYEGWLSTQIVKDFEHYAITCFQAFGDRVKNWITFNEPHGYALQSYD  196

Query  1046  LGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVV  1225
             LG+ APG CSI  HL C  GNS+ EPY VAH++LL+HAA    Y++ ++ KQGG+I I +
Sbjct  197   LGIQAPGRCSILGHLFCKKGNSSVEPYIVAHNILLSHAATYHTYQQYFKEKQGGQIGISL  256

Query  1226  ESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESAL  1405
             ++ W+EPL+ +  DIDA  RA +F LGWFL+P+  G+YP S+   VG RLP  S   S  
Sbjct  257   DAKWHEPLSETDEDIDAAHRANEFSLGWFLDPLFFGDYPLSMKKLVGKRLPAISKEVSKF  316

Query  1406  LKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLY  1585
             L GS D++G+NHYTT YA +  T I    L D  +D+   T  +KG + IGE+A + WL 
Sbjct  317   LVGSVDFIGINHYTTLYARNDRTRIRKFILQDATSDAAVITTHYKGGVAIGEKAASRWLR  376

Query  1586  IVPRGMRNLMNYIKDKYGNPLVFITENGMDD------AKTDGLNDIKRIRYHRDYLKSLL  1747
             IVP G+R L  YIKDKYGNP + ITENGMDD      +    LND KRIR+HRDYL +L 
Sbjct  377   IVPWGIRKLARYIKDKYGNPPMMITENGMDDPNKPFTSMEKALNDEKRIRFHRDYLSNLS  436

Query  1748  AAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             AAI+ED C+V+GYF WSL+DNWEW +G++ RFGLYYVDY  NL RIPK S +WF  FL
Sbjct  437   AAIREDKCDVRGYFVWSLLDNWEWNMGYTVRFGLYYVDYKKNLTRIPKSSVQWFTRFL  494



>ref|XP_008643498.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
 gb|AFW69122.1| hypothetical protein ZEAMMB73_597791 [Zea mays]
Length=511

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/480 (58%), Positives = 355/480 (74%), Gaps = 6/480 (1%)
 Frame = +2

Query  506   AQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQ  685
             A+ + RA FP+GFVFGTAS+AYQ+EGAV E  RG TIWDT    PG+V DFSNADVAVD 
Sbjct  17    AEALRRADFPQGFVFGTASSAYQYEGAVNEGQRGPTIWDTLTRRPGRVIDFSNADVAVDH  76

Query  686   YHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYV  865
             YHRY ED++L+KD+GMDAYRFSI+WSRIFPNGTG+ N+ G+++YN+LI+ LL  GI+PYV
Sbjct  77    YHRYKEDVDLIKDIGMDAYRFSISWSRIFPNGTGEPNEEGLNYYNSLINTLLDKGIQPYV  136

Query  866   TLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYD  1045
             TL+H+DLPQALE+RY GWLN Q++ DF  YA TCF  FGDRVK W+T NEP +  + GYD
Sbjct  137   TLFHWDLPQALEDRYGGWLNSQIVDDFVHYASTCFKEFGDRVKHWITFNEPHNFAIEGYD  196

Query  1046  LGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVV  1225
             LG+ APG CSI  H+ C  G S+TEPY VAH++LLAHA A   Y++ ++ +QGG I I +
Sbjct  197   LGIQAPGRCSILSHIFCREGKSSTEPYVVAHNILLAHAGAFHTYKQHFKKEQGGIIGIAL  256

Query  1226  ESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESAL  1405
             +S WYEPL++   D +A  RA+DF LGWFL+P+M G YP S+   VGDRLP+FSA  S L
Sbjct  257   DSKWYEPLSDVDEDTEAAARAMDFELGWFLDPLMFGHYPPSMQKLVGDRLPQFSARASML  316

Query  1406  LKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLY  1585
             + GS D++G+NHYTT Y  +    I  L ++D  TD+      ++    IGE A + WL+
Sbjct  317   VSGSLDFVGINHYTTLYVRNDRMRIRKLVMNDASTDAAVIPTAYRHGKKIGETAASGWLH  376

Query  1586  IVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLKSLL  1747
             IVP GM  LM +IK+KYGNP V ITENGMDDA        D L D KRI+YH+DY+ +LL
Sbjct  377   IVPWGMFKLMKHIKEKYGNPPVIITENGMDDANNRFSKLEDDLQDDKRIQYHKDYMSNLL  436

Query  1748  AAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
              AI+++GCNV GYF WSL+DNWEW  G++ RFGLYY+DY++NL RIPK S +WF+  LA 
Sbjct  437   DAIRKEGCNVHGYFVWSLLDNWEWNSGYTVRFGLYYIDYNNNLTRIPKASVEWFRQVLAQ  496



>ref|XP_011048252.1| PREDICTED: putative beta-glucosidase 41 isoform X1 [Populus euphratica]
Length=508

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/478 (58%), Positives = 355/478 (74%), Gaps = 6/478 (1%)
 Frame = +2

Query  506   AQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQ  685
             ++ ISRA FP GF FGTAS+AYQFEGAV E  +G +IWDTF   PG++ D SNAD AVDQ
Sbjct  21    SKPISRADFPSGFTFGTASSAYQFEGAVNEGNKGDSIWDTFTRQPGRILDLSNADTAVDQ  80

Query  686   YHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYV  865
             YHR+  DI+LMKD+GMDAYRFSI+W RIFPNGTG  NQ G+D+Y+ LID LL  GI+PYV
Sbjct  81    YHRFKGDIDLMKDLGMDAYRFSISWPRIFPNGTGVPNQEGIDYYSCLIDTLLEKGIQPYV  140

Query  866   TLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYD  1045
             TLYH+DLPQ LE++Y GWL++Q+++DF  YA TCF  FGDRVK W+T NEPR  ++ GYD
Sbjct  141   TLYHWDLPQMLEDKYEGWLSKQIVEDFEHYAFTCFQAFGDRVKHWITFNEPRGFSIQGYD  200

Query  1046  LGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVV  1225
              G+ APG CSI  H LC  GNS++EPY VAH++LL+HAAA   Y+  ++ KQGG+I I +
Sbjct  201   TGIQAPGRCSIMGHFLCKRGNSSSEPYIVAHNILLSHAAAYHCYQLHFKGKQGGQIGITL  260

Query  1226  ESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESAL  1405
             +S WYEPL+++  D DA QRA+DF +GWFL+P+  G+YP S+   VG+RLP+ S   S L
Sbjct  261   DSKWYEPLSDAEEDKDAAQRAMDFGIGWFLDPLFLGKYPFSMKKLVGERLPEISQGMSKL  320

Query  1406  LKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLY  1585
             L GS D++G+NHYTT Y  +  T I  L L D  +D+   T  ++  + IGERA + WL+
Sbjct  321   LVGSLDFVGINHYTTLYVRNDRTRIRKLILQDASSDAAVITTSYRRGVAIGERAASRWLH  380

Query  1586  IVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLKSLL  1747
             IVP G+  L+ Y+KDKYGNP V ITENGMDD  T        L D KRI YHRDYL ++ 
Sbjct  381   IVPWGIHKLLKYVKDKYGNPPVVITENGMDDLNTPFISLNKALQDDKRIEYHRDYLSNIS  440

Query  1748  AAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             AAI++D C+V+GYFAWSL+DNWEW  G++ RFGLY+VDY +NL R+PK SA+WFK+ L
Sbjct  441   AAIRQDNCDVRGYFAWSLLDNWEWNSGYTVRFGLYFVDYRNNLTRVPKASAEWFKSTL  498



>ref|XP_002866052.1| glycosyl hydrolase family 1 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42311.1| glycosyl hydrolase family 1 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=529

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/480 (58%), Positives = 359/480 (75%), Gaps = 6/480 (1%)
 Frame = +2

Query  500   CGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAV  679
               +++ISRA FP+GFVFGTAS+AYQFEGAVKE  +G +IWDTF   PGK+ DFSNAD  V
Sbjct  25    VSSESISRADFPDGFVFGTASSAYQFEGAVKEGNKGQSIWDTFTKKPGKILDFSNADTTV  84

Query  680   DQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEP  859
             DQYHR+  DI+LMKD+ MDAYRFSI+WSRIFPNGTG++N  GV +YN+LIDALLA GI+P
Sbjct  85    DQYHRFHSDIDLMKDLRMDAYRFSISWSRIFPNGTGEVNPDGVKYYNSLIDALLAKGIKP  144

Query  860   YVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLG  1039
             YVTLYH+DLPQALE+RY GWL+R+V++DF  YA TCF  FGDRVK W+TINEP  +++ G
Sbjct  145   YVTLYHWDLPQALEDRYEGWLSREVVEDFEHYAFTCFKAFGDRVKYWITINEPHGVSIQG  204

Query  1040  YDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITI  1219
             YD G+ APG CS+  H  C  G S+ EPY VAH++LL+HAAA   Y+R ++ KQ G+I I
Sbjct  205   YDTGIQAPGRCSLLGHWFCKEGKSSVEPYVVAHNILLSHAAAYHTYQRNFKEKQRGQIGI  264

Query  1220  VVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAES  1399
              +++ WYEP+++   D DA +RA+DF +GWF++P++ G+YP S+ S V +RLPK +   S
Sbjct  265   SLDAKWYEPMSDCDEDKDAARRAMDFGIGWFMDPLIYGDYPASMKSLVEERLPKITPEMS  324

Query  1400  ALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVW  1579
               +KG++DY+G+NHYT  YA +  T I  L L D  +DS   T  F+G + IGE+A + W
Sbjct  325   QSIKGAFDYVGINHYTALYARNDRTRIRKLILRDASSDSAVITSSFRGGVAIGEKAGSSW  384

Query  1580  LYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLKS  1741
             L+IVP G+R L  Y+KD YGNP VFITENGMD+           L D KRI +HRDYL +
Sbjct  385   LHIVPWGIRKLAVYLKDMYGNPPVFITENGMDEKNKPFIDMEKALKDNKRISFHRDYLSN  444

Query  1742  LLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             L AAI+ D C+V+GYF WSL+DNWEW  G++ RFG+YYVDY +NL RIPK SA+WF+  L
Sbjct  445   LSAAIRTDECDVRGYFVWSLLDNWEWNSGYTVRFGIYYVDYKNNLTRIPKASARWFQRIL  504



>ref|XP_006851185.1| hypothetical protein AMTR_s00043p00189470 [Amborella trichopoda]
 gb|ERN12766.1| hypothetical protein AMTR_s00043p00189470 [Amborella trichopoda]
Length=497

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/475 (59%), Positives = 354/475 (75%), Gaps = 6/475 (1%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             +SRA FP  FVFGTAS+AYQFEGA  E  RG +IWDTF+  PG++ DFSNADVAVDQYHR
Sbjct  20    LSRAHFPHDFVFGTASSAYQFEGASSEGKRGQSIWDTFSRKPGRILDFSNADVAVDQYHR  79

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             +  DI+LM+++GM AYRFSI+WSRI PNGTG++N  G+++YN+LI+ALL  GI+PYVTLY
Sbjct  80    FKADIDLMRNLGMHAYRFSISWSRILPNGTGQVNPEGINYYNSLINALLEKGIQPYVTLY  139

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             H+DLPQALE++Y+GWL+  ++KDFA YA TCF  FG RVK W+T NEP    + GYDLGV
Sbjct  140   HWDLPQALEDQYSGWLSPLIVKDFAHYAHTCFQAFGGRVKHWITFNEPHGFALQGYDLGV  199

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
              APG CSIF HL C +G+SATEPY VAH++LLAHA    IY+  ++ +QGG I I ++S 
Sbjct  200   QAPGRCSIFAHLFCKSGSSATEPYIVAHNILLAHATTFRIYQHHFKEEQGGLIGIALDSK  259

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             WYEP++++  D++A QRA+DF LGWFL P+  G+YP S+ + VG+RLPK +   S  L G
Sbjct  260   WYEPISDNDEDMEAAQRAMDFELGWFLNPLFFGKYPVSMQNLVGNRLPKLTPEMSGSLIG  319

Query  1415  SYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVP  1594
             S D++GVNHYTT YA +    I  L L D  +D      PF+    IGERA + WL+IVP
Sbjct  320   SLDFVGVNHYTTLYAKNDKNRIRKLILRDASSDVAVIATPFRRGRQIGERAASRWLHIVP  379

Query  1595  RGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLKSLLAAI  1756
              G+R L  YIKD YGNP V ITENGMDD  T      + L D KRI+YH +YL +L  AI
Sbjct  380   WGIRKLTTYIKDTYGNPPVIITENGMDDPNTHHLVLNEALQDHKRIKYHNEYLSNLSVAI  439

Query  1757  KEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             +EDGC+V+GYF WSL+DNWEW +G++ RFGLY++DY++NL RIPK S +WFK FL
Sbjct  440   REDGCDVQGYFVWSLLDNWEWNMGYTVRFGLYFIDYNNNLTRIPKASVEWFKGFL  494



>ref|XP_004966274.1| PREDICTED: beta-glucosidase 25-like [Setaria italica]
Length=501

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/480 (59%), Positives = 351/480 (73%), Gaps = 6/480 (1%)
 Frame = +2

Query  506   AQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQ  685
             A+ + RA FP GFVFGTAS+AYQ+EGAV E  RG TIWDT    PG+V DFSNADVAVD 
Sbjct  17    AEALRRADFPPGFVFGTASSAYQYEGAVNEGQRGPTIWDTLTRRPGRVIDFSNADVAVDH  76

Query  686   YHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYV  865
             YHRY ED++LMKD+GMDAYRFSI+WSRIFPNGTG+ N+ G+++YN+LIDA+L  G++PYV
Sbjct  77    YHRYKEDVDLMKDIGMDAYRFSISWSRIFPNGTGEPNEEGLNYYNSLIDAVLDKGMQPYV  136

Query  866   TLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYD  1045
             TL+H+DLPQALE+RY GWLN Q++ DF  YA TCF  FGDRVK W+T NEP +  + GYD
Sbjct  137   TLFHWDLPQALEDRYGGWLNSQIVDDFVHYASTCFKEFGDRVKHWITFNEPHNFAIEGYD  196

Query  1046  LGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVV  1225
             LG+ APG CSI  H+ C  G S+TEPY VAH++LLAHA A   Y++ ++ +QGG I I +
Sbjct  197   LGIQAPGRCSILSHMFCRDGKSSTEPYIVAHNILLAHAGAFHTYKQHFKNEQGGLIGIAL  256

Query  1226  ESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESAL  1405
             +S WYEP T+   D  A  RA+DF LGWFL+P+M G YP S+    GDRLP+FS   S L
Sbjct  257   DSKWYEPWTDVDEDTQAAARAMDFELGWFLDPLMFGHYPPSMQKLAGDRLPQFSTQASKL  316

Query  1406  LKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLY  1585
             + GS D++G+NHYTT Y  +    I  L ++D  TDS T    ++    IGE A + WL+
Sbjct  317   VSGSLDFVGINHYTTLYVRNDRMQIRKLVMNDASTDSATIPTAYRHGKRIGETAASRWLH  376

Query  1586  IVPRGMRNLMNYIKDKYGNPLVFITENGMDDAK------TDGLNDIKRIRYHRDYLKSLL  1747
             IVP GM  LM +IK+KYGNP V +TENGMDDA        D L D KRIRYH DY+ +LL
Sbjct  377   IVPWGMFKLMKHIKEKYGNPPVIVTENGMDDANLPFSRLEDVLQDDKRIRYHNDYMSNLL  436

Query  1748  AAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
              AI+++GCNV GYF WSL+DNWEW  G++ RFGLYY+DY++NL RIPK S +WF  FLA 
Sbjct  437   DAIRKEGCNVHGYFVWSLLDNWEWNSGYTVRFGLYYIDYNNNLTRIPKASVEWFSRFLAQ  496



>ref|XP_009418476.1| PREDICTED: beta-glucosidase 25-like [Musa acuminata subsp. malaccensis]
Length=532

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/479 (59%), Positives = 349/479 (73%), Gaps = 4/479 (1%)
 Frame = +2

Query  497   ICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVA  676
             +  ++ I R  FP GFVFGTAS+AYQFEGA  E  RG +IWDTF   PG++ DFSNADVA
Sbjct  36    VATSEAIRRDDFPSGFVFGTASSAYQFEGAAGEGNRGKSIWDTFTRRPGRILDFSNADVA  95

Query  677   VDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIE  856
             VDQYHRY  D++LMK MGMDAYRFSI+WSRIFPNGTG+ NQ G+ +YN LID LL  GI+
Sbjct  96    VDQYHRYKSDVDLMKGMGMDAYRFSISWSRIFPNGTGEPNQEGISYYNRLIDTLLQKGIQ  155

Query  857   PYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVL  1036
             PYVTL+H+DLPQALE+RYNGWL++++I+DF  YA TCF  FGDRVK W+T NEP   ++ 
Sbjct  156   PYVTLFHWDLPQALEDRYNGWLSQEIIQDFKHYAYTCFKAFGDRVKHWITFNEPHGFSIQ  215

Query  1037  GYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKIT  1216
             GYD G+ APG CSI  H+LC  G S+ EPY VAH++LL+HAAA   Y+  ++ KQ G I 
Sbjct  216   GYDTGLQAPGRCSILIHMLCRRGKSSIEPYIVAHNILLSHAAAFHTYKLNFKEKQKGVIG  275

Query  1217  IVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAE  1396
             I ++S WYEP++ +  D+DA  RA++F LGWFL P++ G+YP S+ + V  RLP+F++ +
Sbjct  276   IALDSKWYEPISGAKEDLDAANRAMEFELGWFLNPLIFGDYPLSMKNLVRSRLPRFTSDD  335

Query  1397  SALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAV  1576
             S  L GS D+LG+NHYTT YA +  T I  L L+D L D+   T   +    IGERA + 
Sbjct  336   STSLAGSLDFLGINHYTTLYARNDRTRIRKLVLNDALADALVITTSSRNGERIGERAASG  395

Query  1577  WLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAK----TDGLNDIKRIRYHRDYLKSL  1744
             WL+IVP G+R  MNYIK+ Y NPLV ITENGMDD         L D KRIRYH DYL +L
Sbjct  396   WLHIVPWGIRKSMNYIKENYANPLVIITENGMDDPNFTTLDKALKDDKRIRYHADYLSNL  455

Query  1745  LAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
              AAI EDGCNV GYF WSL+DNWEW  GF+ RFGLYYVDY  NL RIPK S +WFK+ L
Sbjct  456   QAAIWEDGCNVHGYFVWSLLDNWEWNSGFTVRFGLYYVDYKSNLTRIPKASVQWFKHVL  514



>ref|XP_003527305.1| PREDICTED: beta-glucosidase 25-like isoform X1 [Glycine max]
Length=507

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/481 (57%), Positives = 355/481 (74%), Gaps = 6/481 (1%)
 Frame = +2

Query  497   ICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVA  676
             + GA++ISRA FPEGFVFGTAS+A+QFEGA  E  +G +IWDTF+  PG++ DFSNAD A
Sbjct  18    LVGAESISRADFPEGFVFGTASSAHQFEGATDEGNKGDSIWDTFSRIPGRIVDFSNADKA  77

Query  677   VDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIE  856
             VDQYHR+  DI LMKD+GMD+YRFSI+W RIFPNGTG+ N+ G+ +YN+LID+LL  GI+
Sbjct  78    VDQYHRFQNDINLMKDLGMDSYRFSISWPRIFPNGTGEPNKEGIKYYNSLIDSLLVKGIQ  137

Query  857   PYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVL  1036
             P+VTLYH+DLPQ LE++Y GWL+ Q+IKD+  YA TCF  FGDRVK W+T NEP +  + 
Sbjct  138   PFVTLYHWDLPQMLEDKYEGWLSSQIIKDYEHYANTCFKAFGDRVKHWITFNEPHNFALH  197

Query  1037  GYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKIT  1216
             GYDLG+ APG CS+  HLLC  G S+TEPY VAH++LL+HAAA   Y+  ++ +QGG+I 
Sbjct  198   GYDLGIQAPGRCSLLGHLLCKKGKSSTEPYIVAHNILLSHAAAYRSYQLHFKEQQGGQIG  257

Query  1217  IVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAE  1396
             I ++  WYEP+T    D DA  RA+DF LGWFL+P+  G+YP S+   V  RLP+ S   
Sbjct  258   IALDVIWYEPITELDEDKDAAARAMDFSLGWFLDPLFFGKYPLSMEKLVAKRLPEISDTA  317

Query  1397  SALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAV  1576
             S  L GS D++G+NHYT+ Y  +  T I  L + D  TD+   T  ++    IGE+A + 
Sbjct  318   SKFLVGSLDFIGINHYTSVYTRNDRTRIRKLVMQDAATDAAVITTAYRRGSAIGEKAASS  377

Query  1577  WLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAK------TDGLNDIKRIRYHRDYLK  1738
             WL+IVP G+R L+ ++KDKYG+  V ITENGMDD           LND KRIRYHRDYL 
Sbjct  378   WLHIVPWGIRKLVKHVKDKYGDTPVIITENGMDDPSGPFRTLEKALNDDKRIRYHRDYLS  437

Query  1739  SLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNF  1918
             +L AAI+EDGCNV+GYF WSL+DNWEW +G++ RFGLYYVD+ +NL RIPK+S +WFKN 
Sbjct  438   NLSAAIREDGCNVRGYFVWSLLDNWEWNMGYTVRFGLYYVDFRNNLTRIPKDSVQWFKNM  497

Query  1919  L  1921
             L
Sbjct  498   L  498



>gb|KFK27066.1| hypothetical protein AALP_AA8G330000 [Arabis alpina]
Length=522

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/482 (57%), Positives = 360/482 (75%), Gaps = 6/482 (1%)
 Frame = +2

Query  500   CGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAV  679
               +++ISRA+FP+GFVFGTAS+AYQFEGAV E  +G +IWDTF   PGK+ DFSNAD  V
Sbjct  18    VSSESISRANFPDGFVFGTASSAYQFEGAVSEGNKGQSIWDTFTKKPGKILDFSNADTTV  77

Query  680   DQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEP  859
             DQYHR+  DI+LMKD+ MDAYRFSI+WSRIFPNGTG+ N  GV +YN+LIDALLA GI+P
Sbjct  78    DQYHRFHSDIDLMKDLRMDAYRFSISWSRIFPNGTGEPNPEGVMYYNSLIDALLAKGIKP  137

Query  860   YVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLG  1039
             YVTLYH+DLPQALE+RY GWL+R+V+ DF  YA TCF  FGDRVK W+T NEPR +++ G
Sbjct  138   YVTLYHWDLPQALEDRYEGWLSREVVDDFEHYAFTCFKAFGDRVKYWITFNEPRGLSIQG  197

Query  1040  YDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITI  1219
             YD G+ APG CS+  H  C  G S+ EPY VAH++LL++AAA   Y+R ++ KQ G+I I
Sbjct  198   YDTGIQAPGRCSLLGHWFCKEGKSSVEPYVVAHNILLSNAAAYHTYQRNFKEKQRGRIGI  257

Query  1220  VVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAES  1399
              +++ W+EP+++   D DA +RA+DF +GWF++P++ G+YP S+   V +RLPK +   S
Sbjct  258   SLDAKWFEPMSDCDEDRDAARRAMDFSIGWFMDPLINGDYPASMKGLVEERLPKITPEMS  317

Query  1400  ALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVW  1579
               +KG++DY+G+NHYTT YA +    I  L L D  +D+   T  ++G +PIG++A + W
Sbjct  318   KTIKGAFDYIGINHYTTLYARNDRIRIRKLILQDATSDAAVITSSYRGGVPIGKKAGSSW  377

Query  1580  LYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLKS  1741
             L+IVP G+R L  Y+KD YGNP V ITENGMD+  +        L D KRI +HRDYL +
Sbjct  378   LHIVPWGIRKLAVYVKDMYGNPPVIITENGMDEKNSPFIDMEKALEDDKRISFHRDYLSN  437

Query  1742  LLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             L AAI++DGC+V+GYF WSL+DNWEW  G++ RFG+YYVDY +NL RIPK SA+WF+  L
Sbjct  438   LSAAIRKDGCDVRGYFVWSLLDNWEWNSGYTVRFGIYYVDYKNNLTRIPKASAQWFRTLL  497

Query  1922  AS  1927
              S
Sbjct  498   DS  499



>gb|KHG13868.1| Putative beta-glucosidase 41 -like protein [Gossypium arboreum]
Length=513

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/483 (58%), Positives = 354/483 (73%), Gaps = 6/483 (1%)
 Frame = +2

Query  491   LQICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNAD  670
             L    AQ + R  FP+GF+FGTAS+AYQ+EGAV E  +G +IWDTF   PGK+ DFSNAD
Sbjct  22    LVSSSAQTVDRDDFPDGFIFGTASSAYQYEGAVNEGNKGDSIWDTFTRKPGKIMDFSNAD  81

Query  671   VAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANG  850
               VDQYHR+  DIELMKD+GMDAYRFSI+W RIFP GTG+ N  G+++YN LIDAL+  G
Sbjct  82    TTVDQYHRFESDIELMKDLGMDAYRFSISWPRIFPYGTGEPNIEGINYYNCLIDALIKKG  141

Query  851   IEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSIT  1030
             I+P VTLYH+DLPQ LE++Y GWL++Q++ DF  YA TCF  FGDRVK WVT NEP   +
Sbjct  142   IQPLVTLYHWDLPQILEDKYQGWLSKQIVDDFEHYAITCFQAFGDRVKHWVTFNEPHGFS  201

Query  1031  VLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGK  1210
             + GYD G+ APG CSI   LLC +GNS+TEPY VAH++LL+HAAA   YRR ++ KQGG+
Sbjct  202   IQGYDNGIQAPGRCSILGGLLCNSGNSSTEPYIVAHNILLSHAAAYHSYRRYFKEKQGGQ  261

Query  1211  ITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSA  1390
             I I +++ WYEP+++   D DA  RA+DF +GWFL+P+  G+YP S+   VG+RLP+ S 
Sbjct  262   IGIALDAKWYEPISDKDEDKDAANRALDFGIGWFLDPLFFGDYPGSMRKLVGERLPQISP  321

Query  1391  AESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERAN  1570
               S LL G++D++GVNHYTT+YA +  T I  L L D  +D+   T  F+    IGE+A 
Sbjct  322   ETSKLLVGAFDFIGVNHYTTYYARNDRTQIRKLILQDASSDAAVITTSFREGAAIGEKAA  381

Query  1571  AVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKTD------GLNDIKRIRYHRDY  1732
             + WL IVP G+R L  Y+KDKYGNP V ITENGMDD  +        L D+KRI YHRDY
Sbjct  382   SRWLRIVPWGIRKLARYLKDKYGNPPVMITENGMDDLNSPFISIKRALKDVKRIEYHRDY  441

Query  1733  LKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFK  1912
             L +L AAI+ED C+V+GYF WSL+DNWEW  G++ RFGLYYVDY +NL RIPK S +WFK
Sbjct  442   LSNLSAAIREDKCDVRGYFVWSLLDNWEWNSGYTVRFGLYYVDYKNNLTRIPKASVQWFK  501

Query  1913  NFL  1921
             +FL
Sbjct  502   SFL  504



>sp|Q0DA21.2|BGL25_ORYSJ RecName: Full=Beta-glucosidase 25; Short=Os6bglu25; Flags: Precursor 
[Oryza sativa Japonica Group]
Length=501

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/480 (59%), Positives = 347/480 (72%), Gaps = 6/480 (1%)
 Frame = +2

Query  506   AQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQ  685
              + ISRA FP GF+FGTAS+AYQ+EGAV E  RG TIWDT    PG+V DFSNADVAVD 
Sbjct  17    VEAISRADFPPGFIFGTASSAYQYEGAVNEGQRGPTIWDTLTKRPGRVIDFSNADVAVDH  76

Query  686   YHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYV  865
             YHRY ED+ELM D+GMDAYRFSI+WSRIFPNGTG+ N+ G+ +YN+LIDALL  GIEPYV
Sbjct  77    YHRYKEDVELMNDIGMDAYRFSISWSRIFPNGTGEPNEEGLSYYNSLIDALLDKGIEPYV  136

Query  866   TLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYD  1045
             TL+H+DLPQALE+RY GWLN ++I+DF  YA TCF  FGDRVK W+T NEP +  + GYD
Sbjct  137   TLFHWDLPQALEDRYGGWLNSEIIEDFVQYAFTCFKEFGDRVKHWITFNEPYNFAIDGYD  196

Query  1046  LGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVV  1225
             LG+ APG CSI  H+ C  G S+TEPY VAH++LLAHA A   Y + ++ +QGG I I +
Sbjct  197   LGIQAPGRCSILSHVFCREGKSSTEPYIVAHNILLAHAGAFRAYEQHFKNEQGGLIGIAL  256

Query  1226  ESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESAL  1405
              S WYEP +N+  D +A  RA+DF LGWFL+P+M G YP S+    GDRLP+FS   S L
Sbjct  257   NSRWYEPFSNADEDTEAAARAMDFELGWFLDPLMFGHYPPSMQKLAGDRLPQFSTHASKL  316

Query  1406  LKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLY  1585
             + GS D++G+NHYTT YA +    I  L + D  TDS      ++    IGE A + WL+
Sbjct  317   VSGSLDFVGINHYTTLYARNDRLRIRKLVMDDASTDSAVIPTAYRHGKKIGETAASSWLH  376

Query  1586  IVPRGMRNLMNYIKDKYGNPLVFITENGMDDAK------TDGLNDIKRIRYHRDYLKSLL  1747
             IVP GM  LM ++K+KYGNP V ITENGMDDA        D L D KRI+YH DY+ +LL
Sbjct  377   IVPWGMFKLMKHVKEKYGNPPVVITENGMDDANHPFSRLEDVLQDDKRIQYHNDYMSNLL  436

Query  1748  AAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
              AI+++GCNV GYF WSL+DNWEW  G++ RFGLYY+DY +NL RIPK S +WF   LA 
Sbjct  437   DAIRKEGCNVHGYFVWSLLDNWEWNSGYTVRFGLYYIDYKNNLTRIPKASVQWFSQVLAQ  496



>ref|XP_007021150.1| Beta glucosidase 41 isoform 1 [Theobroma cacao]
 gb|EOY12675.1| Beta glucosidase 41 isoform 1 [Theobroma cacao]
Length=509

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/483 (57%), Positives = 353/483 (73%), Gaps = 6/483 (1%)
 Frame = +2

Query  491   LQICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNAD  670
             L    ++++ RA FP GF FGTAS+AYQFEGAV E  +G +IWDTF   PGK+ DFSNAD
Sbjct  15    LFFVSSESVRRADFPHGFTFGTASSAYQFEGAVNEGNKGDSIWDTFTRKPGKIMDFSNAD  74

Query  671   VAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANG  850
              AVDQYHR+  DI+LMKD+GMDAYRFSI+WSRIFPNG G+ N  G+++YN LIDAL+  G
Sbjct  75    TAVDQYHRFESDIDLMKDLGMDAYRFSISWSRIFPNGAGESNVEGINYYNRLIDALIQKG  134

Query  851   IEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSIT  1030
             I+PYVTLYH+DLPQ LE++Y GWL+RQ++ DF  +A TCF  FGDRVK W+T NEP   +
Sbjct  135   IQPYVTLYHWDLPQMLEDKYEGWLSRQIVDDFEHFAFTCFQAFGDRVKHWITFNEPHGFS  194

Query  1031  VLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGK  1210
             + GYD G+ APG CSI   LLC TGNS+TEPY VAH++LL+HAAA   YR+ ++ +QGG+
Sbjct  195   IQGYDSGIQAPGRCSILGGLLCKTGNSSTEPYIVAHNILLSHAAAYHSYRKNFKERQGGQ  254

Query  1211  ITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSA  1390
             I + +++ WYEP++ S  D DA  RA+DF +GWFL+P+  G+YP S+   VG+RLP+   
Sbjct  255   IGMALDAKWYEPISESDEDKDAANRAMDFGIGWFLDPLFFGDYPLSMKRLVGERLPQVLP  314

Query  1391  AESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERAN  1570
               S +L GS D++G+NHYTT YA +  T I  L L D  +D+   T  F+G   IGERA 
Sbjct  315   EMSKMLLGSLDFIGINHYTTLYARNDRTRIRKLILQDASSDAAVITTSFRGGAAIGERAA  374

Query  1571  AVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDY  1732
             + WL +VP G+R L  Y+KDKYGNP V ITENGMDD  +        L D KRI++HRDY
Sbjct  375   SRWLRVVPWGIRKLARYVKDKYGNPPVIITENGMDDLNSPFINMKKALQDDKRIKFHRDY  434

Query  1733  LKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFK  1912
             L +L AAI+ED C+V+GYF WSL+DNWEW  G++ RFGLY+VDY +NL R+PK S +WFK
Sbjct  435   LSNLSAAIREDNCDVRGYFVWSLLDNWEWNSGYTVRFGLYFVDYKNNLTRVPKASVEWFK  494

Query  1913  NFL  1921
               L
Sbjct  495   GVL  497



>ref|XP_006656393.1| PREDICTED: beta-glucosidase 25-like isoform X1 [Oryza brachyantha]
Length=501

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/483 (58%), Positives = 349/483 (72%), Gaps = 6/483 (1%)
 Frame = +2

Query  497   ICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVA  676
             +  A+ ISRA FP GFVFGTAS+AYQ+EGAV E  RG TIWDT    PG+V DFSNADVA
Sbjct  14    LSCAEAISRADFPPGFVFGTASSAYQYEGAVNEGQRGPTIWDTLTKRPGRVIDFSNADVA  73

Query  677   VDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIE  856
             VD YHRY ED+ELMK +GMDAYRFSI+WSRIFPNGTG+ N+ G+ +YN+LID LL  GIE
Sbjct  74    VDHYHRYKEDVELMKGIGMDAYRFSISWSRIFPNGTGEPNEEGLSYYNSLIDTLLDKGIE  133

Query  857   PYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVL  1036
             PYVTL+H+DLPQALE+RY GWLN ++I+DF  YA TCF  FGDRVK W+T NEP +  + 
Sbjct  134   PYVTLFHWDLPQALEDRYEGWLNSKIIEDFVQYAFTCFKEFGDRVKHWITFNEPYNFAID  193

Query  1037  GYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKIT  1216
             GYDLG+ APG CSI  H+ C  G S+TEPY VAH++LLAHA A   Y + ++ +QGG I 
Sbjct  194   GYDLGIQAPGRCSILSHVFCREGKSSTEPYIVAHNVLLAHAGAFRTYEQHFKKEQGGSIG  253

Query  1217  IVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAE  1396
             I + S WYEP +++  D +A  RA+DF LGWFL+P+M G YP S+    GDRLP+FS   
Sbjct  254   IALNSRWYEPFSSADEDREAAARAMDFELGWFLDPLMFGHYPPSMQKLAGDRLPQFSTQA  313

Query  1397  SALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAV  1576
             S L+ GS D++G+NHYTT YA +    I  L ++D  TDS      ++    IGE A + 
Sbjct  314   SKLVSGSLDFVGINHYTTLYARNDRMRIRKLVMNDASTDSAVIPTAYRHGKKIGETAASS  373

Query  1577  WLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAK------TDGLNDIKRIRYHRDYLK  1738
             WL+IVP GM  LM ++K+KYGNP V ITENGMDDA        D L D KRI+YH DY+ 
Sbjct  374   WLHIVPWGMFKLMKHVKEKYGNPPVIITENGMDDANHPFSRLEDVLQDDKRIQYHNDYMS  433

Query  1739  SLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNF  1918
             +LL AI+++GC+V GYF WSL+DNWEW  G++ RFGLYY+DY +NL RIPK S +WF   
Sbjct  434   NLLDAIRKEGCSVHGYFVWSLLDNWEWNSGYTVRFGLYYIDYKNNLTRIPKASVQWFSQV  493

Query  1919  LAS  1927
             LA 
Sbjct  494   LAQ  496



>ref|NP_200268.3| beta glucosidase 41 [Arabidopsis thaliana]
 sp|Q9FIU7.2|BGL41_ARATH RecName: Full=Putative beta-glucosidase 41; Short=AtBGLU41; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AED96511.1| beta glucosidase 41 [Arabidopsis thaliana]
Length=535

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/481 (58%), Positives = 359/481 (75%), Gaps = 7/481 (1%)
 Frame = +2

Query  500   CGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFA-HTPGKVTDFSNADVA  676
               +++ISRA+FP+GFVFGTAS+AYQFEGAVKE  +G +IWDTF    PGK+ DFSNAD  
Sbjct  25    VSSESISRANFPDGFVFGTASSAYQFEGAVKEGNKGESIWDTFTKEKPGKILDFSNADTT  84

Query  677   VDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIE  856
             VDQYHR+  DI+LMKD+ MDAYRFSI+WSRIFPNGTG++N  GV +YN+LIDALLA GI+
Sbjct  85    VDQYHRFHNDIDLMKDLRMDAYRFSISWSRIFPNGTGEVNPDGVKYYNSLIDALLAKGIK  144

Query  857   PYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVL  1036
             PYVTLYH+DLPQALE+RY GWL+R+V+ DF  YA TCF  FGDRVK W+T NEP  +++ 
Sbjct  145   PYVTLYHWDLPQALEDRYEGWLSREVVDDFEHYAFTCFKAFGDRVKYWITFNEPHGVSIQ  204

Query  1037  GYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKIT  1216
             GYD G+ APG CS+  H  C  G S+ EPY VAH++LL+HAAA   Y+R ++ KQ G+I 
Sbjct  205   GYDTGIQAPGRCSLLGHWFCKKGKSSVEPYIVAHNILLSHAAAYHTYQRNFKEKQRGQIG  264

Query  1217  IVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAE  1396
             I +++ WYEP+++   D DA +RA+DF LGWF++P++ G+YP S+ S V +RLPK +   
Sbjct  265   ISLDAKWYEPMSDCDEDKDAARRAMDFGLGWFMDPLINGDYPASMKSLVEERLPKITPEM  324

Query  1397  SALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAV  1576
                +KG++DY+G+NHYTT YA +  T I  L L D  +DS   T  F+G + IGERA + 
Sbjct  325   YKTIKGAFDYVGINHYTTLYARNDRTRIRKLILQDASSDSAVITSSFRGGVAIGERAGSS  384

Query  1577  WLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLK  1738
             WL+IVP G+R L  Y+KD YGNP VFITENGMD+  +        L D KRI +HRDYL 
Sbjct  385   WLHIVPWGIRKLAVYVKDIYGNPPVFITENGMDEKNSPFIDMEKALKDDKRIGFHRDYLS  444

Query  1739  SLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNF  1918
             +L AAI+ D C+V+GYF WSL+DNWEW  G++ RFG+YYVDY +NL RIPK SA+WF+  
Sbjct  445   NLSAAIRNDECDVRGYFVWSLLDNWEWNSGYTVRFGIYYVDYKNNLTRIPKASARWFQTI  504

Query  1919  L  1921
             L
Sbjct  505   L  505



>gb|KEH30766.1| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=515

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/478 (57%), Positives = 355/478 (74%), Gaps = 6/478 (1%)
 Frame = +2

Query  506   AQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQ  685
             A++I+R  FPEGF+FGTAS+A+QFEGA  E  +G +IWDTF+  PG++ DFSNA++AVDQ
Sbjct  21    AESITRGDFPEGFIFGTASSAHQFEGAADEGNKGDSIWDTFSRIPGRILDFSNANMAVDQ  80

Query  686   YHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYV  865
             YHR+  DI LMKD+GMD+YRFSI+W RIFPNGTG+ N  G+ +YN LIDALL  GI+P+V
Sbjct  81    YHRFQNDINLMKDLGMDSYRFSISWPRIFPNGTGEPNTEGIKYYNTLIDALLEKGIQPFV  140

Query  866   TLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYD  1045
             TLYH+DLPQ LE++Y GWL+ Q+IKDF  YA TCF  FGDRVK W+T NEP +  + GYD
Sbjct  141   TLYHWDLPQMLEDKYEGWLSTQIIKDFEHYAYTCFKAFGDRVKHWITFNEPHNFALHGYD  200

Query  1046  LGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVV  1225
             LG+ APG CS+  HL+C  G S+TEPY VAH++LL+HAAA   Y+  ++ KQGGKI I +
Sbjct  201   LGIQAPGRCSLLGHLVCKKGKSSTEPYIVAHNILLSHAAAYRSYQLHFKEKQGGKIGIAL  260

Query  1226  ESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESAL  1405
             ++ WYEP+T    D +A  RA+DF LGWFL+P++ G+YP S+   V +RLP+ + A S L
Sbjct  261   DAVWYEPITELDEDKEAAARAMDFSLGWFLDPLIFGKYPFSMQKLVSERLPEITDATSNL  320

Query  1406  LKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLY  1585
             L GS D++G+NHYT+ YA +  T I  L + D ++D+   T  ++    IG +A + WL+
Sbjct  321   LVGSLDFIGINHYTSLYARNDRTRIHKLIMQDAISDAAVITTAYRRGAAIGNKAASSWLH  380

Query  1586  IVPRGMRNLMNYIKDKYGNPLVFITENGMDDAK------TDGLNDIKRIRYHRDYLKSLL  1747
             IVP G+R LM ++K KYGN  V ITENGMDD           LND KRIRYHRDYL +L 
Sbjct  381   IVPWGIRKLMKHVKSKYGNTPVIITENGMDDPSRPLMTLQKALNDDKRIRYHRDYLSNLS  440

Query  1748  AAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             AAI+EDGC+V+GYF WSL+DNWEW +G++ RFGLYYVD+ +NL RIPK S +WFKN L
Sbjct  441   AAIREDGCDVRGYFVWSLLDNWEWNMGYTVRFGLYYVDFKNNLTRIPKSSVQWFKNML  498



>ref|XP_010443033.1| PREDICTED: putative beta-glucosidase 41 [Camelina sativa]
Length=525

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/480 (57%), Positives = 356/480 (74%), Gaps = 6/480 (1%)
 Frame = +2

Query  491   LQICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNAD  670
             L    +++ISRA+FP+GFVFGTAS+AYQFEGAVKE  +G +IWDTF   PGK+ DFSNAD
Sbjct  22    LDHVSSESISRANFPDGFVFGTASSAYQFEGAVKEGNKGESIWDTFTKKPGKILDFSNAD  81

Query  671   VAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANG  850
               VDQYHR+  DI+LMKD+ MDAYRFSI+WSRIFPNGTGK+N  GV +YN+LIDALL  G
Sbjct  82    TTVDQYHRFHSDIDLMKDLSMDAYRFSISWSRIFPNGTGKVNPDGVKYYNSLIDALLVKG  141

Query  851   IEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSIT  1030
             I+PYVTLYH+DLPQALE+RY GWL+R+V+ DF  YA TCF  FGDRVK WVT NEP  ++
Sbjct  142   IKPYVTLYHWDLPQALEDRYEGWLSREVVDDFERYAFTCFKAFGDRVKYWVTFNEPHGLS  201

Query  1031  VLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGK  1210
             + GYD G+ APG CS+  H  C  G S+ EPY VAH++LL+HAAA   Y+R ++ KQ G+
Sbjct  202   IQGYDTGIQAPGRCSLLGHWFCKKGTSSVEPYVVAHNILLSHAAAYHTYQRNFKEKQRGQ  261

Query  1211  ITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSA  1390
             I I +++ WYEP+++   D DA +RA+DF +GWF++P++ G+YP S+ S V  RLPK + 
Sbjct  262   IGIALDAKWYEPMSDCDEDKDAARRAMDFGIGWFMDPLINGDYPASMKSLVEKRLPKITP  321

Query  1391  AESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERAN  1570
               S  + G+YD++G+NHYTT YA +  T I  L LHD  +D+   T  ++G + IGERA 
Sbjct  322   EMSKSIIGAYDFIGINHYTTLYARNDRTRIRKLILHDASSDAAVITSSYRGGVAIGERAG  381

Query  1571  AVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDY  1732
             + WL+IVP G+R L  Y+KD YGNP V+ITENGMD+           L D KRI +HRDY
Sbjct  382   SSWLHIVPWGIRKLAVYVKDIYGNPPVYITENGMDEKNNPFIDMEKALQDDKRISFHRDY  441

Query  1733  LKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFK  1912
             L +L AAI+ D C+V+GYF WSL+DNWEW  G++ RFG+YY+DY +NL RIPK SA+ F+
Sbjct  442   LSNLSAAIRNDECDVRGYFVWSLLDNWEWNSGYTVRFGIYYIDYKNNLTRIPKASARLFQ  501



>ref|XP_010539264.1| PREDICTED: putative beta-glucosidase 41 isoform X2 [Tarenaya 
hassleriana]
Length=503

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/484 (57%), Positives = 357/484 (74%), Gaps = 6/484 (1%)
 Frame = +2

Query  494   QICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADV  673
              +  ++++ RA FP+GFVFGTAS+AYQFEGAV E  +G +IWDTF   PG++ DFSNAD 
Sbjct  14    HVVSSESLGRADFPDGFVFGTASSAYQFEGAVDEGNKGESIWDTFTKKPGRILDFSNADT  73

Query  674   AVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGI  853
             AVDQYHR+  DI LMKD+GMDAYRFSI+W RIFPNGTG+ N  G+++YN+ ID L+A GI
Sbjct  74    AVDQYHRFESDIGLMKDLGMDAYRFSISWPRIFPNGTGEPNPDGINYYNSFIDVLIAKGI  133

Query  854   EPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITV  1033
             +PYVTLYH+DLPQAL++RY GWL+ QV+KD+  YA TCF  FGDRVKQW+T NEP   ++
Sbjct  134   QPYVTLYHWDLPQALQDRYEGWLSSQVVKDYEHYAFTCFKEFGDRVKQWITFNEPHGFSI  193

Query  1034  LGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKI  1213
              GYD G+ APG CS+  HL C  G S+ EPY VAH++LL+HAAA   Y+R ++ KQ GKI
Sbjct  194   QGYDTGIQAPGRCSLLGHLFCKKGKSSVEPYVVAHNILLSHAAAYYSYQRNFKDKQRGKI  253

Query  1214  TIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAA  1393
              I +++ WYEP+++   D DA +RA+DF LGWFL+P++ G+YP S+   VG+RLPK +  
Sbjct  254   GIALDAKWYEPMSDCDEDNDAARRAMDFGLGWFLDPLIYGDYPASMKRLVGERLPKITPE  313

Query  1394  ESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANA  1573
              S  +KGS D++G+NHYTT YA +  T I  L L D  +D+   T   +G + IGERA +
Sbjct  314   MSKRIKGSLDFVGINHYTTLYARNDRTRIRKLILQDASSDAAVITSSLRGGVAIGERAGS  373

Query  1574  VWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDA------KTDGLNDIKRIRYHRDYL  1735
              WL+IVP G+R L  Y+KD YGNP +FITENG+D+       +   L D KRI YHRDYL
Sbjct  374   SWLHIVPWGIRKLAVYLKDNYGNPPIFITENGVDELNNPLMNRDKALKDDKRINYHRDYL  433

Query  1736  KSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKN  1915
              +L AAI+E+ C+V+GYF WSL+DNWEW  G++ RFGLYYVDY +NL RIPK S +WF++
Sbjct  434   SNLSAAIREENCDVRGYFVWSLLDNWEWNSGYTVRFGLYYVDYTNNLTRIPKASVQWFQS  493

Query  1916  FLAS  1927
              L S
Sbjct  494   ILHS  497



>ref|XP_004294321.1| PREDICTED: putative beta-glucosidase 41-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=524

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/489 (57%), Positives = 352/489 (72%), Gaps = 17/489 (3%)
 Frame = +2

Query  506   AQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQ  685
             +Q++SRA FPEGFVFGTAS+AYQFEGAV E  +GA++WDTF   PGK+ DFSNAD AVDQ
Sbjct  17    SQSLSRADFPEGFVFGTASSAYQFEGAVNEGNKGASVWDTFTKVPGKILDFSNADTAVDQ  76

Query  686   YHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYV  865
             YHR+  D++LMKDMG++AYRFSI+W RIFPNGTG  N  G+ +YN+LID+LL  GI+P+V
Sbjct  77    YHRFQGDVDLMKDMGVNAYRFSISWPRIFPNGTGAPNSEGISYYNSLIDSLLEKGIQPFV  136

Query  866   TLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYD  1045
             TLYH+DLPQ LE++Y GWL+ Q++KDF  YA TCF  FGDRVK W+T NEP    +  YD
Sbjct  137   TLYHWDLPQMLEDKYEGWLSTQIVKDFEHYAITCFQAFGDRVKNWITFNEPHGYALQSYD  196

Query  1046  LGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVV  1225
             LG+ APG CSI  HL C  GNS+ EPY VAH++LL+HAA    Y++ ++ KQGG+I I +
Sbjct  197   LGIQAPGRCSILGHLFCKKGNSSVEPYIVAHNILLSHAATYHTYQQYFKEKQGGQIGISL  256

Query  1226  ESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESAL  1405
             ++ W+EPL+ +  DIDA  RA +F LGWFL+P+  G+YP S+   VG RLP  S   S  
Sbjct  257   DAKWHEPLSETDEDIDAAHRANEFSLGWFLDPLFFGDYPLSMKKLVGKRLPAISKEVSKF  316

Query  1406  LKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFT---------LP--FKGLMP  1552
             L GS D++G+NHYTT YA +  T I    L D  +D+   T         LP  +KG + 
Sbjct  317   LVGSVDFIGINHYTTLYARNDRTRIRKFILQDATSDAAVITTRKMPQNNVLPPDYKGGVA  376

Query  1553  IGERANAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDD------AKTDGLNDIKRI  1714
             IGE+A + WL IVP G+R L  YIKDKYGNP + ITENGMDD      +    LND KRI
Sbjct  377   IGEKAASRWLRIVPWGIRKLARYIKDKYGNPPMMITENGMDDPNKPFTSMEKALNDEKRI  436

Query  1715  RYHRDYLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKE  1894
             R+HRDYL +L AAI+ED C+V+GYF WSL+DNWEW +G++ RFGLYYVDY  NL RIPK 
Sbjct  437   RFHRDYLSNLSAAIREDKCDVRGYFVWSLLDNWEWNMGYTVRFGLYYVDYKKNLTRIPKS  496

Query  1895  SAKWFKNFL  1921
             S +WF  FL
Sbjct  497   SVQWFTRFL  505



>ref|XP_002437464.1| hypothetical protein SORBIDRAFT_10g027600 [Sorghum bicolor]
 gb|EER88831.1| hypothetical protein SORBIDRAFT_10g027600 [Sorghum bicolor]
Length=511

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/486 (57%), Positives = 352/486 (72%), Gaps = 6/486 (1%)
 Frame = +2

Query  506   AQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQ  685
             A+ + RA FP+GFV GTAS+AYQ+EGAV E  RG TIWDT    PG+V DFSNAD+AVD 
Sbjct  17    AEALRRADFPQGFVIGTASSAYQYEGAVNEGRRGPTIWDTLTRRPGRVIDFSNADIAVDH  76

Query  686   YHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYV  865
             YHRY ED++L+KD+GMDAYRFSI+WSRIFPNGTG+ N+ G+++YN+LID LL  GI+PYV
Sbjct  77    YHRYKEDVDLIKDIGMDAYRFSISWSRIFPNGTGEPNEEGLNYYNSLIDVLLDKGIQPYV  136

Query  866   TLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYD  1045
             TL+H+DLPQALE+RY GWLN Q++ DF  YA TCF  FGDRVK W+T NEP +  + GYD
Sbjct  137   TLFHWDLPQALEDRYGGWLNSQIVDDFVHYASTCFKEFGDRVKHWITFNEPHNFAIDGYD  196

Query  1046  LGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVV  1225
             LG+ APG CSI  H+ C  G S+TEPY VAH++LLAHA A   Y++ ++  QGG I I +
Sbjct  197   LGIQAPGRCSILSHIFCREGKSSTEPYVVAHNILLAHAGAFHSYKQHFKKDQGGIIGIAL  256

Query  1226  ESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESAL  1405
             +S WYEPL++   D +A  RA+DF LGWFL+P+M G YP S+    GDRLPKFS   S L
Sbjct  257   DSKWYEPLSDVDEDTEAAARAMDFELGWFLDPLMFGHYPPSMQKLAGDRLPKFSTQASKL  316

Query  1406  LKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLY  1585
             + GS D++G+NHYTT Y  +    I  L ++D  TD+      ++    IG+ A + WL+
Sbjct  317   VSGSLDFVGINHYTTLYVRNDRMRIRKLVMNDASTDAAIIPTAYRHGKKIGDTAASGWLH  376

Query  1586  IVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLKSLL  1747
             IVP GM  LM +IK+KYGNP V ITENGMDDA        + L D KRI+YH DY+ +LL
Sbjct  377   IVPWGMFKLMKHIKEKYGNPPVIITENGMDDANNRFSRLENDLQDDKRIQYHNDYMSNLL  436

Query  1748  AAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
              AI+++GCNV GYF WSL+DNWEW  G++ RFGLYY+DY++NL RIPK S +WFK  LA 
Sbjct  437   DAIRKEGCNVHGYFVWSLLDNWEWNSGYTVRFGLYYIDYNNNLTRIPKASVEWFKQVLAQ  496

Query  1928  *IMNYD  1945
                N +
Sbjct  497   KTANLE  502



>ref|XP_006475282.1| PREDICTED: putative beta-glucosidase 41-like [Citrus sinensis]
Length=506

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/481 (58%), Positives = 353/481 (73%), Gaps = 6/481 (1%)
 Frame = +2

Query  497   ICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVA  676
             +  +++ISRA FP+GF+FGTAS+AYQFEGAV E  +G +IWD+F   PG++ DFSNAD A
Sbjct  15    VANSESISRADFPDGFIFGTASSAYQFEGAVNEGNKGPSIWDSFTRQPGRIMDFSNADTA  74

Query  677   VDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIE  856
             VDQYHR+  DI+LMKD+GMDAYRFSI+W RIFPNGTG+ N  G+ +YN+LIDALL  GI+
Sbjct  75    VDQYHRFKSDIDLMKDLGMDAYRFSISWPRIFPNGTGEPNPEGISYYNSLIDALLEKGIQ  134

Query  857   PYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVL  1036
             P VTLYH+DLPQ LE++Y GWL+RQ+I+DF  YA TCF  FGDRVK W+T NEP   T+ 
Sbjct  135   PCVTLYHWDLPQVLEDKYGGWLSRQIIEDFEHYAFTCFQEFGDRVKYWITFNEPHGFTLQ  194

Query  1037  GYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKIT  1216
             GYD G+ APG CSI  HL C TG S+ EPY VAH++LL+HAAA   YR  ++ KQGG+I 
Sbjct  195   GYDTGLQAPGRCSILGHLFCKTGKSSIEPYVVAHNILLSHAAAYHSYRINFKEKQGGQIG  254

Query  1217  IVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAE  1396
             I +++ WYEP ++S  D DA QRAIDF +GWFL+P+  GEYP S+ S V  RLP+ +   
Sbjct  255   IALDAKWYEPKSDSDEDKDAAQRAIDFGIGWFLDPLFFGEYPLSMRSLVDGRLPEITPEM  314

Query  1397  SALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAV  1576
             S  L GS D++G+NHYTT YA +  + I  L L D  +D+   T  F+  + IG+RA + 
Sbjct  315   SKALVGSLDFVGLNHYTTLYARNDRSRIQKLILQDAYSDAAVITTSFRSGIAIGKRAASR  374

Query  1577  WLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLK  1738
             WL+IVP G+R L  Y+K KY NP + ITENGMDD  +        L+D+KRIRYH DYL 
Sbjct  375   WLHIVPWGIRKLARYVKHKYKNPPMIITENGMDDPNSPFITLNKALHDVKRIRYHGDYLS  434

Query  1739  SLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNF  1918
             +L AAI+ED C+V+GYF WSL+DNWEW  G++ RFGLYYVDY +NL RIPK S +WFK  
Sbjct  435   NLSAAIREDNCDVRGYFIWSLLDNWEWNSGYTVRFGLYYVDYKNNLTRIPKASVEWFKRM  494

Query  1919  L  1921
             L
Sbjct  495   L  495



>ref|XP_010644313.1| PREDICTED: putative beta-glucosidase 41 [Vitis vinifera]
Length=504

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/480 (57%), Positives = 351/480 (73%), Gaps = 6/480 (1%)
 Frame = +2

Query  506   AQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQ  685
             +++ISR  FP+GF+FGTAS+AYQFEGAV E  +G +IWDTF   PG++ DFSNAD+AVDQ
Sbjct  17    SESISRVDFPDGFIFGTASSAYQFEGAVDEGNKGVSIWDTFTRQPGRILDFSNADMAVDQ  76

Query  686   YHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYV  865
             YHR+  DI+LMKD+GMDAYRFSI+WSRIFP GTG+ N  G+++YN+LIDALL  GI+PYV
Sbjct  77    YHRFKTDIDLMKDLGMDAYRFSISWSRIFPKGTGEPNLEGIEYYNSLIDALLEKGIQPYV  136

Query  866   TLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYD  1045
             TLYH+DLPQ LE+RY GWL++Q++KDF  YA TCF  FGDRVK W+T NEP    + GYD
Sbjct  137   TLYHWDLPQMLEDRYEGWLSKQIVKDFEYYASTCFQAFGDRVKNWITFNEPHGFALQGYD  196

Query  1046  LGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVV  1225
              G+ APG CSI  HL C TG S+TEPY VAH++LL+HAAA   Y+  ++  QGG I + +
Sbjct  197   TGLQAPGRCSILGHLFCKTGESSTEPYIVAHNILLSHAAAYHNYQLHFKESQGGLIGMAL  256

Query  1226  ESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESAL  1405
             ++ WYEP+++S  D DA +RA+DF + WFL+P+  GEYP S+   VG RLP+ S   +  
Sbjct  257   DAKWYEPISDSDEDKDAARRAMDFGIRWFLDPLFFGEYPLSMQRLVGKRLPEISPKTAKF  316

Query  1406  LKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLY  1585
             L GS D++G+NHYTT YA +  T I    L D  +D+   T  F+G   IGERA + WL+
Sbjct  317   LLGSLDFVGINHYTTLYARNDRTRIRKFILRDASSDAAVITTSFRGGEAIGERAASRWLH  376

Query  1586  IVPRGMRNLMNYIKDKYGNPLVFITENGMDDAK------TDGLNDIKRIRYHRDYLKSLL  1747
             IVP G+R L  Y+KD YGNP V ITENGMDD           L D KRI +HRDYL +L 
Sbjct  377   IVPWGIRKLARYVKDNYGNPPVIITENGMDDPNRGSIPLEKALQDDKRINFHRDYLTNLS  436

Query  1748  AAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
             AAI++D C+V+GYF WSL+DNWEW +G+S RFGLY+VDY +NL RIPK S +WF+  L S
Sbjct  437   AAIRQDNCDVRGYFVWSLLDNWEWNLGYSVRFGLYFVDYKNNLTRIPKTSVQWFRRILRS  496



>ref|XP_010062938.1| PREDICTED: putative beta-glucosidase 41 [Eucalyptus grandis]
 ref|XP_010062939.1| PREDICTED: putative beta-glucosidase 41 [Eucalyptus grandis]
 gb|KCW70090.1| hypothetical protein EUGRSUZ_F03394 [Eucalyptus grandis]
Length=505

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/480 (57%), Positives = 351/480 (73%), Gaps = 6/480 (1%)
 Frame = +2

Query  506   AQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQ  685
             +++ISR  FP+GFVFGTAS+AYQFEGAV E  +G +IWDTF   PGK+ DFS AD AVDQ
Sbjct  18    SESISRDDFPDGFVFGTASSAYQFEGAVNEGNKGTSIWDTFTRQPGKILDFSTADTAVDQ  77

Query  686   YHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYV  865
             YHR+ +DI LMKD+GMDAYRFSI+W RIFPNGTG+ N+ G+++YN  IDALL  GIEPYV
Sbjct  78    YHRFKDDIGLMKDLGMDAYRFSISWPRIFPNGTGEPNREGLNYYNRFIDALLEQGIEPYV  137

Query  866   TLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYD  1045
             TLYH+DLPQ LE+ Y GWL+ +++KDF  YA TCF  FGDRVK W+T NEP   ++ GYD
Sbjct  138   TLYHWDLPQMLEDEYEGWLSERIVKDFENYASTCFRAFGDRVKYWITFNEPHGFSIQGYD  197

Query  1046  LGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVV  1225
              G+ APG CSI  H+ C  G S+ EPY VAH++LL+HAA    Y+  ++ KQGG+I I +
Sbjct  198   TGLQAPGRCSILGHVFCKRGKSSVEPYIVAHNILLSHAATYQNYKLNFREKQGGQIGISL  257

Query  1226  ESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESAL  1405
             ++ WYEP+++S  D DA  RA++F +GWFL+P+  GEYP S+ + V +RLP+ S+  S  
Sbjct  258   DAKWYEPISDSDEDQDAADRAMEFSIGWFLDPLFFGEYPLSMKNLVEERLPEISSEMSKF  317

Query  1406  LKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLY  1585
             L GS D++G+NHYTT YA +  T I  L L D  +D+   T PF+  + IGERA + WL+
Sbjct  318   LMGSLDFVGLNHYTTLYARNDRTRIRKLILQDASSDNAVITTPFRAGVAIGERAASRWLH  377

Query  1586  IVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLKSLL  1747
             +VP G+  L  Y++DKYGNP V +TENGMDD           L D KRI YHRDYL +L 
Sbjct  378   VVPWGITKLARYVRDKYGNPPVVMTENGMDDLNRPYIGLDKALQDDKRIEYHRDYLSNLS  437

Query  1748  AAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
             AAI++D CNV+GYF WSL+DNWEW +G++ RFGLYY+DY +NL RIPK S +WFK+ L S
Sbjct  438   AAIRQDNCNVRGYFVWSLLDNWEWNLGYTVRFGLYYIDYKNNLTRIPKSSVEWFKSLLRS  497



>ref|XP_008365874.1| PREDICTED: putative beta-glucosidase 41 [Malus domestica]
Length=504

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/480 (57%), Positives = 351/480 (73%), Gaps = 6/480 (1%)
 Frame = +2

Query  500   CGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAV  679
               A+++ RA FP+GFVFGTAS+A+QFEGA  E  +G ++WDTFA  PG++ DFSNAD AV
Sbjct  15    ANAESLGRADFPDGFVFGTASSAHQFEGAANEGNKGVSVWDTFAKEPGRILDFSNADTAV  74

Query  680   DQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEP  859
             DQYHR+  DIELMKDMG+DAYRFSI+W RIFPNG G+ N  G+++YN+LIDALL  GI+P
Sbjct  75    DQYHRFQSDIELMKDMGVDAYRFSISWPRIFPNGRGESNSEGINYYNSLIDALLEKGIKP  134

Query  860   YVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLG  1039
             +VTLYH+DLPQALE+RY GWL+  +IKDF  YA TCF  FGDRVK W+T NEP    + G
Sbjct  135   FVTLYHWDLPQALEDRYEGWLSANIIKDFEHYAFTCFKTFGDRVKNWITFNEPHGNALQG  194

Query  1040  YDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITI  1219
             YDLG+ APG CSI  HL C  GNS+ EPY VAH++LL+HAAA   YR+ ++  QGG++ I
Sbjct  195   YDLGIQAPGRCSILGHLFCKKGNSSAEPYIVAHNILLSHAAAYHSYRQFFKETQGGQVGI  254

Query  1220  VVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAES  1399
              +++ WYEP++++  D DA  RAIDF LGWFL+P+  GEYP S+   V  RLP+ S   S
Sbjct  255   SLDAKWYEPVSDNDEDRDAAHRAIDFSLGWFLDPLFFGEYPLSMKKLVDKRLPEISQEIS  314

Query  1400  ALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVW  1579
               L G+ D++G+NHYTT+YA +  T I    + D  +D+   + P+KG + IGERA + W
Sbjct  315   NFLVGTLDFVGLNHYTTYYARNDRTRIRKFIMQDATSDAAVISTPYKGGVAIGERAASRW  374

Query  1580  LYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLKS  1741
             L IVP G+R L  ++KDKYGNP + ITENGMDD           LND KRI +HRDYL +
Sbjct  375   LRIVPWGIRKLARHLKDKYGNPPMIITENGMDDPNKRFIPLEKALNDEKRITFHRDYLSN  434

Query  1742  LLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             L AAI++D C+V+GYF WSL+DNWEW +G++ RFGLYYVDY  NL RIPK S +WF+  L
Sbjct  435   LSAAIRQDNCDVRGYFVWSLLDNWEWNMGYTVRFGLYYVDYKKNLTRIPKTSVQWFRTLL  494



>gb|AES89992.2| beta-glucosidase [Medicago truncatula]
Length=411

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/408 (66%), Positives = 324/408 (79%), Gaps = 7/408 (2%)
 Frame = +2

Query  716   MKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLYHYDLPQA  895
             MKD+GMDAYRFSI+WSRI+PNG+G +NQAG+DHYN  I+ALLA GIEPYVTLYH+DLPQA
Sbjct  1     MKDLGMDAYRFSISWSRIYPNGSGAINQAGIDHYNKFINALLAKGIEPYVTLYHWDLPQA  60

Query  896   LENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGVHAPGHCS  1075
             L+++Y GWL+  +IKDFA YAETCF  FGDRVK W+T NEP + T  GYD+G+ APG CS
Sbjct  61    LDDKYKGWLSTDIIKDFATYAETCFQKFGDRVKHWITFNEPHTFTTQGYDVGLQAPGRCS  120

Query  1076  IFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESFWYEPLTN  1255
             I  HL C  GNSATEPY VAH++LL HAA  DIYR+KY+  QGG + I  +  WYEP TN
Sbjct  121   ILLHLFCRAGNSATEPYIVAHNVLLTHAAVADIYRKKYKNTQGGSLGIAFDVIWYEPATN  180

Query  1256  SPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKGSYDYLGV  1435
             +  DI A QRA DF LGWFL+P+M G+YP S+ SRVG+RLPKFS++E+AL+KGS D++G+
Sbjct  181   TKEDIAAAQRAQDFQLGWFLDPLMFGDYPSSMRSRVGNRLPKFSSSEAALVKGSLDFVGI  240

Query  1436  NHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVPRGMRNLM  1615
             NHYTT+YA +  TN++G+ LHD++ DSG  TLPF G   I ERAN++WLYIVP+ MR LM
Sbjct  241   NHYTTFYARNNSTNLIGILLHDSIADSGAITLPFNGTKAIAERANSIWLYIVPQSMRTLM  300

Query  1616  NYIKDKYGNPLVFITENGMDD------AKTDGLNDIKRIRYHRDYLKSLLAAIKEDGCNV  1777
             NYIK KYGNP VFITENGMDD      +K D L D KRIRY   YL  L A+IK DGCNV
Sbjct  301   NYIKQKYGNPPVFITENGMDDPNNIFISKKDALKDEKRIRYFSGYLSYLQASIK-DGCNV  359

Query  1778  KGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             KGYFAWSL+DNWEW  G+SSRFGLY+VDY DNL+R PK+S +WFKNFL
Sbjct  360   KGYFAWSLLDNWEWAAGYSSRFGLYFVDYRDNLKRYPKQSVQWFKNFL  407



>ref|XP_008454582.1| PREDICTED: beta-glucosidase 25 isoform X1 [Cucumis melo]
Length=526

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/480 (57%), Positives = 353/480 (74%), Gaps = 6/480 (1%)
 Frame = +2

Query  506   AQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQ  685
             ++ +SRA FP+GF+FGTA++AYQFEGAV E  RG +IWDTF   PG++ DFSNAD  VDQ
Sbjct  17    SECLSRADFPDGFIFGTAASAYQFEGAVDEGNRGPSIWDTFVKEPGRILDFSNADRTVDQ  76

Query  686   YHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYV  865
             YHR+ +DI+LMKDMGMDAYRFSI+W RIFPNGTGK N   +++YNN IDALL  GI+P+V
Sbjct  77    YHRFKDDIKLMKDMGMDAYRFSISWPRIFPNGTGKPNADAINYYNNFIDALLEKGIQPFV  136

Query  866   TLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYD  1045
             TLYH+DLPQ LE+ Y GWL+R+++KDF  YA TCF  FGDRVK W+T NEP   ++  YD
Sbjct  137   TLYHWDLPQVLEDEYEGWLSRRIVKDFEHYAVTCFQAFGDRVKHWITFNEPHGYSIKSYD  196

Query  1046  LGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVV  1225
             LG+ APG CS   H+LC  GNS++EPY VAH++LL+HAAA   Y+  ++ +QGG+I I +
Sbjct  197   LGIQAPGRCSFLGHILCKKGNSSSEPYIVAHNILLSHAAAYRNYQNHFKKRQGGRIGIAL  256

Query  1226  ESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESAL  1405
             ++ WYEPL+ +  + +A  RA+DF +GWFL+P+  G+YP S+   VG RLPK S   +  
Sbjct  257   DAIWYEPLSENDENKEAALRALDFEIGWFLDPLFFGKYPPSMRRLVGPRLPKISLVTAKF  316

Query  1406  LKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLY  1585
             L G+ D++G+NHYT+ YA +    I  L  +D  +DS   T P KG+  IGERA + WL+
Sbjct  317   LIGTLDFVGMNHYTSLYARNDRIGIRKLIFNDASSDSNVITTPRKGISTIGERAASHWLH  376

Query  1586  IVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLKSLL  1747
             IVP G+R L  Y+K KYGNP VFITENGMDD           L D KRIRYHRDYL +L 
Sbjct  377   IVPWGIRKLAVYLKYKYGNPPVFITENGMDDPNKRSIPLEKALKDDKRIRYHRDYLSNLS  436

Query  1748  AAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
              AI ++GCNV+GYFAWSL+DNWEW +G++ RFGLYYVDY +NL RIPK S +WF++ L S
Sbjct  437   IAIGQEGCNVQGYFAWSLLDNWEWNMGYTVRFGLYYVDYKNNLTRIPKASVQWFQSMLKS  496



>ref|XP_004151969.1| PREDICTED: putative beta-glucosidase 41-like [Cucumis sativus]
Length=532

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/480 (57%), Positives = 351/480 (73%), Gaps = 6/480 (1%)
 Frame = +2

Query  506   AQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQ  685
             ++ +SRA FP+GF+FGTA++AYQFEGAV E  RG +IWDTF   PG++ DFSNA+  VDQ
Sbjct  17    SECLSRADFPDGFIFGTAASAYQFEGAVDEGNRGPSIWDTFVKEPGRILDFSNANKTVDQ  76

Query  686   YHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYV  865
             YHR+ +DI+LMKDMGMDAYRFSIAW RIFPNGTGK N   +++YNN IDALL  GI+P+V
Sbjct  77    YHRFKDDIKLMKDMGMDAYRFSIAWPRIFPNGTGKPNADAINYYNNFIDALLEKGIQPFV  136

Query  866   TLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYD  1045
             TLYH+DLPQ LE+ Y GWL+R+++KDF  YA TCF  FGDRVK W+T NEP   ++  YD
Sbjct  137   TLYHWDLPQVLEDEYEGWLSRRIVKDFEHYAVTCFQAFGDRVKHWITFNEPHGYSIKSYD  196

Query  1046  LGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVV  1225
             LG+ APG CS   H+LC  GNS++EPY VAH++LL+HAAA   Y   ++ +QGG+I I +
Sbjct  197   LGIQAPGRCSFLGHILCKKGNSSSEPYIVAHNILLSHAAAYRSYENHFKKRQGGRIGIAL  256

Query  1226  ESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESAL  1405
             ++ WYEPL+ +  + +A  RA+DF +GWFL+P+  G+YP S+   VG RLPK S   +  
Sbjct  257   DAIWYEPLSENDENKEAALRALDFEIGWFLDPLFFGKYPPSMRRLVGTRLPKISLVTAKF  316

Query  1406  LKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLY  1585
             L G+ D++G+NHYT+ YA +    I  L  +D  +DS   T P KG+  IGERA + WL 
Sbjct  317   LTGTLDFVGMNHYTSLYARNDRIGIRKLIFNDASSDSNVITTPHKGMSTIGERAASHWLR  376

Query  1586  IVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLKSLL  1747
             IVP G+R L  Y+K KYGNP V ITENGMDD           L D KRIRYHRDYL +L 
Sbjct  377   IVPWGIRKLAVYLKYKYGNPPVIITENGMDDPNKRSIPLEKALRDDKRIRYHRDYLSNLS  436

Query  1748  AAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
              AI+++GCNV+GYFAWSL+DNWEW +G++ RFGLYYVDY +NL RIPK S +WF++ L S
Sbjct  437   IAIRQEGCNVQGYFAWSLLDNWEWNMGYTVRFGLYYVDYKNNLTRIPKASVEWFQSMLKS  496



>ref|XP_004505421.1| PREDICTED: putative beta-glucosidase 41-like [Cicer arietinum]
Length=508

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/482 (56%), Positives = 350/482 (73%), Gaps = 6/482 (1%)
 Frame = +2

Query  497   ICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVA  676
             +   ++I+R  FP GFVFGTAS+AYQFEG V E  +G +IWDTF+  PG++ DFSNAD+A
Sbjct  18    LVRTESINRGDFPHGFVFGTASSAYQFEGGVDEGNKGDSIWDTFSRIPGRILDFSNADMA  77

Query  677   VDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIE  856
             VDQYHR+  DI LMKD+GMD+YRFSI+W RIFPNGTG+ N+ G+ +YNNLIDALL  GI+
Sbjct  78    VDQYHRFQNDINLMKDLGMDSYRFSISWPRIFPNGTGEPNREGIKYYNNLIDALLEKGIQ  137

Query  857   PYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVL  1036
             P+VTLYH+DLPQ LE++Y GWL+ Q+I DF  YA TCF  FGDRVK W+T NEP +  + 
Sbjct  138   PFVTLYHWDLPQMLEDKYEGWLSPQIINDFEHYAYTCFKAFGDRVKHWITFNEPHNFAIH  197

Query  1037  GYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKIT  1216
             GYDLG+ APG CS+  HL+C  G S+TEPY VAH++LL+HAAA   Y+  ++ KQ GKI 
Sbjct  198   GYDLGIQAPGRCSLLGHLVCKKGKSSTEPYIVAHNILLSHAAAYRSYQLHFKEKQRGKIG  257

Query  1217  IVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAE  1396
             I +++ WYEP+T    D +A  RA+DF LGWFLEP+  G+YP S+ + V +RLP+ + A 
Sbjct  258   IALDAVWYEPITELDEDKEAAARAMDFSLGWFLEPLFFGKYPLSMQTLVAERLPEITDAT  317

Query  1397  SALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAV  1576
             S  L GS D++G+NHYT+ Y  +  T I  L + D + D+   T  ++    IGERA + 
Sbjct  318   SNFLVGSLDFIGINHYTSVYTRNDRTRIHKLIMRDGIADAAVITTAYRKGAAIGERAASS  377

Query  1577  WLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAK------TDGLNDIKRIRYHRDYLK  1738
             WL+IVP G+R LM ++K KYGN  + ITENGMDD           L D KRIRYHRDYL 
Sbjct  378   WLHIVPWGIRKLMKHVKVKYGNTPIIITENGMDDPSRPFMTLQKALKDDKRIRYHRDYLS  437

Query  1739  SLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNF  1918
             +L AAI+ED CNV+GYF WSL+DNWEW +G++ RFGLYYVD+ +NL RIPK S +WFKN 
Sbjct  438   NLSAAIREDDCNVRGYFVWSLLDNWEWNLGYTVRFGLYYVDFKNNLTRIPKASVQWFKNM  497

Query  1919  LA  1924
             L 
Sbjct  498   LT  499



>gb|KHN28382.1| Putative beta-glucosidase 41 [Glycine soja]
Length=495

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/482 (57%), Positives = 352/482 (73%), Gaps = 7/482 (1%)
 Frame = +2

Query  497   ICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVA  676
             + GA++ISRA FPEGFVFGTAS+A+QFEGA  E  +G +IWDTF+  PG++ DFSNAD A
Sbjct  5     LVGAESISRADFPEGFVFGTASSAHQFEGATDEGNKGDSIWDTFSRIPGRIVDFSNADKA  64

Query  677   VDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIE  856
             VDQYHR+  DI LMKD+GMD+YRFSI+W RIFPNGTG+ N+ G+ +YN+LID+LL  GI+
Sbjct  65    VDQYHRFQNDINLMKDLGMDSYRFSISWPRIFPNGTGEPNKEGIKYYNSLIDSLLEKGIQ  124

Query  857   PYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVL  1036
             P+VTLYH+DLPQ LE++Y GWL+ Q+IKD+  YA TCF  FGDRVK W+T NEP +  + 
Sbjct  125   PFVTLYHWDLPQMLEDKYEGWLSSQIIKDYEHYANTCFKAFGDRVKHWITFNEPHNFALH  184

Query  1037  GYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKIT  1216
             GYDLG+ APG CS+  HLLC  G S+TEPY VAH++LL+HAAA   Y+  ++ +QGG+I 
Sbjct  185   GYDLGIQAPGRCSLLGHLLCKKGKSSTEPYIVAHNILLSHAAAYRSYQLHFKEQQGGQIG  244

Query  1217  IVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAE  1396
             I ++  WYEP+T    D DA  RA+DF LGWFL+P+  G+YP S+   V  RLP+ S   
Sbjct  245   IALDVIWYEPITELDEDKDAAARAMDFSLGWFLDPLFFGKYPLSMEKLVAKRLPEISDTA  304

Query  1397  SALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPI-GERANA  1573
             S  L GS D++G+NHYT+ Y  +  T I  L + D  TD+   T      M I   +A +
Sbjct  305   SKFLVGSLDFIGINHYTSVYTRNDRTRIRKLVMQDAATDAAVITTDTVDFMLILLSQAAS  364

Query  1574  VWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAK------TDGLNDIKRIRYHRDYL  1735
              WL+IVP G+R L+ ++KDKYG+  V ITENGMDD           LND KRIRYHRDYL
Sbjct  365   SWLHIVPWGIRKLVKHVKDKYGDTPVIITENGMDDPSGPFRTLEKALNDDKRIRYHRDYL  424

Query  1736  KSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKN  1915
              +L AAI+EDGCNV+GYF WSL+DNWEW +G++ RFGLYYVD+ +NL RIPK+S +WFKN
Sbjct  425   SNLSAAIREDGCNVRGYFVWSLLDNWEWNMGYTVRFGLYYVDFRNNLTRIPKDSVQWFKN  484

Query  1916  FL  1921
              L
Sbjct  485   ML  486



>emb|CBI20471.3| unnamed protein product [Vitis vinifera]
Length=580

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/480 (57%), Positives = 351/480 (73%), Gaps = 6/480 (1%)
 Frame = +2

Query  506   AQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQ  685
             +++ISR  FP+GF+FGTAS+AYQFEGAV E  +G +IWDTF   PG++ DFSNAD+AVDQ
Sbjct  93    SESISRVDFPDGFIFGTASSAYQFEGAVDEGNKGVSIWDTFTRQPGRILDFSNADMAVDQ  152

Query  686   YHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYV  865
             YHR+  DI+LMKD+GMDAYRFSI+WSRIFP GTG+ N  G+++YN+LIDALL  GI+PYV
Sbjct  153   YHRFKTDIDLMKDLGMDAYRFSISWSRIFPKGTGEPNLEGIEYYNSLIDALLEKGIQPYV  212

Query  866   TLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYD  1045
             TLYH+DLPQ LE+RY GWL++Q++KDF  YA TCF  FGDRVK W+T NEP    + GYD
Sbjct  213   TLYHWDLPQMLEDRYEGWLSKQIVKDFEYYASTCFQAFGDRVKNWITFNEPHGFALQGYD  272

Query  1046  LGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVV  1225
              G+ APG CSI  HL C TG S+TEPY VAH++LL+HAAA   Y+  ++  QGG I + +
Sbjct  273   TGLQAPGRCSILGHLFCKTGESSTEPYIVAHNILLSHAAAYHNYQLHFKESQGGLIGMAL  332

Query  1226  ESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESAL  1405
             ++ WYEP+++S  D DA +RA+DF + WFL+P+  GEYP S+   VG RLP+ S   +  
Sbjct  333   DAKWYEPISDSDEDKDAARRAMDFGIRWFLDPLFFGEYPLSMQRLVGKRLPEISPKTAKF  392

Query  1406  LKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLY  1585
             L GS D++G+NHYTT YA +  T I    L D  +D+   T  F+G   IGERA + WL+
Sbjct  393   LLGSLDFVGINHYTTLYARNDRTRIRKFILRDASSDAAVITTSFRGGEAIGERAASRWLH  452

Query  1586  IVPRGMRNLMNYIKDKYGNPLVFITENGMDDAK------TDGLNDIKRIRYHRDYLKSLL  1747
             IVP G+R L  Y+KD YGNP V ITENGMDD           L D KRI +HRDYL +L 
Sbjct  453   IVPWGIRKLARYVKDNYGNPPVIITENGMDDPNRGSIPLEKALQDDKRINFHRDYLTNLS  512

Query  1748  AAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
             AAI++D C+V+GYF WSL+DNWEW +G+S RFGLY+VDY +NL RIPK S +WF+  L S
Sbjct  513   AAIRQDNCDVRGYFVWSLLDNWEWNLGYSVRFGLYFVDYKNNLTRIPKTSVQWFRRILRS  572



>emb|CDP05824.1| unnamed protein product [Coffea canephora]
Length=510

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/478 (57%), Positives = 349/478 (73%), Gaps = 4/478 (1%)
 Frame = +2

Query  506   AQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQ  685
             +++ISR  FP+GF FGTAS+AYQFEGAV E  +G +IWD F   PG++ DFSNA+ AVDQ
Sbjct  17    SESISRDDFPDGFTFGTASSAYQFEGAVDEGNKGLSIWDAFIKLPGRIVDFSNANTAVDQ  76

Query  686   YHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYV  865
             YHR+  DI+LM D+GMDAYRFSI+WSRIFPNGTG  N  G+ +YNN ID+L+  GI+PY 
Sbjct  77    YHRFKSDIDLMTDLGMDAYRFSISWSRIFPNGTGTPNPEGIQYYNNFIDSLIEKGIQPYA  136

Query  866   TLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYD  1045
             TLYH+DLP  L+  Y G+L+ Q++KDF  YA TCF  FGDRVK W+T NEPR   + GYD
Sbjct  137   TLYHWDLPLKLQETYGGFLSDQIVKDFEQYAVTCFKAFGDRVKHWMTFNEPRGFAIEGYD  196

Query  1046  LGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVV  1225
             LG+ APG CSI  HL C  G S+ EPY VAH++LL+HAAA   Y R ++ +QGG++ IV+
Sbjct  197   LGIQAPGRCSILGHLFCKGGKSSVEPYIVAHNILLSHAAAYHNYHRNFKKRQGGQVGIVL  256

Query  1226  ESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESAL  1405
             ++ WYEP+++   D DA  RAIDF LGWFL+P++ G YP S+   V +RLP+ +   S  
Sbjct  257   DAKWYEPISDCDEDRDASNRAIDFSLGWFLDPLLLGNYPLSMQKSVAERLPEINPEVSKF  316

Query  1406  LKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLY  1585
             LKG+ D++G+NHYTT YA +  T+   L L D  +DS   T  ++    IGERA +VWL 
Sbjct  317   LKGTLDFIGINHYTTLYARNDRTHFRKLILRDASSDSAVITSAYRHGAAIGERAASVWLR  376

Query  1586  IVPRGMRNLMNYIKDKYGNPLVFITENGMDDAK----TDGLNDIKRIRYHRDYLKSLLAA  1753
             IVP G+R L  YIK++YGNP V ITENGMDDA      + LND KRI +HRDYL +L AA
Sbjct  377   IVPWGIRKLARYIKERYGNPPVIITENGMDDASHLSLKNALNDQKRINFHRDYLSNLSAA  436

Query  1754  IKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
             I++D C+V+GYFAWSL+DNWEW +G++ RFGLYYVD+ +NL RIPK S +WFK+ L S
Sbjct  437   IRQDNCDVRGYFAWSLLDNWEWNMGYTVRFGLYYVDFKNNLTRIPKSSVQWFKDMLRS  494



>gb|EYU28850.1| hypothetical protein MIMGU_mgv1a004939mg [Erythranthe guttata]
Length=461

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/432 (64%), Positives = 340/432 (79%), Gaps = 8/432 (2%)
 Frame = +2

Query  494   QICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADV  673
               C   +ISR SFP+GFVFGTAS+AYQ+EGAVKEDGRG +IWDT+ H+ GKV DFSNADV
Sbjct  22    HTCYGHSISRGSFPKGFVFGTASSAYQYEGAVKEDGRGQSIWDTYVHSYGKVLDFSNADV  81

Query  674   AVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGI  853
             A DQYH Y EDI+LMKDMGMDAYRFSI+WSRI+PNG+G++N+AG+DHYN+LI+ALLANGI
Sbjct  82    ANDQYHLYNEDIQLMKDMGMDAYRFSISWSRIYPNGSGEVNRAGIDHYNDLINALLANGI  141

Query  854   EPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITV  1033
             EPYVTLYH+DLPQ+L +RY GWL+ + IKD+AAYAETCF  FGDRVK W+T NEP + TV
Sbjct  142   EPYVTLYHWDLPQSLHDRYTGWLSTRSIKDYAAYAETCFKEFGDRVKNWITFNEPFTFTV  201

Query  1034  LGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKI  1213
              GY LG+ APG CSIF + +C  GNS+TEPY VAH++LL+H   VDIY++KYQ KQGG I
Sbjct  202   QGYALGIQAPGRCSIFKYTVCGAGNSSTEPYVVAHNVLLSHGKVVDIYKKKYQPKQGGSI  261

Query  1214  TIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAA  1393
              I ++SFW+EP TNS ADI+A QRA+DF+LGWFLEP++ G+YP+S+ +RV +RLP+FS  
Sbjct  262   GITLDSFWFEPATNSSADIEAAQRALDFFLGWFLEPLIFGDYPKSIRNRVENRLPRFSQT  321

Query  1394  ESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANA  1573
             +S+ LKG++D++G+NHYTTWYA   D N         L DSG   L      P+ E A++
Sbjct  322   QSSKLKGAFDFIGINHYTTWYAE--DRNGTNKTTEVLLDDSGVLALSNVVGKPVHETAHS  379

Query  1574  VWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYL  1735
              WLYIVP G+R+LMNYI+ KYGNPLV ITENGMDD  +      D LND KRI+Y+ DYL
Sbjct  380   TWLYIVPHGIRSLMNYIRHKYGNPLVLITENGMDDGNSPSTSINDALNDKKRIKYYNDYL  439

Query  1736  KSLLAAIKEDGC  1771
              +LLAAIK   C
Sbjct  440   TNLLAAIKWMQC  451



>ref|XP_010092278.1| Putative beta-glucosidase 41 [Morus notabilis]
 gb|EXB50912.1| Putative beta-glucosidase 41 [Morus notabilis]
Length=503

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/477 (57%), Positives = 348/477 (73%), Gaps = 18/477 (4%)
 Frame = +2

Query  509   QNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQY  688
             +++SR  FP+GF+FGTAS+AYQFEGAV E  +G + WDTF    G++ DFSNAD AVDQY
Sbjct  28    ESLSRVDFPDGFIFGTASSAYQFEGAVDEGNKGVSTWDTFTKKSGRILDFSNADTAVDQY  87

Query  689   HRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVT  868
             HR+  DI+LM+D+G+DAYRFSI+W RIFPNGTG+ N  G+ +YNNLIDALL  GI+P+VT
Sbjct  88    HRFESDIDLMRDLGVDAYRFSISWPRIFPNGTGEYNPEGIQYYNNLIDALLQKGIKPFVT  147

Query  869   LYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDL  1048
             LYH+DLPQ LE+RY GWLN+Q+IKDF  YA TCF  FGDRVK W+T NEP   ++  YDL
Sbjct  148   LYHWDLPQMLEDRYEGWLNKQIIKDFEHYAITCFKAFGDRVKHWITFNEPHGYSLQSYDL  207

Query  1049  GVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVE  1228
             G+ APG CSI  HL C  GNS+TEPY VAH++LL+H AA   Y+R ++ KQGGK+ I ++
Sbjct  208   GIQAPGRCSILGHLFCKKGNSSTEPYIVAHNILLSHTAAYHSYQRYFKEKQGGKVGIGLD  267

Query  1229  SFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALL  1408
             + WYEP+++S  DIDA  RA+DF LGWFL+P++ G+YP S+   VG+RLPK S   S LL
Sbjct  268   TKWYEPISDSEEDIDAANRAMDFGLGWFLDPLLLGDYPLSMRKLVGERLPKISQPISKLL  327

Query  1409  KGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYI  1588
              GS D++G+NHYTT+Y     T I    L D ++D+   T              + WL+I
Sbjct  328   VGSLDFVGLNHYTTFYVRKDKTRIRKFVLKDAISDAAVIT------------TASRWLHI  375

Query  1589  VPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLKSLLA  1750
             VP G+R L  Y+KDKYGNP V ITENGMDD           L D KRIR+HRDYL +L A
Sbjct  376   VPWGIRKLARYVKDKYGNPPVIITENGMDDPNRPFVPLDKALKDEKRIRFHRDYLSNLSA  435

Query  1751  AIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             AI++D C+++GYF WSL+DNWEW +G++ RFGLYYVDY +NL RIPK+S +WFK FL
Sbjct  436   AIRQDECDIRGYFVWSLLDNWEWNMGYTVRFGLYYVDYKNNLTRIPKDSVQWFKRFL  492



>ref|XP_007133036.1| hypothetical protein PHAVU_011G145900g [Phaseolus vulgaris]
 gb|ESW05030.1| hypothetical protein PHAVU_011G145900g [Phaseolus vulgaris]
Length=507

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/481 (57%), Positives = 355/481 (74%), Gaps = 7/481 (1%)
 Frame = +2

Query  497   ICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVA  676
             +  A++ISRA FP+GF+FGTAS+A+QFEGA  E  +G +IWDTF+  PG++ DFSNAD+A
Sbjct  18    LVKAESISRADFPKGFIFGTASSAHQFEGAADEGNKGDSIWDTFSRIPGRIVDFSNADMA  77

Query  677   VDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIE  856
             VDQYHR+  D+ LMKD+GMD+YRFSI+W+RIFPNGTG+ N+ G+ +YN+LIDALL  GI+
Sbjct  78    VDQYHRFQNDVNLMKDLGMDSYRFSISWTRIFPNGTGEPNKEGITYYNSLIDALLEKGIQ  137

Query  857   PYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVL  1036
             P+VTLYH+DLPQ LE+ Y GWL+ Q+IKDF  YA TCF  FGDRVK W+T NEP +  + 
Sbjct  138   PFVTLYHWDLPQMLEDEYEGWLSTQIIKDFEHYAYTCFKAFGDRVKHWITFNEPHNFALH  197

Query  1037  GYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKIT  1216
             GYDLG+ APG CS+   LLC  G S+TEPY VAH++LL+HAAA   Y+  ++ +QGG+I 
Sbjct  198   GYDLGIQAPGRCSLLGRLLCKKGKSSTEPYIVAHNILLSHAAAYRSYQLHFK-EQGGQIG  256

Query  1217  IVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAE  1396
             I ++  WYEP+T    D DA  RA+DF LGWFL+P+  G+YP S+   VG+RLP+ S A 
Sbjct  257   IALDVIWYEPITELDEDKDAALRAMDFSLGWFLDPLFFGKYPLSMKKLVGERLPEISYAN  316

Query  1397  SALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAV  1576
             S  L GS D++G+NHYT+ Y  +  T I  L + D ++D+   T  ++    IGE+A + 
Sbjct  317   SKFLVGSLDFIGINHYTSVYTRNDRTRIHKLVMQDAVSDAAVITTAYRRGAAIGEKAASS  376

Query  1577  WLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAK------TDGLNDIKRIRYHRDYLK  1738
             WL+IVP G+R L+ ++KDKYG+  V ITENGMDD           L D KRIRYH DYL 
Sbjct  377   WLHIVPWGIRKLVKHVKDKYGDTPVIITENGMDDPSQPFMTLQKALKDDKRIRYHGDYLS  436

Query  1739  SLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNF  1918
             +L AAI+ED CNV+GYF WSL+DNWEW +G++ RFGLYYVD+ +NL RIPK+S KWFKN 
Sbjct  437   NLSAAIREDDCNVRGYFVWSLLDNWEWNMGYTVRFGLYYVDFKNNLTRIPKDSVKWFKNI  496

Query  1919  L  1921
             L
Sbjct  497   L  497



>ref|XP_003607795.1| Beta-glucosidase [Medicago truncatula]
Length=406

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/403 (66%), Positives = 319/403 (79%), Gaps = 7/403 (2%)
 Frame = +2

Query  731   MDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLYHYDLPQALENRY  910
             MDAYRFSI+WSRI+PNG+G +NQAG+DHYN  I+ALLA GIEPYVTLYH+DLPQAL+++Y
Sbjct  1     MDAYRFSISWSRIYPNGSGAINQAGIDHYNKFINALLAKGIEPYVTLYHWDLPQALDDKY  60

Query  911   NGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGVHAPGHCSIFFHL  1090
              GWL+  +IKDFA YAETCF  FGDRVK W+T NEP + T  GYD+G+ APG CSI  HL
Sbjct  61    KGWLSTDIIKDFATYAETCFQKFGDRVKHWITFNEPHTFTTQGYDVGLQAPGRCSILLHL  120

Query  1091  LCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESFWYEPLTNSPADI  1270
              C  GNSATEPY VAH++LL HAA  DIYR+KY+  QGG + I  +  WYEP TN+  DI
Sbjct  121   FCRAGNSATEPYIVAHNVLLTHAAVADIYRKKYKNTQGGSLGIAFDVIWYEPATNTKEDI  180

Query  1271  DAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKGSYDYLGVNHYTT  1450
              A QRA DF LGWFL+P+M G+YP S+ SRVG+RLPKFS++E+AL+KGS D++G+NHYTT
Sbjct  181   AAAQRAQDFQLGWFLDPLMFGDYPSSMRSRVGNRLPKFSSSEAALVKGSLDFVGINHYTT  240

Query  1451  WYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVPRGMRNLMNYIKD  1630
             +YA +  TN++G+ LHD++ DSG  TLPF G   I ERAN++WLYIVP+ MR LMNYIK 
Sbjct  241   FYARNNSTNLIGILLHDSIADSGAITLPFNGTKAIAERANSIWLYIVPQSMRTLMNYIKQ  300

Query  1631  KYGNPLVFITENGMDD------AKTDGLNDIKRIRYHRDYLKSLLAAIKEDGCNVKGYFA  1792
             KYGNP VFITENGMDD      +K D L D KRIRY   YL  L A+IK DGCNVKGYFA
Sbjct  301   KYGNPPVFITENGMDDPNNIFISKKDALKDEKRIRYFSGYLSYLQASIK-DGCNVKGYFA  359

Query  1793  WSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             WSL+DNWEW  G+SSRFGLY+VDY DNL+R PK+S +WFKNFL
Sbjct  360   WSLLDNWEWAAGYSSRFGLYFVDYRDNLKRYPKQSVQWFKNFL  402



>ref|XP_010539263.1| PREDICTED: putative beta-glucosidase 41 isoform X1 [Tarenaya 
hassleriana]
Length=530

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/520 (53%), Positives = 357/520 (69%), Gaps = 42/520 (8%)
 Frame = +2

Query  494   QICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGK---------  646
              +  ++++ RA FP+GFVFGTAS+AYQFEGAV E  +G +IWDTF   PGK         
Sbjct  5     HVVSSESLGRADFPDGFVFGTASSAYQFEGAVDEGNKGESIWDTFTKKPGKNLEEILSVF  64

Query  647   ---------------------------VTDFSNADVAVDQYHRYLEDIELMKDMGMDAYR  745
                                        + DFSNAD AVDQYHR+  DI LMKD+GMDAYR
Sbjct  65    ASGFGQEKRYISLGVDFGVFGVSLVGRILDFSNADTAVDQYHRFESDIGLMKDLGMDAYR  124

Query  746   FSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLYHYDLPQALENRYNGWLN  925
             FSI+W RIFPNGTG+ N  G+++YN+ ID L+A GI+PYVTLYH+DLPQAL++RY GWL+
Sbjct  125   FSISWPRIFPNGTGEPNPDGINYYNSFIDVLIAKGIQPYVTLYHWDLPQALQDRYEGWLS  184

Query  926   RQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGVHAPGHCSIFFHLLCPTG  1105
              QV+KD+  YA TCF  FGDRVKQW+T NEP   ++ GYD G+ APG CS+  HL C  G
Sbjct  185   SQVVKDYEHYAFTCFKEFGDRVKQWITFNEPHGFSIQGYDTGIQAPGRCSLLGHLFCKKG  244

Query  1106  NSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESFWYEPLTNSPADIDAKQR  1285
              S+ EPY VAH++LL+HAAA   Y+R ++ KQ GKI I +++ WYEP+++   D DA +R
Sbjct  245   KSSVEPYVVAHNILLSHAAAYYSYQRNFKDKQRGKIGIALDAKWYEPMSDCDEDNDAARR  304

Query  1286  AIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKGSYDYLGVNHYTTWYASS  1465
             A+DF LGWFL+P++ G+YP S+   VG+RLPK +   S  +KGS D++G+NHYTT YA +
Sbjct  305   AMDFGLGWFLDPLIYGDYPASMKRLVGERLPKITPEMSKRIKGSLDFVGINHYTTLYARN  364

Query  1466  TDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVPRGMRNLMNYIKDKYGNP  1645
               T I  L L D  +D+   T   +G + IGERA + WL+IVP G+R L  Y+KD YGNP
Sbjct  365   DRTRIRKLILQDASSDAAVITSSLRGGVAIGERAGSSWLHIVPWGIRKLAVYLKDNYGNP  424

Query  1646  LVFITENGMDDA------KTDGLNDIKRIRYHRDYLKSLLAAIKEDGCNVKGYFAWSLMD  1807
              +FITENG+D+       +   L D KRI YHRDYL +L AAI+E+ C+V+GYF WSL+D
Sbjct  425   PIFITENGVDELNNPLMNRDKALKDDKRINYHRDYLSNLSAAIREENCDVRGYFVWSLLD  484

Query  1808  NWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
             NWEW  G++ RFGLYYVDY +NL RIPK S +WF++ L S
Sbjct  485   NWEWNSGYTVRFGLYYVDYTNNLTRIPKASVQWFQSILHS  524



>ref|XP_006370585.1| linamarase family protein [Populus trichocarpa]
 gb|ERP67154.1| linamarase family protein [Populus trichocarpa]
Length=515

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/479 (56%), Positives = 348/479 (73%), Gaps = 9/479 (2%)
 Frame = +2

Query  506   AQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQ  685
             ++ ISRA FP GF FGTAS+AYQFEGAV E  +G +IWDTF   PG++ D SNAD AVDQ
Sbjct  29    SKPISRADFPSGFTFGTASSAYQFEGAVNEGNKGDSIWDTFTRQPGRILDLSNADTAVDQ  88

Query  686   YHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYV  865
             YHR+  DI+LMKD+GMDAYRFSI+W RIFPNGTG  NQ G+D+Y+ LID LL  GI+PYV
Sbjct  89    YHRFKGDIDLMKDLGMDAYRFSISWPRIFPNGTGVPNQEGIDYYSCLIDTLLEKGIQPYV  148

Query  866   TLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYD  1045
             TLYH+DLPQ LE++Y GWL++Q+++DF  YA TCF  FGDRVK W+T NEPR  ++ GYD
Sbjct  149   TLYHWDLPQMLEDKYEGWLSKQIVEDFEHYAFTCFQAFGDRVKHWITFNEPRGFSIQGYD  208

Query  1046  LGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVV  1225
              G+ APG CSI  H LC  GNS++EPY VAH++LL+HAAA   Y+  ++ KQGG+I I +
Sbjct  209   TGIQAPGRCSIMGHFLCKRGNSSSEPYMVAHNILLSHAAAYRCYQLHFKGKQGGQIGITL  268

Query  1226  ESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESAL  1405
             +S WYEP++++  D DA QRA+DF +GWFL+P+  G+YP S+   VG+RLP+ S   S L
Sbjct  269   DSKWYEPISDAEEDKDAAQRAMDFAIGWFLDPLFLGKYPLSMKKLVGERLPEISQGMSKL  328

Query  1406  LKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLY  1585
             L GS D++G+NHYTT Y  +  T I  L L D  +D+   T  ++  + IGERA + WL+
Sbjct  329   LVGSLDFVGINHYTTLYVRNDRTRIRKLILQDASSDAAVITTSYRRGVAIGERAASRWLH  388

Query  1586  IVPRGMRNLMNYIKDK-YGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLKSL  1744
             IVP G+  L+ Y+KDK    P   I+  GMDD  T        L D KRI YHRDYL ++
Sbjct  389   IVPWGIHRLLKYVKDKILHKPDSMIS--GMDDLNTPFISLNKALQDDKRIEYHRDYLSNI  446

Query  1745  LAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
              AAI++D C+V+GYFAWSL+DNWEW  G++ RFGLY+VDY +NL R+PK SA+WFK  L
Sbjct  447   SAAIRQDNCDVRGYFAWSLLDNWEWNSGYTVRFGLYFVDYRNNLTRVPKASAEWFKRTL  505



>ref|XP_008454583.1| PREDICTED: beta-glucosidase 25 isoform X2 [Cucumis melo]
Length=514

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/480 (56%), Positives = 345/480 (72%), Gaps = 18/480 (4%)
 Frame = +2

Query  506   AQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQ  685
             ++ +SRA FP+GF+FGTA++AYQFEGAV E  RG +IWDTF   PG++ DFSNAD  VDQ
Sbjct  17    SECLSRADFPDGFIFGTAASAYQFEGAVDEGNRGPSIWDTFVKEPGRILDFSNADRTVDQ  76

Query  686   YHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYV  865
             YHR+ +DI+LMKDMGMDAYRFSI+W RIFPNGTGK N   +++YNN IDALL  GI+P+V
Sbjct  77    YHRFKDDIKLMKDMGMDAYRFSISWPRIFPNGTGKPNADAINYYNNFIDALLEKGIQPFV  136

Query  866   TLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYD  1045
             TLYH+DLPQ LE+ Y GWL+R+++KDF  YA TCF  FGDRVK W+T NEP   ++  YD
Sbjct  137   TLYHWDLPQVLEDEYEGWLSRRIVKDFEHYAVTCFQAFGDRVKHWITFNEPHGYSIKSYD  196

Query  1046  LGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVV  1225
             LG+ APG CS   H+LC  GNS++EPY VAH++LL+HAAA   Y+  ++ +QGG+I I +
Sbjct  197   LGIQAPGRCSFLGHILCKKGNSSSEPYIVAHNILLSHAAAYRNYQNHFKKRQGGRIGIAL  256

Query  1226  ESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESAL  1405
             ++ WYEPL+ +  + +A  RA+DF +GWFL+P+  G+YP S+   VG RLPK S   +  
Sbjct  257   DAIWYEPLSENDENKEAALRALDFEIGWFLDPLFFGKYPPSMRRLVGPRLPKISLVTAKF  316

Query  1406  LKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLY  1585
             L G+ D++G+NHYT+ YA +    I  L  +D  +DS   T P            + WL+
Sbjct  317   LIGTLDFVGMNHYTSLYARNDRIGIRKLIFNDASSDSNVITTP------------SHWLH  364

Query  1586  IVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLKSLL  1747
             IVP G+R L  Y+K KYGNP VFITENGMDD           L D KRIRYHRDYL +L 
Sbjct  365   IVPWGIRKLAVYLKYKYGNPPVFITENGMDDPNKRSIPLEKALKDDKRIRYHRDYLSNLS  424

Query  1748  AAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
              AI ++GCNV+GYFAWSL+DNWEW +G++ RFGLYYVDY +NL RIPK S +WF++ L S
Sbjct  425   IAIGQEGCNVQGYFAWSLLDNWEWNMGYTVRFGLYYVDYKNNLTRIPKASVQWFQSMLKS  484



>ref|XP_010267845.1| PREDICTED: putative beta-glucosidase 41 isoform X2 [Nelumbo nucifera]
Length=483

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/480 (56%), Positives = 344/480 (72%), Gaps = 27/480 (6%)
 Frame = +2

Query  506   AQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQ  685
             ++ ISRA FP+GFVFGTAS+AYQFEGAV E  +GA+IWDTF   PG++ DFSNADVAVDQ
Sbjct  19    SKAISRADFPDGFVFGTASSAYQFEGAVNEGNKGASIWDTFTRRPGRIMDFSNADVAVDQ  78

Query  686   YHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYV  865
             YHR+  D++LMK++GMDAYRFSI+WSRIFP G+G+LN  G+ +YNNLID+LL  GI+PYV
Sbjct  79    YHRFKTDVDLMKNIGMDAYRFSISWSRIFPEGSGELNTEGIKYYNNLIDSLLEKGIQPYV  138

Query  866   TLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYD  1045
             TLYH+DLPQALE++YNGWL+R+++KDF  +A TCF  FGDRVKQW+T NEP   ++ GYD
Sbjct  139   TLYHWDLPQALEDKYNGWLSRKIVKDFENFAFTCFQAFGDRVKQWITFNEPHGFSLQGYD  198

Query  1046  LGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVV  1225
              G+ APG CSI  HL C  G S+ EPY VAH++LL+HA     Y+  ++ KQGG I I +
Sbjct  199   TGLQAPGRCSILGHLFCKKGKSSIEPYIVAHNILLSHATVFHTYQLHFKEKQGGFIGIAL  258

Query  1226  ESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESAL  1405
             ++ WYEP++++  D  A QRA+DF +GWFL+P+  G+YP S+ + V  RLP+ ++  S L
Sbjct  259   DAKWYEPISDADEDKYAAQRAMDFGIGWFLDPLFFGKYPLSMQNLVKHRLPEITSEMSKL  318

Query  1406  LKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLY  1585
             L                       I  L L D  +D+   T   +G + IGE A + WL+
Sbjct  319   L---------------------IRIRKLVLQDASSDAAVITTSSRGGIAIGETAASHWLH  357

Query  1586  IVPRGMRNLMNYIKDKYGNPLVFITENGMDD------AKTDGLNDIKRIRYHRDYLKSLL  1747
             IVP G+R L  Y+KDKYGNP VFITENGMDD      A +  L D KRI YHRDYL +L 
Sbjct  358   IVPWGIRKLARYVKDKYGNPPVFITENGMDDPNKPFMALSTALQDNKRISYHRDYLSNLS  417

Query  1748  AAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
             AAI++DGC+V+GYF WSL+DNWEW  G++ RFGLYY+DY +NL RIPK S +WFK+FL  
Sbjct  418   AAIRQDGCDVRGYFIWSLLDNWEWNSGYTVRFGLYYIDYKNNLTRIPKASVQWFKSFLGQ  477



>gb|AFW89226.1| hypothetical protein ZEAMMB73_293984 [Zea mays]
Length=436

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/385 (65%), Positives = 318/385 (83%), Gaps = 0/385 (0%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             ++R SFP+GFVFGTAS+AYQ+EGAVKEDGRG TIWD FAHT GKV D SNADVAVDQYHR
Sbjct  31    LTRGSFPKGFVFGTASSAYQYEGAVKEDGRGKTIWDKFAHTFGKVADLSNADVAVDQYHR  90

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             + EDI+LM DMGMDAYRFSIAWSRI PNGTG++NQAGVDHYN  IDALL+ GIEPYVTLY
Sbjct  91    FEEDIQLMADMGMDAYRFSIAWSRILPNGTGQVNQAGVDHYNRFIDALLSKGIEPYVTLY  150

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             H+DLPQALE+RYNGWL+RQ++ DFA YAETCF  FGDRV+ WVT+NEP ++ V GYD G+
Sbjct  151   HWDLPQALEDRYNGWLDRQIVYDFAEYAETCFEAFGDRVRHWVTLNEPHTVAVQGYDAGL  210

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
              APG CS+  HL C +G+SATEPY VAH+ +LAHA   D+YR+KY+A Q G++ I  +  
Sbjct  211   QAPGRCSLLLHLYCRSGDSATEPYVVAHNFILAHAKVSDVYRKKYKAAQNGELGIAFDVM  270

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             W+EP+TN+ ADI+A +R  +F LGWF +P   G+YP S+ SRVGDRLP+F+AAE+AL+KG
Sbjct  271   WFEPMTNTTADIEAAKRGQEFQLGWFADPFFFGDYPASMRSRVGDRLPRFTAAEAALVKG  330

Query  1415  SYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVP  1594
             + D++G+NHYTT+Y     T+++G  LH+TL D+GT +LPF+    IG+RAN++WLYIVP
Sbjct  331   ALDFVGINHYTTYYTKHNSTDLVGRLLHNTLADTGTISLPFRNGKAIGDRANSIWLYIVP  390

Query  1595  RGMRNLMNYIKDKYGNPLVFITENG  1669
              GMR+LMNY+K++Y +P +++TENG
Sbjct  391   SGMRSLMNYVKERYNSPPIYVTENG  415



>ref|XP_002960920.1| hypothetical protein SELMODRAFT_163822 [Selaginella moellendorffii]
 gb|EFJ38459.1| hypothetical protein SELMODRAFT_163822 [Selaginella moellendorffii]
Length=499

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/482 (58%), Positives = 352/482 (73%), Gaps = 10/482 (2%)
 Frame = +2

Query  491   LQICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNAD  670
             L  CGA  ISR  FP+ FVFGTAS+AYQ+EG  K+ GR  +IWD F+HT GK+ D SN D
Sbjct  16    LAGCGATGISRCDFPKQFVFGTASSAYQYEGGAKQGGRKPSIWDKFSHTFGKILDGSNGD  75

Query  671   VAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNG-TGKLNQAGVDHYNNLIDALLAN  847
             VA DQY+RY EDI LMK++G+DAYRFSI+WSRIFP+G T ++N  GV+HYN  I+ALLAN
Sbjct  76    VAEDQYNRYQEDILLMKELGIDAYRFSISWSRIFPDGNTTQVNAEGVNHYNGFINALLAN  135

Query  848   GIEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSI  1027
              IEPYVTLYH+DLPQALE+   GWL+ +++  FAAYA+ CF  FGDR+K W+T NEP+S 
Sbjct  136   NIEPYVTLYHWDLPQALEDSIGGWLSSEIVNRFAAYADACFNAFGDRIKYWITFNEPQSF  195

Query  1028  TVLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGG  1207
                GYDLG+HAPG CSI   LLC  GNSATEPY VAH++LL+HAAAV IYR KYQA+QGG
Sbjct  196   ATSGYDLGIHAPGRCSI---LLCSKGNSATEPYAVAHNVLLSHAAAVRIYRTKYQARQGG  252

Query  1208  KITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFS  1387
              I I + SFWYEPL+NS  +I A QRA+DF LGWFL+P++ GEYP  +   VG RLP F+
Sbjct  253   TIGITLNSFWYEPLSNSTNNIAAAQRALDFELGWFLDPIVYGEYPAVMRDYVGHRLPMFT  312

Query  1388  AAESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERA  1567
               + + L  S D+LG+NHYTT +AS+    ++  +  D   DS  F    +G + IG RA
Sbjct  313   EEQRSSLLLSIDFLGLNHYTTNFASALPPPLIKNWT-DYFQDSRVFRTASRGGVSIGRRA  371

Query  1568  NAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDD----AKTDGLNDIKRIRYHRDYL  1735
              +VWLY VP G R L++Y+  +Y    + ITENGMD     +++  L+D  RI +H +YL
Sbjct  372   ASVWLYDVPWGFRKLVSYVTHRYNQLPIIITENGMDQSSFLSRSSALHDSHRIDFHSNYL  431

Query  1736  KSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKN  1915
              +L AAI+ DG +V+GYF WS++DNWEW+ GF+SRFGLYYVDY DNL+R PK SA WF N
Sbjct  432   SNLSAAIR-DGADVRGYFVWSMLDNWEWSAGFTSRFGLYYVDYRDNLKRCPKASAAWFTN  490

Query  1916  FL  1921
             FL
Sbjct  491   FL  492



>dbj|BAB09336.1| beta-glucosidase [Arabidopsis thaliana]
Length=520

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/482 (56%), Positives = 351/482 (73%), Gaps = 20/482 (4%)
 Frame = +2

Query  500   CGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFA-HTPGKVTDFSNADVA  676
               +++ISRA+FP+GFVFGTAS+AYQFEGAVKE  +G +IWDTF    PGK+ DFSNAD  
Sbjct  21    VSSESISRANFPDGFVFGTASSAYQFEGAVKEGNKGESIWDTFTKEKPGKILDFSNADTT  80

Query  677   VDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFP-NGTGKLNQAGVDHYNNLIDALLANGI  853
             VDQYHR+  DI+LMKD+ MDAYRFSI+WSRIFP +GTG++N  GV +YN+LIDALLA GI
Sbjct  81    VDQYHRFHNDIDLMKDLRMDAYRFSISWSRIFPTDGTGEVNPDGVKYYNSLIDALLAKGI  140

Query  854   EPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITV  1033
             +PYVTLYH+DLPQALE+RY GWL+R+V+ DF  YA TCF  FGDRVK W+T NEP  +++
Sbjct  141   KPYVTLYHWDLPQALEDRYEGWLSREVVDDFEHYAFTCFKAFGDRVKYWITFNEPHGVSI  200

Query  1034  LGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKI  1213
              GYD G+ APG CS+  H  C  G S+ EPY VAH++LL+HAAA   Y+R ++ KQ G+I
Sbjct  201   QGYDTGIQAPGRCSLLGHWFCKKGKSSVEPYIVAHNILLSHAAAYHTYQRNFKEKQRGQI  260

Query  1214  TIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAA  1393
              I +++ WYEP+++   D DA +RA+DF LGWF++P++ G+YP S+ S V +RLPK +  
Sbjct  261   GISLDAKWYEPMSDCDEDKDAARRAMDFGLGWFMDPLINGDYPASMKSLVEERLPKITPE  320

Query  1394  ESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANA  1573
                 +KG++DY+G+NHYTT YA +  T I  L L D  +DS   T            + +
Sbjct  321   MYKTIKGAFDYVGINHYTTLYARNDRTRIRKLILQDASSDSAVIT------------SWS  368

Query  1574  VWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYL  1735
              WL+IVP G+R L  Y+KD YGNP VFITENGMD+  +        L D KRI +HRDYL
Sbjct  369   SWLHIVPWGIRKLAVYVKDIYGNPPVFITENGMDEKNSPFIDMEKALKDDKRIGFHRDYL  428

Query  1736  KSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKN  1915
              +L AAI+ D C+V+GYF WSL+DNWEW  G++ RFG+YYVDY +NL RIPK SA+WF+ 
Sbjct  429   SNLSAAIRNDECDVRGYFVWSLLDNWEWNSGYTVRFGIYYVDYKNNLTRIPKASARWFQT  488

Query  1916  FL  1921
              L
Sbjct  489   IL  490



>ref|XP_010267846.1| PREDICTED: putative beta-glucosidase 41 isoform X3 [Nelumbo nucifera]
Length=474

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/479 (55%), Positives = 341/479 (71%), Gaps = 36/479 (8%)
 Frame = +2

Query  506   AQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQ  685
             ++ ISRA FP+GFVFGTAS+AYQFEGAV E  +GA+IWDTF   PG++ DFSNADVAVDQ
Sbjct  19    SKAISRADFPDGFVFGTASSAYQFEGAVNEGNKGASIWDTFTRRPGRIMDFSNADVAVDQ  78

Query  686   YHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYV  865
             YHR+  D++LMK++GMDAYRFSI+WSRIFP G+G+LN  G+ +YNNLID+LL  GI+PYV
Sbjct  79    YHRFKTDVDLMKNIGMDAYRFSISWSRIFPEGSGELNTEGIKYYNNLIDSLLEKGIQPYV  138

Query  866   TLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYD  1045
             TLYH+DLPQALE++YNGWL+R+++KDF  +A TCF  FGDRVKQW+T NEP   ++ GYD
Sbjct  139   TLYHWDLPQALEDKYNGWLSRKIVKDFENFAFTCFQAFGDRVKQWITFNEPHGFSLQGYD  198

Query  1046  LGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVV  1225
              G+ APG CSI  HL C  G S+ EPY VAH++LL+HA     Y+  ++ KQGG I I +
Sbjct  199   TGLQAPGRCSILGHLFCKKGKSSIEPYIVAHNILLSHATVFHTYQLHFKEKQGGFIGIAL  258

Query  1226  ESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESAL  1405
             ++ WYEP++++  D  A QRA+DF +GWFL+P+  G+YP S+ + V  RLP+ ++  S L
Sbjct  259   DAKWYEPISDADEDKYAAQRAMDFGIGWFLDPLFFGKYPLSMQNLVKHRLPEITSEMSKL  318

Query  1406  LKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLY  1585
             L                              D  +D+   T   +G + IGE A + WL+
Sbjct  319   L------------------------------DASSDAAVITTSSRGGIAIGETAASHWLH  348

Query  1586  IVPRGMRNLMNYIKDKYGNPLVFITENGMDD------AKTDGLNDIKRIRYHRDYLKSLL  1747
             IVP G+R L  Y+KDKYGNP VFITENGMDD      A +  L D KRI YHRDYL +L 
Sbjct  349   IVPWGIRKLARYVKDKYGNPPVFITENGMDDPNKPFMALSTALQDNKRISYHRDYLSNLS  408

Query  1748  AAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLA  1924
             AAI++DGC+V+GYF WSL+DNWEW  G++ RFGLYY+DY +NL RIPK S +WFK+FL 
Sbjct  409   AAIRQDGCDVRGYFIWSLLDNWEWNSGYTVRFGLYYIDYKNNLTRIPKASVQWFKSFLG  467



>ref|XP_008226796.1| PREDICTED: putative beta-glucosidase 41 isoform X2 [Prunus mume]
Length=484

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/478 (56%), Positives = 338/478 (71%), Gaps = 36/478 (8%)
 Frame = +2

Query  506   AQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQ  685
             +Q+ISRA FP+GFVFGTAS+AYQFEGAV E  +GA++WDTF   PG++ DFSNAD AVDQ
Sbjct  17    SQSISRADFPDGFVFGTASSAYQFEGAVNEGNKGASVWDTFTKEPGRILDFSNADTAVDQ  76

Query  686   YHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYV  865
             YHR+  DI+LMKDMG+DAYRFSI+W RIFPNGTG+ N  G+++YN+LIDALL  GI+P+V
Sbjct  77    YHRFQSDIDLMKDMGVDAYRFSISWPRIFPNGTGEPNSEGINYYNSLIDALLEKGIKPFV  136

Query  866   TLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYD  1045
             TLYH+DLPQ LE+RY GWL+ Q++KDF  YA TCF  FGDRVK W+T NEP +  + GYD
Sbjct  137   TLYHWDLPQVLEDRYEGWLSTQIVKDFEHYAFTCFQTFGDRVKHWITFNEPHNTALQGYD  196

Query  1046  LGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVV  1225
             LG+ APG CSI  HL C  GNS+ EPY VAH++LL+HAAA   Y++ ++A+QGG++ I +
Sbjct  197   LGIQAPGRCSILGHLFCKKGNSSAEPYIVAHNILLSHAAAYHSYQQFFKARQGGQVGIAL  256

Query  1226  ESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESAL  1405
             +  WYEP++++  DIDA  RAIDF LGWFL+P+  G+YP S+   VG RLP+ S A S  
Sbjct  257   DVKWYEPVSDNDEDIDAAHRAIDFSLGWFLDPLFFGKYPLSMKKLVGQRLPEISQAISKF  316

Query  1406  LKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLY  1585
             L                              D ++D+     P+K  + IGERA + WL 
Sbjct  317   L------------------------------DAISDAAVIITPYKEGVAIGERAASRWLR  346

Query  1586  IVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLKSLL  1747
             IVP G+R L  ++KDKY NP V ITENGMDD           L D KRIR+H DYL +L 
Sbjct  347   IVPWGIRKLARHLKDKYQNPPVIITENGMDDPNKPFIPLEKALKDEKRIRFHGDYLSNLS  406

Query  1748  AAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             AAI++D C+V+GYF WSL+DNWEW +G++ RFGLYYVDY  NL RIPK S +WF+ FL
Sbjct  407   AAIRQDNCDVRGYFVWSLLDNWEWNMGYTVRFGLYYVDYKKNLTRIPKTSVQWFRRFL  464



>gb|AFW69121.1| hypothetical protein ZEAMMB73_597791 [Zea mays]
Length=487

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/480 (55%), Positives = 336/480 (70%), Gaps = 30/480 (6%)
 Frame = +2

Query  506   AQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQ  685
             A+ + RA FP+GFVFGTAS+AYQ+EGAV E  RG TIWDT    PG+V DFSNADVAVD 
Sbjct  17    AEALRRADFPQGFVFGTASSAYQYEGAVNEGQRGPTIWDTLTRRPGRVIDFSNADVAVDH  76

Query  686   YHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYV  865
             YHRY ED++L+KD+GMDAYRFSI+WSRIFP+                        I+PYV
Sbjct  77    YHRYKEDVDLIKDIGMDAYRFSISWSRIFPS------------------------IQPYV  112

Query  866   TLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYD  1045
             TL+H+DLPQALE+RY GWLN Q++ DF  YA TCF  FGDRVK W+T NEP +  + GYD
Sbjct  113   TLFHWDLPQALEDRYGGWLNSQIVDDFVHYASTCFKEFGDRVKHWITFNEPHNFAIEGYD  172

Query  1046  LGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVV  1225
             LG+ APG CSI  H+ C  G S+TEPY VAH++LLAHA A   Y++ ++ +QGG I I +
Sbjct  173   LGIQAPGRCSILSHIFCREGKSSTEPYVVAHNILLAHAGAFHTYKQHFKKEQGGIIGIAL  232

Query  1226  ESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESAL  1405
             +S WYEPL++   D +A  RA+DF LGWFL+P+M G YP S+   VGDRLP+FSA  S L
Sbjct  233   DSKWYEPLSDVDEDTEAAARAMDFELGWFLDPLMFGHYPPSMQKLVGDRLPQFSARASML  292

Query  1406  LKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLY  1585
             + GS D++G+NHYTT Y  +    I  L ++D  TD+      ++    IGE A + WL+
Sbjct  293   VSGSLDFVGINHYTTLYVRNDRMRIRKLVMNDASTDAAVIPTAYRHGKKIGETAASGWLH  352

Query  1586  IVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLKSLL  1747
             IVP GM  LM +IK+KYGNP V ITENGMDDA        D L D KRI+YH+DY+ +LL
Sbjct  353   IVPWGMFKLMKHIKEKYGNPPVIITENGMDDANNRFSKLEDDLQDDKRIQYHKDYMSNLL  412

Query  1748  AAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
              AI+++GCNV GYF WSL+DNWEW  G++ RFGLYY+DY++NL RIPK S +WF+  LA 
Sbjct  413   DAIRKEGCNVHGYFVWSLLDNWEWNSGYTVRFGLYYIDYNNNLTRIPKASVEWFRQVLAQ  472



>ref|XP_002967091.1| hypothetical protein SELMODRAFT_169039 [Selaginella moellendorffii]
 gb|EFJ31690.1| hypothetical protein SELMODRAFT_169039 [Selaginella moellendorffii]
Length=499

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/482 (57%), Positives = 350/482 (73%), Gaps = 10/482 (2%)
 Frame = +2

Query  491   LQICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNAD  670
             L  CGA  ISR  FP+ FVFGTAS+AYQ+EG  K+ GR  +IWD F+HT GK+ D SN D
Sbjct  16    LAGCGATGISRCDFPKQFVFGTASSAYQYEGGAKQGGRKPSIWDKFSHTFGKILDGSNGD  75

Query  671   VAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNG-TGKLNQAGVDHYNNLIDALLAN  847
             VA DQY+RY EDI LMK++G+DAYRFSI+W RIFP+G T ++N  GV+HYN  I+ALLAN
Sbjct  76    VAEDQYNRYQEDILLMKELGIDAYRFSISWCRIFPDGNTTQVNAEGVNHYNGFINALLAN  135

Query  848   GIEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSI  1027
              IEPYVTLYH+DLPQALE+   GWL+ +++  FAAYA+ CF  FGDR+K W+T NEP+S 
Sbjct  136   NIEPYVTLYHWDLPQALEDSIGGWLSSEIVNRFAAYADACFNAFGDRIKYWITFNEPQSF  195

Query  1028  TVLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGG  1207
                GYDLG+HAPG CSI   LLC  GNSATEPY VAH++LL+HAAAV IYR KY+A+QGG
Sbjct  196   ATSGYDLGIHAPGRCSI---LLCSKGNSATEPYTVAHNVLLSHAAAVRIYRTKYKARQGG  252

Query  1208  KITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFS  1387
              I I + SFWYEPL+NS  +I A QRA+DF LGWFL+P++ G+YP  +   VG RLP F+
Sbjct  253   TIGITLNSFWYEPLSNSTNNIAAAQRALDFELGWFLDPIVYGDYPAVMRDYVGHRLPMFT  312

Query  1388  AAESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERA  1567
               + + L  S D+LG+NHYTT +AS+    ++  +  D   DS       +G + IG RA
Sbjct  313   EEQRSSLLLSIDFLGLNHYTTNFASALPPPLIKNWT-DYFQDSRVLRTASRGGVSIGRRA  371

Query  1568  NAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDD----AKTDGLNDIKRIRYHRDYL  1735
              ++WLY VP G R L++Y+  +Y    + ITENGMD     +++  L+D  RI +H +YL
Sbjct  372   ASIWLYDVPWGFRKLVSYVTHRYNQLPIIITENGMDQSSFLSRSSALHDSHRIDFHSNYL  431

Query  1736  KSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKN  1915
              +L AAI+ DG +V+GYF WS++DNWEW+ GF+SRFGLYYVDY DNL+R PK SA WF N
Sbjct  432   SNLSAAIR-DGADVRGYFVWSMLDNWEWSAGFTSRFGLYYVDYRDNLKRCPKASAAWFTN  490

Query  1916  FL  1921
             FL
Sbjct  491   FL  492



>ref|XP_002464163.1| hypothetical protein SORBIDRAFT_01g013360 [Sorghum bicolor]
 gb|EER91161.1| hypothetical protein SORBIDRAFT_01g013360 [Sorghum bicolor]
Length=440

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/421 (60%), Positives = 323/421 (77%), Gaps = 20/421 (5%)
 Frame = +2

Query  725   MGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLYHYDLPQALEN  904
             MGMDAYRFSIAW RIFPNGTG++NQAG+DHYNNLI+ALLA GIEPYVTLYH+DLPQALE+
Sbjct  1     MGMDAYRFSIAWPRIFPNGTGEVNQAGIDHYNNLINALLAKGIEPYVTLYHWDLPQALED  60

Query  905   RYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGVHAPGHCSIFF  1084
             +Y GWL+RQ+I D+A YAETCF  FGDRVK W+T NEP ++TV GYD G+ APG CS+  
Sbjct  61    KYTGWLDRQIINDYAVYAETCFKAFGDRVKHWITFNEPHTVTVQGYDSGLQAPGRCSLIL  120

Query  1085  HLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESFWYEPLTNSPA  1264
             HL C  GNS TEPY VAH+++LAHA   DIY  KY+A Q G++ I  +  WYEP++NS A
Sbjct  121   HLYCKEGNSGTEPYIVAHNIILAHATVADIYMNKYKATQNGQLGISFDVIWYEPMSNSTA  180

Query  1265  DIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKGSYDYLGVNHY  1444
             D++A +RA +F LGWF +P   G+YP  + SRVG RLPKF+A E+AL+KGS D++G+NHY
Sbjct  181   DVEATKRAQEFQLGWFADPFFFGDYPEIMRSRVGKRLPKFTAEEAALVKGSLDFMGINHY  240

Query  1445  TTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVPRGMRNLMNYI  1624
             TT+Y    +++++G  L++TL D+GT +LPF+   PIG+RAN++WLYIVP  MR+LMNY+
Sbjct  241   TTFYVQDDESSVVGTLLNNTLADTGTISLPFRNGKPIGDRANSIWLYIVPGSMRSLMNYV  300

Query  1625  KDKYGNPLVFITEN--------------GMDDAKT------DGLNDIKRIRYHRDYLKSL  1744
             KD+Y  P V+ITEN              GMDD+ +      D + D KRI YH +YL +L
Sbjct  301   KDRYNTPPVYITENGKKQETNGNFPVDLGMDDSNSPFISLKDAVKDDKRISYHNEYLTNL  360

Query  1745  LAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLA  1924
              A+I+EDGC+V+GYF WSL+DNWEWT G++SRFGLY+VDY++NL+R PK S  WFKN LA
Sbjct  361   AASIREDGCDVRGYFVWSLLDNWEWTAGYTSRFGLYFVDYNNNLKRYPKNSVLWFKNLLA  420

Query  1925  S  1927
             S
Sbjct  421   S  421



>ref|XP_002530914.1| beta-glucosidase, putative [Ricinus communis]
 gb|EEF31463.1| beta-glucosidase, putative [Ricinus communis]
Length=495

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/488 (54%), Positives = 346/488 (71%), Gaps = 17/488 (3%)
 Frame = +2

Query  506   AQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQ  685
             +++ISRA FPEGF+FGTAS+AYQFEGAV E  +G +IWDTF   PG++ DFSNAD  VDQ
Sbjct  18    SESISRAEFPEGFIFGTASSAYQFEGAVNEGNKGVSIWDTFTRQPGRILDFSNADTTVDQ  77

Query  686   YHRYLEDIELMKDMGMDAYRFSIAWSRI-FPNGTGKLNQAGVDHYNNLIDALLANGIEPY  862
             YHR+   I        D Y +S  +  +   +GTG+ N  G+++YN+LIDALL  GI+P+
Sbjct  78    YHRFKVRI-------TDFYYYSKLYQNLSLTDGTGEPNSEGIEYYNSLIDALLEKGIQPF  130

Query  863   VTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGY  1042
             VTLYH+DLPQ LE++Y GWL++QV+KDF  YA TCF  FGDRVK W+T NEP   ++ GY
Sbjct  131   VTLYHWDLPQMLEDKYEGWLSKQVVKDFEHYAFTCFQAFGDRVKHWITFNEPHGFSIQGY  190

Query  1043  DLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIV  1222
             D G+ APG CS+  HLLC TGNS+ EPY VAH++LL+HAAA   Y+  ++AKQGG+I I 
Sbjct  191   DTGIQAPGRCSVLGHLLCKTGNSSVEPYVVAHNILLSHAAAYRSYQLNFKAKQGGQIGIA  250

Query  1223  VESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESA  1402
             ++S WYEP++++  D DA  RA+DF +GWFL+P+  G+YP S+   VG+RLP+ +   S 
Sbjct  251   LDSKWYEPISDADEDKDAAHRAMDFTIGWFLDPLFFGKYPPSMKKLVGERLPEITPKISE  310

Query  1403  LLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWL  1582
              L G  D++G+NHYTT +A +  T I  L L D  +DS   T P +  + IGERA + WL
Sbjct  311   FLMGCLDFIGINHYTTLFARNDRTQIRKLILQDASSDSAVITTPHRHGVAIGERAASRWL  370

Query  1583  YIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLKSL  1744
              IVP G+R L+NY+KDKYGNP V ITENGMDD  T        L D KRI YHRDYL +L
Sbjct  371   RIVPWGIRKLVNYVKDKYGNPPVIITENGMDDPNTPFTSLNKALQDHKRIEYHRDYLSNL  430

Query  1745  LAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLA  1924
              AAI++D C+++GYF WS++DNWEW  G++ RFGLYYVDY +NL RIPK S +WFK+ L 
Sbjct  431   SAAIRQDKCDIRGYFVWSVLDNWEWNSGYTVRFGLYYVDYKNNLTRIPKASVQWFKSILR  490

Query  1925  S*IMNYDI  1948
                +N DI
Sbjct  491   ---LNSDI  495



>gb|EPS70537.1| hypothetical protein M569_04221, partial [Genlisea aurea]
Length=407

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/415 (64%), Positives = 323/415 (78%), Gaps = 14/415 (3%)
 Frame = +2

Query  701   EDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLYHY  880
             EDI LMK++GMDAYRFSIAWSRI+P+GTGKLNQAGVDHYN +ID LLANGI PYVTLYH+
Sbjct  1     EDIRLMKNLGMDAYRFSIAWSRIYPDGTGKLNQAGVDHYNKVIDTLLANGITPYVTLYHW  60

Query  881   DLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGVHA  1060
             DLPQ+L+NRY GWL  Q+I+DFA YAETCF  FG+RVK W+TINEP +I + GYD G+ A
Sbjct  61    DLPQSLQNRYKGWLGSQIIRDFAIYAETCFKEFGNRVKHWITINEPHTIVMQGYDSGLLA  120

Query  1061  PGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESFWY  1240
             PG CS   + +C  GNS+TEPY V H+LLL+HAAAV+IY  KY+  Q G I I ++ FWY
Sbjct  121   PGRCS---YSVCNGGNSSTEPYVVGHNLLLSHAAAVEIYNTKYKKVQHGAIGIALDVFWY  177

Query  1241  EPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKGSY  1420
             EP ++   DI A QRAIDF+LGWF+EP++ G+YP  + SRVG+R+P+FS  +S ++KGS+
Sbjct  178   EPASDRSPDIKATQRAIDFHLGWFIEPLILGDYPLIMRSRVGNRIPRFSPLQSRIVKGSF  237

Query  1421  DYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVPRG  1600
             D++G+NHYTTWY S    +I   F +D   DSG+ + P     PI ++AN++WLYIVP G
Sbjct  238   DFIGINHYTTWYTS----DITVKFSNDAQADSGSSSSPIALGKPIPDKANSIWLYIVPHG  293

Query  1601  MRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLKSLLAAIKE  1762
             +R+LMNYI+ KY NPLV ITENGMDDA        D L D KRI+YHRDYL +LLAAIK 
Sbjct  294   LRSLMNYIRVKYRNPLVLITENGMDDANNPLTPLKDALKDAKRIKYHRDYLSNLLAAIK-  352

Query  1763  DGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
             DGCNV+GYF WSL+DNWEWTVGF SRFGLY+VDY D L+R PK SA WFK FLAS
Sbjct  353   DGCNVRGYFVWSLLDNWEWTVGFGSRFGLYFVDYRDKLKRYPKNSANWFKTFLAS  407



>ref|XP_004160275.1| PREDICTED: putative beta-glucosidase 41-like [Cucumis sativus]
Length=504

 Score =   535 bits (1377),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 257/474 (54%), Positives = 336/474 (71%), Gaps = 22/474 (5%)
 Frame = +2

Query  506   AQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQ  685
             ++ +SRA FP+GF+FGTA++AYQFEGAV E  RG +IWDTF   PG++ DFSNA+  VDQ
Sbjct  17    SECLSRADFPDGFIFGTAASAYQFEGAVDEGNRGPSIWDTFVKEPGRILDFSNANKTVDQ  76

Query  686   YHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYV  865
             YHR+ +DI+LMKDMGMDAYRFSIAW RIFPNGTGK N   +++YNN IDALL  GI+P+V
Sbjct  77    YHRFKDDIKLMKDMGMDAYRFSIAWPRIFPNGTGKPNADAINYYNNFIDALLEKGIQPFV  136

Query  866   TLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYD  1045
             TLYH+DLPQ LE+ Y GWL+R+++KDF  YA TCF  FGDRVK W+T NEP   ++  YD
Sbjct  137   TLYHWDLPQVLEDEYEGWLSRRIVKDFEHYAVTCFQAFGDRVKHWITFNEPHGYSIKSYD  196

Query  1046  LGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVV  1225
             LG+ APG CS   H+LC  GNS++EPY VAH++LL+HAAA   Y   ++ +QGG+I I +
Sbjct  197   LGIQAPGRCSFLGHILCKKGNSSSEPYIVAHNILLSHAAAYRSYENHFKKRQGGRIGIAL  256

Query  1226  ESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESAL  1405
             ++ WYEPL+ +  + +A  RA+DF +GWFL+P+  G+YP S+   VG RLPK S   +  
Sbjct  257   DAIWYEPLSENDENKEAALRALDFEIGWFLDPLFFGKYPPSMRRLVGTRLPKISLVTAKF  316

Query  1406  LKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLY  1585
             L G+ D++G+NHYT+ YA +    I  L  +D  +DS   T P KG+  IGERA + WL 
Sbjct  317   LTGTLDFVGMNHYTSLYARNDRIGIRKLIFNDASSDSNVITTPHKGMSTIGERAASHWLR  376

Query  1586  IVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKTDGLNDIKRIRYHRDYLKSLLAAIKED  1765
             IVP G+R L  Y+K KYGNP V ITEN                      + +L  AI+++
Sbjct  377   IVPWGIRKLAVYLKYKYGNPPVIITEN----------------------VSNLSIAIRQE  414

Query  1766  GCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
             GCNV+GYFAWSL+DNWEW +G++ RFGLYYVDY +NL RIPK S +WF++ L S
Sbjct  415   GCNVQGYFAWSLLDNWEWNMGYTVRFGLYYVDYKNNLTRIPKASVEWFQSMLKS  468



>gb|EMT00549.1| Beta-glucosidase 6 [Aegilops tauschii]
Length=529

 Score =   534 bits (1376),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 265/504 (53%), Positives = 345/504 (68%), Gaps = 31/504 (6%)
 Frame = +2

Query  506   AQNISRASFPEGFVFGTASAAYQFEGAVKEDG-----------RGATIWDTF-----AHT  637
             A+ I RA FP GF FGTAS+AYQ +                    +  W  F     A  
Sbjct  17    AEAIRRADFPPGFTFGTASSAYQVKYCENTASLISAVLAFIYLSDSCFWSIFYQYEGAVN  76

Query  638   PGKVTDFSNADVAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFP---------NGTGK  790
              G+V DFSNADVAVD YHRY ED++LMKD+G+DAYRFSI+W+RIFP         +GTGK
Sbjct  77    EGRVIDFSNADVAVDHYHRYKEDVDLMKDIGVDAYRFSISWARIFPSMSEMILFPDGTGK  136

Query  791   LNQAGVDHYNNLIDALLANGIEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCF  970
              N+ G+ +YN+LID LL  GI+PYVTL+H+DLPQALE++Y GWLN Q+++DF  YA TCF
Sbjct  137   PNEEGLSYYNSLIDVLLEKGIQPYVTLFHWDLPQALEDKYGGWLNSQIVEDFVHYASTCF  196

Query  971   LIFGDRVKQWVTINEPRSITVLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlll  1150
               FGDRVK W+T+NEP +  + GYD G+ APG CSI  HL C  G S+TEPY VAH++LL
Sbjct  197   KEFGDRVKHWITVNEPHNFAIDGYDFGIQAPGRCSIISHLFCKEGTSSTEPYIVAHNILL  256

Query  1151  ahaaaVDIYRRKYQAKQGGKITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMT  1330
             AHA     Y++ ++ +QGG I I ++S WYEPL++   D +A  RA+DF LGWFL+P+M 
Sbjct  257   AHAGVFHAYKQHFKKEQGGLIGIALDSKWYEPLSDVDEDREAAARAMDFELGWFLDPLMF  316

Query  1331  GEYPRSVISRVGDRLPKFSAAESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLT  1510
             G YP S+   VGDRLP+FS  ES L+ GS D++G+NHYTT YA +    +  L ++D  T
Sbjct  317   GRYPASMQKLVGDRLPQFSNQESQLVSGSLDFVGINHYTTLYARNDRMRVRKLVMNDAST  376

Query  1511  DSGTFTLPFKGLMPIGERANAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT-  1687
             D+      ++    IGE A + WL+IVP GM +LM ++K+KYGNP VFITENGMDDA + 
Sbjct  377   DAAVIATAYRHGKKIGETAASNWLHIVPWGMFSLMKHVKEKYGNPPVFITENGMDDANSR  436

Query  1688  -----DGLNDIKRIRYHRDYLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLY  1852
                  + L D KRI+YH DY+ +LL AI+++GCN+ GYF WSL+DNWEW  G++ RFGLY
Sbjct  437   FSRLENVLQDDKRIQYHNDYMSNLLDAIRKEGCNILGYFVWSLLDNWEWNSGYTVRFGLY  496

Query  1853  YVDYDDNLRRIPKESAKWFKNFLA  1924
             Y+DY++NL RIPK S +WF   LA
Sbjct  497   YIDYNNNLTRIPKASVEWFTQVLA  520



>ref|XP_011095300.1| PREDICTED: putative beta-glucosidase 41 isoform X2 [Sesamum indicum]
Length=487

 Score =   530 bits (1364),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 263/480 (55%), Positives = 329/480 (69%), Gaps = 41/480 (9%)
 Frame = +2

Query  506   AQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQ  685
              ++ISRA FPEGF FGTAS+AYQFEGAV E  +G +IWDTF   PG++ DFSNAD AVDQ
Sbjct  33    CESISRADFPEGFTFGTASSAYQFEGAVNEGNKGDSIWDTFTRKPGRILDFSNADTAVDQ  92

Query  686   YHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYV  865
             YHR+  DI+LMKD+GMDAYRFSI+WSRI PNGTG+ NQ G+++YNNLIDALL  GI+PY 
Sbjct  93    YHRFKSDIDLMKDLGMDAYRFSISWSRILPNGTGEPNQEGIEYYNNLIDALLDKGIQPYA  152

Query  866   TLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYD  1045
             TLYH+DLPQ LE++Y G L  Q                                   GYD
Sbjct  153   TLYHWDLPQILEDKYGGLLTNQ-----------------------------------GYD  177

Query  1046  LGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVV  1225
             LG+ APG CSI  HL+C  G S+ EPY VAH++LL+HAAA  IY+  ++ +Q GK+ I +
Sbjct  178   LGIQAPGRCSILGHLICKAGKSSVEPYIVAHNILLSHAAAYHIYQNHFKERQQGKVGIAL  237

Query  1226  ESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESAL  1405
             ++ WYEP++N+  DIDA  RA+DF LGWFL+P++ G YP S+   V +RLP+ +   S  
Sbjct  238   DAKWYEPISNADEDIDAAGRAMDFGLGWFLDPLLLGNYPLSMQKLVAERLPEITPETSRF  297

Query  1406  LKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLY  1585
             LKGS D++G+NHYTT YA +  T+   L L D  +DS       K  + IGERA + WL+
Sbjct  298   LKGSLDFVGINHYTTLYARNDRTHFRKLILQDASSDSAVIATSSKHGIAIGERAASSWLH  357

Query  1586  IVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKTD------GLNDIKRIRYHRDYLKSLL  1747
             IVP G+R L NYIKDKYGNP V ITENGMDD K         L D KRI YHRDYL +L 
Sbjct  358   IVPWGIRKLANYIKDKYGNPPVIITENGMDDPKRSHRALPKALQDDKRINYHRDYLSNLS  417

Query  1748  AAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
             AAI++D C+V+GYF WSL+DNWEW +G++ RFGLYYVDY +NL RIPK S  WF+N L +
Sbjct  418   AAIRQDNCDVRGYFVWSLLDNWEWNMGYTVRFGLYYVDYKNNLTRIPKSSVSWFRNMLTT  477



>ref|XP_008454584.1| PREDICTED: putative beta-glucosidase 41 isoform X3 [Cucumis melo]
Length=502

 Score =   530 bits (1364),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 259/480 (54%), Positives = 335/480 (70%), Gaps = 30/480 (6%)
 Frame = +2

Query  506   AQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQ  685
             ++ +SRA FP+GF+FGTA++AYQFEGAV E  RG +IWDTF   PG++ DFSNAD  VDQ
Sbjct  17    SECLSRADFPDGFIFGTAASAYQFEGAVDEGNRGPSIWDTFVKEPGRILDFSNADRTVDQ  76

Query  686   YHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYV  865
             YHR+ +DI+LMKDMGMDAYRFSI+W RIFP                         I+P+V
Sbjct  77    YHRFKDDIKLMKDMGMDAYRFSISWPRIFPR------------------------IQPFV  112

Query  866   TLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYD  1045
             TLYH+DLPQ LE+ Y GWL+R+++KDF  YA TCF  FGDRVK W+T NEP   ++  YD
Sbjct  113   TLYHWDLPQVLEDEYEGWLSRRIVKDFEHYAVTCFQAFGDRVKHWITFNEPHGYSIKSYD  172

Query  1046  LGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVV  1225
             LG+ APG CS   H+LC  GNS++EPY VAH++LL+HAAA   Y+  ++ +QGG+I I +
Sbjct  173   LGIQAPGRCSFLGHILCKKGNSSSEPYIVAHNILLSHAAAYRNYQNHFKKRQGGRIGIAL  232

Query  1226  ESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESAL  1405
             ++ WYEPL+ +  + +A  RA+DF +GWFL+P+  G+YP S+   VG RLPK S   +  
Sbjct  233   DAIWYEPLSENDENKEAALRALDFEIGWFLDPLFFGKYPPSMRRLVGPRLPKISLVTAKF  292

Query  1406  LKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLY  1585
             L G+ D++G+NHYT+ YA +    I  L  +D  +DS   T P KG+  IGERA + WL+
Sbjct  293   LIGTLDFVGMNHYTSLYARNDRIGIRKLIFNDASSDSNVITTPRKGISTIGERAASHWLH  352

Query  1586  IVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLKSLL  1747
             IVP G+R L  Y+K KYGNP VFITENGMDD           L D KRIRYHRDYL +L 
Sbjct  353   IVPWGIRKLAVYLKYKYGNPPVFITENGMDDPNKRSIPLEKALKDDKRIRYHRDYLSNLS  412

Query  1748  AAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
              AI ++GCNV+GYFAWSL+DNWEW +G++ RFGLYYVDY +NL RIPK S +WF++ L S
Sbjct  413   IAIGQEGCNVQGYFAWSLLDNWEWNMGYTVRFGLYYVDYKNNLTRIPKASVQWFQSMLKS  472



>ref|XP_007045908.1| Beta glucosidase 40 isoform 2 [Theobroma cacao]
 gb|EOY01740.1| Beta glucosidase 40 isoform 2 [Theobroma cacao]
Length=413

 Score =   524 bits (1349),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 248/357 (69%), Positives = 297/357 (83%), Gaps = 0/357 (0%)
 Frame = +2

Query  497   ICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVA  676
             +  +QNISRASFP+GFVFGTAS+++Q+EGAVKEDGRG TIWD F+HT GK+ D SNADVA
Sbjct  23    LSQSQNISRASFPKGFVFGTASSSFQYEGAVKEDGRGPTIWDKFSHTFGKIIDGSNADVA  82

Query  677   VDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIE  856
             VDQYHRY EDI LMKDMGMDAYRFSIAWSRIFPNGTG++NQAGVDHYNNLI+ALLA GIE
Sbjct  83    VDQYHRYTEDIRLMKDMGMDAYRFSIAWSRIFPNGTGEINQAGVDHYNNLINALLAKGIE  142

Query  857   PYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVL  1036
             PYVTLYH+DLPQALE+RYNGWLN Q+IKDFA +AETCF IFGDRVK W+T NEP + TV 
Sbjct  143   PYVTLYHWDLPQALEDRYNGWLNPQIIKDFAMFAETCFQIFGDRVKHWITFNEPHTFTVQ  202

Query  1037  GYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKIT  1216
             GYD+G+ APG CSI   L+C  GNSATEPY VAH++LL+HA   DIYR+KY+AKQ G + 
Sbjct  203   GYDVGLQAPGRCSIILRLICKAGNSATEPYIVAHNVLLSHATVADIYRKKYKAKQHGSVG  262

Query  1217  IVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAE  1396
             +  +  WYEP TNS  + +A QRA DF LGWFL+P++ G+YP S+ISRVG+RLP+FS AE
Sbjct  263   VSFDVMWYEPETNSTENTEAAQRAQDFQLGWFLDPLIFGDYPSSMISRVGNRLPRFSKAE  322

Query  1397  SALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERA  1567
             SALLKGS D++G+NHYTT+YA +  TN +G  L+D++ DSG FT PFK   PIG++ 
Sbjct  323   SALLKGSLDFVGINHYTTYYARANATNALGTILNDSIADSGAFTAPFKNGKPIGDKG  379



>gb|EMS61848.1| Beta-glucosidase 25 [Triticum urartu]
Length=711

 Score =   534 bits (1375),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 271/522 (52%), Positives = 350/522 (67%), Gaps = 49/522 (9%)
 Frame = +2

Query  506   AQNISRASFPEGFVFGTASAAYQ-----------FEGAVKEDGRGATIWDTF-----AHT  637
             A+ I RA FP GF FGTAS+AYQ           F  +V      +  W  F     A  
Sbjct  17    AEAIRRADFPPGFTFGTASSAYQVKYCENTHLSDFSRSVFSYLSDSCFWSIFYQYEGAVN  76

Query  638   PGKVTDFSNADVAVDQYHRY------------------LEDIELMKDMGMDAYRFSIAWS  763
              G+V DFSNADVAVD YHRY                   ED++LMKD+G+DAYRFSI+W+
Sbjct  77    EGRVIDFSNADVAVDHYHRYKISYTNKLSIADKPSTDWQEDVDLMKDIGVDAYRFSISWA  136

Query  764   RIFP---------NGTGKLNQAGVDHYNNLIDALLANGIEPYVTLYHYDLPQALENRYNG  916
             RIFP         +GTGK N+ G+ +YNNLID LL  GI+PYVTL+H+DLPQALE++Y G
Sbjct  137   RIFPSMSQMIVFPDGTGKPNEEGLSYYNNLIDVLLEKGIQPYVTLFHWDLPQALEDKYGG  196

Query  917   WLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGVHAPGHCSIFFHLLC  1096
             WLN Q+++DF  YA TCF  FGDRVK W+TINEP +  + GYD G+ APG CSI  HL C
Sbjct  197   WLNSQIVEDFVRYASTCFKEFGDRVKHWITINEPHNFAIDGYDFGIQAPGRCSIISHLFC  256

Query  1097  PTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESFWYEPLTNSPADIDA  1276
               G S+TEPY VAH++LLAHA     Y++ ++ KQGG I I ++S WYEPL++   D +A
Sbjct  257   KEGTSSTEPYIVAHNILLAHAGVFHAYKQHFKKKQGGLIGIALDSKWYEPLSDVDEDREA  316

Query  1277  KQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKGSYDYLGVNHYTTWY  1456
               RA+DF LGWFL+P+M G YP S+   VGDRLP+FS+ ES L+ GS D++G+NHYTT Y
Sbjct  317   AARAMDFELGWFLDPLMFGRYPASMQKLVGDRLPQFSSQESQLVSGSLDFVGINHYTTLY  376

Query  1457  ASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVPRGMRNLMNYIKDKY  1636
             A +    +  L ++D  TD+   +  ++    IGE A + WL+IVP GM +LM ++K+KY
Sbjct  377   ARNDRMRVRKLVMNDASTDAAVISTAYRHGKKIGETAASNWLHIVPWGMFSLMKHVKEKY  436

Query  1637  GNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLKSLLAAIKEDGCNVKGYFAWS  1798
             GNP VFITENGMDDA +      + L D KRI+YH DY+ +LL AIK++GCN++GYF WS
Sbjct  437   GNPPVFITENGMDDANSRFSRLENVLQDDKRIQYHNDYMSNLLDAIKKEGCNIQGYFVWS  496

Query  1799  LMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLA  1924
             L+DNWEW  G++ RFGLYY+DY++NL RIPK S +WF   LA
Sbjct  497   LLDNWEWNSGYTVRFGLYYIDYNNNLTRIPKASVEWFTQVLA  538



>ref|XP_002990785.1| hypothetical protein SELMODRAFT_185578 [Selaginella moellendorffii]
 gb|EFJ08058.1| hypothetical protein SELMODRAFT_185578 [Selaginella moellendorffii]
Length=495

 Score =   526 bits (1354),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 265/475 (56%), Positives = 338/475 (71%), Gaps = 9/475 (2%)
 Frame = +2

Query  512   NISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYH  691
             N+SRASFP+GF FGTA++AYQ EGA K+ GRG +IWD F  TPG+V + +  DVAVD+YH
Sbjct  22    NLSRASFPKGFTFGTATSAYQVEGAAKKYGRGPSIWDVFIRTPGRVQENATGDVAVDEYH  81

Query  692   RYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTL  871
             RY EDI+LM D+ MDAYRFSI+WSRIFP G G++N+ GV +YN LID LL  GI+PY  L
Sbjct  82    RYKEDIDLMADLNMDAYRFSISWSRIFPEGKGRVNRYGVAYYNRLIDYLLLKGIQPYANL  141

Query  872   YHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLG  1051
              HYDLP++LE  Y GWL+R+V+KDF  +AE CF  FGDRVK W T NEPR +  LGYD G
Sbjct  142   NHYDLPESLEKDYEGWLSRKVVKDFTNFAEFCFKTFGDRVKYWTTFNEPRVVAQLGYDNG  201

Query  1052  VHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVES  1231
               APG CS  +   C  GNSATEPY VAH+LLL+H +A  +YR+KYQ KQ G I I+++ 
Sbjct  202   QFAPGRCSAPYG-NCTEGNSATEPYIVAHNLLLSHGSAAQVYRKKYQEKQKGSIGILLDF  260

Query  1232  FWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLK  1411
              +YEP +NS  DIDA QR  DF++GWFLEP++ G YP+++   VG RLPKFS  +  ++K
Sbjct  261   VYYEPFSNSTEDIDAAQRGRDFHVGWFLEPIINGSYPKTMQQYVGSRLPKFSKDDIEMVK  320

Query  1412  GSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIV  1591
             GS D++G+NHYTT+YA   D         D   D     L  +  + IG RA++ WLYIV
Sbjct  321   GSVDFVGINHYTTYYAK--DAGSQNRNTTDYFQDMNIQMLHDRDGVSIGPRAHSTWLYIV  378

Query  1592  PRGMRNLMNYIKDKYGNPLVFITENGMDDAKT----DGLNDIKRIRYHRDYLKSLLAAIK  1759
             P GM   ++YIKD YGNP V ++ENGMDD         L+D  RI Y++ Y+++L+AA+K
Sbjct  379   PWGMYKALSYIKDHYGNPKVVLSENGMDDPANLTLFQSLHDTTRINYYQSYIENLVAAMK  438

Query  1760  EDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYD-DNLRRIPKESAKWFKNFL  1921
              DG NV GYFAWSL+DN+EW  G++SRFGL Y+D+    L+RIPKESAKWFK  L
Sbjct  439   -DGANVHGYFAWSLVDNFEWLSGYTSRFGLVYIDFKHKTLKRIPKESAKWFKTLL  492



>ref|XP_002988358.1| hypothetical protein SELMODRAFT_183841 [Selaginella moellendorffii]
 gb|EFJ10448.1| hypothetical protein SELMODRAFT_183841 [Selaginella moellendorffii]
Length=496

 Score =   525 bits (1353),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 263/489 (54%), Positives = 347/489 (71%), Gaps = 16/489 (3%)
 Frame = +2

Query  491   LQIC---GAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFS  661
             L +C   G + +SR SFP+GFVFGTASAAYQ+EGA +E GRG +IWD +AHTPGK+ D +
Sbjct  10    LVVCAVEGHEILSRRSFPKGFVFGTASAAYQYEGAAREGGRGPSIWDVYAHTPGKIMDGT  69

Query  662   NADVAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALL  841
               DVAVDQYHRY ED+ LM DMG+DAYRFSI+WSRIFP G GK+NQ GVD+YNNLI+ LL
Sbjct  70    TGDVAVDQYHRYKEDVGLMVDMGVDAYRFSISWSRIFPEGRGKINQEGVDYYNNLINELL  129

Query  842   ANGIEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPR  1021
               GI+PYVTL+H+D PQALE+ Y  WL+ +++ D+AAYAE CF  FGDRVK W+T NEP 
Sbjct  130   KKGIQPYVTLFHWDSPQALEDAYKTWLSSRIVDDYAAYAEACFRAFGDRVKHWITFNEPH  189

Query  1022  SITVLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQ  1201
              +   GY+ G+ APG CS      C  GNS+ EPY V HH+LL+HA+AV IYR KYQ KQ
Sbjct  190   VVCNFGYNFGMLAPGRCSSEVG-NCSAGNSSVEPYIVGHHILLSHASAVKIYREKYQEKQ  248

Query  1202  GGKITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPK  1381
              G I I +++ W+EP + S  D  A +RA+DF LGW L+P+M G+YP ++ SRV DRLPK
Sbjct  249   AGIIGITLDAQWHEPFSRSSKDKAAARRALDFNLGWMLDPIMFGDYPATMRSRVRDRLPK  308

Query  1382  FSAAESALLKGSYDYLGVNHYTTWY---ASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMP  1552
             F+  +S  LKGS+D++G+NHYT++Y   AS+++             D+G F+   +    
Sbjct  309   FTKEQSKRLKGSHDFIGINHYTSFYDADASNSNHPQAAFSQQAYFKDTGVFSTDMRNGRL  368

Query  1553  IGERANAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRI  1714
             IG+  N    YIVP GMR L+NYI+ +Y NP +FITENG+ D         + LND  R+
Sbjct  369   IGQNVNG--FYIVPFGMRRLLNYIRLRYNNPTIFITENGISDVTNATAPLKEVLNDTTRV  426

Query  1715  RYHRDYLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKE  1894
              + + YL +L AAI  DG +V+GYF WSL+DN+EW+ G S +FGLY+V+Y+ +L+R+PK+
Sbjct  427   NFLKAYLSNLRAAI-ADGSDVRGYFVWSLLDNFEWSRGLSVKFGLYHVEYEKDLQRVPKK  485

Query  1895  SAKWFKNFL  1921
             SA W+K FL
Sbjct  486   SAWWYKKFL  494



>ref|XP_002979705.1| hypothetical protein SELMODRAFT_153534 [Selaginella moellendorffii]
 gb|EFJ19107.1| hypothetical protein SELMODRAFT_153534 [Selaginella moellendorffii]
Length=501

 Score =   525 bits (1351),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 261/484 (54%), Positives = 345/484 (71%), Gaps = 13/484 (3%)
 Frame = +2

Query  497   ICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVA  676
             + G + +SR SFP+GFVFGTASAAYQ+EGA KE GRG +IWD +AHTPGK+ D +  DVA
Sbjct  20    VEGHEILSRRSFPKGFVFGTASAAYQYEGAAKEGGRGPSIWDVYAHTPGKIMDGTTGDVA  79

Query  677   VDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIE  856
             VDQYHRY ED+ LM DMG+DAYRFSI+WSRIFP G GK+NQ GVD+YNNLI+ LL  GI+
Sbjct  80    VDQYHRYKEDVGLMVDMGVDAYRFSISWSRIFPEGRGKINQEGVDYYNNLINELLKKGIQ  139

Query  857   PYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVL  1036
             PYVTL+H+D PQALE+ Y  WL+ +++ D+AAYAE CF  FGDRVK W+T NEP  +   
Sbjct  140   PYVTLFHWDSPQALEDAYKTWLSSRIVDDYAAYAEACFRAFGDRVKHWITFNEPHVVCNF  199

Query  1037  GYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKIT  1216
             GY+ G+ APG CS      C  GNS+ EPY V HH+LL+HA+AV IYR KYQ KQ G I 
Sbjct  200   GYNFGMLAPGRCSSEVG-NCSAGNSSVEPYIVGHHILLSHASAVKIYREKYQEKQAGIIG  258

Query  1217  IVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAE  1396
             I +++ W+EP + S  D  A +RA+DF LGW L+P++ G+YP ++ SRV DRLPKF+  +
Sbjct  259   ITLDAQWHEPFSRSSKDKAAARRALDFNLGWMLDPIVFGDYPATMRSRVRDRLPKFTKEQ  318

Query  1397  SALLKGSYDYLGVNHYTTWY---ASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERA  1567
             S  LKGS+D++G+NHYT++Y   AS+++             D+G F+   +    IG+  
Sbjct  319   SKRLKGSHDFIGINHYTSFYDADASNSNHPQAAFSQQAYFKDTGVFSTDTRNGRLIGQNV  378

Query  1568  NAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRD  1729
             N    YIVP GMR L+NYI+ +Y NP +FITENG+ D         + LND  R+ + + 
Sbjct  379   NG--FYIVPFGMRRLLNYIRLRYNNPTIFITENGISDVTNATAPLKEVLNDTTRVNFLKA  436

Query  1730  YLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWF  1909
             YL +L AAI  DG +V+GYF WSL+DN+EW+ G S +FGLY+V+Y+ +L+R+PK+SA W+
Sbjct  437   YLSNLRAAI-ADGSDVRGYFVWSLLDNFEWSRGLSVKFGLYHVEYEKDLQRVPKKSALWY  495

Query  1910  KNFL  1921
             K FL
Sbjct  496   KKFL  499



>ref|XP_002974513.1| hypothetical protein SELMODRAFT_149851 [Selaginella moellendorffii]
 gb|EFJ24735.1| hypothetical protein SELMODRAFT_149851 [Selaginella moellendorffii]
Length=494

 Score =   523 bits (1346),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 262/475 (55%), Positives = 338/475 (71%), Gaps = 9/475 (2%)
 Frame = +2

Query  512   NISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYH  691
             N+SRASFP+GF FGTA++AYQ EGA K+ GRG +IWD F  TPG+V + +  DVAVD+YH
Sbjct  21    NLSRASFPKGFTFGTATSAYQVEGAAKKYGRGPSIWDVFIRTPGRVQENATGDVAVDEYH  80

Query  692   RYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTL  871
             RY EDI+LM D+ MDAYRFSI+WSRIFP G G++N+ GV +YN LID LL  GI+PY  L
Sbjct  81    RYKEDIDLMADLNMDAYRFSISWSRIFPEGKGRVNRYGVAYYNRLIDYLLLKGIQPYANL  140

Query  872   YHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLG  1051
              HYDLP++LE  Y GWL+R+V+KDF  +AE CF  FGDRVK W T NEPR +  LGYD G
Sbjct  141   NHYDLPESLEKDYEGWLSREVVKDFTNFAEFCFKTFGDRVKYWTTFNEPRVVAQLGYDNG  200

Query  1052  VHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVES  1231
               APG CS  +   C  GNSATEPY VAH+LLL+H +A  +YR+ YQ KQ G I I+++ 
Sbjct  201   QFAPGRCSTPYG-NCTEGNSATEPYIVAHNLLLSHGSAAQVYRKNYQEKQKGSIGILLDF  259

Query  1232  FWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLK  1411
              +YEP +NS  DIDA QR  DF++GWFLEP++ G YP+++   VG RLPKFS  +  ++K
Sbjct  260   VYYEPFSNSTEDIDAAQRGRDFHVGWFLEPIINGSYPKTMQQYVGSRLPKFSKDDIEMVK  319

Query  1412  GSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIV  1591
             GS D++G+NHYTT+YA   D         D   D     L  +  + IG RA++ WLYIV
Sbjct  320   GSVDFVGINHYTTYYAK--DAGSQNRNTTDYFQDMNIQMLHDRDGVSIGPRAHSTWLYIV  377

Query  1592  PRGMRNLMNYIKDKYGNPLVFITENGMDDAK----TDGLNDIKRIRYHRDYLKSLLAAIK  1759
             P GM   ++YIK+ YGNP V ++ENGMDD      +  L+D  RI Y++ Y+++L+AA++
Sbjct  378   PWGMYKALSYIKEHYGNPKVVLSENGMDDPANLTLSQSLHDTTRINYYQSYIENLVAAMR  437

Query  1760  EDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDN-LRRIPKESAKWFKNFL  1921
              DG NV GYFAWSL+DN+EW  G++SRFGL Y+D+    L+RIPKESAKWFK  L
Sbjct  438   -DGANVHGYFAWSLVDNFEWLSGYTSRFGLVYIDFKHKALKRIPKESAKWFKTLL  491



>ref|XP_003614037.1| Beta-glucosidase [Medicago truncatula]
Length=459

 Score =   520 bits (1340),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 252/414 (61%), Positives = 314/414 (76%), Gaps = 22/414 (5%)
 Frame = +2

Query  491   LQICGAQNISRASFPEGFVFGTASAAYQ---------------------FEGAVKEDGRG  607
             +Q+C  Q I+R SFP+GFVFGTAS+A+Q                     +EGAVKEDGRG
Sbjct  18    IQMCLCQ-INRHSFPKGFVFGTASSAFQLSWLERVAVNHKVGGSTPPSSYEGAVKEDGRG  76

Query  608   ATIWDTFAHTPGKVTDFSNADVAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTG  787
              +IWDTF+H PGK+   +N+DVAVDQYHRY  DI+LMKDMGMDAYRFSI+W+RIFPNG+G
Sbjct  77    PSIWDTFSHIPGKIHGNNNSDVAVDQYHRYEGDIQLMKDMGMDAYRFSISWTRIFPNGSG  136

Query  788   KLNQAGVDHYNNLIDALLANGIEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETC  967
              +NQAG+DHYN LIDALLA GIEPYVTLYH+DLPQALE++Y GWL+  +IKDFA YAETC
Sbjct  137   VVNQAGIDHYNKLIDALLAKGIEPYVTLYHWDLPQALEDKYTGWLSPLIIKDFATYAETC  196

Query  968   FLIFGDRVKQWVTINEPRSITVLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhll  1147
             F  FGDRVK W+T NEP +   +GYD+G   PG CSI  H LC +GNSATEPY VAH++L
Sbjct  197   FEKFGDRVKHWITFNEPHTFAWMGYDIGQQPPGRCSILLHHLCRSGNSATEPYIVAHNVL  256

Query  1148  lahaaaVDIYRRKYQAKQGGKITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVM  1327
             L+HA   D+YR+KYQ  QGG + I ++  W E  TNS  DI+A QRA+DF LGWFL+P++
Sbjct  257   LSHAIVADVYRKKYQKIQGGSVGISLDVIWVESATNSKEDIEATQRALDFTLGWFLDPLI  316

Query  1328  TGEYPRSVISRVGDRLPKFSAAESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTL  1507
              G+YP+S+  RVG RLPKFS +E+ L+KGS D++G+NHYTT+YA    T+ +   +HD +
Sbjct  317   FGDYPKSMKIRVGKRLPKFSKSEANLVKGSLDFVGINHYTTFYAMHNATDSLRELVHDYI  376

Query  1508  TDSGTFTLPFKGLMPIGERANAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENG  1669
             +D G  T+PF G   IG++AN+ WLYIVP+GMR+LMNYIK KY NPLV ITENG
Sbjct  377   SDIGAVTVPFNGTEIIGDKANSFWLYIVPQGMRSLMNYIKHKYENPLVIITENG  430



>ref|XP_002960251.1| hypothetical protein SELMODRAFT_75234 [Selaginella moellendorffii]
 gb|EFJ37790.1| hypothetical protein SELMODRAFT_75234 [Selaginella moellendorffii]
Length=495

 Score =   521 bits (1342),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 270/482 (56%), Positives = 341/482 (71%), Gaps = 15/482 (3%)
 Frame = +2

Query  500   CGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAV  679
             C A N  R  FP+GFVFGTASAAYQ+EGAV E GR  +IWDTF+HTPGK+ D SN DV  
Sbjct  17    CAALN--RCDFPQGFVFGTASAAYQYEGAVAEGGRRPSIWDTFSHTPGKIIDGSNGDVTD  74

Query  680   DQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPN-GTGKLNQAGVDHYNNLIDALLANGIE  856
             DQYH Y +D+ LMK+M MDAYRFSI+WSRI P+     +N  G+ +YN LIDALL  GI+
Sbjct  75    DQYHLYQDDVLLMKNMSMDAYRFSISWSRILPDLKASAVNPEGIAYYNRLIDALLKQGIQ  134

Query  857   PYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVL  1036
             PYVTLYH+DLPQALE+   GWLN   I  F+AYAE CF  FGDRVK W+T NEP +  V 
Sbjct  135   PYVTLYHWDLPQALED-LGGWLNSSTIDKFSAYAEACFNAFGDRVKHWITFNEPHNFVVT  193

Query  1037  GYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKIT  1216
             GYDLGV APG CSI   L C  GNSATEPY VAH++LL+HAAAVD+YR+K+Q+ Q GKI 
Sbjct  194   GYDLGVEAPGRCSI---LGCLRGNSATEPYIVAHNVLLSHAAAVDVYRKKFQSTQKGKIG  250

Query  1217  IVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAE  1396
             I +++ WYEP++NS     A QRA+DF LGWFL+P+M G+YP  +   VGDRLP F+  E
Sbjct  251   ITLDAKWYEPISNSTEHTSAAQRALDFELGWFLDPIMFGDYPSVMRENVGDRLPNFTNEE  310

Query  1397  SALLKGSYDYLGVNHYTTWYASSTDTNI--MGLFLHDTLTDSGTFTLPFK-GLMPIGERA  1567
              + +  S D+LG+NHYTT +A     N+  +  ++   +  SG  +  F   + P   + 
Sbjct  311   RSRVLHSMDFLGLNHYTTNFALPIPFNLSRVDYYMDARVIGSGKVSKCFHCNIFPSWFQG  370

Query  1568  NAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDD----AKTDGLNDIKRIRYHRDYL  1735
              + WLYIVP G+R ++NYIK++Y NP + ITENG+D     +  + L D  R+ +H DYL
Sbjct  371   ASFWLYIVPWGIRKIVNYIKERYNNPTIIITENGVDQNNLLSSKETLKDDIRVNFHADYL  430

Query  1736  KSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKN  1915
              +LL AI+ DG +V+GYFAWSL+DNWEWT GF+SRFGLYYVDY + L+R PK S+ WF N
Sbjct  431   SNLLLAIR-DGADVRGYFAWSLLDNWEWTSGFTSRFGLYYVDYKNELKRYPKNSSVWFSN  489

Query  1916  FL  1921
             FL
Sbjct  490   FL  491



>ref|XP_006582224.1| PREDICTED: beta-glucosidase 25-like isoform X2 [Glycine max]
Length=465

 Score =   514 bits (1323),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 245/433 (57%), Positives = 316/433 (73%), Gaps = 6/433 (1%)
 Frame = +2

Query  641   GKVTDFSNADVAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYN  820
             G++ DFSNAD AVDQYHR+  DI LMKD+GMD+YRFSI+W RIFPNGTG+ N+ G+ +YN
Sbjct  24    GRIVDFSNADKAVDQYHRFQNDINLMKDLGMDSYRFSISWPRIFPNGTGEPNKEGIKYYN  83

Query  821   NLIDALLANGIEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQW  1000
             +LID+LL  GI+P+VTLYH+DLPQ LE++Y GWL+ Q+IKD+  YA TCF  FGDRVK W
Sbjct  84    SLIDSLLVKGIQPFVTLYHWDLPQMLEDKYEGWLSSQIIKDYEHYANTCFKAFGDRVKHW  143

Query  1001  VTINEPRSITVLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYR  1180
             +T NEP +  + GYDLG+ APG CS+  HLLC  G S+TEPY VAH++LL+HAAA   Y+
Sbjct  144   ITFNEPHNFALHGYDLGIQAPGRCSLLGHLLCKKGKSSTEPYIVAHNILLSHAAAYRSYQ  203

Query  1181  RKYQAKQGGKITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISR  1360
               ++ +QGG+I I ++  WYEP+T    D DA  RA+DF LGWFL+P+  G+YP S+   
Sbjct  204   LHFKEQQGGQIGIALDVIWYEPITELDEDKDAAARAMDFSLGWFLDPLFFGKYPLSMEKL  263

Query  1361  VGDRLPKFSAAESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFK  1540
             V  RLP+ S   S  L GS D++G+NHYT+ Y  +  T I  L + D  TD+   T  ++
Sbjct  264   VAKRLPEISDTASKFLVGSLDFIGINHYTSVYTRNDRTRIRKLVMQDAATDAAVITTAYR  323

Query  1541  GLMPIGERANAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAK------TDGLND  1702
                 IGE+A + WL+IVP G+R L+ ++KDKYG+  V ITENGMDD           LND
Sbjct  324   RGSAIGEKAASSWLHIVPWGIRKLVKHVKDKYGDTPVIITENGMDDPSGPFRTLEKALND  383

Query  1703  IKRIRYHRDYLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRR  1882
              KRIRYHRDYL +L AAI+EDGCNV+GYF WSL+DNWEW +G++ RFGLYYVD+ +NL R
Sbjct  384   DKRIRYHRDYLSNLSAAIREDGCNVRGYFVWSLLDNWEWNMGYTVRFGLYYVDFRNNLTR  443

Query  1883  IPKESAKWFKNFL  1921
             IPK+S +WFKN L
Sbjct  444   IPKDSVQWFKNML  456



>ref|XP_006845279.1| hypothetical protein AMTR_s00005p00266150 [Amborella trichopoda]
 gb|ERN06954.1| hypothetical protein AMTR_s00005p00266150 [Amborella trichopoda]
Length=482

 Score =   512 bits (1318),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 263/477 (55%), Positives = 337/477 (71%), Gaps = 13/477 (3%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             +SR  FP GFVFGTA++AYQ EGA  EDGRG +IWD F   PG + + +  +V+ D+YHR
Sbjct  6     LSRERFPPGFVFGTATSAYQVEGAAHEDGRGPSIWDVFIQQPGIIPNGATGEVSADEYHR  65

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             Y ED+++M DM MDAYRFSI+WSRIFP G G++NQ GVD+YN LID LL  GI PY  LY
Sbjct  66    YKEDVDIMADMNMDAYRFSISWSRIFPEGAGRVNQKGVDYYNRLIDYLLEKGITPYANLY  125

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             HYDLPQALE+ YNG LNR+V+ DFAAYA+ CF  FGDRVK W+T NEPR I  LGYD G 
Sbjct  126   HYDLPQALEDSYNGLLNRRVVDDFAAYADFCFKTFGDRVKNWMTFNEPRVIAALGYDNGF  185

Query  1055  HAPGHCSIFF---HLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVV  1225
             HAPG CS  F    + C  G+S+TEPY VAH+L+L+HA+AV  YR KYQA Q G+I I++
Sbjct  186   HAPGRCSNPFGNDGMNCTAGDSSTEPYIVAHNLILSHASAVKRYREKYQATQKGRIGILL  245

Query  1226  ESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESAL  1405
             +  WYEP +N+ AD+ A QR+ DF++GWFL P++ G YPRS++  VGDRLPKF+  E  +
Sbjct  246   DFVWYEPFSNAKADVRAAQRSRDFHIGWFLHPIVFGTYPRSMVRVVGDRLPKFTNEEVEM  305

Query  1406  LKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTD-SGTFTLPFKGLMPIGERANAVWL  1582
             +KGS D++G+N YT++Y   TD +I    + D   D    F     G + IG +AN+ WL
Sbjct  306   VKGSIDFVGINQYTSYYI--TDQHIKNGTVTDYQMDWHAGFEYSRDGKL-IGPQANSYWL  362

Query  1583  YIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT----DGLNDIKRIRYHRDYLKSLLA  1750
             Y+VP GM   + YIK+ Y NP + ++ENGMD A        L+D KRI Y+R YL +L  
Sbjct  363   YMVPWGMYKAVTYIKENYRNPTMILSENGMDYAANITLPAALHDTKRISYYRSYLINLKK  422

Query  1751  AIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             AI +DG NV GYFAWSL+DN+EW +G++SRFGL YVDY   L+R PK SA WF+  +
Sbjct  423   AI-DDGANVIGYFAWSLVDNFEWRLGYTSRFGLVYVDY-QTLKRYPKMSASWFRGLI  477



>ref|XP_010533966.1| PREDICTED: beta-glucosidase 44-like [Tarenaya hassleriana]
Length=514

 Score =   511 bits (1316),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 270/483 (56%), Positives = 337/483 (70%), Gaps = 10/483 (2%)
 Frame = +2

Query  488   GLQICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNA  667
             G  I     +SR SFP GFVFGTA++AYQ EG   +DGRG +IWDTF   PG V + + A
Sbjct  32    GDAIFDTGGLSRRSFPSGFVFGTATSAYQVEGETYQDGRGPSIWDTFVKIPGIVANNATA  91

Query  668   DVAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLAN  847
             +V VDQYHRY ED++LM  +  DAYRFSI+WSRIFP GTGK+N  GV +YN+LID LL  
Sbjct  92    NVTVDQYHRYKEDVDLMAKLNFDAYRFSISWSRIFPEGTGKVNWKGVAYYNSLIDYLLKK  151

Query  848   GIEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSI  1027
             GI PY  LYHYDLP+ALE RY G L +QV++DFA YAE CF  FGDRVK W+T NEPR +
Sbjct  152   GITPYANLYHYDLPEALEKRYKGLLGKQVVRDFADYAEFCFKTFGDRVKNWMTFNEPRVV  211

Query  1028  TVLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGG  1207
               LGYD G  APG CS  F   C  G+SATEPY VAHHL+LAH++AV  YR KYQ KQ G
Sbjct  212   AALGYDNGFFAPGRCSKAFG-NCTAGDSATEPYTVAHHLILAHSSAVQRYRLKYQEKQKG  270

Query  1208  KITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFS  1387
             +I I+++  WYEPLT   AD  A QRA DF++GWF+ P++ GEYP+++ + VGDRLPKFS
Sbjct  271   RIGILLDFVWYEPLTRGKADNLAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGDRLPKFS  330

Query  1388  AAESALLKGSYDYLGVNHYTTWYASSTD-TNIMGLFLHDTLTDSGTFTLPFKGLMPIGER  1564
               E  ++KGS D++G+N YTT+Y      +N    F +    ++G F    KG  PIG R
Sbjct  331   EEEVKMVKGSMDFVGINQYTTYYMYDPHLSNPPKYFGYQQDWNAG-FAFSKKG-KPIGPR  388

Query  1565  ANAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAK----TDGLNDIKRIRYHRDY  1732
             AN+ WLY VP GM   + YIK++YGNP V ++ENGMDD      + GL+D  RI ++R Y
Sbjct  389   ANSYWLYNVPWGMYKALMYIKERYGNPTVILSENGMDDPGNVTLSQGLHDTTRIGFYRGY  448

Query  1733  LKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFK  1912
             L  L  A+ +DG NV GYFAWSL+DN+EW +G++SRFG+ YVDY  NL+R PK SA WFK
Sbjct  449   LTQLKKAV-DDGANVAGYFAWSLLDNFEWKLGYTSRFGIVYVDY-KNLKRYPKMSAHWFK  506

Query  1913  NFL  1921
               L
Sbjct  507   QLL  509



>ref|XP_002967460.1| hypothetical protein SELMODRAFT_267120 [Selaginella moellendorffii]
 gb|EFJ32059.1| hypothetical protein SELMODRAFT_267120 [Selaginella moellendorffii]
Length=510

 Score =   509 bits (1311),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 256/478 (54%), Positives = 332/478 (69%), Gaps = 12/478 (3%)
 Frame = +2

Query  506   AQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQ  685
              + +SR SFP GFVFGT+SAAYQ+EGAV+E GRG +IWD F+H    ++D SN DV  DQ
Sbjct  30    GEALSRCSFPRGFVFGTSSAAYQYEGAVREGGRGPSIWDIFSHNSTNISDSSNGDVTEDQ  89

Query  686   YHRYLEDIELMKDMGMDAYRFSIAWSRIFPNG-TGKLNQAGVDHYNNLIDALLANGIEPY  862
             YHRY +D+ LMK+M MDAYRFSI+WSRI+P+G +   N  G+ +YN+LI++LL  GI+PY
Sbjct  90    YHRYKKDVLLMKEMFMDAYRFSISWSRIYPDGQSSPANGEGIAYYNSLINSLLEQGIQPY  149

Query  863   VTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGY  1042
             VTLYH+DLPQALE+   GWLN Q++K+F  YAETCF  FGDRVK W+T NEP S    GY
Sbjct  150   VTLYHWDLPQALEDSLGGWLNPQIVKEFTKYAETCFDAFGDRVKHWITFNEPHSFVREGY  209

Query  1043  DLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIV  1222
              LGV APG CS      C  GNSATEPY  AH++LL+HA+A  +Y++K+QA+Q GKI I 
Sbjct  210   CLGVSAPGRCS-----GCIGGNSATEPYIAAHNVLLSHASAAQVYKKKFQAQQKGKIGIA  264

Query  1223  VESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESA  1402
             + + WYEP +NS AD  A  RA DF LGWFL P++ G YP  + S V  RLP+F+  E+ 
Sbjct  265   LNADWYEPFSNSSADKAAAIRATDFQLGWFLNPIVYGNYPPVMRSYVASRLPQFTGNEAG  324

Query  1403  LLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWL  1582
             LL  S D+LG+NHYT+ YA  +      +  +D   DS   +L  +  +PIG + ++ WL
Sbjct  325   LLMSSLDFLGLNHYTSNYAQDSPEVPPSMTNYD--LDSRVRSLVSRDGVPIGPKGSSTWL  382

Query  1583  YIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAK----TDGLNDIKRIRYHRDYLKSLLA  1750
             Y+VP G R L+ YIK  Y NP++ ITENGMD A     +  L D  RI YH++YL +L  
Sbjct  383   YVVPWGFRKLLGYIKAHYKNPIIVITENGMDQASGHNLSQSLGDKTRIDYHQEYLANLNL  442

Query  1751  AIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLA  1924
             AI  D  +V+GYFAWSL+D WEW+ GF+ RFGLY+VDY + L+R PK SA+WF+  L 
Sbjct  443   AITRDSVDVRGYFAWSLLDTWEWSHGFTVRFGLYFVDYTNGLKRYPKMSARWFRRLLC  500



>ref|XP_010487722.1| PREDICTED: beta-glucosidase 44-like [Camelina sativa]
Length=513

 Score =   509 bits (1311),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 265/477 (56%), Positives = 334/477 (70%), Gaps = 16/477 (3%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             +SR SFP+GF+FGTA++AYQ EG   +DGRG +IWD F   PG +   + A++ VDQYHR
Sbjct  40    LSRQSFPKGFLFGTATSAYQVEGETHQDGRGPSIWDAFVKIPGTIAKNATAEITVDQYHR  99

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             Y ED++LMK +  DAYRFSI+WSRIFP+G+GK+N  GV +YN LID L+  GI PY  LY
Sbjct  100   YKEDVDLMKKLNFDAYRFSISWSRIFPDGSGKVNWKGVAYYNRLIDYLVQKGITPYANLY  159

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             HYDLP ALE +Y G L RQV+ DFA YAE CF  FGDRVK W+T NEPR +  LGYD G+
Sbjct  160   HYDLPLALEKKYKGLLGRQVVNDFADYAEFCFKTFGDRVKNWMTFNEPRVVAALGYDNGI  219

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
              APG CS  F   C  GNSATEPY V HHL+LAHAAAV  YR+ YQAKQ G+I I+++  
Sbjct  220   FAPGRCSKAFG-NCTEGNSATEPYIVTHHLILAHAAAVQRYRKYYQAKQKGRIGILLDFV  278

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             WYEPLT S AD  A QRA DF++GWF+ P++ GEYP+++ + V DRLPKF+A E  ++KG
Sbjct  279   WYEPLTRSKADNYAAQRARDFHIGWFIHPIVYGEYPKTMQNIVKDRLPKFTAEEVKMVKG  338

Query  1415  SYDYLGVNHYTTWYAS----STDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWL  1582
             S DY+G+N YTT+Y S    +T    +G +  D     G   L      PIG RA++ WL
Sbjct  339   SIDYVGINQYTTYYMSEPHFTTKPKDLG-YQQDWNVQFGFAKLG----KPIGPRAHSTWL  393

Query  1583  YIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAK----TDGLNDIKRIRYHRDYLKSLLA  1750
             Y VP GM   + YIK++YGNP + ++ENGMDD        GL+D  RI+Y+RDYL +L  
Sbjct  394   YNVPWGMYKALMYIKERYGNPTMILSENGMDDPGNVTLAQGLHDTTRIKYYRDYLTNLKK  453

Query  1751  AIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             A  +DG NV GYFAWSL+DN+EW  G++SRFG+ YVDY   L+R PK SAKWF+  L
Sbjct  454   AT-DDGANVVGYFAWSLLDNFEWLSGYTSRFGIVYVDY-KTLKRYPKMSAKWFRKLL  508



>ref|XP_006430653.1| hypothetical protein CICLE_v10013421mg, partial [Citrus clementina]
 gb|ESR43893.1| hypothetical protein CICLE_v10013421mg, partial [Citrus clementina]
Length=528

 Score =   509 bits (1311),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 262/473 (55%), Positives = 333/473 (70%), Gaps = 9/473 (2%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             +SR SFPEGFVFGTA++AYQ EG   +DGRG  IWD +AHTPG + + + ADV VDQYHR
Sbjct  57    LSRKSFPEGFVFGTATSAYQVEGMADKDGRGPCIWDVYAHTPGHIANNATADVTVDQYHR  116

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             Y EDI+LMK++  DAYRFSI+WSRIFP GTG +NQ GVD+YN LID +L  GI PY  LY
Sbjct  117   YKEDIDLMKNLNFDAYRFSISWSRIFPEGTGTVNQKGVDYYNRLIDYMLEQGITPYANLY  176

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             HYD+P AL+ +Y G L+ QV+KD+A YA+ CF  FGDRVK W T NEPR I  LG+D G 
Sbjct  177   HYDMPLALQEKYGGLLDCQVVKDYADYADFCFKTFGDRVKNWYTFNEPRVIAALGFDDGS  236

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
             + P  CS   +  C  GNS TEPY  AH+++LAHAAAV  YR KYQ  Q GKI I+++  
Sbjct  237   NPPSRCSKEVN-NCTDGNSGTEPYIAAHNMILAHAAAVQRYREKYQETQKGKIGILLDFV  295

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             WYEP T S AD  A QRA DF++GWFL P+  GEYPR++   VGDRLPKF+  E  +++G
Sbjct  296   WYEPHTRSKADNLAAQRARDFHIGWFLHPLTYGEYPRTMQENVGDRLPKFTPEEVLMVQG  355

Query  1415  SYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVP  1594
             S+DYLGVN YT++Y          +  +    D+G +     G+ PIG+RAN+ WLYIVP
Sbjct  356   SFDYLGVNQYTSYYMFDPPWPKSNISSYANDWDAG-YAYDRNGV-PIGQRANSGWLYIVP  413

Query  1595  RGMRNLMNYIKDKYGNPLVFITENGMDDAKTDGLN----DIKRIRYHRDYLKSLLAAIKE  1762
              G+ N + Y+K++YGNP+V ++ENGMDD     +N    D  R+ Y+RDY+  L  A+ +
Sbjct  414   WGLYNALMYVKERYGNPIVMLSENGMDDPSNYTVNHLLHDTTRVNYYRDYISQLKKAV-D  472

Query  1763  DGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             DG NV GYFAWSL+DN+EW +G+SSRFG+ YVD+ D L+R PK SA WFK  L
Sbjct  473   DGANVTGYFAWSLVDNFEWLLGYSSRFGITYVDF-DTLKRTPKMSAYWFKQLL  524



>ref|XP_002988359.1| hypothetical protein SELMODRAFT_127964 [Selaginella moellendorffii]
 gb|EFJ10449.1| hypothetical protein SELMODRAFT_127964 [Selaginella moellendorffii]
Length=494

 Score =   507 bits (1305),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 257/484 (53%), Positives = 340/484 (70%), Gaps = 15/484 (3%)
 Frame = +2

Query  497   ICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVA  676
             + G + +SR SFP+GFVFGTASAAYQ+EGA KE GRG +IWD +AHTPGK+ D +  DVA
Sbjct  15    VEGHEILSRRSFPKGFVFGTASAAYQYEGAAKEGGRGPSIWDVYAHTPGKIMDGTTGDVA  74

Query  677   VDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIE  856
             VDQYHRY ED+ LM DMG+DAYRFSI+W   FP   GK+NQ GV +YNNLI+ LL  GI+
Sbjct  75    VDQYHRYKEDVGLMVDMGVDAYRFSISWVSDFP--WGKINQEGVAYYNNLINELLKKGIQ  132

Query  857   PYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVL  1036
             PYVTL+H+D PQALE+ Y  WL+ +++ D+AAYAE CF  FGDRVK W+T NEP  +   
Sbjct  133   PYVTLFHWDSPQALEDAYKTWLSSRIVDDYAAYAEACFRAFGDRVKHWITFNEPHVVCNF  192

Query  1037  GYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKIT  1216
             GY+ G+ APG CS      C  GNS+ EPY V HH+LL+HA+AV IYR KYQ KQ G I 
Sbjct  193   GYNFGMLAPGRCSSEVG-NCSAGNSSVEPYIVGHHILLSHASAVKIYREKYQEKQAGIIG  251

Query  1217  IVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAE  1396
             I +++ W+EP + S  D  A  RA+DF LGW L+P+M G+YP ++ SRV DRLPKF+  +
Sbjct  252   ITLDAQWHEPFSRSSKDKAAAGRALDFNLGWMLDPIMFGDYPATMRSRVRDRLPKFTKEQ  311

Query  1397  SALLKGSYDYLGVNHYTTWY---ASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERA  1567
             S  LKGS+D++G+NHYT++Y   AS+++ +           D+G F+   +    IG+  
Sbjct  312   SKRLKGSHDFIGINHYTSFYDADASNSNLSQAAFSQQAYFKDTGVFSTDMRNGGLIGQNV  371

Query  1568  NAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRD  1729
             N    YIVP GMR L+NYI+ +Y NP +FITENG+ D         + LND  R+ + + 
Sbjct  372   NG--FYIVPFGMRRLLNYIRLRYNNPTIFITENGISDVTNATAPLKEVLNDTTRVNFLKA  429

Query  1730  YLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWF  1909
             YL +L AAI  DG +V+GYF WSL+DN+EW+ G S +FGLY+V+Y+ +L+R+PK+SA W+
Sbjct  430   YLSNLRAAI-ADGSDVRGYFVWSLLDNFEWSRGLSVKFGLYHVEYEKDLQRVPKKSAWWY  488

Query  1910  KNFL  1921
             K FL
Sbjct  489   KKFL  492



>ref|XP_010910031.1| PREDICTED: beta-glucosidase 25 isoform X3 [Elaeis guineensis]
Length=411

 Score =   503 bits (1296),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 242/408 (59%), Positives = 303/408 (74%), Gaps = 6/408 (1%)
 Frame = +2

Query  716   MKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLYHYDLPQA  895
             MKDMGMDAYRFSI+WSRIFPNGTG+ N  G+ HYN+LIDALL  G++PYVTLYH+DLPQ+
Sbjct  1     MKDMGMDAYRFSISWSRIFPNGTGEPNPEGISHYNSLIDALLEKGLQPYVTLYHWDLPQS  60

Query  896   LENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGVHAPGHCS  1075
             LE+RY+GWL+RQ+++DF  YA TCF  FGDRVK W+T NEP   ++ GYD G+ APG CS
Sbjct  61    LEDRYDGWLSRQIVEDFEHYARTCFETFGDRVKHWITFNEPHGFSIQGYDTGLQAPGRCS  120

Query  1076  IFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESFWYEPLTN  1255
             I  HLLC  G S+TEPY VAH++LL+HAAA   Y+R ++AKQ G I I ++S WYEP+++
Sbjct  121   ILSHLLCRKGKSSTEPYIVAHNILLSHAAAFHTYKRNFKAKQDGAIGIALDSKWYEPISD  180

Query  1256  SPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKGSYDYLGV  1435
             +  D DA  RA+DF LGWFL+P++ G YPRS+ + VG RLP  ++  S  L G+ D++G+
Sbjct  181   ADEDQDAAHRAMDFELGWFLDPLIFGHYPRSMQNIVGSRLPNITSKMSKSLAGTLDFVGI  240

Query  1436  NHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVPRGMRNLM  1615
             NHYTT Y  +    I  L L D  TD+G     F+    IGERA + WL+IVP G+R LM
Sbjct  241   NHYTTLYVRNDRIRIWNLVLDDASTDAGVIATSFRHGEMIGERAASHWLHIVPWGIRKLM  300

Query  1616  NYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLKSLLAAIKEDGCNV  1777
              YIK+KYGNPLV ITENGMDD+          L D KRI YH DYL +L AA++EDGCNV
Sbjct  301   RYIKEKYGNPLVIITENGMDDSNNPFATLDKALEDNKRIHYHNDYLSNLSAAVREDGCNV  360

Query  1778  KGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             +GYF WSL+DNWEW  G++ RFGLY+VDY DNL+RIPK S KWFK+FL
Sbjct  361   RGYFVWSLLDNWEWNSGYTVRFGLYFVDYRDNLKRIPKASVKWFKHFL  408



>ref|XP_009113531.1| PREDICTED: beta-glucosidase 43 [Brassica rapa]
Length=498

 Score =   506 bits (1303),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 260/474 (55%), Positives = 332/474 (70%), Gaps = 8/474 (2%)
 Frame = +2

Query  512   NISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYH  691
             +++R SFPEGFVFGTA++AYQ EG   +DGRG +IWD F   PGK+ + + A++ VDQYH
Sbjct  25    DLNRKSFPEGFVFGTATSAYQVEGETYQDGRGPSIWDAFVKIPGKIANNATAELTVDQYH  84

Query  692   RYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTL  871
              Y ED++LM+ +  DAYRFSI+WSRIFP+GTGK+N  GV +YN LID L+  GI PY  L
Sbjct  85    LYKEDVDLMQTLNFDAYRFSISWSRIFPDGTGKINWNGVAYYNRLIDYLVQKGITPYANL  144

Query  872   YHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLG  1051
             YHYDLP ALE +Y G L R V++DFA YAE CF  FGDRVK W+T NEPR +  LGYD G
Sbjct  145   YHYDLPLALEKKYKGLLGRHVVEDFADYAEFCFKTFGDRVKNWMTFNEPRVVAALGYDNG  204

Query  1052  VHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVES  1231
             + AP  CS  F   C  GNSATEPY VAHHL++AHA+AV  YR+ YQ KQ G+I I+++ 
Sbjct  205   IFAPARCSKAFG-NCTEGNSATEPYIVAHHLIVAHASAVQRYRQHYQEKQKGRIGILLDF  263

Query  1232  FWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLK  1411
              W+EPLT+S AD DA QRA DF+LGWF+ P++ GEYP+++ + V +RLP F+  E  ++K
Sbjct  264   VWFEPLTSSEADNDAAQRARDFHLGWFIHPIVYGEYPKTMQNIVKERLPNFTEEEVKMVK  323

Query  1412  GSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIV  1591
             GS D++G+N YTT+Y S+         L      +  F     G  PIG RA++ WLY V
Sbjct  324   GSIDFVGINQYTTYYMSAPHPTAKPKDLGYQQDWNVVFNFAKDG-KPIGPRAHSEWLYNV  382

Query  1592  PRGMRNLMNYIKDKYGNPLVFITENGMDDA----KTDGLNDIKRIRYHRDYLKSLLAAIK  1759
             P GM   M Y+K+ YGNP + ++ENGMDDA    +  G+ND  RI Y+RDYL  L  A+ 
Sbjct  383   PWGMYKAMMYVKEHYGNPTMILSENGMDDAGNITQAQGVNDTSRITYYRDYLTQLKKAV-  441

Query  1760  EDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             EDG NV GYFAWSL+DN+EW  G++SRFG+ YVDY D L+R PK SA WFK  L
Sbjct  442   EDGANVTGYFAWSLLDNFEWLSGYTSRFGIVYVDYKD-LKRYPKMSALWFKRIL  494



>gb|KDO63131.1| hypothetical protein CISIN_1g036937mg, partial [Citrus sinensis]
Length=497

 Score =   506 bits (1303),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 260/473 (55%), Positives = 331/473 (70%), Gaps = 9/473 (2%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             +SR SFPEGFVFGTA++AYQ EG   +DGRG  IWD +AHTPG + + + ADV VDQYHR
Sbjct  26    LSRKSFPEGFVFGTATSAYQVEGMADKDGRGPCIWDVYAHTPGHIANNATADVTVDQYHR  85

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             Y EDI+LMK++  DAYRFSI+WSRIFP GTG +NQ GVD+YN LID +L  GI PY  LY
Sbjct  86    YKEDIDLMKNLNFDAYRFSISWSRIFPEGTGTVNQKGVDYYNRLIDYMLEQGITPYANLY  145

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             HYD+P AL+ +Y G L+ QV+KD+A YA+ CF  FGDRVK W T NEPR I  LG+D G 
Sbjct  146   HYDMPLALQEKYGGLLDCQVVKDYADYADFCFKTFGDRVKNWYTFNEPRVIAALGFDDGS  205

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
             + P  CS   +  C  GNS TEPY  AH+++L+HAAAV  YR KYQ  Q G I I+++  
Sbjct  206   NPPSRCSKEVN-NCTDGNSGTEPYIAAHNMILSHAAAVQRYREKYQETQKGNIGILLDFV  264

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             WYEP T S AD  A QRA DF++GWFL P+  GEYPR++   VGDRLPKF+  E  +++G
Sbjct  265   WYEPHTRSKADNLAAQRARDFHIGWFLHPLTYGEYPRTMQENVGDRLPKFTPEEVLMVQG  324

Query  1415  SYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVP  1594
             S+DYLGVN YT++Y          +  +    D+G +     G+ PIG RAN+ WLYIVP
Sbjct  325   SFDYLGVNQYTSYYMFDPPWPKSNISSYANDWDAG-YAYDRNGV-PIGPRANSGWLYIVP  382

Query  1595  RGMRNLMNYIKDKYGNPLVFITENGMDDAKTDGLN----DIKRIRYHRDYLKSLLAAIKE  1762
              G+ N + Y+K++YGNP+V ++ENGMDD     +N    D  R+ Y+RDY+  L  A+ +
Sbjct  383   WGLYNALMYVKERYGNPIVMLSENGMDDPSNYTVNHLLHDTTRVNYYRDYISQLKKAV-D  441

Query  1763  DGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             DG NV GYFAWSL+DN+EW +G+SSRFG+ YVD+ D L+R PK SA WFK  L
Sbjct  442   DGANVTGYFAWSLLDNFEWLLGYSSRFGITYVDF-DTLKRTPKMSAYWFKQLL  493



>ref|XP_010465882.1| PREDICTED: beta-glucosidase 44 [Camelina sativa]
Length=513

 Score =   506 bits (1304),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 264/477 (55%), Positives = 334/477 (70%), Gaps = 16/477 (3%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             +SR SFP+GF+FGTA++AYQ EG   +DGRG +IWD F   PG +   + A++ VDQYHR
Sbjct  40    LSRKSFPKGFLFGTATSAYQVEGETHQDGRGPSIWDAFVKIPGTIAKNATAEITVDQYHR  99

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             Y ED++LMK +  DAYRFSI+WSRIFP G+GK+N  GV +YN LID L+  GI PY  LY
Sbjct  100   YKEDVDLMKKLNFDAYRFSISWSRIFPEGSGKVNWKGVAYYNRLIDYLVQKGITPYANLY  159

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             HYDLP ALE +Y G L RQV+ DFA YAE CF  FGDRVK W+T NEPR +  LGYD G+
Sbjct  160   HYDLPLALEKKYKGLLGRQVLNDFADYAEFCFKTFGDRVKNWMTFNEPRVVAALGYDNGI  219

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
              APG CS  F   C  GNSATEPY V HHL+LAHAAAV  YR+ YQAKQ G+I I+++  
Sbjct  220   FAPGRCSKAFG-NCTEGNSATEPYIVTHHLILAHAAAVQRYRKYYQAKQKGRIGILLDFV  278

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             WYEPLT S AD  A QRA DF++GWF+ P++ GEYP+++ + V DRLPKF+A E  ++KG
Sbjct  279   WYEPLTRSKADNYAAQRARDFHIGWFIHPLVYGEYPKTMQNIVKDRLPKFTAKEVKMVKG  338

Query  1415  SYDYLGVNHYTTWYAS----STDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWL  1582
             S DY+G+N YTT+Y S    +T    +G +  D   + G   L      PIG RA++ WL
Sbjct  339   SIDYVGINQYTTYYMSEPHPTTKPKDLG-YQQDWNVEFGFAKLG----KPIGPRAHSTWL  393

Query  1583  YIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAK----TDGLNDIKRIRYHRDYLKSLLA  1750
             Y VP GM   + YIK++YGNP + ++ENGMDD        GL+D  RI+Y+RDYL +L  
Sbjct  394   YNVPWGMYKALMYIKERYGNPTMILSENGMDDPGNVTLAQGLHDTTRIKYYRDYLTNLKK  453

Query  1751  AIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             A  +DG NV GYFAWSL+DN+EW  G++SRFG+ YVDY   L+R PK SA+WF+  L
Sbjct  454   AT-DDGANVVGYFAWSLLDNFEWLSGYTSRFGIVYVDY-KTLKRYPKMSARWFRKLL  508



>ref|XP_008789190.1| PREDICTED: putative beta-glucosidase 41 isoform X2 [Phoenix dactylifera]
Length=411

 Score =   502 bits (1293),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 241/408 (59%), Positives = 304/408 (75%), Gaps = 6/408 (1%)
 Frame = +2

Query  716   MKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLYHYDLPQA  895
             MKDMGMDAYRFSI+WSRIFPNGTG+ N  G+ HYN+LIDALL  G++PYVTLYH+DLPQ+
Sbjct  1     MKDMGMDAYRFSISWSRIFPNGTGEPNPEGISHYNSLIDALLEKGLQPYVTLYHWDLPQS  60

Query  896   LENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGVHAPGHCS  1075
             LE+RY+GWL+RQ+++DF  YA TCF  FGDRVK W+T NEP   ++ GYDLG+ APG CS
Sbjct  61    LEDRYDGWLSRQIVEDFEHYACTCFEAFGDRVKHWITFNEPHGFSIQGYDLGLQAPGRCS  120

Query  1076  IFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESFWYEPLTN  1255
             I  HLLC  G S+TEPY VAH++LL+HAA    Y+R ++AKQGG I I ++S WYEP+++
Sbjct  121   ILSHLLCRKGKSSTEPYIVAHNILLSHAAVFHTYKRLFKAKQGGSIGIALDSKWYEPISD  180

Query  1256  SPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKGSYDYLGV  1435
             +  D DA  RA+DF LGWFL+P++ G YPRS+ + VG RLPK ++  S  L G+ D++G+
Sbjct  181   ADEDHDAAHRAMDFELGWFLDPLIFGHYPRSMQNIVGSRLPKITSEMSKSLAGTLDFVGI  240

Query  1436  NHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVPRGMRNLM  1615
             NHYTT Y  +    I  L + D  TD+G  T  F+    IGE+A + WL+IVP G R LM
Sbjct  241   NHYTTLYVRNDRIRIWNLVMDDASTDAGVITTSFRHGEMIGEKAASHWLHIVPWGFRKLM  300

Query  1616  NYIKDKYGNPLVFITENGMDDAKT------DGLNDIKRIRYHRDYLKSLLAAIKEDGCNV  1777
              Y+K+KYGNPLV ITENGMDD           L D KRI YHRDYL +L A I+EDGC+V
Sbjct  301   RYVKEKYGNPLVIITENGMDDLNNPFATLDKALEDNKRIHYHRDYLSNLSAVIREDGCDV  360

Query  1778  KGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             +GYF WSL+DNWEW  G++ RFGLY+VDY +NL RIPK SAKWF++FL
Sbjct  361   RGYFVWSLLDNWEWNSGYTVRFGLYFVDYRNNLTRIPKASAKWFRHFL  408



>ref|NP_188436.1| beta-glucosidase 44 [Arabidopsis thaliana]
 sp|Q9LV33.1|BGL44_ARATH RecName: Full=Beta-glucosidase 44; Short=AtBGLU44; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB02020.1| beta-glucosidase [Arabidopsis thaliana]
 gb|AAM61427.1| beta-glucosidase, putative [Arabidopsis thaliana]
 dbj|BAH19552.1| AT3G18080 [Arabidopsis thaliana]
 dbj|BAH19607.1| AT3G18080 [Arabidopsis thaliana]
 gb|AEE76044.1| beta-glucosidase 44 [Arabidopsis thaliana]
Length=512

 Score =   506 bits (1303),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 261/477 (55%), Positives = 336/477 (70%), Gaps = 16/477 (3%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             +SR SFP+GFVFGTA++AYQ EG   +DGRG +IWD F   PGK+   + A++ VDQYHR
Sbjct  39    LSRQSFPKGFVFGTATSAYQVEGETHQDGRGPSIWDAFVKIPGKIAKNATAEITVDQYHR  98

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             Y ED++LMK +  DAYRFSI+WSRIFP G+GK+N  GV +YN LID ++  GI PY  LY
Sbjct  99    YKEDVDLMKKLNFDAYRFSISWSRIFPEGSGKVNWKGVAYYNRLIDYMVQKGITPYANLY  158

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             HYDLP ALEN+Y G L RQV+KDFA YAE C+  FGDRVK W+T NEPR +  LGYD G+
Sbjct  159   HYDLPLALENKYKGLLGRQVVKDFADYAEFCYKTFGDRVKNWMTFNEPRVVAALGYDNGI  218

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
              APG CS  F   C  GNSATEPY V HHL+LAHAAAV  YR+ YQAKQ G++ I+++  
Sbjct  219   FAPGRCSKAFG-NCTEGNSATEPYIVTHHLILAHAAAVQRYRKYYQAKQKGRVGILLDFV  277

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             WYEPLT S AD  A QRA DF++GWF+ P++ GEYP+++ + V +RLPKF+  E  ++KG
Sbjct  278   WYEPLTRSKADNLAAQRARDFHIGWFIHPLVYGEYPKTMQNIVKERLPKFTEKEVKMVKG  337

Query  1415  SYDYLGVNHYTTWYAS----STDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWL  1582
             S D++G+N YTT+Y S    +T    +G +  D   + G   L      PIG RA + WL
Sbjct  338   SIDFVGINQYTTYYMSEPHPTTKPKDLG-YQQDWNVEFGFAKLG----KPIGPRAYSSWL  392

Query  1583  YIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAK----TDGLNDIKRIRYHRDYLKSLLA  1750
             Y VP GM   + Y+K++YGNP + ++ENGMDD        GL+D  RI+Y++DYL +L  
Sbjct  393   YNVPWGMYKALMYMKERYGNPTMILSENGMDDPGNVTLAQGLHDTTRIKYYKDYLTNLKK  452

Query  1751  AIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             A ++DG NV GYFAWSL+DN+EW  G++SRFG+ YVDY   L+R PK SA+WFK  L
Sbjct  453   A-RDDGANVVGYFAWSLLDNFEWLSGYTSRFGIVYVDY-KTLKRYPKMSAQWFKQLL  507



>ref|XP_006482389.1| PREDICTED: beta-glucosidase 44-like [Citrus sinensis]
Length=520

 Score =   506 bits (1304),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 262/473 (55%), Positives = 331/473 (70%), Gaps = 9/473 (2%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             +SR SFPEGFVFGTA++AYQ EG   +DGRG  IWD +AHTPG + + + ADV VDQYHR
Sbjct  49    LSRKSFPEGFVFGTATSAYQVEGMADKDGRGPCIWDVYAHTPGHIANNATADVTVDQYHR  108

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             Y EDI+LMK++  DAYRFSI+WSRIFP GTG +NQ GVD+YN LID +L  GI PY  LY
Sbjct  109   YKEDIDLMKNLNFDAYRFSISWSRIFPEGTGTVNQKGVDYYNRLIDYMLEQGITPYANLY  168

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             HYD+P AL+ +Y G L+ QV+KD+A YA+ CF  FGDRVK W T NEPR I  LG+D G 
Sbjct  169   HYDMPLALQEKYGGLLDCQVVKDYADYADFCFKTFGDRVKNWYTFNEPRVIAALGFDDGS  228

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
             + P  CS   +  C  GNS TEPY  AH+++LAHAAAV  YR KYQ  Q GKI I+++  
Sbjct  229   NPPSRCSKEVN-NCTDGNSGTEPYIAAHNMILAHAAAVQRYREKYQETQKGKIGILLDFV  287

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             WYEP T S AD  A QRA DF++GWFL P+  GEYPR++   VGDRLPKF+  E  +++G
Sbjct  288   WYEPHTRSKADNLAAQRARDFHIGWFLHPLTYGEYPRTMQENVGDRLPKFTPEEVLMVQG  347

Query  1415  SYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVP  1594
             S+DYLGVN YT++Y          +  +    D+G +     G+ PIG RAN+ WLYIVP
Sbjct  348   SFDYLGVNQYTSYYMFDPPWPKSNISSYANDWDAG-YAYDRNGV-PIGPRANSGWLYIVP  405

Query  1595  RGMRNLMNYIKDKYGNPLVFITENGMDDAKTDGLN----DIKRIRYHRDYLKSLLAAIKE  1762
              G+ N + Y+K++YGNP+V ++ENGMDD     +N    D  R+ Y+RDY+  L  A  +
Sbjct  406   WGLYNALMYVKERYGNPIVMLSENGMDDPSNYTVNHLLHDTTRVNYYRDYISQLKKA-AD  464

Query  1763  DGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             DG NV GYFAWSL+DN+EW +G+SSRFG+ YVD+ D L+R PK SA WFK  L
Sbjct  465   DGANVTGYFAWSLLDNFEWLLGYSSRFGITYVDF-DTLKRTPKMSAYWFKQLL  516



>ref|XP_002960254.1| hypothetical protein SELMODRAFT_163827 [Selaginella moellendorffii]
 gb|EFJ37793.1| hypothetical protein SELMODRAFT_163827 [Selaginella moellendorffii]
Length=504

 Score =   506 bits (1302),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 258/480 (54%), Positives = 333/480 (69%), Gaps = 14/480 (3%)
 Frame = +2

Query  506   AQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQ  685
              + +SR SFP GFVFGT+SAAYQ+EGAV+E GRG +IWD F+H    ++D SN DV  DQ
Sbjct  22    GEALSRCSFPRGFVFGTSSAAYQYEGAVQEGGRGPSIWDIFSHNSTNISDSSNGDVTEDQ  81

Query  686   YHRYLEDIELMKDMGMDAYRFSIAWSRIFPNG-TGKLNQAGVDHYNNLIDALLANGIEPY  862
             YHRY +D+ LMK+M MDAYRFSI+WSRI+P+G +   N  G+ +YN+LID+LL  GI+PY
Sbjct  82    YHRYKKDVLLMKEMFMDAYRFSISWSRIYPDGQSSPANGEGIAYYNSLIDSLLEQGIQPY  141

Query  863   VTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGY  1042
             VTLYH+DLPQALE+   GWLN Q++K+F  YAETCF  FGDRVK W+T NEP S    GY
Sbjct  142   VTLYHWDLPQALEDSLGGWLNPQIVKEFTKYAETCFDAFGDRVKHWITFNEPHSFVREGY  201

Query  1043  DLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIV  1222
              LGV APG CS      C  GNSATEPY  AH++LL+HA+A  +Y++K+QA+Q GKI I 
Sbjct  202   CLGVSAPGRCS-----GCIGGNSATEPYVAAHNVLLSHASAAQVYKKKFQAQQKGKIGIA  256

Query  1223  VESFWYEPLTNSPADIDAKQRAIDFYLGW--FLEPVMTGEYPRSVISRVGDRLPKFSAAE  1396
             + + WYEP +NS AD  A  RA DF LGW  FL P++ G YP  + S VG RLP+F+  E
Sbjct  257   LNADWYEPFSNSSADKAAAIRATDFQLGWYVFLNPIVYGNYPPVMRSYVGSRLPQFTGNE  316

Query  1397  SALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAV  1576
             + LL  S D+LG+NHYT+ YA  +      +  +D   DS   +L  +  +PIG + ++ 
Sbjct  317   ARLLMSSLDFLGLNHYTSNYARDSPEVPPSMTNYD--LDSRVRSLVSRDGVPIGPKGSST  374

Query  1577  WLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAK----TDGLNDIKRIRYHRDYLKSL  1744
             WLY+VP G R L+ YIK  Y NP++ ITENGMD A     +  L D  RI YH++YL +L
Sbjct  375   WLYVVPWGFRKLLRYIKAHYKNPVIVITENGMDQASGHNLSQSLGDKTRIDYHQEYLANL  434

Query  1745  LAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLA  1924
               AI  D  +V+GYFAWSL+D WEW+ GF+ RFGLY+VDY + L+R PK SA+WF+  L 
Sbjct  435   NLAITRDSVDVRGYFAWSLLDTWEWSHGFTVRFGLYFVDYTNGLKRYPKMSARWFRRLLC  494



>emb|CDY18494.1| BnaA01g27010D [Brassica napus]
Length=524

 Score =   506 bits (1304),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 260/474 (55%), Positives = 332/474 (70%), Gaps = 8/474 (2%)
 Frame = +2

Query  512   NISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYH  691
             +++R SFPEGFVFGTA++AYQ EG   +DGRG +IWD F   PGK+ + + A++ VDQYH
Sbjct  51    DLNRKSFPEGFVFGTATSAYQVEGETYQDGRGPSIWDAFVKIPGKIANNATAELTVDQYH  110

Query  692   RYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTL  871
              Y ED++LM+ +  DAYRFSI+WSRIFP+GTGK+N  GV +YN LID L+  GI PY  L
Sbjct  111   LYKEDVDLMQTLNFDAYRFSISWSRIFPDGTGKINWNGVAYYNRLIDYLVQKGITPYANL  170

Query  872   YHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLG  1051
             YHYDLP ALE +Y G L R V++DFA YAE CF  FGDRVK W+T NEPR +  LGYD G
Sbjct  171   YHYDLPLALEKKYKGLLGRHVVEDFADYAEFCFKTFGDRVKNWMTFNEPRVVAALGYDNG  230

Query  1052  VHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVES  1231
             + AP  CS  F   C  GNSATEPY VAHHL++AHA+AV  YR+ YQ KQ G+I I+++ 
Sbjct  231   IFAPARCSKAFG-NCTEGNSATEPYIVAHHLIVAHASAVQRYRQHYQEKQKGRIGILLDF  289

Query  1232  FWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLK  1411
              W+EPLT+S AD DA QRA DF+LGWF+ P++ GEYP+++ + V +RLP F+  E  ++K
Sbjct  290   VWFEPLTSSEADNDAAQRARDFHLGWFIHPIVYGEYPKTMQNIVKERLPNFTEEEVKMVK  349

Query  1412  GSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIV  1591
             GS D++G+N YTT+Y S+         L      +  F     G  PIG RA++ WLY V
Sbjct  350   GSIDFVGINQYTTYYMSAPHPTAKPKDLGYQQDWNVVFNFAKDG-KPIGPRAHSEWLYNV  408

Query  1592  PRGMRNLMNYIKDKYGNPLVFITENGMDDA----KTDGLNDIKRIRYHRDYLKSLLAAIK  1759
             P GM   M Y+K+ YGNP + ++ENGMDDA    +  G+ND  RI Y+RDYL  L  A+ 
Sbjct  409   PWGMYKAMMYVKEHYGNPTMILSENGMDDAGNITQAQGVNDTSRITYYRDYLTQLKKAV-  467

Query  1760  EDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             EDG NV GYFAWSL+DN+EW  G++SRFG+ YVDY D L+R PK SA WFK  L
Sbjct  468   EDGANVTGYFAWSLLDNFEWLSGYTSRFGIVYVDYKD-LKRYPKMSALWFKRIL  520



>ref|XP_006406654.1| hypothetical protein EUTSA_v10020536mg [Eutrema salsugineum]
 ref|XP_006406658.1| hypothetical protein EUTSA_v10020535mg [Eutrema salsugineum]
 gb|ESQ48107.1| hypothetical protein EUTSA_v10020536mg [Eutrema salsugineum]
 gb|ESQ48111.1| hypothetical protein EUTSA_v10020535mg [Eutrema salsugineum]
Length=512

 Score =   506 bits (1303),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 259/473 (55%), Positives = 332/473 (70%), Gaps = 8/473 (2%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             +SR SFP+GF+FGTA++AYQ EG   +DGRG +IWD F   PG + + + A++ VDQYHR
Sbjct  39    LSRQSFPKGFLFGTATSAYQVEGETHQDGRGPSIWDAFVKIPGTIANNATAEITVDQYHR  98

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             Y ED++LMK++  DAYRFSI+WSRIFP G GK+N  GV +YN LID L+  GI PY  LY
Sbjct  99    YKEDVDLMKNLNFDAYRFSISWSRIFPEGAGKINWKGVAYYNRLIDYLIQRGITPYANLY  158

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             HYDLP ALE +Y G L RQV++DFA YAE CF  FGDRVK W+T NEPR +  LGYD G+
Sbjct  159   HYDLPLALEKKYKGLLGRQVVEDFANYAEFCFKTFGDRVKNWMTFNEPRVVAALGYDNGI  218

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
              APG CS  +   C  GNSATEPY V+HHL+LAHAAAV  YR+ YQAKQ G+I I+++  
Sbjct  219   FAPGRCSKTYG-NCTQGNSATEPYIVSHHLILAHAAAVQRYRKNYQAKQKGRIGILLDFV  277

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             WYEPL  S AD  A QRA DF++GWF+ P++ GEYP+++   V +RLPKF+  E  ++KG
Sbjct  278   WYEPLQKSKADYLAAQRARDFHIGWFIHPLVYGEYPKTMQLIVKERLPKFTEEEVKMVKG  337

Query  1415  SYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVP  1594
             S D++G+N YTT++ S T  + +   L      + TF     G  PIG RAN+ WLY VP
Sbjct  338   SIDFVGINQYTTYFMSDTHNSTIPKDLGYQQDWNVTFGFSKLG-KPIGPRANSYWLYNVP  396

Query  1595  RGMRNLMNYIKDKYGNPLVFITENGMDDAK----TDGLNDIKRIRYHRDYLKSLLAAIKE  1762
              GM   + Y+K+ YGNP + ++ENGMDD        GL+D  RI+Y+RDYL  L  A+ +
Sbjct  397   WGMYKALMYMKEHYGNPTMILSENGMDDPGNFTLAQGLHDTTRIKYYRDYLTQLKKAV-D  455

Query  1763  DGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             DG NVKGYFAWSL+DN+EW  G++SRFG+ YVDY + L+R PK SA WF   L
Sbjct  456   DGANVKGYFAWSLLDNFEWLSGYTSRFGIVYVDY-NTLKRYPKMSALWFNQLL  507



>ref|XP_006430655.1| hypothetical protein CICLE_v10013521mg [Citrus clementina]
 gb|ESR43895.1| hypothetical protein CICLE_v10013521mg [Citrus clementina]
Length=520

 Score =   506 bits (1304),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 260/473 (55%), Positives = 332/473 (70%), Gaps = 9/473 (2%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             +SR SFPEGFVFGTA++AYQ EG   +DGRG  IWD +AHTPG + + + ADV VDQYHR
Sbjct  49    LSRKSFPEGFVFGTATSAYQVEGMADKDGRGPCIWDVYAHTPGHIANNATADVTVDQYHR  108

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             Y EDI+LMK++  DAYRFSI+WSRIFP GTG +NQ GVD+YN LID +L  GI PY  LY
Sbjct  109   YKEDIDLMKNLNFDAYRFSISWSRIFPEGTGTVNQKGVDYYNRLIDYMLEQGITPYANLY  168

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             HYD+P AL+ +Y G L+ QV+KD+A YA+ CF  FGDRVK W T NEPR I  LG+D G 
Sbjct  169   HYDMPLALQEKYGGLLDCQVVKDYADYADFCFKTFGDRVKNWYTFNEPRVIAALGFDDGS  228

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
             + P  CS   +  C  GNS TEPY  AH+++LAHAAAV  +R KYQ  Q GKI I+++  
Sbjct  229   NPPSRCSKEVN-NCTDGNSGTEPYIAAHNMILAHAAAVQRFREKYQETQKGKIGILLDFV  287

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             WYEP T S AD  A QRA DF++GWFL P+  GEYPR++   VGDRLPKF+  E  +++G
Sbjct  288   WYEPHTRSKADNLAAQRARDFHIGWFLHPLTYGEYPRTMQENVGDRLPKFTPEEVLMVQG  347

Query  1415  SYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVP  1594
             S+DYLGVN YT++Y          +  +    D+G +     G+ PIG+RAN+ WLYIVP
Sbjct  348   SFDYLGVNQYTSYYMFDPPWPKSNISSYANDWDAG-YAYDRNGV-PIGQRANSGWLYIVP  405

Query  1595  RGMRNLMNYIKDKYGNPLVFITENGMDDAKTDGLN----DIKRIRYHRDYLKSLLAAIKE  1762
              G+ N + Y+K++YGNP V ++ENGMDD     +N    D  R+ Y+RDY+  L  A+ +
Sbjct  406   WGLYNALMYVKERYGNPTVMLSENGMDDPSNYTVNHLLHDTTRVNYYRDYISQLKKAV-D  464

Query  1763  DGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             DG NV GYFAWSL+DN+EW +G+S+RFG+ YVD+ D L+R PK SA WFK  L
Sbjct  465   DGANVTGYFAWSLLDNFEWLLGYSARFGITYVDF-DTLKRTPKMSAYWFKQLL  516



>gb|ABR17739.1| unknown [Picea sitchensis]
Length=505

 Score =   505 bits (1301),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 262/476 (55%), Positives = 330/476 (69%), Gaps = 15/476 (3%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             +SRASFP+GFVFGTA++AYQ EGA K DGRG +IWDTF   PG + + + ADV+VD+YHR
Sbjct  35    LSRASFPKGFVFGTATSAYQVEGAAKTDGRGPSIWDTFILQPGIIANNATADVSVDEYHR  94

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             Y  D+ELM  M MDAYRFSI+WSRIFP G G++N  GV +YNNLI+ LL  GI PY  LY
Sbjct  95    YKTDVELMVKMNMDAYRFSISWSRIFPKGAGQINYKGVQYYNNLINYLLKRGITPYANLY  154

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             HYDLPQ LE  Y G LN +V+ D+A +AE CF  FGDRVK W+T NEPR +  LGYD G+
Sbjct  155   HYDLPQGLETAYGGLLNSKVVDDYAKFAEFCFKTFGDRVKYWMTFNEPRVVAALGYDNGI  214

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
              APG CS  F   C  GNSATEPY VAH+LLL+HA AV IYR KYQ  Q GKI I+++  
Sbjct  215   FAPGRCSAPFG-NCTAGNSATEPYIVAHNLLLSHATAVKIYREKYQPIQKGKIGILLDFV  273

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             WYEPLTNS  D  A QR+ DF++GWFL P++ G+YP S++  VG RLPKF+  +  ++KG
Sbjct  274   WYEPLTNSSEDQAAAQRSRDFHIGWFLHPIVYGKYPDSMVEIVGKRLPKFTKEQYQMVKG  333

Query  1415  SYDYLGVNHYTTWY---ASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLY  1585
             S DYLGVN YT +Y         N+ G  +   +     F     G+ PIG +AN+ WLY
Sbjct  334   SIDYLGVNQYTAYYMYDPKQPKQNVTGYQMDWNV----GFAYARNGV-PIGPKANSYWLY  388

Query  1586  IVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT----DGLNDIKRIRYHRDYLKSLLAA  1753
             IVP G+   + YIK+ YGNP + ++ENGMDD        GL+D  R+ Y++ YL++L+ A
Sbjct  389   IVPWGLYKAVTYIKEHYGNPTMILSENGMDDPGNVTLPAGLHDTTRVNYYKSYLQNLIGA  448

Query  1754  IKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             +  DG NV GYFAWSL+DN+EW  G++SRFG+ YVD+  NL+R PK SA WF   L
Sbjct  449   M-NDGANVVGYFAWSLLDNFEWKSGYTSRFGVVYVDF-TNLKRYPKMSAYWFSKLL  502



>gb|AEV76986.1| beta-glucosidase 4, partial [Triticum aestivum]
Length=501

 Score =   504 bits (1299),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 256/484 (53%), Positives = 336/484 (69%), Gaps = 16/484 (3%)
 Frame = +2

Query  494   QICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADV  673
             +I     +SR  FP GFVFGTA++AYQ EG  ++ GRG +IWD FA  PG +    +ADV
Sbjct  24    EIRNTGGLSRQGFPAGFVFGTAASAYQVEGMARQGGRGPSIWDAFAAIPGTIAGNGSADV  83

Query  674   AVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGI  853
              VD+YHRY ED+ +MKDMG DAYRFSI+WSRIFP+GTGK+NQ GVD+YN LID +L  GI
Sbjct  84    TVDEYHRYKEDVGIMKDMGFDAYRFSISWSRIFPDGTGKVNQEGVDYYNRLIDYMLQQGI  143

Query  854   EPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITV  1033
              PY  LYHYDLP AL  +Y GWL+ +++  FA YAE CF +FGDRVK W T NEPR +  
Sbjct  144   TPYANLYHYDLPLALHQQYLGWLSPKIVGAFADYAEFCFKVFGDRVKNWFTFNEPRVVAA  203

Query  1034  LGYDLGVHAPGHCSIFFHLLCPT-GNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGK  1210
             LGYD G+HAPG CS      CP  G+S TEPY V H+++L+HAAAV  YR KYQ  Q G+
Sbjct  204   LGYDNGLHAPGRCS-----KCPAGGDSRTEPYIVTHNIILSHAAAVQRYREKYQPHQKGR  258

Query  1211  ITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSA  1390
             I I+++  WYEP +NS AD  A QRA DF++GWFL+P+  G YP S++  VG+RLP FS 
Sbjct  259   IGILLDFVWYEPHSNSNADQGAAQRARDFHIGWFLDPITNGRYPSSMLKIVGNRLPGFST  318

Query  1391  AESALLKGSYDYLGVNHYTTWYASSTDT-NIMGLFLHDTLTDSGTFTLPFKGLMPIGERA  1567
              ES ++KGS DY+G+N YT++Y       N+  +   D       +    +  +PIG RA
Sbjct  319   NESRMVKGSIDYVGINQYTSYYMKDPGAWNLTPVSYQDDWHVGFVYE---RNGVPIGPRA  375

Query  1568  NAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDD----AKTDGLNDIKRIRYHRDYL  1735
             N+ WLYIVP GM   + Y+K++YGNP + ++ENGMD     +  DG++D  RIRY+RDY+
Sbjct  376   NSDWLYIVPWGMNKAVTYVKERYGNPTMILSENGMDQPGNVSIADGVHDTIRIRYYRDYI  435

Query  1736  KSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKN  1915
               L  AI ++G  V GYFAWSL+DN+EW +G+++RFG+ YVD+ + L+R PK+SA WFKN
Sbjct  436   TELKKAI-DNGARVVGYFAWSLLDNFEWRLGYTARFGIAYVDF-NTLKRYPKDSALWFKN  493

Query  1916  FLAS  1927
              L+ 
Sbjct  494   MLSE  497



>gb|KFK39134.1| beta-glucosidase 44 [Arabis alpina]
Length=514

 Score =   505 bits (1300),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 258/473 (55%), Positives = 334/473 (71%), Gaps = 8/473 (2%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             +SR SFP+GF+FGTA++AYQ EG   +DGRG +IWD F   PG +   + A++ VDQYHR
Sbjct  41    LSRQSFPKGFLFGTATSAYQVEGETHQDGRGPSIWDAFVKIPGTIAKNATAELTVDQYHR  100

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             Y ED++LMK++  DAYRFSI+WSRIFP GTGK+N  GV +YN LID L+  GI PY  LY
Sbjct  101   YKEDVDLMKNLNFDAYRFSISWSRIFPEGTGKINWKGVAYYNRLIDYLIQKGITPYANLY  160

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             HYDLP ALE +Y G L R+V++DFA YA+ CF +FGDRVK W+T NEPR ++ LGYD G+
Sbjct  161   HYDLPLALEKKYKGLLGREVVEDFADYAQFCFNLFGDRVKNWMTFNEPRVVSALGYDNGI  220

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
              APG CS  F   C  GNSATEPY V HHL+LAHAAAV  YR+ YQAKQ G+I I+++  
Sbjct  221   FAPGRCSKAFG-NCTQGNSATEPYIVTHHLILAHAAAVQRYRKYYQAKQKGRIGILLDFV  279

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             WYEPLT S AD  A QRA DF++GWF+ P++ GEYP+++   V +RLPKF+  E  ++KG
Sbjct  280   WYEPLTRSKADNLAAQRARDFHIGWFIHPLVYGEYPKTMQYIVKERLPKFTEEEVKMVKG  339

Query  1415  SYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVP  1594
             S D++G+N YTT++ S T    +   L      + TF+    G  PIG RA + WLY VP
Sbjct  340   SIDFVGINQYTTYFMSDTHNPTIPKDLGYQQDWNATFSFAKLG-KPIGPRAYSYWLYNVP  398

Query  1595  RGMRNLMNYIKDKYGNPLVFITENGMDDAK----TDGLNDIKRIRYHRDYLKSLLAAIKE  1762
              GM   + Y+K++YGNP + ++ENGMDD        GL+D  RI+Y++DYL  L  A+ +
Sbjct  399   WGMYKALMYMKERYGNPTMILSENGMDDPGNVTLAQGLHDTTRIKYYKDYLTQLKKAV-D  457

Query  1763  DGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             DG NV GYFAWSL+DN+EW  G++SRFG+ YVDY   L+R PK SA+WFK  L
Sbjct  458   DGANVTGYFAWSLLDNFEWLSGYTSRFGIVYVDY-KTLKRYPKMSAQWFKQLL  509



>ref|XP_006297463.1| hypothetical protein CARUB_v10013483mg [Capsella rubella]
 gb|EOA30361.1| hypothetical protein CARUB_v10013483mg [Capsella rubella]
Length=511

 Score =   505 bits (1300),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 262/477 (55%), Positives = 336/477 (70%), Gaps = 16/477 (3%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             +SR SFPEGF+FGTA++AYQ EG   +DGRG +IWD F   PG +   + A++ VDQYHR
Sbjct  38    LSRQSFPEGFLFGTATSAYQVEGETHQDGRGPSIWDAFVKIPGTIAKNATAEITVDQYHR  97

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             Y ED++LMK +  DAYRFSI+WSRIFP GTGK+N  GV +YN LID L+  GI PY  LY
Sbjct  98    YKEDVDLMKKLNFDAYRFSISWSRIFPEGTGKVNWKGVAYYNRLIDYLVQKGITPYANLY  157

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             HYDLP ALE +Y G L RQV++DFA YAE CF  FGDRVK W+T NEPR +  LGYD G+
Sbjct  158   HYDLPLALEKKYKGLLGRQVVEDFADYAEFCFKTFGDRVKNWMTFNEPRVVAALGYDNGI  217

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
              APG CS  F   C  GNSATEPY V+HHL+LAHAAA   YR+ YQAKQ G+I I+++  
Sbjct  218   FAPGRCSKAFG-NCTEGNSATEPYIVSHHLILAHAAAAQRYRKYYQAKQKGRIGILLDFV  276

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             WYEPLT S AD  A QRA DF++GWF+ P++ GEYP+++ + V +RLPKF+A E  ++KG
Sbjct  277   WYEPLTRSKADNYAAQRARDFHIGWFIHPIVYGEYPKTMQNIVKERLPKFTADEVKMVKG  336

Query  1415  SYDYLGVNHYTTWYAS----STDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWL  1582
             S D++G+N YTT+Y S    +T +  +G +  D   + G   L      PIG RA + WL
Sbjct  337   SIDFVGINQYTTYYMSEPHPTTKSKDLG-YQQDWNVEFGFAKLG----KPIGSRAYSKWL  391

Query  1583  YIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAK----TDGLNDIKRIRYHRDYLKSLLA  1750
             Y VP GM   + Y+K++YGNP + ++ENGMDD        GL+D  RI+Y+RDYL +L  
Sbjct  392   YNVPWGMYKALMYMKERYGNPTMILSENGMDDPGNVTLAQGLHDTTRIKYYRDYLTNLKK  451

Query  1751  AIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             A ++DG NV GYFAWSL+DN+EW  G++SRFG+ YVDY   L+R PK SA+WF+  L
Sbjct  452   A-RDDGANVVGYFAWSLLDNFEWLSGYTSRFGIVYVDY-TTLKRYPKMSAQWFRKLL  506



>ref|XP_002883106.1| beta-glucosidase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59365.1| beta-glucosidase [Arabidopsis lyrata subsp. lyrata]
Length=503

 Score =   504 bits (1298),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 257/474 (54%), Positives = 336/474 (71%), Gaps = 8/474 (2%)
 Frame = +2

Query  512   NISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYH  691
             +++R SFP+GF+FGTA++AYQ EG   +DGRG +IWD F   PGK+ + + A++ VDQYH
Sbjct  29    DLNRQSFPKGFLFGTATSAYQVEGETHQDGRGPSIWDAFVKIPGKIANNATAEITVDQYH  88

Query  692   RYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTL  871
             RY ED++LM+++  DAYRFSI+WSRIFP G+GK+N  GV +YN LID L+  GI PY  L
Sbjct  89    RYKEDVDLMENLNFDAYRFSISWSRIFPEGSGKINWNGVAYYNRLIDYLIQKGITPYANL  148

Query  872   YHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLG  1051
             YHYDLP  LE +Y G L++QV+ DFA YAE CF  FGDRVK W+T NEPR +  LGYD G
Sbjct  149   YHYDLPLVLERKYQGLLSKQVVDDFADYAEFCFKTFGDRVKNWMTFNEPRVVAALGYDNG  208

Query  1052  VHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVES  1231
             + APG CS  F   C  GNSATEPY VAHHL+LAHAAAV  YR+ Y+ KQ G+I I+++ 
Sbjct  209   IFAPGRCSKAFG-NCTDGNSATEPYIVAHHLILAHAAAVQRYRQNYKEKQKGRIGILLDF  267

Query  1232  FWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLK  1411
              W+EPLT+S AD DA QRA DF++GWF+ P++ GEYP ++ + V +RLPKF+  E  ++K
Sbjct  268   VWFEPLTSSKADNDAAQRARDFHVGWFIHPIVYGEYPYTMQNIVKERLPKFAEEEVKMVK  327

Query  1412  GSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIV  1591
             GS D++G+N YTT++ S    + +   L      + TF     G  PIG RA++ WLY V
Sbjct  328   GSIDFVGINQYTTYFMSDPKISTIPKDLGYQQDWNVTFNFAKNG-TPIGPRAHSEWLYNV  386

Query  1592  PRGMRNLMNYIKDKYGNPLVFITENGMDDAK----TDGLNDIKRIRYHRDYLKSLLAAIK  1759
             P GM   + YIK++YGNP + ++ENGMDD      T G ND  RI+Y+RDYL  L  A+ 
Sbjct  387   PWGMYKALMYIKERYGNPTMILSENGMDDPGNITLTQGQNDTTRIKYYRDYLAQLKKAV-  445

Query  1760  EDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             +DG N+ GYFAWSL+DN+EW  G++SRFG+ YVDY D L+R PK SA WFK  L
Sbjct  446   DDGANLTGYFAWSLLDNFEWLSGYTSRFGIVYVDYKD-LKRYPKMSALWFKQLL  498



>gb|AGS43007.1| beta-D-glucoside glucohydrolase [Lotus japonicus]
Length=514

 Score =   504 bits (1298),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 254/481 (53%), Positives = 348/481 (72%), Gaps = 16/481 (3%)
 Frame = +2

Query  512   NISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHT-PGKVTDFSNADVAVDQY  688
             ++ R++FP+GF+FGTASA+YQ+EGA KE GR  +IWDTF+H  P K+TD S  DV++DQY
Sbjct  36    SMRRSNFPKGFIFGTASASYQYEGAAKEGGREPSIWDTFSHKYPEKITDRSTGDVSIDQY  95

Query  689   HRYLEDIELMKDMGMDAYRFSIAWSRIFPNG--TGKLNQAGVDHYNNLIDALLANGIEPY  862
             HRY ED+ELMK + +DAYRFSI+WSRI P G  +G +NQ G+ +YNNLID LLANG++P+
Sbjct  96    HRYKEDVELMKSLNLDAYRFSISWSRILPKGKLSGGINQEGIKYYNNLIDELLANGLQPF  155

Query  863   VTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGY  1042
             VTL+H+DLPQ LE+ Y G+L+ ++++DF  Y E CF  FGDRVK W+T+NEP   +  GY
Sbjct  156   VTLFHWDLPQTLEDEYGGFLSPEIVEDFQDYVELCFKEFGDRVKHWITLNEPWGYSSNGY  215

Query  1043  DLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIV  1222
              LG  APG CS + +  C  G+S  EPY V+HHLLLAHA AV +Y++KYQA Q G I I 
Sbjct  216   VLGAFAPGRCSKWVNPNCTGGDSGIEPYLVSHHLLLAHAKAVQVYKKKYQASQKGIIGIT  275

Query  1223  VESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESA  1402
             + + W+EP +++  D DA  RA+DF  GWF++P+  G YP+S+ S VG RLPKFS  +++
Sbjct  276   LVTHWFEPFSDNKYDHDAAGRAVDFMFGWFMDPLTFGNYPQSMRSLVGSRLPKFSKKQAS  335

Query  1403  LLKGSYDYLGVNHYTTWYA--SSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAV  1576
             L+KGS+D+LG+N+YTT+YA  +S+ +N    F  D+L +  T     +   PIG+RA + 
Sbjct  336   LVKGSFDFLGLNYYTTYYAANASSGSNDRPYFFTDSLANLTT----ERNGNPIGQRAASS  391

Query  1577  WLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDD------AKTDGLNDIKRIRYHRDYLK  1738
             WLY+ P+G++ L+ YIK KY NPL++ITENG+D+      +  + L D  RI YH  +L 
Sbjct  392   WLYVYPKGIQELLLYIKKKYNNPLIYITENGIDEFNDPTLSLEEALIDTYRIDYHYRHLF  451

Query  1739  SLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNF  1918
              L +AI+ DG NVKGYFAWSL+DN+EW  G++ RFG+ +VDY + L+R  K SAKWF NF
Sbjct  452   YLQSAIR-DGANVKGYFAWSLLDNYEWNSGYTVRFGINFVDYKNGLKRYQKLSAKWFTNF  510

Query  1919  L  1921
             L
Sbjct  511   L  511



>ref|XP_002883107.1| glycosyl hydrolase family 1 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59366.1| glycosyl hydrolase family 1 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=513

 Score =   504 bits (1297),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 261/477 (55%), Positives = 334/477 (70%), Gaps = 16/477 (3%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             +SR SFP+GF+FGTA++AYQ EG   +DGRG +IWD F   PG +   + A++ VDQYHR
Sbjct  40    LSRQSFPKGFLFGTATSAYQVEGETHQDGRGPSIWDAFVKIPGTIAKNATAEITVDQYHR  99

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             Y ED++LMK +  DAYRFSI+WSRIFP G+GK+N  GV +YN LID L+  GI PY  LY
Sbjct  100   YKEDVDLMKKLNFDAYRFSISWSRIFPEGSGKVNWKGVAYYNRLIDYLVQKGISPYANLY  159

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             HYDLP ALE +Y G L RQV+ DFA YAE CF  FGDRVK W+T NEPR +  LGYD G+
Sbjct  160   HYDLPLALEKKYKGLLGRQVVNDFADYAEFCFKTFGDRVKNWMTFNEPRVVAALGYDNGI  219

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
              APG CS  F   C  GNSATEPY V+HHL+LAHAAAV  YR+ YQAKQ G+I I+++  
Sbjct  220   FAPGRCSKAFG-NCTEGNSATEPYIVSHHLILAHAAAVQRYRKYYQAKQKGRIGILLDFV  278

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             WYEPLT S AD  A QRA DF++GWF+ P++ GEYP+++ + V +RLPKF+  E  ++KG
Sbjct  279   WYEPLTRSKADNLAAQRARDFHIGWFIHPIVYGEYPKTMQNIVKERLPKFTKEEVKMVKG  338

Query  1415  SYDYLGVNHYTTWYAS----STDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWL  1582
             S D++G+N YTT+Y S    +T    +G +  D   D G   L      PIG RA + WL
Sbjct  339   SIDFVGINQYTTYYMSEPHPTTKPKALG-YQQDWNVDFGFAKLG----KPIGPRAYSYWL  393

Query  1583  YIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAK----TDGLNDIKRIRYHRDYLKSLLA  1750
             Y VP GM   + Y+K++YGNP + ++ENGMDD        GL+D  RI+Y++DYL +L  
Sbjct  394   YNVPWGMYKALMYMKERYGNPTMILSENGMDDPGNVTLAQGLHDTTRIKYYKDYLTNLKK  453

Query  1751  AIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             A ++DG NV GYFAWSL+DN+EW  G++SRFG+ YVDY   L+R PK SA+WFK  L
Sbjct  454   A-RDDGANVVGYFAWSLLDNFEWLSGYTSRFGIVYVDY-KTLKRYPKMSAQWFKQLL  508



>ref|XP_010487721.1| PREDICTED: beta-glucosidase 43 [Camelina sativa]
Length=504

 Score =   503 bits (1296),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 258/474 (54%), Positives = 333/474 (70%), Gaps = 8/474 (2%)
 Frame = +2

Query  512   NISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYH  691
             +++R SFPEGF+FGTA++AYQ EG   +DGRG +IWD F   PGK+ + + A++ VDQYH
Sbjct  30    DLNRESFPEGFLFGTATSAYQVEGETHQDGRGPSIWDAFVKIPGKIANNATAELTVDQYH  89

Query  692   RYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTL  871
             RY ED++LM+++  DAYRFSI+WSRIFP GTGK+N  GV +YN LID L+  GI+PY  L
Sbjct  90    RYKEDVDLMQNLNFDAYRFSISWSRIFPEGTGKINWNGVAYYNRLIDYLILKGIKPYANL  149

Query  872   YHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLG  1051
             YHYDLP ALE +Y G L++QV++DF  YAE CF  FGDRVK W+T NEPR +  LGYD G
Sbjct  150   YHYDLPLALEQKYQGLLSKQVVEDFVDYAEFCFKTFGDRVKNWMTFNEPRVVAALGYDNG  209

Query  1052  VHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVES  1231
             + APG CS  F   C  GNSATEPY VAHHL+LAH+AAV  YR+ YQ KQ G+I I+++ 
Sbjct  210   IFAPGRCSKAFG-NCTDGNSATEPYIVAHHLILAHSAAVQRYRQIYQEKQKGRIGILLDF  268

Query  1232  FWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLK  1411
              W+EPLT+S AD DA QRA DF++GWF+ P++ G+YP ++ + V +RLPKF+  E  ++K
Sbjct  269   VWFEPLTSSEADNDAAQRARDFHVGWFIHPIVYGKYPNTMQNIVKERLPKFTEEEVKMVK  328

Query  1412  GSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIV  1591
             GS D++G+N YTT++ S    +     L      +  F     G  PIG RA++ WLY V
Sbjct  329   GSIDFIGINQYTTYFMSDPKISTPPKALGYQQDWNVAFNFAKNG-TPIGPRAHSEWLYNV  387

Query  1592  PRGMRNLMNYIKDKYGNPLVFITENGMDDAK----TDGLNDIKRIRYHRDYLKSLLAAIK  1759
             P GM   + YIK+ YGNP + ++ENGMDD        GLND  RI Y+RDYL  L  A+ 
Sbjct  388   PWGMYKALMYIKEHYGNPTMILSENGMDDPGNITLAQGLNDTTRINYYRDYLAQLKKAVD  447

Query  1760  EDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             E G NV GYFAWSL+DN+EW  G++SRFG+ YVDY D L+R PK SA WFK  L
Sbjct  448   E-GANVTGYFAWSLLDNFEWLSGYTSRFGIVYVDYKD-LKRYPKMSALWFKQLL  499



>emb|CDX95557.1| BnaC01g34490D [Brassica napus]
Length=514

 Score =   503 bits (1296),  Expect = 9e-168, Method: Compositional matrix adjust.
 Identities = 258/473 (55%), Positives = 332/473 (70%), Gaps = 8/473 (2%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             +SR SFP+ F+FGTA++AYQ EG   +DGRG +IWD F   PG +   + A++ VDQYHR
Sbjct  41    LSRQSFPKDFLFGTATSAYQVEGETHQDGRGPSIWDAFVKIPGTIAKNATAELTVDQYHR  100

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             Y ED++LMK +  DAYRFSI+WSRIFP GTGK+N  GVD+YN LI+ L+  GI PY  LY
Sbjct  101   YKEDVDLMKKLNFDAYRFSISWSRIFPEGTGKINWKGVDYYNRLINYLIQKGITPYANLY  160

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             HYDLP ALE +Y G L+RQV+ DFA YAE CF IFGDRVK W+T NEPR +  LGYD G+
Sbjct  161   HYDLPLALEKKYKGLLDRQVVNDFADYAEFCFNIFGDRVKNWMTFNEPRVVAALGYDNGI  220

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
              APG CS  +   C  GNS TEPY V+HHL+LAHAAA   YR+ YQAKQ G+I I+++  
Sbjct  221   FAPGRCSKSYG-NCTQGNSGTEPYIVSHHLILAHAAAAQRYRKYYQAKQKGRIGILLDFV  279

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             WYEPLT S AD  A QRA DF++GWF+ P++ GEYP+++ + V DRLPKF+  E  ++KG
Sbjct  280   WYEPLTRSKADYLAAQRARDFHIGWFIHPIVYGEYPQTMQNIVKDRLPKFTEEEVKMVKG  339

Query  1415  SYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVP  1594
             S D++G+N YTT++ S T    +   L      + TF     G  PIG RA + WLY VP
Sbjct  340   SIDFVGINQYTTYFMSDTHNATIPKELGYQQDWNATFGFAKLG-KPIGPRAYSYWLYNVP  398

Query  1595  RGMRNLMNYIKDKYGNPLVFITENGMDDAK----TDGLNDIKRIRYHRDYLKSLLAAIKE  1762
              GM   + Y+K++YGNP + ++ENGMDD+       GL+D  RI+Y++DYL  L  A+ +
Sbjct  399   WGMYKALMYMKERYGNPTMILSENGMDDSGNVTLAQGLHDTTRIKYYKDYLTQLKKAV-D  457

Query  1763  DGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             DG NVKGYFAWSL+DN+EW  G++SRFG+ YVDY   L+R PK SA+WF   L
Sbjct  458   DGANVKGYFAWSLLDNFEWLSGYTSRFGIVYVDY-KTLKRYPKMSAQWFMQLL  509



>gb|AIP98403.1| beta-glucosidase [Pinus sylvestris]
Length=513

 Score =   503 bits (1295),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 255/490 (52%), Positives = 344/490 (70%), Gaps = 19/490 (4%)
 Frame = +2

Query  488   GLQICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNA  667
             G Q+  A+ + R SFP  F+FGTAS+AYQ+EGAV+EDG+G + WD   H PG++ D SN 
Sbjct  17    GFQVTTAR-LDRNSFPSDFMFGTASSAYQYEGAVREDGKGPSTWDALTHMPGRIKDSSNG  75

Query  668   DVAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLAN  847
             DVA DQYHRY+EDIELM  +G+DAYRFSI+WSRI P G G++N AG+++YNNLIDALL N
Sbjct  76    DVAADQYHRYMEDIELMASLGLDAYRFSISWSRILPEGRGEINMAGIEYYNNLIDALLQN  135

Query  848   GIEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSI  1027
             GI+P+VTL+H+DLP+ALE+ Y GWL+ Q+I DF AYAE CF  FGDRVK W T+NEP   
Sbjct  136   GIQPFVTLFHFDLPKALEDSYGGWLSPQIINDFEAYAEICFRAFGDRVKYWATVNEPNLF  195

Query  1028  TVLGYDLGVHAPGHCSI-FFHLLCPTGN-SATEPYFVahhlllahaaaVDIYRRKYQAKQ  1201
               LGY +G+  P  C+    + LC TGN S+ EPY  AHH+LLAHAAAV+ YR KYQ  Q
Sbjct  196   VPLGYTVGIFPPTRCAAPNANSLCITGNCSSAEPYLAAHHVLLAHAAAVEKYREKYQKIQ  255

Query  1202  GGKITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPK  1381
             GG I +V+ + WYEPL +SP +  A  R + F L WFL+P++ G+YP+ +  R+G RLP 
Sbjct  256   GGSIGLVMSAPWYEPLEDSPEERSAVDRILSFNLRWFLDPIVFGDYPQEMRERLGSRLPS  315

Query  1382  FSAAESALLKGSYDYLGVNHYTTWYASSTDT----NIMGLFLHDTLTDSGTFTLPFKGLM  1549
              S+  SA L+GS+DY+G+NHYTT YA++T      N   L+      DS  +    +  +
Sbjct  316   ISSELSAKLRGSFDYMGINHYTTLYATTTPPLSPDNTQYLY-----PDSRVYLTGERHGV  370

Query  1550  PIGERANAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAK------TDGLNDIKR  1711
              IGER     L++VP G++ ++ Y+K+ Y NP++ ITENG  D++       + LND++R
Sbjct  371   SIGERTGMDGLFVVPHGIQKIVEYVKEFYDNPIIIITENGYPDSEESSSTLQENLNDVRR  430

Query  1712  IRYHRDYLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPK  1891
             IR+H D L  L AAIK +G +V+GYF WSL+DN+EW  G++ RFGLY+VD+  + +R PK
Sbjct  431   IRFHGDCLSYLSAAIK-NGSDVRGYFVWSLLDNFEWAFGYTIRFGLYHVDFISDQKRYPK  489

Query  1892  ESAKWFKNFL  1921
              SA+WF+ FL
Sbjct  490   LSARWFRQFL  499



>ref|XP_006353826.1| PREDICTED: beta-glucosidase 44-like [Solanum tuberosum]
Length=502

 Score =   502 bits (1293),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 260/473 (55%), Positives = 330/473 (70%), Gaps = 10/473 (2%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             ++R SFP+ FVFGT+++AYQ EGA  +DGRG ++WDTF   PG+  + ++ +V+ DQYH 
Sbjct  33    LNRESFPKSFVFGTSTSAYQVEGAASKDGRGPSVWDTFIKLPGREPNNASGEVSADQYHH  92

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             Y EDI+LM  +  DAYRFSI+WSRIFPNGTGK+N  GV +YN LI+ +L  GI PYV L 
Sbjct  93    YKEDIDLMVKLNFDAYRFSISWSRIFPNGTGKINWKGVTYYNKLINYMLKKGIAPYVNLN  152

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             HYDLPQAL+NRY GWL+R+V+KDFA YAE CF  +GDRVK W + NEPR +  LGYD G 
Sbjct  153   HYDLPQALQNRYKGWLSREVVKDFADYAEFCFKTYGDRVKNWFSFNEPRVVADLGYDTGF  212

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
              APG CS  F   C  G+SATEPY VAH+L+L+HAAA   YR  YQ KQ GK  I+++  
Sbjct  213   FAPGRCSKAFG-NCTAGDSATEPYIVAHNLILSHAAAAHRYRENYQEKQKGKFGIILDFV  271

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             WYEPLT S AD  A QRA DF LGWFL P++ GEYP+++ + V DRLPKF+  E  ++KG
Sbjct  272   WYEPLTRSKADNYAAQRARDFELGWFLHPLVYGEYPKTMQNIVRDRLPKFTTDEIKMVKG  331

Query  1415  SYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVP  1594
             S DY+G+NHYTT+YA    + +  L       D        +  +PIG RA++ WLYIVP
Sbjct  332   SIDYVGINHYTTFYAYDHLSKLKALAYQQ---DQNCGFANDRNGVPIGPRAHSYWLYIVP  388

Query  1595  RGMRNLMNYIKDKYGNPLVFITENGMDDAK----TDGLNDIKRIRYHRDYLKSLLAAIKE  1762
              G+   +NY+K+ YGNP + ++ENGMD A     +D L+D KRI Y+R YL  L  AI E
Sbjct  389   WGLYKAVNYVKEHYGNPTILLSENGMDYAGNISLSDALHDTKRIDYYRSYLAKLKKAIDE  448

Query  1763  DGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
              G NV GYFAWSL+DN+EW  G++SRFG+ YVDY   L+R PK SA WFK  L
Sbjct  449   -GANVIGYFAWSLLDNFEWRSGYTSRFGIVYVDY-TTLKRYPKMSAYWFKQLL  499



>sp|Q9ZT64.1|CBG_PINCO RecName: Full=Coniferin beta-glucosidase; Flags: Precursor [Pinus 
contorta]
 gb|AAC69619.1| beta-glucosidase [Pinus contorta]
Length=513

 Score =   503 bits (1294),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 252/486 (52%), Positives = 341/486 (70%), Gaps = 11/486 (2%)
 Frame = +2

Query  488   GLQICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNA  667
             G Q+  A+ + R +FP  F+FGTAS+AYQ+EGAV+EDG+G + WD   H PG++ D SN 
Sbjct  17    GFQVTTAR-LDRNNFPSDFMFGTASSAYQYEGAVREDGKGPSTWDALTHMPGRIKDSSNG  75

Query  668   DVAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLAN  847
             DVAVDQYHRY+EDIELM  +G+DAYRFSI+WSRI P G G++N AG+++YNNLIDALL N
Sbjct  76    DVAVDQYHRYMEDIELMASLGLDAYRFSISWSRILPEGRGEINMAGIEYYNNLIDALLQN  135

Query  848   GIEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSI  1027
             GI+P+VTL+H+DLP+ALE+ Y GWL+ Q+I DF AYAE CF  FGDRVK W T+NEP   
Sbjct  136   GIQPFVTLFHFDLPKALEDSYGGWLSPQIINDFEAYAEICFRAFGDRVKYWATVNEPNLF  195

Query  1028  TVLGYDLGVHAPGHCSI-FFHLLCPTGN-SATEPYFVahhlllahaaaVDIYRRKYQAKQ  1201
               LGY +G+  P  C+    + LC TGN S+ EPY  AHH+LLAHA+AV+ YR KYQ  Q
Sbjct  196   VPLGYTVGIFPPTRCAAPHANPLCMTGNCSSAEPYLAAHHVLLAHASAVEKYREKYQKIQ  255

Query  1202  GGKITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPK  1381
             GG I +V+ + WYEPL NSP +  A  R + F L WFL+P++ G+YP+ +  R+G RLP 
Sbjct  256   GGSIGLVISAPWYEPLENSPEERSAVDRILSFNLRWFLDPIVFGDYPQEMRERLGSRLPS  315

Query  1382  FSAAESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGE  1561
              S+  SA L+GS+DY+G+NHYTT YA+ST   +          DS  +    +  + IGE
Sbjct  316   ISSELSAKLRGSFDYMGINHYTTLYATSTPP-LSPDHTQYLYPDSRVYLTGERHGVSIGE  374

Query  1562  RANAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAK------TDGLNDIKRIRYH  1723
             R     L++VP G++ ++ Y+K+ Y NP + I ENG  +++       + LND++RIR+H
Sbjct  375   RTGMDGLFVVPHGIQKIVEYVKEFYDNPTIIIAENGYPESEESSSTLQENLNDVRRIRFH  434

Query  1724  RDYLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAK  1903
              D L  L AAIK +G +V+GYF WSL+DN+EW  G++ RFGLY+VD+  + +R PK SA+
Sbjct  435   GDCLSYLSAAIK-NGSDVRGYFVWSLLDNFEWAFGYTIRFGLYHVDFISDQKRYPKLSAQ  493

Query  1904  WFKNFL  1921
             WF+ FL
Sbjct  494   WFRQFL  499



>ref|XP_010506359.1| PREDICTED: beta-glucosidase 44-like [Camelina sativa]
Length=513

 Score =   502 bits (1292),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 259/473 (55%), Positives = 330/473 (70%), Gaps = 8/473 (2%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             +SR SFP+GF+FGTA++AYQ EG   +DGRG +IWD F   PG +   + A++ VDQYHR
Sbjct  40    LSRQSFPKGFLFGTATSAYQVEGETHQDGRGPSIWDAFVKIPGTIAKNATAEITVDQYHR  99

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             Y ED++LMK +  DAYRFSI+WSRIFP G+GK+N  GV +YN LID L+  GI PY  LY
Sbjct  100   YKEDVDLMKKLNFDAYRFSISWSRIFPEGSGKVNWKGVAYYNRLIDYLVQKGITPYANLY  159

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             HYDLP ALE +Y G L RQV+ DFA YAE CF  FGDRVK W+T NEPR +  LGYD G+
Sbjct  160   HYDLPLALEKKYKGLLGRQVVNDFADYAEFCFKTFGDRVKNWMTFNEPRVVAALGYDNGI  219

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
              APG CS  F   C  GNSATEPY V+HHL+LAHAAAV  YR+ YQAKQ G+I I+++  
Sbjct  220   FAPGRCSKAFG-NCTEGNSATEPYIVSHHLILAHAAAVQRYRKYYQAKQKGRIGILLDFV  278

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             WYEPLT S AD  A QRA DF++GWF+ P++ GEYP+++ + V +RLPKF+A E  ++KG
Sbjct  279   WYEPLTRSKADNYAAQRARDFHIGWFIHPIVYGEYPKTMQNIVKERLPKFTAEEVKMVKG  338

Query  1415  SYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVP  1594
             S DY+G+N YTT+Y S          L      +  F     G + IG RA++ WLY VP
Sbjct  339   SIDYVGINQYTTYYMSEPHPTTKPKDLGYQQDWNVQFGFAKLGKL-IGPRAHSTWLYNVP  397

Query  1595  RGMRNLMNYIKDKYGNPLVFITENGMDDAK----TDGLNDIKRIRYHRDYLKSLLAAIKE  1762
              GM   + Y+K++YGNP + ++ENGMDD        GL+D  RI+Y+RDYL +L  A  +
Sbjct  398   WGMYKALMYMKERYGNPTMILSENGMDDPGNVTLAQGLHDTTRIKYYRDYLTNLKKAT-D  456

Query  1763  DGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             DG NV GYFAWSL+DN+EW  G++SRFG+ YVDY   L+R PK SA+WF+  L
Sbjct  457   DGANVVGYFAWSLLDNFEWLSGYTSRFGIVYVDY-KTLKRYPKMSAQWFRKLL  508



>ref|XP_002986009.1| hypothetical protein SELMODRAFT_271823 [Selaginella moellendorffii]
 gb|EFJ12828.1| hypothetical protein SELMODRAFT_271823 [Selaginella moellendorffii]
Length=505

 Score =   501 bits (1291),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 266/479 (56%), Positives = 342/479 (71%), Gaps = 20/479 (4%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             I+R SFP+GFVFGTASAAYQ+EGAVKEDGR  +IWDTF+HTPGK T   N D+A DQYHR
Sbjct  32    INRCSFPKGFVFGTASAAYQYEGAVKEDGRKPSIWDTFSHTPGKTTGGKNGDIAEDQYHR  91

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNG-TGKLNQAGVDHYNNLIDALLANGIEPYVTL  871
             Y EDI LMK+M MDAYRFSI+WSRI+P+G T  LN AGV HYN LI++LL  GI+PY+TL
Sbjct  92    YREDIGLMKNMNMDAYRFSISWSRIYPDGDTKNLNAAGVAHYNMLINSLLHEGIQPYITL  151

Query  872   YHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLG  1051
             YH+DLPQ LE+   GWL+ Q++  +AAYAE CF  FGDRVK W+T NEP S    GY  G
Sbjct  152   YHWDLPQTLEDSVGGWLSPQIVSKYAAYAEACFAAFGDRVKHWITFNEPLSFITSGYASG  211

Query  1052  VHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVES  1231
                P  C+      C  GNSATEPY  AH++LL+HAAAVDIYR+KYQ KQGGKI I + S
Sbjct  212   SGPPSRCTS-----CSKGNSATEPYIAAHNVLLSHAAAVDIYRKKYQPKQGGKIGITLNS  266

Query  1232  FWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLK  1411
              WYEP TNS AD +A QR +DF LGWFLEP+++G+YPRS+ +  G RLP F+  ++A +K
Sbjct  267   NWYEPSTNSAADKEAAQRGLDFDLGWFLEPIVSGDYPRSMRTSAGTRLPVFTPEQAAAIK  326

Query  1412  GSYDYLGVNHYTTWYASSTDT---NIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWL  1582
             GS D+LG+NHYT+ YA +      N +  +  D+   S   +    G+  IG +A + WL
Sbjct  327   GSMDFLGLNHYTSNYAKAGQVVPRNQVTYYFQDSRVAS---SFENNGVA-IGPKAASDWL  382

Query  1583  YIVPRGMRNLMNYIKDKYGNPLVFITENGMDD------AKTDGLNDIKRIRYHRDYLKSL  1744
             YIVP G + L+ Y+  +Y NP++ ITENG+D+      +    L D  R++Y+ DY+ +L
Sbjct  383   YIVPWGFQKLVTYVAQRYNNPVIIITENGVDEFNDPSRSLKQSLRDTTRVKYYSDYISNL  442

Query  1745  LAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             L AI+    +V+GYFAWSL+DN+EW  G+S RFGL++VD+++NL+R PK SA WFK FL
Sbjct  443   LQAIRSK-ADVRGYFAWSLLDNFEWNDGYSVRFGLHFVDFNNNLKRYPKHSALWFKRFL  500



>ref|XP_006832849.1| hypothetical protein AMTR_s00095p00053110 [Amborella trichopoda]
 gb|ERM98127.1| hypothetical protein AMTR_s00095p00053110 [Amborella trichopoda]
Length=509

 Score =   501 bits (1290),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 262/476 (55%), Positives = 331/476 (70%), Gaps = 11/476 (2%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             +SR  FP GFVFGTA++AYQ EGA  +DGRG +IWD F   PG V D S  +V+VD+YHR
Sbjct  37    LSREGFPPGFVFGTATSAYQVEGAADKDGRGPSIWDVFIRKPGVVADNSTGEVSVDEYHR  96

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             Y ED+++M DM MDAYRFSI+WSRIFP G G++NQ GVD+YN LID LL  G+ PY  LY
Sbjct  97    YKEDVDIMADMNMDAYRFSISWSRIFPEGVGRVNQKGVDYYNRLIDYLLERGVTPYANLY  156

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             HYDLP+ALE  YNG LNR+V+ DFA YAE CF  FGDRVK W+T NEPR +  LGYD G+
Sbjct  157   HYDLPEALEESYNGLLNRRVVDDFADYAEFCFKTFGDRVKNWMTFNEPRVVAALGYDNGI  216

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
              APG CS  F   C  GNS TEPY VAH+L+L+HA+AV  YR KYQA Q G+I I+++  
Sbjct  217   FAPGRCSAPFG-NCTAGNSTTEPYIVAHNLILSHASAVKRYREKYQATQKGRIGILLDFV  275

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             WYEPLT + AD+ A QR+ DF++GWFL P++ G YPRS++  VGDRLPKF+  E  ++KG
Sbjct  276   WYEPLTAAKADVRAAQRSRDFHVGWFLHPIVYGTYPRSMVRIVGDRLPKFTNEEVEMVKG  335

Query  1415  SYDYLGVNHYTTWYASSTDTNI-MGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIV  1591
             S D++G+NHYTT+Y    D +I  G  +   +     F     G  PIG RA +  LY+V
Sbjct  336   SIDFVGINHYTTYYM--YDQHIRKGTVMDYQMEWHAGFAFARDG-KPIGPRAYSPGLYMV  392

Query  1592  PRGMRNLMNYIKDKYGNPLVFITENGMDDAKTDGL----NDIKRIRYHRDYLKSLLAAIK  1759
             P G+   +  IK+ Y NP + ++ENGMD      L    +D KRI Y+R YL +L  AI 
Sbjct  393   PWGIYKAVTCIKENYKNPTIILSENGMDYPGNVTLLASVHDTKRIDYYRSYLINLKKAI-  451

Query  1760  EDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
             +DG NV GYFAWSL+DN+EW  G++SRFGL YV+Y   L+R PK SA WF++ L S
Sbjct  452   DDGANVVGYFAWSLLDNFEWLSGYTSRFGLVYVNY-QTLKRYPKMSASWFRHLLQS  506



>ref|NP_001043156.1| Os01g0508000 [Oryza sativa Japonica Group]
 sp|Q5QMT0.1|BGL01_ORYSJ RecName: Full=Beta-glucosidase 1; Short=Os1bglu1; Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAD73293.1| putative beta-glucosidase [Oryza sativa Japonica Group]
 dbj|BAF05070.1| Os01g0508000 [Oryza sativa Japonica Group]
Length=516

 Score =   501 bits (1290),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 258/475 (54%), Positives = 333/475 (70%), Gaps = 13/475 (3%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             +SR SFP GFVFGTA++AYQ EG   +DGRG +IWD F  TPG++ + + ADV VD+YHR
Sbjct  49    LSRRSFPAGFVFGTAASAYQVEGMALKDGRGPSIWDAFVKTPGEIANNATADVTVDEYHR  108

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             Y ED+ +MK MG DAYRFSI+WSRIFP GTGK+N  GV +YN LI+ +L  GI PY  LY
Sbjct  109   YKEDVNIMKSMGFDAYRFSISWSRIFPTGTGKVNWKGVAYYNRLINYMLKIGITPYANLY  168

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             HYDLP+ALE +Y G LNR++++ FA YAE CF  FGDRVK W+T NEPR +  LGYD G 
Sbjct  169   HYDLPEALEVQYGGLLNRKIVEAFADYAEFCFKTFGDRVKNWMTFNEPRVVAALGYDDGN  228

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
              APG C+      C  GNSATEPY VAHHL+L+HA+AV  YR KYQ  Q GKI I+++  
Sbjct  229   FAPGRCT-----KCTAGNSATEPYIVAHHLILSHASAVQRYRHKYQHIQKGKIGILLDFV  283

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             WYE LTNS AD  A QR+ DF++GWFL P++ GEYP+S+   V +RLPKF+A E  ++KG
Sbjct  284   WYEGLTNSTADQAAAQRSRDFHVGWFLHPIIYGEYPKSLQVIVKERLPKFTADEVHMVKG  343

Query  1415  SYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVP  1594
             S DY+G+N YT +Y      N   L  +   +D     +  +  +PIG RAN+ WLYIVP
Sbjct  344   SIDYVGINQYTAYYVRDQQPNATTLPSYS--SDWHAAPIYERDGVPIGPRANSDWLYIVP  401

Query  1595  RGMRNLMNYIKDKYGNPLVFITENGMDDAK----TDGLNDIKRIRYHRDYLKSLLAAIKE  1762
              G+   + Y+K+KYGNP +F++ENGMDD        G++D  R+ Y+R Y+  L  AI +
Sbjct  402   WGLYKAVTYVKEKYGNPTMFLSENGMDDPGNVTIAQGVHDTTRVAYYRSYITKLKEAI-D  460

Query  1763  DGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
             DG N  GYFAWSL+DN+EW +G++SRFGL YVD+   LRR PK SA WF++ ++S
Sbjct  461   DGANCIGYFAWSLLDNFEWKLGYTSRFGLVYVDF-RTLRRYPKMSAYWFRDLVSS  514



>ref|XP_004252272.1| PREDICTED: beta-glucosidase 44-like isoform X1 [Solanum lycopersicum]
Length=526

 Score =   501 bits (1291),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 259/475 (55%), Positives = 331/475 (70%), Gaps = 10/475 (2%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             ++R SFP+GFVFGT+++AYQ EGA  +DGRG ++WDTF   PG+  + ++ +V+ DQYH 
Sbjct  55    LNRESFPKGFVFGTSTSAYQVEGAASKDGRGPSVWDTFIKQPGREPNNASGEVSADQYHH  114

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             Y EDI+LM  +  DAYRFSI+WSRIFPNGT K+N  GV +YN LI+ +L  GI PYV L 
Sbjct  115   YKEDIDLMVKLNFDAYRFSISWSRIFPNGTEKINWKGVTYYNKLINYMLFRGITPYVNLN  174

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             HYDLPQAL+NRY GWL+R+V+KDFA YAE CF  +GDRVK W + NEPR +  LGYD G 
Sbjct  175   HYDLPQALQNRYKGWLSREVVKDFADYAEFCFKTYGDRVKNWFSFNEPRVVADLGYDTGF  234

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
              APG CS  F   C  G+SATEPY VAH+L+L+HAAA   YR+ YQ KQ GK  I+++  
Sbjct  235   FAPGRCSKAFG-NCTAGDSATEPYIVAHNLILSHAAAAHRYRKNYQEKQKGKFGIILDFV  293

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             WYEPLT S AD  A QRA DF LGWFL P++ GEYP+++ + VG+RLPKF+  E  ++KG
Sbjct  294   WYEPLTRSKADNYAAQRARDFELGWFLHPLVHGEYPKTMQNIVGNRLPKFTTEEIKMVKG  353

Query  1415  SYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVP  1594
             S DY+G+NHYTT+YA    + +  L       D        +  +PIG RA++ WLYIVP
Sbjct  354   SIDYVGINHYTTFYAYDHVSKLKALAYQQ---DQNCGFANDRNGVPIGPRAHSYWLYIVP  410

Query  1595  RGMRNLMNYIKDKYGNPLVFITENGMDDAK----TDGLNDIKRIRYHRDYLKSLLAAIKE  1762
              G+   +NY+K+ YGNP + ++ENGMD A     ++ L+D KRI Y+R YL  L  AI E
Sbjct  411   WGLYKAVNYVKEHYGNPTILLSENGMDYAGNISISEALHDTKRIDYYRSYLAELKKAIDE  470

Query  1763  DGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
              G NV GYFAWSL+DN+EW  G++SRFG+ YVDY   L R PK SA WF   L S
Sbjct  471   -GANVIGYFAWSLLDNFEWRSGYTSRFGIVYVDY-TTLERYPKMSAYWFNQLLKS  523



>ref|XP_009113523.1| PREDICTED: beta-glucosidase 44 [Brassica rapa]
 emb|CDY18495.1| BnaA01g27000D [Brassica napus]
Length=514

 Score =   501 bits (1289),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 259/473 (55%), Positives = 328/473 (69%), Gaps = 8/473 (2%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             +SR SFP+ F+FGTA++AYQ EG   +DGRG +IWD F   PG +   + A++ VDQYHR
Sbjct  41    LSRQSFPKDFLFGTATSAYQVEGETHQDGRGPSIWDAFVKIPGTIAKNATAELTVDQYHR  100

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             Y ED++LMK +  DAYRFSI+WSRIFP GTGK+N  GVD+YN LID L+  GI PY  LY
Sbjct  101   YKEDVDLMKKLNFDAYRFSISWSRIFPEGTGKINWKGVDYYNRLIDYLIQKGITPYANLY  160

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             HYDLP ALE +Y G L RQV+ DFA YAE CF IFGDRVK W+T NEPR +  LGYD G+
Sbjct  161   HYDLPLALEKKYKGLLGRQVVNDFADYAEFCFNIFGDRVKNWMTFNEPRVVAALGYDNGI  220

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
              APG CS  +   C  GNS TEPY V+HHL+LAHAAA   YR+ YQAKQ G+I I+++  
Sbjct  221   FAPGRCSKSYG-NCTQGNSGTEPYIVSHHLILAHAAAAQRYRKYYQAKQKGRIGILLDFV  279

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             WYEPLT S AD  A QRA DF++GWF+ P++ GEYP+++   V DRLPKF+  E  ++KG
Sbjct  280   WYEPLTRSKADYLAAQRARDFHIGWFIHPIVYGEYPQTMQYIVKDRLPKFTEEEVKMVKG  339

Query  1415  SYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVP  1594
             S D++G+N YTT++ S T    +   L      + TF     G  PIG RA + WLY VP
Sbjct  340   SIDFVGINQYTTYFMSDTHNATIPKELGYQQDWNATFGYAKLG-KPIGPRAYSYWLYNVP  398

Query  1595  RGMRNLMNYIKDKYGNPLVFITENGMDDAK----TDGLNDIKRIRYHRDYLKSLLAAIKE  1762
              GM   + Y+K+ YGNP + ++ENGMDD        GL+D  RI+Y++DYL  L  A+ +
Sbjct  399   WGMYKALMYMKEHYGNPTMILSENGMDDPGNVTLAQGLHDTTRIKYYKDYLTQLKKAV-D  457

Query  1763  DGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             DG NVKGYFAWSL+DN+EW  G++SRFG+ YVDY   L+R PK SA+WF   L
Sbjct  458   DGANVKGYFAWSLLDNFEWLSGYTSRFGIVYVDY-KTLKRYPKMSAQWFMQLL  509



>ref|NP_001234620.1| beta-mannosidase enzyme precursor [Solanum lycopersicum]
 gb|AAL37714.1|AF403444_1 beta-mannosidase enzyme [Solanum lycopersicum]
 gb|AAL37719.1|AF413204_1 beta-mannosidase [Solanum lycopersicum]
Length=514

 Score =   501 bits (1289),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 260/479 (54%), Positives = 330/479 (69%), Gaps = 9/479 (2%)
 Frame = +2

Query  497   ICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVA  676
             I     +SR SFP+GF FGTA++AYQ EG+   +GRG +IWDTF   PG   + +N ++A
Sbjct  36    ILDTGGLSRESFPKGFTFGTATSAYQVEGSASTEGRGPSIWDTFLKIPGLEPNNANGEIA  95

Query  677   VDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIE  856
             VDQYHRY EDI+LM  +  +AYRFSI+WSRIFPNGTGK+N  GV +YN LID +L  GI 
Sbjct  96    VDQYHRYKEDIDLMAKLNFEAYRFSISWSRIFPNGTGKVNWKGVAYYNRLIDYMLKRGIT  155

Query  857   PYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVL  1036
             PY  L HYDLPQAL++RYNGWL R+V+KDFA YAE CF  FGDRVK W + NEPR +  L
Sbjct  156   PYANLNHYDLPQALQDRYNGWLGREVVKDFADYAEFCFKTFGDRVKNWFSFNEPRVVAAL  215

Query  1037  GYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKIT  1216
             GYD G  APG CS  F   C  G+SATEPY VAH+L+L HA+A   YR KYQ KQ GK  
Sbjct  216   GYDNGFFAPGRCSKPFG-NCTEGDSATEPYIVAHNLILCHASAAQRYREKYQEKQKGKFG  274

Query  1217  IVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAE  1396
             I+++  WYEPLT   AD  A QRA DF+LGWFL P++ GEYP+++ + VG RLPKFS  E
Sbjct  275   ILLDFVWYEPLTKGKADNYAAQRARDFHLGWFLHPLVYGEYPKTMQNIVGTRLPKFSKEE  334

Query  1397  SALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAV  1576
               ++KGS+DY+G+N YT++Y             +    + G F    KG+ PIG RA++ 
Sbjct  335   VKMVKGSFDYVGINQYTSYYMYDPHYTTPQPLGYQQDWNVG-FAYDRKGV-PIGPRAHSY  392

Query  1577  WLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT----DGLNDIKRIRYHRDYLKSL  1744
             WLYIVP G+   +NY+K+ YGNP + + ENGMD A        L+D KRI Y++ YL+ L
Sbjct  393   WLYIVPWGLYKAINYVKEHYGNPTIILAENGMDYAGNITLPKALHDTKRINYYKSYLQQL  452

Query  1745  LAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
                + +DG NV GYFAWSL+DN+EW +G++SRFG+ YVD+ + LRR PK SA WFK  L
Sbjct  453   KKTV-DDGANVIGYFAWSLLDNFEWRLGYTSRFGIVYVDF-NTLRRYPKMSAYWFKKLL  509



>gb|KFK39133.1| beta-glucosidase 44 [Arabis alpina]
Length=497

 Score =   500 bits (1287),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 256/473 (54%), Positives = 329/473 (70%), Gaps = 8/473 (2%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             +SR SFPEGF+FGTA++AYQ EG   +DGRG +IWD F   PGK+ + + A++ VDQYHR
Sbjct  24    LSRKSFPEGFLFGTATSAYQVEGETYQDGRGPSIWDAFVKIPGKIANNATAEITVDQYHR  83

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             Y ED++LM+++  DAYRFSI+WSRIFP GTGK+N  GV +YN LID L+  GI PY  LY
Sbjct  84    YKEDVDLMQNLNFDAYRFSISWSRIFPEGTGKINLKGVAYYNRLIDYLIQKGITPYANLY  143

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             HYDLP ALE +Y G L++QV+ DFA YAE CF  FGDRVK W+T NEPR +  LGYD G+
Sbjct  144   HYDLPLALEQKYQGLLSKQVVVDFADYAEFCFKTFGDRVKNWMTFNEPRVVAALGYDNGI  203

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
              AP  CS  F   C  GNSA EPY VAHHL+LAHA AV  YR+ YQ KQ G+I I+++  
Sbjct  204   FAPARCSKAFG-NCTEGNSAIEPYIVAHHLILAHATAVQRYRQNYQEKQKGRIGILLDFV  262

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             W+EPLT+S AD DA QRA DF++GWF+ PV+ GEYP+++ + V +RLP+F+  E  ++KG
Sbjct  263   WFEPLTSSEADNDAAQRARDFHVGWFIHPVVYGEYPKTMQNIVKERLPRFTEEEVKMVKG  322

Query  1415  SYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVP  1594
             S D++G+N YTT++ S    +     L      +  F     G  PIG RA++ WLY VP
Sbjct  323   SIDFVGINQYTTYFMSDPHLSTPPKDLGYQQDWNVAFNFAKNG-TPIGSRAHSEWLYNVP  381

Query  1595  RGMRNLMNYIKDKYGNPLVFITENGMDDAK----TDGLNDIKRIRYHRDYLKSLLAAIKE  1762
              GM   + YIK+ YGNP + ++ENGMDD        GLND  R  Y+RDYL  L  A+ +
Sbjct  382   WGMYKALMYIKEHYGNPTMILSENGMDDPGNITLAQGLNDTTRTNYYRDYLLQLKKAV-D  440

Query  1763  DGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             DG N+ GYFAWSL+DN+EW  G++SRFG+ YVDY  +L+R PK SA WFK  L
Sbjct  441   DGANLTGYFAWSLLDNFEWLSGYTSRFGIVYVDY-QSLKRYPKMSALWFKQLL  492



>ref|XP_006482391.1| PREDICTED: beta-glucosidase 44-like [Citrus sinensis]
Length=520

 Score =   501 bits (1289),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 257/473 (54%), Positives = 328/473 (69%), Gaps = 9/473 (2%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             ++R SFP+GFVFGTA++AYQ EG   +DGRG  IWD + HTPG + + + ADV VDQYHR
Sbjct  49    LTRKSFPDGFVFGTATSAYQVEGMANKDGRGPCIWDVYVHTPGNIANNATADVTVDQYHR  108

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             Y EDI+LMK +  DAYRFSI+WSRIFP G G++N  GV +YN LID +L  GI PY  LY
Sbjct  109   YKEDIDLMKKLNFDAYRFSISWSRIFPQGAGRVNWKGVAYYNRLIDYMLEQGITPYANLY  168

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             HYD+P AL  RY G L RQV+KD+A +AE CF  FGDRVK W T NEPR I  LG+D G+
Sbjct  169   HYDMPLALHERYGGLLGRQVVKDYADFAEFCFKTFGDRVKNWYTFNEPRVIAALGFDSGI  228

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
             + P  CS   +  C  G+S TEPY  AH+++L+HA+AV  YR  YQ  Q GKI I+++  
Sbjct  229   NPPSRCSKEVN-NCTEGDSGTEPYTAAHNMILSHASAVQRYRENYQQAQKGKIGILLDFV  287

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             WYEP + S AD  A QRA DF++GWFL P+  GEYPR++   VG+RLPKF+  E A++KG
Sbjct  288   WYEPHSRSKADNYAAQRARDFHIGWFLHPLTYGEYPRTMQENVGERLPKFTPEEVAMVKG  347

Query  1415  SYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVP  1594
             SYDYLGVN YT++Y          +  +    D G +     G+ PIG RAN+ WLYIVP
Sbjct  348   SYDYLGVNQYTSYYMFDPPWPQSNISSYANDWDVG-YAYDRNGV-PIGRRANSGWLYIVP  405

Query  1595  RGMRNLMNYIKDKYGNPLVFITENGMDDAK----TDGLNDIKRIRYHRDYLKSLLAAIKE  1762
              G+ N + Y+K++YGNP V ++ENGMDD      T  L+D  RI Y+RDY+  L  AI +
Sbjct  406   WGLYNALMYVKERYGNPTVMLSENGMDDPSNYTLTHLLHDTTRINYYRDYISQLKKAI-D  464

Query  1763  DGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             DG NV GYFAWSL+DN+EW +G+++RFG+ YVD+ D L+RIPK SA WFK  L
Sbjct  465   DGANVTGYFAWSLLDNFEWLLGYTARFGITYVDF-DTLQRIPKMSAYWFKQLL  516



>emb|CDX95558.1| BnaC01g34500D [Brassica napus]
Length=493

 Score =   499 bits (1286),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 261/474 (55%), Positives = 329/474 (69%), Gaps = 9/474 (2%)
 Frame = +2

Query  512   NISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYH  691
             + +R SFPEGFVFGTA++AYQ EG   +DGRG +IWD F   PGK+ + + A++ VDQYH
Sbjct  21    DANRKSFPEGFVFGTATSAYQVEGETYQDGRGPSIWDAFVKIPGKIANNATAELTVDQYH  80

Query  692   RYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTL  871
              Y ED++LM+ +  DAYRFSI+WSRIFP G GK+N  GV +YN LID L+  GI PY  L
Sbjct  81    LYKEDVDLMQTLNFDAYRFSISWSRIFPEGAGKINWNGVAYYNRLIDYLVQKGITPYANL  140

Query  872   YHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLG  1051
             YHYDLP ALE +Y G L RQV +DFA YAE CF  FGDRVK W+T NEPR +  LGYD G
Sbjct  141   YHYDLPLALEKKYKGLLGRQV-EDFADYAEFCFKTFGDRVKNWMTFNEPRVVAALGYDNG  199

Query  1052  VHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVES  1231
             + AP  CS  F   C  GNSATEPY VAHHL+LAHA+AV  YR+ YQ KQ G+I I+++ 
Sbjct  200   IFAPARCSKAFG-NCTEGNSATEPYIVAHHLILAHASAVQRYRQHYQEKQKGRIGILLDF  258

Query  1232  FWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLK  1411
              W+EPLT+S AD DA QRA DF+LGWF+ P++ GEYP+++   V +RLPKF+  E  L+K
Sbjct  259   VWFEPLTSSEADNDAAQRARDFHLGWFIHPIVYGEYPKTMQDIVKERLPKFTEEEVKLVK  318

Query  1412  GSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIV  1591
             GS D++G+N YTT+Y S+         L      +  F     G  PIG RA++ WLY V
Sbjct  319   GSIDFVGINQYTTYYMSAPHPTAKPKDLGYQQDWNVVFNFAKDG-KPIGPRAHSEWLYNV  377

Query  1592  PRGMRNLMNYIKDKYGNPLVFITENGMDDA----KTDGLNDIKRIRYHRDYLKSLLAAIK  1759
             P GM   M Y+K+ YGNP + ++ENGMDDA    +  G+ND  RI Y+RDYL  L  A+ 
Sbjct  378   PWGMYKAMMYVKEHYGNPTMILSENGMDDAGNITQAQGVNDTSRITYYRDYLTQLKKAV-  436

Query  1760  EDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             +DG NV GYFAWSL+DN+EW  G++SRFG+ YVDY D L+R PK SA WF+  L
Sbjct  437   DDGANVTGYFAWSLLDNFEWLSGYTSRFGIVYVDYKD-LKRYPKMSALWFRRLL  489



>gb|EAY74244.1| hypothetical protein OsI_02124 [Oryza sativa Indica Group]
Length=516

 Score =   500 bits (1288),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 258/475 (54%), Positives = 332/475 (70%), Gaps = 13/475 (3%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             +SR SFP GFVFGTA++AYQ EG   +DGRG +IWD F  TPG++ + + ADV VD+YHR
Sbjct  49    LSRRSFPAGFVFGTAASAYQVEGMALKDGRGPSIWDAFVKTPGEIANNATADVTVDEYHR  108

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             Y ED+ +MK MG DAYRFSI+WSRIFP GTGK+N  GV +YN LI+ +L  GI PY  LY
Sbjct  109   YKEDVNIMKSMGFDAYRFSISWSRIFPTGTGKVNWKGVAYYNRLINYMLKIGITPYANLY  168

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             HYDLP+ALE +Y G LNR++++ FA YAE CF  FGDRVK W+T NEPR +  LGYD G 
Sbjct  169   HYDLPEALEVQYGGLLNRKIVEAFADYAEFCFKTFGDRVKNWMTFNEPRVVAALGYDDGN  228

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
              APG C+      C  GNSATEPY VAHHL+L+HA+AV  YR KYQ  Q GKI I+++  
Sbjct  229   FAPGRCT-----KCTAGNSATEPYIVAHHLILSHASAVQRYRHKYQHIQKGKIGILLDFV  283

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             WYE LTNS AD  A QR+ DF++GWFL P++ GEYP+S+   V +RLPKF+A E  ++KG
Sbjct  284   WYEGLTNSTADQAAAQRSRDFHVGWFLHPIIYGEYPKSLQVIVKERLPKFTADEVHMVKG  343

Query  1415  SYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVP  1594
             S DY+G+N YT +Y      N   L  +   +D     +  +  +PIG RAN+ WLYIVP
Sbjct  344   SIDYVGINQYTAYYVRDQQPNATTLPSYS--SDWHAAPIYERDGVPIGPRANSDWLYIVP  401

Query  1595  RGMRNLMNYIKDKYGNPLVFITENGMDDAK----TDGLNDIKRIRYHRDYLKSLLAAIKE  1762
              G+   + Y+K+KYGNP +F++ENGMDD        G++D  R+ Y+R Y+  L  AI +
Sbjct  402   WGLYKAVTYVKEKYGNPTMFLSENGMDDPGNVTIAQGVHDTTRVAYYRSYITKLKEAI-D  460

Query  1763  DGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
             DG N  GYFAWSL+DN+EW +G++SRFGL YVD+   LRR PK SA WF++ + S
Sbjct  461   DGANCIGYFAWSLLDNFEWKLGYTSRFGLVYVDF-RTLRRYPKMSAYWFRDLVRS  514



>ref|XP_007036679.1| B-S glucosidase 44 isoform 1 [Theobroma cacao]
 gb|EOY21180.1| B-S glucosidase 44 isoform 1 [Theobroma cacao]
Length=513

 Score =   500 bits (1287),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 259/473 (55%), Positives = 332/473 (70%), Gaps = 9/473 (2%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             +SR SFP+GFVFGTA++AYQ EG    DGRG +IWD F   PG V   +  +V+VDQYHR
Sbjct  41    LSRESFPKGFVFGTATSAYQVEGMASGDGRGPSIWDVFVKIPGIVAKNATGEVSVDQYHR  100

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             Y ED++LM ++  DAYRFSI+WSRIFP+GTGK+N  GV +YN LID+LL  GI PY  LY
Sbjct  101   YKEDVDLMANLNFDAYRFSISWSRIFPDGTGKVNWKGVAYYNRLIDSLLQRGITPYANLY  160

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             HYDLP+ALE RYNG L+ QV+KDFA +A+ CF  FGDRVK W+T NEPR +  LGYD G 
Sbjct  161   HYDLPEALEKRYNGLLSYQVVKDFADFADFCFKTFGDRVKNWMTFNEPRVVAALGYDNGF  220

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
              APG CS  +   C  GNS TEPY VAHHL+LAH AAV  YR KYQ KQ G+I I+++  
Sbjct  221   FAPGRCSKAYG-NCTAGNSGTEPYIVAHHLILAHGAAVQRYRLKYQPKQKGRIGILLDFV  279

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             WYEPLT S AD  A QRA DF++GWF+ P++ GEYPR++   VG+RLPKF+  E  ++KG
Sbjct  280   WYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPRTMQEIVGNRLPKFTKEEVKMVKG  339

Query  1415  SYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVP  1594
             S D++G+N YT +Y      +   +  +    ++G F    +G+ PIG RAN+ WLY VP
Sbjct  340   SIDFVGINQYTAYYMYDPHQSKPKVLGYQQDWNAG-FAYAKRGV-PIGPRANSNWLYNVP  397

Query  1595  RGMRNLMNYIKDKYGNPLVFITENGMDDAK----TDGLNDIKRIRYHRDYLKSLLAAIKE  1762
              G+   + YIK++YGNP V ++ENGMDD      + GL+D  RI Y++ YL  L  A+ +
Sbjct  398   WGLYKALMYIKERYGNPTVILSENGMDDPGNVTLSQGLHDTTRINYYKAYLTQLRKAV-D  456

Query  1763  DGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
              G NV GYFAWSL+DN+EW +G++SRFG+ YVD+  NL+R PK SA WFK  L
Sbjct  457   GGANVVGYFAWSLLDNFEWRLGYTSRFGIVYVDF-SNLKRYPKMSAYWFKQLL  508



>gb|KDO63132.1| hypothetical protein CISIN_1g046891mg [Citrus sinensis]
Length=520

 Score =   499 bits (1284),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 256/473 (54%), Positives = 328/473 (69%), Gaps = 9/473 (2%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             ++R SFP+GFVFGTA++AYQ EG   +DGRG  IWD + HTPG + + + ADV VDQYHR
Sbjct  49    LTRKSFPDGFVFGTATSAYQVEGMANKDGRGPCIWDVYVHTPGNIANNATADVTVDQYHR  108

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             Y EDI+LMK +  DAYRFSI+WSRIFP G G++N  GV +YN LID +L  GI PY  LY
Sbjct  109   YKEDIDLMKKLNFDAYRFSISWSRIFPQGAGRVNWKGVAYYNRLIDYMLEQGITPYANLY  168

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             HYD+P AL  RY G L RQV+KD+A +AE CF  FGDRVK W T NEPR I  LG+D G+
Sbjct  169   HYDMPLALHERYGGLLGRQVVKDYADFAEFCFKTFGDRVKNWYTFNEPRVIAALGFDSGI  228

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
             + P  CS   +  C  G+S TEPY  AH+++L+HA+AV  YR  YQ  Q GKI I+++  
Sbjct  229   NPPSRCSKEVN-NCTEGDSGTEPYTAAHNMILSHASAVQRYRENYQQAQKGKIGILLDFV  287

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             WYEP + S AD  A QRA DF++GWFL P+  GEYPR++   VG+RLPKF+  E A++KG
Sbjct  288   WYEPHSRSKADNYAAQRARDFHIGWFLHPLTYGEYPRTMQENVGERLPKFTPEEVAMVKG  347

Query  1415  SYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVP  1594
             SYDYLGVN YT++Y          +  +    D G +     G+ PIG RAN+ WLYIVP
Sbjct  348   SYDYLGVNQYTSYYMFDPPWPQSNISSYANDWDVG-YAYDRNGV-PIGRRANSGWLYIVP  405

Query  1595  RGMRNLMNYIKDKYGNPLVFITENGMDDAK----TDGLNDIKRIRYHRDYLKSLLAAIKE  1762
              G+ N + Y+K++YGNP V ++ENGMD+      T  L+D  RI Y+RDY+  L  AI +
Sbjct  406   WGLYNALMYVKERYGNPTVMLSENGMDNPSNYTLTHLLHDTTRINYYRDYISQLKKAI-D  464

Query  1763  DGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             DG NV GYFAWSL+DN+EW +G+++RFG+ YVD+ D L+RIPK SA WFK  L
Sbjct  465   DGANVTGYFAWSLLDNFEWLLGYTARFGITYVDF-DTLQRIPKMSAYWFKQLL  516



>gb|KDP41124.1| hypothetical protein JCGZ_03615 [Jatropha curcas]
Length=516

 Score =   499 bits (1284),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 261/473 (55%), Positives = 330/473 (70%), Gaps = 9/473 (2%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             +SR SFP GF+FGTA++AYQ EG   +DGRG +IWD F   PG V + +  +V+VDQYHR
Sbjct  44    LSRQSFPAGFLFGTATSAYQVEGMADKDGRGPSIWDEFVKIPGIVANNATGEVSVDQYHR  103

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             Y ED++LM  +  DAYRFSI+WSRIFP+GTGK+N  GV +YN LID +L  GI PY  LY
Sbjct  104   YKEDVDLMAKLNFDAYRFSISWSRIFPDGTGKVNWKGVAYYNRLIDYMLKKGITPYANLY  163

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             HYDLP ALE +Y G L RQV+KDFA YA+ CF  FGDRVK W+T NEPR +  LGYD G 
Sbjct  164   HYDLPLALEKKYKGLLGRQVVKDFADYADFCFKTFGDRVKNWMTFNEPRVVAALGYDNGY  223

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
              APG CS  F   C  GNSATEPY VAH+L+L+HAAAV  YR KYQ KQ G+I I+++  
Sbjct  224   FAPGRCSKAFG-NCTAGNSATEPYIVAHNLILSHAAAVQRYREKYQEKQKGRIGILLDFV  282

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             WYEPLT S AD  A QRA DF++GWF+ P++ GEYP+++ + VG+RLPKF+  E  ++KG
Sbjct  283   WYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGNRLPKFTQEEIKIVKG  342

Query  1415  SYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVP  1594
             S DY+G+N YTT+Y      +      +    ++G F     G+  IG RAN+ WLY VP
Sbjct  343   SIDYVGINQYTTYYMYDPHQSKPKDLGYQQDWNAG-FAYEKNGVQ-IGPRANSYWLYNVP  400

Query  1595  RGMRNLMNYIKDKYGNPLVFITENGMDDAKT----DGLNDIKRIRYHRDYLKSLLAAIKE  1762
              G+   + YIK++YGNP VF++ENGMDD        GL+D  RI Y+R YL  L  A+ +
Sbjct  401   WGLYKALIYIKERYGNPTVFLSENGMDDPGNVTLPKGLHDTTRINYYRSYLTQLKKAV-D  459

Query  1763  DGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             DG NV GYFAWSL+DN+EW  G++SRFG+ YVDY  NL+R PK SA WFK  +
Sbjct  460   DGANVIGYFAWSLLDNFEWRSGYTSRFGIVYVDY-TNLKRYPKMSAYWFKQLM  511



>ref|XP_006430656.1| hypothetical protein CICLE_v10013386mg [Citrus clementina]
 gb|ESR43896.1| hypothetical protein CICLE_v10013386mg [Citrus clementina]
Length=520

 Score =   499 bits (1284),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 256/473 (54%), Positives = 327/473 (69%), Gaps = 9/473 (2%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             ++R SFP+GFVFGTA++AYQ EG   +DGRG  IWD + HTPG + + + ADV VDQYHR
Sbjct  49    LTRKSFPDGFVFGTATSAYQVEGMANKDGRGPCIWDVYVHTPGNIANNATADVTVDQYHR  108

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             Y EDI+LMK +  DAYRFSI+WSRIFP G G++N  GV +YN LID +L  GI PY  LY
Sbjct  109   YKEDIDLMKKLNFDAYRFSISWSRIFPQGAGRVNWKGVAYYNRLIDYMLEQGITPYANLY  168

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             HYD+P AL  RY G L RQV+KD+A +AE CF  FGDRVK W T NEPR I  LG+D G 
Sbjct  169   HYDMPLALHERYGGLLGRQVVKDYADFAEFCFKTFGDRVKNWYTFNEPRVIAALGFDSGT  228

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
             + P  CS   +  C  G+S TEPY  AH+++L+HA+AV  YR  YQ  Q GKI I+++  
Sbjct  229   NPPSRCSKEVN-NCTEGDSGTEPYTAAHNMILSHASAVQRYRENYQQAQKGKIGILLDFV  287

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             WYEP + S AD  A QRA DF++GWFL P+  GEYPR++   VG+RLPKF+  E A++KG
Sbjct  288   WYEPHSRSKADNYAAQRARDFHIGWFLHPLTYGEYPRTMQENVGERLPKFTPEEVAMVKG  347

Query  1415  SYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVP  1594
             SYDYLGVN YT++Y          +  +    D G +     G+ PIG RAN+ WLYIVP
Sbjct  348   SYDYLGVNQYTSYYMFDPPWPQSNISSYANDWDVG-YAYDRNGV-PIGRRANSEWLYIVP  405

Query  1595  RGMRNLMNYIKDKYGNPLVFITENGMDDAK----TDGLNDIKRIRYHRDYLKSLLAAIKE  1762
              G+ N + Y+K++YGNP V ++ENGMD+      T  L+D  RI Y+RDY+  L  AI +
Sbjct  406   WGLYNALMYVKERYGNPTVMLSENGMDNPSNYTLTHLLHDTTRINYYRDYISQLKKAI-D  464

Query  1763  DGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             DG NV GYFAWSL+DN+EW +G+++RFG+ YVD+ D L+RIPK SA WFK  L
Sbjct  465   DGANVTGYFAWSLLDNFEWLLGYTARFGITYVDF-DTLQRIPKMSAYWFKQLL  516



>ref|XP_002281407.1| PREDICTED: beta-glucosidase 44 [Vitis vinifera]
 emb|CBI15543.3| unnamed protein product [Vitis vinifera]
Length=507

 Score =   498 bits (1282),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 261/481 (54%), Positives = 332/481 (69%), Gaps = 11/481 (2%)
 Frame = +2

Query  497   ICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVA  676
             I     +SR SFP+GFVFGTA++AYQ EG   +DGRG +IWD F   PG V +    +VA
Sbjct  31    IFNTHGLSRESFPKGFVFGTATSAYQVEGMADKDGRGPSIWDVFIRKPGIVANNGTGEVA  90

Query  677   VDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIE  856
             VDQYHRY EDI+LMK +  +AYRFSI+WSRIFP GTGK+N  GV +YN LI+ LL  GI 
Sbjct  91    VDQYHRYKEDIDLMKSLNFEAYRFSISWSRIFPEGTGKVNWKGVAYYNRLINYLLKKGIT  150

Query  857   PYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVL  1036
             PY  LYHYDLP ALE +YNG L+ +V+KDFA YA+ CF +FGDRVK W+T NEPR +  L
Sbjct  151   PYANLYHYDLPLALEKKYNGLLSYRVVKDFADYADFCFKMFGDRVKNWMTFNEPRVVAAL  210

Query  1037  GYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKIT  1216
             GYD G  APG CS  +   C  GNS TEPY VAHHL+L+HAAAV  YR KYQ +Q G+I 
Sbjct  211   GYDNGFFAPGRCSKEYG-NCTAGNSGTEPYIVAHHLILSHAAAVQRYREKYQKEQKGRIG  269

Query  1217  IVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAE  1396
             I+++  WYEPLT S AD  A QR+ DF++GWF+ P++ GEYPR++   VGDRLPKF+ AE
Sbjct  270   ILLDFVWYEPLTRSKADNLAAQRSRDFHVGWFIHPIVYGEYPRTMQEIVGDRLPKFTKAE  329

Query  1397  SALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAV  1576
               ++KGS D++G+N YT +Y        +  +  D       F     G+ PIG RA + 
Sbjct  330   VKMVKGSMDFVGINQYTAYYMYDKPKPKVPGYQEDW---HAGFAYEKHGV-PIGPRAYSS  385

Query  1577  WLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAK----TDGLNDIKRIRYHRDYLKSL  1744
             WLY VP G+   + YIK++YGNP V ++ENGMDD      + GL+D KR+ ++ +YL  L
Sbjct  386   WLYKVPWGLYKAVTYIKERYGNPTVILSENGMDDPGNVTLSQGLHDTKRVNFYTNYLTEL  445

Query  1745  LAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLA  1924
               AI +DG NV GYFAWSL+DN+EW +G++SRFG+ YVD+   L+R PK SAKWFK  LA
Sbjct  446   KKAI-DDGANVIGYFAWSLLDNFEWRLGYTSRFGIVYVDW-RTLKRYPKMSAKWFKQMLA  503

Query  1925  S  1927
              
Sbjct  504   Q  504



>ref|XP_006482390.1| PREDICTED: beta-glucosidase 44-like [Citrus sinensis]
Length=518

 Score =   498 bits (1283),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 261/473 (55%), Positives = 329/473 (70%), Gaps = 11/473 (2%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             +SR SFPEGFVFGTA++AYQ EG   +DGRG  IWD +AHTPG + + + ADV VDQYHR
Sbjct  49    LSRKSFPEGFVFGTATSAYQVEGMADKDGRGPCIWDVYAHTPGHIANNATADVTVDQYHR  108

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             Y EDI+LMK++  DAYRFSI+WSRIFP GTG +NQ GVD+YN LID +L  GI PY  LY
Sbjct  109   YKEDIDLMKNLNFDAYRFSISWSRIFPEGTGTVNQKGVDYYNRLIDYMLEQGITPYANLY  168

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             HYD+P AL+ +Y G L+ QV  D+A YA+ CF  FGDRVK W T NEPR I  LG+D G 
Sbjct  169   HYDMPLALQEKYGGLLDCQV--DYADYADFCFKTFGDRVKNWYTFNEPRVIAALGFDDGS  226

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
             + P  CS   +  C  GNS TEPY  AH+++LAHAAAV  YR KYQ  Q GKI I+++  
Sbjct  227   NPPSRCSKEVN-NCTDGNSGTEPYIAAHNMILAHAAAVQRYREKYQETQKGKIGILLDFV  285

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             WYEP T S AD  A QRA DF++GWFL P+  GEYPR++   VGDRLPKF+  E  +++G
Sbjct  286   WYEPHTRSKADNLAAQRARDFHIGWFLHPLTYGEYPRTMQENVGDRLPKFTPEEVLMVQG  345

Query  1415  SYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVP  1594
             S+DYLGVN YT++Y          +  +    D+G +     G+ PIG RAN+ WLYIVP
Sbjct  346   SFDYLGVNQYTSYYMFDPPWPKSNISSYANDWDAG-YAYDRNGV-PIGPRANSGWLYIVP  403

Query  1595  RGMRNLMNYIKDKYGNPLVFITENGMDDAKTDGLN----DIKRIRYHRDYLKSLLAAIKE  1762
              G+ N + Y+K++YGNP+V ++ENGMDD     +N    D  R+ Y+RDY+  L  A  +
Sbjct  404   WGLYNALMYVKERYGNPIVMLSENGMDDPSNYTVNHLLHDTTRVNYYRDYISQLKKA-AD  462

Query  1763  DGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             DG NV GYFAWSL+DN+EW +G+SSRFG+ YVD+ D L+R PK SA WFK  L
Sbjct  463   DGANVTGYFAWSLLDNFEWLLGYSSRFGITYVDF-DTLKRTPKMSAYWFKQLL  514



>ref|XP_006652405.1| PREDICTED: beta-glucosidase 12-like [Oryza brachyantha]
Length=512

 Score =   498 bits (1282),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 260/483 (54%), Positives = 337/483 (70%), Gaps = 12/483 (2%)
 Frame = +2

Query  500   CGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHT-PGKVTDFSNADVA  676
              G   ISR SFPEGF+FGTASAAYQ+EG   E GRG +IWDTF H  P K+ D SN DVA
Sbjct  31    SGEPAISRRSFPEGFIFGTASAAYQYEGGATEGGRGPSIWDTFTHQHPDKIADGSNGDVA  90

Query  677   VDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGT--GKLNQAGVDHYNNLIDALLANG  850
              D YH Y ED+ LMKDMGMDAYRFSI+W+RI PNG+  G +N+ G+++YNNLI+ LL  G
Sbjct  91    DDSYHLYKEDVRLMKDMGMDAYRFSISWTRILPNGSLSGGVNREGINYYNNLINELLLKG  150

Query  851   IEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSIT  1030
             ++PYVTL+H+D PQALE+RYNG+L+  +I D+  YAE CF  FGDRVK W+T NEP +  
Sbjct  151   VQPYVTLFHWDSPQALEDRYNGFLSPNIINDYRDYAEVCFKEFGDRVKHWITFNEPWTFC  210

Query  1031  VLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGK  1210
               GY  GV APG CS +    C  G+S TEPY   HH LLAHA +V +Y+ KYQA Q GK
Sbjct  211   SNGYAAGVFAPGRCSPWEMGKCSVGDSGTEPYTACHHQLLAHAESVRLYKEKYQASQKGK  270

Query  1211  ITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSA  1390
             I I + S W+ P + S ++  A +RAIDF LGWF++P++ G+YP ++   VGDRLP+F+ 
Sbjct  271   IGITLVSHWFVPYSRSKSNDAAAKRAIDFMLGWFMDPLINGDYPLNMRGLVGDRLPQFTK  330

Query  1391  AESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERAN  1570
              ES L+KGS+D++G+N+YT  YA +   +  GL    T TDSG      +  +PIG++A 
Sbjct  331   EESELVKGSFDFIGLNYYTANYADNLPAS-NGLNKSYT-TDSGANLTGVRNGVPIGQQAA  388

Query  1571  AVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMD--DAKT----DGLNDIKRIRYHRDY  1732
             + WLY+ P+G  +L+ Y+K+ YGNP V+ITENG+D  D KT    + L D  RI Y+  +
Sbjct  389   SPWLYVYPKGFHDLLLYVKENYGNPTVYITENGVDEFDNKTLTLQEALQDDARIDYYNRH  448

Query  1733  LKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFK  1912
             L SLL AI+  G NVK YFAWSL+DN+EW  G++ RFG+ YVDY D  +R PK+SA WFK
Sbjct  449   LLSLLTAIRA-GANVKAYFAWSLLDNFEWANGYTVRFGINYVDYKDGAKRYPKKSAHWFK  507

Query  1913  NFL  1921
              FL
Sbjct  508   KFL  510



>ref|XP_006341563.1| PREDICTED: beta-glucosidase 44-like [Solanum tuberosum]
Length=512

 Score =   498 bits (1281),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 258/479 (54%), Positives = 331/479 (69%), Gaps = 9/479 (2%)
 Frame = +2

Query  497   ICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVA  676
             I     +SR SFP+GF+FGTA++AYQ EG+   +GRG +IWDTF   PG   + +N ++A
Sbjct  34    ILDTGGLSRESFPKGFIFGTATSAYQVEGSASTEGRGPSIWDTFLKIPGLEPNNANGEIA  93

Query  677   VDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIE  856
             VDQYHRY EDI+LM  +  +AYRFSI+WSRIFPNGTG++N  GV +YN LID +L  GI 
Sbjct  94    VDQYHRYKEDIDLMAKLNFEAYRFSISWSRIFPNGTGEVNWKGVAYYNRLIDYMLKRGIT  153

Query  857   PYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVL  1036
             PY  L HYDLPQAL++RYNGWL R+V+KDFA YAE CF  FGDRVK W + NEPR +  L
Sbjct  154   PYANLNHYDLPQALQDRYNGWLGREVVKDFADYAEFCFKTFGDRVKNWFSFNEPRVVAAL  213

Query  1037  GYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKIT  1216
             GYD G  APG CS  F   C  G+SATEPY VAH+L+L HA+A   YR KYQ KQ GK  
Sbjct  214   GYDNGFFAPGRCSKPFG-NCTEGDSATEPYIVAHNLILCHASAAQRYREKYQEKQKGKFG  272

Query  1217  IVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAE  1396
             I+++  WYEPLT   AD  A QRA DF+LGWFL P++ GEYP+++ + VG RLPKFS  E
Sbjct  273   ILLDFVWYEPLTKGKADNYAAQRARDFHLGWFLHPLVYGEYPKTMQNIVGTRLPKFSKEE  332

Query  1397  SALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAV  1576
               ++KGS+DY+G+N YT++Y             +    + G F    KG+ PIG RA++ 
Sbjct  333   VKMVKGSFDYVGINQYTSYYMYDPHYTTPQPLGYQQDWNVG-FAYDRKGV-PIGPRAHSY  390

Query  1577  WLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT----DGLNDIKRIRYHRDYLKSL  1744
             WLYIVP G+   +NY+K+ YGNP + + ENGMD A        L+D KRI Y++ YL+ L
Sbjct  391   WLYIVPWGLYKAVNYVKEHYGNPTIILAENGMDYAGNITLPKALHDTKRIDYYKSYLQQL  450

Query  1745  LAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
                + +DG NV GYFAWSL+DN+EW +G++SRFG+ YVD+ + L+R PK SA WFK  L
Sbjct  451   KKTV-DDGANVIGYFAWSLLDNFEWRLGYTSRFGIVYVDF-NTLKRYPKMSAYWFKKLL  507



>ref|XP_010097587.1| Beta-glucosidase 44 [Morus notabilis]
 gb|EXB69119.1| Beta-glucosidase 44 [Morus notabilis]
Length=512

 Score =   498 bits (1281),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 256/473 (54%), Positives = 328/473 (69%), Gaps = 9/473 (2%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             +SRASFP+GFVFGTA++AYQ EG   +DGRG +IWD F  TPG + D   A+V VDQYHR
Sbjct  41    LSRASFPKGFVFGTATSAYQVEGMTHQDGRGPSIWDVFVKTPGIIADNGTAEVTVDQYHR  100

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             Y ED+++MK +  DAYRFSI+WSRIFP G GK+N  GV +YN LI+ ++  GI PY  LY
Sbjct  101   YREDVDIMKKLNFDAYRFSISWSRIFPEGAGKVNWKGVAYYNRLINYMIKRGITPYANLY  160

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             HYDLP+ALE +Y G LN QV+KDFA YA+ CF  FGDRVK W+T NEPR +  LGYD G+
Sbjct  161   HYDLPEALEEKYLGLLNDQVVKDFADYADFCFKTFGDRVKNWMTFNEPRVVAALGYDNGL  220

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
             HAPG CS  F   C  GNSATEPY  AHHL+L+HAAAV  YR KYQ  Q G+I I+ +  
Sbjct  221   HAPGRCSKEFG-NCTAGNSATEPYIAAHHLILSHAAAVQRYREKYQKTQKGRIGILTDFV  279

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             WYEPLT S AD  A QRA DF++GWFL P++ GEYPR++   VG+RLPKF+  +  ++KG
Sbjct  280   WYEPLTRSKADNYAAQRARDFHIGWFLHPIVYGEYPRTIQEIVGERLPKFTKEQVKMVKG  339

Query  1415  SYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVP  1594
             S D++G+N YT++Y      +   +  +    + G F     G + IG RA + WLY VP
Sbjct  340   SIDFVGINQYTSYYMYDPHASKPKVLGYQQDWNVG-FAYAKNGKL-IGPRAYSEWLYQVP  397

Query  1595  RGMRNLMNYIKDKYGNPLVFITENGMDDAK----TDGLNDIKRIRYHRDYLKSLLAAIKE  1762
              G+   + Y+K++YGNP V ++ENGMDD        GL+D  R+ Y+R YL  L  A  +
Sbjct  398   SGLYKCLMYLKERYGNPTVILSENGMDDPGNVTLAQGLHDTTRVNYYRSYLLQLKKA-AD  456

Query  1763  DGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             DG NV GYFAWSL+DN+EW +G++SRFG+ YVDY  +L+R PK SA WF+  L
Sbjct  457   DGANVIGYFAWSLLDNFEWRLGYTSRFGMVYVDY-HSLKRYPKMSAYWFQKLL  508



>ref|XP_002533126.1| beta-glucosidase, putative [Ricinus communis]
 gb|EEF29253.1| beta-glucosidase, putative [Ricinus communis]
Length=517

 Score =   498 bits (1281),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 259/473 (55%), Positives = 328/473 (69%), Gaps = 9/473 (2%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             +SR SFPEGF+FGTA++AYQ EG   +DGRG +IWD F   PG + D S  +V+VDQYHR
Sbjct  45    LSRDSFPEGFLFGTATSAYQVEGMADKDGRGPSIWDVFVKVPGIIADNSTGEVSVDQYHR  104

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             Y +D+++M+ +  DAYRFSI+WSRIFP GTGK+N  GV +Y+ LID +L  GI PY  LY
Sbjct  105   YKQDVDIMQKLNFDAYRFSISWSRIFPYGTGKVNWKGVAYYHRLIDYMLKRGITPYANLY  164

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             HYDLP ALE +YNG LNRQV+KDFA YA+ CF  FGDRVK W+T NEPR I  LGYD G 
Sbjct  165   HYDLPLALEKKYNGLLNRQVVKDFADYADFCFKTFGDRVKNWMTFNEPRVIAALGYDNGF  224

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
              AP  CS  F   C  G+SATEPY  AH+L+L+HAAAV  YR KYQ KQ GKI I+++  
Sbjct  225   FAPARCSKAFG-NCTAGDSATEPYIAAHNLILSHAAAVQRYREKYQEKQKGKIGILLDFV  283

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             WYEPLT S AD  A QRA DF++GWF+ P++ GEYP+++ + VG RLPKF+  E  ++KG
Sbjct  284   WYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGTRLPKFTKQEVEMVKG  343

Query  1415  SYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVP  1594
             S D++G+N YTT+Y S           +    D+G F     G+ P+G +AN+ WLY VP
Sbjct  344   SIDFVGINQYTTYYISDPHQAKPKYLGYQQDWDAG-FAYEKNGV-PVGPKANSYWLYNVP  401

Query  1595  RGMRNLMNYIKDKYGNPLVFITENGMDDAKT----DGLNDIKRIRYHRDYLKSLLAAIKE  1762
              GM   + YIK+ YGNP V ++ENGMDD        GL+D  RI Y++ YL  +  AI +
Sbjct  402   WGMYKALTYIKEHYGNPTVILSENGMDDPGNVTLPKGLHDTTRINYYKGYLTQMKKAI-D  460

Query  1763  DGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             DG NV GYFAWSL+DN+EW  G++SRFG+ YVD+   L+R PK SA WFK  L
Sbjct  461   DGANVVGYFAWSLVDNFEWRSGYTSRFGIVYVDF-TTLKRYPKMSAYWFKQML  512



>tpg|DAA44055.1| TPA: hypothetical protein ZEAMMB73_095768 [Zea mays]
Length=404

 Score =   493 bits (1270),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 226/339 (67%), Positives = 283/339 (83%), Gaps = 0/339 (0%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             ++R SFP+GFVFGTA+AAYQ+EGAVK DGRG TIWDTFAHT GK++DFSNADVAVDQYHR
Sbjct  45    LTRGSFPKGFVFGTAAAAYQYEGAVKTDGRGQTIWDTFAHTFGKISDFSNADVAVDQYHR  104

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             + ED++LM DMGMDAYRFSIAWSRI PNGTG++NQAG+DHYN +I+ALL+ GI+PYVTLY
Sbjct  105   FEEDVQLMADMGMDAYRFSIAWSRILPNGTGQVNQAGIDHYNKVINALLSKGIQPYVTLY  164

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             H+DLPQALE+RYNGWL+RQ++ DFAAYAETCF  FGDRVK W+T+NEP ++ V GYD G+
Sbjct  165   HWDLPQALEDRYNGWLDRQIVNDFAAYAETCFKAFGDRVKHWITLNEPHTVAVQGYDAGL  224

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
             HAPG CS+  HL C TGNS TEPY VAH+ +LAHA   D+YRRKY+A Q G++ I  +  
Sbjct  225   HAPGRCSVLLHLYCRTGNSGTEPYIVAHNFILAHATVSDMYRRKYKAAQNGELGIAFDVI  284

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             WYEP+TNS  DI+A +RA +F LGWF +P   G+YP ++ +RVG+RLPKF+A E+AL+KG
Sbjct  285   WYEPMTNSTIDIEATKRAQEFQLGWFADPFFFGDYPATMRARVGERLPKFTADEAALVKG  344

Query  1415  SYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTL  1531
             + D++G+NHYTT+Y    DTNI+G  L+DTL D+GT +L
Sbjct  345   ALDFMGINHYTTFYTRHNDTNIIGRLLNDTLADTGTISL  383



>ref|XP_008218659.1| PREDICTED: beta-glucosidase 12-like [Prunus mume]
Length=550

 Score =   499 bits (1284),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 254/481 (53%), Positives = 340/481 (71%), Gaps = 14/481 (3%)
 Frame = +2

Query  506   AQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHT-PGKVTDFSNADVAVD  682
             A+ ++R+SFP GF+FG+A AAYQFEG  KE GRG +IWDTF H  P K+TD SN DVA+D
Sbjct  38    AKALNRSSFPPGFIFGSAGAAYQFEGGAKEGGRGPSIWDTFTHKYPDKITDRSNGDVAID  97

Query  683   QYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNG--TGKLNQAGVDHYNNLIDALLANGIE  856
              YHRY ED+ ++KDMG DAYRFSI+WSRI P G  +G +NQ G+ +YNNLI+ L+ANGI+
Sbjct  98    SYHRYKEDVSIVKDMGWDAYRFSISWSRILPTGMLSGGVNQEGIKYYNNLINELVANGIK  157

Query  857   PYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVL  1036
             P+VT++H+DLPQ +EN Y G+L+ + + DF  YAE CF  FGDRVK W+T+NEP + +  
Sbjct  158   PFVTIFHWDLPQGIENAYGGFLSPKSVDDFRDYAEICFREFGDRVKHWITLNEPHTFSTA  217

Query  1037  GYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKIT  1216
             GY  GV APG CS   H  C  GNS TEPY V+HH LLAHAAAV +YR K+ A Q G I 
Sbjct  218   GYTSGVFAPGRCSN--HTKCNGGNSGTEPYLVSHHQLLAHAAAVKVYREKFLATQKGVIG  275

Query  1217  IVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAE  1396
             I + + +  P ++S AD DA  RA+DF  GWFL P+  G+YP+S+ S VG+RLPKF+  +
Sbjct  276   IALNTGFSVPFSDSQADKDAASRAMDFSYGWFLNPLTRGQYPQSMQSLVGNRLPKFTKEQ  335

Query  1397  SALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAV  1576
             S +L GS+D++G+N+Y++ YA +   N  G   +   TDS   +L  +  +PIG  A + 
Sbjct  336   SQMLTGSFDFIGLNYYSSSYAKAVPPNKAGTPSY--ATDSQADSLNNRNGVPIGPVAASD  393

Query  1577  WLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKTDGLN------DIKRIRYHRDYLK  1738
             WLY+ PRG R+++ Y K KY NPL++ITENG+D+     L+      D  RI+Y+ ++L 
Sbjct  394   WLYVYPRGFRDVLLYTKRKYKNPLIYITENGVDEHNDPKLSLEQALIDKDRIKYYDEHLY  453

Query  1739  SLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNF  1918
              L  AIK DG NVKG+FAWSL DN+EW  G++ RFG+Y+VDY +  +R PK+SA+WFKNF
Sbjct  454   YLQLAIK-DGVNVKGFFAWSLFDNFEWANGYTVRFGIYFVDYKNGNKRYPKQSARWFKNF  512

Query  1919  L  1921
             L
Sbjct  513   L  513



>ref|XP_006644213.1| PREDICTED: beta-glucosidase 1-like [Oryza brachyantha]
Length=511

 Score =   497 bits (1280),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 254/473 (54%), Positives = 331/473 (70%), Gaps = 13/473 (3%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             +SR SFP GFVFGTA++AYQ EG   +DGRG +IWD F   PG++ + + ADV VD+YHR
Sbjct  44    LSRRSFPAGFVFGTAASAYQVEGMALKDGRGPSIWDAFVKIPGEIANNATADVTVDEYHR  103

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             Y ED+++MK MG DAYRFSI+WSRIFP GTGK+N  GV +YN LI+ +L  GI PY  LY
Sbjct  104   YKEDVDIMKRMGFDAYRFSISWSRIFPTGTGKVNWKGVAYYNRLINYMLKIGITPYANLY  163

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             HYDLP+ALE +Y G LNR++++ FA YAE CF  FGDRVK W+T NEPR +  LGYD G 
Sbjct  164   HYDLPEALEVQYGGLLNRKIVEAFADYAEFCFKTFGDRVKNWMTFNEPRVVAALGYDDGA  223

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
              APG C+      C  GNSATEPY VAHHL+L+HAAA  IYR KYQ  Q G+I I+++  
Sbjct  224   FAPGRCT-----KCKAGNSATEPYIVAHHLILSHAAAAQIYRHKYQHVQKGRIGILLDFV  278

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             WYE LTNS AD DA QR+ DF++GWFL P++ GEYP+S+   V +RLP+F+A E  ++KG
Sbjct  279   WYEGLTNSTADQDAAQRSRDFHVGWFLHPIIYGEYPKSLQVIVKERLPRFTADEIQMVKG  338

Query  1415  SYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVP  1594
             S DY+G+N YT +Y      N   +  + +   +  F     G+ PIG RAN+ WLYIVP
Sbjct  339   SIDYVGINQYTAYYVRDQQPNATTIPSYSSDWHAA-FAYERNGV-PIGPRANSDWLYIVP  396

Query  1595  RGMRNLMNYIKDKYGNPLVFITENGMDD----AKTDGLNDIKRIRYHRDYLKSLLAAIKE  1762
              G+   + Y+K+KYGNP + ++ENGMDD        G++D  R+ Y+R Y+  L  AI +
Sbjct  397   WGLYKAVTYVKEKYGNPTMLLSENGMDDPGNVTVAQGVHDTARVAYYRSYITKLKEAI-D  455

Query  1763  DGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             DG N  GYFAWS++DN+EW +G++SRFGL YVD+   LRR PK SA WF++ +
Sbjct  456   DGANCVGYFAWSMLDNFEWKLGYTSRFGLVYVDF-ATLRRYPKASAYWFRDVV  507



>ref|XP_003562544.1| PREDICTED: beta-glucosidase 26 [Brachypodium distachyon]
 ref|XP_010234616.1| PREDICTED: beta-glucosidase 26 [Brachypodium distachyon]
Length=500

 Score =   497 bits (1279),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 260/482 (54%), Positives = 336/482 (70%), Gaps = 14/482 (3%)
 Frame = +2

Query  494   QICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADV  673
             +I     +SR +FPEGFVFGTA++AYQ EG  K  GRG +IWD F   PG ++    ADV
Sbjct  24    EIHDTGGLSRGAFPEGFVFGTAASAYQVEGMAKRGGRGPSIWDAFIEIPGMISGNGTADV  83

Query  674   AVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGI  853
             AVD+YHRY ED+++MK MG DAYRFSI+WSRIFPNG GK+NQ GVD+YN LID +L  GI
Sbjct  84    AVDEYHRYKEDVDIMKSMGFDAYRFSISWSRIFPNGAGKVNQEGVDYYNRLIDYMLQQGI  143

Query  854   EPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITV  1033
              PY  LYHYDLP AL  +Y GWL+ ++++ FA YA+ CF +FGDRVK W T NEPR +  
Sbjct  144   TPYANLYHYDLPLALHQQYLGWLSPKIVEAFADYADFCFKVFGDRVKNWFTFNEPRCVAA  203

Query  1034  LGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKI  1213
             LGYD G HAPG CS         GNS TEPY VAHHL+L+HAAAV  YR KYQ  Q GKI
Sbjct  204   LGYDNGYHAPGRCS----QCTAGGNSMTEPYLVAHHLILSHAAAVKRYREKYQHHQKGKI  259

Query  1214  TIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAA  1393
              I+++  WYEPL+ S AD  A QRA DF+LGWFL+P++ G+YP S++  V  RLP FS  
Sbjct  260   GILLDFVWYEPLSKSKADQAAAQRARDFHLGWFLDPIVHGQYPESMLKIVEGRLPTFSHE  319

Query  1394  ESALLKGSYDYLGVNHYTTWYASSTDT-NIMGLFLHDTLTDSGTFTLPFKGLMPIGERAN  1570
             ES ++KGS DY+G+NHYT++Y       N+  +   D       +    +  +PIG RAN
Sbjct  320   ESRMVKGSMDYVGINHYTSYYMKDPGAWNLTPVSYQDDWHVGFVYE---RNGVPIGARAN  376

Query  1571  AVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDD----AKTDGLNDIKRIRYHRDYLK  1738
             + WLYIVP G+   + Y+K++YGNP +F++ENGMD     + T+G++D  R+RY+R+Y+ 
Sbjct  377   SYWLYIVPWGINKAVTYVKERYGNPTMFLSENGMDQPGNVSITEGVHDTVRVRYYREYIT  436

Query  1739  SLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNF  1918
              L   I +DG  V GYFAWSL+DN+EW +G++SRFG+ YVDY   L+R PK+SA WFKN 
Sbjct  437   ELKKVI-DDGARVIGYFAWSLLDNFEWRLGYTSRFGIVYVDY-KTLKRYPKDSAFWFKNM  494

Query  1919  LA  1924
             L+
Sbjct  495   LS  496



>ref|XP_002512138.1| beta-glucosidase, putative [Ricinus communis]
 gb|EEF50172.1| beta-glucosidase, putative [Ricinus communis]
Length=508

 Score =   496 bits (1278),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 241/485 (50%), Positives = 348/485 (72%), Gaps = 11/485 (2%)
 Frame = +2

Query  494   QICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHT-PGKVTDFSNAD  670
             ++  A   +R+SFP GF+FGTA+A+YQ+EGAV EDG+G +IWDTF H  P ++   +NAD
Sbjct  24    ELVSASTFNRSSFPAGFLFGTAAASYQYEGAVNEDGKGLSIWDTFTHKYPERIAGGANAD  83

Query  671   VAVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGT--GKLNQAGVDHYNNLIDALLA  844
             VAVD YHRY ED+ +MK+MG+D +RFSI+WSR+ PNGT  G +N+ G+D YNNLI+ LL+
Sbjct  84    VAVDFYHRYQEDVNIMKNMGLDTFRFSISWSRVLPNGTVKGGVNKKGIDFYNNLINELLS  143

Query  845   NGIEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRS  1024
              GI+P+VTL+H+DLPQALE+ Y G+L+  ++ DF  YAE CF  FGDRVK W+T+NEP S
Sbjct  144   QGIQPFVTLFHWDLPQALEDEYGGFLSPSIVHDFKNYAELCFKEFGDRVKHWITLNEPWS  203

Query  1025  ITVLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQG  1204
              +  GY++G+ APG CS F +  C  G+SATEPY V HH+LL+HAAAV +Y+ KYQA Q 
Sbjct  204   YSNTGYNMGLFAPGRCSKFMNAACQAGDSATEPYLVGHHMLLSHAAAVKLYKEKYQASQK  263

Query  1205  GKITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKF  1384
             G+I I +   W  P + +  D  A +RA+DF  GW++ P++ G+YP+S+I+ VG+RLP+F
Sbjct  264   GQIGITLVCHWMVPFSKTKPDHQASKRALDFMYGWYMHPLVYGDYPKSMINLVGNRLPRF  323

Query  1385  SAAESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGER  1564
             +  +S ++KGS+D++G+N+Y+++YA S       + +  + TDS T     +  +PIG  
Sbjct  324   TTDQSMMVKGSFDFIGLNYYSSFYAYSVPATSNSVNISYS-TDSLTNLTTERDGIPIGPT  382

Query  1565  ANAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAK------TDGLNDIKRIRYHR  1726
               ++W+++ PRG+R+++ Y K KY NP ++ITENG+D         T+ +ND+ RI Y++
Sbjct  383   DGSIWIHVYPRGLRDVLMYTKKKYNNPTIYITENGIDQLDNGTSTLTELVNDLNRIDYYK  442

Query  1727  DYLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKW  1906
              +L SL  AIKE G +VKGYFAWSL+DN+EW   ++ R+G+  VDY + L+R PK+SA W
Sbjct  443   RHLASLERAIKE-GVDVKGYFAWSLLDNFEWAAAYTMRYGINVVDYKNGLKRYPKKSAIW  501

Query  1907  FKNFL  1921
             F NFL
Sbjct  502   FNNFL  506



>gb|KDO62878.1| hypothetical protein CISIN_1g010049mg [Citrus sinensis]
Length=519

 Score =   497 bits (1279),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 258/473 (55%), Positives = 331/473 (70%), Gaps = 9/473 (2%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             +SR S P GFVFGTA++AYQ EG   +DGRG +IWD FA  PG V + +  DV+VDQYHR
Sbjct  47    LSRESLPNGFVFGTATSAYQVEGMAHKDGRGPSIWDVFAKKPGIVANNATGDVSVDQYHR  106

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             Y ED+++M ++  DAYRFSI+WSRIFP GTGK+N  GV +YN LI+ LL  GI PY  LY
Sbjct  107   YKEDVDIMANLNFDAYRFSISWSRIFPYGTGKVNWKGVAYYNQLINYLLKRGITPYANLY  166

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             HYDLP+ALE +YNG L+++V+KDFA YA+ CF  FGDRVK W+T NEPR +  LGYD G 
Sbjct  167   HYDLPEALEKKYNGLLSKRVVKDFADYADFCFKTFGDRVKNWMTFNEPRVVAALGYDNGF  226

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
              APG CS  F   C  GNSATEPY VAH+L+L+HAAAV  YR+KY+ KQ G+I I+++  
Sbjct  227   FAPGRCSKAFG-NCTVGNSATEPYIVAHNLILSHAAAVQRYRQKYEQKQKGRIGILLDFV  285

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             WYEPLT S AD  A QRA DF++GWF+ P++ GEYP+++ + VG+RLPKF+  E  ++KG
Sbjct  286   WYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGNRLPKFTKEEVKMVKG  345

Query  1415  SYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVP  1594
             S D++G+N YT +Y             +    ++G F     G+ PIG RAN+ WLY VP
Sbjct  346   SIDFVGINQYTAYYMYDPHLKQPKQVGYQQDWNAG-FAYEKNGV-PIGPRANSYWLYNVP  403

Query  1595  RGMRNLMNYIKDKYGNPLVFITENGMDDAKT----DGLNDIKRIRYHRDYLKSLLAAIKE  1762
              GM   + YIK  YGNP V ++ENGMDD        GL+D  RI Y++ YL  L  A+ +
Sbjct  404   WGMYKALMYIKGHYGNPTVILSENGMDDPGNVTLPKGLHDTTRINYYKGYLTQLKKAV-D  462

Query  1763  DGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             DG NV GYFAWSL+DN+EW +G++SRFG+ YVD+  NL+R PK SA WFK  L
Sbjct  463   DGANVVGYFAWSLLDNFEWRLGYTSRFGIVYVDF-TNLKRYPKMSAYWFKQLL  514



>ref|XP_004295227.1| PREDICTED: beta-glucosidase 13-like [Fragaria vesca subsp. vesca]
 gb|AFU61922.1| beta-glucosidase 3 [Fragaria x ananassa]
Length=520

 Score =   497 bits (1279),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 249/478 (52%), Positives = 339/478 (71%), Gaps = 11/478 (2%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHT-PGKVTDFSNADVAVDQYH  691
             ++R+SFP GFVFGTAS+AYQ+EGA    GRG +IWDTF H  P K+TD SN DVA+D YH
Sbjct  42    LNRSSFPAGFVFGTASSAYQYEGAANLSGRGPSIWDTFTHKYPDKITDGSNGDVAIDSYH  101

Query  692   RYLEDIELMKDMGMDAYRFSIAWSRIFPNG--TGKLNQAGVDHYNNLIDALLANGIEPYV  865
             RY ED+ +MK+MG+D YRFSI+WSR+ P G  +G +N+ G+++YNNLI+ LLANGI+P+V
Sbjct  102   RYKEDVAIMKEMGLDVYRFSISWSRVLPTGKLSGGVNKEGIEYYNNLINELLANGIKPFV  161

Query  866   TLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYD  1045
             TL+H+DLPQ L++ + G+++  ++K F AYAE C+  FGD+VK W+T NEP ++ V GY 
Sbjct  162   TLFHWDLPQPLQDEHGGFISPHIVKHFKAYAELCYREFGDQVKHWITFNEPIALAVAGYG  221

Query  1046  LGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVV  1225
             LG  APG CS + +  C  GNS TEPY V H+ LLAHAAAV++Y++ YQ  Q G I I +
Sbjct  222   LGALAPGRCSAWINPNCTGGNSTTEPYLVTHYQLLAHAAAVNLYKKHYQESQKGLIGITL  281

Query  1226  ESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESAL  1405
              + W  P T +  D  A+ R +DF LGW+++P+  G+YP+S+ S VGDRLPKF   +S L
Sbjct  282   VAQWLVPNTTARHDRAAQLRGLDFMLGWYMDPLTNGDYPKSMKSLVGDRLPKFKKEQSKL  341

Query  1406  LKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLY  1585
             LKGS+D++G+N+YT+ Y S     ++ +     +TDS     P +  +PIG +A +  LY
Sbjct  342   LKGSFDFIGLNYYTSNYVSDA-PQLVKVVNASFMTDSLATMSPLRNGIPIGPKAASEDLY  400

Query  1586  IVPRGMRNLMNYIKDKYGNPLVFITENGMDD------AKTDGLNDIKRIRYHRDYLKSLL  1747
             I PRG+R+++ Y K KY NPL++ITENG+D+         + L D +RI YH  +L  L 
Sbjct  401   IYPRGIRDILLYTKRKYNNPLIYITENGVDEFNDPKLTLEEALADNQRIDYHFRHLYYLQ  460

Query  1748  AAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
              AIK DG NVKGYFAWS +DN+EWT+G++ RFG+ YVDY D L+R PK SA WFKNFL
Sbjct  461   EAIK-DGVNVKGYFAWSFLDNFEWTLGYTVRFGINYVDYKDGLKRYPKHSALWFKNFL  517



>ref|XP_003534146.1| PREDICTED: beta-glucosidase 44 [Glycine max]
Length=506

 Score =   496 bits (1277),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 258/475 (54%), Positives = 333/475 (70%), Gaps = 9/475 (2%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             +SR +FP+GF+FGTA++AYQ EG   +DGRG +IWD F   PG V +    +V+VDQYHR
Sbjct  34    LSRDTFPKGFLFGTATSAYQVEGMAHKDGRGPSIWDVFIKKPGIVANNGTGEVSVDQYHR  93

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             Y EDI+LM  +  DAYRFSI+WSRIFPNGTG++N  GV +YN LI+ LL  GI PY  LY
Sbjct  94    YKEDIDLMASLNFDAYRFSISWSRIFPNGTGQVNWKGVAYYNRLINYLLEKGITPYANLY  153

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             HYDLP ALE RYNG L+RQV+KDFA YAE CF  FGDRVK W+T NEPR +  LGYD G 
Sbjct  154   HYDLPLALEERYNGLLSRQVVKDFADYAEFCFKTFGDRVKNWMTFNEPRVVAALGYDNGF  213

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
              APG CS  +   C  GNS TEPY VAH+L+L+HAAAV  YR KYQ KQ G+I I+++  
Sbjct  214   FAPGRCSKEYG-NCTAGNSGTEPYIVAHNLILSHAAAVQRYRAKYQEKQKGRIGILLDFV  272

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             WYEPLT S AD  A QRA DF++GWF+ P++ GEYP+++ + VG+RLPKF++ E  ++KG
Sbjct  273   WYEPLTRSKADNFAAQRARDFHIGWFIHPLVYGEYPKTIQNIVGNRLPKFTSEEVKIVKG  332

Query  1415  SYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVP  1594
             S D++G+N YTT++      +   +  +    ++G F     G+ PIG RAN+ WLY VP
Sbjct  333   SIDFVGINQYTTFFIYDPHQSKPKVPGYQMDWNAG-FAYAKNGV-PIGPRANSYWLYNVP  390

Query  1595  RGMRNLMNYIKDKYGNPLVFITENGMDDAKT----DGLNDIKRIRYHRDYLKSLLAAIKE  1762
              GM   + YIK++YGNP V ++ENGMDD        GL+D  RI Y++ YL  L  A+ +
Sbjct  391   WGMYKSLMYIKERYGNPTVILSENGMDDPGNVTLPKGLHDTTRINYYKGYLTQLKKAV-D  449

Query  1763  DGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLAS  1927
             DG NV GYFAWSL+DN+EW +G++SRFG+ YVD+   L+R PK SA WFK  +  
Sbjct  450   DGANVVGYFAWSLLDNFEWRLGYTSRFGIVYVDF-KTLKRYPKMSAYWFKQLITK  503



>gb|AES67732.2| glycoside hydrolase family 1 protein [Medicago truncatula]
Length=511

 Score =   496 bits (1277),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 249/484 (51%), Positives = 341/484 (70%), Gaps = 12/484 (2%)
 Frame = +2

Query  497   ICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHT-PGKVTDFSNADV  673
             I    +++R SFP  F+FGT S++YQ+EGA KE GRGA+IWDT+ H  P K+ D SN DV
Sbjct  28    ILDVSSLNRTSFPTSFIFGTGSSSYQYEGAAKEGGRGASIWDTYTHKYPEKIRDKSNGDV  87

Query  674   AVDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNG--TGKLNQAGVDHYNNLIDALLAN  847
             A+DQY+RY ED+ +M++M +DAYRFSI+WSRI P G   G +NQ GV +YNNLI+ LLAN
Sbjct  88    AIDQYYRYKEDVGIMRNMNLDAYRFSISWSRIVPKGKLNGGINQEGVKYYNNLINELLAN  147

Query  848   GIEPYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSI  1027
             G++P+VTL+H+DLPQ LE+ Y G+L+  ++ DF  YAE CF  FGDRVK W T NEP + 
Sbjct  148   GLQPFVTLFHWDLPQTLEDEYGGFLSPLIVNDFQDYAELCFKEFGDRVKYWTTFNEPYAF  207

Query  1028  TVLGYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGG  1207
             +   Y LG  APG CS +F   C  G+S  EPY V+HH LLAHAA V +Y++KYQ  Q G
Sbjct  208   SNFAYTLGFFAPGRCSKWFSSNCTGGDSGKEPYIVSHHQLLAHAAVVHVYKKKYQESQKG  267

Query  1208  KITIVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFS  1387
              I I + S W+ PL++   D +A +R +DF LGWF+EP+ TG+YP+S+   VG RLPKFS
Sbjct  268   VIGITLASHWFLPLSDKKLDQNAVERGLDFMLGWFMEPLTTGKYPQSMHCLVGKRLPKFS  327

Query  1388  AAESALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERA  1567
               ++ LLKGS+D++G+N+YT+ YA++      G   +D  TDS       +  +PIG+RA
Sbjct  328   KKQARLLKGSFDFVGLNYYTSMYATNAPQPKNGRLSYD--TDSHVNFTSERNGVPIGQRA  385

Query  1568  NAVWLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDD------AKTDGLNDIKRIRYHRD  1729
              + WLY+ P+G++ L+ Y+K  Y NPL++ITENG+D+      +  + L D  RI Y+  
Sbjct  386   ASNWLYVYPKGIQELLLYVKKVYNNPLIYITENGIDEFNDPTLSLEEALMDTYRIDYYHR  445

Query  1730  YLKSLLAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWF  1909
             +L  + +AIK +G NVKGYFAWSL+DN+EWT G+++RFG+ +VDY + L+R PK SAKWF
Sbjct  446   HLFYIRSAIK-NGVNVKGYFAWSLLDNFEWTSGYTTRFGMNFVDYKNGLKRHPKLSAKWF  504

Query  1910  KNFL  1921
             KNFL
Sbjct  505   KNFL  508



>emb|CAN74265.1| hypothetical protein VITISV_040977 [Vitis vinifera]
Length=506

 Score =   496 bits (1277),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 260/481 (54%), Positives = 331/481 (69%), Gaps = 11/481 (2%)
 Frame = +2

Query  497   ICGAQNISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVA  676
             I     +SR SFP+G VFGTA++AYQ EG   +DGRG +IWD F   PG V +    +VA
Sbjct  30    IFNTHGLSRESFPKGLVFGTATSAYQVEGMADKDGRGPSIWDVFIRKPGIVANNGTGEVA  89

Query  677   VDQYHRYLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIE  856
             VDQYHRY EDI+LMK +  +AYRFSI+WSRIFP GTGK+N  GV +YN LI+ LL  GI 
Sbjct  90    VDQYHRYKEDIDLMKSLNFEAYRFSISWSRIFPEGTGKVNWKGVAYYNRLINYLLKKGIT  149

Query  857   PYVTLYHYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVL  1036
             PY  LYHYDLP ALE +YNG L+ +V+KDFA YA+ CF +FGDRVK W+T NEPR +  L
Sbjct  150   PYANLYHYDLPLALEKKYNGLLSYRVVKDFADYADFCFKMFGDRVKNWMTFNEPRVVAAL  209

Query  1037  GYDLGVHAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKIT  1216
             GYD G  APG CS  +   C  GNS TEPY VAHHL+L+HAAAV  YR KYQ +Q G+I 
Sbjct  210   GYDNGFFAPGRCSREYG-NCTAGNSGTEPYIVAHHLILSHAAAVQRYREKYQKEQKGRIG  268

Query  1217  IVVESFWYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAE  1396
             I+++  WYEPLT S AD  A QR+ DF++GWF+ P++ GEYPR++   VGDRLPKF+ AE
Sbjct  269   ILLDFVWYEPLTRSKADNLAAQRSRDFHVGWFIHPIVYGEYPRTMQEIVGDRLPKFTKAE  328

Query  1397  SALLKGSYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAV  1576
               ++KGS D++G+N YT +Y        +  +  D       F     G+ PIG RA + 
Sbjct  329   VKMVKGSMDFVGINQYTAYYMYDKPKPKVPGYQEDW---HAGFAYEKHGV-PIGPRAYSS  384

Query  1577  WLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAK----TDGLNDIKRIRYHRDYLKSL  1744
             WLY VP G+   + YIK++YGNP V ++ENGMDD      + GL+D KR+ ++ +YL  L
Sbjct  385   WLYKVPWGLYKAVTYIKERYGNPTVILSENGMDDPGNVTLSQGLHDTKRVNFYTNYLTEL  444

Query  1745  LAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFLA  1924
               AI +DG NV GYFAWSL+DN+EW +G++SRFG+ YVD+   L+R PK SAKWFK  LA
Sbjct  445   KKAI-DDGANVIGYFAWSLLDNFEWRLGYTSRFGIVYVDW-RTLKRYPKMSAKWFKQMLA  502

Query  1925  S  1927
              
Sbjct  503   Q  503



>ref|XP_010034459.1| PREDICTED: beta-glucosidase 44-like [Eucalyptus grandis]
Length=507

 Score =   496 bits (1277),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 258/479 (54%), Positives = 341/479 (71%), Gaps = 21/479 (4%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             +SRASFP+GF+FGTA++AYQ EG    DGRG +IWD F   PG + +  + ++AVDQYH+
Sbjct  37    LSRASFPKGFLFGTATSAYQVEGMASGDGRGPSIWDAFVQVPGNIKELDSGEMAVDQYHK  96

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             Y EDI+LM  +  DAYRFSI+WSRIFPNGTG +N  GV++YN LIDAL+A GI PY  LY
Sbjct  97    YKEDIDLMHKLNFDAYRFSISWSRIFPNGTGYVNWRGVNYYNRLIDALIAKGITPYANLY  156

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             HYD+P AL+ RY G L+  V+KDFA YAE CF  FGDRVK W+T NEPR I  LG+D G 
Sbjct  157   HYDMPLALQLRYEGLLSINVVKDFADYAEFCFKTFGDRVKNWMTFNEPRVIAALGFDSGS  216

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
             + P  CS  +   C  GNSATEPY  AHHL+L+HAAAV  YR++YQAKQ G+I I+++  
Sbjct  217   NPPNRCSKPYG-NCTAGNSATEPYIAAHHLILSHAAAVKRYRKRYQAKQQGRIGILLDFV  275

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             WYEPLT+S  D  A QRA DF++GWFL P++ GEYP+++ + VG+RLPKF+  E  ++KG
Sbjct  276   WYEPLTSSLEDNYAAQRARDFHIGWFLHPLVYGEYPKTMQNIVGERLPKFTKREVNIVKG  335

Query  1415  SYDYLGVNHYTTWYASS---TDTNIMGLFLHDTLTDSGTFTLPF---KGLMPIGERANAV  1576
              +D++GVNHYT++Y  +   T+T+  G            + + F   K  +PIG RAN+ 
Sbjct  336   GFDFVGVNHYTSYYMYNPNWTETSPPGY--------QADWNVGFAFEKNGVPIGPRANSG  387

Query  1577  WLYIVPRGMRNLMNYIKDKYGNPLVFITENGMDDAKT----DGLNDIKRIRYHRDYLKSL  1744
             WLYIVP G+   + Y+K+ YGNP +F++ENGMDD       +GL+D  RI Y+R YL+ L
Sbjct  388   WLYIVPWGVNKAVTYVKENYGNPYMFLSENGMDDPGNVTYLEGLHDSTRINYYRSYLQEL  447

Query  1745  LAAIKEDGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
              AAI ++G NV GYFAWSL+DN+EW +G+++RFG+ Y+D++D L R PK SA WFK  L
Sbjct  448   KAAI-DNGANVNGYFAWSLLDNFEWLLGYTARFGIVYMDFND-LSRHPKMSAYWFKQLL  504



>ref|XP_009757932.1| PREDICTED: beta-glucosidase 44-like [Nicotiana sylvestris]
Length=515

 Score =   496 bits (1276),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 259/473 (55%), Positives = 327/473 (69%), Gaps = 9/473 (2%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             +SR SFP+GF+FGTA++AYQ EGA   DGRG +IWDTF   PG   + +N +VAVDQYHR
Sbjct  43    LSRESFPKGFIFGTATSAYQVEGAASTDGRGPSIWDTFIKRPGVEPNNANGEVAVDQYHR  102

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             Y EDI+L+ ++  +AYRFSI+WSRIFPNGTGK+N  GV +YN LID +L  GI PY  L 
Sbjct  103   YKEDIDLLANLNFEAYRFSISWSRIFPNGTGKVNWKGVAYYNRLIDYMLERGITPYANLN  162

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             HYDLPQAL++RYNGWL+R+V+KD+A YAE CF  FGDRVK W + NEPR +  LGYD G 
Sbjct  163   HYDLPQALQDRYNGWLSREVVKDYADYAEFCFKTFGDRVKNWFSFNEPRVVAALGYDTGF  222

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
              APG CS  F   C  G+SATEPY VAH+L+L HA A   YR KYQ KQ GK  I+++  
Sbjct  223   FAPGRCSKPFG-NCTEGDSATEPYIVAHNLILCHATAAQRYREKYQEKQKGKFGILLDFV  281

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             WYEPLT   AD  A QRA DF+LGWFL P++ GEYP+++ + VG RLPKF+  E  ++KG
Sbjct  282   WYEPLTRGKADNYAAQRARDFHLGWFLHPLVYGEYPKTMQNIVGKRLPKFTKEEVKMVKG  341

Query  1415  SYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVP  1594
             S D LG+N YT +Y             +    + G F    KG+ PIG RA++ WLYIVP
Sbjct  342   SIDLLGINQYTAYYMYDPHYTTPQPLGYQQDWNVG-FAYDRKGV-PIGPRAHSDWLYIVP  399

Query  1595  RGMRNLMNYIKDKYGNPLVFITENGMDDAKT----DGLNDIKRIRYHRDYLKSLLAAIKE  1762
              G+   +NY+K++YGNP + + ENGMD A        L D KRI Y++ YLK L   + E
Sbjct  400   WGLHKAVNYVKERYGNPTMILAENGMDYAGNITLPKALYDTKRIAYYKSYLKELKKTVDE  459

Query  1763  DGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
              G NV GYFAWSL+DN+EW +G++SRFG+ YVD+ + L+R PK SA WFK  L
Sbjct  460   -GANVIGYFAWSLVDNFEWRLGYTSRFGIVYVDF-NTLKRYPKLSALWFKKLL  510



>ref|XP_006490742.1| PREDICTED: beta-glucosidase 44-like [Citrus sinensis]
Length=519

 Score =   496 bits (1276),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 256/473 (54%), Positives = 332/473 (70%), Gaps = 9/473 (2%)
 Frame = +2

Query  515   ISRASFPEGFVFGTASAAYQFEGAVKEDGRGATIWDTFAHTPGKVTDFSNADVAVDQYHR  694
             +SR S P GFVFGTA++AYQ EG   ++GRG +IWD FA  PG V + +  DV+VDQYHR
Sbjct  47    LSRESLPNGFVFGTATSAYQVEGMAHKEGRGPSIWDVFAKKPGIVANNATGDVSVDQYHR  106

Query  695   YLEDIELMKDMGMDAYRFSIAWSRIFPNGTGKLNQAGVDHYNNLIDALLANGIEPYVTLY  874
             Y ED+++M ++  DAYRFSI+WSRIFP GTGK+N  GV +YN LI+ LL  GI PY  LY
Sbjct  107   YKEDVDIMANLNFDAYRFSISWSRIFPYGTGKVNWKGVAYYNQLINYLLKRGITPYANLY  166

Query  875   HYDLPQALENRYNGWLNRQVIKDFAAYAETCFLIFGDRVKQWVTINEPRSITVLGYDLGV  1054
             HYDLP+ALE +YNG L+++V+KDFA YA+ CF  FGDRVK W+T NEPR +  LGYD G 
Sbjct  167   HYDLPEALEKKYNGLLSKRVVKDFADYADFCFKTFGDRVKNWMTFNEPRVVAALGYDNGF  226

Query  1055  HAPGHCSIFFHLLCPTGNSATEPYFVahhlllahaaaVDIYRRKYQAKQGGKITIVVESF  1234
              APG CS  F   C  GNSATEPY VAH+L+L+HAAAV  YR+KY+ KQ G+I I+++  
Sbjct  227   FAPGRCSKAFG-NCTVGNSATEPYIVAHNLILSHAAAVQRYRQKYEQKQKGRIGILLDFV  285

Query  1235  WYEPLTNSPADIDAKQRAIDFYLGWFLEPVMTGEYPRSVISRVGDRLPKFSAAESALLKG  1414
             WYEPLT S AD  A QRA DF++GWF+ P++ GEYP+++ + VG+RLPKF+  E  ++KG
Sbjct  286   WYEPLTRSKADNYAAQRARDFHVGWFIHPIVYGEYPKTMQNIVGNRLPKFTKEEVKMVKG  345

Query  1415  SYDYLGVNHYTTWYASSTDTNIMGLFLHDTLTDSGTFTLPFKGLMPIGERANAVWLYIVP  1594
             S D++G+N YT +Y             +    ++G F     G+ PIG RAN+ WLY VP
Sbjct  346   SIDFVGINQYTAYYMYDPHLKKPKQVGYQQDWNAG-FAYEKNGV-PIGPRANSYWLYNVP  403

Query  1595  RGMRNLMNYIKDKYGNPLVFITENGMDDAKT----DGLNDIKRIRYHRDYLKSLLAAIKE  1762
              GM   + YIK++YGNP V ++ENGMDD        GL+D  RI Y++ YL  L  A+ +
Sbjct  404   WGMYKALMYIKERYGNPTVILSENGMDDPGNVTLPKGLHDTTRINYYKGYLTQLKKAV-D  462

Query  1763  DGCNVKGYFAWSLMDNWEWTVGFSSRFGLYYVDYDDNLRRIPKESAKWFKNFL  1921
             DG NV GYFAWSL+DN+EW +G++SRFG+ YVD+   L+R PK SA WFK  L
Sbjct  463   DGANVVGYFAWSLLDNFEWRLGYTSRFGIVYVDF-TTLKRYPKMSAYWFKQLL  514



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6173933421468