BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24168_g1_i2 len=776 path=[1112:0-80 77:81-143 140:144-261
2460:262-346 1460:347-386 1500:387-414 1528:415-442 1556:443-627
1741:628-666 253:667-706 293:707-775]

Length=776
                                                                      Score     E

emb|CDP11794.1|  unnamed protein product                                130   2e-33   
ref|XP_004289158.1|  PREDICTED: uncharacterized protein LOC101296241    127   2e-32   
ref|XP_008342109.1|  PREDICTED: uncharacterized protein LOC103404925    124   7e-31   
ref|XP_006447535.1|  hypothetical protein CICLE_v10018096mg             122   2e-30   
ref|XP_007149965.1|  hypothetical protein PHAVU_005G114300g             119   3e-29   
gb|KDO59828.1|  hypothetical protein CISIN_1g042038mg                   119   3e-29   
ref|XP_007217405.1|  hypothetical protein PRUPE_ppa024052mg             119   4e-29   
ref|XP_003539504.1|  PREDICTED: uncharacterized protein LOC100800442    116   6e-28   
gb|KHN36542.1|  hypothetical protein glysoja_001273                     113   8e-27   
ref|XP_006367292.1|  PREDICTED: uncharacterized protein LOC102586598    112   2e-26   
ref|XP_010324093.1|  PREDICTED: uncharacterized protein LOC104648479    111   4e-26   
gb|KCW89420.1|  hypothetical protein EUGRSUZ_A01719                     110   7e-26   
ref|XP_008803237.1|  PREDICTED: uncharacterized protein LOC103716838    113   2e-25   
ref|XP_003543384.2|  PREDICTED: uncharacterized protein LOC100807939    106   3e-24   
ref|XP_002529744.1|  conserved hypothetical protein                     106   3e-24   Ricinus communis
gb|KDO75530.1|  hypothetical protein CISIN_1g044545mg                   106   4e-24   
ref|XP_003541944.1|  PREDICTED: uncharacterized protein LOC100783184    105   5e-24   
ref|XP_010931901.1|  PREDICTED: uncharacterized protein LOC105052688    105   6e-24   
ref|XP_009342270.1|  PREDICTED: uncharacterized protein LOC103934260    107   4e-23   
ref|XP_002302881.1|  hypothetical protein POPTR_0002s23100g             102   7e-23   Populus trichocarpa [western balsam poplar]
ref|XP_008803236.1|  PREDICTED: uncharacterized protein LOC103716837    102   1e-22   
ref|XP_006449078.1|  hypothetical protein CICLE_v10018014mg             102   1e-22   
ref|XP_008224850.1|  PREDICTED: uncharacterized protein LOC103324556    100   3e-22   
ref|XP_007045609.1|  Late embryogenesis abundant hydroxyproline-r...    100   4e-22   
ref|XP_010931925.1|  PREDICTED: uncharacterized protein LOC105052703  99.8    1e-21   
ref|NP_001236865.1|  uncharacterized protein LOC100306568             99.4    1e-21   
gb|KHN41205.1|  hypothetical protein glysoja_017249                   99.4    1e-21   
gb|KHN30465.1|  hypothetical protein glysoja_033203                   98.2    3e-21   
ref|XP_006574316.1|  PREDICTED: uncharacterized protein LOC102659599  98.2    4e-21   
ref|XP_010098577.1|  hypothetical protein L484_026019                 95.5    4e-20   
ref|XP_003543385.2|  PREDICTED: uncharacterized protein LOC100808471  94.4    7e-20   
ref|XP_004515079.1|  PREDICTED: uncharacterized protein LOC101496950  94.0    1e-19   
ref|XP_006363837.1|  PREDICTED: uncharacterized protein LOC102596623  94.0    1e-19   
ref|XP_007212448.1|  hypothetical protein PRUPE_ppa017248mg           93.6    2e-19   
ref|XP_009340961.1|  PREDICTED: uncharacterized protein LOC103933033  92.8    3e-19   
ref|XP_002316605.1|  hypothetical protein POPTR_0011s00510g           92.8    3e-19   Populus trichocarpa [western balsam poplar]
ref|XP_009357569.1|  PREDICTED: uncharacterized protein LOC103948284  92.4    4e-19   
ref|XP_004233608.1|  PREDICTED: uncharacterized protein LOC101244452  92.0    6e-19   
ref|XP_006593281.1|  PREDICTED: uncharacterized protein LOC100800449  90.1    7e-19   
ref|XP_009618005.1|  PREDICTED: uncharacterized protein LOC104110256  91.7    8e-19   
ref|XP_008384235.1|  PREDICTED: uncharacterized protein LOC103446858  91.7    8e-19   
ref|XP_007026001.1|  Late embryogenesis abundant hydroxyproline-r...  91.3    1e-18   
ref|XP_008230144.1|  PREDICTED: uncharacterized protein LOC103329447  90.1    1e-18   
ref|XP_009788045.1|  PREDICTED: uncharacterized protein LOC104235912  90.5    2e-18   
ref|XP_011096157.1|  PREDICTED: uncharacterized protein LOC105175420  90.1    3e-18   
ref|XP_010069624.1|  PREDICTED: uncharacterized protein LOC104456511  90.5    5e-18   
ref|XP_006826529.1|  hypothetical protein AMTR_s00004p00269390        89.0    7e-18   
ref|XP_009417238.1|  PREDICTED: uncharacterized protein LOC103997671  88.6    8e-18   
ref|XP_011000705.1|  PREDICTED: uncharacterized protein LOC105108198  88.2    1e-17   
ref|XP_004487716.1|  PREDICTED: uncharacterized protein LOC101490975  89.7    5e-17   
ref|XP_002518521.1|  conserved hypothetical protein                   86.7    5e-17   Ricinus communis
ref|XP_004511451.1|  PREDICTED: uncharacterized protein LOC101510765  86.3    5e-17   
ref|XP_003597010.1|  hypothetical protein MTR_2g088610                85.9    7e-17   
gb|KEH29659.1|  late embryogenesis abundant hydroxyproline-rich g...  85.1    1e-16   
gb|KEH29660.1|  late embryogenesis abundant protein                   84.3    2e-16   
ref|XP_004487719.1|  PREDICTED: uncharacterized protein LOC101491919  83.2    2e-16   
ref|XP_010109519.1|  hypothetical protein L484_018254                 84.3    3e-16   
ref|XP_007157156.1|  hypothetical protein PHAVU_002G047300g           83.2    7e-16   
ref|XP_004170140.1|  PREDICTED: uncharacterized protein LOC101232393  82.8    8e-16   
ref|XP_003597014.1|  hypothetical protein MTR_2g088680                82.0    1e-15   
gb|KCW75363.1|  hypothetical protein EUGRSUZ_E04109                   82.0    2e-15   
gb|AII99860.1|  late embryogenesis abundant protein                   79.7    9e-15   
ref|XP_008465308.1|  PREDICTED: uncharacterized protein LOC103502964  79.0    2e-14   
ref|XP_004487718.1|  PREDICTED: uncharacterized protein LOC101491611  77.8    4e-14   
ref|XP_007033816.1|  Harpin-induced 1, putative                       74.7    7e-13   
ref|XP_010095491.1|  hypothetical protein L484_014918                 73.2    1e-12   
ref|XP_008371183.1|  PREDICTED: uncharacterized protein LOC103434605  72.0    2e-12   
ref|XP_009352837.1|  PREDICTED: uncharacterized protein LOC103944145  73.2    2e-12   
ref|XP_002884549.1|  hypothetical protein ARALYDRAFT_896701           73.2    2e-12   
gb|KDP20784.1|  hypothetical protein JCGZ_21255                       72.8    2e-12   
ref|XP_007132564.1|  hypothetical protein PHAVU_011G105400g           72.8    4e-12   
ref|XP_007205880.1|  hypothetical protein PRUPE_ppa011272mg           72.4    4e-12   
ref|XP_010921236.1|  PREDICTED: uncharacterized protein LOC105044876  72.0    5e-12   
gb|KEH29664.1|  late embryogenesis abundant hydroxyproline-rich g...  70.5    2e-11   
ref|XP_010059636.1|  PREDICTED: COBRA-like protein 10                 73.9    2e-11   
ref|XP_006408003.1|  hypothetical protein EUTSA_v10022344mg           70.5    2e-11   
gb|EYU25166.1|  hypothetical protein MIMGU_mgv1a014071mg              69.7    4e-11   
ref|XP_010036040.1|  PREDICTED: uncharacterized protein LOC104425143  69.3    5e-11   
ref|XP_008801006.1|  PREDICTED: uncharacterized protein LOC103715222  68.9    7e-11   
emb|CDY05218.1|  BnaC05g45850D                                        67.8    1e-10   
ref|XP_007135148.1|  hypothetical protein PHAVU_010G105100g           68.2    1e-10   
ref|XP_010523771.1|  PREDICTED: uncharacterized protein LOC104802047  68.2    2e-10   
ref|NP_683533.1|  Late embryogenesis abundant (LEA) hydroxyprolin...  67.0    3e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010464163.1|  PREDICTED: uncharacterized protein LOC104744760  67.0    3e-10   
ref|XP_009129622.1|  PREDICTED: uncharacterized protein LOC103854440  66.6    3e-10   
ref|XP_011076469.1|  PREDICTED: uncharacterized protein LOC105160687  67.0    4e-10   
ref|XP_003521609.1|  PREDICTED: uncharacterized protein LOC100811806  66.6    4e-10   
emb|CDY27724.1|  BnaA05g31330D                                        66.6    4e-10   
ref|XP_004305063.1|  PREDICTED: uncharacterized protein LOC101292145  66.6    6e-10   
ref|XP_011076471.1|  PREDICTED: uncharacterized protein LOC105160688  66.6    6e-10   
ref|XP_002876246.1|  hypothetical protein ARALYDRAFT_485817           66.6    6e-10   
ref|XP_003560138.1|  PREDICTED: uncharacterized protein LOC100829856  66.2    6e-10   
ref|XP_008349106.1|  PREDICTED: uncharacterized protein LOC103412298  65.5    8e-10   
ref|XP_011076473.1|  PREDICTED: uncharacterized protein LOC105160690  66.2    9e-10   
ref|XP_006842622.1|  hypothetical protein AMTR_s00077p00180970        65.9    9e-10   
ref|XP_003610688.1|  hypothetical protein MTR_5g005950                65.5    9e-10   
ref|XP_010261404.1|  PREDICTED: uncharacterized protein LOC104600249  66.2    9e-10   
gb|KHN13121.1|  hypothetical protein glysoja_044779                   65.5    9e-10   
ref|XP_010251606.1|  PREDICTED: uncharacterized protein LOC104593459  65.9    1e-09   
ref|XP_002323694.2|  hypothetical protein POPTR_0016s14900g           65.9    1e-09   Populus trichocarpa [western balsam poplar]
ref|XP_006381280.1|  hypothetical protein POPTR_0006s11350g           65.5    1e-09   
ref|XP_007140029.1|  hypothetical protein PHAVU_008G078300g           65.1    2e-09   
ref|NP_001151664.1|  harpin-induced protein                           65.9    2e-09   Zea mays [maize]
ref|XP_007038863.1|  Late embryogenesis abundant hydroxyproline-r...  65.1    2e-09   
ref|XP_004293054.1|  PREDICTED: uncharacterized protein LOC101299162  67.4    2e-09   
ref|XP_010434631.1|  PREDICTED: uncharacterized protein LOC104718532  64.3    3e-09   
ref|XP_011006239.1|  PREDICTED: uncharacterized protein LOC105112288  64.7    4e-09   
ref|XP_008244315.1|  PREDICTED: uncharacterized protein LOC103342465  64.3    4e-09   
ref|XP_008670458.1|  PREDICTED: uncharacterized protein LOC103647718  64.3    5e-09   
ref|XP_010525241.1|  PREDICTED: uncharacterized protein LOC104803064  63.9    5e-09   
ref|XP_001776895.1|  predicted protein                                63.5    6e-09   
ref|XP_008388400.1|  PREDICTED: uncharacterized protein LOC103450790  63.5    6e-09   
ref|XP_003543987.1|  PREDICTED: uncharacterized protein LOC100804569  65.5    6e-09   
ref|XP_007219590.1|  hypothetical protein PRUPE_ppa023497mg           65.1    6e-09   
emb|CDO98059.1|  unnamed protein product                              64.3    7e-09   
ref|XP_001775349.1|  predicted protein                                62.8    7e-09   
ref|XP_009413332.1|  PREDICTED: uncharacterized protein LOC103994657  63.9    8e-09   
ref|XP_008232966.1|  PREDICTED: uncharacterized protein LOC103332053  63.5    8e-09   
ref|XP_002968170.1|  hypothetical protein SELMODRAFT_17213            62.8    9e-09   
ref|XP_006477513.1|  PREDICTED: uncharacterized protein LOC102620163  63.2    1e-08   
gb|KDO36298.1|  hypothetical protein CISIN_1g045946mg                 63.2    1e-08   
ref|XP_004306727.1|  PREDICTED: uncharacterized protein LOC101306460  63.2    1e-08   
ref|XP_003551627.1|  PREDICTED: uncharacterized protein LOC100802530  62.8    1e-08   
ref|XP_009124946.1|  PREDICTED: uncharacterized protein LOC103849997  62.4    1e-08   
ref|XP_009399918.1|  PREDICTED: uncharacterized protein LOC103984192  62.4    1e-08   
ref|XP_003560139.1|  PREDICTED: uncharacterized protein LOC100830161  62.4    1e-08   
emb|CDY18837.1|  BnaAnng03020D                                        62.0    2e-08   
ref|XP_009803964.1|  PREDICTED: uncharacterized protein LOC104249272  62.8    2e-08   
gb|KDP25370.1|  hypothetical protein JCGZ_20526                       62.4    2e-08   
ref|XP_008804677.1|  PREDICTED: uncharacterized protein LOC103717897  62.0    2e-08   
gb|ACU19833.1|  unknown                                               62.0    2e-08   Glycine max [soybeans]
ref|XP_010067292.1|  PREDICTED: uncharacterized protein LOC104454202  61.6    3e-08   
ref|XP_006826533.1|  hypothetical protein AMTR_s00004p00269550        60.5    3e-08   
ref|XP_010504211.1|  PREDICTED: uncharacterized protein LOC104781281  62.0    3e-08   
ref|XP_004492604.1|  PREDICTED: uncharacterized protein LOC101511623  61.2    3e-08   
emb|CDP08749.1|  unnamed protein product                              62.0    3e-08   
gb|KCW88466.1|  hypothetical protein EUGRSUZ_A00854                   61.6    3e-08   
ref|XP_006439452.1|  hypothetical protein CICLE_v10023929mg           61.6    4e-08   
ref|XP_009597586.1|  PREDICTED: uncharacterized protein LOC104093535  61.6    4e-08   
ref|XP_009337828.1|  PREDICTED: uncharacterized protein LOC103930251  61.2    4e-08   
gb|KEH18783.1|  late embryogenesis abundant protein                   61.6    4e-08   
ref|XP_003548621.1|  PREDICTED: uncharacterized protein LOC100799820  61.6    4e-08   
ref|XP_010515937.1|  PREDICTED: uncharacterized protein LOC104791691  61.6    5e-08   
ref|XP_002277286.1|  PREDICTED: uncharacterized protein LOC100258567  61.2    5e-08   Vitis vinifera
ref|XP_003534194.1|  PREDICTED: uncharacterized protein LOC100793858  62.0    5e-08   
ref|XP_007038869.1|  Uncharacterized protein TCM_015287               60.8    6e-08   
ref|XP_010427088.1|  PREDICTED: uncharacterized protein LOC104711998  61.2    7e-08   
ref|XP_010060068.1|  PREDICTED: uncharacterized protein LOC104447999  60.1    8e-08   
ref|XP_010937311.1|  PREDICTED: uncharacterized protein LOC105056...  60.8    8e-08   
gb|EYU25165.1|  hypothetical protein MIMGU_mgv1a013680mg              60.5    8e-08   
ref|XP_010937290.1|  PREDICTED: uncharacterized protein LOC105056...  60.8    9e-08   
ref|XP_004957892.1|  PREDICTED: uncharacterized protein LOC101770229  60.1    9e-08   
ref|XP_010937299.1|  PREDICTED: uncharacterized protein LOC105056...  60.5    1e-07   
gb|AGU36451.1|  hypothetical protein                                  59.7    1e-07   
ref|XP_002531822.1|  conserved hypothetical protein                   59.7    2e-07   Ricinus communis
ref|XP_002509872.1|  conserved hypothetical protein                   60.1    2e-07   Ricinus communis
emb|CDP20614.1|  unnamed protein product                              59.7    2e-07   
ref|XP_009391139.1|  PREDICTED: uncharacterized protein LOC103977372  59.7    2e-07   
ref|XP_008239012.1|  PREDICTED: uncharacterized protein LOC103337622  59.3    2e-07   
ref|XP_002279706.1|  PREDICTED: uncharacterized protein LOC100258307  59.7    3e-07   Vitis vinifera
ref|XP_009370863.1|  PREDICTED: uncharacterized protein LOC103960171  58.9    3e-07   
gb|EMS47199.1|  hypothetical protein TRIUR3_20290                     58.5    3e-07   
ref|XP_008463309.1|  PREDICTED: uncharacterized protein LOC103501497  58.9    4e-07   
ref|XP_002462941.1|  hypothetical protein SORBIDRAFT_02g035010        58.2    4e-07   Sorghum bicolor [broomcorn]
ref|XP_008345576.1|  PREDICTED: uncharacterized protein LOC103408507  58.2    5e-07   
ref|XP_008792375.1|  PREDICTED: uncharacterized protein LOC103709005  58.9    5e-07   
ref|XP_002511928.1|  conserved hypothetical protein                   58.5    5e-07   Ricinus communis
ref|XP_010278954.1|  PREDICTED: uncharacterized protein LOC104612979  58.2    5e-07   
ref|XP_010036039.1|  PREDICTED: uncharacterized protein LOC104425142  58.2    5e-07   
gb|AGU36446.1|  hypothetical protein                                  57.8    6e-07   
gb|EAZ40060.1|  hypothetical protein OsJ_24506                        58.5    6e-07   Oryza sativa Japonica Group [Japonica rice]
gb|AGU36449.1|  hypothetical protein                                  57.8    6e-07   
gb|AGU36448.1|  hypothetical protein                                  57.8    7e-07   
ref|XP_010278917.1|  PREDICTED: uncharacterized protein LOC104612950  58.2    7e-07   
ref|XP_008777264.1|  PREDICTED: uncharacterized protein LOC103697223  58.2    7e-07   
gb|EYU21543.1|  hypothetical protein MIMGU_mgv1a013195mg              58.2    8e-07   
ref|NP_001275944.1|  uncharacterized protein LOC102587329             58.2    8e-07   
gb|KHN18825.1|  hypothetical protein glysoja_045345                   57.8    8e-07   
gb|EYU40055.1|  hypothetical protein MIMGU_mgv1a018374mg              57.0    1e-06   
ref|XP_011093079.1|  PREDICTED: uncharacterized protein LOC105173120  57.8    1e-06   
ref|XP_009334502.1|  PREDICTED: uncharacterized protein LOC103927318  57.4    1e-06   
ref|XP_004143964.1|  PREDICTED: uncharacterized protein LOC101212153  57.4    1e-06   
ref|XP_008347313.1|  PREDICTED: uncharacterized protein LOC103410386  57.4    1e-06   
emb|CAN72107.1|  hypothetical protein VITISV_044045                   57.8    1e-06   Vitis vinifera
gb|AGU36443.1|  hypothetical protein                                  57.0    1e-06   
ref|XP_010907059.1|  PREDICTED: uncharacterized protein LOC105033825  57.8    1e-06   
ref|XP_008382630.1|  PREDICTED: uncharacterized protein LOC103445373  57.4    1e-06   
gb|EMT12100.1|  hypothetical protein F775_20394                       57.4    1e-06   
ref|XP_008779021.1|  PREDICTED: uncharacterized protein LOC103698755  57.8    1e-06   
ref|XP_007210661.1|  hypothetical protein PRUPE_ppa022176mg           57.4    1e-06   
gb|AGU36453.1|  hypothetical protein                                  57.0    1e-06   
ref|XP_006573794.1|  PREDICTED: uncharacterized protein LOC102667904  56.6    1e-06   
ref|XP_006300138.1|  hypothetical protein CARUB_v10016367mg           56.6    2e-06   
ref|XP_010527200.1|  PREDICTED: uncharacterized protein LOC104804584  57.0    2e-06   
ref|XP_002284574.1|  PREDICTED: uncharacterized protein LOC100254347  57.0    2e-06   Vitis vinifera
ref|XP_010251607.1|  PREDICTED: uncharacterized protein LOC104593460  56.6    2e-06   
emb|CAN63322.1|  hypothetical protein VITISV_022239                   58.2    2e-06   Vitis vinifera
ref|XP_010055074.1|  PREDICTED: uncharacterized protein LOC104443400  57.0    2e-06   
emb|CBI28084.3|  unnamed protein product                              57.0    2e-06   
ref|XP_010937278.1|  PREDICTED: uncharacterized protein LOC105056680  57.0    2e-06   
ref|XP_001778135.1|  predicted protein                                56.6    2e-06   
ref|XP_002462942.1|  hypothetical protein SORBIDRAFT_02g035020        57.0    2e-06   Sorghum bicolor [broomcorn]
ref|XP_010251950.1|  PREDICTED: uncharacterized protein LOC104593682  56.6    2e-06   
ref|XP_008234898.1|  PREDICTED: uncharacterized protein LOC103333786  56.6    3e-06   
gb|AGU36457.1|  hypothetical protein                                  56.2    3e-06   
ref|XP_009375608.1|  PREDICTED: uncharacterized protein LOC103964401  56.2    3e-06   
ref|XP_010229652.1|  PREDICTED: uncharacterized protein LOC104582058  55.8    3e-06   
gb|AGU36444.1|  hypothetical protein                                  56.2    3e-06   
ref|XP_002264899.3|  PREDICTED: uncharacterized protein LOC100253618  56.2    3e-06   Vitis vinifera
tpg|DAA41029.1|  TPA: harpin-induced protein                          55.8    3e-06   
gb|KDP28555.1|  hypothetical protein JCGZ_14326                       56.2    3e-06   
ref|XP_009103910.1|  PREDICTED: uncharacterized protein LOC103829969  56.2    3e-06   
gb|AGU36447.1|  hypothetical protein                                  55.8    4e-06   
gb|AGU36445.1|  hypothetical protein                                  55.8    4e-06   
ref|NP_001233914.1|  plant cell wall protein SlTFR88                  55.8    5e-06   
ref|XP_007022217.1|  Late embryogenesis abundant hydroxyproline-r...  55.1    5e-06   
ref|XP_007152822.1|  hypothetical protein PHAVU_004G162700g           56.2    5e-06   
ref|XP_006658623.1|  PREDICTED: uncharacterized protein LOC102716708  55.5    5e-06   
ref|XP_009418806.1|  PREDICTED: uncharacterized protein LOC103998921  55.8    6e-06   
gb|EYU40056.1|  hypothetical protein MIMGU_mgv1a022222mg              55.1    6e-06   
ref|XP_004959712.1|  PREDICTED: uncharacterized protein LOC101756040  55.5    6e-06   
ref|XP_007040367.1|  Late embryogenesis abundant hydroxyproline-r...  55.1    6e-06   
ref|XP_004512968.1|  PREDICTED: uncharacterized protein LOC101515080  55.8    6e-06   
ref|XP_010529410.1|  PREDICTED: uncharacterized protein LOC104806281  55.1    6e-06   
ref|XP_010924768.1|  PREDICTED: uncharacterized protein LOC105047520  55.8    6e-06   
ref|XP_011095190.1|  PREDICTED: uncharacterized protein LOC105174699  55.5    6e-06   
ref|XP_003626628.1|  hypothetical protein MTR_8g005060                55.1    7e-06   
gb|ABE93043.1|  Harpin-induced 1                                      54.7    7e-06   Medicago truncatula
ref|XP_004300828.1|  PREDICTED: uncharacterized protein LOC101295630  55.1    7e-06   
ref|XP_011077650.1|  PREDICTED: uncharacterized protein LOC105161611  54.7    7e-06   
emb|CDP10944.1|  unnamed protein product                              55.1    8e-06   
ref|XP_004510083.1|  PREDICTED: uncharacterized protein LOC101494...  54.7    8e-06   
ref|XP_009368774.1|  PREDICTED: uncharacterized protein LOC103958250  55.1    8e-06   
ref|XP_009394853.1|  PREDICTED: uncharacterized protein LOC103980249  55.1    9e-06   
ref|XP_006291779.1|  hypothetical protein CARUB_v10017950mg           55.5    9e-06   
ref|XP_010916767.1|  PREDICTED: uncharacterized protein LOC105041504  55.1    9e-06   
ref|XP_006381279.1|  hypothetical protein POPTR_0006s11340g           54.3    9e-06   
gb|KHN24292.1|  hypothetical protein glysoja_049047                   54.3    1e-05   
emb|CDP12088.1|  unnamed protein product                              54.7    1e-05   
ref|XP_010105722.1|  hypothetical protein L484_014210                 54.7    1e-05   
ref|XP_010058302.1|  PREDICTED: uncharacterized protein LOC104446092  54.3    1e-05   
ref|XP_008368054.1|  PREDICTED: uncharacterized protein LOC103431655  54.7    1e-05   
ref|XP_003534956.1|  PREDICTED: uncharacterized protein LOC100777377  54.3    1e-05   
emb|CAQ58621.1|  unknown                                              53.5    1e-05   Vitis vinifera
ref|XP_010054770.1|  PREDICTED: uncharacterized protein LOC104443115  54.7    1e-05   
ref|XP_010036037.1|  PREDICTED: uncharacterized protein LOC104425140  54.3    1e-05   
gb|KHN12300.1|  hypothetical protein glysoja_026192                   53.9    1e-05   
emb|CDP06360.1|  unnamed protein product                              54.3    1e-05   
gb|EYU35113.1|  hypothetical protein MIMGU_mgv1a013462mg              54.3    2e-05   
ref|XP_003611050.1|  hypothetical protein MTR_5g009910                53.5    2e-05   
gb|AGU36456.1|  hypothetical protein                                  53.9    2e-05   
ref|XP_010113042.1|  hypothetical protein L484_022768                 54.3    2e-05   
gb|KFK34673.1|  hypothetical protein AALP_AA5G176600                  54.3    2e-05   
ref|XP_010922821.1|  PREDICTED: uncharacterized protein LOC105046037  53.9    2e-05   
ref|XP_010092873.1|  hypothetical protein L484_022468                 54.3    2e-05   
ref|XP_010054771.1|  PREDICTED: uncharacterized protein LOC104443116  53.5    2e-05   
emb|CDY07553.1|  BnaC06g15110D                                        54.7    2e-05   
ref|XP_010532848.1|  PREDICTED: uncharacterized protein LOC104808...  53.9    2e-05   
ref|XP_010532846.1|  PREDICTED: uncharacterized protein LOC104808...  53.9    2e-05   
ref|XP_004142665.1|  PREDICTED: uncharacterized protein LOC101208230  53.9    2e-05   
ref|XP_011074234.1|  PREDICTED: uncharacterized protein LOC105158998  53.1    2e-05   
ref|XP_008801697.1|  PREDICTED: uncharacterized protein LOC103715738  53.9    3e-05   
ref|XP_010662664.1|  PREDICTED: uncharacterized protein LOC104882184  53.1    3e-05   
ref|XP_010112610.1|  hypothetical protein L484_006690                 53.5    3e-05   
ref|XP_004166270.1|  PREDICTED: uncharacterized LOC101212153          52.8    3e-05   
ref|XP_006657007.1|  PREDICTED: uncharacterized protein LOC102720718  52.8    3e-05   
gb|KDO64202.1|  hypothetical protein CISIN_1g028279mg                 53.1    3e-05   
ref|XP_010036038.1|  PREDICTED: uncharacterized protein LOC104425141  53.1    4e-05   
ref|XP_009334504.1|  PREDICTED: uncharacterized protein LOC103927320  53.1    4e-05   
ref|XP_004309173.1|  PREDICTED: uncharacterized protein LOC101303177  53.1    4e-05   
ref|XP_009421423.1|  PREDICTED: uncharacterized protein LOC104000979  53.1    4e-05   
ref|XP_004300835.1|  PREDICTED: uncharacterized protein LOC101297644  52.8    4e-05   
ref|XP_008437350.1|  PREDICTED: uncharacterized protein LOC103482794  53.1    4e-05   
gb|EPS65262.1|  hypothetical protein M569_09519                       52.8    5e-05   
ref|XP_010049704.1|  PREDICTED: uncharacterized protein LOC104438290  53.1    5e-05   
ref|XP_001761483.1|  predicted protein                                52.4    6e-05   
ref|XP_008234816.1|  PREDICTED: uncharacterized protein LOC103333700  52.0    6e-05   
ref|XP_009786428.1|  PREDICTED: transmembrane protein 106C            52.4    7e-05   
ref|XP_008781642.1|  PREDICTED: uncharacterized protein LOC103701379  52.8    7e-05   
ref|NP_001150368.1|  harpin-induced protein                           52.0    7e-05   
emb|CDY42881.1|  BnaC08g46850D                                        52.4    8e-05   
ref|XP_007051691.1|  Late embryogenesis abundant (LEA) hydroxypro...  52.4    8e-05   
ref|XP_008345651.1|  PREDICTED: uncharacterized protein LOC103408589  52.0    8e-05   
gb|EMS62984.1|  hypothetical protein TRIUR3_12723                     52.4    8e-05   
ref|XP_004309172.1|  PREDICTED: uncharacterized protein LOC101302889  52.4    9e-05   
ref|XP_011080841.1|  PREDICTED: uncharacterized protein LOC105164000  52.4    9e-05   
ref|XP_007219159.1|  hypothetical protein PRUPE_ppa016330mg           51.6    9e-05   
ref|XP_010098050.1|  hypothetical protein L484_026181                 51.6    9e-05   
ref|NP_190988.1|  late embryogenesis abundant hydroxyproline-rich...  52.4    1e-04   
ref|XP_007022216.1|  Late embryogenesis abundant hydroxyproline-r...  52.4    1e-04   
ref|XP_007140030.1|  hypothetical protein PHAVU_008G078400g           52.0    1e-04   
ref|XP_007040372.1|  Late embryogenesis abundant hydroxyproline-r...  51.6    1e-04   
ref|XP_004494916.1|  PREDICTED: uncharacterized protein LOC101515208  52.0    1e-04   
gb|EMT30184.1|  hypothetical protein F775_21234                       51.6    1e-04   
ref|XP_007040368.1|  Late embryogenesis abundant hydroxyproline-r...  51.6    2e-04   
ref|XP_007038868.1|  Late embryogenesis abundant hydroxyproline-r...  51.2    2e-04   
gb|AAO19373.1|  hypothetical protein                                  52.0    2e-04   
ref|XP_009107688.1|  PREDICTED: uncharacterized protein LOC103833354  51.2    2e-04   
ref|XP_002272642.1|  PREDICTED: uncharacterized protein LOC100241699  51.2    2e-04   
gb|EYU42063.1|  hypothetical protein MIMGU_mgv1a013760mg              51.2    2e-04   
ref|XP_010662657.1|  PREDICTED: uncharacterized protein LOC104882181  51.2    2e-04   
ref|XP_004300825.1|  PREDICTED: uncharacterized protein LOC101294764  50.4    2e-04   
gb|KFK36217.1|  hypothetical protein AALP_AA4G093100                  50.8    2e-04   
ref|XP_010653100.1|  PREDICTED: uncharacterized protein LOC100248515  51.2    2e-04   
ref|XP_006414934.1|  hypothetical protein EUTSA_v10026222mg           50.8    2e-04   
ref|XP_003577129.1|  PREDICTED: uncharacterized protein LOC100838218  51.2    2e-04   
dbj|BAJ98808.1|  predicted protein                                    51.2    2e-04   
ref|XP_002466929.1|  hypothetical protein SORBIDRAFT_01g016860        50.8    3e-04   
ref|XP_006429659.1|  hypothetical protein CICLE_v10012748mg           50.8    3e-04   
ref|XP_006368771.1|  hypothetical protein POPTR_0001s09980g           50.1    3e-04   
ref|XP_009394597.1|  PREDICTED: uncharacterized protein LOC103980037  50.8    3e-04   
ref|XP_004963692.1|  PREDICTED: uncharacterized protein LOC101753786  50.4    3e-04   
ref|XP_003559726.1|  PREDICTED: uncharacterized protein LOC100830877  50.4    3e-04   
ref|XP_004986428.1|  PREDICTED: uncharacterized protein LOC101782835  50.4    3e-04   
ref|XP_010105721.1|  hypothetical protein L484_014209                 50.4    3e-04   
ref|XP_007219125.1|  hypothetical protein PRUPE_ppa015851mg           49.3    3e-04   
ref|XP_007134597.1|  hypothetical protein PHAVU_010G060100g           50.1    3e-04   
ref|XP_010534001.1|  PREDICTED: uncharacterized protein LOC104809652  50.4    3e-04   
gb|AAM62885.1|  unknown                                               50.4    4e-04   
gb|KDP21825.1|  hypothetical protein JCGZ_00612                       50.4    4e-04   
gb|EAZ01153.1|  hypothetical protein OsI_23182                        50.4    4e-04   
ref|XP_001757818.1|  predicted protein                                49.7    4e-04   
ref|XP_009628224.1|  PREDICTED: transmembrane protein 106C            50.1    4e-04   
ref|XP_007202533.1|  hypothetical protein PRUPE_ppa011027mg           50.1    5e-04   
ref|XP_008805654.1|  PREDICTED: uncharacterized protein LOC103718555  50.1    5e-04   
ref|XP_009347170.1|  PREDICTED: uncharacterized protein LOC103938851  50.1    5e-04   
ref|XP_008382741.1|  PREDICTED: uncharacterized protein LOC103445465  50.1    5e-04   
dbj|BAD61666.1|  hypothetical protein                                 50.4    5e-04   
ref|XP_004309174.1|  PREDICTED: uncharacterized protein LOC101303468  49.3    6e-04   
ref|XP_007040369.1|  Late embryogenesis abundant hydroxyproline-r...  49.3    6e-04   
ref|XP_010058292.1|  PREDICTED: uncharacterized protein LOC104446083  49.3    7e-04   
gb|KHG14734.1|  Aspartyl/glutamyl-tRNA (Asn/Gln) amidotransferase...  49.7    7e-04   
emb|CDY61168.1|  BnaA08g29800D                                        49.7    7e-04   
ref|XP_010662783.1|  PREDICTED: uncharacterized protein LOC104882207  49.3    8e-04   
ref|NP_001050978.1|  Os03g0696000                                     49.3    9e-04   
ref|XP_002439974.1|  hypothetical protein SORBIDRAFT_09g023690        49.3    9e-04   
ref|XP_009334503.1|  PREDICTED: uncharacterized protein LOC103927319  49.3    0.001   



>emb|CDP11794.1| unnamed protein product [Coffea canephora]
Length=191

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 96/160 (60%), Gaps = 2/160 (1%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYY  383
             T+ KP+ P I P   +L NV   LFP  SL+A++ +  TI N NYG   ++N++  V Y
Sbjct  34   FTVFKPKDPLIKPLPAKLENVQFQLFPTLSLNATMGINATIYNRNYGGFQFKNSTTFVDY  93

Query  384  RDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVK  563
            R   + A+PL++G+VPARG++++    N+   K+ +S  F +D G+G LNFT+ A +  K
Sbjct  94   RGMNIAAIPLEEGSVPARGKLNISTIANITAEKLVTSPYFWQDFGSGRLNFTSTANLHGK  153

Query  564  VTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
              VL  FKF   V   CD+SV+V  Q  DV   C +KLK+
Sbjct  154  AVVLNVFKFDAKVFSTCDISVQVLSQEVDV--DCTAKLKL  191



>ref|XP_004289158.1| PREDICTED: uncharacterized protein LOC101296241 [Fragaria vesca 
subsp. vesca]
Length=163

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 95/160 (59%), Gaps = 2/160 (1%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYY  383
            LT+ KP+ PEI      + N+   LFP  +L+ +L+M +TI N NYG  S++NA+A V Y
Sbjct  6    LTVFKPKQPEISARPVGVENIQYTLFPNVTLNVTLSMLVTINNKNYGSFSFKNATAYVTY  65

Query  384  RDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVK  563
             DT V  +P++   VPARG+I++    +L G K+ S+  F+EDV +G  N  + A +  K
Sbjct  66   HDTVVALVPMEHAFVPARGKINITTSVDLMGDKLISNPHFMEDVTSGIFNLISTADLHGK  125

Query  564  VTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
            VTVLK  KF  +    CD+S  +  Q  D  S C SKLK+
Sbjct  126  VTVLKFVKFGATAFSTCDISFSIKTQQID--SKCKSKLKM  163



>ref|XP_008342109.1| PREDICTED: uncharacterized protein LOC103404925 [Malus domestica]
Length=192

 Score =   124 bits (311),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 100/160 (63%), Gaps = 3/160 (2%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPN-YGDCSYRNASAEVY  380
            LTILKP+ P I      ++N+  +LFP  +L+ +LNM ITI+N N  G   Y+NA+A V 
Sbjct  34   LTILKPKQPIIDAKPVGVQNIQFSLFPSATLNVTLNMLITIENRNRIGSFKYKNATAYVQ  93

Query  381  YRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPV  560
            YRD+ V  +P+Q   VPARG++++    +L G  + S+ +F+ DV +GSLN T++A +  
Sbjct  94   YRDSIVAEVPIQADFVPARGKVNMTTSVDLMGETLLSNPNFMSDVASGSLNMTSIASLHG  153

Query  561  KVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLK  680
            +V+VL   KFH +    CD+S  +  ++ D  S C SK+K
Sbjct  154  RVSVLNFLKFHATALSTCDISCSILTKTID--SKCKSKMK  191



>ref|XP_006447535.1| hypothetical protein CICLE_v10018096mg [Citrus clementina]
 gb|ESR60775.1| hypothetical protein CICLE_v10018096mg [Citrus clementina]
Length=187

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 102/185 (55%), Gaps = 5/185 (3%)
 Frame = +3

Query  132  KICCFTTallliaiviaavcailFLTILKPRAPEIIPHRTRLRNVTVAL-FPEPSLSASL  308
            KICC  TA+ L   VI        LTI KP+ PEI  H   L N+T    +P  +L+A+L
Sbjct  7    KICCGVTAIFLFIFVILITTLS--LTIFKPKQPEITAHPVALENITTGGGYPNVTLNATL  64

Query  309  NMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVA  488
             M +TI N NYG   YRN +A V YR   V  +P++   VPARG+I++    +L   K+ 
Sbjct  65   RMIVTIDNRNYGSFKYRNTTAHVNYRGGIVADVPIEAALVPARGKINISTSADLMADKLL  124

Query  489  SSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCA  668
            SS  FL D+ +GSLN T+VA +  +VT+LK    H      CD ++    Q  D  S C 
Sbjct  125  SSPYFLGDIESGSLNLTSVANLHGEVTMLKFLSLHARAMSTCDFTLWTKTQKVD--SNCK  182

Query  669  SKLKI  683
            SK+K+
Sbjct  183  SKIKL  187



>ref|XP_007149965.1| hypothetical protein PHAVU_005G114300g [Phaseolus vulgaris]
 gb|ESW21959.1| hypothetical protein PHAVU_005G114300g [Phaseolus vulgaris]
Length=186

 Score =   119 bits (299),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 92/160 (58%), Gaps = 2/160 (1%)
 Frame = +3

Query  201  FLTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVY  380
            FLT+ KPR P+II     L +  ++L    + + SL M IT++NPNYG   Y  A+  V 
Sbjct  28   FLTVFKPRDPDIIVQPVGLEHFDLSLMSNLTSNVSLGMVITMENPNYGSFEYPKATGYVN  87

Query  381  YRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPV  560
            + DT V  +P+Q  +VPAR QI V    N    K+ + ++F  DV TGSLNFT+ A MP 
Sbjct  88   FHDTVVGEVPIQGESVPAREQITVTTSANFMPQKLVADSNFFPDVLTGSLNFTSTAAMPG  147

Query  561  KVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLK  680
            KV + K FK   +V   C  S+ ++  S +V S C SK+K
Sbjct  148  KVRMFKIFKLKATVYCTCYFSMNIA--SSNVNSNCISKIK  185



>gb|KDO59828.1| hypothetical protein CISIN_1g042038mg [Citrus sinensis]
Length=187

 Score =   119 bits (299),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 101/185 (55%), Gaps = 5/185 (3%)
 Frame = +3

Query  132  KICCFTTallliaiviaavcailFLTILKPRAPEIIPHRTRLRNVTVAL-FPEPSLSASL  308
            KICC  TA+ L   VI        LTI KP+ PEI  H   L N+T    +P  +L+A+L
Sbjct  7    KICCGVTAIFLFIFVILITTLS--LTIFKPKQPEITAHPVALENITTGGGYPNVTLNATL  64

Query  309  NMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVA  488
             M +TI N NYG   YRN +A V YR   V  +P++   VPARG+I++    +L   K+ 
Sbjct  65   RMIVTIDNRNYGSFKYRNTTAHVNYRGGIVADVPIEAALVPARGKINISTSADLMADKLL  124

Query  489  SSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCA  668
            SS   L D+ +GSLN T+VA +  +VT+LK    H      CD ++    Q  D  S C 
Sbjct  125  SSPYVLGDIESGSLNLTSVANLHGEVTMLKFLSLHARAMSTCDFTLWTKTQKVD--SNCK  182

Query  669  SKLKI  683
            SK+K+
Sbjct  183  SKIKL  187



>ref|XP_007217405.1| hypothetical protein PRUPE_ppa024052mg [Prunus persica]
 gb|EMJ18604.1| hypothetical protein PRUPE_ppa024052mg [Prunus persica]
Length=191

 Score =   119 bits (299),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 98/156 (63%), Gaps = 2/156 (1%)
 Frame = +3

Query  216  KPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRDTP  395
            KP+ P+I      L N+  +LFP  +L+ +L M ITI+N NYG   Y+N++A V+YR++ 
Sbjct  38   KPKDPKINAKPVGLENIQFSLFPNVTLNVTLGMLITIENRNYGSFMYKNSTAYVHYRNSV  97

Query  396  VTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVL  575
            V  +P++   VPARG+I+     +L+   + S+ +F+ DV +GSLN T+ A +  KV++L
Sbjct  98   VAEVPIEGELVPARGKINTTTSVDLNAETLISNPNFIADVTSGSLNMTSTASLHGKVSLL  157

Query  576  KTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
            K FKF  +    C++S  +  +S D  S CASK+K+
Sbjct  158  KIFKFPATAFSTCNISFFILTKSID--SKCASKIKL  191



>ref|XP_003539504.1| PREDICTED: uncharacterized protein LOC100800442 [Glycine max]
 gb|KHN25782.1| hypothetical protein glysoja_040657 [Glycine soja]
Length=186

 Score =   116 bits (290),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 59/161 (37%), Positives = 91/161 (57%), Gaps = 2/161 (1%)
 Frame = +3

Query  201  FLTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVY  380
            F+TI KP+ PEI  H   L +   +L P  +++ +L M ITI+NPNYG   Y+N++  V 
Sbjct  28   FMTIFKPKNPEITVHPVGLEDFQFSLSPNLTINVTLGMIITIRNPNYGSFEYKNSTGYVN  87

Query  381  YRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPV  560
            + DT V  +P++   VPARGQI+V    +    K+ +  +FL DV  G+LNFT+   +P 
Sbjct  88   FHDTVVAEVPIEAELVPARGQINVNTSADFMVEKLINDPNFLSDVLGGTLNFTSTTALPG  147

Query  561  KVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
            K  +    K   +    CD+SV +S +  D  + C  K+K+
Sbjct  148  KARMFNIIKLKATSYSSCDISVNISSRKVD--TNCNYKIKL  186



>gb|KHN36542.1| hypothetical protein glysoja_001273 [Glycine soja]
Length=186

 Score =   113 bits (283),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 92/161 (57%), Gaps = 2/161 (1%)
 Frame = +3

Query  201  FLTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVY  380
            F+TI KP+ PEI  H   L +   +  P  +L+ +L M ITI+NPNYG   Y N+++ V 
Sbjct  28   FMTIFKPKNPEITVHPVGLEDFQSSFSPNLTLNVTLGMIITIRNPNYGSFQYINSTSYVK  87

Query  381  YRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPV  560
            + DT V  +P++   VPAR QI+V    +    K+ +  +FL DV  G+LNFT+   +P 
Sbjct  88   FHDTVVAEVPIEAELVPARSQINVNTSADFMVAKLINDPNFLSDVLGGTLNFTSTIALPG  147

Query  561  KVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
            K  +L   K   +    CD+SV +S ++ D  + C SK+K+
Sbjct  148  KARMLNIIKLKATSYSTCDISVNISSRNVD--TNCKSKIKL  186



>ref|XP_006367292.1| PREDICTED: uncharacterized protein LOC102586598 [Solanum tuberosum]
Length=195

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 95/162 (59%), Gaps = 2/162 (1%)
 Frame = +3

Query  201  FLTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNA-SAEV  377
            F TILKP+ P+II H   L  +   +    SL+ SL + ITIKNPNYG   + ++ S+ +
Sbjct  35   FHTILKPKKPQIILHPISLDEIESQILSRLSLNVSLRLIITIKNPNYGSFKFEDSISSLI  94

Query  378  YYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMP  557
            Y+ +  V  + ++ G VP++G+++  ++ N+ G K+  S  F++D+  GSLNF +   + 
Sbjct  95   YHGNNSVGEIVIEHGTVPSKGELNTRSYANITGDKLVKSPYFIKDIEAGSLNFISYLTLN  154

Query  558  VKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
             KV +LK FK H  V   CD+S+ V       LS C SK+++
Sbjct  155  GKVKMLKIFKIHAIVNSYCDISILVHSHLAIQLS-CHSKVRL  195



>ref|XP_010324093.1| PREDICTED: uncharacterized protein LOC104648479 [Solanum lycopersicum]
Length=195

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 67/188 (36%), Positives = 109/188 (58%), Gaps = 4/188 (2%)
 Frame = +3

Query  123  KSRKICCFTTallliaiviaavcailFLTILKPRAPEIIPHRTRLRNVTVALFPEPSLSA  302
            K+ KICC  +  L I ++I ++    F TILKP+ P+II H   L  +   +    SL+ 
Sbjct  11   KNFKICCGVSLFLSIILIIVSITL--FHTILKPKKPQIILHPISLDEIESEILSRLSLNV  68

Query  303  SLNMTITIKNPNYGDCSYRNASAE-VYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGH  479
            SL + ITIKNPNYG   + ++ A  +Y+ +  V  + ++ G VP++G+++  ++ N+ G 
Sbjct  69   SLRLIITIKNPNYGSFKFEDSIASLIYHGNNSVGEIVIEHGIVPSKGELNTRSYANITGD  128

Query  480  KVASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLS  659
            K+  S  F +D+  G+LNFT+   +  KV +LK FK H +V   CD+S+ V       LS
Sbjct  129  KLVKSPYFTKDIEAGNLNFTSNLTLHGKVKMLKIFKIHATVNSYCDISILVHSHLAIQLS  188

Query  660  TCASKLKI  683
             C SK+++
Sbjct  189  -CHSKVRL  195



>gb|KCW89420.1| hypothetical protein EUGRSUZ_A01719, partial [Eucalyptus grandis]
Length=182

 Score =   110 bits (275),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 64/189 (34%), Positives = 103/189 (54%), Gaps = 9/189 (5%)
 Frame = +3

Query  117  APKSRKICCFTTallliaiviaavcailFLTILKPRAPEIIPHRTRLRNVTVALFPEPSL  296
            A +  K+CC T+ + L+ ++   V      TI KP+ P+I      L+N    +      
Sbjct  3    ARRRLKLCCITSVVFLVILIAIIVTLS--FTIFKPKDPQITIQPVGLKNFNFNI-----T  55

Query  297  SASLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDG  476
              +LN  +TI NPNYG   Y+N +  V YR + V  +P+    +PAR ++++   T+L  
Sbjct  56   GVTLNTLVTIHNPNYGSFEYKNVTGYVNYRGSTVAEVPIAHNKIPARAKVNMTTSTDLIV  115

Query  477  HKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVL  656
             K+ S+ SF ED+G+G LNF+A A +P KV++ K FKF  +    C + + +  QS D  
Sbjct  116  GKLISNPSFWEDIGSGYLNFSATATLPGKVSLAKIFKFRATTYTSCYILIYI--QSQDAD  173

Query  657  STCASKLKI  683
            S C +K+K+
Sbjct  174  SKCITKIKL  182



>ref|XP_008803237.1| PREDICTED: uncharacterized protein LOC103716838 [Phoenix dactylifera]
Length=359

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/199 (33%), Positives = 110/199 (55%), Gaps = 3/199 (2%)
 Frame = +3

Query  87   KNSQNTMEITAPKSRKICCFTTallliaiviaavcailFLTILKPRAPEIIPHRTRLRNV  266
            K   N M   + +  K+CCF   +++  +++ A+  + F TI  P+ P++      L+++
Sbjct  164  KKPMNMMNAKSRRGLKLCCFPACVVVGLLLVVALVILWF-TIFMPKDPQVEVKPADLQHL  222

Query  267  TVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQI  446
             + +FP  +L+ +L + + IKN NY D  Y N +  +YYR+  V   P++ G + AR   
Sbjct  223  DLGVFPSLTLNLTLGLDVGIKNSNYEDFMYHNTTTSIYYREVFVGQAPIEAGRIDARSTT  282

Query  447  DVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSV  626
            ++     L   K+ S+  F +D+ +GSLNFTA+  +  KV  LK FK H S+ I CDMS+
Sbjct  283  NISTVAELQALKLISNKCFSQDILSGSLNFTALLSIEGKVVFLKIFKKHGSIHISCDMSI  342

Query  627  KVSDQSYDVLSTCASKLKI  683
             +   + +  S C SK+KI
Sbjct  343  FLQTSTSE--SNCRSKIKI  359


 Score =   111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 81/138 (59%), Gaps = 0/138 (0%)
 Frame = +3

Query  210  ILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRD  389
            +LKP+ P+++     +R++   LFP P+L  SL++ I IKNPNY    Y N +  +YYR 
Sbjct  1    MLKPKQPQVVETPVNIRSIKFGLFPTPTLKISLDIDIFIKNPNYAAFEYDNTTTSIYYRG  60

Query  390  TPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVKVT  569
              V   PL+ G++ AR   ++    +L   K+ S+  FL D+ +GSLN T+ + +  K  
Sbjct  61   VLVGLPPLEAGSIDARATKNITTVADLQVEKIISNRYFLPDIASGSLNLTSSSNLEGKAI  120

Query  570  VLKTFKFHVSVTIRCDMS  623
            +LK FK H S+ + CD+S
Sbjct  121  LLKIFKLHASIHVSCDIS  138



>ref|XP_003543384.2| PREDICTED: uncharacterized protein LOC100807939 [Glycine max]
 gb|KHN36543.1| hypothetical protein glysoja_001274 [Glycine soja]
Length=175

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 88/161 (55%), Gaps = 2/161 (1%)
 Frame = +3

Query  201  FLTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVY  380
            F TI +P+ P II H     N   +L    + + SL M ITI+N NY +  Y NA+  + 
Sbjct  17   FFTIFRPKDPNIIVHPVGFENFNPSLLTNVTANVSLGMLITIENSNYENFEYPNATGYIK  76

Query  381  YRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPV  560
            + DT V  +P+    VP R QI+V    N    K+ +  +FL D  +G +NFT+ A +P 
Sbjct  77   FHDTVVGQVPIVGELVPPRSQINVNTSANFMVAKLINDPNFLSDFLSGIVNFTSTASLPG  136

Query  561  KVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
            K  +LK  KF  +V   CD+S+ ++ ++ D  S C SK+K+
Sbjct  137  KAHMLKIIKFKATVYSSCDISLNITSRNVD--SKCISKIKL  175



>ref|XP_002529744.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32651.1| conserved hypothetical protein [Ricinus communis]
Length=189

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 91/160 (57%), Gaps = 5/160 (3%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYY  383
             TI KP+ P++  H + L N+ +A     + + +++M ITI NPNYG   +RN++  V Y
Sbjct  35   FTIFKPKDPQVFLHPSGLENLQLA---NITSNVTMDMVITIGNPNYGSFKFRNSTGYVNY  91

Query  384  RDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVK  563
            R   V  +P+ +  VPAR + ++    +L   K+ ++  F  D   G+LN TA A +  K
Sbjct  92   RGDVVGEIPVAEDLVPARSKTNITTSADLMAGKIMTNPEFFGDFLLGNLNMTATAVLHGK  151

Query  564  VTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
            V+VLK F  H +    C +SV V+  S D+ STC SK+K+
Sbjct  152  VSVLKIFNLHATTFTTCYISVFVN--SRDIQSTCKSKIKL  189



>gb|KDO75530.1| hypothetical protein CISIN_1g044545mg [Citrus sinensis]
Length=191

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 91/161 (57%), Gaps = 2/161 (1%)
 Frame = +3

Query  201  FLTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVY  380
            F T+ KP+ P+I      L  + +  FP   L+ +L + +T+ N NYG   Y+N +A V 
Sbjct  33   FFTLFKPKEPKITAKPVDLEKINLLFFPTIQLNVTLGVVVTVDNRNYGGFKYQNGTAYVS  92

Query  381  YRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPV  560
            Y    V   P++DG +PARG+ ++ +   +   K+ S+++FL D+ +G +NF++   +  
Sbjct  93   YHGVVVAEAPVEDGRIPARGKQNISSSLTIFADKLISNSNFLGDILSGVMNFSSTTTLHG  152

Query  561  KVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
            +V VLK FK   + +  CD+S+ +  Q  D  S C SK+++
Sbjct  153  EVIVLKYFKQKATSSSSCDISIVLQSQIID--SVCESKVEL  191



>ref|XP_003541944.1| PREDICTED: uncharacterized protein LOC100783184 [Glycine max]
 gb|KHN36544.1| hypothetical protein glysoja_001275 [Glycine soja]
Length=186

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 87/161 (54%), Gaps = 2/161 (1%)
 Frame = +3

Query  201  FLTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVY  380
            F T+ KP+ P I  H   L +   +L P  + + SL M ITI+NPNYG   + N+   + 
Sbjct  28   FFTVFKPKDPNITVHPIGLEHFDFSLLPNITANVSLGMVITIENPNYGSFEFTNSIGYIN  87

Query  381  YRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPV  560
            + DT V  +P+    VPA GQI+V    N    K+ S   F  DV +G+LNFT+ + +P 
Sbjct  88   FHDTVVGEVPIGAELVPAHGQINVNTWANFMVAKLISVPKFWSDVLSGTLNFTSTSSLPG  147

Query  561  KVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
               + K FK   +    C++S+++  ++ D  + C SK+K+
Sbjct  148  IARMFKIFKLKATAYSSCNISLRIVPRNVD--TKCISKIKL  186



>ref|XP_010931901.1| PREDICTED: uncharacterized protein LOC105052688 [Elaeis guineensis]
Length=188

 Score =   105 bits (262),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 56/161 (35%), Positives = 88/161 (55%), Gaps = 2/161 (1%)
 Frame = +3

Query  201  FLTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVY  380
            + T+ KP+ P+I+     L+N+   L P PSL+ SL + + I+N NY    Y N +  +Y
Sbjct  30   YFTMFKPKQPQIVATPVNLQNIEFQLSPSPSLNISLGLDVLIRNRNYAGFKYDNTTTFIY  89

Query  381  YRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPV  560
            YR   V   P++ G + AR    +    +L   K+ S+ SFL DV +GSLN T+ ++   
Sbjct  90   YRGVLVGLAPIEAGTIDARSTESISTVVDLQVEKIISNPSFLPDVISGSLNLTSSSEQEG  149

Query  561  KVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
             V +L  FK H S  + CD+SV V  ++    S C +K++I
Sbjct  150  DVVLLNKFKLHASTLVSCDISVFVFTRNSS--SICNAKVRI  188



>ref|XP_009342270.1| PREDICTED: uncharacterized protein LOC103934260 [Pyrus x bretschneideri]
Length=470

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 62/161 (39%), Positives = 99/161 (61%), Gaps = 3/161 (2%)
 Frame = +3

Query  114  TAPKSRKICCFTTallliaiviaavcailFLTILKPRAPEIIPHRTRLRNVTVALFPEPS  293
            T+ +  KICC  TA+ L+ ++I        LTILK + P I      ++N+  +LFP  +
Sbjct  6    TSRRGLKICCGATAIFLVIVIIILTTLS--LTILKLKQPIIDAKPVGVQNIQFSLFPSAT  63

Query  294  LSASLNMTITIKNPN-YGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNL  470
            L+ +LNM ITI+N N  G   Y+NA+A V+YRD+ V  +P+Q   VPARG++++    +L
Sbjct  64   LNVTLNMLITIENRNRIGSFKYKNATAYVHYRDSIVAEVPIQADFVPARGKVNMTTSVDL  123

Query  471  DGHKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFH  593
             G  + S+ +F+ DV +GSLN T++A +  +V++L   K H
Sbjct  124  MGETILSNPNFMSDVASGSLNMTSIASLHGRVSILNFLKLH  164



>ref|XP_002302881.1| hypothetical protein POPTR_0002s23100g [Populus trichocarpa]
 gb|EEE82154.1| hypothetical protein POPTR_0002s23100g [Populus trichocarpa]
Length=187

 Score =   102 bits (255),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 99/191 (52%), Gaps = 4/191 (2%)
 Frame = +3

Query  111  ITAPKSRKICCFTTallliaiviaavcailFLTILKPRAPEIIPHRTRLRNVTVALFPEP  290
            +T  +  KICC  T + +I +          LT+ KP+ P II +   L N+     P  
Sbjct  1    MTRMRGFKICCGVTTIFIIILAAVFTTLA--LTVFKPKNPSIIANPVGLENIQFGGSPNV  58

Query  291  SLSASLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNL  470
            +L+ +L M +TI NPNYG   + N++A V Y    V  +P+Q   +PA  ++++    +L
Sbjct  59   TLNVTLGMVVTIDNPNYGSFKFTNSTAYVDYHGVIVAEVPIQADLIPAHSKVNITTSVDL  118

Query  471  DGHKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYD  650
                +  +  FL+D+  G  NF + + +  KV V+K  K H +    CD+++ V+  S D
Sbjct  119  MADALIKNPYFLQDLIAGRFNFVSTSSLHGKVEVIKILKLHATALSTCDITLFVTSLSID  178

Query  651  VLSTCASKLKI  683
              S+C S++K+
Sbjct  179  --SSCKSEIKL  187



>ref|XP_008803236.1| PREDICTED: uncharacterized protein LOC103716837 [Phoenix dactylifera]
Length=188

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/161 (35%), Positives = 86/161 (53%), Gaps = 2/161 (1%)
 Frame = +3

Query  201  FLTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVY  380
            + T+ KP+ PE++     LRN+   L P  +L+ SL + + +KN N     Y N +  +Y
Sbjct  30   YFTMFKPKQPEVVAKPVYLRNMEFGLLPVLTLNVSLGLDVFVKNRNRAGFKYDNTTTSIY  89

Query  381  YRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPV  560
            YR   V    ++ G + AR    +    +L   K+  + SFL DV +GSLNFT+ + +  
Sbjct  90   YRGVLVGVASIEAGTIDARATDVIPTVADLQAGKIILNPSFLPDVVSGSLNFTSSSNLEG  149

Query  561  KVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
             V +L  FK H S  + CD+SV +   S  + STC SK+KI
Sbjct  150  DVILLDIFKLHASTRVSCDISVFLMTSS--ISSTCHSKVKI  188



>ref|XP_006449078.1| hypothetical protein CICLE_v10018014mg [Citrus clementina]
 gb|ESR62318.1| hypothetical protein CICLE_v10018014mg [Citrus clementina]
Length=191

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 92/161 (57%), Gaps = 2/161 (1%)
 Frame = +3

Query  201  FLTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVY  380
            F T+ KP+ P+I      L  + +  FP   L+ +L + +T+ N NYG   Y+N +A V 
Sbjct  33   FFTLFKPKEPKITAKPVDLEKINLLFFPTIQLNVTLGVVVTVDNRNYGGFKYQNGTAYVS  92

Query  381  YRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPV  560
            YR   V   P++DG +PARG+ ++ +   +   K+ S+++FL D+ +G +NF++   +  
Sbjct  93   YRGVVVAEAPVEDGRIPARGKQNISSSLTIFADKLISNSNFLGDILSGVMNFSSTTTLHG  152

Query  561  KVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
            +V VLK FK   + +  CD+S+ +  Q  D  S C SK+++
Sbjct  153  EVIVLKYFKQKATSSSSCDISIVIQSQIID--SVCESKVEL  191



>ref|XP_008224850.1| PREDICTED: uncharacterized protein LOC103324556 [Prunus mume]
Length=191

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/162 (33%), Positives = 90/162 (56%), Gaps = 3/162 (2%)
 Frame = +3

Query  201  FLTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVY  380
            F+TI KP+ P I      L +  + + P   L+ S+ + IT+KNPNYG   Y N++A + 
Sbjct  30   FVTIFKPKEPSIFTKPVTLESFELVVTPVVRLNVSIGILITVKNPNYGGFKYENSTAHIS  89

Query  381  YRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDV-GTGSLNFTAVAKMP  557
            YR   V   P+++  +PAR   ++ +  ++   K+ + T F+ DV   G LNFT+   + 
Sbjct  90   YRGNVVAEAPIEEDTIPARATHNITSSVSILADKLVTDTHFMGDVILVGVLNFTSETTLH  149

Query  558  VKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
             KV++LK FK   +    C++S+ +  QS D  S C S++++
Sbjct  150  GKVSLLKVFKMKATSYSECNISITIKTQSAD--SVCKSRVEL  189



>ref|XP_007045609.1| Late embryogenesis abundant hydroxyproline-rich glycoprotein 
family, putative [Theobroma cacao]
 gb|EOY01441.1| Late embryogenesis abundant hydroxyproline-rich glycoprotein 
family, putative [Theobroma cacao]
Length=196

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 67/195 (34%), Positives = 105/195 (54%), Gaps = 9/195 (5%)
 Frame = +3

Query  114  TAPKSRKICCFTTallliaiviaavcailFLTILKPRAPEIIPHRTRLRNVT-----VAL  278
            T+ +  KICC  TA+ ++ I I  +      T+ KP+ PEI  +   L N+      +A+
Sbjct  6    TSRRGLKICCCVTAIFIVIIAIVLITLA--FTVFKPKNPEITVYPQGLENIAFDLQGLAM  63

Query  279  FPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVA  458
                + + ++ M I I N NYG   ++N +A V YR   V  +P+    VPA G++++  
Sbjct  64   LSNTTANVTVGMIIAINNRNYGSFKFKNTTALVNYRGGVVAEIPIIQSHVPAHGKLNITT  123

Query  459  HTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSD  638
            + +    K+ S+ SF  DV  GS+NFT+ A +  KVT+LK  K H SV   C +S+ V  
Sbjct  124  NADFMVDKLISNPSFWVDVMAGSVNFTSEATVRGKVTMLKILKMHASVPSSCYISIFV--  181

Query  639  QSYDVLSTCASKLKI  683
            QS  + S C +KLK+
Sbjct  182  QSQRIESICMTKLKL  196



>ref|XP_010931925.1| PREDICTED: uncharacterized protein LOC105052703 [Elaeis guineensis]
Length=189

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 83/161 (52%), Gaps = 2/161 (1%)
 Frame = +3

Query  201  FLTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVY  380
            + T+ KP+ PE+      +RN+   LFP P+L+ SL + I I N NY      N +  +Y
Sbjct  31   YFTMFKPKDPEVETTLVNIRNIEFGLFPTPTLNLSLALDIFINNRNYAAFKNDNTTTNIY  90

Query  381  YRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPV  560
            YR   V   P++ G V  RG  ++     +   K+ S+  FL D+ +G LN T+   M  
Sbjct  91   YRGVLVGLSPIEAGTVRPRGTKNISCVAKIQVEKIISNPYFLPDIASGPLNLTSSTNMDG  150

Query  561  KVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
            K  VLK FK   S+ + C++SV V   +    S C SK+++
Sbjct  151  KAMVLKIFKLRASIHVACNISVFVFSGNSS--SICESKIRM  189



>ref|NP_001236865.1| uncharacterized protein LOC100306568 [Glycine max]
 gb|ACU14798.1| unknown [Glycine max]
Length=184

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 83/160 (52%), Gaps = 4/160 (3%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYY  383
            LTI KP+ P+I  H   L N    L    + SA L + ITI NPNYG+  Y N+S  + Y
Sbjct  29   LTIFKPKNPDIFLHPVDLENF--QLLSPNTTSAPLGIVITIVNPNYGNFKYVNSSGYLKY  86

Query  384  RDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVK  563
            RDT +  +PL   + PAR   +V     +   K+     FL D+  G  N TA A +P K
Sbjct  87   RDTIIAEVPLGIRSFPARSTTNVSTTVGIMTDKLIQDPKFLSDIEGGVFNLTAEATLPGK  146

Query  564  VTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
            VT++K  +    + I C +S  +   + D  S+C SK+K+
Sbjct  147  VTMIKILRLKAKIYISCGVSFNI--IAVDASSSCMSKIKL  184



>gb|KHN41205.1| hypothetical protein glysoja_017249 [Glycine soja]
Length=184

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 83/160 (52%), Gaps = 4/160 (3%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYY  383
            LTI KP+ P+I  H   L N    L    + SA L + ITI NPNYG+  Y N+S  + Y
Sbjct  29   LTIFKPKNPDIFLHPVDLENF--QLLSPNTTSAPLGIVITIVNPNYGNFKYVNSSGYLKY  86

Query  384  RDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVK  563
            RDT +  +PL   + PAR   +V     +   K+     FL D+  G  N TA A +P K
Sbjct  87   RDTIIAEVPLGIRSFPARSTTNVSTTVGIMTDKLIQDPKFLSDIEGGVFNLTAEATLPGK  146

Query  564  VTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
            VT++K  +    + I C +S  +   + D  S+C SK+K+
Sbjct  147  VTMIKILRLKAKIYISCGVSFNI--ITVDASSSCMSKIKL  184



>gb|KHN30465.1| hypothetical protein glysoja_033203 [Glycine soja]
Length=186

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 68/197 (35%), Positives = 106/197 (54%), Gaps = 25/197 (13%)
 Frame = +3

Query  123  KSRKICCFTTallliaiviaavcailFLTILKPRAPEIIPHRTRLRNVTVALFPEPSLSA  302
            K  KICC  TALLLI +++  V    F TI KP+ P+I+    +L    + +FP   L+ 
Sbjct  5    KGLKICCGVTALLLIILIVVLVVL--FFTIFKPKDPDIVLQSVKLDGFKLEVFPTLKLNV  62

Query  303  SLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHK  482
            SL + +T++NPN+G  +Y+N++A +YYR   V   PL    +PAR           + H 
Sbjct  63   SLGIVVTVENPNHGSFTYQNSTAFLYYRGNLVAEAPLHQDTIPAR-----------NDHN  111

Query  483  VASS-TSFLE---------DVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKV  632
            +++S T F++         D   G +NFT+   +  KV VL  FK   +    CD+S+ V
Sbjct  112  ISTSLTIFVDLTKFKDLPSDYSGGVINFTSTTTLLGKVKVLDLFKIKATSYSTCDLSLFV  171

Query  633  SDQSYDVLSTCASKLKI  683
            +DQ+ +  STC S++K 
Sbjct  172  NDQTIN--STCNSEIKF  186



>ref|XP_006574316.1| PREDICTED: uncharacterized protein LOC102659599 [Glycine max]
Length=192

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 68/197 (35%), Positives = 106/197 (54%), Gaps = 25/197 (13%)
 Frame = +3

Query  123  KSRKICCFTTallliaiviaavcailFLTILKPRAPEIIPHRTRLRNVTVALFPEPSLSA  302
            K  KICC  TALLLI +++  V    F TI KP+ P+I+    +L    + +FP   L+ 
Sbjct  11   KGLKICCGVTALLLIILIVVLVVL--FFTIFKPKDPDIVLQSVKLDGFKLEVFPTLKLNV  68

Query  303  SLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHK  482
            SL + +T++NPN+G  +Y+N++A +YYR   V   PL    +PAR           + H 
Sbjct  69   SLGIVVTVENPNHGSFTYQNSTAFLYYRGNLVAEAPLHQDTIPAR-----------NDHN  117

Query  483  VASS-TSFLE---------DVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKV  632
            +++S T F++         D   G +NFT+   +  KV VL  FK   +    CD+S+ V
Sbjct  118  ISTSLTIFVDLTKFKDLPSDYSGGVINFTSTTTLLGKVKVLDLFKIKATSYSTCDLSLFV  177

Query  633  SDQSYDVLSTCASKLKI  683
            +DQ+ +  STC S++K 
Sbjct  178  NDQTIN--STCNSEIKF  192



>ref|XP_010098577.1| hypothetical protein L484_026019 [Morus notabilis]
 gb|EXB75237.1| hypothetical protein L484_026019 [Morus notabilis]
Length=188

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 66/189 (35%), Positives = 102/189 (54%), Gaps = 8/189 (4%)
 Frame = +3

Query  123  KSRKICCFTTallliaiviaavcailFLTILKPRAPEIIPHRTRLRNVTV-ALFPEPSLS  299
            K  +ICC  TA  LI + +       + T  KP+ PEI  +   L ++ V ++F   +++
Sbjct  6    KGLEICCGITATFLIVVALVFTTL--WFTTFKPKEPEITAYPVGLEDINVFSIFFVRNIT  63

Query  300  ASLNMTITIKN-PNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDG  476
              LNMTITI N  N G   ++NA+A V YR   V  +P+    VPARG+++     +L  
Sbjct  64   --LNMTITINNHRNVGSFEFKNATAYVNYRGGVVAEVPIGQNLVPARGKLNTTTSADLMV  121

Query  477  HKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVL  656
             K+ ++  F +DV  GSLN TA A +  KV + +  K   +    CD+S  ++  S +V 
Sbjct  122  GKIITNPVFFDDVAAGSLNLTATAALHGKVRLFEFVKIRATALSTCDISFSIA--SRNVQ  179

Query  657  STCASKLKI  683
            STC SK+K+
Sbjct  180  STCKSKIKL  188



>ref|XP_003543385.2| PREDICTED: uncharacterized protein LOC100808471 [Glycine max]
Length=173

 Score = 94.4 bits (233),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 71/121 (59%), Gaps = 0/121 (0%)
 Frame = +3

Query  201  FLTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVY  380
            F+TI KP+ PEI  H   L +   +  P  +L+ +L M ITI+NPNYG   Y N+++ V 
Sbjct  28   FMTIFKPKNPEITVHPVGLEDFQSSFSPNLTLNVTLGMIITIRNPNYGSFQYINSTSYVK  87

Query  381  YRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPV  560
            + DT V  +P++   VPAR QI+V    +    K+ +  +FL DV  G+LNFT+   +P 
Sbjct  88   FHDTVVAEVPIEAELVPARSQINVNTSADFMVAKLINDPNFLSDVLGGTLNFTSTIALPG  147

Query  561  K  563
            K
Sbjct  148  K  148



>ref|XP_004515079.1| PREDICTED: uncharacterized protein LOC101496950 [Cicer arietinum]
 ref|XP_004515080.1| PREDICTED: uncharacterized protein LOC101497504 [Cicer arietinum]
Length=192

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 100/188 (53%), Gaps = 8/188 (4%)
 Frame = +3

Query  123  KSRKICCFTTallliaiviaavcailFLTILKPRAPEIIPHRTRLRNVTVALFPEPSLS-  299
            +S KIC F + + LI +    +     LTI KP+ P++  +   L+++    F +P+++ 
Sbjct  12   RSLKICLFVSFIFLIIVATVIISLS--LTIFKPKNPDVSLYPIGLKDLQ---FFQPNVTI  66

Query  300  ASLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGH  479
              L + ITI NPNYG    +N +  + Y  T V  +P++   +PAR   +V A   L   
Sbjct  67   VPLGLIITIVNPNYGGFKTKNTTGFLNYHKTLVANVPIKTEFLPARSTTNVTAIAGLMTQ  126

Query  480  KVASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLS  659
             + S   FL D+  GS N TA A +  KV ++K FK   +V + CDM   ++  S+D  S
Sbjct  127  NLISDADFLSDIEDGSFNLTANATLHGKVHMIKVFKLKATVYLSCDMFFNIT--SFDTHS  184

Query  660  TCASKLKI  683
            +C +K+K+
Sbjct  185  SCITKIKV  192



>ref|XP_006363837.1| PREDICTED: uncharacterized protein LOC102596623 [Solanum tuberosum]
Length=192

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 81/161 (50%), Gaps = 2/161 (1%)
 Frame = +3

Query  201  FLTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVY  380
            + TILKP++P++      L  V +  FP   L+ ++ + +TI N NYG   Y ++ A V 
Sbjct  34   YFTILKPKSPKVTTQSVTLETVRLEPFPAFHLNITIGLILTIHNRNYGSFKYDSSRAYVT  93

Query  381  YRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPV  560
            YR  P    P++   +PAR   D+     +D    + + +FL D+ +G LNFT+   +  
Sbjct  94   YRGDPAAEAPIEADTIPARANHDLNTTVLVDSDGFSKNPNFLGDLFSGCLNFTSSTALHG  153

Query  561  KVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
            KVTV K  K        CD+SV    Q  +  S C SK+K 
Sbjct  154  KVTVWKVLKLKARTVSTCDISVFTKFQ--NATSVCKSKIKF  192



>ref|XP_007212448.1| hypothetical protein PRUPE_ppa017248mg [Prunus persica]
 gb|EMJ13647.1| hypothetical protein PRUPE_ppa017248mg [Prunus persica]
Length=194

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 85/157 (54%), Gaps = 3/157 (2%)
 Frame = +3

Query  216  KPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRDTP  395
            KP+ P I      L +  + + P   L+ S+ + IT+KNPNYG   Y N++A + YR   
Sbjct  38   KPKEPSIFTKPVTLESFELVVTPVVRLNVSIGILITVKNPNYGGFKYENSTAHISYRGNV  97

Query  396  VTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDV-GTGSLNFTAVAKMPVKVTV  572
            V   P++   +PAR   ++ +  ++   K+ + T FL DV   G LNFT+   +  KV++
Sbjct  98   VAEAPIEKDTIPARATHNITSSVSILADKLVTDTHFLGDVILVGVLNFTSETTLHGKVSL  157

Query  573  LKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
            LK F+   +    C++S+ +  QS D  S C SK+++
Sbjct  158  LKVFEMKATSYSECNISITIKTQSAD--SVCKSKVEL  192



>ref|XP_009340961.1| PREDICTED: uncharacterized protein LOC103933033 [Pyrus x bretschneideri]
Length=191

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/156 (31%), Positives = 81/156 (52%), Gaps = 2/156 (1%)
 Frame = +3

Query  216  KPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRDTP  395
            KP+ P +      L    +  FP   L+ S+ + +T+KNPNYG   Y N++A + Y    
Sbjct  36   KPKDPSVFTEPVSLEGFELVGFPVIKLNISIRILVTVKNPNYGGFKYENSTAYISYHGNV  95

Query  396  VTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVL  575
            V   P++D  VPAR   ++    ++   K+ + + FL D+  G LNFT+   +  KV + 
Sbjct  96   VAEAPIKDDTVPARSTHNMTTVLSILADKLVTDSHFLGDMVVGVLNFTSETTLHGKVNLW  155

Query  576  KTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
            K FK   +    C++S+ +  QS D  S C S++K+
Sbjct  156  KIFKMKAASYTDCNISITIGTQSAD--SVCKSRVKL  189



>ref|XP_002316605.1| hypothetical protein POPTR_0011s00510g [Populus trichocarpa]
 gb|EEE97217.1| hypothetical protein POPTR_0011s00510g [Populus trichocarpa]
Length=192

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 87/162 (54%), Gaps = 3/162 (2%)
 Frame = +3

Query  201  FLTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVY  380
            + T+ KP+ P+I P    L ++   +FP   L+ +L M IT++N NYG   Y+ ++A V 
Sbjct  33   YFTVFKPKEPKINPQPVILESIRWIIFPIQMLNITLGMVITVENRNYGSFKYQESTAYVS  92

Query  381  YRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGS-LNFTAVAKMP  557
            YR   V   P++   +PARG+ ++     +   K+ S  +F  ++  GS LNFT+   + 
Sbjct  93   YRGNVVAEAPIEADTIPARGKHNISTTVTMFADKLLSDDNFKRELLQGSILNFTSATTLH  152

Query  558  VKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
             KV + K  K   + +  CD+S+ V +Q  +  S C SK+ +
Sbjct  153  GKVILFKLIKAKATSSSTCDISIFVQEQQTE--SICKSKVGL  192



>ref|XP_009357569.1| PREDICTED: uncharacterized protein LOC103948284 [Pyrus x bretschneideri]
Length=191

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/156 (31%), Positives = 81/156 (52%), Gaps = 2/156 (1%)
 Frame = +3

Query  216  KPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRDTP  395
            KP+ P +      L    +  FP   L+ S+ + +T+KNPNYG   Y N++A + Y    
Sbjct  36   KPKDPSVFTEPVSLEGFELVGFPVIKLNISIRILVTVKNPNYGGFKYENSTAYISYHGNV  95

Query  396  VTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVL  575
            V   P++D  VPAR   ++    ++   K+ + + FL D+  G LNFT+   +  KV + 
Sbjct  96   VAEAPIKDDTVPARSTHNMTTVLSILADKLVTDSHFLGDMVVGVLNFTSETTLHGKVNLW  155

Query  576  KTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
            K FK   +    C++S+ +  QS D  S C S++K+
Sbjct  156  KIFKMKAASYTDCNISITIGTQSAD--SVCKSRVKL  189



>ref|XP_004233608.1| PREDICTED: uncharacterized protein LOC101244452 [Solanum lycopersicum]
Length=192

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 81/161 (50%), Gaps = 2/161 (1%)
 Frame = +3

Query  201  FLTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVY  380
            + TILKP++P++      L  V +  FP   L+ ++ + +TI N NYG   Y N+ A V 
Sbjct  34   YFTILKPKSPKVTTQSVALETVRLEPFPAFHLNITIGLILTIHNRNYGSFKYDNSRAYVT  93

Query  381  YRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPV  560
            YR  P     ++   +PAR   D+     +D    + + +FL D+ +G LNFT+   +  
Sbjct  94   YRGDPAAEALIEADTIPARADHDLNTTVLIDSDGFSKNPNFLGDLLSGCLNFTSSTALHG  153

Query  561  KVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
            KVTV K  K        CD+SV    Q  +  S C SK+K+
Sbjct  154  KVTVWKILKLKARTVSTCDISVFTKFQ--NASSVCKSKIKL  192



>ref|XP_006593281.1| PREDICTED: uncharacterized protein LOC100800449 [Glycine max]
Length=122

 Score = 90.1 bits (222),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 72/124 (58%), Gaps = 2/124 (2%)
 Frame = +3

Query  312  MTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVAS  491
            M ITI+NPNY +  Y NA+  V + DT V  +P+    VP R QI+V    N    K+ +
Sbjct  1    MLITIENPNYENFEYPNATGYVKFLDTVVGQVPIVGELVPPRSQINVNTSANFMVSKLIN  60

Query  492  STSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCAS  671
              +FL D  +G +NFT+ A +P K  +LK  KF  +V   CD+S+ ++ ++ D  S C S
Sbjct  61   DPNFLSDFLSGIVNFTSTASLPGKAHMLKIIKFKATVYSLCDISINITSRNVD--SNCIS  118

Query  672  KLKI  683
            K+KI
Sbjct  119  KIKI  122



>ref|XP_009618005.1| PREDICTED: uncharacterized protein LOC104110256 [Nicotiana tomentosiformis]
Length=192

 Score = 91.7 bits (226),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 81/161 (50%), Gaps = 2/161 (1%)
 Frame = +3

Query  201  FLTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVY  380
            + TILKP+ P++      L ++    FP   L+ ++ + +TI N NYG   Y ++ A V 
Sbjct  34   YFTILKPKDPKVTIQSVTLESIRFEPFPAFHLNITIGLILTIHNRNYGSFKYDSSRAYVT  93

Query  381  YRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPV  560
            YRD P    P++   +PAR   DV     ++    + + +FL D  +G LNFT+   +  
Sbjct  94   YRDDPAAEAPIEADTIPARKDHDVNTTVLINSDGFSKNPNFLGDFISGCLNFTSSTTLHG  153

Query  561  KVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
            KVTV K  K   +    CD+SV    Q  +  S C SK+K 
Sbjct  154  KVTVFKVLKLKATTVSICDISVFTKFQ--NASSLCKSKIKF  192



>ref|XP_008384235.1| PREDICTED: uncharacterized protein LOC103446858 [Malus domestica]
Length=191

 Score = 91.7 bits (226),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 48/156 (31%), Positives = 80/156 (51%), Gaps = 2/156 (1%)
 Frame = +3

Query  216  KPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRDTP  395
            KP+ P +      L       FP   L+ S+ + +T+KNPNYG   Y N++A + Y    
Sbjct  36   KPKDPSVFTEPVSLEGFEFVGFPVIKLNISIRILVTVKNPNYGGFKYENSTAHISYHGNV  95

Query  396  VTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVL  575
            V   P++D  VPAR   ++    ++   K+ + + FL ++  G LNFT+   +  KV + 
Sbjct  96   VAEAPIKDDTVPARSTHNMTTVLSILADKLVTDSHFLGELVVGVLNFTSETTLHGKVNLW  155

Query  576  KTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
            K FK   +    C++S+ +  QS D  S C S++K+
Sbjct  156  KIFKMKATSYTDCNISITIGTQSXD--SVCKSRVKL  189



>ref|XP_007026001.1| Late embryogenesis abundant hydroxyproline-rich glycoprotein 
family, putative [Theobroma cacao]
 gb|EOY28623.1| Late embryogenesis abundant hydroxyproline-rich glycoprotein 
family, putative [Theobroma cacao]
Length=184

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 99/184 (54%), Gaps = 4/184 (2%)
 Frame = +3

Query  132  KICCFTTallliaiviaavcailFLTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLN  311
            KICC  TA+L I +V+  V      T+ KP+ P+I P    L+++ + +FP    + SL 
Sbjct  5    KICCGVTAILFIIVVVVFVILT--FTLFKPKDPKITPQSVSLKSIDLVVFPVIKGNVSLG  62

Query  312  MTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVAS  491
            + +T+ NPNYG   Y N++A V YR   V    ++  ++PAR + ++     +   ++A+
Sbjct  63   LVVTVDNPNYGGFKYMNSTAYVNYRGNLVGEASIESDSIPARAKHNMSTTVIIFADRLAT  122

Query  492  STSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCAS  671
              +FL D   G LNFT+   +   V VL   K   S +  C++S+ V  +S D  S C +
Sbjct  123  DPNFLTDFLGGVLNFTSSTILHGTVRVLNLLKLKASSSSSCNISILVQTESVD--SVCKA  180

Query  672  KLKI  683
            K+++
Sbjct  181  KIRL  184



>ref|XP_008230144.1| PREDICTED: uncharacterized protein LOC103329447 [Prunus mume]
Length=155

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 69/109 (63%), Gaps = 0/109 (0%)
 Frame = +3

Query  228  PEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTAL  407
            P+I      L N+  +LFP  +L+ +L M ITI+N NYG   Y+N++A V+YR++ V  +
Sbjct  42   PKINAKPVGLENIQFSLFPNVTLNVTLGMLITIENRNYGSFKYKNSTAYVHYRNSVVAEV  101

Query  408  PLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKM  554
            P++   VPARG+I+     +L+   + S+ +F+ DV +GSLN T+ A +
Sbjct  102  PIEGELVPARGKINTTTSVDLEAETIISNPNFMADVTSGSLNMTSTASL  150



>ref|XP_009788045.1| PREDICTED: uncharacterized protein LOC104235912 [Nicotiana sylvestris]
Length=192

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 80/161 (50%), Gaps = 2/161 (1%)
 Frame = +3

Query  201  FLTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVY  380
            + TILKP+ P++      L ++    FP   L+ ++ + +TI N NYG   Y ++ A V 
Sbjct  34   YFTILKPKDPKVTIQSVTLESIRFEPFPAFHLNITIGLILTIHNRNYGSFKYDSSRAYVS  93

Query  381  YRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPV  560
            Y D P    P++   +PAR   DV     +     + + +FL D  +G LNFT+   +  
Sbjct  94   YHDDPAAEAPIEADTIPARKDHDVNTTVLIKSDGFSKNPNFLGDFISGCLNFTSSTTLHG  153

Query  561  KVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
            KVTVLK  K   +    CD+SV    Q  +  S C SK+K 
Sbjct  154  KVTVLKVLKLKATTVSTCDISVFTKFQ--NASSLCKSKIKF  192



>ref|XP_011096157.1| PREDICTED: uncharacterized protein LOC105175420 [Sesamum indicum]
Length=184

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/185 (31%), Positives = 96/185 (52%), Gaps = 5/185 (3%)
 Frame = +3

Query  123  KSRKICCFTTallliaiviaavcailFLTILKPRAPEIIPHRTRLRNVTVALFPEPSLSA  302
            ++ KICCF TA+++  ++ A +    +LT+LKP+ P+I      L++ +  L P   L+ 
Sbjct  3    RALKICCFATAIVIATLLAAILII--YLTLLKPKEPKITTEEVTLKSFSGLLNP-LHLNV  59

Query  303  SLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHK  482
            +L + +T+ NPNYG   Y N +A + Y  TP     +++  +PARG+ D+     +    
Sbjct  60   TLGIIVTVDNPNYGSFKYDNTTAYISYHGTPAAEAAIEEDTIPARGKHDISTDVLVIVDN  119

Query  483  VASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLST  662
            + ++  F E+  +G LNFT+   +     VL   K   +    CD+SV    Q  +  S 
Sbjct  120  LVTNYYFQEEYASGCLNFTSSITLHGLAKVLNFLKIKATAYSTCDISVYFQTQ--NASSV  177

Query  663  CASKL  677
            C SKL
Sbjct  178  CRSKL  182



>ref|XP_010069624.1| PREDICTED: uncharacterized protein LOC104456511 [Eucalyptus grandis]
Length=267

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 82/150 (55%), Gaps = 7/150 (5%)
 Frame = +3

Query  117  APKSRKICCFTTallliaiviaavcailFLTILKPRAPEIIPHRTRLRNVTVALFPEPSL  296
            A +  K+CC T+ + L+ ++   V      TI KP+ P+I      L+N    +      
Sbjct  2    ARRRLKLCCITSVVFLVILIAIIVTLS--FTIFKPKDPQITIQPVGLKNFNFNI-----T  54

Query  297  SASLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDG  476
              +LN  +TI NPNYG   Y+N +  V YR + V  +P+    +PAR ++++   T+L  
Sbjct  55   GVTLNTLVTIHNPNYGSFEYKNVTGYVNYRGSTVAEVPIAHNKIPARAKVNMTTSTDLIV  114

Query  477  HKVASSTSFLEDVGTGSLNFTAVAKMPVKV  566
             K+ S+ SF ED+G+G LNF+A A +P KV
Sbjct  115  GKLISNPSFWEDIGSGYLNFSATATLPGKV  144


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 57/107 (53%), Gaps = 15/107 (14%)
 Frame = +3

Query  216  KPRAPEI----IPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYY  383
            +P+ P+I    I   + L NVT           +L+M +TI NPNYG   Y++    V Y
Sbjct  172  RPKEPQITVQSISLGSMLFNVT-----------TLSMLVTIDNPNYGSFEYKSTMDYVNY  220

Query  384  RDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTG  524
              + V  +P+    +PARG++++   T+L   K+ S+ SF +DV +G
Sbjct  221  NGSTVPEVPMAQNKIPARGKVNMTTSTDLITDKLISNPSFWKDVASG  267



>ref|XP_006826529.1| hypothetical protein AMTR_s00004p00269390 [Amborella trichopoda]
 gb|ERM93766.1| hypothetical protein AMTR_s00004p00269390 [Amborella trichopoda]
Length=187

 Score = 89.0 bits (219),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 96/184 (52%), Gaps = 4/184 (2%)
 Frame = +3

Query  132  KICCFTTallliaiviaavcailFLTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLN  311
            KICC  T LL++ + I  V    + T+LKP+ P++      L N+   LFP  +L+ +L 
Sbjct  8    KICCGVTFLLILLLGITLVIL--YFTLLKPKQPKVEARAVTLENIEFGLFPVVNLNVTLG  65

Query  312  MTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVAS  491
            + + I+NPN     + N++A  YYR   V   P+ +G + ARG   V     +   K+ +
Sbjct  66   LVLLIRNPNVASFKFSNSTAFAYYRGVEVAQSPVPEGRIAARGSHMVSTRVVIVADKLVT  125

Query  492  STSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCAS  671
            + +F  D+  GSL FT+++++  KV +    KF    +  C+++V +     +  STC S
Sbjct  126  NPNFFGDILKGSLFFTSISEVSGKVGLFGIVKFRAMSSTSCEITVVLPGGPVN--STCNS  183

Query  672  KLKI  683
             +K 
Sbjct  184  AVKF  187



>ref|XP_009417238.1| PREDICTED: uncharacterized protein LOC103997671 [Musa acuminata 
subsp. malaccensis]
Length=188

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 54/194 (28%), Positives = 100/194 (52%), Gaps = 11/194 (6%)
 Frame = +3

Query  105  MEITAPKSRK---ICCFTTallliaiviaavcailFLTILKPRAPEIIPHRTRLRNVTVA  275
            M  T  +SR+   +CCF      + +++     IL+LT+ KP+ PE+      LR +   
Sbjct  1    MLTTKTRSRRGPQVCCF------LILLLFVTLIILYLTVFKPKQPEVRGTVVGLRQIEFQ  54

Query  276  LFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVV  455
             FP   L+ +L + +TI+NPNY    + + +  ++YR   V   P+ +G V AR    + 
Sbjct  55   PFPNFMLNITLVVAVTIENPNYAGFEFESGTTLIFYRGVLVGQAPVMEGEVGARSTETLS  114

Query  456  AHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVS  635
             +  L+   + ++ +F++D+ +G L   +   +  KVT+L  FK + SV   CD++V + 
Sbjct  115  VYVELEVSTITANPNFVQDIASGILPLESFTSVRGKVTILGVFKLNASVFTSCDITVALL  174

Query  636  DQSYDVLSTCASKL  677
             +     +TC S++
Sbjct  175  SRYAS--ATCNSRV  186



>ref|XP_011000705.1| PREDICTED: uncharacterized protein LOC105108198 [Populus euphratica]
Length=192

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/162 (31%), Positives = 84/162 (52%), Gaps = 3/162 (2%)
 Frame = +3

Query  201  FLTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVY  380
            + T+ KP+ P+I P    L ++   +FP   L+ +L M +T++N NYG   Y+ ++A V 
Sbjct  33   YFTVFKPKEPKINPQPVILESIRWIIFPIQMLNITLGMVVTVENRNYGSFKYQESAAYVS  92

Query  381  YRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGS-LNFTAVAKMP  557
            YR   V   P+    +PARG+ ++     +   K+ S  +F  +   GS LNFT+   + 
Sbjct  93   YRGDVVAEAPIDADTIPARGKHNISTTVTIFADKLLSDDNFKREFLQGSILNFTSATTLH  152

Query  558  VKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
             KV + K  K     +  CD+S+ V +Q  +  S C SK+ +
Sbjct  153  GKVILFKLIKAKAISSSTCDISIFVREQQAE--SICKSKVSL  192



>ref|XP_004487716.1| PREDICTED: uncharacterized protein LOC101490975 [Cicer arietinum]
Length=446

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 53/162 (33%), Positives = 86/162 (53%), Gaps = 9/162 (6%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYY  383
             T+ KP+ P I  H          L P  +++ +L M +TI NPNYG   Y+N+++ + Y
Sbjct  291  FTVFKPKEPTINVHFAPFN----FLSPNMAMNVTLGMVVTIGNPNYGSFKYQNSTSYITY  346

Query  384  RDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFT--AVAKMP  557
             DT V ++P++   VPAR +I+V  + N    K+  + +F  D+  G + FT  +  ++P
Sbjct  347  NDTIVGSVPIESKLVPARSEINVTTYANFMVGKLIQNPNFWSDIVHG-MEFTLQSTTELP  405

Query  558  VKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
             K  VLK  K        C +SV ++  S DV S C S++K+
Sbjct  406  GKAIVLKYIKLKAMAYSSCHISVNIT--SNDVGSNCISRIKL  445


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/146 (29%), Positives = 72/146 (49%), Gaps = 5/146 (3%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYY  383
             T+ KP+ P +  H + +      L P   L+ +L M +TI N N+G   Y ++   + Y
Sbjct  28   FTVFKPKDPIVTLHLSHVD----FLSPTLPLNMTLGMMMTIANRNFGSFKYESSIGYIRY  83

Query  384  RDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTG-SLNFTAVAKMPV  560
            RD  V ++P++   VPAR +I+V  + +     +  + +F  DV  G   N T+ A++P 
Sbjct  84   RDVTVGSVPIEAALVPARSEINVTTNAHFMVGVLLHNPNFWTDVVPGMKFNLTSTAELPG  143

Query  561  KVTVLKTFKFHVSVTIRCDMSVKVSD  638
            K  +LK  K        C +SV ++ 
Sbjct  144  KAIILKFIKVKAKAYNNCQISVNMTS  169



>ref|XP_002518521.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43908.1| conserved hypothetical protein [Ricinus communis]
Length=191

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 61/186 (33%), Positives = 94/186 (51%), Gaps = 6/186 (3%)
 Frame = +3

Query  123  KSRKICCFTTallliaiviaavcailFLTILKPRAPEIIPHRTRLRNVTVALFPEPSLSA  302
            +  KICC  TA+L + I +  V    + T+ KP+ P +I     L N+ VA +P+  L+ 
Sbjct  9    RGLKICCGITAILTVIIAVVLVIL--YFTVFKPKEPNVITRSVALENIKVA-WPQLFLNI  65

Query  303  SLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHK  482
            +L + + I N NYG   Y N++A V YR   +   P+    VPAR + D      +  +K
Sbjct  66   TLGVGVIIDNKNYGGFKYSNSTAYVSYRGNVIGEAPVPADTVPARKKHDTSTSVTIFANK  125

Query  483  VASSTSFLED-VGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLS  659
            +    +FL D +  G LNFTA + +  K + L  FK   ++   CD+S+ V  Q     S
Sbjct  126  LFEDDNFLHDFLIVGILNFTAASTLHGKASFLDLFKVEATIFTTCDISLFVVPQHAQ--S  183

Query  660  TCASKL  677
             C SK+
Sbjct  184  FCKSKV  189



>ref|XP_004511451.1| PREDICTED: uncharacterized protein LOC101510765 [Cicer arietinum]
Length=190

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 85/161 (53%), Gaps = 3/161 (2%)
 Frame = +3

Query  201  FLTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVY  380
            F+T  KP+ P+I      ++ + V + P   L+ASL + +T+ NPN+G   Y+N++A + 
Sbjct  33   FITDFKPKDPKITLQSVTIQKIHVNVLPIIDLNASLAIVVTVDNPNHGSFRYQNSTAYLN  92

Query  381  YRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPV  560
            YR  P+   PL +  +PAR   ++    N+    +       +D  +G +NFT+   +  
Sbjct  93   YRGNPLAEAPLNEDTIPARKAHNISTSLNVYV-DITEVPELFKDYTSGIINFTSTTTLVG  151

Query  561  KVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
            KV +LK  K   +    CD+ V V D  + V STC+ K+K+
Sbjct  152  KVKILKFIKIKATSYSTCDLFVYVHD--HIVNSTCSVKIKL  190



>ref|XP_003597010.1| hypothetical protein MTR_2g088610 [Medicago truncatula]
 gb|AES67261.1| late embryogenesis abundant protein [Medicago truncatula]
Length=189

 Score = 85.9 bits (211),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 53/168 (32%), Positives = 87/168 (52%), Gaps = 10/168 (6%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYY  383
            LTI KP+ P I  +  +   ++  +    +++ +L M ITI NPNY    Y+N+ + + Y
Sbjct  29   LTIFKPKDPTIRANFAQFNFLSANI----TMNMTLGMVITIVNPNYAGFKYQNSISYINY  84

Query  384  RDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSL--NFTAVAKMP  557
             DT V  +P++   VPAR +I+V    +L   K+  +  F +D+    +  NFT+  ++P
Sbjct  85   HDTIVGNVPIESQLVPARSEINVTTSADLMVGKLLQNPQFWKDMVHNRMIINFTSTTELP  144

Query  558  VKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI*LMEFG  701
             K  +LK  K        CD+SV ++    D  S C S++K  L  FG
Sbjct  145  GKAILLKYIKLKAITYCSCDISVNITSNGAD--SNCKSRIK--LFYFG  188



>gb|KEH29659.1| late embryogenesis abundant hydroxyproline-rich glycoprotein 
[Medicago truncatula]
Length=184

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 82/161 (51%), Gaps = 6/161 (4%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSL-SASLNMTITIKNPNYGDCSYRNASAEVY  380
             TI KP+ P++  +   L N+    F +P++ S  L+M +TI NPNYG    +N +  + 
Sbjct  29   FTIFKPKNPDVHVYPIGLENLQ---FLQPNVTSVPLHMVVTIFNPNYGTYKTKNTTGYLN  85

Query  381  YRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPV  560
            Y+DT V   P+    +P     +V A   L   ++ S+  FL DV  GS NFTA A    
Sbjct  86   YQDTLVAIAPIGPKKLPGHRTTNVSATAGLMSVELISNDKFLVDVADGSFNFTAKAIFHG  145

Query  561  KVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
            KV + K FK    V I CD+   ++    D  S C +K+K+
Sbjct  146  KVHMSKVFKVKAMVNISCDIFFNITSLGTD--SYCITKIKV  184



>gb|KEH29660.1| late embryogenesis abundant protein [Medicago truncatula]
Length=184

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/188 (32%), Positives = 97/188 (52%), Gaps = 8/188 (4%)
 Frame = +3

Query  123  KSRKICCFTTallliaiviaavcailFLTILKPRAPEIIPHRTRLRNVTVALFPEPSLS-  299
            KS KIC   + + LI +    +      TI KP+ P++  +   L+N+ +    +P+++ 
Sbjct  4    KSLKICLLVSIIFLIIVATVILSLA--FTISKPKDPDVHVYPIGLKNLKLL---QPNVTI  58

Query  300  ASLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGH  479
              L++ ITI NPNYG    +N +  + ++DT V   P+    +P+    +V A   L   
Sbjct  59   VPLHLVITIFNPNYGTYKTKNTTGYLSFQDTLVAIAPIGPNKLPSHRTTNVTATAGLMNE  118

Query  480  KVASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLS  659
            K+ S+  FL DV  GS N TA A +  KV + K FK   +VTI CD+   ++    D  S
Sbjct  119  KLISNDKFLVDVAHGSFNLTAKATLRGKVHISKVFKVKATVTINCDIFFNITSFYTD--S  176

Query  660  TCASKLKI  683
             C +K+K+
Sbjct  177  YCITKIKV  184



>ref|XP_004487719.1| PREDICTED: uncharacterized protein LOC101491919 [Cicer arietinum]
Length=134

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 79/139 (57%), Gaps = 7/139 (5%)
 Frame = +3

Query  294  LSASLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLD  473
            ++ +L M ITI NPNYG   Y+N+++ + Y DT V ++P++   VPAR +I+V  + N+ 
Sbjct  1    MNVTLGMVITIGNPNYGSFKYQNSTSYITYNDTIVGSVPIESKLVPARSEINVTTYANVM  60

Query  474  GHKVASSTSFLEDVGTGSLNFT--AVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQSY  647
              K+  + +F  D+  G + FT  +  ++P K  VLK  K        C +SV ++  S 
Sbjct  61   VGKLIQNPNFWSDIVHG-MEFTLQSTTELPGKAIVLKYIKLKAMAYSSCHISVNIT--SN  117

Query  648  DVLSTCASKLKI*LMEFGD  704
            DV S C S++K  L  FG+
Sbjct  118  DVGSNCISRIK--LFYFGN  134



>ref|XP_010109519.1| hypothetical protein L484_018254 [Morus notabilis]
 gb|EXC23123.1| hypothetical protein L484_018254 [Morus notabilis]
Length=186

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/162 (34%), Positives = 86/162 (53%), Gaps = 11/162 (7%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYY  383
            LTI K R P     R +L N  +   P  +++    + + +KNPNY    Y+N +A + Y
Sbjct  34   LTIFKRREP-----RVQLENFHLTYLPNETITVK--VVVKVKNPNYESFKYKNTTASITY  86

Query  384  RDTPVTALPLQDGAVPARGQIDV-VAHTNLDGHKVASSTSFLED-VGTGSLNFTAVAKMP  557
            +   V  +P++   VPARG+++  +   +L  +K+  S  F ED V  GS NFT+ A + 
Sbjct  87   QGIIVALVPIEPRFVPARGKLNFTITSVDLLVYKMVESPKFFEDIVSYGSFNFTSSATLH  146

Query  558  VKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
             KV +LK  KF   V   CD+S  +  Q  +V S C +K+K+
Sbjct  147  GKVRILKFLKFDAKVLCTCDISYLILSQ--NVTSRCMTKVKL  186



>ref|XP_007157156.1| hypothetical protein PHAVU_002G047300g [Phaseolus vulgaris]
 gb|ESW29150.1| hypothetical protein PHAVU_002G047300g [Phaseolus vulgaris]
Length=185

 Score = 83.2 bits (204),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 51/161 (32%), Positives = 83/161 (52%), Gaps = 4/161 (2%)
 Frame = +3

Query  201  FLTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVY  380
            F T+ KP+ P II    +L+   +   P   L+ SL + IT++NPN+G  +Y N +A +Y
Sbjct  29   FFTVFKPKDPHIILKSVKLQGFKLET-PTLKLNVSLGIVITVENPNHGSFTYHNNTAHLY  87

Query  381  YRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPV  560
            + +T V   PL++  +PAR   ++    ++    VA       D   G +NFT+   +  
Sbjct  88   HGETLVAEAPLREDTIPARRDHNITTSLSIFA-DVAKLKDLSSDYSRGVINFTSSVTLLG  146

Query  561  KVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
            KV V+  FK   +    C +S+ V  +S D  S C SK+K+
Sbjct  147  KVKVVNLFKMKATSFCTCYISLFVPHKSID--SICNSKIKL  185



>ref|XP_004170140.1| PREDICTED: uncharacterized protein LOC101232393 [Cucumis sativus]
 gb|KGN47220.1| hypothetical protein Csa_6G212910 [Cucumis sativus]
Length=191

 Score = 82.8 bits (203),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 75/148 (51%), Gaps = 0/148 (0%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYY  383
             T+ KP+ P I+     L ++ V++     LS SLN+ +T++NPN     Y  ++A V Y
Sbjct  33   FTVFKPKQPIIVVDSVSLLDLNVSITDGVHLSLSLNVDLTVQNPNKVGFEYSESTAVVIY  92

Query  384  RDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVK  563
            R   V   P+  G +P +G   +     + G ++   +    DV +G L  +  A++P K
Sbjct  93   RGEKVGEAPIPGGRLPGKGTEKMNLTLTIMGDRMLGKSEVFSDVVSGQLPISTFARLPGK  152

Query  564  VTVLKTFKFHVSVTIRCDMSVKVSDQSY  647
            V V+   K HV  +  CD+ + V ++S+
Sbjct  153  VKVMNVLKIHVVASTSCDLIIDVKNESF  180



>ref|XP_003597014.1| hypothetical protein MTR_2g088680 [Medicago truncatula]
 gb|AES67265.1| late embryogenesis abundant hydroxyproline-rich glycoprotein 
[Medicago truncatula]
Length=186

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/162 (31%), Positives = 89/162 (55%), Gaps = 7/162 (4%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYY  383
             T+ KP+ P I+ H   +      L P+  +  +++  +TI NPN+G   ++ + + V Y
Sbjct  29   FTVFKPKDPNIVVHVEPVD----LLSPDMPIIMNISTLVTIGNPNFGSFEFKKSYSYVTY  84

Query  384  RDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAK--MP  557
             DT V  +P++   VPA  +I+V  +T +  +K+ ++  F ++V  G   FT ++K   P
Sbjct  85   HDTVVGTVPIESQLVPAHSEINVSTYTLMTVNKLINNPDFWKEVVPG-YKFTLISKAEFP  143

Query  558  VKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
             KV VLK  K   +    C+++V ++  S+DV S C S++KI
Sbjct  144  GKVIVLKYIKLKGTAYNTCNITVNMAPGSHDVKSICNSQIKI  185



>gb|KCW75363.1| hypothetical protein EUGRSUZ_E04109 [Eucalyptus grandis]
Length=186

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 84/161 (52%), Gaps = 3/161 (2%)
 Frame = +3

Query  201  FLTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVY  380
            + TILKP+ P +IP    L ++  AL P   L+ +L +TIT+ N NYG  +Y ++   + 
Sbjct  29   YFTILKPKQPIVIPQPVTLLHLHFALSPL-ELNLTLGLTITVDNRNYGSFTYPDSMVYIN  87

Query  381  YRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPV  560
            Y+   V    L    +PAR + ++    ++ G ++ ++  F++D   G +NFT+   +  
Sbjct  88   YQTIEVAKALLVADTIPARAKHNISTSVDVFGDRLVTNMDFIQDFWGGVVNFTSSTALHG  147

Query  561  KVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
            +  VL   K   +    CD+S+    ++ D  S C SKLK+
Sbjct  148  EAKVLHFIKKKATSYTTCDISISFKQRTTD--SVCKSKLKL  186



>gb|AII99860.1| late embryogenesis abundant protein [Cicer arietinum]
Length=183

 Score = 79.7 bits (195),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 51/160 (32%), Positives = 81/160 (51%), Gaps = 7/160 (4%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYY  383
             T+ KP+ P +  H + +      L P   L+ +L M +TI N N+G   Y ++   + Y
Sbjct  28   FTVFKPKDPIVTLHLSHVD----FLSPTLPLNMTLGMMMTIANRNFGSFKYESSIGYIRY  83

Query  384  RDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTG-SLNFTAVAKMPV  560
            RD  V ++P++   VPAR +I+V  + +     +  + +F  DV  G   N T+ A++P 
Sbjct  84   RDVTVGSVPIEAALVPARSEINVTTNAHFMVGVLLHNPNFWTDVVPGMKFNLTSTAELPG  143

Query  561  KVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLK  680
            K  +LK  K        C +SV ++  S DV S C SKLK
Sbjct  144  KAIILKFIKVKAKAYNNCQISVNMT--SSDVQSYCISKLK  181



>ref|XP_008465308.1| PREDICTED: uncharacterized protein LOC103502964 [Cucumis melo]
Length=190

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 75/148 (51%), Gaps = 0/148 (0%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYY  383
             T+ KP+ P I+     L ++ VAL     L+ S+N+ +T++NPN     Y  ++A V Y
Sbjct  32   FTVFKPQRPIIVVDSVSLLDLNVALTDGVDLNLSINVDLTVENPNKVAFEYSKSTAVVIY  91

Query  384  RDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVK  563
            R   V   P+  G +P +G   +     + G ++   +    DV +G L+ + +A++  K
Sbjct  92   RGEKVGEAPIPGGRLPGKGTKKMNLTLTIMGERMLGRSEVFSDVVSGQLSISTLARLAGK  151

Query  564  VTVLKTFKFHVSVTIRCDMSVKVSDQSY  647
            V V+   K HV  +  CD+ + V + S+
Sbjct  152  VKVMGVVKIHVVASTSCDLIIDVKNGSF  179



>ref|XP_004487718.1| PREDICTED: uncharacterized protein LOC101491611 [Cicer arietinum]
Length=183

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 49/160 (31%), Positives = 81/160 (51%), Gaps = 7/160 (4%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYY  383
             T+ KP+ P +  H + +  ++    P   L+ +L + +TI N N+G   Y ++   + Y
Sbjct  27   FTVFKPKDPIVTFHLSHVDFLS----PTLPLNLTLGVMMTIANRNFGSFQYESSIGYISY  82

Query  384  RDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTG-SLNFTAVAKMPV  560
            RD  V ++PL+   +PAR +I+V    +    K+  + +F  DV  G   N T+ A++P 
Sbjct  83   RDIMVGSVPLEAALIPARSEINVTTKAHFMIGKLLHNPNFWMDVVPGMKFNLTSTAQLPG  142

Query  561  KVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLK  680
            K  +L   K        C +SV ++  S DV S C SKLK
Sbjct  143  KAIILNFIKVKAKAYNNCQISVNMT--SSDVQSYCISKLK  180



>ref|XP_007033816.1| Harpin-induced 1, putative [Theobroma cacao]
 gb|EOY04742.1| Harpin-induced 1, putative [Theobroma cacao]
Length=215

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 46/150 (31%), Positives = 76/150 (51%), Gaps = 3/150 (2%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVAL---FPEPSLSASLNMTITIKNPNYGDCSYRNASAE  374
             T+ K + P        L N+  +L     +  L+ASL++ ++IKNPN     Y ++SA+
Sbjct  54   FTVFKAKRPVTTIDSVSLANLKFSLDLVRLQVLLNASLDVDLSIKNPNKVAFKYTDSSAQ  113

Query  375  VYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKM  554
            + YR   V  +P+  G +PA   + +     L   ++ S + F  DV  G L   A A++
Sbjct  114  LNYRGQQVGEVPIPAGKMPADATVPMNLTLTLMADRLLSDSQFFSDVSGGELPLNAFARI  173

Query  555  PVKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
            P KV +L  FK HV  +  CD +V +S+ +
Sbjct  174  PGKVNLLNLFKIHVVSSTSCDFTVFLSNST  203



>ref|XP_010095491.1| hypothetical protein L484_014918 [Morus notabilis]
 gb|EXB60465.1| hypothetical protein L484_014918 [Morus notabilis]
Length=154

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 67/117 (57%), Gaps = 3/117 (3%)
 Frame = +3

Query  336  NYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDV  515
            N G   + NA+A V Y    V  +P+    VPARG++++ + T+L   ++ ++  F +DV
Sbjct  40   NIGSFKFSNATAYVNYHGDVVAEVPIGQNLVPARGKLNITSSTDLMVGRIVANLIFFDDV  99

Query  516  GTGSLNFTAVAKMPVKVTVLKTF-KFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
            G GSLN TA A +  KV++L  F K   +    CD+S  V+  S +V S C SK+K+
Sbjct  100  GKGSLNLTATAALHGKVSLLFEFVKLRATTFSTCDISFLVA--SMNVKSMCMSKIKL  154



>ref|XP_008371183.1| PREDICTED: uncharacterized protein LOC103434605 [Malus domestica]
Length=129

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 58/103 (56%), Gaps = 0/103 (0%)
 Frame = +3

Query  318  ITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASST  497
            +T+KNPNYG   Y N++  + YR   V   P++D  VPAR   ++ +  ++   K+ +++
Sbjct  8    VTVKNPNYGGFKYENSTVHISYRGNVVAEAPIRDDTVPARSTHNITSVVSILADKLVTNS  67

Query  498  SFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSV  626
             F  D+  G LNFT+   +  KV +LK FK   +    C++S+
Sbjct  68   HFSGDMAVGVLNFTSETTLHGKVNLLKVFKMKATCYSDCNISI  110



>ref|XP_009352837.1| PREDICTED: uncharacterized protein LOC103944145 [Pyrus x bretschneideri]
Length=195

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 62/111 (56%), Gaps = 0/111 (0%)
 Frame = +3

Query  294  LSASLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLD  473
            L+ S+ + +T+KNPNYG   Y N++A + Y    V   P++D  VPAR   ++ +  ++ 
Sbjct  66   LNISIGILVTVKNPNYGGFKYENSTAHISYCGNVVAEAPIRDDTVPARSTHNITSVVSIL  125

Query  474  GHKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSV  626
              K+ + + FL D+  G LN T+   +  KV +LK FK   +    C++S+
Sbjct  126  ADKLVTDSHFLGDMAVGVLNLTSETTLHGKVNLLKVFKMKATSYSDCNISI  176



>ref|XP_002884549.1| hypothetical protein ARALYDRAFT_896701 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60808.1| hypothetical protein ARALYDRAFT_896701 [Arabidopsis lyrata subsp. 
lyrata]
Length=189

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/183 (30%), Positives = 92/183 (50%), Gaps = 9/183 (5%)
 Frame = +3

Query  129  RKICCFTTallliaiviaavcailFLTILKPRAPEIIPHRTRLRNVT--VALFPEPSLSA  302
            R+ICC  +A++++   I     I    + KP+ P +    + +  ++  ++L  E  L+ 
Sbjct  4    RRICCIVSAIIIVLFAIFMAALI-LAQVFKPKHPILQTVSSTVDGISTNISLPYEVQLNF  62

Query  303  SLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHK  482
            +L + + +KNPN  D  Y+     VYYRDT V  L L    +PA+G + +     L   K
Sbjct  63   TLTLQMLLKNPNVADFEYKTVENLVYYRDTLVGNLTLPSSTLPAKGSVLLACPLFLQLDK  122

Query  483  -VASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDM-----SVKVSDQS  644
             VA+    ++DV  G +     A+MP K+T+L  FK H+     C++     S++V DQ 
Sbjct  123  FVANLGDIVQDVLHGKIVMETKARMPGKITLLGIFKIHLDSISHCNLVLGFPSMEVVDQV  182

Query  645  YDV  653
             D+
Sbjct  183  CDL  185



>gb|KDP20784.1| hypothetical protein JCGZ_21255 [Jatropha curcas]
Length=190

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/185 (29%), Positives = 86/185 (46%), Gaps = 5/185 (3%)
 Frame = +3

Query  123  KSRKICCFTTallliaiviaavcailFLTILKPRAPEIIPHRTRLRNVTVALFPEPSLSA  302
            +  KICC     L + + IA V  +LF T+ KP+ P        + +   A +P   L+ 
Sbjct  9    RGLKICC--GVSLALLLTIAVVLIVLFFTLFKPKEPTFTTPSVTIEHFRAA-WPALFLNF  65

Query  303  SLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHK  482
            +L + +T+ N NYG   Y  +   V YR   +   P+    +PARG+ DV     +  +K
Sbjct  66   TLGIGVTVSNKNYGGFMYEESIGYVSYRGNLIGEAPIAADTIPARGKHDVKTSVTIFANK  125

Query  483  VASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLST  662
            +    +F+ D  +G LN T+   +  KV V K FK        C++S+ +  Q     S 
Sbjct  126  LFDDDTFVLDFLSGVLNVTSSLSLHGKVIVFKLFKLKAESLSTCNISIFIVPQQAQ--SV  183

Query  663  CASKL  677
            C +K+
Sbjct  184  CNAKI  188



>ref|XP_007132564.1| hypothetical protein PHAVU_011G105400g [Phaseolus vulgaris]
 gb|ESW04558.1| hypothetical protein PHAVU_011G105400g [Phaseolus vulgaris]
Length=222

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/156 (27%), Positives = 75/156 (48%), Gaps = 5/156 (3%)
 Frame = +3

Query  216  KPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRDTP  395
            KP+ P +  H   L +  +      S  A L M IT+ NPNY    +RN S  + Y D  
Sbjct  72   KPKNPAVFIHPLDLEHFQLV---SDSSRAPLGMVITVVNPNYARFKHRNCSGYLKYGDKI  128

Query  396  VTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVL  575
            +  +P    + P+R   ++    +++  K+    +F  ++  G  N TA AK+  KV+++
Sbjct  129  IAEVPFGTRSYPSRSTTNLTTTADIETEKLIEDPNFWSEIEGGIFNMTAEAKLSGKVSMV  188

Query  576  KTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
            K       + I C +S+ ++  +    STC +K+K+
Sbjct  189  KIISLKAKIYISCVISLNIT--AVHATSTCITKIKL  222



>ref|XP_007205880.1| hypothetical protein PRUPE_ppa011272mg [Prunus persica]
 gb|EMJ07079.1| hypothetical protein PRUPE_ppa011272mg [Prunus persica]
Length=216

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 75/151 (50%), Gaps = 5/151 (3%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTI----TIKNPNYGDCSYRNASA  371
             T+ K R PE+  +   L+++ VAL   P LS  +N+T+    ++KNPN     Y++ SA
Sbjct  55   FTVFKAREPEMTINSVVLKDLDVAL-NIPRLSVDVNLTLDVDLSVKNPNKAGFKYKSGSA  113

Query  372  EVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAK  551
             + YR   V    +  G + A     +     +   +    +    DV  G+L FT + K
Sbjct  114  LLNYRGELVGQGRIGSGEISADHTKPMNVTLTIMADRFLEKSELFSDVVAGTLPFTTLTK  173

Query  552  MPVKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
            +  KV +   FKFHV  T  CD+S+ VS+++
Sbjct  174  VSGKVVIFGIFKFHVISTSSCDVSINVSNKT  204



>ref|XP_010921236.1| PREDICTED: uncharacterized protein LOC105044876 [Elaeis guineensis]
Length=202

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 79/163 (48%), Gaps = 6/163 (4%)
 Frame = +3

Query  207  TILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTI----TIKNPNYGDCSYRNASAE  374
            T+ +PR      +  RL  + V  F  P+L   LN+T+    T  NPN+    Y + SA+
Sbjct  42   TVFRPRHAVTTINSVRLAGLRVG-FDVPNLGVDLNVTLDLDLTATNPNHASFRYGDGSAD  100

Query  375  VYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKM  554
            +YYR   V    +  G V A G +       +   ++  +++   D  +GSL FT   ++
Sbjct  101  LYYRGNVVGEAAIPPGEVAAGGSVRTEVLLTVMAGRLIGNSAVYADAISGSLPFTTTTEI  160

Query  555  PVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
            P +VTVL  FK H+     C++ V V ++S +  S C  K K+
Sbjct  161  PGRVTVLGVFKHHMVTYSTCNIVVNVRNRSVEN-SDCTYKTKL  202



>gb|KEH29664.1| late embryogenesis abundant hydroxyproline-rich glycoprotein 
[Medicago truncatula]
Length=184

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 67/136 (49%), Gaps = 3/136 (2%)
 Frame = +3

Query  279  FPEPSLS-ASLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVV  455
            F  P ++  +L M I++ NPNYG     N +  V Y+ T V  +P+    +P     +V 
Sbjct  50   FFTPGVTIVNLTMIISVMNPNYGIYKTENTTGFVSYQKTVVAMVPVDAQTLPGHATTNVS  109

Query  456  AHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVS  635
                L  HK+ ++ +F+ DVG GS N T       KV +LK  K    V + CD+  K+ 
Sbjct  110  VTAGLMSHKLMTNENFVADVGDGSFNMTTRTTFHGKVHLLKIIKIKALVNMYCDILFKMD  169

Query  636  DQSYDVLSTCASKLKI  683
                D +S+C + +++
Sbjct  170  PM--DAVSSCVTHMRV  183



>ref|XP_010059636.1| PREDICTED: COBRA-like protein 10 [Eucalyptus grandis]
Length=792

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/160 (28%), Positives = 83/160 (52%), Gaps = 3/160 (2%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYY  383
            +++ +P+ P +IP    L ++  AL P   L+ +L +TIT+ N NYG  +Y ++   + Y
Sbjct  636  VSLAQPKQPIVIPQPVTLLHLHFALSPL-ELNLTLGLTITVDNRNYGSFTYPDSMVYINY  694

Query  384  RDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVK  563
            +   V    L    +PAR + ++    ++ G ++ ++  F++D   G +NFT+   +  +
Sbjct  695  QTIEVAKALLVADTIPARAKHNISTSVDVFGDRLVTNMDFIQDFWGGVVNFTSSTALHGE  754

Query  564  VTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
              VL   K   +    CD+S+    ++ D  S C SKLK+
Sbjct  755  AKVLHFIKKKATSYTTCDISISFKQRTTD--SVCKSKLKL  792



>ref|XP_006408003.1| hypothetical protein EUTSA_v10022344mg [Eutrema salsugineum]
 gb|ESQ49456.1| hypothetical protein EUTSA_v10022344mg [Eutrema salsugineum]
Length=190

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 74/153 (48%), Gaps = 8/153 (5%)
 Frame = +3

Query  207  TILKPRAPEIIPHRTRLRNVTVALFP--EPSLSASLNMTITIKNPNYGDCSYRNASAEVY  380
            T+ KP+ P +    + +  V+  + P  E  L+ +L + + +KNPN  D  Y+     VY
Sbjct  30   TVFKPKHPILQTVSSTVEGVSTNVAPPFEVQLNFTLTLQMLLKNPNLADFEYKTVENLVY  89

Query  381  YRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHK-VASSTSFLEDVGTGSLNFTAVAKMP  557
            YRD  V  L L    +PA+G   +     L   K VA     L+DV  G +     AKMP
Sbjct  90   YRDNLVGNLTLPSSTLPAKGSALLPCPLVLQIDKFVADLGDILQDVLHGKIVIETKAKMP  149

Query  558  VKVTVLKTFKFHVSVTIRCDM-----SVKVSDQ  641
             K+TVL  FK H++    C +     +++V DQ
Sbjct  150  GKITVLGIFKAHLNTLSHCKLVLGFPTMEVEDQ  182



>gb|EYU25166.1| hypothetical protein MIMGU_mgv1a014071mg [Erythranthe guttata]
Length=202

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/147 (27%), Positives = 66/147 (45%), Gaps = 0/147 (0%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYY  383
            LT++K R P+       L N        PS SA++N   T+KN N+G   YRN + + +Y
Sbjct  49   LTVMKIRTPKFRIRSAHLTNFNAGTPASPSFSATVNAEFTVKNANFGRYKYRNTTVDFFY  108

Query  384  RDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVK  563
            R TPV  + ++D     R         NL      ++     D+  G +  ++ A+M  +
Sbjct  109  RGTPVGQVLVRDSRAGWRSTKKFNVAVNLSLTNAQANPQLASDLNAGVVQISSQARMRGR  168

Query  564  VTVLKTFKFHVSVTIRCDMSVKVSDQS  644
            V ++   K + S  + C M +  + Q 
Sbjct  169  VELIFVMKKNKSTDMNCTMEIVTATQQ  195



>ref|XP_010036040.1| PREDICTED: uncharacterized protein LOC104425143 [Eucalyptus grandis]
 gb|KCW47564.1| hypothetical protein EUGRSUZ_K01313 [Eucalyptus grandis]
Length=206

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 76/150 (51%), Gaps = 3/150 (2%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEP---SLSASLNMTITIKNPNYGDCSYRNASAE  374
             T+ K + P    +  +LRN+ V++   P   +L+ ++++ I++KNPN     Y N++  
Sbjct  45   FTVFKAKHPVTTVNSAKLRNLQVSVSIAPLGINLNVTVDVDISVKNPNRVAFKYENSTCL  104

Query  375  VYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKM  554
            + YR   V   P+  G + A     +    N+  ++  S++  + D  +G L      KM
Sbjct  105  LNYRGEQVGEAPVPAGEIGAGRTKQMNLTLNVLANRFLSNSQAMSDFLSGVLPLNTYTKM  164

Query  555  PVKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
            P  VT+L  FK HV  T  CD+SV VS+ +
Sbjct  165  PGTVTILGLFKVHVVSTTSCDLSVLVSNST  194



>ref|XP_008801006.1| PREDICTED: uncharacterized protein LOC103715222 [Phoenix dactylifera]
Length=202

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 68/130 (52%), Gaps = 1/130 (1%)
 Frame = +3

Query  294  LSASLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLD  473
            L+ +L++ +T  NPN+    Y + +A++YYR T V    +  G V A G +       + 
Sbjct  74   LNVTLDLNLTASNPNHASFRYGDGTADLYYRGTLVGEATIPPGEVSAGGSVQTDVLVTVM  133

Query  474  GHKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDV  653
              ++  + +   DV +GS+ FT   ++P +VTVL  FK H+     CD+ V V +++ + 
Sbjct  134  AGRLIGNKAVYADVISGSVPFTTTTEIPGRVTVLGVFKHHMETYTTCDIVVNVRNRTVEN  193

Query  654  LSTCASKLKI  683
             S C  K K+
Sbjct  194  -SDCKYKTKL  202



>emb|CDY05218.1| BnaC05g45850D [Brassica napus]
Length=190

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 75/159 (47%), Gaps = 12/159 (8%)
 Frame = +3

Query  207  TILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITI----KNPNYGDCSYRNASAE  374
            T+ KP+ P +    + +  V+  +   P L   +N T+T+    KNPN  D  Y+     
Sbjct  30   TVFKPKHPVLQTLSSTVEGVSTHI--SPPLDVQINFTLTLQMLLKNPNLADFEYKTVENL  87

Query  375  VYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHK-VASSTSFLEDVGTGSLNFTAVAK  551
            VYYRD  V  L L    +PA+G   +     L   K VA+    L+D+    +     A 
Sbjct  88   VYYRDILVGNLTLPSSTLPAKGSAILPCPLVLQIDKFVANLGDILQDILQRKIVIETKAN  147

Query  552  MPVKVTVLKTFKFHVSVTIRCDM-----SVKVSDQSYDV  653
            MP K+TVL  FK H++ T  C +     S++V DQ  D+
Sbjct  148  MPGKITVLGIFKAHLNTTSHCKLVLSVPSMEVVDQVCDL  186



>ref|XP_007135148.1| hypothetical protein PHAVU_010G105100g [Phaseolus vulgaris]
 gb|ESW07142.1| hypothetical protein PHAVU_010G105100g [Phaseolus vulgaris]
Length=220

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 67/134 (50%), Gaps = 1/134 (1%)
 Frame = +3

Query  282  PEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAH  461
            P+   + SL   +++KNPN     Y N +  +YYR   V    L  G   AR  I +   
Sbjct  88   PQSGANMSLVADVSVKNPNVASFKYSNTTTSLYYRGIMVGEARLPPGRAKARRTIRMNVT  147

Query  462  TNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQ  641
             ++   ++ SS  F  D+G+G +  ++ +++P +V +L  FK HV V + C  +  +S Q
Sbjct  148  IDVITDRLVSSPDFRTDLGSGLMTMSSFSRVPGQVKILNLFKRHVVVKMNCSTTFNISTQ  207

Query  642  SYDVLSTCASKLKI  683
            +    S C  K+K+
Sbjct  208  AIKEQS-CLGKVKL  220



>ref|XP_010523771.1| PREDICTED: uncharacterized protein LOC104802047 [Tarenaya hassleriana]
Length=219

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/150 (25%), Positives = 76/150 (51%), Gaps = 2/150 (1%)
 Frame = +3

Query  201  FLTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTI--TIKNPNYGDCSYRNASAE  374
            F T+ + + P I+ +   + ++    FP P ++A+++M +  ++KNPN     Y N + E
Sbjct  58   FFTVFQAKDPIIVVNNVTMPSLPGTQFPPPDITANMSMVVDVSVKNPNAASFKYSNTTTE  117

Query  375  VYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKM  554
            +YY+           G   AR  + +    ++   ++ S    LED+G+G +N T+ +++
Sbjct  118  LYYKGLLFGEARGPPGRARARRTVRMNVTLDIYAGRLMSDPGLLEDIGSGLMNVTSYSRV  177

Query  555  PVKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
              +V +L   K  ++V + C  S  V+ +S
Sbjct  178  HGRVKILGFLKAQMTVKMNCSTSFNVTSRS  207



>ref|NP_683533.1| Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein 
family [Arabidopsis thaliana]
 gb|ABE65475.1| hypothetical protein At3g05975 [Arabidopsis thaliana]
 gb|AEE74325.1| Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein 
family [Arabidopsis thaliana]
Length=189

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 54/183 (30%), Positives = 89/183 (49%), Gaps = 9/183 (5%)
 Frame = +3

Query  129  RKICCFTTallliaiviaavcailFLTILKPRAPEIIPHRTRLRNVT--VALFPEPSLSA  302
            R+ICC  + ++ +  VI     I    + KP+ P +    + +  ++  ++L  E  L+ 
Sbjct  4    RRICCIVSGIIFVLFVIFMTALI-LAQVFKPKHPILQTVSSTVDGISTNISLPYEVQLNF  62

Query  303  SLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHK  482
            +L + + +KNPN  D  Y+     VYYRDT V  L L    +PA+G + +     L   K
Sbjct  63   TLTLEMLLKNPNVADFEYKTVENLVYYRDTLVGNLTLPSSTLPAKGSVLLPCPLFLQLDK  122

Query  483  -VASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDM-----SVKVSDQS  644
             VA+    ++DV  G +     AKMP K+T+L  FK  +     C++     S+ V DQ 
Sbjct  123  FVANLGDIVQDVLHGKIVMETRAKMPGKITLLGIFKIPLDSISHCNLVLGFPSMVVEDQV  182

Query  645  YDV  653
             D+
Sbjct  183  CDL  185



>ref|XP_010464163.1| PREDICTED: uncharacterized protein LOC104744760 [Camelina sativa]
Length=190

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 75/157 (48%), Gaps = 8/157 (5%)
 Frame = +3

Query  207  TILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTIT--IKNPNYGDCSYRNASAEVY  380
            T+ KP+ P +    + +  V+  L P   +  +  +T+   + NPN  D +Y+     VY
Sbjct  30   TVFKPKHPILQTVSSTVEGVSTNLLPPDQIQVNFTLTLEMLLTNPNVADVTYKTVENLVY  89

Query  381  YRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHK-VASSTSFLEDVGTGSLNFTAVAKMP  557
            YRDT V  L L    +PA+G + +     L   K V +     +D+  G +     A+MP
Sbjct  90   YRDTLVGNLSLPSSTLPAKGSVMLACPLVLQIDKFVVNLGDIAQDILHGKIVMETKARMP  149

Query  558  VKVTVLKTFKFHVSVTIRCDM-----SVKVSDQSYDV  653
             ++T+L  FK H+     C++     S+KV +Q  D+
Sbjct  150  GEITLLGIFKTHMDSLSHCNLVLGFPSMKVLEQVCDL  186



>ref|XP_009129622.1| PREDICTED: uncharacterized protein LOC103854440 [Brassica rapa]
Length=170

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 75/159 (47%), Gaps = 12/159 (8%)
 Frame = +3

Query  207  TILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITI----KNPNYGDCSYRNASAE  374
            T+ KP+ P +    + +  V+  +   P L   +N T+T+    KNPN  D  Y+     
Sbjct  10   TVFKPKHPVLQTLSSTVEGVSTHI--SPPLDVQINFTLTLQMLLKNPNLVDFEYKTVENL  67

Query  375  VYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHK-VASSTSFLEDVGTGSLNFTAVAK  551
            VYYRD  V  L L    +PA+G   +     L   K VA+    L+D+    +     A 
Sbjct  68   VYYRDILVGNLTLPSSTLPAKGSAILPCPLVLQIDKFVANLGDILQDILQRKIVIETKAN  127

Query  552  MPVKVTVLKTFKFHVSVTIRCDM-----SVKVSDQSYDV  653
            MP K+TVL  FK H++ T  C +     S++V DQ  D+
Sbjct  128  MPGKITVLGIFKAHLNTTSHCKLVLSVPSMEVVDQVCDL  166



>ref|XP_011076469.1| PREDICTED: uncharacterized protein LOC105160687 [Sesamum indicum]
Length=217

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/147 (26%), Positives = 67/147 (46%), Gaps = 0/147 (0%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYY  383
            +TI+K R P          N  V     P+ SA +N  + +KN N+G   YRN +   +Y
Sbjct  64   VTIMKVRTPRFRVRSASFENFNVGTPASPAFSARMNAELGVKNANFGRYKYRNTTVVFFY  123

Query  384  RDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVK  563
            R TPV    L++  V  R    +    +L     A+++    D+  G +  T+ A+M  +
Sbjct  124  RGTPVGQAILRNSRVNWRATKKIDVAVDLSLGNAAANSQLGSDLSAGIVPITSQARMTGR  183

Query  564  VTVLKTFKFHVSVTIRCDMSVKVSDQS  644
            V ++   K + +  + C+M +  + Q 
Sbjct  184  VELVFVMKKNKATEMNCNMEIVTATQQ  210



>ref|XP_003521609.1| PREDICTED: uncharacterized protein LOC100811806 [Glycine max]
 gb|KHN42121.1| hypothetical protein glysoja_021611 [Glycine soja]
Length=192

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 91/181 (50%), Gaps = 6/181 (3%)
 Frame = +3

Query  105  MEITAPKSRKICCFTTallliaiviaavcailFLTILKPRAPEIIPHRTRLRNVTVALFP  284
            M++ + K RK+C   T +++  +++  + A   LT+ K + P      T+L +  V+L P
Sbjct  1    MKVGSGKGRKVCLTVTGVVIAIVLLIVILA---LTVFKAKHPVTTVDSTKLEDFHVSLDP  57

Query  285  ---EPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVV  455
                  L+ +L + +++KNPN     Y +++A + YR   +  +P+  G + +       
Sbjct  58   VKLRVDLNVTLGVDVSVKNPNKVGFQYSDSTAHLNYRGQLIGEVPISAGEISSGETKGFN  117

Query  456  AHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVS  635
                +   ++ S++  L DV +G+L      +M  KV++L   K HV  +  CD+++ +S
Sbjct  118  LTLTIMADRLLSNSQLLSDVTSGTLPLNTFVRMSGKVSILGFIKVHVVSSTSCDVAINLS  177

Query  636  D  638
            +
Sbjct  178  N  178



>emb|CDY27724.1| BnaA05g31330D [Brassica napus]
Length=190

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 75/159 (47%), Gaps = 12/159 (8%)
 Frame = +3

Query  207  TILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITI----KNPNYGDCSYRNASAE  374
            T+ KP+ P +    + +  V+  +   P L   +N T+T+    KNPN  D  Y+     
Sbjct  30   TVFKPKHPVLQTLSSTVEGVSTHI--SPPLDVQINFTLTLQMLLKNPNLVDFEYKTVENL  87

Query  375  VYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHK-VASSTSFLEDVGTGSLNFTAVAK  551
            VYYRD  V  L L    +PA+G   +     L   K VA+    L+D+    +     A 
Sbjct  88   VYYRDILVGNLTLPSSTLPAKGSAILPCPLVLQIDKFVANLGDILQDILQRKIVIETKAN  147

Query  552  MPVKVTVLKTFKFHVSVTIRCDM-----SVKVSDQSYDV  653
            MP K+TVL  FK H++ T  C +     S++V DQ  D+
Sbjct  148  MPGKITVLGIFKAHLNTTSHCKLVLSVPSMEVVDQVCDL  186



>ref|XP_004305063.1| PREDICTED: uncharacterized protein LOC101292145 [Fragaria vesca 
subsp. vesca]
Length=213

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 75/150 (50%), Gaps = 8/150 (5%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPS---LSASLNMTITIKNPNYGDCSYRNASAE  374
            LT+ K + PE   +   LRN+        +   ++ +L++ +T+KNPN     Y N++A 
Sbjct  51   LTVFKAKDPETTENSVVLRNLQTDFNINRATVDVNITLDVDMTVKNPNKLGMKYTNSTAL  110

Query  375  VYYRDTPVTALPLQDGAVPARGQ---IDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAV  545
            + YR   V   P+  G + A G+   +DV      D   +  ++  L+DV  GS+ F  V
Sbjct  111  LNYRGELVGQAPIVAGDISA-GETKSMDVTLTVMAD-RFLGKTSELLQDVIAGSIPFNTV  168

Query  546  AKMPVKVTVLKTFKFHVSVTIRCDMSVKVS  635
             K+  KVT+L  FK HV  T  CD +V V 
Sbjct  169  TKISGKVTILGIFKVHVVSTSSCDFNVHVG  198



>ref|XP_011076471.1| PREDICTED: uncharacterized protein LOC105160688 [Sesamum indicum]
Length=217

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 38/147 (26%), Positives = 67/147 (46%), Gaps = 0/147 (0%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYY  383
            +TI+K R P          N  V     P+ SA +N  + +KN N+G   YRN +   +Y
Sbjct  64   VTIMKVRTPRFRVRSATFENFNVGTPASPAFSARMNAELGVKNANFGRYKYRNTTVVFFY  123

Query  384  RDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVK  563
            R TPV    L++  V  R    +    +L     A+++    D+  G +  T+ A+M  +
Sbjct  124  RGTPVGQAILRNSRVNWRATKKIDVAVDLSLGNAAANSQLGSDLSAGIVPITSQARMTGR  183

Query  564  VTVLKTFKFHVSVTIRCDMSVKVSDQS  644
            V ++   K + +  + C+M +  + Q 
Sbjct  184  VELVFVMKKNRATQMNCNMEIVTATQQ  210



>ref|XP_002876246.1| hypothetical protein ARALYDRAFT_485817 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52505.1| hypothetical protein ARALYDRAFT_485817 [Arabidopsis lyrata subsp. 
lyrata]
Length=235

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 74/150 (49%), Gaps = 3/150 (2%)
 Frame = +3

Query  204  LTILKPRAP-EIIPHRT--RLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAE  374
             T+ KP+ P   I   T  RLR     L  +  L+ +LN+ +++KNPN    SY ++SA 
Sbjct  74   FTLFKPKRPVTTIDSVTVDRLRASVNPLLLKVILNLTLNVDLSLKNPNRVGFSYDSSSAL  133

Query  375  VYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKM  554
            + YR   +   PL    + AR    +     L   ++ S +  L DV  G +      K+
Sbjct  134  LNYRGQLIGEAPLPANRIAARQTEPMNLTLTLMADRLLSESQLLSDVMAGVIPLNTFVKV  193

Query  555  PVKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
              KVTVLK FK  V  +  CD+++ VSD++
Sbjct  194  SGKVTVLKVFKIKVQSSSSCDLTISVSDRN  223



>ref|XP_003560138.1| PREDICTED: uncharacterized protein LOC100829856 [Brachypodium 
distachyon]
Length=209

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 66/146 (45%), Gaps = 2/146 (1%)
 Frame = +3

Query  201  FLTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVY  380
            F  + +P  P ++     +      L P PSL+ S+ + + + NP+     Y   S  V 
Sbjct  31   FYILYRPLPPRVVATPVVIGVEHFGLLPVPSLTLSVGVHVVVSNPSRAPFRYEETSTPVL  90

Query  381  YRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLED--VGTGSLNFTAVAKM  554
            Y   PV    +  G V   G   V   T +DG KVA+   F  D  VG G+L F A  ++
Sbjct  91   YHGEPVGVTVVPAGRVGGYGTSTVEPLTEVDGVKVAADPHFAADVAVGEGALPFVAFVRL  150

Query  555  PVKVTVLKTFKFHVSVTIRCDMSVKV  632
              K  VL+ F+  V+V + C + V V
Sbjct  151  DGKALVLRVFEVSVTVEVVCYVRVMV  176



>ref|XP_008349106.1| PREDICTED: uncharacterized protein LOC103412298 [Malus domestica]
Length=183

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 41/148 (28%), Positives = 73/148 (49%), Gaps = 4/148 (3%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYY  383
            LT++K + P++        N +      PSLS +L     +KN N+G   Y+N++  +YY
Sbjct  30   LTVMKVKGPKVRFSTIVTENFSSPAANSPSLSLNLVTKFAVKNTNFGHFKYQNSTVTIYY  89

Query  384  RDTPVTALPLQDGAVPARG--QIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMP  557
                +    +  G   AR   + DV+   N D  K++ ST+   D+ +G +  T+ A + 
Sbjct  90   GGQAIGTADIPQGKAKARSTRRTDVIISINTD--KLSGSTNLGNDINSGVVPLTSEATLK  147

Query  558  VKVTVLKTFKFHVSVTIRCDMSVKVSDQ  641
             KV ++K  K + S  + C MSV + ++
Sbjct  148  GKVELMKIIKKNKSGKMSCSMSVNLKNR  175



>ref|XP_011076473.1| PREDICTED: uncharacterized protein LOC105160690 [Sesamum indicum]
Length=217

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 38/147 (26%), Positives = 67/147 (46%), Gaps = 0/147 (0%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYY  383
            +TI+K R P          N  V     P+ SA +N  + +KN N+G   YRN +   +Y
Sbjct  64   VTIMKVRTPRFRVRSATFENFNVGNPASPAFSARMNAELGVKNANFGRYKYRNTTVVFFY  123

Query  384  RDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVK  563
            R TPV    L++  V  R    +    +L     A+++    D+  G +  T+ A+M  +
Sbjct  124  RGTPVGQAILRNSRVNWRATKKIDVAVDLSLGNAAANSQLGSDLSAGIVPITSQARMTGR  183

Query  564  VTVLKTFKFHVSVTIRCDMSVKVSDQS  644
            V ++   K + +  + C+M +  + Q 
Sbjct  184  VELVFVMKKNKATEMNCNMEIVTATQQ  210



>ref|XP_006842622.1| hypothetical protein AMTR_s00077p00180970 [Amborella trichopoda]
 gb|ERN04297.1| hypothetical protein AMTR_s00077p00180970 [Amborella trichopoda]
Length=205

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 47/164 (29%), Positives = 83/164 (51%), Gaps = 6/164 (4%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVAL-FPE--PSLSASLNMTITIKNPNYGDCSYRNASAE  374
             T+ + R      +  RL  + V+L  P    SL+ SL++ +++KNPN     Y N++  
Sbjct  44   FTVFRARHTTTTVNSIRLAGLDVSLDIPRLRVSLNVSLDLNVSLKNPNKASFKYGNSTTM  103

Query  375  VYYRDTPVTALPLQDGAVPARGQIDVVAHT-NLDGHKVASSTSFLEDVGTGSLNFTAVAK  551
            +YYR   V    +  G + A G+ +V+  T  +   ++ S +    DV  GSL  T   +
Sbjct  104  LYYRGGLVGEASIPSGEIFA-GETEVMNLTLTILADRLLSDSYIYSDVVNGSLPLTTYTR  162

Query  552  MPVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
            +  +VTV++ FK H+     CD+S+ + DQ  +  S+C  + K+
Sbjct  163  ISGRVTVMRLFKHHLVSYAYCDVSISIRDQKIEN-SSCRYRNKL  205



>ref|XP_003610688.1| hypothetical protein MTR_5g005950 [Medicago truncatula]
 gb|AES93646.1| late embryogenesis abundant protein [Medicago truncatula]
Length=190

 Score = 65.5 bits (158),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 87/188 (46%), Gaps = 9/188 (5%)
 Frame = +3

Query  123  KSRKICCFTTallliaiviaavcailFLTILKPRAPEIIPHRTRLRNVTVALFPEPSLSA  302
            K  KICC  T + LI +++  +   L  T  K + P I     +     + + P   L+ 
Sbjct  9    KGLKICCGVTTIFLIVVLVILLILFL--TDFKQKDPTITLQSVKFGRFHLDILPILDLNL  66

Query  303  SLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPA--RGQIDVVAHTNLDG  476
            SL + +T+ NPN+G  +Y+N+SA + YR   +   PL +  +PA     I  + +  +D 
Sbjct  67   SLAILVTVDNPNHGSFTYQNSSAYLNYRGNLLATAPLHEDTIPALKSHNISTILNVYVD-  125

Query  477  HKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVL  656
              V      L D   G +NFT+   +  KV +    K   +    CD+ V +  Q  +  
Sbjct  126  --VTEVPDLLGDYLGGVINFTSTTTLVGKVKIFNFIKIKATTYSTCDIFVYIHGQIAN--  181

Query  657  STCASKLK  680
            STC +K+K
Sbjct  182  STCDNKIK  189



>ref|XP_010261404.1| PREDICTED: uncharacterized protein LOC104600249 [Nelumbo nucifera]
Length=221

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 42/152 (28%), Positives = 76/152 (50%), Gaps = 8/152 (5%)
 Frame = +3

Query  204  LTILKPRAPEIIPH-----RTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNAS  368
             T+ + R PEI  +     R  L N TV   P P ++ SL   +++KNPN+    Y N S
Sbjct  61   FTVFRVRDPEIKMNGVTIDRLDLVNGTV---PRPGVNMSLTADVSVKNPNFASFKYGNTS  117

Query  369  AEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVA  548
              +YYR T +       G   AR  + +    ++   ++ ++++   D+ +  L  ++  
Sbjct  118  TTLYYRGTVIGEARNPPGHARARRTMRMNVTVDVITDRLMNNSNLQNDISSRMLTMSSYT  177

Query  549  KMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
            ++  +V +LK  K HV+V + C MSV ++ Q+
Sbjct  178  RIGGRVNILKLVKRHVNVKMNCTMSVNLTSQA  209



>gb|KHN13121.1| hypothetical protein glysoja_044779, partial [Glycine soja]
Length=186

 Score = 65.5 bits (158),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 88/175 (50%), Gaps = 6/175 (3%)
 Frame = +3

Query  123  KSRKICCFTTallliaiviaavcailFLTILKPRAPEIIPHRTRLRNVTVALFP---EPS  293
            K RK+C   T +++  +++  + A   LT+ K + P  I   T+L +  V+L P      
Sbjct  1    KGRKVCLTVTGVVIAIVLLIVILA---LTVFKAKHPVTIVDSTKLEDFHVSLDPVKLRVD  57

Query  294  LSASLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLD  473
            L+ +L + +++KNPN     Y +++A + YR   +  +P+  G + +           + 
Sbjct  58   LNVTLGVDVSVKNPNKVGFQYSDSTAHLNYRGQLIGEVPISAGEISSGETKGFNLTLTIM  117

Query  474  GHKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSD  638
              ++ S++  L DV +G+L      +M  KV++L   K HV  +  CD+++ +S+
Sbjct  118  ADRLLSNSQLLSDVTSGTLPLNTFVRMSGKVSILGFIKVHVVSSTSCDVAINLSN  172



>ref|XP_010251606.1| PREDICTED: uncharacterized protein LOC104593459 [Nelumbo nucifera]
Length=221

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/149 (26%), Positives = 75/149 (50%), Gaps = 2/149 (1%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTV--ALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEV  377
             T+ + R PEI  +  ++  + +   +    S++ SL   +++KNPN+    + NAS  V
Sbjct  61   FTVFRVREPEIKMNSVKIDGLELVSGIISGTSINMSLTADVSVKNPNFASFRFGNASTTV  120

Query  378  YYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMP  557
            YYR T V       G   AR  + +    ++   ++ S+ + + D+ +  L  +   ++ 
Sbjct  121  YYRGTVVAEARNPPGHAKARRTLRMNVTVDVITDRLISNPNLISDISSRMLAMSTYTRIG  180

Query  558  VKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
             +V +LK  K HV+V + C M+V ++ Q+
Sbjct  181  GRVNILKIVKRHVTVKMNCTMTVNITSQA  209



>ref|XP_002323694.2| hypothetical protein POPTR_0016s14900g [Populus trichocarpa]
 gb|EEF05455.2| hypothetical protein POPTR_0016s14900g [Populus trichocarpa]
Length=206

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/149 (28%), Positives = 73/149 (49%), Gaps = 3/149 (2%)
 Frame = +3

Query  207  TILKPRAPEIIPHRTRLRNVTVAL---FPEPSLSASLNMTITIKNPNYGDCSYRNASAEV  377
            T+ KP+ P      T + ++ V+         ++ SL++ ++IKNPN     Y+N+SA +
Sbjct  46   TVFKPKQPTTTVDSTSISDMKVSFDIARLRVDVNVSLDVDLSIKNPNKVSVKYKNSSAFL  105

Query  378  YYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMP  557
             YR   V   P+  G + A     +     L   ++ S + F  DV  G++ F  + K+ 
Sbjct  106  NYRGQVVGEAPIPAGKILADKTQPINVTVTLMADRLLSDSQFFSDVMAGTIPFNTLTKIS  165

Query  558  VKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
             K +V   F  H++ T  CD+ V VS+++
Sbjct  166  GKASVFNLFNVHITSTSSCDLLVFVSNRT  194



>ref|XP_006381280.1| hypothetical protein POPTR_0006s11350g [Populus trichocarpa]
 gb|ERP59077.1| hypothetical protein POPTR_0006s11350g [Populus trichocarpa]
Length=206

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 74/150 (49%), Gaps = 3/150 (2%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFP---EPSLSASLNMTITIKNPNYGDCSYRNASAE  374
            LT+ KP+        T + ++ V+L        ++ SL+M ++IKNPN     Y+++SA 
Sbjct  45   LTVFKPKQLTTTVDSTSISDLKVSLDTARLRVRVNVSLDMDLSIKNPNKVSAKYKDSSAF  104

Query  375  VYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKM  554
            + YR   V  +P+  G + A     +     L   ++ S +    D   G++ F  + K+
Sbjct  105  LNYRGQVVGEVPIPAGKISADSTKPMNVTLTLVADRLLSDSQLFSDAMAGAIPFNILTKI  164

Query  555  PVKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
              KV++   FK   + T+RCD+ V VS+ +
Sbjct  165  SGKVSIFNLFKVKFTCTVRCDLVVFVSNST  194



>ref|XP_007140029.1| hypothetical protein PHAVU_008G078300g [Phaseolus vulgaris]
 gb|ESW12023.1| hypothetical protein PHAVU_008G078300g [Phaseolus vulgaris]
Length=195

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/163 (23%), Positives = 85/163 (52%), Gaps = 4/163 (2%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVAL--FPEP-SLSASLNMTITIKNPNYGDCSYRNASAE  374
             T+ KP  P       ++ ++++ +  F    +++ SL++ +++ N N     Y N+SA+
Sbjct  32   FTVFKPHPPITTVDTVKVEDMSLGMDIFSMSVNVNVSLDVGVSVTNRNKFGLEYHNSSAQ  91

Query  375  VYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKM  554
            +YYR   +   P+ +G +       +     +   ++AS+T   +D+ +GS+    + ++
Sbjct  92   LYYRGQLIGEGPIPNGEISGEETKGINLTLTIMADRLASNTEVTKDIASGSMPLNTLVRL  151

Query  555  PVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
               V V+   +FHV+ T  CD ++ +S+++  + +TC SK ++
Sbjct  152  FGMVKVMGFIRFHVASTSSCDFALNISNRTI-IGNTCISKTEL  193



>ref|NP_001151664.1| harpin-induced protein [Zea mays]
 gb|ACG43725.1| harpin-induced protein [Zea mays]
Length=235

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/183 (29%), Positives = 79/183 (43%), Gaps = 4/183 (2%)
 Frame = +3

Query  84   DKNSQNTMEITAPKSRKICCFTTallliaiviaavcailFLTILKPRAPEIIPHRTRLRN  263
            D NS+ + +      R  CC    +L+I   +A      F    +PR P ++     +  
Sbjct  3    DNNSKGSSKARRRAHRVACCVALGVLVILGALALA----FYLRYRPRPPRVVATPVDVGI  58

Query  264  VTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQ  443
                L P P+L  S+ + + + NP+     Y  A + V Y   PV    +  G V     
Sbjct  59   EEFRLLPHPALKLSVGVHVVVSNPSNAPFRYGAALSXVTYHGAPVGETLVPAGEVGGGAT  118

Query  444  IDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMS  623
              V   T +DG KVA S  F  D   G L F AVA++  K  VL+ F+  VSV + C + 
Sbjct  119  ARVEPATLVDGVKVAESPHFASDAVAGVLPFVAVARVVGKALVLRAFEVPVSVXVVCLVR  178

Query  624  VKV  632
            + V
Sbjct  179  IYV  181



>ref|XP_007038863.1| Late embryogenesis abundant hydroxyproline-rich glycofamily protein, 
putative [Theobroma cacao]
 gb|EOY23364.1| Late embryogenesis abundant hydroxyproline-rich glycofamily protein, 
putative [Theobroma cacao]
Length=191

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/118 (28%), Positives = 61/118 (52%), Gaps = 0/118 (0%)
 Frame = +3

Query  303  SLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHK  482
            +LN  +T+KN N+G   ++N++  + YR TPV    +      AR    +    ++   K
Sbjct  71   NLNAQVTVKNTNFGHFKFQNSTLTISYRGTPVGEATIVKARARARSTTKLNVTVSVSSDK  130

Query  483  VASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVL  656
            ++ +++   DVG+G++N ++ AK+  K+ + K FK   S  + C M V  S +    L
Sbjct  131  MSRNSALSSDVGSGTINLSSHAKLDGKIHLFKVFKKKKSAEMNCTMEVTTSSKQIQNL  188



>ref|XP_004293054.1| PREDICTED: uncharacterized protein LOC101299162 [Fragaria vesca 
subsp. vesca]
Length=757

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/124 (30%), Positives = 66/124 (53%), Gaps = 1/124 (1%)
 Frame = +3

Query  216  KPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRDTP  395
            K + P+I+     L +  V +FP    + S+ + IT+KN NYG   Y N++A + YR   
Sbjct  34   KLKDPDIVASPINLESFHVIVFPVIKFNVSIGILITVKNRNYGSFKYDNSTAHISYRGKV  93

Query  396  VTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGT-GSLNFTAVAKMPVKVTV  572
            +   PL++G +P+    ++    ++   K+A   +F  D+ T G +NFT+   +  K ++
Sbjct  94   IAEAPLEEGTIPSHKNYNITTSMDILADKLAFDANFQRDLTTVGVVNFTSHTVVHGKGSM  153

Query  573  LKTF  584
            LK F
Sbjct  154  LKIF  157



>ref|XP_010434631.1| PREDICTED: uncharacterized protein LOC104718532 [Camelina sativa]
Length=191

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 77/157 (49%), Gaps = 8/157 (5%)
 Frame = +3

Query  207  TILKPRAPEIIPHRTRLRNVTVALFP--EPSLSASLNMTITIKNPNYGDCSYRNASAEVY  380
            T+ KP+ P +    + +  V+  + P  +  ++ +L + + + NPN  D  Y+     VY
Sbjct  31   TVFKPKHPILQTVSSTVEGVSTNVSPPDQVQVNFTLTLEMLLTNPNVADVEYKTVENLVY  90

Query  381  YRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHK-VASSTSFLEDVGTGSLNFTAVAKMP  557
            YRDT V  L L    +PA+G + +     L   K VA+     +D+  G +     A+MP
Sbjct  91   YRDTLVGNLSLPSSTLPAKGSVMLACPLVLQIDKFVANLGDIAQDILHGKIVMETKARMP  150

Query  558  VKVTVLKTFKFHVSVTIRCDM-----SVKVSDQSYDV  653
             ++T+L  FK H+     C++     ++KV +Q  D+
Sbjct  151  GEITLLGIFKTHMDSISHCNLVLGFPTMKVLEQVCDL  187



>ref|XP_011006239.1| PREDICTED: uncharacterized protein LOC105112288 [Populus euphratica]
Length=227

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/150 (27%), Positives = 73/150 (49%), Gaps = 3/150 (2%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVAL---FPEPSLSASLNMTITIKNPNYGDCSYRNASAE  374
            LT+ KP+ P      T + ++ V+         ++ SL++ ++IKNPN     Y+N+SA 
Sbjct  66   LTVFKPKQPTTTVDSTSISDMKVSFDIARLRVDVNVSLDVDLSIKNPNKVSVKYKNSSAF  125

Query  375  VYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKM  554
            + YR   V   P+  G + A     +     L   ++ S +    DV  G++ F  + K+
Sbjct  126  LNYRGQVVGEAPIPAGKILADKTQPINVTVTLMADRLLSDSQLFSDVMAGAIPFNTLTKI  185

Query  555  PVKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
              K ++   F  H++ T  CD+ V VS+++
Sbjct  186  SGKASIFNLFNVHITSTSSCDLLVFVSNRT  215



>ref|XP_008244315.1| PREDICTED: uncharacterized protein LOC103342465 [Prunus mume]
Length=218

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 45/151 (30%), Positives = 69/151 (46%), Gaps = 5/151 (3%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTI----TIKNPNYGDCSYRNASA  371
            LT+ K R PE   +   L+++ VAL   P L   +N+T+    ++KNPN     Y+N SA
Sbjct  57   LTVFKARDPETTINSVVLKDLDVAL-DLPRLRVDVNLTLDVDLSVKNPNKVGFKYKNGSA  115

Query  372  EVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAK  551
               YR   V    +  G + A     +     +   +    +    DV  G+L  T   K
Sbjct  116  LFNYRGELVGQALIGSGEMSADQTKPMNVTLTIMADRFLDKSELFSDVVAGTLPLTTSTK  175

Query  552  MPVKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
            +  KV +   FK HV  T  CD S+ VS+++
Sbjct  176  VWGKVVIFGIFKIHVISTSSCDFSINVSNKT  206



>ref|XP_008670458.1| PREDICTED: uncharacterized protein LOC103647718 [Zea mays]
 tpg|DAA41030.1| TPA: harpin-induced protein [Zea mays]
Length=220

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 79/183 (43%), Gaps = 4/183 (2%)
 Frame = +3

Query  84   DKNSQNTMEITAPKSRKICCFTTallliaiviaavcailFLTILKPRAPEIIPHRTRLRN  263
            D N++ + +      R  CC    +L+I   +A      F    +PR P ++     +  
Sbjct  4    DNNNKGSSKARRRAHRLACCVALGVLVILGALALA----FYLRYRPRPPRVVATPVDVGI  59

Query  264  VTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQ  443
                L P P+L  S+ + + + NP+     Y  A + V Y   PV    +  G V     
Sbjct  60   EEFRLLPHPALKLSVGVHVVVSNPSNAPFRYGAALSAVTYHGAPVGETLVPAGEVGGGAT  119

Query  444  IDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMS  623
              V   T +DG KVA S  F  D   G L F AVA++  K  VL+ F+  VSV + C + 
Sbjct  120  ARVEPATVVDGVKVAESPHFASDAVAGVLPFVAVARVVGKALVLRAFEVPVSVEVVCLVR  179

Query  624  VKV  632
            + V
Sbjct  180  IYV  182



>ref|XP_010525241.1| PREDICTED: uncharacterized protein LOC104803064 [Tarenaya hassleriana]
Length=223

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 76/150 (51%), Gaps = 4/150 (3%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPE---PSLSASLNMTITIKNPNYGDCSYRNASAE  374
             T+ + + P+I  +  ++ ++ ++L P+   P ++ S+   ++IKNPN     + N + E
Sbjct  61   FTVFRVKEPKIQMNSIKITSLDISLGPQILQPLINVSMAADLSIKNPNSVSFKFGNTTTE  120

Query  375  VYYRDTPVTALPLQDGAVPARGQIDV-VAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAK  551
            VYY  T V       G   AR  + + +    L    ++S    + DVG+GSLN TA   
Sbjct  121  VYYHGTVVGVARGPPGKARARRTMRMNITMDILADRMLSSGGDLVRDVGSGSLNMTAYTV  180

Query  552  MPVKVTVLKTFKFHVSVTIRCDMSVKVSDQ  641
            +  KV +L   K HV+V + C + + +S +
Sbjct  181  VGGKVNILGIVKKHVTVKMNCTVVLSLSSR  210



>ref|XP_001776895.1| predicted protein [Physcomitrella patens]
 gb|EDQ58298.1| predicted protein [Physcomitrella patens]
Length=206

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 84/164 (51%), Gaps = 8/164 (5%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTIT----IKNPNYGDCSYRNASA  371
            LTI K R P +     +L+NVT  L    +LSA LN++I+    + NPNY D  Y N++ 
Sbjct  47   LTIFKFRDPRVSLVNAKLQNVTFNL-DMLTLSALLNISISADVRVDNPNYYDFKYTNSTI  105

Query  372  EVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAK  551
            ++ Y    V  + L  G + +R  +D+ A   ++   +A ++  L+D+ +          
Sbjct  106  DMKYHVDEVGVVNLGAGTIRSRKTVDLPAVIKVEAISLAVNS--LQDLSSNVATLDLDTV  163

Query  552  MPVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
            M  +V + K +K HV+  + C + + +S+Q+    + C  K+K+
Sbjct  164  MRGRVNLAKIYKKHVTAILNCTLDIFISNQTLK-QTVCKQKIKL  206



>ref|XP_008388400.1| PREDICTED: uncharacterized protein LOC103450790 [Malus domestica]
Length=201

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 73/151 (48%), Gaps = 4/151 (3%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVAL-FPEPSLSASLNMTI--TIKNPNYGDCSYRNASAE  374
            LT+ K + P    +   L+++ V+L  P  S+  +L + +  ++KNPN     Y+N++A 
Sbjct  39   LTVFKAKNPTTTVNSAVLKDLDVSLNIPRVSVDXNLTLGVDLSVKNPNKVGFKYKNSTAS  98

Query  375  VYYRDTPVTALPLQDGAVPARGQIDV-VAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAK  551
            + YR T V    +  G + A     + V  T +    +  S+    DV  G+L      K
Sbjct  99   LNYRGTQVGEAQIGSGKISADQTKPMNVTLTIMADRLLGKSSELFSDVRAGTLPLNTFTK  158

Query  552  MPVKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
            +  KV VL  FK HV  T  CD S+ V +++
Sbjct  159  ISGKVIVLGIFKIHVVSTSSCDFSIDVGNRT  189



>ref|XP_003543987.1| PREDICTED: uncharacterized protein LOC100804569 [Glycine max]
Length=376

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 93/181 (51%), Gaps = 6/181 (3%)
 Frame = +3

Query  105  MEITAPKSRKICCFTTallliaiviaavcailFLTILKPRAPEIIPHRTRLRNVTVALFP  284
            +++ + K RK+C   T +++  +++  + A   LT+ K + P  I   T+L +  V+L P
Sbjct  185  IKVGSGKGRKVCLTVTGVVIAIVLLIVILA---LTVFKAKHPVTIVDSTKLEDFHVSLDP  241

Query  285  ---EPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVV  455
                  L+ +L + +++KNPN     Y +++A + YR   +  +P+  G + +       
Sbjct  242  VKLRVDLNVTLGVDVSVKNPNKVGFQYSDSAAHLNYRGQLIGEVPISAGEISSGETKGFN  301

Query  456  AHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVS  635
                +   ++ S++  L DV +G+L  +   +M  KV++L   K HV  +  CD+++ +S
Sbjct  302  LTHTIMADRLLSNSQLLSDVTSGTLPLSTFVRMSGKVSILGFIKVHVVSSTSCDVAINLS  361

Query  636  D  638
            +
Sbjct  362  N  362



>ref|XP_007219590.1| hypothetical protein PRUPE_ppa023497mg [Prunus persica]
 gb|EMJ20789.1| hypothetical protein PRUPE_ppa023497mg [Prunus persica]
Length=313

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 73/150 (49%), Gaps = 3/150 (2%)
 Frame = +3

Query  204  LTILKPRAPEIIPHR---TRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAE  374
             T+ + + P+I  ++   TRL  +     P+P  + SL   +++KNPN     Y N +  
Sbjct  59   FTVFRLKEPKIKMNKVTVTRLELINDNTTPKPGSNISLTADVSVKNPNAASFRYNNTTTT  118

Query  375  VYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKM  554
            +YY    V       G   AR  + +    ++   ++ S+  +  DVG+G L  ++ +++
Sbjct  119  LYYHGVVVGEAHGSPGKAKARRTMRMNITVDVITDRLTSNPKWGADVGSGLLTMSSYSRI  178

Query  555  PVKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
            P +V +    K HV V + C M+V +S Q+
Sbjct  179  PGRVNMWNIIKRHVVVKMNCTMTVNISSQA  208



>emb|CDO98059.1| unnamed protein product [Coffea canephora]
Length=251

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 75/148 (51%), Gaps = 2/148 (1%)
 Frame = +3

Query  210  ILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRD  389
            +L P  PE+   R RL ++ + LFP PS+  +L++T+ I+N ++    Y++    + YR 
Sbjct  77   LLWPSDPEVSIVRLRLDHLGIHLFPIPSVDITLDVTVKIRNRDFFSIDYKSLIVAIGYRG  136

Query  390  TPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFL-EDVGTGSLNFTAVAKMPVKV  566
              +       G + ARG   V A  +L G  + S    L ED+ TG + F    K+  ++
Sbjct  137  KQLGYATSDHGNIKARGSSYVNATVHLSGVNILSDMLLLIEDLATGEITFDTDTKIGGQL  196

Query  567  TVLKTFKFHVSVTIRCDMSVKVSDQSYD  650
              L  F+  +   + C+++V + +Q+ +
Sbjct  197  G-LAFFEIPLQGKVSCEINVNIHNQTIE  223



>ref|XP_001775349.1| predicted protein [Physcomitrella patens]
 gb|EDQ59819.1| predicted protein [Physcomitrella patens]
Length=168

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 71/151 (47%), Gaps = 4/151 (3%)
 Frame = +3

Query  201  FLTILKPRAPEIIPHRTRLR--NVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAE  374
            F T+ K R P I  +  RL   N+T   F  P +   L+M +T+ NPN  D  Y N+S  
Sbjct  6    FFTVFKARDPIIWINGVRLADLNITYGTFI-PHVQLKLDMNLTVHNPNRADYKYSNSSTI  64

Query  375  VYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLED-VGTGSLNFTAVAK  551
            V+Y+   V    +  G + A      +   N+   K    ++F +D V  G +  +A  +
Sbjct  65   VFYQQIQVGHADIPAGQLGAGKTKTQIVTLNVQADKFLEGSNFTKDFVSAGIIPVSATTR  124

Query  552  MPVKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
            +  +V VL  +K H      C+MSV + +Q+
Sbjct  125  VRGEVNVLNIYKGHGVSYSWCNMSVFIVNQT  155



>ref|XP_009413332.1| PREDICTED: uncharacterized protein LOC103994657 [Musa acuminata 
subsp. malaccensis]
Length=246

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 42/151 (28%), Positives = 76/151 (50%), Gaps = 4/151 (3%)
 Frame = +3

Query  210  ILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRD  389
             L P  PE+   R RL ++ +   PE +   SL + + ++NP++    YR+    + YR 
Sbjct  93   FLWPSDPELTVARLRLDDIHITPPPEAAFDISLGVDLRVRNPDFFALDYRSIVVTIGYRG  152

Query  390  TPVTALPLQDGAVPARGQIDVVAHTNLDGHKVAS-STSFLEDVGTGSLNFTAVAKMPVKV  566
             P+ ++  + G + ARG   V A   LDG +V + + S +ED+  GSL    V ++  + 
Sbjct  153  RPLGSVTAEGGHIRARGVSYVRAKLKLDGIRVLNDAISLIEDLARGSLPLNTVTEVDGR-  211

Query  567  TVLKTFKFHVSVTIRCDMSVKVSDQSYDVLS  659
              ++ F   V V  +   +V V+  + +V+S
Sbjct  212  --MRLFFIDVPVQGKISCAVTVNPNTQEVIS  240



>ref|XP_008232966.1| PREDICTED: uncharacterized protein LOC103332053 [Prunus mume]
Length=226

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 72/150 (48%), Gaps = 3/150 (2%)
 Frame = +3

Query  204  LTILKPRAPEIIPHR---TRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAE  374
             T+ + + P+I  ++   TRL  +     P+P  + SL   +++KNPN     Y   +  
Sbjct  59   FTVFRLKEPKIKMNKVTVTRLELINNNTTPKPGSNISLTADVSVKNPNAASFRYNTTTTT  118

Query  375  VYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKM  554
            +YY    V       G   AR  + +    ++   ++ S+  F  DVG+G L  ++ +++
Sbjct  119  LYYHGVVVGEAHGSPGQAKARRTMRMNIAVDVITDRLTSNPKFGADVGSGLLTMSSYSRI  178

Query  555  PVKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
            P +V +    K HV V + C M+V +S Q+
Sbjct  179  PGRVNMWNIIKRHVVVKMNCTMTVNISSQA  208



>ref|XP_002968170.1| hypothetical protein SELMODRAFT_17213, partial [Selaginella moellendorffii]
 ref|XP_002970400.1| hypothetical protein SELMODRAFT_17211, partial [Selaginella moellendorffii]
 gb|EFJ28530.1| hypothetical protein SELMODRAFT_17211, partial [Selaginella moellendorffii]
 gb|EFJ30424.1| hypothetical protein SELMODRAFT_17213, partial [Selaginella moellendorffii]
Length=177

 Score = 62.8 bits (151),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 78/160 (49%), Gaps = 2/160 (1%)
 Frame = +3

Query  207  TILKPRAPEIIPHRTRLRNVTVAL-FPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYY  383
            T+ KP++P I     +L++  V+L    P L   L M +++ NPN     Y N+++ + Y
Sbjct  19   TVFKPKSPVISIDSVQLQSFNVSLNLLSPRLELGLTMWVSVYNPNRASFKYTNSTSVITY  78

Query  384  RDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVK  563
                V    +  G + ARG+       ++   ++  +++ L DV +GS+  +    +  +
Sbjct  79   HGDEVGNARIPAGEIGARGREKFPTDVSIQAMQIVGNSNLLPDVASGSIPISTRTVVSGR  138

Query  564  VTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
            V VL   K H + T  C++++ V+ ++      C+ K K+
Sbjct  139  VNVLNVIKRHATSTSVCNVTISVASRNVQDFK-CSHKTKL  177



>ref|XP_006477513.1| PREDICTED: uncharacterized protein LOC102620163 [Citrus sinensis]
Length=214

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 77/161 (48%), Gaps = 15/161 (9%)
 Frame = +3

Query  213  LKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRDT  392
            L+P  PE+      ++N++      PS + +L   +TI N NYG   Y+N S  V+Y   
Sbjct  61   LRPNTPEVQLESVTVKNLSHGNGTSPSFNVTLVTELTIDNENYGYFEYKNCSGSVFYGSV  120

Query  393  PVTALPLQDGAVPARG--------QIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVA  548
             V  + ++DG V AR          +DV ++ NLD   + S      D+ +G +   + A
Sbjct  121  TVGDVKIRDGRVEAREVKRINVTVDVDVRSNGNLDNQNLRS------DINSGIVKLNSYA  174

Query  549  KMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCAS  671
            K+   V++    K   +  + C M++ ++ ++ + L  C+S
Sbjct  175  KLHGNVSLFNVLKKTKTPELDCSMNLVLARRAVEDL-VCSS  214



>gb|KDO36298.1| hypothetical protein CISIN_1g045946mg [Citrus sinensis]
Length=214

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 77/161 (48%), Gaps = 15/161 (9%)
 Frame = +3

Query  213  LKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRDT  392
            L+P  PE+      ++N++      PS + +L   +TI N NYG   Y+N S  V+Y   
Sbjct  61   LRPNTPEVQLESVTVKNLSHGNGTSPSFNVTLVTELTIDNENYGYFEYKNCSGSVFYGSV  120

Query  393  PVTALPLQDGAVPARG--------QIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVA  548
             V  + ++DG V AR          +DV ++ NLD   + S      D+ +G +   + A
Sbjct  121  TVGDVKIRDGRVEAREVKRINVTVDVDVRSNGNLDNQNLRS------DINSGIVKLNSYA  174

Query  549  KMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCAS  671
            K+   V++    K   +  + C M++ ++ ++ + L  C+S
Sbjct  175  KLHGNVSLFNVLKKTKTPELDCSMNLVLARRAVEDL-VCSS  214



>ref|XP_004306727.1| PREDICTED: uncharacterized protein LOC101306460 [Fragaria vesca 
subsp. vesca]
Length=219

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/150 (27%), Positives = 75/150 (50%), Gaps = 4/150 (3%)
 Frame = +3

Query  204  LTILKPRAPEIIPHR---TRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAE  374
             T+ + + P+I+ ++   T+L  V     P+P  + SL   +++KNPN     Y N +  
Sbjct  59   FTVFRVKEPKIMMNKVTVTKLELVN-GTTPKPGTNISLTADVSVKNPNVASFKYSNTTTT  117

Query  375  VYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKM  554
            +YY  T V       G   AR  + +    ++    + ++ +   DVG+G L  ++ +++
Sbjct  118  LYYHGTVVGEARGPPGRAKARRTMRMNITVDIITDILTTNPNLKTDVGSGLLTMSSYSRI  177

Query  555  PVKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
            P +V +L   K HV V + C M+V +S Q+
Sbjct  178  PGRVNMLNIVKKHVVVKMNCTMTVNISSQA  207



>ref|XP_003551627.1| PREDICTED: uncharacterized protein LOC100802530 [Glycine max]
 gb|KHN40589.1| hypothetical protein glysoja_001087 [Glycine soja]
Length=196

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 87/164 (53%), Gaps = 6/164 (4%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMT----ITIKNPNYGDCSYRNASA  371
            +T+ KPR P       RL+N+++ +    S+S ++N+T    +++ NPN    +Y N+ A
Sbjct  33   MTVFKPRHPITNVDSVRLQNMSLDM-DIFSMSVNVNLTLEVDVSVNNPNKLGFNYYNSYA  91

Query  372  EVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAK  551
            ++ YR   +   P+ +G + A     + +   +   ++ S++   +DV  G L   ++ +
Sbjct  92   QLNYRGQLIGEAPIPNGHILAEEIKGLNSTLTVMADRLVSNSEVTKDVALGLLPLNSLVR  151

Query  552  MPVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
            +  +V VL   KF+V+ T  CD ++ +S+++  V + C  K KI
Sbjct  152  IFGQVNVLGFIKFYVASTSSCDFTLNLSNRTI-VDNKCQEKTKI  194



>ref|XP_009124946.1| PREDICTED: uncharacterized protein LOC103849997 [Brassica rapa]
Length=190

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 67/143 (47%), Gaps = 7/143 (5%)
 Frame = +3

Query  207  TILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIK----NPNYGDCSYRNASAE  374
            T+ KP+ P +    + + +V+   +  P+    LN T+T++    NPN  D  Y+     
Sbjct  30   TVFKPKHPILQTVSSTVEDVST--YVSPTFDVQLNFTLTLQMLMTNPNLADFEYKTVENL  87

Query  375  VYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHK-VASSTSFLEDVGTGSLNFTAVAK  551
            VYYRD  V  L L    +PA+G   +     L   K VA     L+D+   ++     A 
Sbjct  88   VYYRDILVGNLTLPSTTLPAKGSALLPCPLVLQIDKFVADLGDILQDILQRTIVIETKAN  147

Query  552  MPVKVTVLKTFKFHVSVTIRCDM  620
            MP K+TVL  FK H++    C +
Sbjct  148  MPGKITVLGIFKAHLNTVSHCKL  170



>ref|XP_009399918.1| PREDICTED: uncharacterized protein LOC103984192 [Musa acuminata 
subsp. malaccensis]
Length=197

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 74/162 (46%), Gaps = 6/162 (4%)
 Frame = +3

Query  207  TILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMT----ITIKNPNYGDCSYRNASAE  374
            T+ +PR      +   L  + V L   P LS  LN+T    IT  NPN     Y   +AE
Sbjct  37   TVFRPRHTVTTINSVHLGALRVGL-DVPHLSVDLNVTLDLDITATNPNRASFRYDTGNAE  95

Query  375  VYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKM  554
            ++Y    V    +  G V A G +       +   ++ S  +  +DV +GS+ F+   ++
Sbjct  96   LFYHGGLVGEAVIPPGRVGAEGSVRTNVSLTVMADRLISDATLYKDVISGSVPFSTSTRL  155

Query  555  PVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLK  680
            P  VT+L  FK H+     C+++V V  +S +  S C  K K
Sbjct  156  PGTVTILGVFKHHMVAYTMCNITVSVQSRSVEN-SDCRYKTK  196



>ref|XP_003560139.1| PREDICTED: uncharacterized protein LOC100830161 [Brachypodium 
distachyon]
Length=187

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 75/163 (46%), Gaps = 6/163 (4%)
 Frame = +3

Query  201  FLTILKPRAP--EIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAE  374
            + T+ +PR+P  E     TR+  V +  FP P L+ S ++ +T++NPNY    Y +   +
Sbjct  28   YFTVFRPRSPHVEATVVSTRITQVEIT-FP-PKLNLSFSVDVTVRNPNYASFRYGDVMTQ  85

Query  375  VYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKM  554
            + Y   PV    +  G V AR    V A   ++  KV  +  F+ DV  G+L F     +
Sbjct  86   LTYYGNPVGQSVVLAGEVGARTTQTVEALVVVEADKVVYTLPFIPDVLAGALPFETRTTV  145

Query  555  PVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
              K  VL T K   +  + C ++     Q  +  S C S  ++
Sbjct  146  AGKAVVLGTLKISATSVVTCRITTNPIKQ--ESTSECTSTARV  186



>emb|CDY18837.1| BnaAnng03020D [Brassica napus]
Length=190

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 66/143 (46%), Gaps = 7/143 (5%)
 Frame = +3

Query  207  TILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIK----NPNYGDCSYRNASAE  374
            T+ KP+ P +    + + +V+   +  P+    LN T+T++    NPN  D  Y+     
Sbjct  30   TVFKPKHPILQTVSSTVEDVST--YVSPTFDVQLNFTLTLQMLMTNPNLADFEYKTVENL  87

Query  375  VYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHK-VASSTSFLEDVGTGSLNFTAVAK  551
            VYYRD  V  L L    +PA+G   +     L   K VA     L+D+    +     A 
Sbjct  88   VYYRDILVGNLTLPSTTLPAKGSALLPCPLVLQIDKFVADLGDILQDILQRKIVIETKAN  147

Query  552  MPVKVTVLKTFKFHVSVTIRCDM  620
            MP K+TVL  FK H++    C +
Sbjct  148  MPGKITVLGIFKAHLNTVSHCKL  170



>ref|XP_009803964.1| PREDICTED: uncharacterized protein LOC104249272 [Nicotiana sylvestris]
Length=222

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 65/135 (48%), Gaps = 1/135 (1%)
 Frame = +3

Query  279  FPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVA  458
             P+P  + ++   +++KNPNY    Y N +  + YRDT V       G   AR  + +  
Sbjct  89   MPKPGSNMTIKADVSVKNPNYASFRYSNTTTTISYRDTVVGEARGPPGKSKARRTMRMNI  148

Query  459  HTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSD  638
              ++   K+ S +S L D+ TG L   +   +  KV +L+  K HV V + C ++V ++ 
Sbjct  149  TIDIITDKIVSHSSLLSDISTGLLTINSFTSVGGKVNLLRMIKKHVVVKMNCSITVNITS  208

Query  639  QSYDVLSTCASKLKI  683
            Q       C  K+K+
Sbjct  209  QRIQD-QKCKKKVKL  222



>gb|KDP25370.1| hypothetical protein JCGZ_20526 [Jatropha curcas]
Length=213

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 61/119 (51%), Gaps = 0/119 (0%)
 Frame = +3

Query  288  PSLSASLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTN  467
            P  S +L   ++IKNPN+G   + N++  V Y+D  V    L  G V AR    +    +
Sbjct  88   PFFSFTLQAELSIKNPNFGPFKFENSTCSVLYKDRTVGESRLGQGRVAARETETIKVVLD  147

Query  468  LDGHKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
            +  +++  + SF  D+ +G L  ++ A+   ++ +LKT K      + C M+V ++ Q+
Sbjct  148  VKSYRLHDNQSFDSDIKSGILKLSSRARFNGRIHLLKTIKKKRMAFLNCTMNVNLTSQA  206



>ref|XP_008804677.1| PREDICTED: uncharacterized protein LOC103717897 [Phoenix dactylifera]
Length=202

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/171 (30%), Positives = 76/171 (44%), Gaps = 17/171 (10%)
 Frame = +3

Query  201  FLTILKPRAPEIIPHRTRLRNVT--VALFPEPSLSASLNMTITI----KNPNYGDCSYRN  362
            + T+ +PR P I    TR+  V+  V L   P++   +NMT+ I     NPN     +  
Sbjct  39   YFTLFRPREPTIQIVSTRVAGVSPRVTL---PAVRIEINMTLDIDVLVHNPNRASFDHGQ  95

Query  363  ASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKV-ASSTSFLEDVGTGSLNFT  539
                + YR T V    +  G V  RG   V     + G ++ A   SFL DV  G L F 
Sbjct  96   GHTILRYRGTQVGDADVAPGRVAQRGDSHVHLKLRVLGDRLTAQLGSFLADVAAGELPFD  155

Query  540  AVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSD---QSYDVLSTCASKLKI  683
            +  ++P ++T L   KFH      C++ + V D   +S D    C  K K+
Sbjct  156  SSTRVPGRITFLGFIKFHAVAKSECNVVIGVPDLGVKSQD----CTQKTKL  202



>gb|ACU19833.1| unknown [Glycine max]
Length=219

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/133 (28%), Positives = 65/133 (49%), Gaps = 1/133 (1%)
 Frame = +3

Query  285  EPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHT  464
            +P  + SL   +++KNPN     Y N +  +YY    V       G   AR  + +    
Sbjct  88   QPGANMSLVADVSVKNPNVASFRYSNTTTSLYYHGVIVGEARGPPGRAKARRTLRMNVTI  147

Query  465  NLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
            ++   +V SS  F+ D+G+G L  ++ +++P +V +L   K HV V + C  +  +S Q+
Sbjct  148  DVIAARVISSPDFVTDLGSGLLTMSSFSRVPGQVKILNLIKRHVVVKMNCTTTFNISTQA  207

Query  645  YDVLSTCASKLKI  683
                S C  K+K+
Sbjct  208  IKEQS-CKRKVKL  219



>ref|XP_010067292.1| PREDICTED: uncharacterized protein LOC104454202 [Eucalyptus grandis]
Length=199

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/153 (29%), Positives = 74/153 (48%), Gaps = 5/153 (3%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMT----ITIKNPNYGDCSYRNASA  371
            LT+ K + P I      L ++ V++     + A LNMT    I+++NPN     Y ++ A
Sbjct  38   LTVFKAKRPVITVKSMNLTDLGVSV-DMAQMRALLNMTVGADISVRNPNVAGVKYTDSFA  96

Query  372  EVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAK  551
             + YR   V   P+  G + A     +     +   ++ S+     DV  G L  TA  K
Sbjct  97   LLGYRGETVGDAPIPAGRISAYSTEAMNIAVAVMADRLVSNPQVFADVMAGVLPLTANTK  156

Query  552  MPVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYD  650
            +  KV++L  FK HV+  + CD++V  S+++ D
Sbjct  157  ISGKVSLLSVFKIHVTSAVSCDINVFFSNRTID  189



>ref|XP_006826533.1| hypothetical protein AMTR_s00004p00269550 [Amborella trichopoda]
 gb|ERM93770.1| hypothetical protein AMTR_s00004p00269550 [Amborella trichopoda]
Length=131

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 58/112 (52%), Gaps = 0/112 (0%)
 Frame = +3

Query  291  SLSASLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNL  470
            +L+ +L + + IKNPN     + N++A  YYR   V      +G + ARG   +     +
Sbjct  3    NLNVTLGLVLVIKNPNVASFKFSNSTAFAYYRGVEVAQSLDPEGRIAARGSHMLSTRVVI  62

Query  471  DGHKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSV  626
               K+ +  +FL D+  GSL FT+++++  KV +    +F    +  CD++V
Sbjct  63   VADKLVTKPNFLSDILKGSLFFTSISEVSGKVGLFGIVEFQAKSSTSCDITV  114



>ref|XP_010504211.1| PREDICTED: uncharacterized protein LOC104781281 [Camelina sativa]
 ref|XP_010504221.1| PREDICTED: uncharacterized protein LOC104781289 [Camelina sativa]
Length=232

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 70/150 (47%), Gaps = 3/150 (2%)
 Frame = +3

Query  204  LTILKPRAPEIIPHR---TRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAE  374
             T+ KP+ P          RLR     L  +  L+ +LN+ +++KNPN    SY ++SA 
Sbjct  71   FTLFKPKRPVTTMDSISVERLRASVNPLLLKVFLNLTLNVDLSLKNPNRVGFSYDSSSAL  130

Query  375  VYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKM  554
            + YR   +   PL    +  R    +     L   ++ S +  L DV  G +      K+
Sbjct  131  LSYRGQLIGEAPLPASRIAPRKTHLLNLTLTLMADRLLSESELLSDVMAGVIPLNTFVKV  190

Query  555  PVKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
              KV+VLK FK  V  +  CD+ V VSD++
Sbjct  191  SGKVSVLKIFKIKVQSSSSCDLIVSVSDRN  220



>ref|XP_004492604.1| PREDICTED: uncharacterized protein LOC101511623 [Cicer arietinum]
Length=193

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/131 (27%), Positives = 64/131 (49%), Gaps = 1/131 (1%)
 Frame = +3

Query  291  SLSASLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNL  470
            +L+ +LN+ +++KNPN     Y +  A ++YR   +   P+ +G +       V     L
Sbjct  64   NLNVTLNVDVSVKNPNKFGLKYYDGFALLHYRGLQIGEAPIPNGEISPEETKGVNVTLTL  123

Query  471  DGHKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYD  650
               ++ S++    DV +G L       +  +V +L   KFHVS T  CD S+ +++++ +
Sbjct  124  MADRLLSNSQIFSDVTSGKLPLNTFMSIAGEVNILSLIKFHVSSTSTCDFSINITNKTIE  183

Query  651  VLSTCASKLKI  683
                C  K KI
Sbjct  184  N-HVCHYKTKI  193



>emb|CDP08749.1| unnamed protein product [Coffea canephora]
Length=220

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 76/172 (44%), Gaps = 20/172 (12%)
 Frame = +3

Query  201  FLTILKPRAPEIIPHRTRLRNVTVALF--------PEPSLSASLNMTITIKNPNYGDCSY  356
              T+ K + P I     RL  VT+           P+P  + +L   +++KNPNY    Y
Sbjct  58   IFTVFKVKDPVI-----RLNGVTIDKLELVPNGTTPKPGSNMTLTADVSVKNPNYATFKY  112

Query  357  RNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNF  536
            +NAS  ++Y    V       G   AR  + +    +    K+ SS     DVG+G L  
Sbjct  113  QNASTSLFYHGMLVGEAHTLPGKSKARRTLRMNVTIDFIMDKLLSSPMLKSDVGSGLLPM  172

Query  537  TAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSD---QSYDVLSTCASKLKI  683
            T   ++  +V +L  FK HV V + C ++  ++    QS D    C  K+K+
Sbjct  173  TTYTRVGGRVNMLNIFKKHVVVRMNCTVAANITSRTIQSQD----CKRKVKL  220



>gb|KCW88466.1| hypothetical protein EUGRSUZ_A00854 [Eucalyptus grandis]
Length=207

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/153 (29%), Positives = 74/153 (48%), Gaps = 5/153 (3%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMT----ITIKNPNYGDCSYRNASA  371
            LT+ K + P I      L ++ V++     + A LNMT    I+++NPN     Y ++ A
Sbjct  46   LTVFKAKRPVITVKSMNLTDLGVSV-DMAQMRALLNMTVGADISVRNPNVAGVKYTDSFA  104

Query  372  EVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAK  551
             + YR   V   P+  G + A     +     +   ++ S+     DV  G L  TA  K
Sbjct  105  LLGYRGETVGDAPIPAGRISAYSTEAMNIAVAVMADRLVSNPQVFADVMAGVLPLTANTK  164

Query  552  MPVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYD  650
            +  KV++L  FK HV+  + CD++V  S+++ D
Sbjct  165  ISGKVSLLSVFKIHVTSAVSCDINVFFSNRTID  197



>ref|XP_006439452.1| hypothetical protein CICLE_v10023929mg [Citrus clementina]
 gb|ESR52692.1| hypothetical protein CICLE_v10023929mg [Citrus clementina]
Length=214

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 76/161 (47%), Gaps = 15/161 (9%)
 Frame = +3

Query  213  LKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRDT  392
            L+P  PE+      ++N++      PS + +L   +TI N NYG   Y+N S  V+Y   
Sbjct  61   LRPNTPEVQLESVTVKNLSHGNGTSPSFNVTLVTELTIDNENYGYFEYKNCSGSVFYGSV  120

Query  393  PVTALPLQDGAVPARG--------QIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVA  548
             V  + ++DG V AR          +DV ++ NLD   ++S      D  +G +   + A
Sbjct  121  TVGDVKIRDGRVEAREVKRINVTVDVDVRSNGNLDNQNLSS------DRNSGIVKLNSYA  174

Query  549  KMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCAS  671
            K+   V +    K   +  + C M++ ++ ++ + L  C+S
Sbjct  175  KLHGNVNLFNVLKKTKTPELDCSMNLVLARRAVEDL-VCSS  214



>ref|XP_009597586.1| PREDICTED: uncharacterized protein LOC104093535 [Nicotiana tomentosiformis]
Length=222

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 64/135 (47%), Gaps = 1/135 (1%)
 Frame = +3

Query  279  FPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVA  458
             P+P  + ++   ++++NPNY    Y N S  + YRDT V       G   AR  + +  
Sbjct  89   MPKPGSNMTIKADVSVRNPNYASFRYSNTSTTISYRDTVVGEARGPPGKSKARRTMRMNI  148

Query  459  HTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSD  638
              ++   K+ S  S L D+ TG L   +   +  KV +L+  K HV V + C ++V ++ 
Sbjct  149  TIDIITDKIVSHPSLLADISTGLLTMNSFTSVGGKVNLLRMIKKHVVVKMNCSITVNITS  208

Query  639  QSYDVLSTCASKLKI  683
            Q       C  K+K+
Sbjct  209  QRIQD-QRCKKKVKL  222



>ref|XP_009337828.1| PREDICTED: uncharacterized protein LOC103930251 [Pyrus x bretschneideri]
Length=201

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 44/152 (29%), Positives = 72/152 (47%), Gaps = 6/152 (4%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTI----TIKNPNYGDCSYRNASA  371
            LT+ K + P    +   L++  V+L   P +S  +N+T+    ++KNPN     Y+N++A
Sbjct  39   LTVFKAKNPTTTVNSAVLKDFDVSL-NIPRVSVDVNLTLGVDLSVKNPNKVGFKYKNSTA  97

Query  372  EVYYRDTPVTALPLQDGAVPARGQIDV-VAHTNLDGHKVASSTSFLEDVGTGSLNFTAVA  548
             + YR   V    +  G + A     + V  T +    +  S+    DV  G+L      
Sbjct  98   SLNYRGIQVGEAQIGSGEISADQTKPMNVTLTIMADRLLGESSELFSDVRAGTLPLNTFT  157

Query  549  KMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
            K+  KV VL  FK HV  T  CD S+ V +++
Sbjct  158  KISGKVIVLGIFKIHVVSTSSCDFSIDVGNRT  189



>gb|KEH18783.1| late embryogenesis abundant protein [Medicago truncatula]
Length=219

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 77/164 (47%), Gaps = 6/164 (4%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTI----TIKNPNYGDCSYRNASA  371
             T+ K + P++  +  +L N  V L   P+    +NMT+    +IKN N       N++ 
Sbjct  58   FTVFKVKDPKVTTNEIQLTNFGVNLVQIPTPQVKINMTMVVNMSIKNDNIASIKLGNSTT  117

Query  372  EVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAK  551
             VYYR   V    +  G V A+    +     +   ++ SS + L DV  G +     + 
Sbjct  118  TVYYRGITVADAVIPPGLVKAKKTTRLNVTIEVMADRLVSSPNLLGDVVQGEMVMNTYSI  177

Query  552  MPVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
            +P +V +L   K HV + + C M++ +S +  + + TC  K+K+
Sbjct  178  IPGRVKIL-FIKKHVEMKMNCTMTINISKRGIENM-TCTHKVKL  219



>ref|XP_003548621.1| PREDICTED: uncharacterized protein LOC100799820 [Glycine max]
Length=219

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/133 (28%), Positives = 65/133 (49%), Gaps = 1/133 (1%)
 Frame = +3

Query  285  EPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHT  464
            +P  + SL   +++KNPN     Y N +  +YY    V       G   AR  + +    
Sbjct  88   QPGANMSLVADVSVKNPNVASFRYSNTTTSLYYHGVIVGEARGPPGRAKARRTLRMNVTI  147

Query  465  NLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
            ++   +V SS  F+ D+G+G L  ++ +++P +V +L   K HV V + C  +  +S Q+
Sbjct  148  DVITARVISSPDFVTDLGSGLLTMSSFSRVPGQVKILNLIKRHVVVKMNCTTTFNISTQA  207

Query  645  YDVLSTCASKLKI  683
                S C  K+K+
Sbjct  208  IKEQS-CKRKVKL  219



>ref|XP_010515937.1| PREDICTED: uncharacterized protein LOC104791691 [Camelina sativa]
Length=232

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 48/151 (32%), Positives = 73/151 (48%), Gaps = 5/151 (3%)
 Frame = +3

Query  204  LTILKPRAPEIIPHR---TRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAE  374
             T+ KP+ P          RLR     L  +  L+ +LN+ +++KNPN    SY ++SA 
Sbjct  71   FTLFKPKRPVTTMDSISVERLRASVNPLLLKVFLNLTLNVDLSLKNPNRVGFSYDSSSAL  130

Query  375  VYYRDTPVTALPL-QDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAK  551
            + YR   +   PL  D   P +  I  +  T L   ++ S +  L DV  G +      K
Sbjct  131  LNYRGQLIGEAPLPADRIAPRKTHILNLTLT-LMADRLLSESELLSDVMAGVIPLNTFVK  189

Query  552  MPVKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
            +  KV+VLK FK  V  +  CD+ V VSD++
Sbjct  190  VSGKVSVLKIFKIKVQSSSSCDLIVSVSDRN  220



>ref|XP_002277286.1| PREDICTED: uncharacterized protein LOC100258567 [Vitis vinifera]
 emb|CAN73280.1| hypothetical protein VITISV_040609 [Vitis vinifera]
 emb|CBI40418.3| unnamed protein product [Vitis vinifera]
Length=220

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 61/121 (50%), Gaps = 0/121 (0%)
 Frame = +3

Query  282  PEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAH  461
            P P ++ SL   +++KNPN+    Y+N +  ++Y  T +       G   AR  + +   
Sbjct  88   PGPGVNMSLTADVSVKNPNFASFRYKNTTTTLFYSGTVIGEARGPPGQAKARRTMKMNVT  147

Query  462  TNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQ  641
              +    + S+ S L D+ +G L     +++P +V +LK  K HV V + C ++V ++ +
Sbjct  148  IEIILDSLMSNPSLLTDISSGILPMNTYSRVPGRVKMLKIIKKHVVVKMNCSVTVNITSR  207

Query  642  S  644
            S
Sbjct  208  S  208



>ref|XP_003534194.1| PREDICTED: uncharacterized protein LOC100793858 [Glycine max]
Length=257

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 71/146 (49%), Gaps = 2/146 (1%)
 Frame = +3

Query  210  ILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRD  389
            +L P  PEI   R RL  + +   P P L  S ++T+ ++N ++   SY + +  V YR 
Sbjct  87   LLYPSDPEIRLARIRLDRIGIRTNPRPILDLSFSLTVKVRNRDFFSLSYDSLTVSVGYRG  146

Query  390  TPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSF-LEDVGTGSLNFTAVAKMPVKV  566
              +  +    G++ ARG   V A   +DG +V     + LED+  G + F    ++  K+
Sbjct  147  RQLGFVTAGGGSIRARGSSYVDATLTIDGFEVIYDAFYLLEDIAKGVIPFDTDTRVEGKL  206

Query  567  TVLKTFKFHVSVTIRCDMSVKVSDQS  644
              L  F   +  T+ C++ V ++ Q+
Sbjct  207  G-LFFFTVPLKATVSCEVDVNINQQT  231



>ref|XP_007038869.1| Uncharacterized protein TCM_015287 [Theobroma cacao]
 gb|EOY23370.1| Uncharacterized protein TCM_015287 [Theobroma cacao]
Length=214

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 62/145 (43%), Gaps = 4/145 (3%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYY  383
            LT+++ R P+            V     PS    +N   T+KN N+G   Y        Y
Sbjct  61   LTVMRIRNPKFRVRSGSFTTFNVGTEASPSFDLQMNTQFTVKNTNFGHFKYEGGLVTFAY  120

Query  384  RDTPVTALPLQDGAVPARG--QIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMP  557
            R TPV    +Q     AR   ++DVV   + +G  + ++     D+  G L  T+ +K+ 
Sbjct  121  RGTPVGRATIQKARARARSTKKVDVVVELSSNG--LPNTNELGRDISAGVLTLTSSSKLD  178

Query  558  VKVTVLKTFKFHVSVTIRCDMSVKV  632
             K+ ++K  K   S  + C M V +
Sbjct  179  GKIHLMKVIKKKKSTQMNCTMDVAI  203



>ref|XP_010427088.1| PREDICTED: uncharacterized protein LOC104711998 [Camelina sativa]
Length=232

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 46/150 (31%), Positives = 70/150 (47%), Gaps = 3/150 (2%)
 Frame = +3

Query  204  LTILKPRAPEIIPHR---TRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAE  374
             T+ KP+ P          RLR     L  +  L+ +LN+ +++KNPN    SY ++SA 
Sbjct  71   FTLFKPKRPVTTMDSISVERLRASVNPLLLKVFLNLTLNVDLSLKNPNRVGFSYDSSSAL  130

Query  375  VYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKM  554
            + YR   +   PL    V  R    +     L   ++ S +  L DV  G +   A  K+
Sbjct  131  LNYRGQLIGEAPLPASRVAPRKTHLLNLTLTLMADRLLSESELLSDVMAGVIPLNAFVKV  190

Query  555  PVKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
              KV+VLK FK  V  +  CD+ V VS ++
Sbjct  191  SGKVSVLKIFKIKVQSSSSCDLIVSVSGRN  220



>ref|XP_010060068.1| PREDICTED: uncharacterized protein LOC104447999 [Eucalyptus grandis]
 gb|KCW90582.1| hypothetical protein EUGRSUZ_A02687 [Eucalyptus grandis]
Length=187

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 39/147 (27%), Positives = 65/147 (44%), Gaps = 11/147 (7%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFP------EPSLSASLNMTITIKNPNYGDCSYRNA  365
            L +++ R P++     RL + TV           PS    L   + +KN N+G   + + 
Sbjct  33   LLVMRIRNPKV-----RLSSATVENLKLNTSSTSPSFGMQLRAEVAVKNTNFGHFKFDST  87

Query  366  SAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAV  545
            SA + Y+   V +  +      AR    +    ++   K +S+T F  DV +G+L  +  
Sbjct  88   SATISYQGATVGSADIMKAKAKARSTKRMNVTASVGSKKFSSATQFRSDVNSGTLTLSGH  147

Query  546  AKMPVKVTVLKTFKFHVSVTIRCDMSV  626
            AK+  KV + K FK   S  + C M V
Sbjct  148  AKLSGKVVLFKIFKKKKSAEMNCTMDV  174



>ref|XP_010937311.1| PREDICTED: uncharacterized protein LOC105056689 isoform X3 [Elaeis 
guineensis]
Length=232

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 70/145 (48%), Gaps = 4/145 (3%)
 Frame = +3

Query  213  LKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRDT  392
            L P  P+I   R RL  + V+  P  ++  SL + I ++N ++    YR+ +  + YR  
Sbjct  80   LWPSDPDIQVARLRLDRLRVSPPPHAAIDVSLGLQIRVRNQDFFALDYRSLAVSIGYRGR  139

Query  393  PVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFL-EDVGTGSLNFTAVAKMPVKVT  569
            P+  +    G + ARG   V A   LDG +V +   +L ED+  G L   AV K+  K  
Sbjct  140  PLGNVTSDGGHLRARGVSYVDAELELDGIQVLNDAFYLIEDLARGVLPLDAVTKVQGK--  197

Query  570  VLKTFKFHVSVTIRCDMSVKVSDQS  644
             L+ F   + V  R   SV V+ ++
Sbjct  198  -LRLFFLEIPVQGRISCSVNVNPET  221



>gb|EYU25165.1| hypothetical protein MIMGU_mgv1a013680mg [Erythranthe guttata]
Length=213

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 36/152 (24%), Positives = 69/152 (45%), Gaps = 10/152 (7%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALF-----PEPSLSASLNMTITIKNPNYGDCSYRNAS  368
            +T++K R P+      R+R+  +  F       PS S ++N   ++KN N+G   YRN +
Sbjct  60   VTVMKIRTPKF-----RIRSAHLTTFHAGTPGSPSFSGTVNAEFSVKNANFGRYKYRNTT  114

Query  369  AEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVA  548
               +Y+ TPV  + ++D     R         +L+      +     D+  G +  T+ A
Sbjct  115  VGFFYKGTPVGQVFVRDSRAGWRSTKKFRVVVDLNLANAQGNPQLASDLNAGVVQITSQA  174

Query  549  KMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
            +M  +V ++   K + S  + C+M +  + Q 
Sbjct  175  RMAGRVELIFVMKKNKSTDMNCNMEIVTATQQ  206



>ref|XP_010937290.1| PREDICTED: uncharacterized protein LOC105056689 isoform X1 [Elaeis 
guineensis]
Length=241

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 70/146 (48%), Gaps = 4/146 (3%)
 Frame = +3

Query  210  ILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRD  389
             L P  P+I   R RL  + V+  P  ++  SL + I ++N ++    YR+ +  + YR 
Sbjct  79   FLWPSDPDIQVARLRLDRLRVSPPPHAAIDVSLGLQIRVRNQDFFALDYRSLAVSIGYRG  138

Query  390  TPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFL-EDVGTGSLNFTAVAKMPVKV  566
             P+  +    G + ARG   V A   LDG +V +   +L ED+  G L   AV K+  K 
Sbjct  139  RPLGNVTSDGGHLRARGVSYVDAELELDGIQVLNDAFYLIEDLARGVLPLDAVTKVQGK-  197

Query  567  TVLKTFKFHVSVTIRCDMSVKVSDQS  644
              L+ F   + V  R   SV V+ ++
Sbjct  198  --LRLFFLEIPVQGRISCSVNVNPET  221



>ref|XP_004957892.1| PREDICTED: uncharacterized protein LOC101770229 [Setaria italica]
Length=188

 Score = 60.1 bits (144),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 38/161 (24%), Positives = 73/161 (45%), Gaps = 3/161 (2%)
 Frame = +3

Query  201  FLTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVY  380
            + T+ +PR+P ++          + +FP P L+ ++++ +T++NPNY    Y +    V 
Sbjct  29   YFTVFRPRSPRVVATVVGTEISALNVFP-PVLNITVHVDVTVRNPNYASFRYGDVVTAVR  87

Query  381  YRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPV  560
            Y    V    +  G + AR    + A  ++D  ++A++  FL +   G L       +  
Sbjct  88   YHGDGVGESVVPAGEIGARATETIAAKVSVDTVRMAATPYFLPEAALGVLPLETATAVAG  147

Query  561  KVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
            K  V+  FK   S  + C++ V  +    +  S C S + I
Sbjct  148  KAVVMGRFKISASSEVACEVHVYWTRS--NATSECTSTVHI  186



>ref|XP_010937299.1| PREDICTED: uncharacterized protein LOC105056689 isoform X2 [Elaeis 
guineensis]
Length=236

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 70/145 (48%), Gaps = 4/145 (3%)
 Frame = +3

Query  213  LKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRDT  392
            L P  P+I   R RL  + V+  P  ++  SL + I ++N ++    YR+ +  + YR  
Sbjct  80   LWPSDPDIQVARLRLDRLRVSPPPHAAIDVSLGLQIRVRNQDFFALDYRSLAVSIGYRGR  139

Query  393  PVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFL-EDVGTGSLNFTAVAKMPVKVT  569
            P+  +    G + ARG   V A   LDG +V +   +L ED+  G L   AV K+  K  
Sbjct  140  PLGNVTSDGGHLRARGVSYVDAELELDGIQVLNDAFYLIEDLARGVLPLDAVTKVQGK--  197

Query  570  VLKTFKFHVSVTIRCDMSVKVSDQS  644
             L+ F   + V  R   SV V+ ++
Sbjct  198  -LRLFFLEIPVQGRISCSVNVNPET  221



>gb|AGU36451.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36452.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36454.1| hypothetical protein, partial [Helianthus annuus]
Length=198

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 75/150 (50%), Gaps = 4/150 (3%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEP---SLSASLNMTITIKNPNYGDCSYRNASAE  374
            LT+ K + P +  +   L ++ V + P P   SL+ SL + +TIKNPN     Y+ +SA 
Sbjct  37   LTVFKAKKPVLTVNSVALDDLDVNITPLPPKISLNLSLALDLTIKNPNKVSIKYQPSSAI  96

Query  375  VYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKM  554
            + Y+   V  +P+  G + A G   +     L   ++ + +    DV  G+L F+   ++
Sbjct  97   LRYKGRDVGDVPIPAGKIGADGIERLNLTVVLFADRLLTDSGIYRDVLGGNLPFSTYTRI  156

Query  555  PVKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
              K  V+  F  HV+ T  CD+++ +  +S
Sbjct  157  KAKARVV-FFNVHVTSTSTCDVNIDIGSRS  185



>ref|XP_002531822.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30579.1| conserved hypothetical protein [Ricinus communis]
Length=217

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 72/164 (44%), Gaps = 6/164 (4%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMT----ITIKNPNYGDCSYRNASA  371
             T+ K + P        L N+ V L     +   LNMT    +T+ NPN     Y+N SA
Sbjct  56   FTVFKAKEPTTTIDSISLENLKVDL-DAARMGVDLNMTMDVDLTVTNPNKVGLKYKNGSA  114

Query  372  EVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAK  551
             + YR   V  +P+  G + A     +     +   ++ S+     DV +G LN + + K
Sbjct  115  LLNYRGELVGEVPIPAGKMGADETRPMNVTVTVMADRLLSNPQLFSDVMSGLLNVSTLIK  174

Query  552  MPVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
            +  KV +   FK  V  T  CD+SV +++ +      C  K KI
Sbjct  175  LSGKVAIFNIFKISVDTTTTCDVSVFIANATI-ADQKCKYKAKI  217



>ref|XP_002509872.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51259.1| conserved hypothetical protein [Ricinus communis]
Length=221

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/156 (26%), Positives = 71/156 (46%), Gaps = 9/156 (6%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVAL--------FPEPSLSASLNMTITIKNPNYGDCSYR  359
            L +L+P  P       RL+++  A            P+ + +L   + I+N N+G+  Y 
Sbjct  59   LVVLRPVNPNAELSFVRLKDLNYAAGSGGNGNNVSLPAFNMTLESELKIENSNFGEFKYD  118

Query  360  NASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHK-VASSTSFLEDVGTGSLNF  536
            N SA V+Y    V    L++G V AR  + +     +  HK + + T    D+ +G L  
Sbjct  119  NTSARVFYGGMAVGEAILREGRVSARDTLRMNVKVEVRSHKYIYNGTDLTSDINSGILKL  178

Query  537  TAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
             + AK   +V +L+  K   S ++ C  S+ +  +S
Sbjct  179  NSHAKFSGRVNLLQIAKKRRSASMDCSFSLDLRSRS  214



>emb|CDP20614.1| unnamed protein product [Coffea canephora]
Length=216

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 63/147 (43%), Gaps = 1/147 (1%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYY  383
            LTI+K R P+         N  V     P+   S+N  ++IKN N+G   Y+N +   +Y
Sbjct  62   LTIMKVRTPKFRVQSATFDNFNVGTPTNPAFDLSMNARVSIKNANFGTFKYQNTTMNFFY  121

Query  384  RDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFL-EDVGTGSLNFTAVAKMPV  560
            R  PV    +   +V  R    +     L    + +  S L  D+    L  T+ A++  
Sbjct  122  RGNPVGQAAIPKSSVGWRSNKKINVAVKLSSANLPTPNSQLGTDLSIRLLPLTSQAELKG  181

Query  561  KVTVLKTFKFHVSVTIRCDMSVKVSDQ  641
            KV +   FK   +  + C M V V+ Q
Sbjct  182  KVALTFIFKKKKATQMNCSMEVAVASQ  208



>ref|XP_009391139.1| PREDICTED: uncharacterized protein LOC103977372 [Musa acuminata 
subsp. malaccensis]
Length=228

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 78/167 (47%), Gaps = 10/167 (6%)
 Frame = +3

Query  207  TILKPRAPEIIPHRTRLRNVTVALFPEPSLSAS----LNMTI----TIKNPNYGDCSYRN  362
            T+ K + P +  +   +  + V  F  PS S+S    +NMT+    ++KNPN     +  
Sbjct  64   TVFKVKEPVMTMNSVTIEKLAVN-FGAPSSSSSQLFAINMTVVADVSVKNPNAASVRFGA  122

Query  363  ASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTA  542
            ++  +YYR   +       G   AR    +    ++   ++    +  +D+  GS+  T 
Sbjct  123  STTAIYYRAREMGVAYGPPGTARARRTFRINVTVDVMADRILGDANLFDDLAAGSIAVTT  182

Query  543  VAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
              K+  +V VL  FK HV V + C +++ V++QS  V   C  K+++
Sbjct  183  ATKVGGRVRVLGVFKHHVDVMMNCSITMAVANQSI-VGQNCNQKVRL  228



>ref|XP_008239012.1| PREDICTED: uncharacterized protein LOC103337622 [Prunus mume]
Length=213

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 68/143 (48%), Gaps = 2/143 (1%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYY  383
            L +L+ ++P        ++N+     P  SL+A+L   + IKN N+G+  +  +SA ++Y
Sbjct  58   LVVLRVKSPGFNLSSVVVKNLKHTTSPTSSLNATLVTELAIKNKNFGEYKFEGSSASLWY  117

Query  384  RDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKV--ASSTSFLEDVGTGSLNFTAVAKMP  557
                V    +  G V ARG   V     +  +++   +   F  ++ +G L  ++ AK+ 
Sbjct  118  GGFKVGEAKIGKGRVKARGTRRVSLSIEVRSNRLPQEAKNGFEGEINSGYLKISSYAKLS  177

Query  558  VKVTVLKTFKFHVSVTIRCDMSV  626
             KV ++K  K   ++   C M V
Sbjct  178  GKVNLMKIMKKRKTIDTNCTMVV  200



>ref|XP_002279706.1| PREDICTED: uncharacterized protein LOC100258307 [Vitis vinifera]
Length=237

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/145 (28%), Positives = 70/145 (48%), Gaps = 2/145 (1%)
 Frame = +3

Query  210  ILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRD  389
            +L P  P++   R RLR + V  FP  SL  S+++ + ++N +    +YR+    + YR 
Sbjct  84   VLWPSDPDVSIVRLRLRRIAVHTFPRLSLDVSMSLMVKVRNVDLYSMNYRSLHVAIEYRG  143

Query  390  TPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSF-LEDVGTGSLNFTAVAKMPVKV  566
              +  +  ++G V ARG   V A   L+G  V S   F LED+  G++    V ++   +
Sbjct  144  KELGNVTSEEGHVRARGSSLVDASLELNGVAVLSDVIFVLEDLAKGTIPIDTVTEVRGSM  203

Query  567  TVLKTFKFHVSVTIRCDMSVKVSDQ  641
              L  F+  +   + C + V  + Q
Sbjct  204  GFL-FFQLPLRTKVSCQVYVNTNTQ  227



>ref|XP_009370863.1| PREDICTED: uncharacterized protein LOC103960171 [Pyrus x bretschneideri]
Length=202

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/149 (28%), Positives = 70/149 (47%), Gaps = 5/149 (3%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTI----TIKNPNYGDCSYRNASA  371
            LT+ K + P    +   L+++ +AL   P LS  +N+T+    ++ NPN     Y+N++A
Sbjct  41   LTVFKAKDPTTTVNSVVLKDLDLAL-NIPRLSVDVNLTLGVDLSVNNPNKVGFKYKNSTA  99

Query  372  EVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAK  551
             + YR T V    +  G + A     +     +   ++   +    DV  G+L    + K
Sbjct  100  FLNYRGTNVGEAQIGSGKIFADRTKSMNVTLTIMADRLLGKSELFSDVVAGTLPLNTLTK  159

Query  552  MPVKVTVLKTFKFHVSVTIRCDMSVKVSD  638
            +  + +VL  FK HV  T  CD SV V +
Sbjct  160  VSGEASVLGIFKIHVVSTSSCDFSVDVGN  188



>gb|EMS47199.1| hypothetical protein TRIUR3_20290 [Triticum urartu]
Length=192

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 47/159 (30%), Positives = 74/159 (47%), Gaps = 7/159 (4%)
 Frame = +3

Query  210  ILKPRAPEII--PHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYY  383
            + +P  P ++  P  T +++ +  L P PSL+ S ++ +   NP+     Y      V Y
Sbjct  32   LYRPLPPRVVTSPVETIVQDFS--LLP-PSLTLSASVHVMASNPSRAPFRYGETVTAVTY  88

Query  384  RDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVK  563
               PV    +  G +  R    V   T +DG KVA S  F  DV  G+L F  V ++  K
Sbjct  89   HGEPVGTTVVPAGKIGRRTTTWVAPVTVVDGIKVAESPHFASDVVAGALPFVVVVRLDGK  148

Query  564  VTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLK  680
              VL+ F+  V+V + C + V V     D  S C S+++
Sbjct  149  ALVLRAFEVSVTVEVVCYVQVYVLQG--DSSSNCVSRVR  185



>ref|XP_008463309.1| PREDICTED: uncharacterized protein LOC103501497 [Cucumis melo]
Length=216

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 72/150 (48%), Gaps = 5/150 (3%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMT----ITIKNPNYGDCSYRNASA  371
             T+ K + P    +   L ++ V+L     +S  +N+T    I I NPN    SY+N++A
Sbjct  55   FTVFKAKRPITTVNSVALADLDVSL-NLARVSVDINVTLIAGIAITNPNKVGFSYKNSTA  113

Query  372  EVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAK  551
             + YR   V   P+  G + A  + ++     +   ++  +T+   DV  GS+     A+
Sbjct  114  FLNYRGELVGEAPIMAGKIDAGERKEMNITLTIMADRLLKTTTVFSDVVAGSMPLNTYAR  173

Query  552  MPVKVTVLKTFKFHVSVTIRCDMSVKVSDQ  641
            +  KV +L  F  HV  T  CD +V +S++
Sbjct  174  ISGKVKILGIFNIHVVSTTSCDFNVDISER  203



>ref|XP_002462941.1| hypothetical protein SORBIDRAFT_02g035010 [Sorghum bicolor]
 gb|EER99462.1| hypothetical protein SORBIDRAFT_02g035010 [Sorghum bicolor]
Length=195

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/150 (27%), Positives = 69/150 (46%), Gaps = 11/150 (7%)
 Frame = +3

Query  201  FLTILKPRAPEIIPHRTRLRNVTVALFPEPSLSAS--LNMTI----TIKNPNYGDCSYRN  362
            + T+ +PR+P+++        V   +FP+ +   +  LN+T+    T+ NPNY    Y +
Sbjct  34   YFTLFRPRSPKVV-----ATAVGAEIFPKNNGGGAQDLNLTVHVDVTVNNPNYAAFRYGD  88

Query  363  ASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTA  542
             +  V Y    V    +  G +  R    + A   +D  KVA+   F  +  TG L F  
Sbjct  89   VATVVRYHGEDVGLSVVPAGEIGPRETQTIAAAVEVDTGKVATIPYFWVEFPTGKLPFQT  148

Query  543  VAKMPVKVTVLKTFKFHVSVTIRCDMSVKV  632
              ++  K  VL T K   S  + CD++V++
Sbjct  149  ATEVAGKAVVLGTIKIRASSEVACDVTVQL  178



>ref|XP_008345576.1| PREDICTED: uncharacterized protein LOC103408507 [Malus domestica]
Length=202

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/149 (27%), Positives = 70/149 (47%), Gaps = 5/149 (3%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTI----TIKNPNYGDCSYRNASA  371
            LT+ K + P    +   L+++ +AL   P LS  +N+T+    ++ NPN     Y+N++A
Sbjct  41   LTVFKAKDPTTTVNSVVLKDLDLAL-NIPRLSVDVNLTLGVDLSVNNPNKVGFKYKNSTA  99

Query  372  EVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAK  551
             + YR T V    +  G + A     +     +   ++   +    DV  G+L    + K
Sbjct  100  FLNYRGTNVGEAQIGSGEIFADRTKSMNVTLTIMADRLLGKSELFSDVVAGTLPLNTLTK  159

Query  552  MPVKVTVLKTFKFHVSVTIRCDMSVKVSD  638
            +  +V+VL  FK HV  T  CD  + V +
Sbjct  160  VSGEVSVLGIFKIHVVSTSSCDFRIDVGN  188



>ref|XP_008792375.1| PREDICTED: uncharacterized protein LOC103709005 [Phoenix dactylifera]
Length=234

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 82/164 (50%), Gaps = 5/164 (3%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFP--EP-SLSASLNMTITIKNPNYGDCSYRNASAE  374
            LT+ K + P +  +   L      +F   +P SL+A+L   I+IKNPN     + N++ E
Sbjct  71   LTVFKVKDPTLTMNSISLSGFDSGIFSGNDPGSLNATLTADISIKNPNVASFKFDNSTTE  130

Query  375  VYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGS-LNFTAVAK  551
             YY    V      +G V A   + +    ++   +V   T+    + TGS L+ T+   
Sbjct  131  FYYHGKTVGVAYAPNGKVSAHRTVRMNVTVDVLVDQVLLRTNGTMSLITGSELSLTSYTD  190

Query  552  MPVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLST-CASKLK  680
            +  +V VL  +K H+ V + C M+++VS  S ++ +T CA+ ++
Sbjct  191  LNGRVDVLGIYKRHIDVRMNCSMNLEVSALSQEITNTVCAANVE  234



>ref|XP_002511928.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50597.1| conserved hypothetical protein [Ricinus communis]
Length=218

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 65/137 (47%), Gaps = 5/137 (4%)
 Frame = +3

Query  234  IIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPL  413
            II H   + N      P+P  + SL   +++KNPN     Y N ++ +YY    V     
Sbjct  75   IITHMELINNT----IPKPGTNISLVADLSVKNPNIVSFKYDNTTSALYYHGVLVGEARG  130

Query  414  QDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFH  593
              G   AR  + + A  +L   K+ S+ +   D  TG L   +  K+P KV +L   K H
Sbjct  131  PPGHSKARRTMRLNATIDLVADKLISNPNLNTDAATGLLTVDSYTKLPGKVKIL-IIKKH  189

Query  594  VSVTIRCDMSVKVSDQS  644
            V++ + C ++V +S Q+
Sbjct  190  VTIKMNCSLTVNISSQA  206



>ref|XP_010278954.1| PREDICTED: uncharacterized protein LOC104612979 [Nelumbo nucifera]
Length=207

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 58/122 (48%), Gaps = 5/122 (4%)
 Frame = +3

Query  288  PSLSASLNMT----ITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVV  455
            P+L   LN+T    I ++NPN     +    + V+YR   V  + L  G +PARG   + 
Sbjct  72   PALKIELNITLDLEILVENPNRASFKHGPGKSLVFYRGKQVGEVDLAPGRIPARGSETIR  131

Query  456  AHTNLDGHKVASST-SFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKV  632
            A   ++  +  S   + + DV +G L     +++P ++T L   K HV    +C +++  
Sbjct  132  ARLTIEADEFVSELGNLIRDVSSGELVIDTASRIPGRITFLGFIKRHVVAVSQCQVAIGF  191

Query  633  SD  638
             D
Sbjct  192  PD  193



>ref|XP_010036039.1| PREDICTED: uncharacterized protein LOC104425142 [Eucalyptus grandis]
 gb|KCW47563.1| hypothetical protein EUGRSUZ_K01312 [Eucalyptus grandis]
Length=206

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 74/150 (49%), Gaps = 3/150 (2%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEP---SLSASLNMTITIKNPNYGDCSYRNASAE  374
             T+ K + P    + T++R++  ++   P   +L+ +L++ I++KNPN     Y +++  
Sbjct  45   FTVFKAKHPVTTVNSTKVRSLKASVSIAPLGLNLNVTLDLDISVKNPNKVGFKYEDSTCL  104

Query  375  VYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKM  554
            + YR   V  +P+    + A    ++     +  ++  S++    D  +G L      KM
Sbjct  105  LNYRGEQVGEVPIPADEIGADQTKEMNLTLTVLANRFLSNSQAYSDFLSGVLPLNTYTKM  164

Query  555  PVKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
              KVT++  FK HV  T  C +SV VS+ +
Sbjct  165  SGKVTIMGLFKVHVVATTSCALSVYVSNST  194



>gb|AGU36446.1| hypothetical protein, partial [Helianthus annuus]
Length=198

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 41/149 (28%), Positives = 74/149 (50%), Gaps = 4/149 (3%)
 Frame = +3

Query  207  TILKPRAPEIIPHRTRLRNVTVALFPEP---SLSASLNMTITIKNPNYGDCSYRNASAEV  377
            T+ K + P +  +   L ++ V + P P   SL+ SL + +TIKNPN     Y+ +SA +
Sbjct  38   TVFKAKKPVLTVNSVALDDLDVNITPLPPKISLNLSLALDLTIKNPNKVSIKYQPSSAIL  97

Query  378  YYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMP  557
             Y+   V  +P+  G + A G   +     L   ++ + +    DV  G+L F+   ++ 
Sbjct  98   RYKGRDVGDVPIPAGKIGADGIERLNLTVVLFADRLLTDSGIYRDVLGGNLPFSTYTRIK  157

Query  558  VKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
             K  V+  F  HV+ T  CD+++ +  +S
Sbjct  158  AKARVV-FFNVHVTSTSTCDVNIDIGSRS  185



>gb|EAZ40060.1| hypothetical protein OsJ_24506 [Oryza sativa Japonica Group]
Length=224

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 41/143 (29%), Positives = 61/143 (43%), Gaps = 2/143 (1%)
 Frame = +3

Query  201  FLTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVY  380
            + T+L+PR P +       R    AL P P+L+ + ++ +   NPN     Y      V 
Sbjct  64   YFTVLRPRPPRVTATVVGTRVSAFALIPSPALNLTFDVAVAAYNPNRAAFEYGEVVTVVR  123

Query  381  YRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSF-LEDVGTGSLNFTAVAKMP  557
            Y    V    +  G V AR   +V A   +D  +V SS  F LE +  G+L F     + 
Sbjct  124  YHGDAVGEAVVPRGEVGARASAEVRAAVEVDAVEVFSSPYFPLEGIA-GALPFETATTVA  182

Query  558  VKVTVLKTFKFHVSVTIRCDMSV  626
             K  VL   K   S  + C ++V
Sbjct  183  GKAVVLGVLKIRASSVVTCGVTV  205



>gb|AGU36449.1| hypothetical protein, partial [Helianthus annuus]
Length=198

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 41/149 (28%), Positives = 74/149 (50%), Gaps = 4/149 (3%)
 Frame = +3

Query  207  TILKPRAPEIIPHRTRLRNVTVALFPEP---SLSASLNMTITIKNPNYGDCSYRNASAEV  377
            T+ K + P +  +   L ++ V + P P   SL+ SL + +TIKNPN     Y+ +SA +
Sbjct  38   TVFKAKKPVLTVNSVALDDLDVNITPLPPKISLNLSLALDLTIKNPNKVSIKYQPSSAIL  97

Query  378  YYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMP  557
             Y+   V  +P+  G + A G   +     L   ++ + +    DV  G+L F+   ++ 
Sbjct  98   RYKGRDVGDVPIPAGKIGADGIERLNLTVVLFADRLLTDSGIYRDVLGGNLPFSTYTRIK  157

Query  558  VKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
             K  V+  F  HV+ T  CD+++ +  +S
Sbjct  158  AKARVV-FFNVHVTSTSTCDVNIDIGSRS  185



>gb|AGU36448.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36450.1| hypothetical protein, partial [Helianthus annuus]
Length=198

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 41/149 (28%), Positives = 74/149 (50%), Gaps = 4/149 (3%)
 Frame = +3

Query  207  TILKPRAPEIIPHRTRLRNVTVALFPEP---SLSASLNMTITIKNPNYGDCSYRNASAEV  377
            T+ K + P +  +   L ++ V + P P   SL+ SL + +TIKNPN     Y+ +SA +
Sbjct  38   TVFKAKKPVLTVNSVALDDLDVNITPLPPKISLNLSLALDLTIKNPNKVSIKYQPSSAIL  97

Query  378  YYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMP  557
             Y+   V  +P+  G + A G   +     L   ++ + +    DV  G+L F+   ++ 
Sbjct  98   RYKGRDVGDVPIPAGKIGADGIERLNLTVVLFADRLLTDSGIYRDVLGGNLPFSTYTRIK  157

Query  558  VKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
             K  V+  F  HV+ T  CD+++ +  +S
Sbjct  158  AKARVV-FFNVHVTSTSTCDVNIDIGSRS  185



>ref|XP_010278917.1| PREDICTED: uncharacterized protein LOC104612950 [Nelumbo nucifera]
Length=213

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 63/119 (53%), Gaps = 0/119 (0%)
 Frame = +3

Query  294  LSASLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLD  473
            L+ +L++ +++ NPN     Y N+SA++YYR   V    +  G V   G + +     + 
Sbjct  85   LNVTLHIDLSVANPNKVGFKYSNSSAQLYYRGGLVGEAAIPAGKVSPGGTVGINTTLTVF  144

Query  474  GHKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYD  650
              ++ S ++   DV +G+L  +   ++  +VT+L  FK H+     C++S+ +S ++ +
Sbjct  145  ADRLLSDSNLYSDVLSGTLPLSTHTRISGRVTILNLFKHHLVSYTSCNISINISKRTVE  203



>ref|XP_008777264.1| PREDICTED: uncharacterized protein LOC103697223 [Phoenix dactylifera]
Length=232

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 40/150 (27%), Positives = 72/150 (48%), Gaps = 4/150 (3%)
 Frame = +3

Query  210  ILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRD  389
            +L P  PE+     RL  + ++  P+ ++  +L + + ++NP++   +Y + +  V YR 
Sbjct  79   LLWPSDPELQVSHFRLDRIHISRPPDAAMDVTLGVELLVRNPDFVALNYGSLAVSVGYRG  138

Query  390  TPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFL-EDVGTGSLNFTAVAKMPVKV  566
              +  +    G V ARG   V     LDG +     S+L ED+  GSL     A++  K 
Sbjct  139  QRLGTVTSSGGRVSARGLSYVDVELRLDGIQFLDDASYLIEDLNRGSLLLDTFAEVQGK-  197

Query  567  TVLKTFKFHVSVTIRCDMSVKVSDQSYDVL  656
              L+ F F V V  R   SV ++ ++  ++
Sbjct  198  --LRPFFFQVPVQGRVSCSVNINPETQKII  225



>gb|EYU21543.1| hypothetical protein MIMGU_mgv1a013195mg [Erythranthe guttata]
Length=228

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/146 (24%), Positives = 70/146 (48%), Gaps = 1/146 (1%)
 Frame = +3

Query  210  ILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRD  389
            +L P  P++   R RL  +     P+ S+  ++++T+ ++N ++    Y +    + YR 
Sbjct  69   LLWPAKPQLSIIRLRLDRLQFHTIPKMSVDVTMDLTVKVRNEDFYAMYYDSLLVAIGYRG  128

Query  390  TPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASST-SFLEDVGTGSLNFTAVAKMPVKV  566
              +  +    G + ARG   V A   LD  ++ S   S +ED+  G++ F A +++  K+
Sbjct  129  KRLGYVTADGGRIGARGSSYVNATLQLDRVEIMSDVVSLIEDLAKGAVTFDAESEISGKL  188

Query  567  TVLKTFKFHVSVTIRCDMSVKVSDQS  644
             V   F   +   I C++ V   +Q+
Sbjct  189  EVFYFFNLPLKTEIECEVVVSSRNQT  214



>ref|NP_001275944.1| uncharacterized protein LOC102587329 [Solanum tuberosum]
 gb|AFI81520.1| LEA2-2 [Solanum tuberosum]
Length=223

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 65/139 (47%), Gaps = 1/139 (1%)
 Frame = +3

Query  267  TVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQI  446
            T+   P+P  + ++   +++KNPNY    Y N +  + YRDT V       G   AR  +
Sbjct  86   TLLPIPKPGSNMTIKADVSVKNPNYSSFRYSNTTTTISYRDTVVGEARGPPGKSKARKTM  145

Query  447  DVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSV  626
             +    ++   K+ S     +D+ +G L   +   +  +V +L   K +V V + C ++V
Sbjct  146  RMNVTIDIITDKIVSHPGLQDDISSGLLTMNSYTSVGGRVKLLNMIKKYVVVKMNCSITV  205

Query  627  KVSDQSYDVLSTCASKLKI  683
             ++ QS      C  K+K+
Sbjct  206  NITSQSIQ-DQKCTKKVKL  223



>gb|KHN18825.1| hypothetical protein glysoja_045345 [Glycine soja]
Length=217

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 65/133 (49%), Gaps = 3/133 (2%)
 Frame = +3

Query  285  EPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHT  464
            +P  + SL   +++KNPN     Y N S  +YY    V       G   AR  + +    
Sbjct  88   QPGANMSLVADVSVKNPNVASFRYSNTS--LYYHGVIVGEARGPPGRAKARRTLRMNVTI  145

Query  465  NLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
            ++   +V SS  F+ D+G+G L  ++ +++P +V +L   K HV V + C  +  +S Q+
Sbjct  146  DVITARVISSPDFVTDLGSGLLTMSSFSRVPGQVKILNLIKRHVVVKMNCTTTFNISTQA  205

Query  645  YDVLSTCASKLKI  683
                S C  K+K+
Sbjct  206  IKEQS-CKRKVKL  217



>gb|EYU40055.1| hypothetical protein MIMGU_mgv1a018374mg [Erythranthe guttata]
Length=183

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/162 (27%), Positives = 78/162 (48%), Gaps = 15/162 (9%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALF---------PEPSLSASLNMTITIKNPNYGDCSY  356
            LT+LK ++P+I     R   + V  F         P PS++  L   +TIKN N+G   Y
Sbjct  25   LTVLKIKSPKI-----RFNAIAVESFTSNNGNNAGPTPSINMRLLTQLTIKNTNFGQFKY  79

Query  357  RNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHK-VASSTSFLEDVGTGSLN  533
             NA+  + Y   P+    +  G V AR  +      +L+  +   ++T+   D+ +G L 
Sbjct  80   DNATLAILYNGVPLGEAVIPRGRVKARKTLKFNVSFDLNSDRLNGNNTNLGNDINSGVLR  139

Query  534  FTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLS  659
             ++ A++  KV ++K  K + S  + CD  V ++ +  + L+
Sbjct  140  LSSQARVNGKVHLMKIIKKNKSGNMNCDWIVNLATRMVENLN  181



>ref|XP_011093079.1| PREDICTED: uncharacterized protein LOC105173120 [Sesamum indicum]
Length=220

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 77/169 (46%), Gaps = 15/169 (9%)
 Frame = +3

Query  201  FLTILKPRAPEIIPHRTRLRNVTVALF--------PEPSLSASLNMTITIKNPNYGDCSY  356
              T+ K + P I     R+  VTV           P+P  + +LN  +++KNPNY    Y
Sbjct  59   IFTVFKVKDPII-----RMNGVTVERLELINGTTTPQPGSNMTLNADVSVKNPNYASFKY  113

Query  357  RNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNF  536
            +N +  ++YR T +       G   AR  + +    ++   ++ S      D+ +G +  
Sbjct  114  QNTTTALFYRGTEIGEARGPPGRAKARRTMRMNITVDVMTDRILSQPDLSSDINSGLIAI  173

Query  537  TAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
            ++  ++  +V +    K HV+VT+ C +++  + Q+      C  K+K+
Sbjct  174  SSYTRVGGRVKMF-IIKKHVTVTMNCTITINATSQAIQ-QQKCKRKVKL  220



>ref|XP_009334502.1| PREDICTED: uncharacterized protein LOC103927318 [Pyrus x bretschneideri]
Length=214

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/142 (23%), Positives = 68/142 (48%), Gaps = 3/142 (2%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYY  383
            L + + ++P       +++ +     P  S +A+L+  + IKN N+G+  +  +SA ++Y
Sbjct  58   LVVFRVKSPGFNLTSVQIKTLKSTGSPAASFNATLSAQMAIKNKNFGEYKFEGSSASLWY  117

Query  384  RDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKV---ASSTSFLEDVGTGSLNFTAVAKM  554
            R+  V       G+V ARG   V     +  +++     +     ++ +G LN ++ AK+
Sbjct  118  REFKVGEAKFAKGSVKARGIRKVNVSIEVRSNRLPKDVQNGGLGSEINSGFLNISSYAKI  177

Query  555  PVKVTVLKTFKFHVSVTIRCDM  620
              +V ++K  K   +  + C M
Sbjct  178  SGRVHLMKIMKKRKTTDMSCTM  199



>ref|XP_004143964.1| PREDICTED: uncharacterized protein LOC101212153 [Cucumis sativus]
 gb|KGN50049.1| hypothetical protein Csa_5G152140 [Cucumis sativus]
Length=218

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 63/119 (53%), Gaps = 4/119 (3%)
 Frame = +3

Query  279  FPEPSLSASLNM----TITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQI  446
            FP  +LS++  +    +++++NPN     Y  AS E+YY D  +       G V A+  +
Sbjct  79   FPNDTLSSNSGIIVVASVSVRNPNVASFKYSKASIEIYYHDKVIGEGETPPGEVKAKDTL  138

Query  447  DVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMS  623
             +     ++  K+  ++S ++D  +GSL+ ++  ++P +V +L + K +  V I C ++
Sbjct  139  RMNVTVEIEPWKMDDASSLIKDWNSGSLSISSYTEIPGRVKILGSIKKNYLVKISCSLT  197



>ref|XP_008347313.1| PREDICTED: uncharacterized protein LOC103410386 [Malus domestica]
Length=217

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/147 (22%), Positives = 68/147 (46%), Gaps = 0/147 (0%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYY  383
            LT++K ++P+       L    V     PS +  +++   +KN N+G   Y++   E  Y
Sbjct  64   LTVMKIKSPKFRVRSASLSQYEVGSVTNPSFNLEMDVQFGVKNTNFGHFKYKDGIVEFDY  123

Query  384  RDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVK  563
            R T +    + +    AR    V A  +L  + + +++    D+  G +  T+ +++  K
Sbjct  124  RGTKIGQTNVYEERAKARSTRKVEASLDLSSNGLNANSQLASDISLGIIPITSTSRLEGK  183

Query  564  VTVLKTFKFHVSVTIRCDMSVKVSDQS  644
            + ++K  K   S  + C M + ++ +S
Sbjct  184  IHLMKVIKKKRSAHMNCTMDIVLATRS  210



>emb|CAN72107.1| hypothetical protein VITISV_044045 [Vitis vinifera]
Length=224

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 59/116 (51%), Gaps = 1/116 (1%)
 Frame = +3

Query  210  ILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRD  389
            +L P  P++   R RLR + V  FP  SL  S+++ + ++N +    +YR+    + YR 
Sbjct  78   VLWPSDPDVSIVRLRLRRIAVHTFPRLSLDVSMSLMVKVRNVDLYSMNYRSLHVAIEYRG  137

Query  390  TPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSF-LEDVGTGSLNFTAVAKM  554
              +  +  ++G V ARG   V A   L+G  V S   F LED+  G++    V ++
Sbjct  138  KELGNVTSEEGHVRARGSSLVDASLELNGVAVLSDVIFVLEDLAKGTIPIDTVTEV  193



>gb|AGU36443.1| hypothetical protein, partial [Helianthus petiolaris]
Length=198

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 73/150 (49%), Gaps = 4/150 (3%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEP---SLSASLNMTITIKNPNYGDCSYRNASAE  374
            LT+ K + P +  +   L +  V + P P   S++ SL + +TIKNPN     Y+ +SA 
Sbjct  37   LTVFKAKKPVLTVNSVVLDDFDVNITPLPPKISINLSLALDLTIKNPNKVSIKYQPSSAI  96

Query  375  VYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKM  554
            + Y+   V  +P+  G + A G   +     L   ++ + +    DV  G L F+   ++
Sbjct  97   LRYKGRDVGDVPIPAGKIGADGIERLNLTVVLFADRLLTDSGIYRDVLGGXLPFSTYTRI  156

Query  555  PVKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
              K  V+  F  HV+ T  CD+++ +  +S
Sbjct  157  KAKARVV-FFNVHVTSTSTCDVNIDIGSRS  185



>ref|XP_010907059.1| PREDICTED: uncharacterized protein LOC105033825 [Elaeis guineensis]
Length=230

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/148 (30%), Positives = 70/148 (47%), Gaps = 2/148 (1%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYY  383
            L  L P  PE+   R RL  V V+  P  SL+ S+ + + + N ++    Y +    + Y
Sbjct  75   LFFLWPSDPEVRIVRLRLDRVHVSTSPAVSLAVSMGLEVRVWNKDFFSLDYDSIVVCIEY  134

Query  384  RDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFL-EDVGTGSLNFTAVAKMPV  560
            R   + ++  Q G V ARG   V A  ++DG +V +   +L ED   GS+ F  + K+  
Sbjct  135  RGRRLGSVTSQGGHVRARGVSYVDAELHIDGIEVINDAFYLIEDFVRGSIPFDTITKVEG  194

Query  561  KVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
            K+  L  F   +   I C M V   +Q+
Sbjct  195  KLH-LFFFDIPIQGKISCSMHVNALNQT  221



>ref|XP_008382630.1| PREDICTED: uncharacterized protein LOC103445373 [Malus domestica]
 ref|XP_008343349.1| PREDICTED: uncharacterized protein LOC103406110 [Malus domestica]
Length=214

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/142 (22%), Positives = 68/142 (48%), Gaps = 3/142 (2%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYY  383
            L + + ++P       +++ +     P  S +A+L+  + IKN N+G+  +  +SA ++Y
Sbjct  58   LVVFRVKSPGFNLSSVQIKTLKSTGSPAASFNATLSAQMAIKNKNFGEYKFEGSSASLWY  117

Query  384  RDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKV---ASSTSFLEDVGTGSLNFTAVAKM  554
             +  V       G+V ARG   V     +  +++     +     ++ +G LN ++ AK+
Sbjct  118  GEFKVGEAKFAKGSVKARGTRKVNLRIEVRSNRLPKDVQNGGLGSEINSGFLNISSYAKI  177

Query  555  PVKVTVLKTFKFHVSVTIRCDM  620
              +V ++K  K   ++ + C M
Sbjct  178  SGRVHLMKIMKKRKTIDMNCTM  199



>gb|EMT12100.1| hypothetical protein F775_20394 [Aegilops tauschii]
Length=219

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 68/149 (46%), Gaps = 4/149 (3%)
 Frame = +3

Query  201  FLTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVY  380
            FLT+ + R P       RL  +  +L P+P+ +  L +T+ + NPN    SY + +  ++
Sbjct  62   FLTVFRVRDPTTRLLSPRLVGLAPSL-PQPNFT--LLLTVAVHNPNPASFSYASGTTGLW  118

Query  381  YRDTPVTALPLQDGAVPARGQIDV-VAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMP  557
            YR   V    +  G +P++G   V +  T L           + D+  GSL   A A++P
Sbjct  119  YRGAHVGDAQVDPGRIPSKGDGVVQLEMTVLTAGFTKDMAQLIRDIEAGSLPLDANARIP  178

Query  558  VKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
             +V VL  FK +V     C + V   D  
Sbjct  179  GRVAVLGVFKLNVVAYSDCHIVVGFPDME  207



>ref|XP_008779021.1| PREDICTED: uncharacterized protein LOC103698755 [Phoenix dactylifera]
Length=234

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/147 (28%), Positives = 69/147 (47%), Gaps = 2/147 (1%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYY  383
            +  + P  P+I   R RL  + V+  P  ++  SL + I ++N ++    YR+ +  + Y
Sbjct  79   IFFIWPSDPDIQVARLRLDRLRVSPPPRAAIDVSLGLRIRVRNQDFFALDYRSLAVSIGY  138

Query  384  RDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFL-EDVGTGSLNFTAVAKMPV  560
            R   +       G V ARG   V A   LDG +V +   +L ED+  G L   A+ ++  
Sbjct  139  RGRRLGNATSDGGHVRARGVSYVDAELQLDGIEVLNDAFYLIEDIARGFLPLDAITEVQG  198

Query  561  KVTVLKTFKFHVSVTIRCDMSVKVSDQ  641
            K+ +   F+F V   I C ++V    Q
Sbjct  199  KLRLF-FFEFPVQGKISCSLNVNPETQ  224



>ref|XP_007210661.1| hypothetical protein PRUPE_ppa022176mg [Prunus persica]
 gb|EMJ11860.1| hypothetical protein PRUPE_ppa022176mg [Prunus persica]
Length=213

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 69/143 (48%), Gaps = 2/143 (1%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYY  383
            L +L+ ++P        ++++     P  SL+A+L   + IKN N+G+  +  +SA ++Y
Sbjct  58   LVVLRVKSPGFNLSSVSVKSLKHTTSPTSSLNATLVTELAIKNKNFGEYKFEGSSASLWY  117

Query  384  RDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKV--ASSTSFLEDVGTGSLNFTAVAKMP  557
                V    +  G V ARG   V    ++  +++   +   F  ++ +G L  ++ AK+ 
Sbjct  118  GGFKVGEAKIGKGRVKARGTRRVSLSIDVRSNRLPQEAKNGFEGEMNSGYLKISSYAKLT  177

Query  558  VKVTVLKTFKFHVSVTIRCDMSV  626
             KV ++K  K   ++   C M V
Sbjct  178  GKVNLMKIMKKRKTIDTNCTMVV  200



>gb|AGU36453.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36455.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36458.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36459.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36460.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36461.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36462.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36463.1| hypothetical protein, partial [Helianthus annuus]
Length=198

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/149 (27%), Positives = 74/149 (50%), Gaps = 4/149 (3%)
 Frame = +3

Query  207  TILKPRAPEIIPHRTRLRNVTVALFPEP---SLSASLNMTITIKNPNYGDCSYRNASAEV  377
            T+ K + P +  +   L ++ V + P P   SL+ SL + +TIKNPN     Y+ +SA +
Sbjct  38   TVFKAKKPVLTVNSVALDDLDVNITPLPPKISLNLSLALDLTIKNPNKVSIKYQPSSAIL  97

Query  378  YYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMP  557
             Y+   +  +P+  G + A G   +     L   ++ + +    DV  G+L F+   ++ 
Sbjct  98   RYKGRDLGDVPIPAGKIGADGIERLNLTVVLFADRLLTDSGIYRDVLGGNLPFSTYTRIK  157

Query  558  VKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
             K  V+  F  HV+ T  CD+++ +  +S
Sbjct  158  AKARVV-FFNVHVTSTSTCDVNIDIGSRS  185



>ref|XP_006573794.1| PREDICTED: uncharacterized protein LOC102667904 [Glycine max]
Length=184

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/151 (26%), Positives = 69/151 (46%), Gaps = 8/151 (5%)
 Frame = +3

Query  201  FLTILKPRAPEIIPHRTRLRNVT---VALFPEPSLSASLNMTITIKNPNYGDCSYRNASA  371
            F ++L+ + P +     +LR+ T   ++    PS +A+L + + IKNPN+G  SY N   
Sbjct  32   FASLLRVKNPYL-----KLRSATSNKISYSTSPSFNATLIIFLGIKNPNFGAFSYNNNRV  86

Query  372  EVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAK  551
             V Y    +    +  G V  R   ++     L   K   S +   D+ +GSLN T+  K
Sbjct  87   SVLYAGVKIADRQINGGRVRFRETKEINVTVKLMSAKAPISENLSIDISSGSLNLTSNVK  146

Query  552  MPVKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
                V +LK      ++ + C M + ++  +
Sbjct  147  FSGTVHMLKIINIRKTIEMACAMKLNLTSHT  177



>ref|XP_006300138.1| hypothetical protein CARUB_v10016367mg [Capsella rubella]
 gb|EOA33036.1| hypothetical protein CARUB_v10016367mg [Capsella rubella]
Length=190

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 75/157 (48%), Gaps = 8/157 (5%)
 Frame = +3

Query  207  TILKPRAPEIIPHRTRLRNVTVALFP--EPSLSASLNMTITIKNPNYGDCSYRNASAEVY  380
            T+ KP+ P +    + ++ V+  + P  +  L+ +L + + ++NPN  D  Y+     VY
Sbjct  30   TVFKPKHPILQTVSSTVKGVSTNVLPPFQVQLNFTLTLEMLLENPNVADFEYKTMENLVY  89

Query  381  YRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHK-VASSTSFLEDVGTGSLNFTAVAKMP  557
            Y D  V  L L    +PA+G + +     L   + VA+    ++D+  G +     A+MP
Sbjct  90   YMDRLVGNLTLPSSTLPAKGSVILACPLLLQIDQFVANLGDIVQDILHGKIVIETKARMP  149

Query  558  VKVTVLKTFKFHVSVTIRCDM-----SVKVSDQSYDV  653
              +T+L  FK  +     C++     S+ V +Q  D+
Sbjct  150  GVITLLGIFKTRLDSISHCNLVLGFPSMVVLEQVCDL  186



>ref|XP_010527200.1| PREDICTED: uncharacterized protein LOC104804584 [Tarenaya hassleriana]
 ref|XP_010527201.1| PREDICTED: uncharacterized protein LOC104804584 [Tarenaya hassleriana]
Length=214

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 71/146 (49%), Gaps = 2/146 (1%)
 Frame = +3

Query  210  ILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRD  389
             L P  P+I   R +L +V V   P+P++  S ++TI ++N ++    Y +    V YRD
Sbjct  62   FLYPSDPDIRLTRIQLNHVRVLDSPKPAIDLSFSLTIKVRNRDFFSLDYDSLVVSVGYRD  121

Query  390  TPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASST-SFLEDVGTGSLNFTAVAKMPVKV  566
              +  +  + G + AR    + A  +LDG +V       + D+  G + F  +A +   +
Sbjct  122  RELGIVKSRGGHLRARDSSYIDATLDLDGLEVVHDVIHLIGDLAKGVIPFDTIAWVKGDL  181

Query  567  TVLKTFKFHVSVTIRCDMSVKVSDQS  644
                 F+  +   ++C++ V V+DQ+
Sbjct  182  GFF-FFRIPIQGKVKCEVYVNVNDQT  206



>ref|XP_002284574.1| PREDICTED: uncharacterized protein LOC100254347 [Vitis vinifera]
Length=212

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 74/146 (51%), Gaps = 2/146 (1%)
 Frame = +3

Query  210  ILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRD  389
            +L P  P +      L +V V   P  SL  SL++TI ++N ++   SY + +A V YR 
Sbjct  59   LLYPSDPTVQVVGLHLNSVQVHTSPVISLDLSLDLTIRVRNRDFFSFSYTSLTASVGYRG  118

Query  390  TPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSF-LEDVGTGSLNFTAVAKMPVKV  566
              +  +    G + ARG   + A  +LDG +V     + LED+  GS+ F  V+++  K+
Sbjct  119  RRLGFVNSSGGYLRARGSSYINATLDLDGIEVLHDVFYLLEDLARGSIPFDTVSEVRGKL  178

Query  567  TVLKTFKFHVSVTIRCDMSVKVSDQS  644
              L  F+  +   + C++ V  S+Q+
Sbjct  179  G-LFFFEIPLKARVSCEVYVNTSNQT  203



>ref|XP_010251607.1| PREDICTED: uncharacterized protein LOC104593460 [Nelumbo nucifera]
Length=188

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 72/152 (47%), Gaps = 10/152 (7%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTV-----ALFPEPSLSASLNMTITIKNPNYGDCSYRNAS  368
            LT+LK + P +     +L +VTV     A  P PS + +L   I +KN N+G   + N++
Sbjct  35   LTVLKIKTPSV-----KLTSVTVDRLNSATTPSPSFNMTLTAEIAVKNKNFGHFKFDNST  89

Query  369  AEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVA  548
            A V Y  T V    +      AR    +     +   +++  T+   D+ +G+L   + A
Sbjct  90   ATVSYGGTAVGEAFVPMARAKARKTRRMNITMEVTSERLSGVTNLSNDLSSGTLTLNSYA  149

Query  549  KMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
            K+  KV ++K  K   S  + C ++V +  ++
Sbjct  150  KLSGKVHLMKIMKKRKSAEMNCTIAVNLGSKT  181



>emb|CAN63322.1| hypothetical protein VITISV_022239 [Vitis vinifera]
Length=436

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 47/169 (28%), Positives = 85/169 (50%), Gaps = 3/169 (2%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYY  383
             T+ K + P I      L+++  +L P  +++ASL++ ++++NPN     Y NASA + Y
Sbjct  62   FTVFKAKDPVITVGSVSLKDLDFSLTPL-NINASLDVNVSVRNPNRVGFRYNNASALLNY  120

Query  384  RDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVK  563
              + V   P+  G + AR    +    +L   ++  +     DV +GSL  +  A++  K
Sbjct  121  DGSLVGEAPIPAGRIGARKTTGMNIVISLMADRLLLNPQLYSDVLSGSLPLSTYARISGK  180

Query  564  VTVLKTFKFHVSVTIRCDMSVKVSDQSY-DVLSTCASKLKI*LMEFGDH  707
            V+VL   K  V  T  C+M+V V + +  D +    +KL   +++  DH
Sbjct  181  VSVL-FVKIKVVSTSTCNMTVDVKNGTLKDTVCQYKTKLFNTMIQNNDH  228



>ref|XP_010055074.1| PREDICTED: uncharacterized protein LOC104443400 [Eucalyptus grandis]
 gb|KCW71553.1| hypothetical protein EUGRSUZ_E00095 [Eucalyptus grandis]
Length=218

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 62/122 (51%), Gaps = 0/122 (0%)
 Frame = +3

Query  279  FPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVA  458
             P+P  + SL   I++KNPN     Y+N +  +YY  T V       G   AR  + +  
Sbjct  85   IPKPGSNMSLLADISVKNPNVASFKYKNTTTTLYYHGTVVGEARGPPGKSRARRTMRMNI  144

Query  459  HTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSD  638
              ++    + S+ + +ED+    L  ++ +++P +V +L   K HV+V + C M++ ++ 
Sbjct  145  SVDIITDMLLSNPNLIEDMKQQLLPMSSYSRIPGRVNMLNIIKKHVTVKMNCTMTINITS  204

Query  639  QS  644
            ++
Sbjct  205  RA  206



>emb|CBI28084.3| unnamed protein product [Vitis vinifera]
Length=218

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 74/146 (51%), Gaps = 2/146 (1%)
 Frame = +3

Query  210  ILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRD  389
            +L P  P +      L +V V   P  SL  SL++TI ++N ++   SY + +A V YR 
Sbjct  59   LLYPSDPTVQVVGLHLNSVQVHTSPVISLDLSLDLTIRVRNRDFFSFSYTSLTASVGYRG  118

Query  390  TPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSF-LEDVGTGSLNFTAVAKMPVKV  566
              +  +    G + ARG   + A  +LDG +V     + LED+  GS+ F  V+++  K+
Sbjct  119  RRLGFVNSSGGYLRARGSSYINATLDLDGIEVLHDVFYLLEDLARGSIPFDTVSEVRGKL  178

Query  567  TVLKTFKFHVSVTIRCDMSVKVSDQS  644
              L  F+  +   + C++ V  S+Q+
Sbjct  179  G-LFFFEIPLKARVSCEVYVNTSNQT  203



>ref|XP_010937278.1| PREDICTED: uncharacterized protein LOC105056680 [Elaeis guineensis]
Length=236

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/150 (27%), Positives = 71/150 (47%), Gaps = 4/150 (3%)
 Frame = +3

Query  210  ILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRD  389
             L P  PE+     R+  + V+     +L  S+ + + ++NP+Y    Y + +  V+YR 
Sbjct  83   FLWPSDPELRVSHIRVDRIRVSRPGGAALDVSVGIEVRVRNPDYSAIDYGSLAVSVWYRG  142

Query  390  TPVTALPLQDGAVPARGQIDVVAHTNLDGHK-VASSTSFLEDVGTGSLNFTAVAKMPVKV  566
              +     +   V ARG   V A   LDG + +  S+  +ED+ +GSL    V++   K+
Sbjct  143  QRLGTGTTRGWHVRARGSSYVGADLRLDGIQFLDDSSDLIEDLNSGSLVLDTVSEFKGKI  202

Query  567  TVLKTFKFHVSVTIRCDMSVKVSDQSYDVL  656
               + F F V V  R   SV V+ ++  ++
Sbjct  203  ---RLFFFQVPVQGRVSCSVNVNPENQKII  229



>ref|XP_001778135.1| predicted protein [Physcomitrella patens]
 gb|EDQ57025.1| predicted protein [Physcomitrella patens]
Length=220

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/126 (28%), Positives = 59/126 (47%), Gaps = 2/126 (2%)
 Frame = +3

Query  267  TVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQI  446
            T ++ P   L+ SLN+ + IKNPNY    Y N +  + YR   +  +  +   +  R   
Sbjct  87   TKSILPSYQLNVSLNVLVEIKNPNYAGVVYDNVTLRIVYRGDDLGQVKAEGSRIKPRSTA  146

Query  447  DVVAHTNLDGHKVAS-STSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMS  623
            ++ A  NL G+++ S +   +ED   G L  T        V  L   K  ++VT+ CD+ 
Sbjct  147  NLTATVNLKGNEILSDAKQLMEDYSDGKLPLTTYTAFDGSVQ-LWFVKPLLNVTVACDLV  205

Query  624  VKVSDQ  641
            +   D+
Sbjct  206  LNPEDK  211



>ref|XP_002462942.1| hypothetical protein SORBIDRAFT_02g035020 [Sorghum bicolor]
 gb|EER99463.1| hypothetical protein SORBIDRAFT_02g035020 [Sorghum bicolor]
Length=232

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 63/138 (46%), Gaps = 0/138 (0%)
 Frame = +3

Query  201  FLTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVY  380
            F  + +PR P ++     +     +L P P+L  S+ + + + NP++    Y    + V 
Sbjct  36   FYLVYRPRPPRVVATPVDISVDEFSLLPHPTLKVSVGVHVVVSNPSHSPYRYGPTLSAVT  95

Query  381  YRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPV  560
            Y   PV    +  G V  +    +   T +DG KVA +  F  D   G L F AVA++  
Sbjct  96   YHGAPVGETLVPAGEVGGKATARIEPATVVDGVKVAENPHFASDAVAGVLPFVAVARVVG  155

Query  561  KVTVLKTFKFHVSVTIRC  614
            K  VL+ F+  V+V   C
Sbjct  156  KALVLRAFEVPVTVETVC  173



>ref|XP_010251950.1| PREDICTED: uncharacterized protein LOC104593682 [Nelumbo nucifera]
Length=211

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/159 (26%), Positives = 79/159 (50%), Gaps = 12/159 (8%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSAS-LNMTIT----IKNPNYGDCSYRNAS  368
            LT+LK +AP +     +L +V+V     P+ ++S   MT+T    +KN N+G   + N++
Sbjct  56   LTVLKIKAPSV-----KLSSVSVESISLPNGASSPFRMTVTAQVAVKNKNFGHFKFDNST  110

Query  369  AEVYYRDTPVTALPLQDGAVPARG--QIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTA  542
            A + YR   V    + +    AR   +++V    + +   +  ST    D+ TG+L   +
Sbjct  111  ATLTYRSVTVGEAVIPEARAKARKTRRMNVTMEVSSESLSIDGSTYLNSDIRTGNLTLNS  170

Query  543  VAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLS  659
             A++  KV ++K  K   +  + C ++V +  Q+   L+
Sbjct  171  YARLSGKVHLMKIMKKRKTAEMNCTITVNLEKQTVQELN  209



>ref|XP_008234898.1| PREDICTED: uncharacterized protein LOC103333786 [Prunus mume]
Length=218

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/149 (23%), Positives = 67/149 (45%), Gaps = 2/149 (1%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYY  383
            LT++K ++P+         +  V     PS +  +++   +KN N+G  +Y +   E  Y
Sbjct  63   LTVMKIKSPKFRVRSASFSDFEVGNGTSPSFNLDMDVKFRVKNTNFGHFNYEDGIVEFKY  122

Query  384  RDTPVTALPLQDGAVPARGQIDVVAHTNL--DGHKVASSTSFLEDVGTGSLNFTAVAKMP  557
            R T +  + + +    AR    V     L  +G    S +    D+ +G +  T+ +K+ 
Sbjct  123  RGTRIGQVNVYEARARARSTRKVADSLKLTSNGLSANSQSQLASDISSGIIPITSASKLD  182

Query  558  VKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
             K+ ++K  K   S  + C M + ++ QS
Sbjct  183  GKIHLMKVIKKKKSARMNCTMEIVLATQS  211



>gb|AGU36457.1| hypothetical protein, partial [Helianthus annuus]
Length=198

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/149 (27%), Positives = 73/149 (49%), Gaps = 4/149 (3%)
 Frame = +3

Query  207  TILKPRAPEIIPHRTRLRNVTVALFPEP---SLSASLNMTITIKNPNYGDCSYRNASAEV  377
            T+ K + P +  +   L ++ V + P P   SL+ SL + +TIKNPN     Y+ +SA +
Sbjct  38   TVFKAKKPVLTVNSVALDDLDVNITPLPPKISLNLSLALDLTIKNPNKVSIKYQPSSAIL  97

Query  378  YYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMP  557
             Y+      +P+  G + A G   +     L   ++ + +    DV  G+L F+   ++ 
Sbjct  98   RYKGRDXGDVPIPAGKIGADGIERLNLTVVLFADRLLTDSGIYRDVLGGNLPFSTYTRIK  157

Query  558  VKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
             K  V+  F  HV+ T  CD+++ +  +S
Sbjct  158  AKARVV-FFNVHVTSTSTCDVNIDIGSRS  185



>ref|XP_009375608.1| PREDICTED: uncharacterized protein LOC103964401 [Pyrus x bretschneideri]
Length=215

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/147 (22%), Positives = 66/147 (45%), Gaps = 0/147 (0%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYY  383
            LT++K + P+       L    V     PS +  +++   +KN N+G   Y +   E  Y
Sbjct  62   LTVMKIKTPKYRVRSASLSEFEVGSVTSPSFNLVMDVQFGVKNTNFGHFKYEDGIVEFDY  121

Query  384  RDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVK  563
            R T +    + +    AR    V A   L  +++  ++    D+ +G +  T+ +++  K
Sbjct  122  RGTKIGQTNVYEARARARSTKKVDAPLYLSSNELKGNSQLASDISSGIIPVTSTSRLEGK  181

Query  564  VTVLKTFKFHVSVTIRCDMSVKVSDQS  644
            + ++K  K   S  + C M + ++ QS
Sbjct  182  IHLMKVIKKKRSAQMNCTMEIVLATQS  208



>ref|XP_010229652.1| PREDICTED: uncharacterized protein LOC104582058 [Brachypodium 
distachyon]
Length=193

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 72/164 (44%), Gaps = 1/164 (1%)
 Frame = +3

Query  123  KSRKICCFTTallliaiviaavcailFLTILKPRAPEIIPHRTRLRNVTVALFPEPSLSA  302
            K+   CC   +L +  ++  A  A L+  +L+PR P +       +     + P P+L+ 
Sbjct  7    KATVACCGCASLAVALLLGVAFAAALYFAVLRPRPPRVASAAVDTQLSDFRVLP-PALNF  65

Query  303  SLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHK  482
            SL + + + NP +    +  A   V YR + V       G +PAR    V A   +D  +
Sbjct  66   SLAVDVAVHNPGHAPFRHGEAVTAVTYRGSTVGRSASAPGRIPARSTRTVGARVQVDAAR  125

Query  483  VASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRC  614
            V  S  ++ DV +G+L F A   +  +   L+ F+      + C
Sbjct  126  VVVSRHYVADVVSGALRFEARTAVAGEAVALRAFRLSADAEVAC  169



>gb|AGU36444.1| hypothetical protein, partial [Helianthus argophyllus]
Length=198

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/149 (27%), Positives = 73/149 (49%), Gaps = 4/149 (3%)
 Frame = +3

Query  207  TILKPRAPEIIPHRTRLRNVTVALFPEP---SLSASLNMTITIKNPNYGDCSYRNASAEV  377
            T+ K + P +  +   L +  V + P P   SL+ SL + +TIKNPN     Y+ +SA +
Sbjct  38   TVFKAKKPVLTVNSVALDDFDVNITPLPPKISLNLSLALDLTIKNPNKVSIKYQPSSAIL  97

Query  378  YYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMP  557
             Y+   V  +P+  G + A G   +     L   ++ + +    DV  G+L F+   ++ 
Sbjct  98   RYKGRDVGDVPIPAGKIGADGIERLNLTVVLFADRLLTDSGIYRDVLGGNLPFSTYTRIK  157

Query  558  VKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
             K  V+  F  HV+ T  CD+++ +  ++
Sbjct  158  AKARVV-FFNVHVTSTSTCDVNIDIGSRN  185



>ref|XP_002264899.3| PREDICTED: uncharacterized protein LOC100253618 [Vitis vinifera]
Length=218

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 42/147 (29%), Positives = 75/147 (51%), Gaps = 2/147 (1%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYY  383
             T+ K + P I      L+++  +L P  +++ASL++ ++++NPN     Y NASA + Y
Sbjct  62   FTVFKAKDPVITVGSVSLKDLDFSLTPL-NINASLDVNVSVRNPNRVGFRYNNASALLNY  120

Query  384  RDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVK  563
              + V   P+  G + AR    +    +L   ++  +     DV +GSL  +  A++  K
Sbjct  121  DGSLVGEAPIPAGRIGARKTTGMNIVISLMADRLLLNPQLYSDVLSGSLPLSTYARISGK  180

Query  564  VTVLKTFKFHVSVTIRCDMSVKVSDQS  644
            V+VL   K  V  T  C+M+V V + +
Sbjct  181  VSVL-FVKIKVVSTSTCNMTVDVKNGT  206



>tpg|DAA41029.1| TPA: harpin-induced protein [Zea mays]
Length=194

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/150 (27%), Positives = 66/150 (44%), Gaps = 11/150 (7%)
 Frame = +3

Query  201  FLTILKPRAPEIIPHRTRLRNVTVALFPEPSLSAS--LNMTI----TIKNPNYGDCSYRN  362
            + T+ +PR+P+++        V   L P+        LN+T+    T+ NPNY    Y +
Sbjct  33   YFTVFRPRSPKVV-----ATAVVADLLPKGDGGGGQDLNLTVHVDVTVNNPNYAAFRYGD  87

Query  363  ASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTA  542
                V Y  + V    +  G + AR  + V A   +D  KVA++  F  +  TG L F  
Sbjct  88   VVTLVRYHGSDVGMSVVPAGEIGARETLTVAAAVEVDTLKVAATPYFYVEFPTGKLPFET  147

Query  543  VAKMPVKVTVLKTFKFHVSVTIRCDMSVKV  632
               +  +  VL  FK   S  + C ++V +
Sbjct  148  ATAVAGEAVVLGAFKISASSQVACQVTVHL  177



>gb|KDP28555.1| hypothetical protein JCGZ_14326 [Jatropha curcas]
Length=220

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 63/132 (48%), Gaps = 0/132 (0%)
 Frame = +3

Query  249  TRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAV  428
            T+L  +     P+P ++ SL   +++KNPN     Y N S  ++Y    V       G  
Sbjct  77   TQLELINNTNIPKPGVNISLIADVSVKNPNIASFKYNNTSTALFYYGELVGEARGPPGRA  136

Query  429  PARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTI  608
             AR  + +     +   K+ S+ +   + G+G L  ++ +K+P +V +    K H +V +
Sbjct  137  KARRTMRMNVTVEIITDKLISNPNLNTEAGSGLLTMSSYSKIPGRVKLFHIIKKHATVKM  196

Query  609  RCDMSVKVSDQS  644
             C ++V +S Q+
Sbjct  197  NCTITVNISSQA  208



>ref|XP_009103910.1| PREDICTED: uncharacterized protein LOC103829969 [Brassica rapa]
Length=225

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 69/150 (46%), Gaps = 3/150 (2%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRT---RLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAE  374
            LT+ KP+ P          RLR     L  + +L+ +LN  + +KNPN    S+   SA 
Sbjct  64   LTLFKPKNPTATVDSVAVERLRTSVDVLNLKANLNLTLNAHLALKNPNRVGFSFGATSAL  123

Query  375  VYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKM  554
            + Y+   V   PL    V  +  + +     L   ++ S +    DV +GS+   A  K+
Sbjct  124  LNYKGQLVGEAPLPANRVGPQKTLRMNVTLTLMADRLLSESQVFSDVMSGSIPVNAFVKV  183

Query  555  PVKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
              KV+V   FK  V  +  CD+++ VS ++
Sbjct  184  AGKVSVFNMFKIKVKSSASCDVTISVSSRN  213



>gb|AGU36447.1| hypothetical protein, partial [Helianthus annuus]
Length=198

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 74/153 (48%), Gaps = 12/153 (8%)
 Frame = +3

Query  207  TILKPRAPEIIPHRTRLRNVTVALFPEP---SLSASLNMTITIKNPNYGDCSYRNASAEV  377
            T+ K + P +  +   L +  V + P P   SL+ SL + +TIKNPN     Y+ +SA +
Sbjct  38   TVFKAKKPVLTVNSVALDDXDVNITPLPPKISLNLSLALDLTIKNPNKVSIKYQPSSAIL  97

Query  378  YYRDTPVTALPLQDGAVPARGQIDVVAHTNLD----GHKVASSTSFLEDVGTGSLNFTAV  545
             Y+   V  +P+  G + A G    +   NL       ++ + +    DV  G+L F+  
Sbjct  98   RYKGRDVGDVPIPAGKIGADG----IERLNLTVVXFADRLLTBSXIYRDVLGGNLPFSTY  153

Query  546  AKMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
             ++  K  V+  F  HV+ T  CD+++ +  +S
Sbjct  154  TRIKAKARVV-FFNVHVTSTSTCDVNIDIGSRS  185



>gb|AGU36445.1| hypothetical protein, partial [Helianthus annuus]
Length=198

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 74/153 (48%), Gaps = 12/153 (8%)
 Frame = +3

Query  207  TILKPRAPEIIPHRTRLRNVTVALFPEP---SLSASLNMTITIKNPNYGDCSYRNASAEV  377
            T+ K + P +  +   L +  V + P P   SL+ SL + +TIKNPN     Y+ +SA +
Sbjct  38   TVFKAKKPVLTVNSVALDDXDVNITPLPPKISLNLSLALDLTIKNPNKVSIKYQPSSAIL  97

Query  378  YYRDTPVTALPLQDGAVPARGQIDVVAHTNLD----GHKVASSTSFLEDVGTGSLNFTAV  545
             Y+   V  +P+  G + A G    +   NL       ++ + +    DV  G+L F+  
Sbjct  98   RYKGRDVGDVPIPAGKIGADG----IERLNLTVVXFADRLLTBSXIYRDVLGGNLPFSTY  153

Query  546  AKMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
             ++  K  V+  F  HV+ T  CD+++ +  +S
Sbjct  154  TRIKAKARVV-FFNVHVTSTSTCDVNIDIGSRS  185



>ref|NP_001233914.1| plant cell wall protein SlTFR88 [Solanum lycopersicum]
 gb|ABF39005.1| plant cell wall protein SlTFR88 [Solanum lycopersicum]
Length=226

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/139 (24%), Positives = 64/139 (46%), Gaps = 1/139 (1%)
 Frame = +3

Query  267  TVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQI  446
            T+   P+P  + ++   +++KNPNY    Y N +  + YRD  +       G   AR  +
Sbjct  89   TLLPIPKPGSNMTIKADVSVKNPNYSSFKYSNTTTTISYRDAVIGEARGPPGKSKARKTM  148

Query  447  DVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSV  626
             +    ++   K+ S     +D+ +G L   +   +  +V +L   K +V V + C ++V
Sbjct  149  RMNVTIDIMTDKIMSHPGLQDDISSGLLTMNSYTSVGGRVKLLNMIKKYVVVKMNCSITV  208

Query  627  KVSDQSYDVLSTCASKLKI  683
             ++ QS      C  K+K+
Sbjct  209  NITSQSIQD-QKCTKKVKL  226



>ref|XP_007022217.1| Late embryogenesis abundant hydroxyproline-rich glycofamily protein, 
putative [Theobroma cacao]
 gb|EOY13742.1| Late embryogenesis abundant hydroxyproline-rich glycofamily protein, 
putative [Theobroma cacao]
Length=192

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 44/165 (27%), Positives = 81/165 (49%), Gaps = 20/165 (12%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALF------PEPSLSASLNMTITIKNPNYGDCSYRNA  365
            L +++ R P++     RL  VTV           PS S  LN  +++KN N+G   ++N+
Sbjct  36   LIVMRIRNPKV-----RLGGVTVENLRASSSSSSPSFSTKLNAQVSVKNTNFGHFKFKNS  90

Query  366  SAEVYYRDTPVTALPLQDGAVPARG----QIDVVAHTNLDGHKVASSTSFL-EDVGTGSL  530
            +  + Y  +PV    + +G   AR      + ++  +N   +K++ ++  L  D+ +G++
Sbjct  91   TLTISYNGSPVGKATIVEGLARARSTKKFNVTILVSSN---NKISRNSDQLSSDIESGTI  147

Query  531  NFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTC  665
            N ++ AK+  K+ + K FK   S  + C M V  S +    L TC
Sbjct  148  NLSSHAKLEGKIHLFKIFKKKKSAEMNCTMDVNTSLKQIQKL-TC  191



>ref|XP_007152822.1| hypothetical protein PHAVU_004G162700g [Phaseolus vulgaris]
 gb|ESW24816.1| hypothetical protein PHAVU_004G162700g [Phaseolus vulgaris]
Length=258

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 70/148 (47%), Gaps = 4/148 (3%)
 Frame = +3

Query  210  ILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRD  389
            +L P  PE+   R RL  + +   P P L  S ++T+ ++N N+   SY + +  V YR 
Sbjct  86   LLFPSDPEVHLARIRLNRIGIRANPRPILDLSFSLTVKVRNRNFFSLSYDSLAVSVGYRG  145

Query  390  TPV--TALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSF-LEDVGTGSLNFTAVAKMPV  560
              +   + P   G + AR    V A   +DG +V     + LEDV  G + F   +++  
Sbjct  146  RQIGLVSAPGAGGRIRARASSYVDATLTVDGFEVLYDVFYLLEDVAKGVIPFDTDSRVEG  205

Query  561  KVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
            K+ +       +  T+ C++ V ++ Q+
Sbjct  206  KLGLF-FLTIPLKATVSCEVYVNINQQT  232



>ref|XP_006658623.1| PREDICTED: uncharacterized protein LOC102716708 [Oryza brachyantha]
Length=207

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 50/162 (31%), Positives = 75/162 (46%), Gaps = 7/162 (4%)
 Frame = +3

Query  201  FLTILKPRAPEIIPHRTRLRNVTVALFP--EPSLSASLNMTITIKNPNYGDCSYRNASAE  374
            F  + +PR P ++        VT+ LF    P L A + + + + NP+     Y  A A 
Sbjct  33   FYLVYRPRPPRVVATPV---EVTIELFSVLPPKLKAVVGVHVVVSNPSNSPYRYGEALAS  89

Query  375  VYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKM  554
            V Y   PV A  +  G V  +    +   T +DG KVA S  F  D   G L F AV ++
Sbjct  90   VTYHGEPVGASVVPPGEVGGKATKVIEPATVVDGVKVAESPHFASDAVAGVLPFVAVTRV  149

Query  555  PVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLK  680
              K  VL++F+  VSV + C + + V        S+CAS ++
Sbjct  150  EGKALVLQSFEVSVSVEVVCYVQMYVFHGESS--SSCASTVR  189



>ref|XP_009418806.1| PREDICTED: uncharacterized protein LOC103998921 [Musa acuminata 
subsp. malaccensis]
Length=241

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 71/148 (48%), Gaps = 6/148 (4%)
 Frame = +3

Query  210  ILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRD  389
             L P  P++   R R  ++ V   P  ++   L++ + ++NP++    YR+    + YR 
Sbjct  88   FLWPSDPQLTVARLRFDDLRVTPPPFATIDVVLSVDLMVRNPDFFSLDYRSIVVSIGYRG  147

Query  390  TPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFL-EDVGTGSLNFTAVAKMPVKV  566
             P+ ++    G V ARG   V    +LDG  V +   +L ED+  GSL    V ++  + 
Sbjct  148  RPLGSVTADGGHVRARGVSHVHTKLDLDGILVLNDAIYLIEDLFRGSLPLDTVTEVQGR-  206

Query  567  TVLKTFKFHVSV--TIRCDMSVKVSDQS  644
              ++ F F V V   I C ++V + +Q 
Sbjct  207  --MRLFFFDVPVQGNISCALNVNLENQE  232



>gb|EYU40056.1| hypothetical protein MIMGU_mgv1a022222mg [Erythranthe guttata]
Length=192

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 79/163 (48%), Gaps = 16/163 (10%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALF----------PEPSLSASLNMTITIKNPNYGDCS  353
            LT++K ++P+I     RL  + V  F          P PS++  L   +TIKN N+G   
Sbjct  33   LTVMKIKSPKI-----RLNAIAVESFSSSNNGNNAGPTPSINMKLLTQLTIKNTNFGQFK  87

Query  354  YRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHK-VASSTSFLEDVGTGSL  530
            Y NA+  + Y   P+    +  G V AR  +      +L+  +   ++T+   D+ +G L
Sbjct  88   YDNATLAILYNGVPLGEAVIPRGRVKARKTLKFNVSFDLNSDRLNGNNTNLGNDINSGVL  147

Query  531  NFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLS  659
              ++ A++  KV ++K  K + S  + CD  V ++ +  + L+
Sbjct  148  RLSSQARVNGKVHLMKIIKKNKSGNMNCDWIVNLATRMVENLN  190



>ref|XP_004959712.1| PREDICTED: uncharacterized protein LOC101756040 [Setaria italica]
Length=220

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 46/160 (29%), Positives = 70/160 (44%), Gaps = 2/160 (1%)
 Frame = +3

Query  201  FLTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVY  380
            F    +PR P ++     L     AL P P+L  S+ + + + NP+     Y  A + V 
Sbjct  40   FYLHYRPRPPRVVATPVDLSIDEFALLPHPTLRVSVGVHVVVTNPSNSPYRYGAALSAVT  99

Query  381  YRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPV  560
            Y   PV    +  G +  +    V   T +DG +VA S  F  D   G L F AV ++  
Sbjct  100  YHGAPVGETLVPAGEIGGKSTARVEPVTVVDGVRVAESPHFAADAVAGVLPFVAVVRVVG  159

Query  561  KVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLK  680
            K  VL  F+  V+V + C + + V        S CAS ++
Sbjct  160  KALVLHAFEVPVTVEVVCLVRMYVFHGESS--SRCASTVR  197



>ref|XP_007040367.1| Late embryogenesis abundant hydroxyproline-rich glycofamily protein 
[Theobroma cacao]
 gb|EOY24868.1| Late embryogenesis abundant hydroxyproline-rich glycofamily protein 
[Theobroma cacao]
Length=185

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/151 (22%), Positives = 67/151 (44%), Gaps = 0/151 (0%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYY  383
            LT+++ + P++      + N +      P     L   +T+KN N+G   Y N+S  + Y
Sbjct  32   LTVMRIKNPKVRFGAVTVENFSTGNSSSPFFDMRLMAQVTVKNTNFGHFKYENSSIRILY  91

Query  384  RDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVK  563
               PV    +      AR         ++   K++++++   D+ +G L  ++ AK+  K
Sbjct  92   GGMPVGEATIVKARARARQTKKFDVTIDISSSKLSTNSNLGNDIASGVLPLSSEAKLSGK  151

Query  564  VTVLKTFKFHVSVTIRCDMSVKVSDQSYDVL  656
            V ++K  K   S  + C M + +  ++   L
Sbjct  152  VHLMKVIKKKKSSEMSCTMGINIGTRTVQDL  182



>ref|XP_004512968.1| PREDICTED: uncharacterized protein LOC101515080 [Cicer arietinum]
Length=247

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 39/146 (27%), Positives = 72/146 (49%), Gaps = 3/146 (2%)
 Frame = +3

Query  210  ILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRD  389
            IL P  PEI   R R+ ++ +   P+P L  S ++T+ ++N ++   +Y + S  V YR 
Sbjct  76   ILYPSDPEIQLARIRINHIGIRTNPKPILDLSFSVTVKVRNRDFFSLTYDSLSVAVGYRG  135

Query  390  TPVTAL-PLQDGAVPARGQIDVVAHTNLDGHKVASSTSFL-EDVGTGSLNFTAVAKMPVK  563
              +  +  +  G + ARG   V    ++DG +V     +L +D+  G + F     +  K
Sbjct  136  RQLGLVHSIGGGRIKARGSSYVDVVLSVDGFEVIYDAFYLIQDIAKGVIPFETHTTVDGK  195

Query  564  VTVLKTFKFHVSVTIRCDMSVKVSDQ  641
            + +L  F   +  T+ CD+ V ++ Q
Sbjct  196  LGLL-LFNVPLKATVSCDVYVNLNKQ  220



>ref|XP_010529410.1| PREDICTED: uncharacterized protein LOC104806281 [Tarenaya hassleriana]
Length=205

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/147 (26%), Positives = 69/147 (47%), Gaps = 3/147 (2%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRT---RLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAE  374
            LT+ KP+ P  +       +LR           L+ +L++ +++ NPN    SY   SA 
Sbjct  44   LTVFKPKRPVTVIDSVAVDQLRASVDMARMRVLLNLTLDVDLSLTNPNRVGFSYDPTSAL  103

Query  375  VYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKM  554
            + YR   +   P+  G +PA G+  +     L   ++ S++  L DV +G L    + K+
Sbjct  104  LNYRGDLIGEAPIPAGRIPAEGRKPMNLTLTLMADRLLSNSQLLSDVISGELLLNTLVKV  163

Query  555  PVKVTVLKTFKFHVSVTIRCDMSVKVS  635
              KV ++  F   V  +  CD+++ +S
Sbjct  164  TGKVRIINLFNLRVRSSSSCDLTLSIS  190



>ref|XP_010924768.1| PREDICTED: uncharacterized protein LOC105047520 [Elaeis guineensis]
Length=234

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 45/157 (29%), Positives = 76/157 (48%), Gaps = 4/157 (3%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVAL--FPEP-SLSASLNMTITIKNPNYGDCSYRNASAE  374
            LT+ K + P +  +   L  +   L    +P SL+A+L   I+IKNPN     + N++ E
Sbjct  71   LTVFKVKDPTLTMNSITLSGINTGLSTGSDPVSLNATLTADISIKNPNVASFKFDNSTTE  130

Query  375  VYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGS-LNFTAVAK  551
             YY    V      DG V A   + +    ++   +V   T+    + TG+ LN T+   
Sbjct  131  FYYHAATVGVAYAPDGKVSAHRTVRMNVTVDVLIDQVVMRTNRTLSLITGTELNLTSHTD  190

Query  552  MPVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLST  662
            +  +V VL  +K  + V ++C MS++VS  S  + +T
Sbjct  191  LNGRVNVLGIYKRDIYVMMKCSMSLEVSAFSQQITNT  227



>ref|XP_011095190.1| PREDICTED: uncharacterized protein LOC105174699 [Sesamum indicum]
Length=220

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 60/117 (51%), Gaps = 2/117 (2%)
 Frame = +3

Query  294  LSASLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLD  473
            L+ +L++ I++ NPN     Y N +A + YR   V  +P+  G + AR    +     L 
Sbjct  94   LNVTLDLGISLTNPNRVGFKYSNGTAFLRYRGNDVGEVPVPAGKIGARDTRSLNLTLTLM  153

Query  474  GHKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
              ++ S+++   DV +G+L F    ++  KV +L  F  HV     CD+ + V++++
Sbjct  154  ADRLLSNSALYSDVVSGTLPFQTYIRIAGKVRIL--FNIHVVTYTTCDLEISVANRT  208



>ref|XP_003626628.1| hypothetical protein MTR_8g005060 [Medicago truncatula]
Length=201

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 42/183 (23%), Positives = 82/183 (45%), Gaps = 6/183 (3%)
 Frame = +3

Query  105  MEITAPKSRKICCFTTallliaiviaavcailFLTILKPRAPEIIPHRTRLRNVTVALFP  284
            M+  A K RK C   T + +  +++  + A    T+ K + P    +  +LR+  V L  
Sbjct  10   MKAGAGKGRKACLIVTTVFIAIVLLIVILA---FTVFKSKHPVTTVNSLKLRDFDVNLDI  66

Query  285  EP---SLSASLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVV  455
                  L+ +L++ +++KNPN     Y N +A + YR   +  +P+  G + +       
Sbjct  67   AKLRVDLNVTLDVDVSVKNPNKVGFKYSNTTAHLNYRGQLIGEVPISAGDISSGETKGFN  126

Query  456  AHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVS  635
                    ++ S++    D+ +G+L       +  KV +L   K HV  +  CD +V  S
Sbjct  127  LTLTFMADRLLSNSQLFSDITSGTLPLNTFLTIFGKVNILGFIKVHVISSASCDFAVNTS  186

Query  636  DQS  644
            +++
Sbjct  187  NKT  189



>gb|ABE93043.1| Harpin-induced 1 [Medicago truncatula]
 gb|AFK37188.1| unknown [Medicago truncatula]
 gb|AET01104.2| late embryogenesis abundant protein [Medicago truncatula]
Length=192

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 42/183 (23%), Positives = 82/183 (45%), Gaps = 6/183 (3%)
 Frame = +3

Query  105  MEITAPKSRKICCFTTallliaiviaavcailFLTILKPRAPEIIPHRTRLRNVTVALFP  284
            M+  A K RK C   T + +  +++  + A    T+ K + P    +  +LR+  V L  
Sbjct  1    MKAGAGKGRKACLIVTTVFIAIVLLIVILA---FTVFKSKHPVTTVNSLKLRDFDVNLDI  57

Query  285  EP---SLSASLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVV  455
                  L+ +L++ +++KNPN     Y N +A + YR   +  +P+  G + +       
Sbjct  58   AKLRVDLNVTLDVDVSVKNPNKVGFKYSNTTAHLNYRGQLIGEVPISAGDISSGETKGFN  117

Query  456  AHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVS  635
                    ++ S++    D+ +G+L       +  KV +L   K HV  +  CD +V  S
Sbjct  118  LTLTFMADRLLSNSQLFSDITSGTLPLNTFLTIFGKVNILGFIKVHVISSASCDFAVNTS  177

Query  636  DQS  644
            +++
Sbjct  178  NKT  180



>ref|XP_004300828.1| PREDICTED: uncharacterized protein LOC101295630 [Fragaria vesca 
subsp. vesca]
Length=212

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 36/152 (24%), Positives = 71/152 (47%), Gaps = 3/152 (2%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFP-EPSLSASLNMTITIKNPNYGDCSYRNASAEVY  380
            LT++K + P++    T ++N+     P  PS   +    I IKN N+G   +   +A   
Sbjct  60   LTVMKVKTPKVRLGATNVQNLN--FVPTSPSFDTTFATQIRIKNTNWGPYKFDAGTATFM  117

Query  381  YRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPV  560
            Y+   V  +         R    + A  +L+ +++ S+++   ++ +G L  T+ AK+  
Sbjct  118  YQGVAVGQVSFPKSKAGMRSTKKINAEVSLNSNEIPSTSNLGSELSSGVLTLTSEAKLTG  177

Query  561  KVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVL  656
            KV ++   K   S T+ C M + +S ++   L
Sbjct  178  KVELMLIMKKKKSATMNCTMKLDLSTKTIQAL  209



>ref|XP_011077650.1| PREDICTED: uncharacterized protein LOC105161611 [Sesamum indicum]
Length=197

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 37/143 (26%), Positives = 70/143 (49%), Gaps = 4/143 (3%)
 Frame = +3

Query  207  TILKPRAPEIIPHRTRLRNVTVAL---FPEPSLSASLNMTITIKNPNYGDCSYRNASAEV  377
            T+ K + P +  H   L+++  +L         + +L++ I+IKNPN     Y N++A +
Sbjct  38   TVFKVKRPMMTVHSVALQDLDFSLDIARVRLVFNLTLDVGISIKNPNMVGFKYTNSTAFL  97

Query  378  YYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMP  557
             YR   V  +P+  G + AR         +L   ++ ++++F  DV +G++ F    ++ 
Sbjct  98   RYRGNDVGQVPITAGKIGARHTRSFNFTLSLMADRLLANSTFYSDVSSGTVPFQNYIRVA  157

Query  558  VKVTVLKTFKFHVSVTIRCDMSV  626
             KV +L  F  HV     CD+ +
Sbjct  158  GKVRIL-FFSIHVVSYTTCDLDI  179



>emb|CDP10944.1| unnamed protein product [Coffea canephora]
Length=220

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/146 (22%), Positives = 64/146 (44%), Gaps = 0/146 (0%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYY  383
            LT++K + P+            V      S +  +N  + +KN N+G   ++N++   +Y
Sbjct  67   LTVMKIKTPKFRVQSATFETFNVGTATNASFNLRMNAEVGVKNNNFGTYKFQNSTISFFY  126

Query  384  RDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVK  563
              TP+    + D          +    +L  + + S++    D+ +G L   A +K+  K
Sbjct  127  DGTPIGEAMVPDSKSGWLSTKKLNVAVDLSSNNLTSNSQLENDLNSGVLKLNAQSKLSGK  186

Query  564  VTVLKTFKFHVSVTIRCDMSVKVSDQ  641
            VT+   FK   S  + C ++V  +D+
Sbjct  187  VTLTFMFKKKKSTNMDCTITVGFADR  212



>ref|XP_004510083.1| PREDICTED: uncharacterized protein LOC101494111 isoform X1 [Cicer 
arietinum]
 ref|XP_004510084.1| PREDICTED: uncharacterized protein LOC101494111 isoform X2 [Cicer 
arietinum]
 ref|XP_004510085.1| PREDICTED: uncharacterized protein LOC101494111 isoform X3 [Cicer 
arietinum]
Length=192

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 42/183 (23%), Positives = 82/183 (45%), Gaps = 6/183 (3%)
 Frame = +3

Query  105  MEITAPKSRKICCFTTallliaiviaavcailFLTILKPRAPEIIPHRTRLRNVTVALFP  284
            M++ + K RK C   T + +  +++    A   LT+ K + P       +L+N  + L  
Sbjct  1    MKVGSSKGRKTCLTVTGVFIAIVLLIVTLA---LTVFKAKHPITTVDSLKLQNFNLNLDI  57

Query  285  EP---SLSASLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVV  455
                  L+ SL++ +++KNPN     Y N  A + YR   +  +P+  G + +       
Sbjct  58   AKLRVDLNVSLDVDVSVKNPNKVGFKYSNNIAHLNYRGQLIGEVPISAGEISSGETKGFN  117

Query  456  AHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVS  635
                +   ++ S++    D+ +G+L       +  KV +L   K HV  +  CD +V  S
Sbjct  118  LTLTIMADRLFSNSQLYSDITSGTLPLNTFLTISGKVNILGFIKVHVVSSTSCDFAVNTS  177

Query  636  DQS  644
            +++
Sbjct  178  NKT  180



>ref|XP_009368774.1| PREDICTED: uncharacterized protein LOC103958250 [Pyrus x bretschneideri]
Length=217

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/147 (22%), Positives = 67/147 (46%), Gaps = 0/147 (0%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYY  383
            LT++K ++P+       L    V     PS +  +++   +KN N+G   Y +   E  Y
Sbjct  64   LTVMKIKSPKFRVRSASLSQYEVDSVTNPSFNLEMDVQFGVKNTNFGHFKYEDGIVEFDY  123

Query  384  RDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVK  563
            R T +    + +    AR    V A  +L  + + +++    D+  G +  T+ +++  K
Sbjct  124  RGTKIGQTTVYEERAKARSTRKVEASLDLSSNGLNATSQLASDISLGIIPITSTSRLEGK  183

Query  564  VTVLKTFKFHVSVTIRCDMSVKVSDQS  644
            + ++K  K   S  + C M + ++ +S
Sbjct  184  IHLMKVIKKKRSAHMNCIMDIVLATRS  210



>ref|XP_009394853.1| PREDICTED: uncharacterized protein LOC103980249 [Musa acuminata 
subsp. malaccensis]
Length=214

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 66/131 (50%), Gaps = 7/131 (5%)
 Frame = +3

Query  303  SLNMTITIKNPNYGDCSYRNASA---EVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLD  473
            +L++ + ++N NY   S+ +AS    ++ YR   V    ++ G +PARG   +     ++
Sbjct  87   TLDLAVRVRNRNY--ASFAHASGGHTQLLYRGAEVGKARVEPGRIPARGTELLRLALEVE  144

Query  474  GHKVASS-TSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYD  650
              ++A+   S L D  +G++ F A  +MP +VT+L   K H   T  C + + V D S  
Sbjct  145  VDQLATDLGSLLADAASGAVAFDAETRMPGRVTLLGFIKHHAVATSDCHVVIGVPDLSVQ  204

Query  651  VLSTCASKLKI  683
                CA K K+
Sbjct  205  S-QECAMKTKL  214



>ref|XP_006291779.1| hypothetical protein CARUB_v10017950mg [Capsella rubella]
 gb|EOA24677.1| hypothetical protein CARUB_v10017950mg [Capsella rubella]
Length=239

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 53/109 (49%), Gaps = 0/109 (0%)
 Frame = +3

Query  318  ITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASST  497
            +++KNPN    SY + SA + YR   +   PL    +  R    +     L   ++ S +
Sbjct  119  LSLKNPNRVGFSYGSTSAHLNYRGQLIGEAPLAASRIAPRSTHPLNLTLTLMADRLLSES  178

Query  498  SFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
              L DV  G +      K+  KV+VLK FK  V  +  CD+++ VSD++
Sbjct  179  ELLSDVMAGVIPLNTFVKVSGKVSVLKIFKIKVQSSSSCDLNISVSDRN  227



>ref|XP_010916767.1| PREDICTED: uncharacterized protein LOC105041504 [Elaeis guineensis]
Length=225

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 33/147 (22%), Positives = 70/147 (48%), Gaps = 0/147 (0%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYY  383
            +T+ K + P +  +   ++N+ ++L    +++ ++   +++KNPN     +  ++  +YY
Sbjct  67   VTVYKVKEPVMTMNSVSIKNLNLSLGSSLNINMTVVADVSVKNPNAAFFRFGESTTALYY  126

Query  384  RDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVK  563
            R   V       G   AR    +    ++   ++ S  S + D+  G L+ T   K+  +
Sbjct  127  RAREVGVAYGPPGTAGARKTFRINVTIDVMADRLLSDPSVIGDLAAGKLDVTTSTKVGGR  186

Query  564  VTVLKTFKFHVSVTIRCDMSVKVSDQS  644
              +    K HV V + C M++ VS+QS
Sbjct  187  AKIFLIIKRHVDVMMNCSMTMAVSNQS  213



>ref|XP_006381279.1| hypothetical protein POPTR_0006s11340g [Populus trichocarpa]
 gb|ERP59076.1| hypothetical protein POPTR_0006s11340g [Populus trichocarpa]
Length=173

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 75/167 (45%), Gaps = 15/167 (9%)
 Frame = +3

Query  210  ILKPRAPEIIPHRTRLRNVTV-ALFPEPSLSAS-------LNMTITIKNPNYGDCSYRNA  365
            + KP+ P     RT L + T+  + P  S S         LN+T+ +KNPN+    +   
Sbjct  13   VFKPKEP-----RTELLSATLEGISPRISFSPVSIQLNIFLNLTLLVKNPNHASFKHGPG  67

Query  366  SAEVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTS-FLEDVGTGSLNFTA  542
             + + Y+   V    L  G +P++G   + +   ++  ++A+  S  + DV  G L    
Sbjct  68   KSYLLYQGDQVGEADLCPGLIPSKGTQTLPSQLTIEVDEMATHISALISDVLQGQLVIET  127

Query  543  VAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCASKLKI  683
              ++P +V+ LK FK H   T  C +++ +          C SK K+
Sbjct  128  RTRIPGRVSFLKIFKKHAVATSDCRLAIAIPSMKIQS-QECESKTKL  173



>gb|KHN24292.1| hypothetical protein glysoja_049047 [Glycine soja]
Length=187

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/138 (27%), Positives = 69/138 (50%), Gaps = 5/138 (4%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMT----ITIKNPNYGDCSYRNASA  371
            LT+ KPR P       RL+N+++ +    S+S ++N T    + + NPN    +Y N+SA
Sbjct  19   LTVFKPRHPITNVDSIRLQNMSLGM-DMFSMSVNVNFTLEVDVLVNNPNKLGFNYYNSSA  77

Query  372  EVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAK  551
            ++ YR   +   P+ +G +       +     +   ++ S++   +DV  GSL    + +
Sbjct  78   QLNYRTQLIGEAPIPNGDILVEEIKGLNLTLTVMADRLVSNSKVTKDVALGSLPLNTLVR  137

Query  552  MPVKVTVLKTFKFHVSVT  605
            +  +V VL   KF+V+ T
Sbjct  138  IFCQVNVLGFMKFYVAST  155



>emb|CDP12088.1| unnamed protein product [Coffea canephora]
Length=218

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 73/152 (48%), Gaps = 9/152 (6%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMT----ITIKNPNYGDCSYRNASA  371
            L +L+  AP++      ++N+    +  P   ASLNMT    + I N N+G  ++ N S 
Sbjct  64   LVVLRINAPKLKLELVEIKNLK---YTAPDF-ASLNMTMVAQVKIYNQNFGGFTFHNGST  119

Query  372  EVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHK-VASSTSFLEDVGTGSLNFTAVA  548
             V Y +T +     + G V  R    +     +  +  +A + +F  D+G+G +  ++ A
Sbjct  120  SVVYGNTTLGMTYCKSGLVRGRNSERMTVAVQVKANNGLAENKNFSSDMGSGLVKLSSYA  179

Query  549  KMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
             +  ++ VLK F    +  + C MS+ ++ Q+
Sbjct  180  NLRGEIRVLKHFTRRRTSFMNCTMSLNLTSQA  211



>ref|XP_010105722.1| hypothetical protein L484_014210 [Morus notabilis]
 gb|EXC05942.1| hypothetical protein L484_014210 [Morus notabilis]
Length=213

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/149 (23%), Positives = 74/149 (50%), Gaps = 11/149 (7%)
 Frame = +3

Query  207  TILKPRAPEIIPHRTRLRNVTVALFP--EPSLSASLNMTITIKNPNYGDCSYRNASAEVY  380
            T+++ + PE+      + ++T++      PSLS   +  I +KN N+G+  +  +S    
Sbjct  60   TVMRIKGPELRIRSVAIEDLTISNSDTNSPSLSMKFDSEIGVKNTNFGEFKFDESSITFV  119

Query  381  YRDTPVTALPLQDGAVPARG--QIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKM  554
            Y+ T V    ++ G   AR   +++V A  N       ++++   DV +G L  T+ +K+
Sbjct  120  YKGTEVGDASVEKGKAKARSTKKMNVTAEVN-------ANSNLANDVRSGFLTLTSQSKL  172

Query  555  PVKVTVLKTFKFHVSVTIRCDMSVKVSDQ  641
              KV ++K  K   +  + C +++ + ++
Sbjct  173  NGKVHLMKVIKKKKTAEMNCTITINLENK  201



>ref|XP_010058302.1| PREDICTED: uncharacterized protein LOC104446092 [Eucalyptus grandis]
 gb|KCW72346.1| hypothetical protein EUGRSUZ_E00804 [Eucalyptus grandis]
Length=201

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/147 (27%), Positives = 70/147 (48%), Gaps = 3/147 (2%)
 Frame = +3

Query  204  LTILKPRAPEI-IPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVY  380
            L I+K R+P+  +   T ++++TV     PS   S    I IKN N+G   Y   +    
Sbjct  45   LVIMKFRSPKFRVTPPTMIQSLTVGTPASPSFDMSFIAPIQIKNTNWGPFKYDATAVYFT  104

Query  381  YRDTPVTA--LPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKM  554
            ++  PV    +P       +  +IDV  +  LD   + S+ +   D+ +G +  ++  ++
Sbjct  105  WQGIPVGQAYIPKNKANFKSTKKIDVGVNLKLDSANLPSNPNLTNDLSSGIITLSSQGEL  164

Query  555  PVKVTVLKTFKFHVSVTIRCDMSVKVS  635
              KVTV+  FK   +  + C M++ VS
Sbjct  165  NGKVTVMFMFKKKKTSVMDCRMTILVS  191



>ref|XP_008368054.1| PREDICTED: uncharacterized protein LOC103431655 [Malus domestica]
Length=214

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/142 (22%), Positives = 66/142 (46%), Gaps = 3/142 (2%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYY  383
            L +L+ ++P       +++ +     P  S +A+L+  + IKN N+G   +  +SA ++Y
Sbjct  58   LVVLRVKSPGFNLSSVQIKTLKSTSSPAASFNATLSTEMAIKNKNFGQYKFEGSSASLWY  117

Query  384  RDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASST---SFLEDVGTGSLNFTAVAKM  554
             +  V       G+V ARG   V     +  +++           ++ +G LN ++ AK+
Sbjct  118  GEFKVGEAKFAKGSVKARGTRKVNLSIEVRSNRLPKDVQIGGLGSEINSGYLNISSYAKI  177

Query  555  PVKVTVLKTFKFHVSVTIRCDM  620
              +V ++   K   ++ + C M
Sbjct  178  SGRVHLMNIMKKRKTIDMNCTM  199



>ref|XP_003534956.1| PREDICTED: uncharacterized protein LOC100777377 [Glycine max]
Length=195

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 73/138 (53%), Gaps = 5/138 (4%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMT----ITIKNPNYGDCSYRNASA  371
            LT+ KPR P       RL+N+++A+    S+S ++N+T    +++ NPN    +Y N+ A
Sbjct  33   LTVFKPRHPITNVDSVRLQNMSLAM-DIFSMSVNVNLTLEVDVSVNNPNKLGFNYYNSFA  91

Query  372  EVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAK  551
            ++ Y+   +   P+ +G + A     +     +   ++ S+++  +DV  GSL    + +
Sbjct  92   QLNYKGQLIGEAPIPNGDILAEEIKGLNLTLIVMADRLVSNSNVTKDVALGSLPLNTLVR  151

Query  552  MPVKVTVLKTFKFHVSVT  605
            +  +V +L   KF+V+ T
Sbjct  152  IFCQVNILGFMKFYVAST  169



>emb|CAQ58621.1| unknown [Vitis vinifera]
Length=162

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/147 (28%), Positives = 73/147 (50%), Gaps = 2/147 (1%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMTITIKNPNYGDCSYRNASAEVYY  383
             T+ K + P I      L+++  +L P  +++ASL++ ++++NPN     Y NASA + Y
Sbjct  6    FTVFKAKDPVITVGSVSLKDLDFSLTPL-NINASLDVNVSVRNPNRVGFRYNNASALLNY  64

Query  384  RDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVK  563
                V   P+  G + AR    +    +L   ++  +     DV +GSL  +   ++  K
Sbjct  65   DGGLVGEAPIPAGRIGARKTTGMNIVISLMADRLLLNPQLYSDVLSGSLPLSTYTRISGK  124

Query  564  VTVLKTFKFHVSVTIRCDMSVKVSDQS  644
            V+VL   K  V  T  C+M+V V + +
Sbjct  125  VSVL-FVKIKVVSTSTCNMTVDVKNGT  150



>ref|XP_010054770.1| PREDICTED: uncharacterized protein LOC104443115 [Eucalyptus grandis]
Length=235

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/170 (26%), Positives = 76/170 (45%), Gaps = 20/170 (12%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPS----------LSASLNMTITIKNPNYGDCS  353
            LT+L+ + P +     RLR V V      +          L+A+L     ++N N+G   
Sbjct  63   LTVLRVKTPGL-----RLRRVDVKTLSYSAAAAGASSSASLNATLVGEAVLRNANFGGFE  117

Query  354  YRNASA-EVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVAS----STSFLEDVG  518
            + N +A  V Y    +    ++ G   AR +  V     +   ++A+    S +   DVG
Sbjct  118  FSNGTAVSVIYGGAALGGGKIEGGRAGARERARVTVKMEVRSSELAADVDGSRNLASDVG  177

Query  519  TGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQSYDVLSTCA  668
            +G++  T+ AKM  +VTVL   K   +  + C MS+++  +    L  CA
Sbjct  178  SGTVKLTSYAKMRGRVTVLGWIKRWRTAEMNCTMSLELPGRIVRDLQCCA  227



>ref|XP_010036037.1| PREDICTED: uncharacterized protein LOC104425140 [Eucalyptus grandis]
 gb|KCW47561.1| hypothetical protein EUGRSUZ_K01310 [Eucalyptus grandis]
Length=210

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 68/149 (46%), Gaps = 6/149 (4%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVT--VALFP--EPSLSASLNMTITIKNPNYGDCSYRNASA  371
            LT+LKPR P +      L  ++  V LFP  +  L+ +LN+ + I N N+    +    +
Sbjct  46   LTLLKPRDPTVSVASATLSGISPQVTLFPVLKIELNVTLNIILLIHNRNHFSFRHGPGKS  105

Query  372  EVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASS--TSFLEDVGTGSLNFTAV  545
             V YR   V    L  G +PAR   ++     L+  KV +    S + DV  G +   + 
Sbjct  106  IVLYRGGQVGEAELLPGEIPARKSAEMPCRLMLEVDKVMAEDVASLVRDVLGGEVVVKSR  165

Query  546  AKMPVKVTVLKTFKFHVSVTIRCDMSVKV  632
              +P +V + K  + HV  T  C  ++ V
Sbjct  166  TSIPGRVRLWKVLRRHVVATSECQYTIGV  194



>gb|KHN12300.1| hypothetical protein glysoja_026192 [Glycine soja]
Length=184

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 73/138 (53%), Gaps = 5/138 (4%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVALFPEPSLSASLNMT----ITIKNPNYGDCSYRNASA  371
            LT+ KPR P       RL+N+++A+    S+S ++N+T    +++ NPN    +Y N+ A
Sbjct  22   LTVFKPRHPITNVDSVRLQNMSLAM-DIFSMSVNVNLTLEVDVSVNNPNKLGFNYYNSFA  80

Query  372  EVYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAK  551
            ++ Y+   +   P+ +G + A     +     +   ++ S+++  +DV  GSL    + +
Sbjct  81   QLNYKGQLIGEAPIPNGDILAEEIKGLNLTLIVMADRLVSNSNVTKDVALGSLPLNTLVR  140

Query  552  MPVKVTVLKTFKFHVSVT  605
            +  +V +L   KF+V+ T
Sbjct  141  IFCQVNILGFMKFYVAST  158



>emb|CDP06360.1| unnamed protein product [Coffea canephora]
Length=210

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/149 (27%), Positives = 71/149 (48%), Gaps = 5/149 (3%)
 Frame = +3

Query  204  LTILKPRAPEIIPHRTRLRNVTVAL---FPEPSLSASLNMTITIKNPNYGDCSYRNASAE  374
            LT+ K + P    +   LR++ V++        L+ SL+  I + NPN     Y N++A 
Sbjct  51   LTVFKAKRPVTTVNSVSLRDIDVSVDVARLRVLLNVSLDANIAVNNPNRVGFHYANSTAI  110

Query  375  VYYRDTPVTALPLQDGAVPARGQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKM  554
            + YR   V  +P+  G +  R  + +     L   ++ S+++   DV +G+L  T   ++
Sbjct  111  LKYRGQDVGQVPIPAGYIGPRQTLPMNITLTLMADRLLSNSNLYRDVLSGTLPLTTFTRI  170

Query  555  PVKVTVLKTFKFHVSVTIRCDMSVKVSDQ  641
               V +L  FK HV     CD+ V V ++
Sbjct  171  SGYVRIL--FKIHVVSYTTCDLDVDVGNR  197



>gb|EYU35113.1| hypothetical protein MIMGU_mgv1a013462mg [Erythranthe guttata]
Length=220

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/134 (25%), Positives = 63/134 (47%), Gaps = 2/134 (1%)
 Frame = +3

Query  282  PEPSLSASLNMTITIKNPNYGDCSYRNASAEVYYRDTPVTALPLQDGAVPARGQIDVVAH  461
            P P  + +LN  +++KNPN+    Y N +  +YYR   +       G+  AR  + +   
Sbjct  89   PRPGSNMTLNADVSVKNPNHASFRYMNTTTTLYYRGAVIGEARGPPGSARARRTMRMNVT  148

Query  462  TNLDGHKVASSTSFLEDVGTGSLNFTAVAKMPVKVTVLKTFKFHVSVTIRCDMSVKVSDQ  641
              +   +V S+     D+ TG L  +    +  +V +L   K H++V + C M++ ++ Q
Sbjct  149  VEVITDRVLSNPDLGTDINTGLLTMSTYTVVGGRVKML-MIKKHLTVRMNCSMTINITSQ  207

Query  642  SYDVLSTCASKLKI  683
            +      C  K+K+
Sbjct  208  AIQE-QKCKRKVKL  220



>ref|XP_003611050.1| hypothetical protein MTR_5g009910 [Medicago truncatula]
 gb|AES94008.1| late embryogenesis abundant protein [Medicago truncatula]
Length=189

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 68/150 (45%), Gaps = 4/150 (3%)
 Frame = +3

Query  207  TILKPRAPEIIPHRTRLRNVTVA-LFPEPSLSASLNMTITIKNPNYGDC-SYRNASAEVY  380
            +IL+ + PE+    T L  +    + P P  +A++    +I NPNYG   SY  ++ +V 
Sbjct  34   SILRIKKPELKLTSTTLNGIGYNDVSPSPFFNATIITYFSIWNPNYGGIFSYEYSNIKVL  93

Query  381  YRDTPVTALPLQDGAVPAR--GQIDVVAHTNLDGHKVASSTSFLEDVGTGSLNFTAVAKM  554
            Y    V    + +  V  R    I+V    N     V  +  F  D+G+G LN T+  K 
Sbjct  94   YSGVKVGVTKIPNDKVSQRKTKHINVTVDVNFLKLIVNGNEKFSSDIGSGMLNLTSYVKF  153

Query  555  PVKVTVLKTFKFHVSVTIRCDMSVKVSDQS  644
               V ++K F    ++ + C M++  +  +
Sbjct  154  SGIVQLMKIFHKRKTLEMACIMNLNFTSHA  183



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1376900468608