BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24158_g1_i1 len=913 path=[5150:0-339 1986:340-361 2008:362-912]

Length=913
                                                                      Score     E

emb|CBI34676.3|  unnamed protein product                                146   2e-59   
ref|XP_002269986.1|  PREDICTED: uncharacterized protein LOC100266...    146   1e-58   Vitis vinifera
emb|CDP09744.1|  unnamed protein product                                144   8e-58   
ref|XP_010271779.1|  PREDICTED: uncharacterized protein LOC104607...    147   1e-57   
ref|XP_010271789.1|  PREDICTED: uncharacterized protein LOC104607...    146   1e-57   
ref|XP_011080965.1|  PREDICTED: uncharacterized protein LOC105164099    145   3e-57   
ref|XP_007209672.1|  hypothetical protein PRUPE_ppa012236mg             147   5e-57   
ref|XP_011029263.1|  PREDICTED: uncharacterized protein LOC105129...    146   8e-57   
ref|XP_008238848.1|  PREDICTED: uncharacterized protein LOC103337...    145   1e-56   
ref|XP_010271798.1|  PREDICTED: uncharacterized protein LOC104607...    146   1e-56   
ref|XP_008238849.1|  PREDICTED: uncharacterized protein LOC103337...    145   1e-56   
ref|XP_009801643.1|  PREDICTED: uncharacterized protein LOC104247351    143   2e-56   
ref|XP_002298037.1|  hypothetical protein POPTR_0001s09310g             145   2e-56   Populus trichocarpa [western balsam poplar]
ref|XP_009611968.1|  PREDICTED: uncharacterized protein LOC104105...    142   3e-56   
ref|XP_009611967.1|  PREDICTED: uncharacterized protein LOC104105...    142   3e-56   
ref|XP_002509795.1|  conserved hypothetical protein                     140   7e-56   Ricinus communis
gb|KHG11125.1|  Putative Holliday junction resolvase                    139   4e-55   
ref|XP_011029261.1|  PREDICTED: uncharacterized protein LOC105129...    139   9e-55   
ref|XP_007040207.1|  Polynucleotidyl transferase isoform 1              136   1e-54   
gb|KDP25443.1|  hypothetical protein JCGZ_20599                         143   1e-54   
ref|XP_010682115.1|  PREDICTED: uncharacterized protein LOC104897013    136   1e-53   
ref|XP_004143911.1|  PREDICTED: putative Holliday junction resolv...    144   3e-53   
ref|XP_007040208.1|  Polynucleotidyl transferase isoform 2              126   8e-52   
ref|XP_006362356.1|  PREDICTED: uncharacterized protein LOC102597279    129   3e-51   
ref|XP_009364906.1|  PREDICTED: uncharacterized protein LOC103954...    122   6e-51   
ref|NP_001280784.1|  uncharacterized LOC103454749                       122   2e-50   
ref|XP_010660776.1|  PREDICTED: uncharacterized protein LOC100266...    117   4e-50   
ref|XP_008437257.1|  PREDICTED: uncharacterized protein LOC103482...    135   2e-49   
ref|XP_004249036.1|  PREDICTED: uncharacterized protein LOC101262...    127   2e-49   
ref|XP_006489147.1|  PREDICTED: uncharacterized protein LOC102610...    127   3e-49   
gb|KHN25702.1|  Lysine-specific demethylase rbr-2                       127   4e-49   
gb|KDO75082.1|  hypothetical protein CISIN_1g030251mg                   126   4e-49   
ref|XP_006419658.1|  hypothetical protein CICLE_v10006013mg             127   6e-49   
ref|XP_004143910.1|  PREDICTED: putative Holliday junction resolv...    129   8e-49   
gb|KDO75083.1|  hypothetical protein CISIN_1g030251mg                   126   9e-49   
ref|XP_006572794.1|  PREDICTED: uncharacterized protein LOC100305...    128   3e-48   
ref|XP_010055626.1|  PREDICTED: uncharacterized protein LOC104443...    115   1e-47   
ref|XP_007158496.1|  hypothetical protein PHAVU_002G157400g             121   1e-47   
gb|EPS61791.1|  hypothetical protein M569_13005                         129   2e-47   
ref|XP_011029266.1|  PREDICTED: uncharacterized protein LOC105129...    116   2e-47   
ref|NP_001266040.1|  uncharacterized protein LOC101496715               114   5e-46   
ref|XP_006419659.1|  hypothetical protein CICLE_v10006013mg             116   5e-46   
ref|XP_007040213.1|  Polynucleotidyl transferase isoform 7              108   7e-46   
emb|CDY66284.1|  BnaCnng50230D                                          114   9e-46   
emb|CAB86895.1|  putative protein                                       113   1e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002877892.1|  hypothetical protein ARALYDRAFT_323835             114   2e-45   
ref|XP_011029265.1|  PREDICTED: uncharacterized protein LOC105129...    108   3e-45   
ref|NP_001078274.1|  polynucleotidyl transferase/ ribonuclease H-...    115   4e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006853175.1|  hypothetical protein AMTR_s00038p00196460          119   4e-45   
ref|XP_003611095.1|  Hypothetical protein MTR_5g010310                  111   4e-45   
ref|XP_010515768.1|  PREDICTED: uncharacterized protein LOC104791549    115   5e-45   
ref|XP_008780929.1|  PREDICTED: uncharacterized protein LOC103700828    114   5e-45   
ref|XP_008437258.1|  PREDICTED: uncharacterized protein LOC103482...    119   6e-45   
ref|XP_009148748.1|  PREDICTED: uncharacterized protein LOC103872151    114   8e-45   
ref|XP_006572796.1|  PREDICTED: uncharacterized protein LOC100305...    128   8e-45   
ref|XP_006290284.1|  hypothetical protein CARUB_v10018129mg             114   1e-44   
ref|XP_010504038.1|  PREDICTED: uncharacterized protein LOC104781142    113   2e-44   
ref|XP_006403755.1|  hypothetical protein EUTSA_v10010768mg             114   2e-44   
gb|AFK47509.1|  unknown                                                 111   2e-44   
ref|XP_010906662.1|  PREDICTED: uncharacterized protein LOC105033...    109   2e-44   
emb|CDX67544.1|  BnaA07g15840D                                          113   4e-44   
ref|XP_010426920.1|  PREDICTED: uncharacterized protein LOC104711849    111   6e-44   
ref|XP_010906660.1|  PREDICTED: uncharacterized protein LOC105033...    110   8e-44   
ref|XP_009125237.1|  PREDICTED: uncharacterized protein LOC103850267    113   2e-43   
ref|XP_007040212.1|  Polynucleotidyl transferase isoform 6              105   5e-43   
emb|CDY13334.1|  BnaC06g14230D                                          112   8e-43   
ref|XP_006403754.1|  hypothetical protein EUTSA_v10010768mg             107   1e-42   
ref|XP_004298790.1|  PREDICTED: putative Holliday junction resolv...    124   2e-42   
ref|XP_010527753.1|  PREDICTED: uncharacterized protein LOC104805...    113   4e-42   
ref|XP_004249037.1|  PREDICTED: uncharacterized protein LOC101262...    101   4e-41   
ref|XP_009382994.1|  PREDICTED: uncharacterized protein LOC103970...    106   1e-40   
ref|XP_010527743.1|  PREDICTED: uncharacterized protein LOC104805...    106   4e-40   
ref|XP_003569889.1|  PREDICTED: uncharacterized protein LOC100833580    117   5e-40   
dbj|BAJ97823.1|  predicted protein                                      114   1e-39   
ref|XP_010906659.1|  PREDICTED: uncharacterized protein LOC105033...  96.7    1e-39   
dbj|BAJ99748.1|  predicted protein                                      114   1e-39   
emb|CDM81502.1|  unnamed protein product                                113   4e-39   
ref|XP_006644759.1|  PREDICTED: uncharacterized protein LOC102708106    115   1e-38   
ref|NP_001044344.1|  Os01g0764700                                       114   2e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009364907.1|  PREDICTED: uncharacterized protein LOC103954...    106   6e-38   
ref|XP_008392574.1|  PREDICTED: uncharacterized protein LOC103454...    105   2e-37   
gb|EAY75935.1|  hypothetical protein OsI_03854                          109   5e-37   Oryza sativa Indica Group [Indian rice]
gb|EAZ13647.1|  hypothetical protein OsJ_03564                          109   7e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009382998.1|  PREDICTED: uncharacterized protein LOC103970...  92.8    1e-36   
gb|KHN35021.1|  Putative Holliday junction resolvase                  95.1    2e-35   
gb|EMS54529.1|  Putative Holliday junction resolvase                    113   4e-35   
ref|XP_004970077.1|  PREDICTED: uncharacterized protein LOC101786216    103   8e-35   
ref|XP_010055624.1|  PREDICTED: uncharacterized protein LOC104443...    102   2e-33   
gb|ABR17857.1|  unknown                                               89.0    1e-32   Picea sitchensis
ref|NP_001237859.1|  uncharacterized protein LOC100305864               127   1e-32   
ref|NP_001136992.1|  hypothetical protein                             94.0    5e-32   Zea mays [maize]
gb|EYU23484.1|  hypothetical protein MIMGU_mgv1a0195701mg               122   7e-31   
ref|XP_008392628.1|  PREDICTED: uncharacterized protein LOC103454811    121   2e-30   
ref|XP_008672298.1|  PREDICTED: hypothetical protein isoform X1       79.3    1e-27   
gb|EMT24240.1|  Putative Holliday junction resolvase                  99.8    7e-27   
ref|XP_010906656.1|  PREDICTED: uncharacterized protein LOC105033...    109   9e-26   
ref|XP_008672299.1|  PREDICTED: hypothetical protein isoform X2       72.8    3e-25   
gb|KCW72137.1|  hypothetical protein EUGRSUZ_E00580                   97.4    7e-22   
ref|XP_010906658.1|  PREDICTED: uncharacterized protein LOC105033...  96.3    2e-21   
gb|ACN35369.1|  unknown                                               93.6    9e-20   Zea mays [maize]
ref|XP_001779541.1|  predicted protein                                60.1    1e-15   
ref|WP_036281693.1|  Holliday junction resolvase                      52.4    5e-12   
ref|WP_016920566.1|  Holliday junction resolvase                      52.0    2e-11   
ref|WP_011917295.1|  Holliday junction resolvase                      64.3    4e-11   
ref|WP_020399412.1|  hypothetical protein                             50.8    4e-11   
sp|Q5NPF1.2|RUVX_ZYMMO  RecName: Full=Putative Holliday junction ...  55.5    9e-11   Zymomonas mobilis
ref|WP_038259267.1|  Holliday junction resolvase                      55.5    1e-10   
ref|WP_037233661.1|  Holliday junction resolvase                      50.4    1e-10   
ref|WP_013420037.1|  Holliday junction resolvase                      50.4    1e-10   
ref|WP_011240660.1|  Holliday junction resolvase                      55.1    1e-10   
ref|WP_023004059.1|  MULTISPECIES: Holliday junction resolvase        47.8    2e-10   
gb|KFC72800.1|  putative Holliday junction resolvase                  48.9    3e-10   
ref|WP_006934936.1|  Holliday junction resolvase                      46.6    3e-10   
ref|WP_009800123.1|  Holliday junction resolvase                      53.9    4e-10   
ref|WP_032112172.1|  Holliday junction resolvase                      49.3    5e-10   
ref|WP_038461764.1|  Holliday junction resolvase                      47.8    1e-09   
ref|WP_013933767.1|  Holliday junction resolvase                      52.8    1e-09   
ref|WP_008890778.1|  Holliday junction resolvase                      48.9    1e-09   
ref|WP_019966391.1|  Holliday junction resolvase                      46.6    2e-09   
ref|WP_038368799.1|  Holliday junction resolvase                      47.0    2e-09   
ref|WP_006020907.1|  MULTISPECIES: RNAse H-fold protein YqgF          46.6    2e-09   
ref|WP_029061444.1|  Holliday junction resolvase                      44.7    2e-09   
ref|WP_033069952.1|  Holliday junction resolvase                      48.5    3e-09   
ref|WP_012974539.1|  Holliday junction resolvase                      49.7    3e-09   
ref|WP_011315249.1|  Holliday junction resolvase                      49.3    3e-09   
ref|WP_029039843.1|  Holliday junction resolvase                      45.4    3e-09   
ref|WP_022729523.1|  Holliday junction resolvase                      45.4    3e-09   
ref|WP_026988068.1|  Holliday junction resolvase                      46.6    3e-09   
ref|WP_028481861.1|  Holliday junction resolvase                      49.3    4e-09   
ref|WP_020593528.1|  hypothetical protein                             48.1    4e-09   
ref|WP_037020803.1|  Holliday junction resolvase                      49.3    4e-09   
ref|WP_012111762.1|  Holliday junction resolvase                      44.7    4e-09   
ref|WP_029585403.1|  Holliday junction resolvase                      47.8    6e-09   
ref|WP_013652597.1|  Holliday junction resolvase                      45.8    6e-09   
ref|WP_015459774.1|  Holliday junction resolvase-like protein         46.2    7e-09   
ref|WP_010125183.1|  Holliday junction resolvase                      47.4    7e-09   
ref|WP_008552975.1|  Holliday junction resolvase                      46.2    7e-09   
ref|WP_014286226.1|  Holliday junction resolvase                      46.2    7e-09   
sp|Q1QL26.2|RUVX_NITHX  RecName: Full=Putative Holliday junction ...  47.8    7e-09   Nitrobacter hamburgensis X14
ref|WP_011510748.1|  Holliday junction resolvase                      47.4    7e-09   
ref|WP_036766962.1|  Holliday junction resolvase                      45.8    8e-09   
ref|WP_034996497.1|  Holliday junction resolvase                      47.0    1e-08   
ref|WP_024575135.1|  MULTISPECIES: Holliday junction resolvase        44.3    1e-08   
ref|WP_029006906.1|  Holliday junction resolvase                      44.3    1e-08   
ref|WP_013299526.1|  Holliday junction resolvase                      44.7    2e-08   
ref|WP_033368506.1|  Holliday junction resolvase                      46.2    2e-08   
ref|WP_002715494.1|  RNAse H-fold protein YqgF                        47.0    2e-08   
ref|WP_013411951.1|  Holliday junction resolvase                      56.2    2e-08   
ref|WP_010302895.1|  Holliday junction resolvase                      47.4    2e-08   
ref|WP_009764515.1|  Holliday junction resolvase                      48.5    3e-08   
ref|WP_012642118.1|  Holliday junction resolvase                      47.8    3e-08   
gb|EZQ05725.1|  Holliday junction resolvase                           44.3    3e-08   
sp|Q2W6Y3.2|RUVX_MAGSA  RecName: Full=Putative Holliday junction ...  45.4    3e-08   Magnetospirillum magneticum AMB-1
ref|WP_029355133.1|  Holliday junction resolvase                      43.1    3e-08   
ref|WP_008391369.1|  Holliday junction resolvase                      43.1    3e-08   
ref|WP_035678774.1|  Holliday junction resolvase                      44.3    3e-08   
ref|WP_014198423.1|  Holliday junction resolvase                      44.3    3e-08   
ref|WP_013946770.1|  Holliday junction resolvase                      47.8    4e-08   
ref|WP_011383998.1|  Holliday junction resolvase                      45.4    4e-08   
ref|WP_036351830.1|  Holliday junction resolvase                      48.1    4e-08   
ref|WP_009029367.1|  Holliday junction resolvase                      45.4    4e-08   
ref|WP_015907703.1|  Holliday junction resolvase                      55.1    5e-08   
ref|WP_009469358.1|  Holliday junction resolvase                      43.1    5e-08   
dbj|BAQ17653.1|  putative Holliday junction resolvase                 43.1    5e-08   
ref|WP_009340925.1|  Holliday junction resolvase                      44.7    5e-08   
ref|WP_024275552.1|  Holliday junction resolvase                      47.8    5e-08   
ref|WP_008621989.1|  putative Holliday junction resolvase             44.7    5e-08   
ref|WP_006611220.1|  Holliday junction resolvase                      45.8    5e-08   
ref|WP_009360144.1|  Holliday junction resolvase                      45.1    6e-08   
ref|WP_024512422.1|  Holliday junction resolvase                      45.4    6e-08   
ref|WP_012615413.1|  Holliday junction resolvase                      43.5    6e-08   
ref|WP_022006335.1|  putative Holliday junction resolvase             45.1    6e-08   
ref|WP_024582082.1|  Holliday junction resolvase                      44.3    6e-08   
ref|WP_008962752.1|  Holliday junction resolvase                      45.8    6e-08   
ref|WP_011503423.1|  Holliday junction resolvase                      43.9    6e-08   
ref|WP_022691764.1|  Holliday junction resolvase                      44.7    6e-08   
emb|CEG07742.1|  Putative Holliday junction resolvase                 44.3    6e-08   
ref|WP_023454492.1|  Holliday junction resolvase                      44.7    6e-08   
ref|WP_024515553.1|  Holliday junction resolvase                      46.2    7e-08   
gb|KEO59161.1|  Holliday junction resolvase                           43.1    7e-08   
ref|WP_011927345.1|  Holliday junction resolvase                      45.4    7e-08   
ref|WP_021078329.1|  YqgF family RNAse H domain-containing protein    43.5    8e-08   
ref|WP_012044734.1|  Holliday junction resolvase                      45.4    8e-08   
ref|WP_016407548.1|  putative Holliday junction resolvase             53.1    9e-08   
ref|WP_013432500.1|  MULTISPECIES: Holliday junction resolvase        53.1    9e-08   
ref|WP_011441319.1|  Holliday junction resolvase                      42.4    9e-08   
ref|WP_006275012.1|  Holliday junction resolvase                      43.1    9e-08   
ref|WP_006562377.1|  Holliday junction resolvase                      45.1    9e-08   
ref|WP_012115894.1|  Holliday junction resolvase                      45.4    1e-07   
ref|WP_027276837.1|  Holliday junction resolvase                      44.7    1e-07   
ref|WP_018583542.1|  Holliday junction resolvase                      45.1    1e-07   
ref|WP_013846532.1|  Holliday junction resolvase                      45.8    1e-07   
ref|WP_027537113.1|  Holliday junction resolvase                      47.0    1e-07   
ref|WP_007089906.1|  Holliday junction resolvase                      43.1    1e-07   
ref|WP_012562947.1|  Holliday junction resolvase                      42.7    1e-07   
ref|WP_037987590.1|  Holliday junction resolvase                      42.4    1e-07   
ref|WP_037457292.1|  Holliday junction resolvase                      46.2    1e-07   
ref|WP_009736661.1|  Holliday junction resolvase                      42.4    1e-07   
ref|WP_031337408.1|  Holliday junction resolvase                      42.4    1e-07   
ref|WP_029026330.1|  Holliday junction resolvase                      45.1    1e-07   
ref|WP_002712148.1|  RNAse H-fold protein YqgF                        42.0    1e-07   
ref|WP_028166680.1|  Holliday junction resolvase                      44.3    2e-07   
ref|WP_029081064.1|  Holliday junction resolvase                      43.9    2e-07   
ref|WP_022671178.1|  Holliday junction resolvase                      42.4    2e-07   
ref|WP_025780035.1|  hypothetical protein                             43.1    2e-07   
ref|WP_023462781.1|  Holliday junction resolvase                      45.8    2e-07   
ref|WP_029004526.1|  Holliday junction resolvase                      46.6    2e-07   
ref|WP_028098158.1|  Holliday junction resolvase                      42.7    2e-07   
ref|WP_015514593.1|  hypothetical protein                             49.3    2e-07   
ref|WP_028031877.1|  Holliday junction resolvase                      42.4    2e-07   
ref|WP_018996080.1|  Holliday junction resolvase                      45.8    2e-07   
ref|WP_015666364.1|  putative holliday junction resolvase             44.3    2e-07   
ref|WP_016745426.1|  Holliday junction resolvase                      46.6    2e-07   
ref|WP_011951449.1|  MULTISPECIES: Holliday junction resolvase        46.6    2e-07   
ref|WP_029563669.1|  Holliday junction resolvase                      43.5    2e-07   
ref|WP_014248137.1|  Holliday junction resolvase                      43.1    2e-07   
ref|WP_027553107.1|  Holliday junction resolvase                      43.5    2e-07   
ref|WP_011158658.1|  Holliday junction resolvase                      43.1    2e-07   
ref|WP_013068027.1|  Holliday junction resolvase                      41.6    2e-07   
ref|WP_008967052.1|  Holliday junction resolvase                      43.5    2e-07   
ref|WP_018390671.1|  Holliday junction resolvase                      42.4    2e-07   
ref|WP_028143927.1|  MULTISPECIES: Holliday junction resolvase        43.1    3e-07   
ref|WP_013495637.1|  Holliday junction resolvase                      45.8    3e-07   
ref|WP_020175304.1|  hypothetical protein                             45.1    3e-07   
ref|WP_018321099.1|  Holliday junction resolvase                      43.1    3e-07   
ref|WP_025036743.1|  Holliday junction resolvase                      43.1    3e-07   
ref|WP_007707490.1|  Holliday junction resolvase                      43.9    3e-07   
ref|WP_019403549.1|  hypothetical protein                             42.7    3e-07   
ref|WP_028180845.1|  MULTISPECIES: Holliday junction resolvase        43.5    3e-07   
ref|WP_023450219.1|  Holliday junction resolvase                      42.7    3e-07   
ref|WP_028051332.1|  Holliday junction resolvase                      51.2    3e-07   
ref|WP_029019183.1|  Holliday junction resolvase                      45.1    3e-07   
ref|WP_028183293.1|  Holliday junction resolvase                      45.1    3e-07   
ref|WP_027559624.1|  MULTISPECIES: Holliday junction resolvase        43.5    3e-07   
ref|WP_036025537.1|  Holliday junction resolvase                      42.7    3e-07   
ref|WP_019032717.1|  Holliday junction resolvase                      45.1    3e-07   
ref|WP_012182011.1|  Holliday junction resolvase                      45.1    3e-07   
ref|WP_018644551.1|  Holliday junction resolvase                      43.1    3e-07   
ref|WP_036015081.1|  Holliday junction resolvase                      42.7    3e-07   
gb|EXS69297.1|  Holliday junction resolvase                           45.1    3e-07   
ref|WP_017184652.1|  Holliday junction resolvase                      43.5    3e-07   
ref|WP_011343476.1|  Holliday junction resolvase                      51.2    4e-07   
ref|WP_038036414.1|  Holliday junction resolvase                      48.1    4e-07   
ref|WP_028345629.1|  Holliday junction resolvase                      43.1    4e-07   
ref|WP_013430445.1|  Holliday junction resolvase                      52.0    4e-07   
ref|WP_015598724.1|  Holliday junction resolvase YqgF                 42.7    4e-07   
ref|WP_024341101.1|  Holliday junction resolvase                      42.4    4e-07   
ref|WP_035376057.1|  Holliday junction resolvase                      41.6    4e-07   
ref|WP_018909000.1|  Holliday junction resolvase                      44.3    5e-07   
ref|WP_037480049.1|  Holliday junction resolvase                      44.3    5e-07   
ref|WP_023915490.1|  Holliday junction resolvase                      41.6    5e-07   
ref|WP_023911635.1|  Holliday junction resolvase                      41.6    5e-07   
ref|WP_013403400.1|  Holliday junction resolvase                      52.4    5e-07   
ref|WP_037501191.1|  Holliday junction resolvase                      44.7    5e-07   
ref|WP_027583178.1|  Holliday junction resolvase                      43.9    6e-07   
ref|WP_021693049.1|  putative Holliday junction resolvase             43.5    6e-07   
ref|WP_011472708.1|  Holliday junction resolvase                      43.1    6e-07   
ref|WP_027573639.1|  Holliday junction resolvase                      43.1    6e-07   
ref|WP_023918538.1|  Holliday junction resolvase                      41.6    6e-07   
ref|WP_022682655.1|  Holliday junction resolvase                      44.7    6e-07   
ref|WP_014102604.1|  Holliday junction resolvase                      41.6    6e-07   
ref|WP_030540496.1|  Holliday junction resolvase                      45.1    6e-07   
ref|WP_013627749.1|  Holliday junction resolvase                      40.8    6e-07   
ref|WP_022705759.1|  Holliday junction resolvase                      40.8    7e-07   
ref|WP_012171364.1|  Holliday junction resolvase                      42.7    7e-07   
ref|WP_007686471.1|  MULTISPECIES: Holliday junction resolvase        43.9    7e-07   
ref|WP_003925467.1|  Holliday junction resolvase                      41.2    7e-07   
ref|WP_021246739.1|  Holliday junction resolvase                      44.3    7e-07   
ref|WP_012334076.1|  Holliday junction resolvase                      44.7    8e-07   
ref|WP_027522960.1|  Holliday junction resolvase                      41.6    8e-07   
ref|WP_010337159.1|  Holliday junction resolvase                      42.4    8e-07   
ref|WP_036638216.1|  Holliday junction resolvase                      43.5    8e-07   
ref|WP_030502511.1|  Holliday junction resolvase                      41.2    8e-07   
ref|WP_018259864.1|  Holliday junction resolvase                      44.7    8e-07   
ref|WP_024020334.1|  Holliday junction resolvase                      41.2    8e-07   
ref|WP_023433791.1|  Holliday junction resolvase YqgF                 40.8    9e-07   
ref|WP_014758833.1|  MULTISPECIES: Holliday junction resolvase        48.9    9e-07   
ref|WP_037463060.1|  Holliday junction resolvase                      43.9    1e-06   
ref|WP_025548063.1|  Holliday junction resolvase                      44.7    1e-06   
ref|WP_030440138.1|  Holliday junction resolvase                      43.5    1e-06   
ref|WP_029873111.1|  Holliday junction resolvase                      41.2    1e-06   
ref|WP_018220194.1|  Holliday junction resolvase                      44.3    1e-06   
dbj|GAK34159.1|  putative Holliday junction resolvase                 40.8    1e-06   
gb|EWM64456.1|  Holliday junction resolvase                           40.8    1e-06   
ref|WP_034746896.1|  Holliday junction resolvase                      47.4    1e-06   
ref|WP_028135936.1|  Holliday junction resolvase                      43.1    1e-06   
ref|WP_020951388.1|  Holliday junction resolvase                      42.7    1e-06   
ref|WP_004600648.1|  Holliday junction resolvase                      41.2    1e-06   
ref|WP_011664776.1|  Holliday junction resolvase                      41.6    1e-06   
ref|WP_006904728.1|  Holliday junction resolvase                      40.4    1e-06   
ref|WP_038127271.1|  Holliday junction resolvase                      42.4    1e-06   
emb|CCI83480.1|  putative holliday junction resolvase                 40.8    1e-06   
ref|WP_027547187.1|  Holliday junction resolvase                      43.5    1e-06   
emb|CBI80926.1|  putative resolvase                                   45.8    1e-06   
ref|WP_033373540.1|  Holliday junction resolvase                      42.0    1e-06   
ref|WP_008133854.1|  Holliday junction resolvase                      43.1    1e-06   
ref|WP_025617714.1|  Holliday junction resolvase                      43.5    1e-06   
ref|WP_018253155.1|  Holliday junction resolvase                      43.5    1e-06   
ref|WP_018698971.1|  hypothetical protein                             40.4    1e-06   
ref|WP_018722780.1|  Holliday junction resolvase                      43.5    1e-06   
ref|WP_018725651.1|  Holliday junction resolvase                      43.5    1e-06   
ref|WP_019807637.1|  Holliday junction resolvase                      43.5    2e-06   
ref|WP_026271886.1|  Holliday junction resolvase                      43.5    2e-06   
gb|KEO61574.1|  hypothetical protein DT23_00985                       42.0    2e-06   
ref|WP_035005889.1|  Holliday junction resolvase                      45.4    2e-06   
gb|EZP72475.1|  putative Holliday junction resolvase                  43.5    2e-06   
ref|WP_037483473.1|  Holliday junction resolvase                      43.5    2e-06   
ref|WP_015827818.1|  Holliday junction resolvase                      46.6    2e-06   
ref|WP_018036618.1|  hypothetical protein                             42.7    2e-06   
ref|WP_020049718.1|  Holliday junction resolvase                      40.8    2e-06   
ref|WP_018214962.1|  Holliday junction resolvase                      43.5    2e-06   
ref|WP_010897437.1|  Holliday junction resolvase                      44.7    2e-06   
ref|WP_011541231.1|  Holliday junction resolvase                      43.9    2e-06   
ref|WP_004211843.1|  RNAse H-fold protein YqgF                        40.8    2e-06   
ref|WP_027530019.1|  Holliday junction resolvase                      43.5    2e-06   
ref|WP_019833459.1|  Holliday junction resolvase                      41.2    2e-06   
ref|WP_018730022.1|  Holliday junction resolvase                      43.5    2e-06   
emb|CCQ72505.1|  putative Holliday junction resolvase                 43.5    2e-06   
ref|WP_018785059.1|  Holliday junction resolvase                      40.0    2e-06   
ref|WP_012957794.1|  Holliday junction resolvase                      47.0    2e-06   
ref|WP_011905722.1|  MULTISPECIES: Holliday junction resolvase        43.5    2e-06   
ref|WP_037507470.1|  Holliday junction resolvase                      40.8    2e-06   
ref|WP_023853737.1|  RNAse H-fold protein YqgF                        43.5    2e-06   
ref|WP_026325301.1|  Holliday junction resolvase                      43.5    2e-06   
ref|WP_035709904.1|  Holliday junction resolvase                      40.8    2e-06   
ref|WP_031297822.1|  Holliday junction resolvase                      42.0    2e-06   
ref|WP_009251468.1|  Holliday junction resolvase                      47.8    2e-06   
ref|WP_038062572.1|  Holliday junction resolvase                      40.8    2e-06   
ref|WP_028056909.1|  Holliday junction resolvase                      47.0    2e-06   
ref|WP_037525997.1|  Holliday junction resolvase                      45.4    2e-06   
ref|WP_029131316.1|  Holliday junction resolvase                      42.0    2e-06   
gb|EQB16200.1|  Holliday junction resolvase                           42.0    2e-06   
gb|EAT08250.1|  endonuclease                                          42.4    2e-06   
ref|WP_022217239.1|  putative Holliday junction resolvase             41.2    2e-06   
ref|WP_020085311.1|  hypothetical protein                             42.7    2e-06   
ref|WP_037542598.1|  Holliday junction resolvase                      42.0    2e-06   
ref|WP_013843116.1|  Holliday junction resolvase                      41.6    2e-06   
ref|WP_017928834.1|  hypothetical protein                             40.0    3e-06   
ref|WP_025488389.1|  Holliday junction resolvase                      47.0    3e-06   
ref|WP_015685631.1|  Holliday junction resolvase                      43.1    3e-06   
ref|WP_028171591.1|  MULTISPECIES: Holliday junction resolvase        43.5    3e-06   
ref|WP_038148153.1|  Holliday junction resolvase                      40.4    3e-06   
ref|WP_028155061.1|  Holliday junction resolvase                      43.5    3e-06   
ref|WP_015467381.1|  Putative Holliday junction resolvase             41.2    3e-06   
ref|WP_013474890.1|  Holliday junction resolvase                      39.7    3e-06   
ref|WP_028150651.1|  Holliday junction resolvase                      43.5    3e-06   
ref|WP_011087854.1|  Holliday junction resolvase                      43.5    3e-06   
ref|WP_014130767.1|  Holliday junction resolvase                      41.6    3e-06   
ref|WP_009755918.1|  Holliday junction resolvase                      40.4    3e-06   
ref|WP_013285494.1|  MULTISPECIES: Holliday junction resolvase        39.7    3e-06   
ref|WP_008492639.1|  MULTISPECIES: Holliday junction resolvase        41.2    3e-06   
ref|WP_022273713.1|  putative Holliday junction resolvase             46.6    3e-06   
ref|WP_007564337.1|  Holliday junction resolvase                      40.0    3e-06   
ref|WP_015929900.1|  Holliday junction resolvase                      44.7    3e-06   
gb|ERI71378.1|  RNAse H domain protein, YqgF family                   47.0    3e-06   
ref|WP_014494722.1|  Holliday junction resolvase                      43.1    3e-06   
ref|WP_009014708.1|  MULTISPECIES: Holliday junction resolvase        48.5    3e-06   
ref|WP_036722148.1|  Holliday junction resolvase                      42.0    3e-06   
ref|WP_021239737.1|  Holliday junction resolvase                      43.5    3e-06   
ref|WP_010705318.1|  putative holliday junction resolvase             45.4    3e-06   
ref|WP_033356826.1|  Holliday junction resolvase                      42.0    3e-06   
ref|WP_026453301.1|  Holliday junction resolvase                      42.4    3e-06   
ref|WP_035740879.1|  Holliday junction resolvase                      41.6    3e-06   
ref|WP_012830477.1|  Holliday junction resolvase                      47.0    3e-06   
ref|WP_027567307.1|  Holliday junction resolvase                      43.1    4e-06   
ref|WP_003498804.1|  MULTISPECIES: Holliday junction resolvase        46.2    4e-06   
ref|WP_022626535.1|  Holliday junction resolvase                      45.8    4e-06   
ref|WP_023788289.1|  Holliday junction resolvase                      41.6    4e-06   
ref|WP_007603328.1|  MULTISPECIES: Holliday junction resolvase        43.1    4e-06   
ref|WP_007171963.1|  Holliday junction resolvase                      40.0    4e-06   
ref|WP_020519986.1|  hypothetical protein                             43.5    4e-06   
ref|WP_018303496.1|  Holliday junction resolvase                      40.0    4e-06   
ref|WP_016440167.1|  YqgF family RNAse H domain-containing protein    44.3    4e-06   
dbj|GAF65867.1|  Holliday junction resolvase-like protein             46.2    4e-06   
ref|WP_009757232.1|  Holliday junction resolvase                      45.4    4e-06   
ref|WP_007557483.1|  Holliday junction resolvase YqgF                 42.0    4e-06   
gb|EQD25258.1|  hypothetical protein D084_Lepto4C00203G0002           40.4    4e-06   
ref|WP_018181249.1|  hypothetical protein                             40.4    4e-06   
ref|WP_030488379.1|  Holliday junction resolvase                      44.7    5e-06   
ref|WP_038080154.1|  Holliday junction resolvase                      40.0    5e-06   
ref|WP_027684896.1|  Holliday junction resolvase                      40.8    5e-06   
ref|WP_023665313.1|  Holliday junction resolvase                      44.3    5e-06   
ref|WP_018063703.1|  Holliday junction resolvase                      39.3    5e-06   
ref|WP_008039566.1|  Holliday junction resolvase                      40.4    5e-06   
gb|KEO50520.1|  Holliday junction resolvase                           40.0    5e-06   
ref|WP_011580700.1|  Holliday junction resolvase                      39.7    5e-06   
ref|WP_007027019.1|  Holliday junction resolvase                      42.0    5e-06   
emb|CDM69120.1|  putative Holliday junction resolvase                 46.2    6e-06   
ref|WP_021657184.1|  RNAse H domain protein, YqgF family              43.1    6e-06   
ref|WP_028035005.1|  Holliday junction resolvase                      39.7    6e-06   
ref|WP_015533127.1|  hypothetical protein                             39.7    6e-06   
gb|EJL23725.1|  RNAse H-fold protein YqgF                             41.2    6e-06   
gb|AHF07442.1|  Holliday junction resolvase                           45.1    6e-06   
ref|WP_007628576.1|  Holliday junction resolvase                      40.0    6e-06   
ref|WP_022376178.1|  putative Holliday junction resolvase             46.6    6e-06   
ref|WP_012227231.1|  Holliday junction resolvase                      40.0    6e-06   
ref|WP_027627099.1|  Holliday junction resolvase [                    51.2    7e-06   
ref|WP_038478749.1|  Holliday junction resolvase                      40.0    7e-06   
ref|WP_021317989.1|  Holliday junction resolvase                      42.0    7e-06   
ref|WP_024707346.1|  Holliday junction resolvase                      39.7    7e-06   
ref|WP_036504568.1|  Holliday junction resolvase                      41.2    7e-06   
ref|WP_007323148.1|  Holliday junction resolvase                      40.8    7e-06   
ref|WP_003539043.1|  Holliday junction resolvase                      40.8    7e-06   
ref|WP_029618638.1|  MULTISPECIES: Holliday junction resolvase        39.3    7e-06   
ref|WP_031459174.1|  Holliday junction resolvase                      41.2    7e-06   
emb|CBI79346.1|  putative resolvase                                   43.1    7e-06   
ref|WP_030335609.1|  Holliday junction resolvase                      43.9    8e-06   
ref|WP_012259679.1|  MULTISPECIES: Holliday junction resolvase        41.6    8e-06   
ref|WP_018073400.1|  Holliday junction resolvase                      40.8    8e-06   
ref|WP_016439259.1|  YqgF family RNAse H domain-containing protein    43.1    8e-06   
ref|WP_027666018.1|  Holliday junction resolvase                      40.8    8e-06   
ref|WP_017964079.1|  Holliday junction resolvase                      40.8    8e-06   
ref|WP_031392233.1|  Holliday junction resolvase                      44.7    8e-06   
ref|WP_013214675.1|  Holliday junction resolvase                      40.0    8e-06   
ref|WP_018241821.1|  Holliday junction resolvase                      40.4    8e-06   
ref|WP_012483623.1|  MULTISPECIES: Holliday junction resolvase        39.3    8e-06   
ref|WP_004037634.1|  YqgF family RNAse H domain-containing protein    45.8    8e-06   
gb|AHF83765.1|  Holliday junction resolvase                           39.7    9e-06   
ref|WP_006875016.1|  hypothetical protein                             47.8    9e-06   
ref|WP_034593705.1|  MULTISPECIES: Holliday junction resolvase        45.8    9e-06   
ref|WP_017960224.1|  Holliday junction resolvase                      39.7    9e-06   
ref|WP_017969396.1|  hypothetical protein                             40.0    9e-06   
ref|WP_019370556.1|  Holliday junction resolvase                      39.3    9e-06   
ref|WP_035307460.1|  Holliday junction resolvase                      42.0    9e-06   
ref|WP_009262784.1|  Holliday junction resolvase                      44.3    9e-06   
ref|WP_018445605.1|  Holliday junction resolvase                      40.4    1e-05   
ref|WP_020517574.1|  hypothetical protein                             40.0    1e-05   
ref|WP_008183880.1|  Holliday junction resolvase                      41.2    1e-05   
ref|WP_017943955.1|  hypothetical protein                             40.8    1e-05   
ref|WP_007006740.1|  Holliday junction resolvase                      39.7    1e-05   
ref|WP_035706309.1|  Holliday junction resolvase                      41.2    1e-05   
ref|WP_035396041.1|  Holliday junction resolvase                      38.9    1e-05   
ref|WP_021941714.1|  putative Holliday junction resolvase             40.4    1e-05   
ref|WP_024585510.1|  Holliday junction resolvase                      40.4    1e-05   
ref|WP_027486217.1|  Holliday junction resolvase                      40.4    1e-05   
ref|WP_027673016.1|  Holliday junction resolvase                      40.4    1e-05   
ref|WP_025029841.1|  Holliday junction resolvase                      39.7    1e-05   
ref|WP_003586914.1|  Holliday junction resolvase                      40.4    1e-05   
ref|WP_015777869.1|  Holliday junction resolvase                      40.0    1e-05   
ref|WP_012635525.1|  Holliday junction resolvase                      43.5    1e-05   
ref|WP_021100668.1|  Putative Holliday junction resolvase             42.0    1e-05   
ref|WP_011651679.1|  Holliday junction resolvase                      40.0    1e-05   
ref|WP_037568675.1|  Holliday junction resolvase                      42.7    1e-05   
ref|WP_022342511.1|  putative Holliday junction resolvase             45.8    1e-05   
ref|WP_025735926.1|  Holliday junction resolvase                      39.3    1e-05   
ref|WP_034765258.1|  hypothetical protein                             40.0    1e-05   
ref|WP_015273398.1|  Putative Holliday junction resolvase             38.9    1e-05   
ref|WP_025494781.1|  Holliday junction resolvase                      42.4    1e-05   
ref|WP_008395839.1|  Holliday junction resolvase                      42.7    1e-05   
gb|EGI55197.1|  uncharacterized family protein                        42.7    1e-05   
ref|WP_034132001.1|  Holliday junction resolvase                      45.4    1e-05   
ref|WP_036704438.1|  MULTISPECIES: Holliday junction resolvase        40.4    1e-05   
ref|WP_018481176.1|  Holliday junction resolvase                      39.7    1e-05   
ref|WP_012557506.1|  Holliday junction resolvase                      40.0    1e-05   
ref|WP_038328725.1|  Holliday junction resolvase                      39.7    1e-05   
ref|WP_018043477.1|  hypothetical protein                             41.6    1e-05   
ref|WP_015574411.1|  hypothetical protein [                           42.7    1e-05   
ref|WP_015500793.1|  Holliday junction resolvase                      40.8    1e-05   
gb|AJD40867.1|  holliday junction resolvase protein                   39.7    1e-05   
ref|WP_022714865.1|  Holliday junction resolvase                      39.7    1e-05   
ref|WP_012757263.1|  Holliday junction resolvase                      39.7    1e-05   
ref|WP_036711863.1|  Holliday junction resolvase                      40.4    1e-05   
ref|WP_031498391.1|  hypothetical protein                             40.0    1e-05   
ref|WP_021966045.1|  putative Holliday junction resolvase             42.4    2e-05   
ref|WP_027508576.1|  Holliday junction resolvase                      39.7    2e-05   
ref|WP_013810629.1|  Holliday junction resolvase                      42.4    2e-05   
ref|WP_003610880.1|  Holliday junction resolvase                      53.5    2e-05   
ref|WP_024497151.1|  Holliday junction resolvase                      40.4    2e-05   
ref|WP_020934865.1|  Holliday junction resolvase-like protein         40.0    2e-05   
ref|WP_037121930.1|  Holliday junction resolvase                      39.7    2e-05   
ref|WP_010701173.1|  putative holliday junction resolvase             38.5    2e-05   
ref|WP_011416582.1|  Holliday junction resolvase                      44.3    2e-05   
ref|WP_006773411.1|  Holliday junction resolvase [                    40.4    2e-05   
ref|WP_019541528.1|  Holliday junction resolvase                      45.8    2e-05   
ref|WP_036529458.1|  MULTISPECIES: Holliday junction resolvase        39.3    2e-05   
ref|WP_014128486.1|  Holliday junction resolvase                      48.5    2e-05   
ref|WP_003573496.1|  Holliday junction resolvase                      39.7    2e-05   
ref|WP_018408645.1|  MULTISPECIES: Holliday junction resolvase        53.5    2e-05   
ref|WP_003578927.1|  Holliday junction resolvase                      39.7    2e-05   
ref|WP_008595660.1|  Holliday junction resolvase                      38.9    2e-05   
ref|WP_013545106.1|  Holliday junction resolvase                      42.0    2e-05   
ref|WP_033182505.1|  Holliday junction resolvase                      39.3    2e-05   
ref|WP_012063591.1|  Holliday junction resolvase                      45.1    2e-05   
gb|EJU11071.1|  hypothetical protein LH128_20685                      39.3    2e-05   
ref|WP_007075801.1|  Holliday junction resolvase                      40.0    2e-05   
ref|WP_016292135.1|  YqgF family RNAse H domain-containing protein    44.7    2e-05   
ref|WP_008258252.1|  MULTISPECIES: Holliday junction resolvase        38.1    2e-05   
ref|WP_020091786.1|  Holliday junction resolvase                      40.8    2e-05   
ref|WP_025231562.1|  MULTISPECIES: Holliday junction resolvase        43.1    2e-05   
ref|WP_022318552.1|  putative Holliday junction resolvase             41.2    2e-05   
ref|WP_028965311.1|  Holliday junction resolvase                      44.7    2e-05   
ref|WP_037266278.1|  Holliday junction resolvase                      44.3    2e-05   
ref|WP_038574203.1|  Holliday junction resolvase                      39.7    2e-05   
gb|KEG19708.1|  YqgF family RNAse H domain-containing protein         38.1    2e-05   
ref|WP_011425140.1|  Holliday junction resolvase                      39.3    2e-05   
ref|WP_029935324.1|  Holliday junction resolvase                      42.0    2e-05   
ref|WP_015527088.1|  MULTISPECIES: hypothetical protein               42.4    2e-05   
ref|WP_012317482.1|  MULTISPECIES: Holliday junction resolvase        40.8    2e-05   
ref|WP_028732036.1|  Holliday junction resolvase                      38.5    2e-05   
ref|WP_003869797.1|  MULTISPECIES: Holliday junction resolvase        39.7    2e-05   



>emb|CBI34676.3| unnamed protein product [Vitis vinifera]
Length=224

 Score =   146 bits (368),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            GFI GYPF+RQR++P AV VK+ IDDLC+TGKL  V+YT+WDE F+SK+VE+LLKPLNLH
Sbjct  132  GFIVGYPFNRQRSSPTAVNVKVFIDDLCKTGKLEGVRYTYWDECFTSKNVELLLKPLNLH  191

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNR  643
            PVQSKTI+DKFAAV ILQGYLD+VNR
Sbjct  192  PVQSKTILDKFAAVGILQGYLDHVNR  217


 Score =   111 bits (277),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 64/72 (89%), Gaps = 4/72 (6%)
 Frame = +1

Query  142  FEMKYMKPLNLFQELVK----SRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSN  309
            F MKY+KP+NLF +L+K     RGRLLGLDVG+KYVGLAVSD+ NK+ASPLSVL+RKKSN
Sbjct  54   FVMKYVKPVNLFHDLLKMKATERGRLLGLDVGDKYVGLAVSDLHNKIASPLSVLLRKKSN  113

Query  310  IDLMATDFQSLV  345
            IDLMATDFQSL+
Sbjct  114  IDLMATDFQSLI  125



>ref|XP_002269986.1| PREDICTED: uncharacterized protein LOC100266792 isoform X2 [Vitis 
vinifera]
Length=169

 Score =   146 bits (368),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            GFI GYPF+RQR++P AV VK+ IDDLC+TGKL  V+YT+WDE F+SK+VE+LLKPLNLH
Sbjct  77   GFIVGYPFNRQRSSPTAVNVKVFIDDLCKTGKLEGVRYTYWDECFTSKNVELLLKPLNLH  136

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNR  643
            PVQSKTI+DKFAAV ILQGYLD+VNR
Sbjct  137  PVQSKTILDKFAAVGILQGYLDHVNR  162


 Score =   108 bits (271),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 63/70 (90%), Gaps = 4/70 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVK----SRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            MKY+KP+NLF +L+K     RGRLLGLDVG+KYVGLAVSD+ NK+ASPLSVL+RKKSNID
Sbjct  1    MKYVKPVNLFHDLLKMKATERGRLLGLDVGDKYVGLAVSDLHNKIASPLSVLLRKKSNID  60

Query  316  LMATDFQSLV  345
            LMATDFQSL+
Sbjct  61   LMATDFQSLI  70



>emb|CDP09744.1| unnamed protein product [Coffea canephora]
Length=171

 Score =   144 bits (363),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 77/88 (88%), Gaps = 1/88 (1%)
 Frame = +2

Query  386  GFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ GYPFDRQ RN+ DAVQVKL IDDLC+TGKL  V+YTFWDE F+SK+VE LLKPLNL
Sbjct  77   GFVIGYPFDRQQRNSADAVQVKLFIDDLCKTGKLEGVRYTFWDECFTSKNVEFLLKPLNL  136

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVNRN  646
            HPV  KTI+DKFAAV ILQGYLD+VNR+
Sbjct  137  HPVHYKTIMDKFAAVGILQGYLDFVNRS  164


 Score =   108 bits (269),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 62/70 (89%), Gaps = 4/70 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKS----RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            MKYMKP NLFQEL+K+    R RLLGLDVG+KYVGLAVSDV NK+ASPLSVL+RKKSNID
Sbjct  1    MKYMKPANLFQELIKTNSRNRSRLLGLDVGDKYVGLAVSDVNNKIASPLSVLLRKKSNID  60

Query  316  LMATDFQSLV  345
            LMA+DF+ L+
Sbjct  61   LMASDFELLI  70



>ref|XP_010271779.1| PREDICTED: uncharacterized protein LOC104607779 isoform X1 [Nelumbo 
nucifera]
Length=260

 Score =   147 bits (370),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            GF+ GYPFD QRN PDAVQVKL I+DL + GKL DVKYT+WDE F+SK VE+LLKPLNLH
Sbjct  164  GFVVGYPFDYQRNTPDAVQVKLFIEDLRKIGKLEDVKYTYWDERFTSKCVELLLKPLNLH  223

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNRNDKMK  658
            PV+SKTI+DKFAAV ILQGYLDYVN N K++
Sbjct  224  PVESKTILDKFAAVGILQGYLDYVNMNLKLE  254


 Score =   105 bits (261),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 66/86 (77%), Gaps = 5/86 (6%)
 Frame = +1

Query  100  TAAAWRISQSHSGFFEMKYMKPLNLFQELVKS----RGRLLGLDVGNKYVGLAVSDVENK  267
            T     ++ SH    +MKYMK +NLF +L+KS    +GRLLGLDVG KYVGLAVSD  NK
Sbjct  73   TIFVCSVAHSHPAI-KMKYMKSINLFHDLLKSNTAGKGRLLGLDVGLKYVGLAVSDPYNK  131

Query  268  LASPLSVLIRKKSNIDLMATDFQSLV  345
            +ASPLSVL+RKKSNIDLMA DFQSL+
Sbjct  132  IASPLSVLVRKKSNIDLMAKDFQSLI  157



>ref|XP_010271789.1| PREDICTED: uncharacterized protein LOC104607779 isoform X2 [Nelumbo 
nucifera]
Length=226

 Score =   146 bits (369),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            GF+ GYPFD QRN PDAVQVKL I+DL + GKL DVKYT+WDE F+SK VE+LLKPLNLH
Sbjct  130  GFVVGYPFDYQRNTPDAVQVKLFIEDLRKIGKLEDVKYTYWDERFTSKCVELLLKPLNLH  189

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNRNDKMK  658
            PV+SKTI+DKFAAV ILQGYLDYVN N K++
Sbjct  190  PVESKTILDKFAAVGILQGYLDYVNMNLKLE  220


 Score =   105 bits (261),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 66/86 (77%), Gaps = 5/86 (6%)
 Frame = +1

Query  100  TAAAWRISQSHSGFFEMKYMKPLNLFQELVKS----RGRLLGLDVGNKYVGLAVSDVENK  267
            T     ++ SH    +MKYMK +NLF +L+KS    +GRLLGLDVG KYVGLAVSD  NK
Sbjct  39   TIFVCSVAHSHPAI-KMKYMKSINLFHDLLKSNTAGKGRLLGLDVGLKYVGLAVSDPYNK  97

Query  268  LASPLSVLIRKKSNIDLMATDFQSLV  345
            +ASPLSVL+RKKSNIDLMA DFQSL+
Sbjct  98   IASPLSVLVRKKSNIDLMAKDFQSLI  123



>ref|XP_011080965.1| PREDICTED: uncharacterized protein LOC105164099 [Sesamum indicum]
 ref|XP_011080967.1| PREDICTED: uncharacterized protein LOC105164099 [Sesamum indicum]
 ref|XP_011080968.1| PREDICTED: uncharacterized protein LOC105164099 [Sesamum indicum]
Length=180

 Score =   145 bits (366),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            GF+ GYPFDRQ+NNPDAVQVKL +D+L +TGKL D+KYTFWDE F+SK+VE LLKPL LH
Sbjct  79   GFVIGYPFDRQKNNPDAVQVKLFVDELSKTGKLEDLKYTFWDECFTSKNVEFLLKPLTLH  138

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNRN  646
            PVQ KTIVDKFAAV ILQ YLD+ NR+
Sbjct  139  PVQVKTIVDKFAAVGILQAYLDFANRS  165


 Score =   105 bits (261),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 61/72 (85%), Gaps = 6/72 (8%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKS------RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSN  309
            MKY+KP+ L+ EL+KS      R RLLGLDVG+KYVGLA SDV NK+ASPLSVLIRKK+N
Sbjct  1    MKYVKPMKLYHELLKSNKLKGGRSRLLGLDVGDKYVGLAFSDVNNKIASPLSVLIRKKTN  60

Query  310  IDLMATDFQSLV  345
            IDLMATDFQSL+
Sbjct  61   IDLMATDFQSLI  72



>ref|XP_007209672.1| hypothetical protein PRUPE_ppa012236mg [Prunus persica]
 gb|EMJ10871.1| hypothetical protein PRUPE_ppa012236mg [Prunus persica]
Length=178

 Score =   147 bits (370),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +2

Query  383  KGFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            +GFI GYPFDRQR +PDAVQVKL IDDL  T KL  +KYT+WDE F+SK+VE+LL+PLNL
Sbjct  76   EGFIVGYPFDRQRRSPDAVQVKLFIDDLSATRKLEGLKYTYWDEGFTSKNVELLLRPLNL  135

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVNRNDK  652
            HPV SKTI+DKFAAV ILQGYLDYVNR  K
Sbjct  136  HPVTSKTIIDKFAAVGILQGYLDYVNRKQK  165


 Score =   102 bits (255),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 62/70 (89%), Gaps = 4/70 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVK----SRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            M+Y+KPL+LFQ+LV+     RGRLLGLDVG+KYVG+AVSD+ NK+ASPLSVL+RKKS +D
Sbjct  1    MRYVKPLSLFQDLVRGNALERGRLLGLDVGDKYVGVAVSDIHNKIASPLSVLLRKKSTLD  60

Query  316  LMATDFQSLV  345
            +MA DFQSL+
Sbjct  61   MMADDFQSLI  70



>ref|XP_011029263.1| PREDICTED: uncharacterized protein LOC105129048 isoform X2 [Populus 
euphratica]
 ref|XP_011029264.1| PREDICTED: uncharacterized protein LOC105129048 isoform X2 [Populus 
euphratica]
Length=170

 Score =   146 bits (369),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 82/94 (87%), Gaps = 2/94 (2%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            GFI GYPFDRQR  PDAV+VKL +DDLC+TGKL  VK+T+WDE F+SK+VE+L+KPL+LH
Sbjct  77   GFIVGYPFDRQRGAPDAVRVKLFVDDLCKTGKLEGVKFTYWDECFTSKNVELLVKPLDLH  136

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNRNDKMKLSA  667
            PV +K+I+DKFAAV ILQGYLDYVNR  KMKL +
Sbjct  137  PVHAKSIMDKFAAVGILQGYLDYVNR--KMKLES  168


 Score =   102 bits (254),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 62/70 (89%), Gaps = 4/70 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKS----RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            MKY++PL+LF EL+K+    +GR LGLDVG+KYVGLAVSD  NK+ASPLSVL+RKKSNI+
Sbjct  1    MKYVRPLSLFHELLKTSAINQGRFLGLDVGDKYVGLAVSDPLNKIASPLSVLLRKKSNIE  60

Query  316  LMATDFQSLV  345
            LMATDFQSL+
Sbjct  61   LMATDFQSLI  70



>ref|XP_008238848.1| PREDICTED: uncharacterized protein LOC103337465 isoform X1 [Prunus 
mume]
Length=185

 Score =   145 bits (366),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +2

Query  383  KGFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            +GFI GYPFDRQR +PDAVQV L IDDL  T KL  +KYT+WDE F+SK+VE+LL+PLNL
Sbjct  76   EGFIVGYPFDRQRRSPDAVQVNLFIDDLSATRKLEGLKYTYWDEGFTSKNVELLLRPLNL  135

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVNRNDK  652
            HPV SKTIVDKFAAV ILQGYLDYVNR  K
Sbjct  136  HPVTSKTIVDKFAAVGILQGYLDYVNRKQK  165


 Score =   103 bits (256),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 62/70 (89%), Gaps = 4/70 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVK----SRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            M+Y+KPL+LFQ+LV+     RGRLLGLDVG+KYVG+AVSD+ NK+ASPLSVL+RKKS +D
Sbjct  1    MRYVKPLSLFQDLVRGNALERGRLLGLDVGDKYVGVAVSDIHNKIASPLSVLLRKKSTLD  60

Query  316  LMATDFQSLV  345
            +MA DFQSL+
Sbjct  61   MMADDFQSLI  70



>ref|XP_010271798.1| PREDICTED: uncharacterized protein LOC104607779 isoform X3 [Nelumbo 
nucifera]
Length=174

 Score =   146 bits (369),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            GF+ GYPFD QRN PDAVQVKL I+DL + GKL DVKYT+WDE F+SK VE+LLKPLNLH
Sbjct  78   GFVVGYPFDYQRNTPDAVQVKLFIEDLRKIGKLEDVKYTYWDERFTSKCVELLLKPLNLH  137

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNRNDKMK  658
            PV+SKTI+DKFAAV ILQGYLDYVN N K++
Sbjct  138  PVESKTILDKFAAVGILQGYLDYVNMNLKLE  168


 Score =   101 bits (252),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 60/70 (86%), Gaps = 4/70 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKS----RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            MKYMK +NLF +L+KS    +GRLLGLDVG KYVGLAVSD  NK+ASPLSVL+RKKSNID
Sbjct  2    MKYMKSINLFHDLLKSNTAGKGRLLGLDVGLKYVGLAVSDPYNKIASPLSVLVRKKSNID  61

Query  316  LMATDFQSLV  345
            LMA DFQSL+
Sbjct  62   LMAKDFQSLI  71



>ref|XP_008238849.1| PREDICTED: uncharacterized protein LOC103337465 isoform X2 [Prunus 
mume]
Length=181

 Score =   145 bits (366),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +2

Query  383  KGFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            +GFI GYPFDRQR +PDAVQV L IDDL  T KL  +KYT+WDE F+SK+VE+LL+PLNL
Sbjct  76   EGFIVGYPFDRQRRSPDAVQVNLFIDDLSATRKLEGLKYTYWDEGFTSKNVELLLRPLNL  135

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVNRNDK  652
            HPV SKTIVDKFAAV ILQGYLDYVNR  K
Sbjct  136  HPVTSKTIVDKFAAVGILQGYLDYVNRKQK  165


 Score =   102 bits (255),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 62/70 (89%), Gaps = 4/70 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVK----SRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            M+Y+KPL+LFQ+LV+     RGRLLGLDVG+KYVG+AVSD+ NK+ASPLSVL+RKKS +D
Sbjct  1    MRYVKPLSLFQDLVRGNALERGRLLGLDVGDKYVGVAVSDIHNKIASPLSVLLRKKSTLD  60

Query  316  LMATDFQSLV  345
            +MA DFQSL+
Sbjct  61   MMADDFQSLI  70



>ref|XP_009801643.1| PREDICTED: uncharacterized protein LOC104247351 [Nicotiana sylvestris]
 ref|XP_009801644.1| PREDICTED: uncharacterized protein LOC104247351 [Nicotiana sylvestris]
Length=177

 Score =   143 bits (361),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 84/104 (81%), Gaps = 4/104 (4%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
             F+FGYPFDRQ+ + DAVQVK LIDDLC TG+L  VKYTFWDE F+SK+VE+LL+PL LH
Sbjct  77   AFVFGYPFDRQKMSRDAVQVKFLIDDLCRTGELRGVKYTFWDECFTSKNVELLLQPLKLH  136

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNRNDKMKLSARSEEPADEDG  697
            P Q+KT++DKFAAV ILQGYLD+VNR    K ++  ++ + EDG
Sbjct  137  PAQTKTMLDKFAAVGILQGYLDFVNR----KHASTPDKNSSEDG  176


 Score =   104 bits (260),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 59/70 (84%), Gaps = 4/70 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKSR----GRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            MKYMKP NLFQEL+KS      R LGLDVG+KYVGLAVSD  NK+ASPL+VL+RKK+NID
Sbjct  1    MKYMKPYNLFQELLKSNTLASSRFLGLDVGDKYVGLAVSDSTNKVASPLAVLVRKKTNID  60

Query  316  LMATDFQSLV  345
            LMA DFQSLV
Sbjct  61   LMAKDFQSLV  70



>ref|XP_002298037.1| hypothetical protein POPTR_0001s09310g [Populus trichocarpa]
 gb|EEE82842.1| hypothetical protein POPTR_0001s09310g [Populus trichocarpa]
Length=170

 Score =   145 bits (365),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 82/94 (87%), Gaps = 2/94 (2%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            GFI GYPFDRQR  PDAV+VKL +DDLC+TGKL  VK+T+WDE F+SK+VE+L+KPL+LH
Sbjct  77   GFIVGYPFDRQRGAPDAVRVKLFVDDLCKTGKLEGVKFTYWDECFTSKNVELLVKPLDLH  136

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNRNDKMKLSA  667
            PV +K+I+DKFAAV ILQGYLDYVN+  KMKL +
Sbjct  137  PVHAKSIMDKFAAVGILQGYLDYVNK--KMKLES  168


 Score =   102 bits (253),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 62/70 (89%), Gaps = 4/70 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKS----RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            MKY++PL+LF EL+K+    +GR LGLDVG+KYVGLAVSD  NK+ASPLSVL+RKKSNI+
Sbjct  1    MKYVRPLSLFHELLKTSAINQGRFLGLDVGDKYVGLAVSDPLNKIASPLSVLLRKKSNIE  60

Query  316  LMATDFQSLV  345
            LMATDFQSL+
Sbjct  61   LMATDFQSLI  70



>ref|XP_009611968.1| PREDICTED: uncharacterized protein LOC104105384 isoform X2 [Nicotiana 
tomentosiformis]
Length=177

 Score =   142 bits (358),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 84/104 (81%), Gaps = 4/104 (4%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
             F+FGYPFDRQ+ + DAVQVK LIDDLC TG+L  VKYTFWDE F+SK+VE+LL+PL LH
Sbjct  77   AFVFGYPFDRQKLSRDAVQVKFLIDDLCRTGELRGVKYTFWDECFTSKNVELLLQPLKLH  136

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNRNDKMKLSARSEEPADEDG  697
            P Q+KT++DKFAAV ILQGYLD+VNR    K ++  ++ + EDG
Sbjct  137  PAQTKTMLDKFAAVGILQGYLDFVNR----KHASTPDKDSSEDG  176


 Score =   105 bits (261),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 59/70 (84%), Gaps = 4/70 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKSR----GRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            MKYMKP NLFQEL+KS      R LGLDVG+KYVGLAVSD  NK+ASPL+VLIRKK+NID
Sbjct  1    MKYMKPYNLFQELLKSNTLASSRFLGLDVGDKYVGLAVSDSTNKVASPLAVLIRKKTNID  60

Query  316  LMATDFQSLV  345
            LMA DFQSLV
Sbjct  61   LMAKDFQSLV  70



>ref|XP_009611967.1| PREDICTED: uncharacterized protein LOC104105384 isoform X1 [Nicotiana 
tomentosiformis]
Length=179

 Score =   142 bits (357),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 84/104 (81%), Gaps = 4/104 (4%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
             F+FGYPFDRQ+ + DAVQVK LIDDLC TG+L  VKYTFWDE F+SK+VE+LL+PL LH
Sbjct  79   AFVFGYPFDRQKLSRDAVQVKFLIDDLCRTGELRGVKYTFWDECFTSKNVELLLQPLKLH  138

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNRNDKMKLSARSEEPADEDG  697
            P Q+KT++DKFAAV ILQGYLD+VNR    K ++  ++ + EDG
Sbjct  139  PAQTKTMLDKFAAVGILQGYLDFVNR----KHASTPDKDSSEDG  178


 Score =   105 bits (261),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 59/70 (84%), Gaps = 4/70 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKSR----GRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            MKYMKP NLFQEL+KS      R LGLDVG+KYVGLAVSD  NK+ASPL+VLIRKK+NID
Sbjct  3    MKYMKPYNLFQELLKSNTLASSRFLGLDVGDKYVGLAVSDSTNKVASPLAVLIRKKTNID  62

Query  316  LMATDFQSLV  345
            LMA DFQSLV
Sbjct  63   LMAKDFQSLV  72



>ref|XP_002509795.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51182.1| conserved hypothetical protein [Ricinus communis]
Length=168

 Score =   140 bits (354),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 81/94 (86%), Gaps = 2/94 (2%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            GF+ GYPFDRQR+ PDA+ VKL IDDL + GKL  +KYTFWDE F+SK+VE+L++PL+LH
Sbjct  75   GFVVGYPFDRQRSTPDALHVKLFIDDLRKIGKLEGLKYTFWDECFTSKNVELLVQPLDLH  134

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNRNDKMKLSA  667
            PV++KTI+DKFAAV ILQGYLDYVNR  K+KL A
Sbjct  135  PVEAKTIMDKFAAVGILQGYLDYVNR--KLKLEA  166


 Score =   105 bits (261),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 62/68 (91%), Gaps = 2/68 (3%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKSR--GRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNIDLM  321
            MKYMKP+ LF +L+KS+  GRLLGLDVG+KYVGLA+SD  NK+ASPLSVL+RKKSNIDL+
Sbjct  1    MKYMKPIALFNDLMKSKSNGRLLGLDVGDKYVGLAISDRHNKIASPLSVLLRKKSNIDLV  60

Query  322  ATDFQSLV  345
            ATDFQSL+
Sbjct  61   ATDFQSLI  68



>gb|KHG11125.1| Putative Holliday junction resolvase [Gossypium arboreum]
Length=166

 Score =   139 bits (350),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            GF+ GYPFDRQR  PDA QVKL IDDL ETGKL  +K+TFWDE F+SK+VE+L+KPL+LH
Sbjct  77   GFVVGYPFDRQRLAPDATQVKLFIDDLSETGKLDGLKFTFWDERFTSKNVELLIKPLSLH  136

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNRND  649
            PV +KT+VDKFAAV+ILQ YLDYVN+ +
Sbjct  137  PVLAKTVVDKFAAVQILQAYLDYVNKKE  164


 Score =   104 bits (259),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 68/79 (86%), Gaps = 5/79 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKSR----GRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            M+Y+KPL+LFQ LVKS     GRLLGLDVG+KYVGLA+SD++NK+ASPLSVL+RKK+NID
Sbjct  1    MQYVKPLHLFQNLVKSNASQGGRLLGLDVGDKYVGLAISDLDNKIASPLSVLVRKKTNID  60

Query  316  LMATDFQSLV-RLSFLNYL  369
            L+A DFQSL+  LS + ++
Sbjct  61   LVAHDFQSLISELSLVGFV  79



>ref|XP_011029261.1| PREDICTED: uncharacterized protein LOC105129048 isoform X1 [Populus 
euphratica]
 ref|XP_011029262.1| PREDICTED: uncharacterized protein LOC105129048 isoform X1 [Populus 
euphratica]
Length=176

 Score =   139 bits (351),  Expect(2) = 9e-55, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 82/100 (82%), Gaps = 8/100 (8%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            GFI GYPFDRQR  PDAV+VKL +DDLC+TGKL  VK+T+WDE F+SK+VE+L+KPL+LH
Sbjct  77   GFIVGYPFDRQRGAPDAVRVKLFVDDLCKTGKLEGVKFTYWDECFTSKNVELLVKPLDLH  136

Query  566  PVQSKTIVDKFAAVEIL------QGYLDYVNRNDKMKLSA  667
            PV +K+I+DKFAAV IL      QGYLDYVNR  KMKL +
Sbjct  137  PVHAKSIMDKFAAVGILQLVYLWQGYLDYVNR--KMKLES  174


 Score =   102 bits (254),  Expect(2) = 9e-55, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 62/70 (89%), Gaps = 4/70 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKS----RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            MKY++PL+LF EL+K+    +GR LGLDVG+KYVGLAVSD  NK+ASPLSVL+RKKSNI+
Sbjct  1    MKYVRPLSLFHELLKTSAINQGRFLGLDVGDKYVGLAVSDPLNKIASPLSVLLRKKSNIE  60

Query  316  LMATDFQSLV  345
            LMATDFQSL+
Sbjct  61   LMATDFQSLI  70



>ref|XP_007040207.1| Polynucleotidyl transferase isoform 1 [Theobroma cacao]
 ref|XP_007040211.1| Polynucleotidyl transferase isoform 1 [Theobroma cacao]
 gb|EOY24708.1| Polynucleotidyl transferase isoform 1 [Theobroma cacao]
 gb|EOY24712.1| Polynucleotidyl transferase isoform 1 [Theobroma cacao]
Length=170

 Score =   136 bits (343),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            GFI GYPFDRQ+  PDAVQVKL IDDL +TGKL  VKYTFW+E F+SK+ ++LLKPL+LH
Sbjct  77   GFIVGYPFDRQQRAPDAVQVKLFIDDLSKTGKLDGVKYTFWNECFTSKNADLLLKPLSLH  136

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNRNDKMKLSA  667
            P+ SKTIVDKFAAV+ILQ YLDY  +N K++ + 
Sbjct  137  PILSKTIVDKFAAVQILQTYLDYGKKNVKLETAG  170


 Score =   105 bits (262),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 69/79 (87%), Gaps = 5/79 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKS----RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            M+Y+K LN FQ+L+K+    RGRLLGLDVG+KYVGLAVSD++NK+A+PLSVLIRKK+NID
Sbjct  1    MQYVKCLNFFQDLLKAKALERGRLLGLDVGDKYVGLAVSDLDNKIATPLSVLIRKKTNID  60

Query  316  LMATDFQSLV-RLSFLNYL  369
            LMA+DFQSL+  LS + ++
Sbjct  61   LMASDFQSLISELSLVGFI  79



>gb|KDP25443.1| hypothetical protein JCGZ_20599 [Jatropha curcas]
Length=170

 Score =   143 bits (361),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            GF+ GYPFDR R+ PDAVQVK+ IDDLC+TGKL  +KYT+WDE F+SK+VE+L+KPL L 
Sbjct  77   GFVVGYPFDRLRSAPDAVQVKVFIDDLCKTGKLEGLKYTYWDECFTSKNVELLIKPLALC  136

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNRNDKMK  658
            P Q+KT++DKFAAV ILQGYLDYVNR  KM+
Sbjct  137  PTQAKTMIDKFAAVGILQGYLDYVNRETKME  167


 Score = 98.2 bits (243),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 58/70 (83%), Gaps = 4/70 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKSRG----RLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            MKY+KPL LF EL+K++     RLLGLDVG KYVGLA+SD  N++ASPLSVL+RKKSNID
Sbjct  1    MKYVKPLALFHELMKAKAQGERRLLGLDVGGKYVGLAISDQCNEIASPLSVLLRKKSNID  60

Query  316  LMATDFQSLV  345
            LMA DFQSL 
Sbjct  61   LMADDFQSLT  70



>ref|XP_010682115.1| PREDICTED: uncharacterized protein LOC104897013 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682116.1| PREDICTED: uncharacterized protein LOC104897013 [Beta vulgaris 
subsp. vulgaris]
Length=169

 Score =   136 bits (343),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            GFI G P+DR R +P AVQVK+ +DDLC+TGKL  VKYT+W+E F+SK+VE+LLKPL LH
Sbjct  77   GFIVGCPYDRLRPSPHAVQVKVFVDDLCKTGKLEGVKYTYWNECFTSKNVELLLKPLTLH  136

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNRN  646
            PV+ KT++DKFAAV ILQGYLDYVNRN
Sbjct  137  PVELKTMLDKFAAVGILQGYLDYVNRN  163


 Score =   101 bits (252),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 62/70 (89%), Gaps = 4/70 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKS----RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            MK+MKPL+LFQ+L+K+    RGRLLGLDVG+KYVGLA+SD ENK+A+PLSVL+RKK NID
Sbjct  1    MKHMKPLSLFQDLLKTNALERGRLLGLDVGDKYVGLALSDPENKIATPLSVLLRKKFNID  60

Query  316  LMATDFQSLV  345
            +MA DF SL+
Sbjct  61   MMAADFTSLI  70



>ref|XP_004143911.1| PREDICTED: putative Holliday junction resolvase-like isoform 
2 [Cucumis sativus]
 ref|XP_004159951.1| PREDICTED: putative Holliday junction resolvase-like isoform 
2 [Cucumis sativus]
 gb|KGN50104.1| hypothetical protein Csa_5G153680 [Cucumis sativus]
Length=169

 Score =   144 bits (364),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            GFI GYPFDR RNNPDA+QVK+ IDDLC+TGKL  VKYTFWDE F+SK+VE+L+KPLNL 
Sbjct  77   GFIVGYPFDRLRNNPDAMQVKIFIDDLCKTGKLEGVKYTFWDECFTSKNVELLIKPLNLL  136

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNRNDKM  655
            P  SKTI+DKFAAV ILQGYLDY NR  ++
Sbjct  137  PAVSKTIIDKFAAVGILQGYLDYFNRRPEL  166


 Score = 92.4 bits (228),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 57/70 (81%), Gaps = 4/70 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVK----SRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            MKY++PL LF++L K      GRLLGLDVG+KYVGLAVSD +NK+A PLSVL+RKK+ +D
Sbjct  1    MKYVRPLMLFRDLTKRDALEHGRLLGLDVGDKYVGLAVSDPDNKIACPLSVLLRKKTTMD  60

Query  316  LMATDFQSLV  345
            LMA DFQ ++
Sbjct  61   LMAQDFQKMI  70



>ref|XP_007040208.1| Polynucleotidyl transferase isoform 2 [Theobroma cacao]
 ref|XP_007040209.1| Polynucleotidyl transferase isoform 2 [Theobroma cacao]
 ref|XP_007040210.1| Polynucleotidyl transferase isoform 2 [Theobroma cacao]
 gb|EOY24709.1| Polynucleotidyl transferase isoform 2 [Theobroma cacao]
 gb|EOY24710.1| Polynucleotidyl transferase isoform 2 [Theobroma cacao]
 gb|EOY24711.1| Polynucleotidyl transferase isoform 2 [Theobroma cacao]
Length=186

 Score =   126 bits (317),  Expect(2) = 8e-52, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 78/110 (71%), Gaps = 16/110 (15%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSK------------  529
            GFI GYPFDRQ+  PDAVQVKL IDDL +TGKL  VKYTFW+E F+SK            
Sbjct  77   GFIVGYPFDRQQRAPDAVQVKLFIDDLSKTGKLDGVKYTFWNECFTSKQYMTSSKESHSL  136

Query  530  ----SVEMLLKPLNLHPVQSKTIVDKFAAVEILQGYLDYVNRNDKMKLSA  667
                + ++LLKPL+LHP+ SKTIVDKFAAV+ILQ YLDY  +N K++ + 
Sbjct  137  SFQQNADLLLKPLSLHPILSKTIVDKFAAVQILQTYLDYGKKNVKLETAG  186


 Score =   105 bits (262),  Expect(2) = 8e-52, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 69/79 (87%), Gaps = 5/79 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKS----RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            M+Y+K LN FQ+L+K+    RGRLLGLDVG+KYVGLAVSD++NK+A+PLSVLIRKK+NID
Sbjct  1    MQYVKCLNFFQDLLKAKALERGRLLGLDVGDKYVGLAVSDLDNKIATPLSVLIRKKTNID  60

Query  316  LMATDFQSLV-RLSFLNYL  369
            LMA+DFQSL+  LS + ++
Sbjct  61   LMASDFQSLISELSLVGFI  79



>ref|XP_006362356.1| PREDICTED: uncharacterized protein LOC102597279 [Solanum tuberosum]
Length=179

 Score =   129 bits (324),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
             F+FGYPFDRQ+ + DAVQVKL IDDLC TG+L  V YTF DE F+SK+VE LL+ L  H
Sbjct  91   AFVFGYPFDRQKISRDAVQVKLFIDDLCRTGELRGVNYTFRDECFTSKNVEFLLRDLKFH  150

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNR  643
            P QSKT++DKFAAV ILQGYLD+VNR
Sbjct  151  PTQSKTMLDKFAAVGILQGYLDFVNR  176


 Score =   101 bits (251),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 65/83 (78%), Gaps = 6/83 (7%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKSRG----RLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            M+Y+KP NLF EL+KS      R+LGLDVG+KYVGLAVSD  NK+ASPL+VL+RKK+NID
Sbjct  1    MRYLKPSNLFHELLKSNALASCRILGLDVGDKYVGLAVSDTTNKVASPLAVLLRKKTNID  60

Query  316  LMATDFQSLVRLSFLNYL*AFLE  384
            LMA D Q LVR  F+ YL +F +
Sbjct  61   LMAKDLQGLVR--FIIYLSSFFQ  81



>ref|XP_009364906.1| PREDICTED: uncharacterized protein LOC103954805 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009364912.1| PREDICTED: uncharacterized protein LOC103954811 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009346759.1| PREDICTED: uncharacterized protein LOC103938484 isoform X1 [Pyrus 
x bretschneideri]
Length=170

 Score =   122 bits (305),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            GFI GYPFDRQ+  PDAVQVKL IDDL +T KL  +KYT+WDE F+SK+VE+LLKPLNL 
Sbjct  77   GFIVGYPFDRQKGTPDAVQVKLFIDDLSKTRKLEGLKYTYWDEGFTSKNVELLLKPLNLP  136

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNRNDK  652
            PVQSKTI+DKFAAV ILQGYLDYVNR  K
Sbjct  137  PVQSKTIMDKFAAVGILQGYLDYVNRELK  165


 Score =   107 bits (267),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 68/79 (86%), Gaps = 5/79 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKS----RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            M+Y+KPLNLFQ+LVK+    RGRLLGLDVG+KYVG+AVSD+ NK+ASPLSVL+RKKSNI 
Sbjct  1    MRYVKPLNLFQDLVKANTLERGRLLGLDVGDKYVGVAVSDLHNKIASPLSVLLRKKSNIG  60

Query  316  LMATDFQSLV-RLSFLNYL  369
            LMA DFQSL+  LS + ++
Sbjct  61   LMAADFQSLISELSLVGFI  79



>ref|NP_001280784.1| uncharacterized LOC103454749 [Malus domestica]
 gb|ADL36700.1| GRF domain class transcription factor [Malus domestica]
Length=170

 Score =   122 bits (305),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            GFI GYPFDRQ+  PDAVQVKL IDDL +T KL  +KYT+WDE F+SK+VE+LLKPLNL 
Sbjct  77   GFIVGYPFDRQKGTPDAVQVKLFIDDLSKTRKLEGLKYTYWDEGFTSKNVELLLKPLNLP  136

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNRNDK  652
            PVQSKTI+DKFAAV ILQGYLDYVNR  K
Sbjct  137  PVQSKTIMDKFAAVGILQGYLDYVNRELK  165


 Score =   105 bits (263),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 68/79 (86%), Gaps = 5/79 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKS----RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            M+Y+KPLNLFQ+L+K+    RGRLLGLDVG+KYVG+AVSD+ NK+ASPLSVL+RKKSNI 
Sbjct  1    MRYVKPLNLFQDLLKANTLERGRLLGLDVGDKYVGVAVSDLHNKIASPLSVLLRKKSNIG  60

Query  316  LMATDFQSLV-RLSFLNYL  369
            LMA DFQSL+  LS + ++
Sbjct  61   LMAADFQSLISELSLVGFI  79



>ref|XP_010660776.1| PREDICTED: uncharacterized protein LOC100266792 isoform X1 [Vitis 
vinifera]
Length=173

 Score =   117 bits (293),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 71/90 (79%), Gaps = 4/90 (4%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKL----VDVKYTFWDESFSSKSVEMLLKP  553
            GFI GYPF+RQR++P AV VK+ IDDLC+TGKL    +++      +    ++VE+LLKP
Sbjct  77   GFIVGYPFNRQRSSPTAVNVKVFIDDLCKTGKLEGVSLEINAINCQKPHFDQNVELLLKP  136

Query  554  LNLHPVQSKTIVDKFAAVEILQGYLDYVNR  643
            LNLHPVQSKTI+DKFAAV ILQGYLD+VNR
Sbjct  137  LNLHPVQSKTILDKFAAVGILQGYLDHVNR  166


 Score =   109 bits (272),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 63/70 (90%), Gaps = 4/70 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVK----SRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            MKY+KP+NLF +L+K     RGRLLGLDVG+KYVGLAVSD+ NK+ASPLSVL+RKKSNID
Sbjct  1    MKYVKPVNLFHDLLKMKATERGRLLGLDVGDKYVGLAVSDLHNKIASPLSVLLRKKSNID  60

Query  316  LMATDFQSLV  345
            LMATDFQSL+
Sbjct  61   LMATDFQSLI  70



>ref|XP_008437257.1| PREDICTED: uncharacterized protein LOC103482742 isoform X1 [Cucumis 
melo]
Length=169

 Score =   135 bits (339),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            GFI GYPFDR R N +A+QVK+ IDDLC+TGKL  VKYTFWDE F+SK+VE ++KPLNL 
Sbjct  77   GFIVGYPFDRLRKNTEAIQVKIFIDDLCKTGKLEGVKYTFWDEGFTSKNVEQMIKPLNLL  136

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNRNDKM  655
            P  SKT++DKFAAV ILQGYLDY NR  ++
Sbjct  137  PAVSKTMLDKFAAVGILQGYLDYFNRRPEL  166


 Score = 89.4 bits (220),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 57/70 (81%), Gaps = 4/70 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVK----SRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            MKY+KP  LF++L+K       RLLGLDVG+KYVGLAVSD +NK+ASPLSVL+RKK+ +D
Sbjct  1    MKYVKPSILFRDLLKRDELKHSRLLGLDVGDKYVGLAVSDPDNKIASPLSVLLRKKNTMD  60

Query  316  LMATDFQSLV  345
            LMA DFQ L+
Sbjct  61   LMAEDFQKLI  70



>ref|XP_004249036.1| PREDICTED: uncharacterized protein LOC101262873 isoform X1 [Solanum 
lycopersicum]
Length=165

 Score =   127 bits (320),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
             F+FGYPFDRQ+ + DAV VKL IDDLC TG+L  V YTF DE F+SK+VE LL+ L LH
Sbjct  77   AFVFGYPFDRQKTSRDAVHVKLFIDDLCRTGELRGVNYTFRDECFTSKNVEFLLQDLKLH  136

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNR  643
            P QSKT+ DKFAAV ILQG+LD+VNR
Sbjct  137  PTQSKTMSDKFAAVGILQGFLDFVNR  162


 Score = 96.7 bits (239),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 66/87 (76%), Gaps = 7/87 (8%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKSRG----RLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            M+Y+KP NLF EL+KS      R+LGLDVG+KYVGLAVSD  NK+ASPL+VL+RKK+NID
Sbjct  1    MRYLKPSNLFHELLKSNALASSRILGLDVGDKYVGLAVSDTTNKVASPLAVLLRKKTNID  60

Query  316  LMATDFQSLVRLSFLNYL*AFLEGIHF  396
            LMA D Q LV  S LN L AF+ G  F
Sbjct  61   LMAKDLQGLV--SELN-LGAFVFGYPF  84



>ref|XP_006489147.1| PREDICTED: uncharacterized protein LOC102610643 isoform X1 [Citrus 
sinensis]
Length=180

 Score =   127 bits (318),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 75/100 (75%), Gaps = 2/100 (2%)
 Frame = +2

Query  383  KGFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            +GFI GYPF+RQ+N  DAVQVKL IDDL  T KL D+KY +W+E F+SK VE+LL PL+L
Sbjct  80   EGFIVGYPFNRQQNAADAVQVKLFIDDLSATKKLEDMKYAYWNEGFTSKGVELLLNPLDL  139

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVNRNDKMKLSARSEEP  682
            HPV+ KTI+DKFAAV ILQ YLD  NR  K+ L A    P
Sbjct  140  HPVEHKTILDKFAAVGILQEYLDNANR--KVNLKANVLRP  177


 Score = 97.1 bits (240),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 68/92 (74%), Gaps = 11/92 (12%)
 Frame = +1

Query  145  EMKYMKPLNLFQELVK----SRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNI  312
            +MKY+KPL LF++++K     RGR LGLDVG+KYVGL++SD +NK+ASPLSVL+RKK+ I
Sbjct  4    QMKYVKPLRLFEQMLKRKVSKRGRFLGLDVGDKYVGLSISDPKNKIASPLSVLLRKKNTI  63

Query  313  DLMATDFQSLVRLSFLNYL*AFLEGIHFWLPF  408
            DLMA DF+SL+  S  N     LEG     PF
Sbjct  64   DLMAEDFRSLI--SEFN-----LEGFIVGYPF  88



>gb|KHN25702.1| Lysine-specific demethylase rbr-2 [Glycine soja]
Length=1910

 Score =   127 bits (320),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 79/96 (82%), Gaps = 3/96 (3%)
 Frame = +2

Query  383   KGFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
             KGF+ G PFD+ + + DA+QVK+ ID+LC T  L  VKYT+W+ESF+SK+VE+LLKPLNL
Sbjct  1815  KGFVIGIPFDKHQVSSDAMQVKVFIDNLCRTKMLEGVKYTYWNESFTSKNVELLLKPLNL  1874

Query  563   -HPVQSKTIVDKFAAVEILQGYLDYVNRNDKMKLSA  667
              HPV SKT++DKFAAV ILQGYLD+VNR  KMKL A
Sbjct  1875  NHPVLSKTMLDKFAAVGILQGYLDFVNR--KMKLKA  1908


 Score = 95.5 bits (236),  Expect(2) = 4e-49, Method: Composition-based stats.
 Identities = 49/87 (56%), Positives = 64/87 (74%), Gaps = 6/87 (7%)
 Frame = +1

Query  145   EMKYMKPLNLFQELVKS---RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
             +M+YMKPL LF +L  +   RGRLLGLDVG+KYVGLA+SD +N +ASP +VL+RKK+NI 
Sbjct  1740  KMRYMKPLPLFHDLKNTTPQRGRLLGLDVGDKYVGLALSDFDNNIASPFNVLVRKKTNIS  1799

Query  316   LMATDFQSLVRLSFLNYL*AFLEGIHF  396
             LMA+D +SL+    L     F+ GI F
Sbjct  1800  LMASDLESLIAKYSLK---GFVIGIPF  1823



>gb|KDO75082.1| hypothetical protein CISIN_1g030251mg [Citrus sinensis]
Length=180

 Score =   126 bits (316),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 75/100 (75%), Gaps = 2/100 (2%)
 Frame = +2

Query  383  KGFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            +GFI GYPF+RQ+N  DAVQVKL IDDL  T KL D+KY +W+E F+SK VE+LL PL+L
Sbjct  80   EGFIVGYPFNRQQNAADAVQVKLFIDDLSATKKLEDMKYAYWNEGFTSKGVELLLNPLDL  139

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVNRNDKMKLSARSEEP  682
            HPV+ KTI+DKFAAV ILQ YLD  NR  K+ L A    P
Sbjct  140  HPVEYKTILDKFAAVGILQEYLDNANR--KVNLKANVLRP  177


 Score = 97.1 bits (240),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 68/92 (74%), Gaps = 11/92 (12%)
 Frame = +1

Query  145  EMKYMKPLNLFQELVK----SRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNI  312
            +MKY+KPL LF++++K     RGR LGLDVG+KYVGL++SD +NK+ASPLSVL+RKK+ I
Sbjct  4    QMKYVKPLRLFEQMLKRKVSKRGRFLGLDVGDKYVGLSISDPKNKIASPLSVLLRKKNTI  63

Query  313  DLMATDFQSLVRLSFLNYL*AFLEGIHFWLPF  408
            DLMA DF+SL+  S  N     LEG     PF
Sbjct  64   DLMAEDFRSLI--SEFN-----LEGFIVGYPF  88



>ref|XP_006419658.1| hypothetical protein CICLE_v10006013mg [Citrus clementina]
 ref|XP_006419660.1| hypothetical protein CICLE_v10006013mg [Citrus clementina]
 ref|XP_006489148.1| PREDICTED: uncharacterized protein LOC102610643 isoform X2 [Citrus 
sinensis]
 ref|XP_006489149.1| PREDICTED: uncharacterized protein LOC102610643 isoform X3 [Citrus 
sinensis]
 gb|ESR32898.1| hypothetical protein CICLE_v10006013mg [Citrus clementina]
 gb|ESR32900.1| hypothetical protein CICLE_v10006013mg [Citrus clementina]
Length=176

 Score =   127 bits (318),  Expect(2) = 6e-49, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 75/100 (75%), Gaps = 2/100 (2%)
 Frame = +2

Query  383  KGFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            +GFI GYPF+RQ+N  DAVQVKL IDDL  T KL D+KY +W+E F+SK VE+LL PL+L
Sbjct  76   EGFIVGYPFNRQQNAADAVQVKLFIDDLSATKKLEDMKYAYWNEGFTSKGVELLLNPLDL  135

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVNRNDKMKLSARSEEP  682
            HPV+ KTI+DKFAAV ILQ YLD  NR  K+ L A    P
Sbjct  136  HPVEHKTILDKFAAVGILQEYLDNANR--KVNLKANVLRP  173


 Score = 95.9 bits (237),  Expect(2) = 6e-49, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 67/91 (74%), Gaps = 11/91 (12%)
 Frame = +1

Query  148  MKYMKPLNLFQELVK----SRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            MKY+KPL LF++++K     RGR LGLDVG+KYVGL++SD +NK+ASPLSVL+RKK+ ID
Sbjct  1    MKYVKPLRLFEQMLKRKVSKRGRFLGLDVGDKYVGLSISDPKNKIASPLSVLLRKKNTID  60

Query  316  LMATDFQSLVRLSFLNYL*AFLEGIHFWLPF  408
            LMA DF+SL+  S  N     LEG     PF
Sbjct  61   LMAEDFRSLI--SEFN-----LEGFIVGYPF  84



>ref|XP_004143910.1| PREDICTED: putative Holliday junction resolvase-like isoform 
1 [Cucumis sativus]
 ref|XP_004159950.1| PREDICTED: putative Holliday junction resolvase-like isoform 
1 [Cucumis sativus]
Length=177

 Score =   129 bits (325),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            GFI GYPFDR RNNPDA+QVK+ IDDLC+TGKL  VKYTFWDE F+SK+VE+L+KPLNL 
Sbjct  77   GFIVGYPFDRLRNNPDAMQVKIFIDDLCKTGKLEGVKYTFWDECFTSKNVELLIKPLNLL  136

Query  566  PVQSKTIVDKFAAVEILQGY  625
            P  SKTI+DKFAAV ILQ +
Sbjct  137  PAVSKTIIDKFAAVGILQTF  156


 Score = 92.8 bits (229),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 57/70 (81%), Gaps = 4/70 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVK----SRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            MKY++PL LF++L K      GRLLGLDVG+KYVGLAVSD +NK+A PLSVL+RKK+ +D
Sbjct  1    MKYVRPLMLFRDLTKRDALEHGRLLGLDVGDKYVGLAVSDPDNKIACPLSVLLRKKTTMD  60

Query  316  LMATDFQSLV  345
            LMA DFQ ++
Sbjct  61   LMAQDFQKMI  70



>gb|KDO75083.1| hypothetical protein CISIN_1g030251mg [Citrus sinensis]
Length=176

 Score =   126 bits (316),  Expect(2) = 9e-49, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 75/100 (75%), Gaps = 2/100 (2%)
 Frame = +2

Query  383  KGFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            +GFI GYPF+RQ+N  DAVQVKL IDDL  T KL D+KY +W+E F+SK VE+LL PL+L
Sbjct  76   EGFIVGYPFNRQQNAADAVQVKLFIDDLSATKKLEDMKYAYWNEGFTSKGVELLLNPLDL  135

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVNRNDKMKLSARSEEP  682
            HPV+ KTI+DKFAAV ILQ YLD  NR  K+ L A    P
Sbjct  136  HPVEYKTILDKFAAVGILQEYLDNANR--KVNLKANVLRP  173


 Score = 95.9 bits (237),  Expect(2) = 9e-49, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 67/91 (74%), Gaps = 11/91 (12%)
 Frame = +1

Query  148  MKYMKPLNLFQELVK----SRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            MKY+KPL LF++++K     RGR LGLDVG+KYVGL++SD +NK+ASPLSVL+RKK+ ID
Sbjct  1    MKYVKPLRLFEQMLKRKVSKRGRFLGLDVGDKYVGLSISDPKNKIASPLSVLLRKKNTID  60

Query  316  LMATDFQSLVRLSFLNYL*AFLEGIHFWLPF  408
            LMA DF+SL+  S  N     LEG     PF
Sbjct  61   LMAEDFRSLI--SEFN-----LEGFIVGYPF  84



>ref|XP_006572794.1| PREDICTED: uncharacterized protein LOC100305864 isoform X1 [Glycine 
max]
 ref|XP_006572795.1| PREDICTED: uncharacterized protein LOC100305864 isoform X2 [Glycine 
max]
Length=170

 Score =   128 bits (322),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 79/96 (82%), Gaps = 3/96 (3%)
 Frame = +2

Query  383  KGFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            KGF+ G PFD+ + + DA+QVK+ ID+LC T  L  VKYT+W+ESF+SK+VE+LLKPLNL
Sbjct  75   KGFVIGIPFDKHQVSSDAMQVKVFIDNLCRTKMLEGVKYTYWNESFTSKNVELLLKPLNL  134

Query  563  -HPVQSKTIVDKFAAVEILQGYLDYVNRNDKMKLSA  667
             HPV SKT++DKFAAV ILQGYLD+VNR  KMKL A
Sbjct  135  NHPVLSKTMLDKFAAVGILQGYLDFVNR--KMKLKA  168


 Score = 91.7 bits (226),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 56/69 (81%), Gaps = 3/69 (4%)
 Frame = +1

Query  148  MKYMKPLNLFQEL---VKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNIDL  318
            M+YMKPL LF +L      RGRLLGLDVG+KYVGLA+SD +N +ASP +VL+RKK+NI L
Sbjct  1    MRYMKPLPLFHDLKNTTPQRGRLLGLDVGDKYVGLALSDFDNNIASPFNVLVRKKTNISL  60

Query  319  MATDFQSLV  345
            MA+D +SL+
Sbjct  61   MASDLESLI  69



>ref|XP_010055626.1| PREDICTED: uncharacterized protein LOC104443797 isoform X2 [Eucalyptus 
grandis]
 gb|KCW72139.1| hypothetical protein EUGRSUZ_E00582 [Eucalyptus grandis]
 gb|KCW72140.1| hypothetical protein EUGRSUZ_E00582 [Eucalyptus grandis]
Length=171

 Score =   115 bits (289),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 72/90 (80%), Gaps = 1/90 (1%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ G P DR R+ N DAVQ+K+ ID+L +TGKL  V YT+W+E+F+SK+VE+LL+PL L
Sbjct  77   GFVVGVPLDRFRSPNRDAVQMKVFIDELSKTGKLEGVCYTYWEETFTSKNVELLLQPLTL  136

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVNRNDK  652
            H V +KTI+DKFAA+ ILQGYLDY N+  +
Sbjct  137  HSVVAKTIMDKFAAMGILQGYLDYANKKQR  166


 Score =   102 bits (254),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 66/79 (84%), Gaps = 5/79 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELV----KSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            M+Y+KPL+LFQ+++    K +GRLLGLDVG+KYVGLAVSD  NK+ASPLSVL+RKK+NID
Sbjct  1    MRYVKPLSLFQDVLMAHTKKKGRLLGLDVGDKYVGLAVSDSSNKVASPLSVLLRKKTNID  60

Query  316  LMATDFQSLV-RLSFLNYL  369
            LMATD QSLV   S L ++
Sbjct  61   LMATDLQSLVSEFSLLGFV  79



>ref|XP_007158496.1| hypothetical protein PHAVU_002G157400g [Phaseolus vulgaris]
 ref|XP_007158497.1| hypothetical protein PHAVU_002G157400g [Phaseolus vulgaris]
 gb|ESW30490.1| hypothetical protein PHAVU_002G157400g [Phaseolus vulgaris]
 gb|ESW30491.1| hypothetical protein PHAVU_002G157400g [Phaseolus vulgaris]
Length=172

 Score =   121 bits (304),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 78/99 (79%), Gaps = 3/99 (3%)
 Frame = +2

Query  383  KGFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            KGF+ G PFD+ R + DA  VK+LI++L  T  L  V+YT+W+E F+SK+VE+LLKPLNL
Sbjct  76   KGFVVGLPFDKHRVSCDAGLVKVLINNLSRTKMLEGVEYTYWNECFTSKNVELLLKPLNL  135

Query  563  -HPVQSKTIVDKFAAVEILQGYLDYVNRNDKMKLSARSE  676
             HPV SKTI+DKFAAV ILQGYLD+VNR  KMKL+ R+ 
Sbjct  136  NHPVLSKTILDKFAAVGILQGYLDFVNR--KMKLTVRNS  172


 Score = 96.3 bits (238),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 58/70 (83%), Gaps = 4/70 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKS----RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            M+++KPL LFQ+L  S    RGRLLGLDVG KYVGLA+SD +NK+ASP SVL+RKKSNI 
Sbjct  1    MRHVKPLQLFQDLTNSTHTQRGRLLGLDVGEKYVGLALSDFDNKIASPFSVLVRKKSNIS  60

Query  316  LMATDFQSLV  345
            LMA+DF +L+
Sbjct  61   LMASDFANLI  70



>gb|EPS61791.1| hypothetical protein M569_13005 [Genlisea aurea]
Length=191

 Score =   129 bits (323),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            GF+ G PFDR +N  +A +++L ID+L  TGKL DV YTFWDE F+SK+VE LLKPLNLH
Sbjct  78   GFVVGCPFDRLKNGLNAARIRLFIDELKNTGKLEDVNYTFWDECFTSKNVEFLLKPLNLH  137

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNR  643
            PVQ KTI+DKFAAV ILQGYLD+VNR
Sbjct  138  PVQYKTIMDKFAAVGILQGYLDFVNR  163


 Score = 88.6 bits (218),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 57/71 (80%), Gaps = 5/71 (7%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKSRG-----RLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNI  312
            MKY+KP+  +QE +KS G     RLLGLDVG+K+VGL+VS  +NK+ASPLSVL+R K+N+
Sbjct  1    MKYLKPVKFYQETLKSGGDFAKRRLLGLDVGDKFVGLSVSTSDNKVASPLSVLVRTKTNM  60

Query  313  DLMATDFQSLV  345
            DLM  DF+SL+
Sbjct  61   DLMTCDFKSLI  71



>ref|XP_011029266.1| PREDICTED: uncharacterized protein LOC105129048 isoform X4 [Populus 
euphratica]
Length=147

 Score =   116 bits (290),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 69/78 (88%), Gaps = 2/78 (3%)
 Frame = +2

Query  434  AVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLHPVQSKTIVDKFAAVEI  613
            AV+VKL +DDLC+TGKL  VK+T+WDE F+SK+VE+L+KPL+LHPV +K+I+DKFAAV I
Sbjct  70   AVRVKLFVDDLCKTGKLEGVKFTYWDECFTSKNVELLVKPLDLHPVHAKSIMDKFAAVGI  129

Query  614  LQGYLDYVNRNDKMKLSA  667
            LQGYLDYVNR  KMKL +
Sbjct  130  LQGYLDYVNR--KMKLES  145


 Score =   101 bits (252),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 61/69 (88%), Gaps = 4/69 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKS----RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            MKY++PL+LF EL+K+    +GR LGLDVG+KYVGLAVSD  NK+ASPLSVL+RKKSNI+
Sbjct  1    MKYVRPLSLFHELLKTSAINQGRFLGLDVGDKYVGLAVSDPLNKIASPLSVLLRKKSNIE  60

Query  316  LMATDFQSL  342
            LMATDFQSL
Sbjct  61   LMATDFQSL  69



>ref|NP_001266040.1| uncharacterized protein LOC101496715 [Cicer arietinum]
 emb|CAB88667.1| hypothetical 19.6 kDa protein [Cicer arietinum]
Length=171

 Score =   114 bits (285),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 71/92 (77%), Gaps = 1/92 (1%)
 Frame = +2

Query  383  KGFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            KGF+ G PFDR   + DAV+VK+ ID+L  T     +KYT+W+E F+SK+VE+L+KPLNL
Sbjct  76   KGFVIGLPFDRHLVSSDAVKVKVFIDNLRRTNMFDGLKYTYWNECFTSKNVEILIKPLNL  135

Query  563  -HPVQSKTIVDKFAAVEILQGYLDYVNRNDKM  655
             HPV SKT++DKFAAV ILQGYLDYV R  ++
Sbjct  136  NHPVHSKTMLDKFAAVGILQGYLDYVYRKARL  167


 Score = 98.6 bits (244),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 60/70 (86%), Gaps = 4/70 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKS----RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            M+ MKPL LF +LVK+    RGRL+GLDVG+KYVGLA+SD +NK+ASP SVL+RKK+NI+
Sbjct  1    MRQMKPLQLFHDLVKTTQKERGRLIGLDVGDKYVGLALSDFDNKIASPFSVLVRKKTNIN  60

Query  316  LMATDFQSLV  345
            LMA DF+SLV
Sbjct  61   LMAADFKSLV  70



>ref|XP_006419659.1| hypothetical protein CICLE_v10006013mg [Citrus clementina]
 gb|ESR32899.1| hypothetical protein CICLE_v10006013mg [Citrus clementina]
Length=181

 Score =   116 bits (290),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +2

Query  383  KGFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            +GFI GYPF+RQ+N  DAVQVKL IDDL  T KL D+KY +W+E F+SK VE+LL PL+L
Sbjct  80   EGFIVGYPFNRQQNAADAVQVKLFIDDLSATKKLEDMKYAYWNEGFTSKGVELLLNPLDL  139

Query  563  HPVQSKTIVDKFAAVEILQ  619
            HPV+ KTI+DKFAAV ILQ
Sbjct  140  HPVEHKTILDKFAAVGILQ  158


 Score = 96.7 bits (239),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 61/71 (86%), Gaps = 4/71 (6%)
 Frame = +1

Query  145  EMKYMKPLNLFQELVK----SRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNI  312
            +MKY+KPL LF++++K     RGR LGLDVG+KYVGL++SD +NK+ASPLSVL+RKK+ I
Sbjct  4    QMKYVKPLRLFEQMLKRKVSKRGRFLGLDVGDKYVGLSISDPKNKIASPLSVLLRKKNTI  63

Query  313  DLMATDFQSLV  345
            DLMA DF+SL+
Sbjct  64   DLMAEDFRSLI  74



>ref|XP_007040213.1| Polynucleotidyl transferase isoform 7 [Theobroma cacao]
 ref|XP_007040215.1| Polynucleotidyl transferase isoform 7 [Theobroma cacao]
 gb|EOY24714.1| Polynucleotidyl transferase isoform 7 [Theobroma cacao]
 gb|EOY24716.1| Polynucleotidyl transferase isoform 7 [Theobroma cacao]
Length=147

 Score =   108 bits (269),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  434  AVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLHPVQSKTIVDKFAAVEI  613
            AVQVKL IDDL +TGKL  VKYTFW+E F+SK+ ++LLKPL+LHP+ SKTIVDKFAAV+I
Sbjct  70   AVQVKLFIDDLSKTGKLDGVKYTFWNECFTSKNADLLLKPLSLHPILSKTIVDKFAAVQI  129

Query  614  LQGYLDYVNRNDKMKLSA  667
            LQ YLDY  +N K++ + 
Sbjct  130  LQTYLDYGKKNVKLETAG  147


 Score =   104 bits (259),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 63/69 (91%), Gaps = 4/69 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKS----RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            M+Y+K LN FQ+L+K+    RGRLLGLDVG+KYVGLAVSD++NK+A+PLSVLIRKK+NID
Sbjct  1    MQYVKCLNFFQDLLKAKALERGRLLGLDVGDKYVGLAVSDLDNKIATPLSVLIRKKTNID  60

Query  316  LMATDFQSL  342
            LMA+DFQSL
Sbjct  61   LMASDFQSL  69



>emb|CDY66284.1| BnaCnng50230D [Brassica napus]
Length=538

 Score =   114 bits (284),  Expect(2) = 9e-46, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            G + GYPF +  N  D V V L I++L +T KL DVKYT+WDE  SSK+VE++LKPL LH
Sbjct  445  GLVVGYPFGKLNNVEDVVTVNLFIEELRKTEKLKDVKYTYWDERLSSKTVELMLKPLKLH  504

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNR  643
            PVQ KT++DKFAAV ILQ YLDY NR
Sbjct  505  PVQEKTMLDKFAAVVILQEYLDYANR  530


 Score = 98.6 bits (244),  Expect(2) = 9e-46, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 60/72 (83%), Gaps = 4/72 (6%)
 Frame = +1

Query  145  EMKYMKPLNLFQELVKSR----GRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNI  312
            EMKY+KPL L  + +K++    GR LGLDVG+KYVGLAVSD  N +ASPLSVL+RKK+NI
Sbjct  368  EMKYVKPLRLLGDALKTKVSVPGRFLGLDVGDKYVGLAVSDPSNMIASPLSVLLRKKTNI  427

Query  313  DLMATDFQSLVR  348
            DLMATDFQ+LV+
Sbjct  428  DLMATDFQNLVK  439



>emb|CAB86895.1| putative protein [Arabidopsis thaliana]
Length=548

 Score =   113 bits (283),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            G + GYPF +  N  D V V L I++L +T KL DVKYT+WDE  SSK+VE++LKPLNLH
Sbjct  455  GLVVGYPFGKLNNVEDVVTVNLFIEELRKTEKLKDVKYTYWDERLSSKTVELMLKPLNLH  514

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNR  643
            PVQ KT++DK AAV ILQ YLDY NR
Sbjct  515  PVQEKTMLDKLAAVVILQEYLDYANR  540


 Score = 98.2 bits (243),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 60/72 (83%), Gaps = 4/72 (6%)
 Frame = +1

Query  145  EMKYMKPLNLFQELVKSR----GRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNI  312
            EMKY+KPL+L    +K++    GR LGLDVG+KYVGLA+SD  N +ASPLSVL+RKKSNI
Sbjct  378  EMKYVKPLSLLGNALKTKVSVPGRFLGLDVGDKYVGLAISDPSNMVASPLSVLLRKKSNI  437

Query  313  DLMATDFQSLVR  348
            DLMATDFQ+LV+
Sbjct  438  DLMATDFQNLVK  449



>ref|XP_002877892.1| hypothetical protein ARALYDRAFT_323835 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54151.1| hypothetical protein ARALYDRAFT_323835 [Arabidopsis lyrata subsp. 
lyrata]
Length=542

 Score =   114 bits (284),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            G + GYPF +  N  D V V L I++L +T KL DVKYT+WDE  SSK+VE++LKPLNLH
Sbjct  449  GLVVGYPFGKLNNVEDVVTVNLFIEELRKTEKLKDVKYTYWDERLSSKTVELMLKPLNLH  508

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNR  643
            PVQ KT++DK AAV ILQ YLDY NR
Sbjct  509  PVQEKTMLDKLAAVVILQEYLDYANR  534


 Score = 97.1 bits (240),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 60/72 (83%), Gaps = 4/72 (6%)
 Frame = +1

Query  145  EMKYMKPLNLFQELVKSR----GRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNI  312
            EMKY+KPL+L    +K++    GR LGLDVG+KYVGLA+SD  N +ASPLSVL+RKK+NI
Sbjct  372  EMKYVKPLSLLGNALKTKVSVPGRFLGLDVGDKYVGLAISDPSNMVASPLSVLLRKKTNI  431

Query  313  DLMATDFQSLVR  348
            DLMATDFQ+LV+
Sbjct  432  DLMATDFQNLVK  443



>ref|XP_011029265.1| PREDICTED: uncharacterized protein LOC105129048 isoform X3 [Populus 
euphratica]
Length=153

 Score =   108 bits (271),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 69/84 (82%), Gaps = 8/84 (10%)
 Frame = +2

Query  434  AVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLHPVQSKTIVDKFAAVEI  613
            AV+VKL +DDLC+TGKL  VK+T+WDE F+SK+VE+L+KPL+LHPV +K+I+DKFAAV I
Sbjct  70   AVRVKLFVDDLCKTGKLEGVKFTYWDECFTSKNVELLVKPLDLHPVHAKSIMDKFAAVGI  129

Query  614  L------QGYLDYVNRNDKMKLSA  667
            L      QGYLDYVNR  KMKL +
Sbjct  130  LQLVYLWQGYLDYVNR--KMKLES  151


 Score =   101 bits (252),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 61/69 (88%), Gaps = 4/69 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKS----RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            MKY++PL+LF EL+K+    +GR LGLDVG+KYVGLAVSD  NK+ASPLSVL+RKKSNI+
Sbjct  1    MKYVRPLSLFHELLKTSAINQGRFLGLDVGDKYVGLAVSDPLNKIASPLSVLLRKKSNIE  60

Query  316  LMATDFQSL  342
            LMATDFQSL
Sbjct  61   LMATDFQSL  69



>ref|NP_001078274.1| polynucleotidyl transferase/ ribonuclease H-like protein [Arabidopsis 
thaliana]
 dbj|BAC42098.1| unknown protein [Arabidopsis thaliana]
 gb|AEE79008.1| polynucleotidyl transferase/ ribonuclease H-like protein [Arabidopsis 
thaliana]
Length=170

 Score =   115 bits (287),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            G + GYPF +  N  D V V L I++L +T KL DVKYT+WDE  SSK+VE++LKPLNLH
Sbjct  77   GLVVGYPFGKLNNVEDVVTVNLFIEELRKTEKLKDVKYTYWDERLSSKTVELMLKPLNLH  136

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNR  643
            PVQ KT++DK AAV ILQ YLDY NR
Sbjct  137  PVQEKTMLDKLAAVVILQEYLDYANR  162


 Score = 94.7 bits (234),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 59/71 (83%), Gaps = 4/71 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKSR----GRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            MKY+KPL+L    +K++    GR LGLDVG+KYVGLA+SD  N +ASPLSVL+RKKSNID
Sbjct  1    MKYVKPLSLLGNALKTKVSVPGRFLGLDVGDKYVGLAISDPSNMVASPLSVLLRKKSNID  60

Query  316  LMATDFQSLVR  348
            LMATDFQ+LV+
Sbjct  61   LMATDFQNLVK  71



>ref|XP_006853175.1| hypothetical protein AMTR_s00038p00196460 [Amborella trichopoda]
 gb|ERN14642.1| hypothetical protein AMTR_s00038p00196460 [Amborella trichopoda]
Length=174

 Score =   119 bits (297),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 70/90 (78%), Gaps = 1/90 (1%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            G + GYP   Q   NP AVQVK+ +++L  TG+L  + YT+WDE F+SKSVE LLKPL++
Sbjct  77   GLVVGYPLALQGTANPQAVQVKVFVEELHRTGQLDGLSYTYWDERFTSKSVEALLKPLDM  136

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVNRNDK  652
            HPVQ KTIVDKFAAV ILQGYLD+V+RN K
Sbjct  137  HPVQFKTIVDKFAAVGILQGYLDHVHRNMK  166


 Score = 90.9 bits (224),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 59/71 (83%), Gaps = 4/71 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKS----RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            M++ KP++LFQ+L++S      RLLGLDVGN+YVGLA+SD +NK+ASPLSVL+RKKSNI 
Sbjct  1    MRFAKPIDLFQKLLESNKIAEQRLLGLDVGNRYVGLAISDPDNKIASPLSVLVRKKSNIV  60

Query  316  LMATDFQSLVR  348
             MA D Q+LV+
Sbjct  61   QMAMDIQTLVK  71



>ref|XP_003611095.1| Hypothetical protein MTR_5g010310 [Medicago truncatula]
Length=176

 Score =   111 bits (278),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 70/93 (75%), Gaps = 1/93 (1%)
 Frame = +2

Query  383  KGFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            KG + G PF+    +PDAVQVK+LID+L  T  L  +KYT+W+E F+SK+VE+ LKPLN 
Sbjct  81   KGLVIGVPFEYNLVSPDAVQVKVLIDNLRRTNMLEGLKYTYWNECFTSKNVELFLKPLNF  140

Query  563  -HPVQSKTIVDKFAAVEILQGYLDYVNRNDKMK  658
             + VQSKT++DKFAAV ILQGY+DY NR  K +
Sbjct  141  KNAVQSKTMLDKFAAVGILQGYMDYANRKAKQR  173


 Score = 98.6 bits (244),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 59/71 (83%), Gaps = 4/71 (6%)
 Frame = +1

Query  145  EMKYMKPLNLFQELVKS----RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNI  312
            EM+ MKPL LF +LVK+    RGRL+GLDVG+KYVGLA+SD +NK+ASP SVL+RKKSN 
Sbjct  5    EMRQMKPLELFHDLVKTTKNERGRLMGLDVGDKYVGLALSDFDNKVASPFSVLVRKKSNA  64

Query  313  DLMATDFQSLV  345
             LMA DF+SL+
Sbjct  65   SLMAADFKSLI  75



>ref|XP_010515768.1| PREDICTED: uncharacterized protein LOC104791549 [Camelina sativa]
Length=170

 Score =   115 bits (288),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            G I GYPF +  N  D V V L I++L +T KL DVKYT+WDE  SSK+VE+LLKPLNLH
Sbjct  77   GLIVGYPFGKLNNVEDVVTVNLFIEELRKTEKLKDVKYTYWDERLSSKTVELLLKPLNLH  136

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNR  643
            PVQ KT+ DK AAV ILQ YLDY NR
Sbjct  137  PVQEKTMSDKLAAVVILQEYLDYANR  162


 Score = 94.0 bits (232),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 59/71 (83%), Gaps = 4/71 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKSR----GRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            MKY+KPL+L    +K++    GR LGLDVG+KYVGLA+SD  N +ASPLSVL+RKK+NID
Sbjct  1    MKYVKPLSLLGNALKTKVSVPGRFLGLDVGDKYVGLAISDPSNMVASPLSVLLRKKTNID  60

Query  316  LMATDFQSLVR  348
            LMATDFQ+LV+
Sbjct  61   LMATDFQNLVK  71



>ref|XP_008780929.1| PREDICTED: uncharacterized protein LOC103700828 [Phoenix dactylifera]
Length=174

 Score =   114 bits (284),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 74/90 (82%), Gaps = 1/90 (1%)
 Frame = +2

Query  386  GFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ GYPF  Q +++ +AVQVKL +++L +TG+L  + YT+W+E+++SK VE LL PLNL
Sbjct  78   GFVVGYPFSLQGQSSVEAVQVKLFMEELRKTGRLDGLCYTYWNENYTSKCVEALLDPLNL  137

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVNRNDK  652
            HPV+SKTI+DKFAAV ILQGYLD +NRN K
Sbjct  138  HPVESKTIMDKFAAVGILQGYLDDMNRNLK  167


 Score = 95.5 bits (236),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 63/79 (80%), Gaps = 5/79 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKS----RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            MK +KP+ LFQ+ +KS    +GRLLGLDVG KYVGLAVSD  NK+ASPLSVL+RKK+NID
Sbjct  2    MKLVKPIELFQKFLKSGSKEQGRLLGLDVGQKYVGLAVSDTCNKIASPLSVLVRKKTNID  61

Query  316  LMATDFQSLV-RLSFLNYL  369
            LMA D Q LV +LS + ++
Sbjct  62   LMARDLQMLVSQLSLIGFV  80



>ref|XP_008437258.1| PREDICTED: uncharacterized protein LOC103482742 isoform X2 [Cucumis 
melo]
Length=160

 Score =   119 bits (299),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            GFI GYPFDR R N +A+QVK+ IDDLC+TGKL  VKYTFWDE F+SK+VE ++KPLNL 
Sbjct  77   GFIVGYPFDRLRKNTEAIQVKIFIDDLCKTGKLEGVKYTFWDEGFTSKNVEQMIKPLNLL  136

Query  566  PVQSKTIVDKFAAVEILQ  619
            P  SKT++DKFAAV ILQ
Sbjct  137  PAVSKTMLDKFAAVGILQ  154


 Score = 89.7 bits (221),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 57/70 (81%), Gaps = 4/70 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVK----SRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            MKY+KP  LF++L+K       RLLGLDVG+KYVGLAVSD +NK+ASPLSVL+RKK+ +D
Sbjct  1    MKYVKPSILFRDLLKRDELKHSRLLGLDVGDKYVGLAVSDPDNKIASPLSVLLRKKNTMD  60

Query  316  LMATDFQSLV  345
            LMA DFQ L+
Sbjct  61   LMAEDFQKLI  70



>ref|XP_009148748.1| PREDICTED: uncharacterized protein LOC103872151 [Brassica rapa]
 emb|CDX76250.1| BnaA04g05140D [Brassica napus]
Length=170

 Score =   114 bits (284),  Expect(2) = 8e-45, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            G + GYPF +  N  D V V L I++L +T KL DVKYT+WDE  SSK+VE++LKPL LH
Sbjct  77   GLVVGYPFGKLNNVEDVVIVNLFIEELRKTEKLKDVKYTYWDERLSSKTVELMLKPLKLH  136

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNR  643
            PVQ KT++DKFAAV ILQ YLDY NR
Sbjct  137  PVQEKTMLDKFAAVVILQEYLDYANR  162


 Score = 95.1 bits (235),  Expect(2) = 8e-45, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 59/71 (83%), Gaps = 4/71 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKSR----GRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            MKY+KPL L  + +K++    GR LGLDVG+KYVGLAVSD  N +ASPLSVL+RKK+NID
Sbjct  1    MKYVKPLRLLGDALKTKVSVPGRFLGLDVGDKYVGLAVSDPSNMIASPLSVLLRKKTNID  60

Query  316  LMATDFQSLVR  348
            LMATDFQ+LV+
Sbjct  61   LMATDFQNLVK  71



>ref|XP_006572796.1| PREDICTED: uncharacterized protein LOC100305864 isoform X3 [Glycine 
max]
Length=166

 Score =   128 bits (322),  Expect(2) = 8e-45, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 79/96 (82%), Gaps = 3/96 (3%)
 Frame = +2

Query  383  KGFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            KGF+ G PFD+ + + DA+QVK+ ID+LC T  L  VKYT+W+ESF+SK+VE+LLKPLNL
Sbjct  71   KGFVIGIPFDKHQVSSDAMQVKVFIDNLCRTKMLEGVKYTYWNESFTSKNVELLLKPLNL  130

Query  563  -HPVQSKTIVDKFAAVEILQGYLDYVNRNDKMKLSA  667
             HPV SKT++DKFAAV ILQGYLD+VNR  KMKL A
Sbjct  131  NHPVLSKTMLDKFAAVGILQGYLDFVNR--KMKLKA  164


 Score = 80.5 bits (197),  Expect(2) = 8e-45, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 52/69 (75%), Gaps = 7/69 (10%)
 Frame = +1

Query  148  MKYMKPLNLFQEL---VKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNIDL  318
            M+YMKPL LF +L      RGRLLGLDVG+KYVGLA+SD +N +ASP     +KK+NI L
Sbjct  1    MRYMKPLPLFHDLKNTTPQRGRLLGLDVGDKYVGLALSDFDNNIASPF----KKKTNISL  56

Query  319  MATDFQSLV  345
            MA+D +SL+
Sbjct  57   MASDLESLI  65



>ref|XP_006290284.1| hypothetical protein CARUB_v10018129mg [Capsella rubella]
 gb|EOA23182.1| hypothetical protein CARUB_v10018129mg [Capsella rubella]
Length=170

 Score =   114 bits (286),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            G + GYPF +  N  D V V L I++L +T KL DVKYT+WDE  SSK+VE+LLKPLNLH
Sbjct  77   GLVVGYPFGKLNNVEDVVTVNLFIEELRKTEKLKDVKYTYWDERLSSKTVELLLKPLNLH  136

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNR  643
            PVQ KT+ DK AAV ILQ YLDY NR
Sbjct  137  PVQEKTMSDKLAAVVILQEYLDYANR  162


 Score = 93.6 bits (231),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 59/71 (83%), Gaps = 4/71 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKSR----GRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            MKY+KPL+L    +KS+    GR LGLDVG+KYVGLA+SD  N +ASPLSVL+RKK+NID
Sbjct  1    MKYVKPLSLLGNALKSKLSVPGRFLGLDVGDKYVGLAISDPLNMVASPLSVLLRKKTNID  60

Query  316  LMATDFQSLVR  348
            LMATDFQ+LV+
Sbjct  61   LMATDFQNLVK  71



>ref|XP_010504038.1| PREDICTED: uncharacterized protein LOC104781142 [Camelina sativa]
Length=170

 Score =   113 bits (283),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            G + GYPF +  N  D V V L I++L +T KL +VKYT+WDE  SSK+VE+LLKPLNLH
Sbjct  77   GLVVGYPFGKLNNVEDVVTVNLFIEELRKTEKLKEVKYTYWDERLSSKTVELLLKPLNLH  136

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNR  643
            PVQ KT+ DK AAV ILQ YLDY NR
Sbjct  137  PVQEKTMSDKLAAVVILQEYLDYANR  162


 Score = 94.4 bits (233),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 59/71 (83%), Gaps = 4/71 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKSR----GRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            MKY+KPL+L    +K++    GR LGLDVG+KYVGLA+SD  N +ASPLSVL+RKK+NID
Sbjct  1    MKYVKPLSLLGNALKTKVSVPGRFLGLDVGDKYVGLAISDPSNMVASPLSVLLRKKTNID  60

Query  316  LMATDFQSLVR  348
            LMATDFQ+LV+
Sbjct  61   LMATDFQNLVK  71



>ref|XP_006403755.1| hypothetical protein EUTSA_v10010768mg [Eutrema salsugineum]
 ref|XP_006403756.1| hypothetical protein EUTSA_v10010768mg [Eutrema salsugineum]
 gb|ESQ45208.1| hypothetical protein EUTSA_v10010768mg [Eutrema salsugineum]
 gb|ESQ45209.1| hypothetical protein EUTSA_v10010768mg [Eutrema salsugineum]
Length=170

 Score =   114 bits (284),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            G + GYPF +  N  D V V L I++L +T KL DVKYT+WDE  SSK+VE++LKPL LH
Sbjct  77   GLVVGYPFGKLNNVEDVVTVNLFIEELRKTEKLKDVKYTYWDERLSSKTVELMLKPLKLH  136

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNR  643
            PVQ KT+ DKFAAV ILQ YLDY NR
Sbjct  137  PVQEKTMSDKFAAVVILQEYLDYANR  162


 Score = 94.0 bits (232),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 59/71 (83%), Gaps = 4/71 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKSR----GRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            MKY+KPL L  + +K++    GR LGLDVG+KYVGLA+SD  N +A+PLSVL+RKK+NID
Sbjct  1    MKYVKPLRLLGDALKTKVSVPGRFLGLDVGDKYVGLAISDPSNMIATPLSVLLRKKTNID  60

Query  316  LMATDFQSLVR  348
            LMATDFQ+LV+
Sbjct  61   LMATDFQNLVK  71



>gb|AFK47509.1| unknown [Medicago truncatula]
Length=171

 Score =   111 bits (277),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 70/93 (75%), Gaps = 1/93 (1%)
 Frame = +2

Query  383  KGFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            KG + G PF+    +PDAVQVK+LID+L  T  L  +KYT+W+E F+SK+VE+ LKPLN 
Sbjct  76   KGLVIGVPFEYNLVSPDAVQVKVLIDNLRRTNMLEGLKYTYWNECFTSKNVELFLKPLNF  135

Query  563  -HPVQSKTIVDKFAAVEILQGYLDYVNRNDKMK  658
             + VQSKT++DKFAAV ILQGY+DY NR  K +
Sbjct  136  KNAVQSKTMLDKFAAVGILQGYMDYANRKAKQR  168


 Score = 96.3 bits (238),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 58/70 (83%), Gaps = 4/70 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKS----RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            M+ MKPL LF +LVK+    RGRL+GLDVG+KYVGLA+SD +NK+ASP SVL+RKKSN  
Sbjct  1    MRQMKPLELFHDLVKTTKNERGRLMGLDVGDKYVGLALSDFDNKVASPFSVLVRKKSNAS  60

Query  316  LMATDFQSLV  345
            LMA DF+SL+
Sbjct  61   LMAADFKSLI  70



>ref|XP_010906662.1| PREDICTED: uncharacterized protein LOC105033507 isoform X5 [Elaeis 
guineensis]
Length=240

 Score =   109 bits (273),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 72/90 (80%), Gaps = 1/90 (1%)
 Frame = +2

Query  386  GFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ GYPF  Q +++ +AVQVKL ++DL +TG+L    +T+W+E+++SK V+ LL PL L
Sbjct  144  GFVVGYPFSLQGQSSIEAVQVKLFVEDLRKTGRLDGSYFTYWNENYTSKCVQALLDPLKL  203

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVNRNDK  652
            HPV+SKTI+DKFAAV ILQGYLD +NRN K
Sbjct  204  HPVESKTIIDKFAAVGILQGYLDDMNRNLK  233


 Score = 97.4 bits (241),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 66/82 (80%), Gaps = 5/82 (6%)
 Frame = +1

Query  139  FFEMKYMKPLNLFQELVKS----RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKS  306
            F +MK +KP+ LFQ+ +KS    +GRLLGLDVG KYVGLAVSD  NK+ASPLSVL+RKK+
Sbjct  65   FAQMKLVKPIELFQKFLKSGSMEKGRLLGLDVGQKYVGLAVSDTCNKIASPLSVLVRKKT  124

Query  307  NIDLMATDFQSLV-RLSFLNYL  369
            NIDL+A D Q+LV +LS + ++
Sbjct  125  NIDLVARDLQTLVSQLSLVGFV  146



>emb|CDX67544.1| BnaA07g15840D [Brassica napus]
Length=171

 Score =   113 bits (283),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            G + GYPF +  N  D V V L I++L +T KL D+KYT+WDE  SSK+VE++LKPL LH
Sbjct  78   GLVVGYPFGKLNNVEDVVTVNLFIEELRKTEKLRDLKYTYWDERLSSKTVELMLKPLKLH  137

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNR  643
            PVQ KT++DKFAAV ILQ YLDY NR
Sbjct  138  PVQEKTMLDKFAAVVILQEYLDYANR  163


 Score = 93.2 bits (230),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 58/72 (81%), Gaps = 5/72 (7%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKSR-----GRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNI  312
            MKY+KPL L  + +K+      GR LGLDVG+KYVGLA+SD  N +ASPLSVL+RKK+NI
Sbjct  1    MKYVKPLRLLGDALKTTKVSVPGRFLGLDVGDKYVGLAISDPSNMIASPLSVLLRKKTNI  60

Query  313  DLMATDFQSLVR  348
            DLMATDFQ+LV+
Sbjct  61   DLMATDFQNLVK  72



>ref|XP_010426920.1| PREDICTED: uncharacterized protein LOC104711849 [Camelina sativa]
Length=170

 Score =   111 bits (277),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            G + GYPF +  N  D V V L I++L +T KL DVKYT+WDE  SSK+VE+LLKPLNLH
Sbjct  77   GLVVGYPFGKLNNVEDVVTVNLFIEELRKTEKLKDVKYTYWDERLSSKTVELLLKPLNLH  136

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNR  643
            PVQ KT+ DK AAV ILQ YLD  NR
Sbjct  137  PVQEKTMSDKLAAVVILQEYLDCANR  162


 Score = 94.7 bits (234),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 59/71 (83%), Gaps = 4/71 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKSR----GRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            MKY+KPL+L    +K++    GR LGLDVG+KYVGLA+SD  N +ASPLSVL+RKK+NID
Sbjct  1    MKYVKPLSLLGNALKTKVSVPGRFLGLDVGDKYVGLAISDPSNMIASPLSVLLRKKTNID  60

Query  316  LMATDFQSLVR  348
            LMATDFQ+LV+
Sbjct  61   LMATDFQNLVK  71



>ref|XP_010906660.1| PREDICTED: uncharacterized protein LOC105033507 isoform X4 [Elaeis 
guineensis]
 ref|XP_010906661.1| PREDICTED: uncharacterized protein LOC105033507 isoform X4 [Elaeis 
guineensis]
Length=173

 Score =   110 bits (275),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 72/90 (80%), Gaps = 1/90 (1%)
 Frame = +2

Query  386  GFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ GYPF  Q +++ +AVQVKL ++DL +TG+L    +T+W+E+++SK V+ LL PL L
Sbjct  77   GFVVGYPFSLQGQSSIEAVQVKLFVEDLRKTGRLDGSYFTYWNENYTSKCVQALLDPLKL  136

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVNRNDK  652
            HPV+SKTI+DKFAAV ILQGYLD +NRN K
Sbjct  137  HPVESKTIIDKFAAVGILQGYLDDMNRNLK  166


 Score = 95.1 bits (235),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 64/79 (81%), Gaps = 5/79 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKS----RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            MK +KP+ LFQ+ +KS    +GRLLGLDVG KYVGLAVSD  NK+ASPLSVL+RKK+NID
Sbjct  1    MKLVKPIELFQKFLKSGSMEKGRLLGLDVGQKYVGLAVSDTCNKIASPLSVLVRKKTNID  60

Query  316  LMATDFQSLV-RLSFLNYL  369
            L+A D Q+LV +LS + ++
Sbjct  61   LVARDLQTLVSQLSLVGFV  79



>ref|XP_009125237.1| PREDICTED: uncharacterized protein LOC103850267 [Brassica rapa]
Length=171

 Score =   113 bits (283),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            G + GYPF +  N  D V V L I++L +T KL D+KYT+WDE  SSK+VE++LKPL LH
Sbjct  78   GLVVGYPFGKLNNVEDVVTVNLFIEELRKTEKLRDLKYTYWDERLSSKTVELMLKPLKLH  137

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNR  643
            PVQ KT++DKFAAV ILQ YLDY NR
Sbjct  138  PVQEKTMLDKFAAVVILQEYLDYANR  163


 Score = 90.5 bits (223),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 58/72 (81%), Gaps = 5/72 (7%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKSR-----GRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNI  312
            MKY+KPL L  + +K+      GR LGLDVG+KYVG+++SD  N +ASPLSVL+RKK+NI
Sbjct  1    MKYVKPLRLLGDALKTTKVSVPGRFLGLDVGDKYVGVSISDPSNMIASPLSVLLRKKTNI  60

Query  313  DLMATDFQSLVR  348
            DLMATDFQ+LV+
Sbjct  61   DLMATDFQNLVK  72



>ref|XP_007040212.1| Polynucleotidyl transferase isoform 6 [Theobroma cacao]
 ref|XP_007040214.1| Polynucleotidyl transferase isoform 6 [Theobroma cacao]
 gb|EOY24713.1| Polynucleotidyl transferase isoform 6 [Theobroma cacao]
 gb|EOY24715.1| Polynucleotidyl transferase isoform 6 [Theobroma cacao]
Length=163

 Score =   105 bits (261),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 63/70 (90%), Gaps = 4/70 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKS----RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            M+Y+K LN FQ+L+K+    RGRLLGLDVG+KYVGLAVSD++NK+A+PLSVLIRKK+NID
Sbjct  1    MQYVKCLNFFQDLLKAKALERGRLLGLDVGDKYVGLAVSDLDNKIATPLSVLIRKKTNID  60

Query  316  LMATDFQSLV  345
            LMA+DFQSL 
Sbjct  61   LMASDFQSLA  70


 Score = 97.8 bits (242),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 65/94 (69%), Gaps = 16/94 (17%)
 Frame = +2

Query  434  AVQVKLLIDDLCETGKLVDVKYTFWDESFSSK----------------SVEMLLKPLNLH  565
            AVQVKL IDDL +TGKL  VKYTFW+E F+SK                + ++LLKPL+LH
Sbjct  70   AVQVKLFIDDLSKTGKLDGVKYTFWNECFTSKQYMTSSKESHSLSFQQNADLLLKPLSLH  129

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNRNDKMKLSA  667
            P+ SKTIVDKFAAV+ILQ YLDY  +N K++ + 
Sbjct  130  PILSKTIVDKFAAVQILQTYLDYGKKNVKLETAG  163



>emb|CDY13334.1| BnaC06g14230D [Brassica napus]
Length=262

 Score =   112 bits (280),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            G + GYPF +  N  D V V L I++L +T KL D KYT+WDE  SSK+VE++LKPL LH
Sbjct  169  GLVVGYPFGKLNNVEDVVTVNLFIEELRKTEKLKDAKYTYWDERLSSKTVELMLKPLKLH  228

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNR  643
            PVQ KT++DKFAAV ILQ YLDY NR
Sbjct  229  PVQEKTMLDKFAAVVILQEYLDYANR  254


 Score = 89.7 bits (221),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 55/74 (74%), Gaps = 7/74 (9%)
 Frame = +1

Query  148  MKYMKPLNLF-------QELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKS  306
            MKY+KPL L           V   GR LGLDVG+KYVGLAVSD  N +ASPLSVL+RKK+
Sbjct  90   MKYVKPLKLLILGDALKTTKVSVPGRFLGLDVGDKYVGLAVSDPSNMIASPLSVLLRKKT  149

Query  307  NIDLMATDFQSLVR  348
            NIDLMATDFQ+LV+
Sbjct  150  NIDLMATDFQNLVK  163



>ref|XP_006403754.1| hypothetical protein EUTSA_v10010768mg [Eutrema salsugineum]
 gb|ESQ45207.1| hypothetical protein EUTSA_v10010768mg [Eutrema salsugineum]
Length=167

 Score =   107 bits (268),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 63/86 (73%), Gaps = 3/86 (3%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            G + GYPF +  N    V V L I++L +T KL DVKYT+WDE  SSK+VE++LKPL LH
Sbjct  77   GLVVGYPFGKLNN---VVTVNLFIEELRKTEKLKDVKYTYWDERLSSKTVELMLKPLKLH  133

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNR  643
            PVQ KT+ DKFAAV ILQ YLDY NR
Sbjct  134  PVQEKTMSDKFAAVVILQEYLDYANR  159


 Score = 94.0 bits (232),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 59/71 (83%), Gaps = 4/71 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKSR----GRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            MKY+KPL L  + +K++    GR LGLDVG+KYVGLA+SD  N +A+PLSVL+RKK+NID
Sbjct  1    MKYVKPLRLLGDALKTKVSVPGRFLGLDVGDKYVGLAISDPSNMIATPLSVLLRKKTNID  60

Query  316  LMATDFQSLVR  348
            LMATDFQ+LV+
Sbjct  61   LMATDFQNLVK  71



>ref|XP_004298790.1| PREDICTED: putative Holliday junction resolvase-like [Fragaria 
vesca subsp. vesca]
Length=181

 Score =   124 bits (310),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            GFI G P D  R NP   QVK LIDDLC+T KL  +KYT+WDE ++S+++E+LLKPLN+H
Sbjct  78   GFIVGCPLDTLRKNPGVFQVKRLIDDLCKTEKLEGMKYTYWDECYTSQNIELLLKPLNIH  137

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNR  643
            P  +KTI DKF+AV ILQGYLDYVNR
Sbjct  138  PGHAKTIADKFSAVGILQGYLDYVNR  163


 Score = 76.6 bits (187),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 55/71 (77%), Gaps = 5/71 (7%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKSRG-----RLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNI  312
            MKY++P NLF +L K++      RLLGLDVG+KYVGLAVSD  NK+A PLSVL+RKKS +
Sbjct  1    MKYVRPWNLFLDLQKAKAAGGGGRLLGLDVGDKYVGLAVSDCHNKIALPLSVLLRKKSTL  60

Query  313  DLMATDFQSLV  345
             LMA DFQ+L 
Sbjct  61   GLMAEDFQNLA  71



>ref|XP_010527753.1| PREDICTED: uncharacterized protein LOC104805035 isoform X2 [Tarenaya 
hassleriana]
Length=170

 Score =   113 bits (282),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 67/87 (77%), Gaps = 0/87 (0%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            G + GYP DR  N  D V +   I++L +TGKL DVKY++WDE  SSK+VEMLL+PLN+H
Sbjct  77   GLVVGYPLDRLGNIDDGVGMDTFIEELHKTGKLEDVKYSYWDERLSSKAVEMLLEPLNIH  136

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNRN  646
             V+ KT++DK AAV ILQGYLD+VN+N
Sbjct  137  QVKKKTMLDKCAAVGILQGYLDFVNKN  163


 Score = 87.0 bits (214),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 56/70 (80%), Gaps = 4/70 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKSRG----RLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            MKY+KPL+L   + K++     RLLGLDVG+KYVGLA+SD  NK A PLSVL+R K+NID
Sbjct  1    MKYVKPLSLAVGISKTKTSVQRRLLGLDVGDKYVGLAISDASNKKALPLSVLLRTKTNID  60

Query  316  LMATDFQSLV  345
            LMATDFQ+L+
Sbjct  61   LMATDFQNLI  70



>ref|XP_004249037.1| PREDICTED: uncharacterized protein LOC101262873 isoform X2 [Solanum 
lycopersicum]
Length=142

 Score =   101 bits (252),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +2

Query  434  AVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLHPVQSKTIVDKFAAVEI  613
            AV VKL IDDLC TG+L  V YTF DE F+SK+VE LL+ L LHP QSKT+ DKFAAV I
Sbjct  70   AVHVKLFIDDLCRTGELRGVNYTFRDECFTSKNVEFLLQDLKLHPTQSKTMSDKFAAVGI  129

Query  614  LQGYLDYVNR  643
            LQG+LD+VNR
Sbjct  130  LQGFLDFVNR  139


 Score = 95.1 bits (235),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 56/70 (80%), Gaps = 4/70 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKSRG----RLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            M+Y+KP NLF EL+KS      R+LGLDVG+KYVGLAVSD  NK+ASPL+VL+RKK+NID
Sbjct  1    MRYLKPSNLFHELLKSNALASSRILGLDVGDKYVGLAVSDTTNKVASPLAVLLRKKTNID  60

Query  316  LMATDFQSLV  345
            LMA D Q L 
Sbjct  61   LMAKDLQGLA  70



>ref|XP_009382994.1| PREDICTED: uncharacterized protein LOC103970796 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382995.1| PREDICTED: uncharacterized protein LOC103970796 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382996.1| PREDICTED: uncharacterized protein LOC103970796 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=173

 Score =   106 bits (265),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 73/96 (76%), Gaps = 1/96 (1%)
 Frame = +2

Query  386  GFIFGYPFDR-QRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ GYPF    +++ +AVQV+L ++DL  TG+L  + YT+WDE+++SK VE LL+PL+L
Sbjct  77   GFVVGYPFCLWGQSSVEAVQVRLFMEDLRNTGRLNGLTYTYWDENYTSKCVEALLEPLDL  136

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVNRNDKMKLSAR  670
            +PV+SKTI DKFAAV ILQGYLD +NR  K    AR
Sbjct  137  NPVKSKTIKDKFAAVGILQGYLDNMNRKLKSGNLAR  172


 Score = 89.0 bits (219),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 56/70 (80%), Gaps = 4/70 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKS----RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            MK ++P+ LFQ+L  S    +GRLLGLDVG +YVGLAVSDV N++ASP SVL+RKK+NID
Sbjct  1    MKVIEPVELFQKLCSSGAVQKGRLLGLDVGQRYVGLAVSDVANRIASPGSVLVRKKTNID  60

Query  316  LMATDFQSLV  345
            +MA  FQ L+
Sbjct  61   IMAKVFQKLI  70



>ref|XP_010527743.1| PREDICTED: uncharacterized protein LOC104805035 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010527748.1| PREDICTED: uncharacterized protein LOC104805035 isoform X1 [Tarenaya 
hassleriana]
Length=176

 Score =   106 bits (265),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 67/93 (72%), Gaps = 6/93 (6%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPD------AVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLL  547
            G + GYP DR  N  D       V +   I++L +TGKL DVKY++WDE  SSK+VEMLL
Sbjct  77   GLVVGYPLDRLGNIDDVGIIDDGVGMDTFIEELHKTGKLEDVKYSYWDERLSSKAVEMLL  136

Query  548  KPLNLHPVQSKTIVDKFAAVEILQGYLDYVNRN  646
            +PLN+H V+ KT++DK AAV ILQGYLD+VN+N
Sbjct  137  EPLNIHQVKKKTMLDKCAAVGILQGYLDFVNKN  169


 Score = 86.7 bits (213),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 56/70 (80%), Gaps = 4/70 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKSRG----RLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            MKY+KPL+L   + K++     RLLGLDVG+KYVGLA+SD  NK A PLSVL+R K+NID
Sbjct  1    MKYVKPLSLAVGISKTKTSVQRRLLGLDVGDKYVGLAISDASNKKALPLSVLLRTKTNID  60

Query  316  LMATDFQSLV  345
            LMATDFQ+L+
Sbjct  61   LMATDFQNLI  70



>ref|XP_003569889.1| PREDICTED: uncharacterized protein LOC100833580 [Brachypodium 
distachyon]
Length=175

 Score =   117 bits (292),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 71/88 (81%), Gaps = 2/88 (2%)
 Frame = +2

Query  386  GFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            G + GYPF+ Q + +PDA+QV LL+ +LC+TGKL D+ YT+WDE+F+SK VE LL PL L
Sbjct  78   GLVVGYPFNLQGQCSPDAIQVSLLVGELCKTGKLDDLSYTYWDENFTSKCVEALLNPLKL  137

Query  563  H-PVQSKTIVDKFAAVEILQGYLDYVNR  643
            H PV++KT+ DKFAAV ILQGYLD +NR
Sbjct  138  HDPVETKTMTDKFAAVCILQGYLDNMNR  165


 Score = 75.9 bits (185),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 56/72 (78%), Gaps = 5/72 (7%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKS-----RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNI  312
            M+ +K   LF+++++S     + RLLGLDVG+KYVGLAVSD +N++A PLSVL R K+NI
Sbjct  1    MRLIKAEELFRKVLESGAKKQKNRLLGLDVGSKYVGLAVSDHQNRIALPLSVLGRTKTNI  60

Query  313  DLMATDFQSLVR  348
             LMA DF++LV+
Sbjct  61   TLMADDFKTLVK  72



>dbj|BAJ97823.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=187

 Score =   114 bits (284),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 79/108 (73%), Gaps = 8/108 (7%)
 Frame = +2

Query  386  GFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            G + GYPF+ Q +++PDA QV LL+ +LC+TGKL D+ YT+WDE+F+SK VE LL PLNL
Sbjct  77   GLVVGYPFNLQGQSSPDASQVSLLVGELCKTGKLDDLSYTYWDENFTSKCVEALLNPLNL  136

Query  563  HP-VQSKTIVDKFAAVEILQGYLDYVNR------NDKMKLSARSEEPA  685
            +  V++KT+ DKFAAV ILQGYLD +NR      N K  LS+ S + A
Sbjct  137  NDRVETKTMTDKFAAVCILQGYLDNMNRALTSADNVKSNLSSASGQWA  184


 Score = 77.8 bits (190),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 62/91 (68%), Gaps = 11/91 (12%)
 Frame = +1

Query  148  MKYMKPLNLFQELV----KSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            M+ +K   LF++L+    K + RLLGLDVG+KYVGLAVSD +N++A PLSVL R K+NI+
Sbjct  1    MRLLKAEELFRKLLEGGSKKKARLLGLDVGSKYVGLAVSDQQNRIALPLSVLGRTKTNIN  60

Query  316  LMATDFQSLVRLSFLNYL*AFLEGIHFWLPF  408
            LMA DF++LV     NY    L G+    PF
Sbjct  61   LMADDFKTLVN----NY---SLAGLVVGYPF  84



>ref|XP_010906659.1| PREDICTED: uncharacterized protein LOC105033507 isoform X3 [Elaeis 
guineensis]
Length=216

 Score = 96.7 bits (239),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +2

Query  434  AVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLHPVQSKTIVDKFAAVEI  613
            AVQVKL ++DL +TG+L    +T+W+E+++SK V+ LL PL LHPV+SKTI+DKFAAV I
Sbjct  137  AVQVKLFVEDLRKTGRLDGSYFTYWNENYTSKCVQALLDPLKLHPVESKTIIDKFAAVGI  196

Query  614  LQGYLDYVNRNDK  652
            LQGYLD +NRN K
Sbjct  197  LQGYLDDMNRNLK  209


 Score = 95.1 bits (235),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 59/73 (81%), Gaps = 4/73 (5%)
 Frame = +1

Query  139  FFEMKYMKPLNLFQELVKS----RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKS  306
            F +MK +KP+ LFQ+ +KS    +GRLLGLDVG KYVGLAVSD  NK+ASPLSVL+RKK+
Sbjct  65   FAQMKLVKPIELFQKFLKSGSMEKGRLLGLDVGQKYVGLAVSDTCNKIASPLSVLVRKKT  124

Query  307  NIDLMATDFQSLV  345
            NIDL+A D Q+L 
Sbjct  125  NIDLVARDLQTLA  137



>dbj|BAJ99748.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=199

 Score =   114 bits (284),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 79/108 (73%), Gaps = 8/108 (7%)
 Frame = +2

Query  386  GFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            G + GYPF+ Q +++PDA QV LL+ +LC+TGKL D+ YT+WDE+F+SK VE LL PLNL
Sbjct  89   GLVVGYPFNLQGQSSPDASQVSLLVGELCKTGKLDDLSYTYWDENFTSKCVEALLNPLNL  148

Query  563  HP-VQSKTIVDKFAAVEILQGYLDYVNR------NDKMKLSARSEEPA  685
            +  V++KT+ DKFAAV ILQGYLD +NR      N K  LS+ S + A
Sbjct  149  NDRVETKTMTDKFAAVCILQGYLDNMNRALTSADNVKSNLSSASGQWA  196


 Score = 77.8 bits (190),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 55/70 (79%), Gaps = 4/70 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELV----KSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            M+ +K   LF++L+    K + RLLGLDVG+KYVGLAVSD +N++A PLSVL R K+NI+
Sbjct  13   MRLLKAEELFRKLLEGGSKKKARLLGLDVGSKYVGLAVSDQQNRIALPLSVLGRTKTNIN  72

Query  316  LMATDFQSLV  345
            LMA DF++LV
Sbjct  73   LMADDFKTLV  82



>emb|CDM81502.1| unnamed protein product [Triticum aestivum]
Length=174

 Score =   113 bits (282),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 71/88 (81%), Gaps = 2/88 (2%)
 Frame = +2

Query  386  GFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            G + GYPF+ Q +++PDA QV LL+ +LC+TGKL D+ YT+WDE+F+SK VE LL PL L
Sbjct  77   GLVVGYPFNLQGQSSPDASQVSLLVGELCKTGKLDDLSYTYWDENFTSKCVEALLNPLKL  136

Query  563  H-PVQSKTIVDKFAAVEILQGYLDYVNR  643
            + PV++KT+ DKFAAV ILQGYLD +NR
Sbjct  137  NDPVETKTMTDKFAAVCILQGYLDNMNR  164


 Score = 76.6 bits (187),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 63/91 (69%), Gaps = 11/91 (12%)
 Frame = +1

Query  148  MKYMKPLNLFQELV----KSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            M+ +K   LF++L+    K + RLLGLDVG+KYVGLAVSD +N++A PLSVL R K+NI+
Sbjct  1    MRLLKAEELFRKLLEGGSKKQPRLLGLDVGSKYVGLAVSDQKNRIALPLSVLGRTKTNIN  60

Query  316  LMATDFQSLVRLSFLNYL*AFLEGIHFWLPF  408
            LMA DF++LV+    NY    L G+    PF
Sbjct  61   LMADDFKTLVK----NY---SLAGLVVGYPF  84



>ref|XP_006644759.1| PREDICTED: uncharacterized protein LOC102708106 [Oryza brachyantha]
Length=178

 Score =   115 bits (288),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 80/103 (78%), Gaps = 4/103 (4%)
 Frame = +2

Query  386  GFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ GYPF+ Q + +PDA+QV+LL+ +LC+TGKL DV YT+WDE+F+SK VE LL PL L
Sbjct  77   GFVVGYPFNLQGQASPDALQVRLLVGELCKTGKLDDVSYTYWDENFTSKCVEALLYPLKL  136

Query  563  H-PVQSKTIVDKFAAVEILQGYLDYVNRNDKMKLSARSEEPAD  688
            + PV+ KT+ DKFAAV ILQGYLD +NR  +++ +  SE+  D
Sbjct  137  NDPVEIKTMTDKFAAVCILQGYLDNMNR--ELRCADDSEKQRD  177


 Score = 72.4 bits (176),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 53/70 (76%), Gaps = 4/70 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKS----RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            M+ +K   LF+++++     + RLLGLDVG+KYVGLAVSD +N++A PLSVL R K+NI 
Sbjct  1    MRLLKAGQLFRKVIEGGSEKQSRLLGLDVGSKYVGLAVSDDKNRIALPLSVLSRTKTNIG  60

Query  316  LMATDFQSLV  345
            LMA DF +LV
Sbjct  61   LMADDFVTLV  70



>ref|NP_001044344.1| Os01g0764700 [Oryza sativa Japonica Group]
 dbj|BAD87145.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF06258.1| Os01g0764700 [Oryza sativa Japonica Group]
 dbj|BAG92736.1| unnamed protein product [Oryza sativa Japonica Group]
Length=178

 Score =   114 bits (285),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 73/88 (83%), Gaps = 2/88 (2%)
 Frame = +2

Query  386  GFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ GYPF+ Q +++P+A+QV+LL+ +LC+TGKL D+ YT+WDE+F+SK VE LL PL L
Sbjct  77   GFVVGYPFNLQGQSSPNALQVRLLVGELCKTGKLDDMSYTYWDENFTSKCVEALLHPLKL  136

Query  563  H-PVQSKTIVDKFAAVEILQGYLDYVNR  643
            H PV++KT+ DKFAAV ILQ YLD +NR
Sbjct  137  HDPVETKTMTDKFAAVCILQRYLDNMNR  164


 Score = 72.8 bits (177),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 53/70 (76%), Gaps = 4/70 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELV----KSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            M+ +K   LF++++    + + RLLGLDVG+KYVGLAVSD +N++A PLSVL R K+NI 
Sbjct  1    MRLLKADQLFRKVIDGGWRKQSRLLGLDVGSKYVGLAVSDDKNRIALPLSVLSRTKTNIS  60

Query  316  LMATDFQSLV  345
            LMA DF +LV
Sbjct  61   LMADDFVTLV  70



>ref|XP_009364907.1| PREDICTED: uncharacterized protein LOC103954805 isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009364913.1| PREDICTED: uncharacterized protein LOC103954811 isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009346761.1| PREDICTED: uncharacterized protein LOC103938484 isoform X2 [Pyrus 
x bretschneideri]
Length=140

 Score =   106 bits (265),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 68/79 (86%), Gaps = 5/79 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKS----RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            M+Y+KPLNLFQ+LVK+    RGRLLGLDVG+KYVG+AVSD+ NK+ASPLSVL+RKKSNI 
Sbjct  1    MRYVKPLNLFQDLVKANTLERGRLLGLDVGDKYVGVAVSDLHNKIASPLSVLLRKKSNIG  60

Query  316  LMATDFQSLV-RLSFLNYL  369
            LMA DFQSL+  LS + ++
Sbjct  61   LMAADFQSLISELSLVGFI  79


 Score = 79.3 bits (194),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 48/89 (54%), Gaps = 30/89 (34%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            GFI GYPFDRQ+  PDAVQVKL IDDL +T KL  +KYT+WDE F+SK            
Sbjct  77   GFIVGYPFDRQKGTPDAVQVKLFIDDLSKTRKLEGLKYTYWDEGFTSK------------  124

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNRNDK  652
                              GYLDYVNR  K
Sbjct  125  ------------------GYLDYVNRELK  135



>ref|XP_008392574.1| PREDICTED: uncharacterized protein LOC103454749 isoform X2 [Malus 
domestica]
Length=140

 Score =   105 bits (262),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 68/79 (86%), Gaps = 5/79 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKS----RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            M+Y+KPLNLFQ+L+K+    RGRLLGLDVG+KYVG+AVSD+ NK+ASPLSVL+RKKSNI 
Sbjct  1    MRYVKPLNLFQDLLKANTLERGRLLGLDVGDKYVGVAVSDLHNKIASPLSVLLRKKSNIG  60

Query  316  LMATDFQSLV-RLSFLNYL  369
            LMA DFQSL+  LS + ++
Sbjct  61   LMAADFQSLISELSLVGFI  79


 Score = 79.3 bits (194),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 48/89 (54%), Gaps = 30/89 (34%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            GFI GYPFDRQ+  PDAVQVKL IDDL +T KL  +KYT+WDE F+SK            
Sbjct  77   GFIVGYPFDRQKGTPDAVQVKLFIDDLSKTRKLEGLKYTYWDEGFTSK------------  124

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNRNDK  652
                              GYLDYVNR  K
Sbjct  125  ------------------GYLDYVNRELK  135



>gb|EAY75935.1| hypothetical protein OsI_03854 [Oryza sativa Indica Group]
Length=180

 Score =   109 bits (273),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 73/90 (81%), Gaps = 4/90 (4%)
 Frame = +2

Query  386  GFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSK--SVEMLLKPL  556
            GF+ GYPF+ Q +++P+A+QV+LL+ +LC+TGKL D+ YT+WDE+F+SK   VE LL PL
Sbjct  77   GFVVGYPFNLQGQSSPNALQVRLLVGELCKTGKLDDMSYTYWDENFTSKVMCVEALLHPL  136

Query  557  NLH-PVQSKTIVDKFAAVEILQGYLDYVNR  643
             LH PV++KT+ DKFAAV ILQ YLD +NR
Sbjct  137  KLHDPVETKTMTDKFAAVCILQRYLDNMNR  166


 Score = 73.2 bits (178),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 53/70 (76%), Gaps = 4/70 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELV----KSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            M+ +K   LF++++    + + RLLGLDVG+KYVGLAVSD +N++A PLSVL R K+NI 
Sbjct  1    MRLLKADQLFRKVIDGGSRKQSRLLGLDVGSKYVGLAVSDDKNRIALPLSVLSRTKTNIS  60

Query  316  LMATDFQSLV  345
            LMA DF +LV
Sbjct  61   LMADDFVTLV  70



>gb|EAZ13647.1| hypothetical protein OsJ_03564 [Oryza sativa Japonica Group]
Length=180

 Score =   109 bits (272),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 73/90 (81%), Gaps = 4/90 (4%)
 Frame = +2

Query  386  GFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSK--SVEMLLKPL  556
            GF+ GYPF+ Q +++P+A+QV+LL+ +LC+TGKL D+ YT+WDE+F+SK   VE LL PL
Sbjct  77   GFVVGYPFNLQGQSSPNALQVRLLVGELCKTGKLDDMSYTYWDENFTSKVMCVEALLHPL  136

Query  557  NLH-PVQSKTIVDKFAAVEILQGYLDYVNR  643
             LH PV++KT+ DKFAAV ILQ YLD +NR
Sbjct  137  KLHDPVETKTMTDKFAAVCILQRYLDNMNR  166


 Score = 72.8 bits (177),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 53/70 (76%), Gaps = 4/70 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELV----KSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            M+ +K   LF++++    + + RLLGLDVG+KYVGLAVSD +N++A PLSVL R K+NI 
Sbjct  1    MRLLKADQLFRKVIDGGWRKQSRLLGLDVGSKYVGLAVSDDKNRIALPLSVLSRTKTNIS  60

Query  316  LMATDFQSLV  345
            LMA DF +LV
Sbjct  61   LMADDFVTLV  70



>ref|XP_009382998.1| PREDICTED: uncharacterized protein LOC103970796 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=163

 Score = 92.8 bits (229),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 63/79 (80%), Gaps = 1/79 (1%)
 Frame = +2

Query  386  GFIFGYPFDR-QRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ GYPF    +++ +AVQV+L ++DL  TG+L  + YT+WDE+++SK VE LL+PL+L
Sbjct  77   GFVVGYPFCLWGQSSVEAVQVRLFMEDLRNTGRLNGLTYTYWDENYTSKCVEALLEPLDL  136

Query  563  HPVQSKTIVDKFAAVEILQ  619
            +PV+SKTI DKFAAV ILQ
Sbjct  137  NPVKSKTIKDKFAAVGILQ  155


 Score = 89.4 bits (220),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 56/70 (80%), Gaps = 4/70 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKS----RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            MK ++P+ LFQ+L  S    +GRLLGLDVG +YVGLAVSDV N++ASP SVL+RKK+NID
Sbjct  1    MKVIEPVELFQKLCSSGAVQKGRLLGLDVGQRYVGLAVSDVANRIASPGSVLVRKKTNID  60

Query  316  LMATDFQSLV  345
            +MA  FQ L+
Sbjct  61   IMAKVFQKLI  70



>gb|KHN35021.1| Putative Holliday junction resolvase [Glycine soja]
Length=157

 Score = 95.1 bits (235),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 57/67 (85%), Gaps = 1/67 (1%)
 Frame = +1

Query  148  MKYMKPLNLFQELV-KSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNIDLMA  324
            M+YMKPL LF +L  + RGRLLGLDVG+KYVGLA+SD +N +ASP SVL+RKK+NI L+A
Sbjct  1    MRYMKPLQLFHDLKNQQRGRLLGLDVGDKYVGLALSDFDNNIASPFSVLVRKKTNITLVA  60

Query  325  TDFQSLV  345
            +DF+SL 
Sbjct  61   SDFESLC  67


 Score = 82.0 bits (201),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 61/93 (66%), Gaps = 16/93 (17%)
 Frame = +2

Query  392  IFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL-HP  568
            + G  FD+ + + DA+QVK+  D LC+T  L               +VE+LLKPLNL H 
Sbjct  78   VIGISFDKHQVSSDAMQVKVFTDHLCKTKML-------------EGNVELLLKPLNLNHS  124

Query  569  VQSKTIVDKFAAVEILQGYLDYVNRNDKMKLSA  667
            V SKT++DKFAAV ILQGY+D+VNR  KMKL+A
Sbjct  125  VLSKTMLDKFAAVGILQGYMDFVNR--KMKLTA  155



>gb|EMS54529.1| Putative Holliday junction resolvase [Triticum urartu]
Length=201

 Score =   113 bits (282),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 71/88 (81%), Gaps = 2/88 (2%)
 Frame = +2

Query  386  GFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            G + GYPF+ Q +++PDA QV LL+ +LC+TGKL D+ YT+WDE+F+SK VE LL PL L
Sbjct  100  GLVVGYPFNLQGQSSPDASQVSLLVGELCKTGKLDDLSYTYWDENFTSKCVEALLNPLKL  159

Query  563  H-PVQSKTIVDKFAAVEILQGYLDYVNR  643
            + PV++KT+ DKFAAV ILQGYLD +NR
Sbjct  160  NDPVETKTMTDKFAAVCILQGYLDNMNR  187


 Score = 63.2 bits (152),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 62/114 (54%), Gaps = 34/114 (30%)
 Frame = +1

Query  148  MKYMKPLNLFQELV----KSRGRLLGLDVGNKYVGLAVSDVENKLASPLS----------  285
            M+ +K   LFQ+L+    K + RLLGLDVG+KYVGLAVSD +N++A PL           
Sbjct  1    MRLLKAEELFQKLLEGGSKKQPRLLGLDVGSKYVGLAVSDQKNRIALPLRYGLLAIGVED  60

Query  286  -------------VLIRKKSNIDLMATDFQSLVRLSFLNYL*AFLEGIHFWLPF  408
                         VL R K+NI+LMA DF++LV+    NY    L G+    PF
Sbjct  61   VFLDANVSGHVCFVLGRTKTNINLMADDFKTLVK----NY---SLAGLVVGYPF  107



>ref|XP_004970077.1| PREDICTED: uncharacterized protein LOC101786216 [Setaria italica]
Length=175

 Score =   103 bits (256),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 74/99 (75%), Gaps = 4/99 (4%)
 Frame = +2

Query  386  GFIFGYPFD-RQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ GYPF+   ++  D VQV+LL  +L +TGKL D+ YT+WDE+F+SK VE LL PLNL
Sbjct  78   GFVVGYPFNLHGQHTSDGVQVRLLAGELYQTGKLDDLCYTYWDENFTSKCVEALLHPLNL  137

Query  563  -HPVQSKTIVDKFAAVEILQGYLDYVNRNDKMKLSARSE  676
             +  ++KT+ DKFAAV ILQGYLD +NR  K++ S +SE
Sbjct  138  KNRDEAKTMTDKFAAVCILQGYLDNMNR--KLRPSDKSE  174


 Score = 72.0 bits (175),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 53/71 (75%), Gaps = 5/71 (7%)
 Frame = +1

Query  148  MKYMKPLNLFQELV-----KSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNI  312
            M+ ++   LF++++     K   RLLGLDVG+KYVGLAVSD +N++A PLSVL R K+NI
Sbjct  1    MRLLQAEELFRKVLEGGSKKKAARLLGLDVGSKYVGLAVSDEKNRIALPLSVLSRTKTNI  60

Query  313  DLMATDFQSLV  345
            +LMA DF++L 
Sbjct  61   NLMADDFKTLA  71



>ref|XP_010055624.1| PREDICTED: uncharacterized protein LOC104443797 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010055625.1| PREDICTED: uncharacterized protein LOC104443797 isoform X1 [Eucalyptus 
grandis]
Length=177

 Score =   102 bits (253),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 62/70 (89%), Gaps = 4/70 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELV----KSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            M+Y+KPL+LFQ+++    K +GRLLGLDVG+KYVGLAVSD  NK+ASPLSVL+RKK+NID
Sbjct  1    MRYVKPLSLFQDVLMAHTKKKGRLLGLDVGDKYVGLAVSDSSNKVASPLSVLLRKKTNID  60

Query  316  LMATDFQSLV  345
            LMATD QSLV
Sbjct  61   LMATDLQSLV  70


 Score = 68.9 bits (167),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-----NPDAVQVKLLIDDLCETGKLVDVKYTFWD--ESFSSKSVEML  544
            GF+ G P DR R+     N     +++    L +   L+   +        FS+K+VE+L
Sbjct  77   GFVVGVPLDRFRSPNRDENLKVFVIRIGKKPLHQRCNLLSFFFQSLSLTSCFSTKNVELL  136

Query  545  LKPLNLHPVQSKTIVDKFAAVEILQGYLDYVNRNDK  652
            L+PL LH V +KTI+DKFAA+ ILQGYLDY N+  +
Sbjct  137  LQPLTLHSVVAKTIMDKFAAMGILQGYLDYANKKQR  172



>gb|ABR17857.1| unknown [Picea sitchensis]
Length=178

 Score = 89.0 bits (219),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 71/112 (63%), Gaps = 13/112 (12%)
 Frame = +2

Query  386  GFIFGYP---FDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPL  556
            GF+ GYP   +  QR+   A+QVK+ ++ L +TG+   + YT+WDE  ++++VE +LKPL
Sbjct  77   GFVIGYPLPLYHFQRSQ--AMQVKMFVEQLQKTGRFGCLNYTYWDERLTTRAVESMLKPL  134

Query  557  NLHPVQSKTIVDKFAAVEILQGYLDYVNRNDKMKLSARSEEPADEDGIKPSV  712
             +HP+Q K ++DKFAAV ILQ +LD         L  +++     D ++P++
Sbjct  135  KIHPLQMKHMMDKFAAVGILQDFLD--------NLQHQAKSCVQSDSLRPTI  178


 Score = 79.0 bits (193),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 53/71 (75%), Gaps = 4/71 (6%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKS----RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            MKY+K L LFQ L K+     GRLLG+DVG++YVGLAVS+  N++ASP SVLIRK+SNID
Sbjct  1    MKYVKQLELFQILFKNGKLGTGRLLGMDVGDRYVGLAVSNHLNEIASPHSVLIRKQSNID  60

Query  316  LMATDFQSLVR  348
             +    Q LVR
Sbjct  61   SITDKLQELVR  71



>ref|NP_001237859.1| uncharacterized protein LOC100305864 [Glycine max]
 gb|ACU13753.1| unknown [Glycine max]
Length=110

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 78/96 (81%), Gaps = 3/96 (3%)
 Frame = +2

Query  383  KGFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            KGF+ G PFD+ + + DA+QVK+ ID+LC T  L  VKY +W+ESF+SK+VE+LLKPLNL
Sbjct  15   KGFVIGIPFDKHQVSSDAMQVKVFIDNLCRTKMLEGVKYAYWNESFTSKNVELLLKPLNL  74

Query  563  -HPVQSKTIVDKFAAVEILQGYLDYVNRNDKMKLSA  667
             HPV SKT++DKFAAV ILQGYLD+VNR  KMKL A
Sbjct  75   NHPVLSKTMLDKFAAVGILQGYLDFVNR--KMKLKA  108



>ref|NP_001136992.1| hypothetical protein [Zea mays]
 gb|ACF83034.1| unknown [Zea mays]
 tpg|DAA57481.1| TPA: hypothetical protein ZEAMMB73_010877 [Zea mays]
Length=174

 Score = 94.0 bits (232),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 70/99 (71%), Gaps = 5/99 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKL-LIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ GYPF +    P A  +++ L  +LC+TGKL D+ Y +WDE+F+SK VE LL PLNL
Sbjct  78   GFVVGYPF-KIYGQPCASAIQVSLAGELCKTGKLDDLPYAYWDENFTSKCVEALLHPLNL  136

Query  563  HPV-QSKTIVDKFAAVEILQGYLDYVNRNDKMKLSARSE  676
              +  +KT+ DKFAAV ILQGYLD +NR  K++ + +SE
Sbjct  137  KDLDDAKTMTDKFAAVCILQGYLDNMNR--KLRSTDKSE  173


 Score = 72.0 bits (175),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 55/73 (75%), Gaps = 5/73 (7%)
 Frame = +1

Query  148  MKYMKPLNLFQELVK-----SRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNI  312
            M+ ++   LF+++++        RLLGLDVG+KYVG+A+SD +N++A PLSVL R K+NI
Sbjct  1    MRLLQAEELFRKVLEVGSKNKAARLLGLDVGSKYVGVAISDEKNRVAMPLSVLCRTKTNI  60

Query  313  DLMATDFQSLVRL  351
            +LMA DF++LV +
Sbjct  61   NLMADDFKTLVSM  73



>gb|EYU23484.1| hypothetical protein MIMGU_mgv1a0195701mg, partial [Erythranthe 
guttata]
Length=104

 Score =   122 bits (307),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            G + GYPFDRQ+++P AVQVKL +D+L +TGK  D+KYTFWDE F+SKSVE LLKPL+LH
Sbjct  27   GLVIGYPFDRQKSSPTAVQVKLFVDELTKTGKFEDLKYTFWDECFTSKSVEFLLKPLSLH  86

Query  566  PVQSKTIVDKFAAVEILQ  619
            PVQ KTI DKFAAV ILQ
Sbjct  87   PVQHKTISDKFAAVGILQ  104



>ref|XP_008392628.1| PREDICTED: uncharacterized protein LOC103454811 [Malus domestica]
Length=103

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            GFI GYPFDRQ+  PDAVQVKL IDDL +T KL  +KYT+WDE F+SK+VE+LLKPLNL 
Sbjct  10   GFIVGYPFDRQKGTPDAVQVKLFIDDLSKTRKLEGLKYTYWDEGFTSKNVELLLKPLNLP  69

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNRNDK  652
            PVQSKTI+DKFAAV ILQGYLDYVNR  K
Sbjct  70   PVQSKTIMDKFAAVGILQGYLDYVNRELK  98



>ref|XP_008672298.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=172

 Score = 79.3 bits (194),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 56/80 (70%), Gaps = 3/80 (4%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKL-LIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ GYPF +    P A  +++ L  +LC+TGKL D+ Y +WDE+F+SK VE LL PLNL
Sbjct  78   GFVVGYPF-KIYGQPCASAIQVSLAGELCKTGKLDDLPYAYWDENFTSKCVEALLHPLNL  136

Query  563  HPV-QSKTIVDKFAAVEILQ  619
              +  +KT+ DKFAAV ILQ
Sbjct  137  KDLDDAKTMTDKFAAVCILQ  156


 Score = 72.4 bits (176),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 55/73 (75%), Gaps = 5/73 (7%)
 Frame = +1

Query  148  MKYMKPLNLFQELVK-----SRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNI  312
            M+ ++   LF+++++        RLLGLDVG+KYVG+A+SD +N++A PLSVL R K+NI
Sbjct  1    MRLLQAEELFRKVLEVGSKNKAARLLGLDVGSKYVGVAISDEKNRVAMPLSVLCRTKTNI  60

Query  313  DLMATDFQSLVRL  351
            +LMA DF++LV +
Sbjct  61   NLMADDFKTLVSM  73



>gb|EMT24240.1| Putative Holliday junction resolvase [Aegilops tauschii]
Length=174

 Score = 99.8 bits (247),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 64/80 (80%), Gaps = 2/80 (3%)
 Frame = +2

Query  386  GFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            G + GYPF+ Q +++PDA QV LL+ +LC+TGKL D+ YT+WDE+F+SK VE LL PL L
Sbjct  74   GLVVGYPFNLQGQSSPDASQVSLLVGELCKTGKLDDLSYTYWDENFTSKCVEALLNPLKL  133

Query  563  H-PVQSKTIVDKFAAVEILQ  619
            + PV++KT+ DKFAAV ILQ
Sbjct  134  NDPVETKTMTDKFAAVCILQ  153


 Score = 48.9 bits (115),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 37/49 (76%), Gaps = 4/49 (8%)
 Frame = +1

Query  148  MKYMKPLNLFQELV----KSRGRLLGLDVGNKYVGLAVSDVENKLASPL  282
            M+ +K   LF++L+    K + RLLGLDVG+KYVGLAVSD +N++A PL
Sbjct  1    MRLLKAEELFRKLLEGGSKKQPRLLGLDVGSKYVGLAVSDQKNRIALPL  49



>ref|XP_010906656.1| PREDICTED: uncharacterized protein LOC105033507 isoform X1 [Elaeis 
guineensis]
 ref|XP_010906657.1| PREDICTED: uncharacterized protein LOC105033507 isoform X1 [Elaeis 
guineensis]
Length=244

 Score =   109 bits (272),  Expect(2) = 9e-26, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 72/90 (80%), Gaps = 1/90 (1%)
 Frame = +2

Query  386  GFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ GYPF  Q +++ +AVQVKL ++DL +TG+L    +T+W+E+++SK V+ LL PL L
Sbjct  148  GFVVGYPFSLQGQSSIEAVQVKLFVEDLRKTGRLDGSYFTYWNENYTSKCVQALLDPLKL  207

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVNRNDK  652
            HPV+SKTI+DKFAAV ILQGYLD +NRN K
Sbjct  208  HPVESKTIIDKFAAVGILQGYLDDMNRNLK  237


 Score = 36.2 bits (82),  Expect(2) = 9e-26, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 26/31 (84%), Gaps = 1/31 (3%)
 Frame = +1

Query  280  LSVLIRKKSNIDLMATDFQSLV-RLSFLNYL  369
            LSVL+RKK+NIDL+A D Q+LV +LS + ++
Sbjct  120  LSVLVRKKTNIDLVARDLQTLVSQLSLVGFV  150



>ref|XP_008672299.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=171

 Score = 72.8 bits (177),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 48/64 (75%), Gaps = 2/64 (3%)
 Frame = +2

Query  434  AVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLHPV-QSKTIVDKFAAVE  610
            A+QV L   +LC+TGKL D+ Y +WDE+F+SK VE LL PLNL  +  +KT+ DKFAAV 
Sbjct  71   AIQVSL-AGELCKTGKLDDLPYAYWDENFTSKCVEALLHPLNLKDLDDAKTMTDKFAAVC  129

Query  611  ILQG  622
            ILQG
Sbjct  130  ILQG  133


 Score = 70.9 bits (172),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 53/71 (75%), Gaps = 5/71 (7%)
 Frame = +1

Query  148  MKYMKPLNLFQELVK-----SRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNI  312
            M+ ++   LF+++++        RLLGLDVG+KYVG+A+SD +N++A PLSVL R K+NI
Sbjct  1    MRLLQAEELFRKVLEVGSKNKAARLLGLDVGSKYVGVAISDEKNRVAMPLSVLCRTKTNI  60

Query  313  DLMATDFQSLV  345
            +LMA DF++L 
Sbjct  61   NLMADDFKTLA  71



>gb|KCW72137.1| hypothetical protein EUGRSUZ_E00580 [Eucalyptus grandis]
Length=75

 Score = 97.4 bits (241),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +2

Query  443  VKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLHPVQSKTIVDKFAAVEILQG  622
            +K+ ID+L +TGKL  V YT+W+E+F+SK+VE+LL+PL LHPV +KTI+DKFAA+ ILQG
Sbjct  1    MKVFIDELSKTGKLEGVCYTYWEETFTSKNVELLLQPLTLHPVVAKTIMDKFAAMGILQG  60

Query  623  YLDYVNRNDKMKLS  664
            YLDY N+  + + S
Sbjct  61   YLDYANKKQRSESS  74



>ref|XP_010906658.1| PREDICTED: uncharacterized protein LOC105033507 isoform X2 [Elaeis 
guineensis]
Length=220

 Score = 96.3 bits (238),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +2

Query  434  AVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLHPVQSKTIVDKFAAVEI  613
            AVQVKL ++DL +TG+L    +T+W+E+++SK V+ LL PL LHPV+SKTI+DKFAAV I
Sbjct  141  AVQVKLFVEDLRKTGRLDGSYFTYWNENYTSKCVQALLDPLKLHPVESKTIIDKFAAVGI  200

Query  614  LQGYLDYVNRNDK  652
            LQGYLD +NRN K
Sbjct  201  LQGYLDDMNRNLK  213


 Score = 34.3 bits (77),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +1

Query  280  LSVLIRKKSNIDLMATDFQSLV  345
            LSVL+RKK+NIDL+A D Q+L 
Sbjct  120  LSVLVRKKTNIDLVARDLQTLA  141



>gb|ACN35369.1| unknown [Zea mays]
 tpg|DAA57480.1| TPA: hypothetical protein ZEAMMB73_010877 [Zea mays]
Length=146

 Score = 93.6 bits (231),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 70/99 (71%), Gaps = 5/99 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKL-LIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ GYPF +    P A  +++ L  +LC+TGKL D+ Y +WDE+F+SK VE LL PLNL
Sbjct  50   GFVVGYPF-KIYGQPCASAIQVSLAGELCKTGKLDDLPYAYWDENFTSKCVEALLHPLNL  108

Query  563  HPV-QSKTIVDKFAAVEILQGYLDYVNRNDKMKLSARSE  676
              +  +KT+ DKFAAV ILQGYLD +NR  K++ + +SE
Sbjct  109  KDLDDAKTMTDKFAAVCILQGYLDNMNR--KLRSTDKSE  145



>ref|XP_001779541.1| predicted protein [Physcomitrella patens]
 gb|EDQ55617.1| predicted protein [Physcomitrella patens]
Length=171

 Score = 60.1 bits (144),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 49/87 (56%), Gaps = 1/87 (1%)
 Frame = +2

Query  386  GFIFGYPFDRQR-NNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            G + GYP +          QVKL   +L  +G+  ++ Y +WDE  +S +V  ++  +++
Sbjct  72   GLVIGYPLELTGFQGKQGAQVKLFAKELQMSGRFPNLAYVYWDERLTSVAVTNVIGSMDI  131

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVNR  643
               + K IVDK +A+ ILQG LD ++R
Sbjct  132  TGRRRKNIVDKMSALCILQGCLDSLSR  158


 Score = 50.8 bits (120),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = +1

Query  172  LFQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNIDLMATDFQSLVR  348
            LFQ L  S GRLLGLDVG++ +GLAVSD + ++ASP SV+ R  +      +  +SLV+
Sbjct  9    LFQRL-SSGGRLLGLDVGSRNIGLAVSDPKCRIASPHSVMYRSNTTTLKNISRLESLVQ  66



>ref|WP_036281693.1| Holliday junction resolvase [Methylocystis sp. ATCC 49242]
Length=157

 Score = 52.4 bits (124),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +1

Query  163  PLNLFQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            P+     ++ ++GRL+GLD+G K +GLA+SDVE +LASPL  + R K + D
Sbjct  7    PIEEVARVLPAKGRLMGLDLGTKTIGLALSDVERRLASPLDTIKRVKFSQD  57


 Score = 46.2 bits (108),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 26/88 (30%), Positives = 42/88 (48%), Gaps = 4/88 (5%)
 Frame = +2

Query  383  KGFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLN  559
            +  +FG P +      P A   +  + +L    KL  + + FWDE  S+ +V   L   +
Sbjct  71   QALVFGLPLNMDGTAGPRAQATRAFMRNLR---KLTPIPFVFWDERLSTAAVTRELIAQD  127

Query  560  LHPVQSKTIVDKFAAVEILQGYLDYVNR  643
                +   +VD+ AA  ILQG LD ++R
Sbjct  128  ASRAKRAEVVDRMAAAYILQGALDRLSR  155



>ref|WP_016920566.1| Holliday junction resolvase [Methylocystis parvus]
Length=156

 Score = 52.0 bits (123),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 39/57 (68%), Gaps = 7/57 (12%)
 Frame = +1

Query  196  RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNIDL-----MATDF--QSLV  345
            +GRL+GLD+G K +GLA+SDVE +LASPL  + R K + D       A+DF  Q+LV
Sbjct  17   KGRLIGLDLGTKTIGLALSDVERRLASPLDTIKRVKFSTDAEALLKRASDFEVQALV  73


 Score = 45.1 bits (105),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 26/88 (30%), Positives = 41/88 (47%), Gaps = 4/88 (5%)
 Frame = +2

Query  383  KGFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLN  559
            +  +FG P +      P A   +  + +L    KL  + + FWDE  S+ +V   L   +
Sbjct  70   QALVFGLPLNMDGSEGPRAQATRAFMRNLR---KLTRLPFAFWDERLSTAAVTRELIAQD  126

Query  560  LHPVQSKTIVDKFAAVEILQGYLDYVNR  643
                +   +VD+ AA  ILQG LD + R
Sbjct  127  ASRAKRAEVVDRMAAAYILQGALDRLAR  154



>ref|WP_011917295.1| Holliday junction resolvase [Caldicellulosiruptor saccharolyticus]
 ref|YP_001180552.1| Holliday junction resolvase YqgF [Caldicellulosiruptor saccharolyticus 
DSM 8903]
 sp|A4XKC6.1|RUVX_CALS8 RecName: Full=Putative Holliday junction resolvase [Caldicellulosiruptor 
saccharolyticus DSM 8903]
 gb|ABP67361.1| Holliday junction resolvase YqgF [Caldicellulosiruptor saccharolyticus 
DSM 8903]
Length=138

 Score = 64.3 bits (155),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 52/86 (60%), Gaps = 4/86 (5%)
 Frame = +2

Query  389  FIFGYPFDRQRNNPDAVQVKLL-IDDLC-ETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
             + GYP  +   +PD    KL  ID++C E  +   V    WDE FS+K+VE +L+  N+
Sbjct  54   IVIGYPVSK--FHPDKATEKLQKIDEICSELERRYKVGIIKWDERFSTKAVERILREENV  111

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVN  640
               + K +VDK AAV ILQGYLD++N
Sbjct  112  SWQKRKKVVDKLAAVYILQGYLDFIN  137


 Score = 31.6 bits (70),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 14/37 (38%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +1

Query  202  RLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNI  312
            R+L LD+G++ +G+A+SD     A P  VL  +K ++
Sbjct  2    RILCLDIGSRRIGVAISDPLKIAAQPFCVLDLQKEDL  38



>ref|WP_020399412.1| hypothetical protein [Kordiimonas gwangyangensis]
Length=152

 Score = 50.8 bits (120),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 40/82 (49%), Gaps = 4/82 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ G+P +      P     K   D+L    KL D+   FWDE  S+ +VE  L   + 
Sbjct  71   GFVLGWPVNMDGSEGPRCQSTKAFSDNLA---KLSDLPQIFWDERLSTAAVERTLIEADR  127

Query  563  HPVQSKTIVDKFAAVEILQGYL  628
               + K +VDK AA  ILQG L
Sbjct  128  SRARRKELVDKMAAAYILQGAL  149


 Score = 44.7 bits (104),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKK  303
            M  +  +   ++L+  R RLLGLD+G+K +GLA+SD    +A+P+  + R K
Sbjct  1    MSVVTSVRELKDLLPRRARLLGLDIGSKTIGLALSDTTLTIATPMETIKRTK  52



>sp|Q5NPF1.2|RUVX_ZYMMO RecName: Full=Putative Holliday junction resolvase [Zymomonas 
mobilis subsp. mobilis ZM4 = ATCC 31821]
Length=163

 Score = 55.5 bits (132),  Expect(2) = 9e-11, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNIDL  318
            +K  + L LFQE +  +GRL GLDVG K +GLA+ D +  +ASP   + RKK  +DL
Sbjct  10   LKKQEELRLFQEALPRKGRLAGLDVGTKTIGLALCDSQWIIASPAETIRRKKFTLDL  66


 Score = 38.9 bits (89),  Expect(2) = 9e-11, Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 39/84 (46%), Gaps = 5/84 (6%)
 Frame = +2

Query  383  KGFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLN  559
            KG + G P +    ++P    V+    ++      + +    WDE +S+K+V   L   +
Sbjct  79   KGLVIGLPLNLDGSDSPRTQSVRAFAKNVAP----LSLPVLMWDERWSTKAVTRTLLEAD  134

Query  560  LHPVQSKTIVDKFAAVEILQGYLD  631
                +   +VDK AA  ILQG +D
Sbjct  135  ASRARRSEVVDKMAAAYILQGAID  158



>ref|WP_038259267.1| Holliday junction resolvase [Zymomonas mobilis]
Length=155

 Score = 55.5 bits (132),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNIDL  318
            +K  + L LFQE +  +GRL GLDVG K +GLA+ D +  +ASP   + RKK  +DL
Sbjct  2    LKKQEELRLFQEALPRKGRLAGLDVGTKTIGLALCDSQWIIASPAETIRRKKFTLDL  58


 Score = 38.9 bits (89),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 39/84 (46%), Gaps = 5/84 (6%)
 Frame = +2

Query  383  KGFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLN  559
            KG + G P +    ++P    V+    ++      + +    WDE +S+K+V   L   +
Sbjct  71   KGLVIGLPLNLDGSDSPRTQSVRAFAKNVAP----LSLPVLMWDERWSTKAVTRTLLEAD  126

Query  560  LHPVQSKTIVDKFAAVEILQGYLD  631
                +   +VDK AA  ILQG +D
Sbjct  127  ASRARRSEVVDKMAAAYILQGAID  150



>ref|WP_037233661.1| Holliday junction resolvase [Rhodomicrobium udaipurense]
 gb|KAI95946.1| Holliday junction resolvase [Rhodomicrobium udaipurense JA643]
Length=156

 Score = 50.4 bits (119),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 40/86 (47%), Gaps = 4/86 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            G + G P +      P A   +  +  L   G L D+   FWDE  S+ + E +L   + 
Sbjct  72   GLVVGLPVNLDGTEGPRAQSTRAFVRSL---GALTDMPMAFWDERLSTAAAERVLLEADA  128

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVN  640
               +   ++DK AA  ILQG LD VN
Sbjct  129  SRKRRAEVIDKMAAAYILQGALDRVN  154


 Score = 43.9 bits (102),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = +1

Query  163  PLNLFQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            PL      +K   RL+GLDVG K VGLA+SDV  ++A+P   + R K   D
Sbjct  7    PLPDLISRLKRDERLMGLDVGTKTVGLALSDVMRQIATPFDTIRRTKFTAD  57



>ref|WP_013420037.1| Holliday junction resolvase [Rhodomicrobium vannielii]
 ref|YP_004012754.1| Holliday junction resolvase YqgF [Rhodomicrobium vannielii ATCC 
17100]
 gb|ADP71655.1| Holliday junction resolvase YqgF [Rhodomicrobium vannielii ATCC 
17100]
Length=156

 Score = 50.4 bits (119),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 40/86 (47%), Gaps = 4/86 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            G + G P +      P A   +  +  L   G L D+   FWDE  S+ + E +L   + 
Sbjct  72   GLVVGLPVNLDGTEGPRAQSTRAFVRSL---GALTDMPMAFWDERLSTAAAERVLLEADA  128

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVN  640
               +   ++DK AA  ILQG LD VN
Sbjct  129  SRKRRAEVIDKMAAAYILQGALDRVN  154


 Score = 43.9 bits (102),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = +1

Query  163  PLNLFQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            PL      +K   RL+GLDVG K VGLA+SDV  ++A+P   + R K   D
Sbjct  7    PLPDLISRLKRDERLMGLDVGTKTVGLALSDVMRQIATPFDTIRRTKFTAD  57



>ref|WP_011240660.1| Holliday junction resolvase [Zymomonas mobilis]
 ref|YP_162520.1| Holliday junction resolvase YqgF [Zymomonas mobilis subsp. mobilis 
ZM4 = ATCC 31821]
 ref|YP_003225630.1| Holliday junction resolvase YqgF [Zymomonas mobilis subsp. mobilis 
NCIMB 11163]
 ref|YP_005620803.1| Holliday junction resolvase YqgF [Zymomonas mobilis subsp. mobilis 
ATCC 10988]
 ref|YP_006517928.1| Holliday junction resolvase [Zymomonas mobilis subsp. mobilis 
ATCC 29191]
 ref|YP_008833062.1| RNAse H-fold protein YqgF [Zymomonas mobilis subsp. mobilis str. 
CP4 = NRRL B-14023]
 gb|AAV89409.1| Holliday junction resolvase YqgF [Zymomonas mobilis subsp. mobilis 
ZM4 = ATCC 31821]
 gb|ACV75046.1| Holliday junction resolvase YqgF [Zymomonas mobilis subsp. mobilis 
NCIMB 11163]
 gb|AEH62352.1| Holliday junction resolvase YqgF [Zymomonas mobilis subsp. mobilis 
ATCC 10988]
 gb|AFN56406.1| Holliday junction resolvase [Zymomonas mobilis subsp. mobilis 
ATCC 29191]
 gb|AHB09835.1| RNAse H-fold protein YqgF [Zymomonas mobilis subsp. mobilis str. 
CP4 = NRRL B-14023]
 gb|AHJ70140.1| Putative Holliday junction resolvase [Zymomonas mobilis subsp. 
mobilis NRRL B-12526]
 gb|AHJ71995.1| Putative Holliday junction resolvase [Zymomonas mobilis subsp. 
mobilis str. CP4 = NRRL B-14023]
Length=179

 Score = 55.1 bits (131),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNIDL  318
            +K  + L LFQE +  +GRL GLDVG K +GLA+ D +  +ASP   + RKK  +DL
Sbjct  26   LKKQEELRLFQEALPRKGRLAGLDVGTKTIGLALCDSQWIIASPAETIRRKKFTLDL  82


 Score = 38.5 bits (88),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 39/84 (46%), Gaps = 5/84 (6%)
 Frame = +2

Query  383  KGFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLN  559
            KG + G P +    ++P    V+    ++      + +    WDE +S+K+V   L   +
Sbjct  95   KGLVIGLPLNLDGSDSPRTQSVRAFAKNVAP----LSLPVLMWDERWSTKAVTRTLLEAD  150

Query  560  LHPVQSKTIVDKFAAVEILQGYLD  631
                +   +VDK AA  ILQG +D
Sbjct  151  ASRARRSEVVDKMAAAYILQGAID  174



>ref|WP_023004059.1| MULTISPECIES: Holliday junction resolvase [Labrenzia]
 gb|ERP85791.1| Holliday junction resolvase [Labrenzia sp. C1B10]
 gb|ERS07307.1| Holliday junction resolvase [Labrenzia sp. C1B70]
Length=162

 Score = 47.8 bits (112),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  175  FQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            F   V  R RL+GLD+G K +GLA+SD+   +ASP+  + RKK  +D
Sbjct  12   FMAAVPDRTRLIGLDLGTKTIGLALSDLGRGIASPMETIRRKKFTLD  58


 Score = 45.4 bits (106),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 41/86 (48%), Gaps = 4/86 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQV-KLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            G + G P +   +    VQ  +  + +L +     D+  T+WDE  S+ +V   L   + 
Sbjct  73   GMVLGLPLNMDGSEGPRVQATRAFVRNLSQK---TDLPITYWDERLSTAAVTRTLLEADT  129

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVN  640
               +   +VDK AA  ILQG+LD + 
Sbjct  130  SRAKRADVVDKMAAAYILQGFLDRLG  155



>gb|KFC72800.1| putative Holliday junction resolvase [Bosea sp. LC85]
Length=163

 Score = 48.9 bits (115),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 33/51 (65%), Gaps = 1/51 (2%)
 Frame = +1

Query  163  PLNLFQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            PL  F  L     RLLGLD+G K +GLA+SDVE ++A+PL  + R K  +D
Sbjct  7    PLETFLNL-PDHARLLGLDLGTKTIGLALSDVERQIATPLETIKRVKFGLD  56


 Score = 43.9 bits (102),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 39/87 (45%), Gaps = 4/87 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQ-VKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            G + G P +        VQ  +  + +L     L  +  TFWDE  S+ +V   L   + 
Sbjct  71   GLVIGLPLNMDGTEGPRVQSTRAFVRNLA---PLTSLPITFWDERMSTLAVTRTLLSADA  127

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVNR  643
               +   +VDK AA  ILQG LD + R
Sbjct  128  SRAKRAEVVDKMAAAYILQGALDRLMR  154



>ref|WP_006934936.1| Holliday junction resolvase [Labrenzia aggregata]
 gb|EAV43799.1| Putative Holliday junction resolvase [Stappia aggregata IAM 12614]
Length=162

 Score = 46.6 bits (109),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 41/86 (48%), Gaps = 4/86 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            G + G P +   +  P A   +  + +L +     D+  T+WDE  S+ +V   L   + 
Sbjct  73   GIVLGLPLNMDGSEGPRAQATRAFVRNLSQK---TDLPITYWDERLSTAAVTRTLLEADT  129

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVN  640
               +   +VDK AA  ILQG+LD + 
Sbjct  130  SRAKRADVVDKMAAAYILQGFLDRLG  155


 Score = 46.2 bits (108),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  175  FQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            F   V +R RL+GLD+G K +GLA+SD+   +ASP+  + RKK  +D
Sbjct  12   FVAAVPARTRLIGLDLGTKTIGLALSDLGLGIASPMETIRRKKFTLD  58



>ref|WP_009800123.1| Holliday junction resolvase [Nitrobacter sp. Nb-311A]
 gb|EAQ34652.1| Holliday junction resolvase YqgF [Nitrobacter sp. Nb-311A]
Length=166

 Score = 53.9 bits (128),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 49/104 (47%), Gaps = 10/104 (10%)
 Frame = +2

Query  383  KGFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLN  559
            KGFI G P +   +  P A   +    +L    +L D+    WDE  S+ +VE  L  L+
Sbjct  71   KGFILGLPINMDGSEGPRAQSTRAFARNLA---RLTDLAIGLWDERLSTAAVERELIGLD  127

Query  560  LHPVQSKTIVDKFAAVEILQGYLDYVNRNDKMKLSARSEEPADE  691
            +   +   ++D+ AA+ ILQG L      D++    RS  P D 
Sbjct  128  MSRARRARVIDEHAAIFILQGAL------DRLAAQRRSSGPGDH  165


 Score = 38.5 bits (88),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +1

Query  196  RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            RG L+GLD+G + +G+AVSD + +LA+ +  + RK    D
Sbjct  18   RGALVGLDLGTRTIGVAVSDPDRRLATGVETIRRKAFTAD  57



>ref|WP_032112172.1| Holliday junction resolvase [Candidatus Paracaedibacter symbiosus]
Length=152

 Score = 49.3 bits (116),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 41/83 (49%), Gaps = 4/83 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ G P +      P A + +  ID L     ++D+   FWDE  S+ +V   L   +L
Sbjct  70   GFVIGLPLNMNGSEGPQAQKARAFIDALL---TVIDIPVYFWDERLSTVAVTRTLLEADL  126

Query  563  HPVQSKTIVDKFAAVEILQGYLD  631
               +   +VDK AA  ILQG LD
Sbjct  127  SRKKRAQVVDKMAATFILQGALD  149


 Score = 42.7 bits (99),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  166  LNLFQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIR  297
            L+  +EL   + RLLGLD+G K +GLA+SD+   ++SPL V+ R
Sbjct  6    LDDLKELKSGKNRLLGLDLGEKTIGLALSDITWFISSPLEVIRR  49



>ref|WP_038461764.1| Holliday junction resolvase [Candidatus Caedibacter acanthamoebae]
 gb|AIL12924.1| Holliday junction resolvase [Candidatus Caedibacter acanthamoebae]
Length=148

 Score = 47.8 bits (112),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +1

Query  166  LNLFQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNIDL  318
            +N  + L  ++ RL+GLDVG K +GLA+SD    +A+PL  L RKK   D+
Sbjct  1    MNSLKSLKNNKNRLMGLDVGTKTIGLALSDTTWTIATPLQTLERKKFKQDI  51


 Score = 43.1 bits (100),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 42/87 (48%), Gaps = 4/87 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            G + G+P +      P    +K    +L      +D+  +FWDE  S+ +V   L   ++
Sbjct  65   GLVIGFPKNMDGSEGPRCQSIKQFSYNLLTE---IDIHISFWDERLSTVAVTRALLEADV  121

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVNR  643
               + + +VDK AA  ILQG LD + R
Sbjct  122  SRKRRQEVVDKMAASYILQGVLDTLTR  148



>ref|WP_013933767.1| Holliday junction resolvase [Zymomonas mobilis]
 ref|YP_004661658.1| Holliday junction resolvase YqgF [Zymomonas mobilis subsp. pomaceae 
ATCC 29192]
 gb|AEI37368.1| Holliday junction resolvase YqgF [Zymomonas mobilis subsp. pomaceae 
ATCC 29192]
Length=174

 Score = 52.8 bits (125),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +1

Query  151  KYMKPLNLFQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNIDL  318
            K  + L LF+E + S GRL GLDVG K +GLAV D +  +ASP   + RKK  +D 
Sbjct  22   KKQQELKLFREALPSGGRLAGLDVGTKTIGLAVCDSQWIIASPSETIRRKKFTLDF  77


 Score = 38.1 bits (87),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 24/84 (29%), Positives = 38/84 (45%), Gaps = 5/84 (6%)
 Frame = +2

Query  383  KGFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLN  559
            KG + G P      ++P    V+    ++   G    +    WDE +S+K+V   L   +
Sbjct  90   KGLVIGLPLSLDGTDSPRTQSVRAFSRNMEPLG----LPVLMWDERWSTKAVTRTLLEAD  145

Query  560  LHPVQSKTIVDKFAAVEILQGYLD  631
                +   +VDK AA  ILQG +D
Sbjct  146  ASRARRSEVVDKMAAAYILQGAID  169



>ref|WP_008890778.1| Holliday junction resolvase [Thalassospira profundimaris]
 gb|EKF07736.1| Holliday junction resolvase YqgF [Thalassospira profundimaris 
WP0211]
Length=174

 Score = 48.9 bits (115),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 50/89 (56%), Gaps = 5/89 (6%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAV-QVKLLIDDLCETGKLVDVKYTFWDESFSSKSVE-MLLKPLN  559
            G I G+P +   +   A  +V   ID   E  K +D+    WDE  S+ +VE +L++ ++
Sbjct  70   GIIIGFPRELDGSIGKACHRVYAFID---EMEKYIDLPVLMWDERLSTNAVERILIEEVD  126

Query  560  LHPVQSKTIVDKFAAVEILQGYLDYVNRN  646
            +   +   +VDK AA  ILQG LD++NR+
Sbjct  127  MTRKRRAEVVDKTAAAYILQGALDHLNRH  155


 Score = 41.6 bits (96),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 35/53 (66%), Gaps = 3/53 (6%)
 Frame = +1

Query  169  NLFQELVK---SRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNIDL  318
            N  QEL++      R+LGLD+G K +G+A+SDV  ++ASP  ++ RKK   D+
Sbjct  4    NDTQELLRFLPPAARVLGLDLGTKTIGVALSDVGLQIASPYELISRKKFTRDI  56



>ref|WP_019966391.1| Holliday junction resolvase [Pannonibacter phragmitetus]
Length=175

 Score = 46.6 bits (109),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +1

Query  163  PLNLFQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            PL  F   V    RL+GLD+G K +GLA+SD+   +A+PL  + R+K  +D
Sbjct  8    PLEDFIAAVAPGSRLIGLDLGTKTIGLALSDIGRGIATPLETIRREKFTLD  58


 Score = 43.9 bits (102),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 40/86 (47%), Gaps = 4/86 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQV-KLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            G + G P +   +    VQ  +  + +L E   L     T+WDE  S+ +V   L   + 
Sbjct  73   GLVMGLPLNMDGSEGPRVQATRAFVRNLAEKTPL---PVTYWDERLSTAAVTRTLIEADR  129

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVN  640
               +   +VDK AA  ILQG+LD + 
Sbjct  130  SRARRAELVDKMAAAYILQGFLDRLG  155



>ref|WP_038368799.1| Holliday junction resolvase [Bosea sp. UNC402CLCol]
Length=165

 Score = 47.0 bits (110),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = +1

Query  196  RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNIDLMA  324
              RLLGLD+G K +GLA+SDVE  +A+PL  + R K  +D  A
Sbjct  17   HARLLGLDLGTKTIGLALSDVERSIATPLETIQRVKFGLDAAA  59


 Score = 43.1 bits (100),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 40/87 (46%), Gaps = 4/87 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQ-VKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            G + G P +   +    VQ  +  + +L     L ++   FWDE  S+ +V   L   + 
Sbjct  71   GLVIGLPLNMDGSEGPRVQSTRAFVRNLA---PLTELPIVFWDERMSTLAVTRTLLDADA  127

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVNR  643
               +   +VDK AA  ILQG LD + R
Sbjct  128  SRAKRAAVVDKMAAAYILQGALDRLAR  154



>ref|WP_006020907.1| MULTISPECIES: RNAse H-fold protein YqgF [Afipia]
 gb|EKS38348.1| RNAse H-fold protein YqgF [Afipia broomeae ATCC 49717]
Length=163

 Score = 46.6 bits (109),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 42/85 (49%), Gaps = 4/85 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GFI G P +   +  P A   +    +     KL D+    WDE  S+ +VE  L  +++
Sbjct  72   GFILGLPINMDGSEGPRAQSTRAFARNFA---KLTDLAIGLWDERLSTVAVERELIDMDM  128

Query  563  HPVQSKTIVDKFAAVEILQGYLDYV  637
               +   ++D+ AA+ ILQG LD +
Sbjct  129  SRAKRAKVIDEHAAIFILQGALDRL  153


 Score = 43.9 bits (102),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +1

Query  157  MKPLNLFQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            + PL     L  +RG L+GLD+G K +G+AVSD + KLA+ +  + RK    D
Sbjct  5    IHPLIEAAALWPARGALIGLDLGTKTIGVAVSDPDRKLATGIETIQRKTFTAD  57



>ref|WP_029061444.1| Holliday junction resolvase [Labrenzia sp. DG1229]
Length=160

 Score = 44.7 bits (104),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +1

Query  202  RLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            RL+GLD+G K +GLA+SD+   +ASP+  + RKK  ID
Sbjct  21   RLIGLDLGTKTIGLALSDLGRGIASPMETIRRKKFTID  58


 Score = 44.7 bits (104),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 39/86 (45%), Gaps = 4/86 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            G + G P +      P A   +    +L +     ++  TFWDE  S+ +V   L   + 
Sbjct  73   GIVLGLPLNMDGTEGPRAQATRAFARNLAQK---TELPITFWDERLSTAAVTRTLLEADS  129

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVN  640
               +   +VDK AA  ILQG+LD + 
Sbjct  130  SRAKRAEVVDKMAAAYILQGFLDRLG  155



>ref|WP_033069952.1| Holliday junction resolvase, partial [Thalassospira australica]
Length=146

 Score = 48.5 bits (114),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 49/88 (56%), Gaps = 5/88 (6%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAV-QVKLLIDDLCETGKLVDVKYTFWDESFSSKSVE-MLLKPLN  559
            G I G+P +   +   A  +V   ID   E  K +D+    WDE  S+ +VE +L++ ++
Sbjct  62   GIIIGFPRELDGSIGKACHRVYAFID---EMEKHIDLPVLMWDERLSTNAVERILIEEVD  118

Query  560  LHPVQSKTIVDKFAAVEILQGYLDYVNR  643
            +   +   +VDK AA  ILQG LD++NR
Sbjct  119  MTRKRRAEVVDKTAAAYILQGALDHLNR  146


 Score = 41.2 bits (95),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 34/49 (69%), Gaps = 2/49 (4%)
 Frame = +1

Query  199  GRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNIDLMATDFQSLV  345
             R+LGLD+G K +G+A+SDV  ++ASP  ++ RKK + D+  T   S++
Sbjct  9    ARVLGLDLGTKTIGVALSDVGLQIASPYELISRKKFSRDM--TQLSSII  55



>ref|WP_012974539.1| Holliday junction resolvase [Azospirillum lipoferum]
 ref|YP_003449111.1| holliday junction resolvase [Azospirillum sp. B510]
 dbj|BAI72567.1| holliday junction resolvase [Azospirillum sp. B510]
Length=178

 Score = 49.7 bits (117),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/108 (29%), Positives = 52/108 (48%), Gaps = 4/108 (4%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLV--DVKYTFWDESFSSKSVE-MLLKP  553
            G + G P +   +  P A  V+   ++L E   L+  + +  FWDE  S+ +VE  ++  
Sbjct  69   GLVVGLPLNMDGSEGPRAESVRAFANNLLERSDLLGWEAEIAFWDERLSTSAVERFMIGE  128

Query  554  LNLHPVQSKTIVDKFAAVEILQGYLDYVNRNDKMKLSARSEEPADEDG  697
             ++   +   +VDK AA  ILQG LD +    ++   A  +    EDG
Sbjct  129  ADMTRKRRDEVVDKMAAAYILQGALDMLANQRRLAAEADGDGEGMEDG  176


 Score = 39.7 bits (91),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +1

Query  202  RLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            RLLGLDVG K VGLAV+D    +ASP+  L R K   D
Sbjct  17   RLLGLDVGTKTVGLAVADPGLIVASPIGTLKRTKFTQD  54



>ref|WP_011315249.1| Holliday junction resolvase [Nitrobacter winogradskyi]
 ref|YP_318615.1| holliday junction resolvase-like protein [Nitrobacter winogradskyi 
Nb-255]
 sp|Q3SR28.1|RUVX_NITWN RecName: Full=Putative Holliday junction resolvase [Nitrobacter 
winogradskyi Nb-255]
 gb|ABA05263.1| Holliday junction resolvase YqgF [Nitrobacter winogradskyi Nb-255]
Length=163

 Score = 49.3 bits (116),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 43/86 (50%), Gaps = 4/86 (5%)
 Frame = +2

Query  383  KGFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLN  559
            +GFI G P +   +  P A   +    +L    +L D     WDE  S+ +VE  L  L+
Sbjct  71   EGFILGLPINMDGSEGPRAQSTRAFARNLA---RLTDFAIGLWDERLSTAAVERELIGLD  127

Query  560  LHPVQSKTIVDKFAAVEILQGYLDYV  637
            +   +   ++D+ AA+ ILQG LD +
Sbjct  128  MSRARRAKVIDEHAAIFILQGALDRL  153


 Score = 40.0 bits (92),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +1

Query  193  SRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            +RG L+GLD+G K +G+AVSD + +LA+ +  + RK    D
Sbjct  17   ARGALVGLDLGTKTIGVAVSDPDRRLATGVETIRRKTFTAD  57



>ref|WP_029039843.1| Holliday junction resolvase [Cucumibacter marinus]
Length=158

 Score = 45.4 bits (106),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 33/56 (59%), Gaps = 0/56 (0%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            M    P N    ++ + GRLLGLD+G K +G+AVSD  +  A+P+  + RKK   D
Sbjct  1    MPETTPENDIASILPNVGRLLGLDLGTKTIGVAVSDSLHMSATPVETIARKKFTKD  56


 Score = 44.3 bits (103),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 39/85 (46%), Gaps = 4/85 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            G + G P +      P A   +    +L    +L D+   +WDE  S+ +V   +   ++
Sbjct  71   GIVLGLPLNMDGTEGPRAQSTRAFARNLQ---RLTDLPIAYWDERLSTHAVTRTMLEADM  127

Query  563  HPVQSKTIVDKFAAVEILQGYLDYV  637
               +   IVDK AA  ILQG LD +
Sbjct  128  SRARRAEIVDKLAASYILQGALDRL  152



>ref|WP_022729523.1| Holliday junction resolvase [Fodinicurvata sediminis]
Length=165

 Score = 45.4 bits (106),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = +1

Query  196  RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNIDLMA  324
            R RLLGLD+G K +GLA+S+    LASPL  + RKK   D  A
Sbjct  16   RTRLLGLDLGEKTIGLAISESAFSLASPLETIARKKFTRDAEA  58


 Score = 43.9 bits (102),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 41/87 (47%), Gaps = 3/87 (3%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVE-MLLKPLN  559
            G +FG P     +    A   +    +L E   L D+   FWDE  S+ +VE  L+   +
Sbjct  70   GLVFGLPVHMDGSEGTRARSTRQFARNLSEIAGL-DLPTAFWDERLSTAAVERFLVDEAD  128

Query  560  LHPVQSKTIVDKFAAVEILQGYLDYVN  640
            +   +   +VDK AA  ILQG LD + 
Sbjct  129  MSRAKRGKVVDKMAAAYILQGALDALR  155



>ref|WP_026988068.1| Holliday junction resolvase [Fodinicurvata fenggangensis]
Length=165

 Score = 46.6 bits (109),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +1

Query  196  RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            R RLLGLD+G K +GLA+SD    LASPL  + RKK   D
Sbjct  16   RTRLLGLDLGEKTIGLAISDSAFSLASPLETIARKKFTKD  55


 Score = 42.4 bits (98),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 41/87 (47%), Gaps = 3/87 (3%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVE-MLLKPLN  559
            G +FG P     +    A   +    +L E   L D+   FWDE  S+ +VE  L+   +
Sbjct  70   GLVFGLPVHMDGSEGTRARSTRQFARNLSEIAGL-DLPTAFWDERLSTAAVERFLVDEAD  128

Query  560  LHPVQSKTIVDKFAAVEILQGYLDYVN  640
            +   +   +VDK AA  ILQG LD + 
Sbjct  129  MSRAKRGKVVDKMAAGYILQGALDALR  155



>ref|WP_028481861.1| Holliday junction resolvase [Nesiotobacter exalbescens]
Length=164

 Score = 49.3 bits (116),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +1

Query  166  LNLFQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            L+ F++ +   GR++GLD+G K +GLA+SD+   +A+PL  + RKK  +D
Sbjct  10   LDEFEQTLPDTGRVMGLDLGTKTIGLALSDLGRSIATPLETIKRKKFTLD  59


 Score = 39.7 bits (91),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 38/86 (44%), Gaps = 4/86 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQ-VKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            G + G P +   +    VQ  K    +L +      +   FWDE  S+ +V   L   + 
Sbjct  74   GLVLGLPLNMDGSEGPRVQSTKAFARNLAQR---TSIPMVFWDERLSTAAVTRTLIDADR  130

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVN  640
               +   +VDK AA  ILQG LD ++
Sbjct  131  SRARRAELVDKMAASYILQGLLDRLH  156



>ref|WP_020593528.1| hypothetical protein [Kiloniella laminariae]
Length=160

 Score = 48.1 bits (113),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 38/55 (69%), Gaps = 2/55 (4%)
 Frame = +1

Query  157  MKPLNLFQ--ELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            M+ ++L+   EL+    RLLGLD G+K +G+AVSD + K+ASP+  ++R K  +D
Sbjct  1    MQDIDLYDLPELLDRNQRLLGLDPGSKTIGMAVSDRDYKVASPIGTILRSKFKVD  55


 Score = 40.8 bits (94),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 41/89 (46%), Gaps = 3/89 (3%)
 Frame = +2

Query  386  GFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVE-MLLKPLN  559
              + G P +      P    V+ L ++L +      +   FWDE  S+ +VE  L+   +
Sbjct  70   ALVMGLPVNMDGTEGPRCQSVRTLAENLHKLAGFT-IPIVFWDERMSTSAVERFLIGEAD  128

Query  560  LHPVQSKTIVDKFAAVEILQGYLDYVNRN  646
            +   +   +VDK AA  ILQG LD + R 
Sbjct  129  MTRKRRSEVVDKAAAAYILQGALDALQRR  157



>ref|WP_037020803.1| Holliday junction resolvase, partial [Rhizobiales bacterium YIM 
77505]
Length=154

 Score = 49.3 bits (116),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +1

Query  199  GRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNIDLMA  324
             RLLG+D+G K +GLA+SDVE ++A+PL  + R K  ID  A
Sbjct  15   ARLLGIDLGTKTIGLALSDVERRIATPLETIKRSKFTIDASA  56


 Score = 39.7 bits (91),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/90 (29%), Positives = 40/90 (44%), Gaps = 4/90 (4%)
 Frame = +2

Query  383  KGFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLN  559
            +G + G P +      P A   +    +L     +V     FWDE  S+ +V   L   +
Sbjct  67   QGLVLGLPLNMDGTEGPRAQAARAFARNLA---PVVKRPIAFWDERLSTVAVTRTLLDAD  123

Query  560  LHPVQSKTIVDKFAAVEILQGYLDYVNRND  649
                +   +VDK AA  ILQG+LD + R +
Sbjct  124  TSRARRGALVDKLAAAYILQGFLDRLARPE  153



>ref|WP_012111762.1| Holliday junction resolvase [Parvibaculum lavamentivorans]
 ref|YP_001414105.1| Holliday junction resolvase YqgF [Parvibaculum lavamentivorans 
DS-1]
 gb|ABS64448.1| Holliday junction resolvase YqgF [Parvibaculum lavamentivorans 
DS-1]
Length=182

 Score = 44.7 bits (104),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 39/87 (45%), Gaps = 4/87 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
              +FG P +      P     +  I +L    KL D+   FWDE  S+ +V   L   + 
Sbjct  98   ALVFGLPLNMDGTEGPRCQSTRAFIRNL---EKLTDLPIAFWDERLSTMAVTRTLLDADA  154

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVNR  643
               +   +VDK AA  ILQG LD + +
Sbjct  155  SRARRAELVDKMAAAYILQGALDRLRK  181


 Score = 43.9 bits (102),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 39/68 (57%), Gaps = 5/68 (7%)
 Frame = +1

Query  127  SHSGFFEMKY-----MKPLNLFQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVL  291
            + +GFF+        +KPL   +  +    RL+G+D+G+K +GLA+SDV   +ASPL  +
Sbjct  16   ARTGFFKESNRLSGNLKPLAELKVGLGRNRRLIGVDLGSKTIGLALSDVSLSIASPLETI  75

Query  292  IRKKSNID  315
             R K   D
Sbjct  76   RRTKFTAD  83



>ref|WP_029585403.1| Holliday junction resolvase [Bradyrhizobium sp. URHD0069]
Length=163

 Score = 47.8 bits (112),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 42/85 (49%), Gaps = 4/85 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ G P +   +  P A   +    +     KL D+    WDE  S+ +VE  L  +++
Sbjct  72   GFVLGLPINMDASEGPRAQSTRAFARNFS---KLTDLAIALWDERLSTAAVERELIGMDM  128

Query  563  HPVQSKTIVDKFAAVEILQGYLDYV  637
               +   ++D+ AA+ ILQG LD +
Sbjct  129  SRARRAEVIDEHAAIFILQGALDRL  153


 Score = 40.4 bits (93),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +1

Query  196  RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            RG L+GLD+G K +G+AVSD + +LA+ +  + RK   +D
Sbjct  18   RGALVGLDLGTKTIGVAVSDPDRRLATGVETIQRKAFKVD  57



>ref|WP_013652597.1| Holliday junction resolvase [Polymorphum gilvum]
 ref|YP_004303581.1| endonuclease [Polymorphum gilvum SL003B-26A1]
 gb|ADZ70279.1| Predicted endonuclease involved in recombination [Polymorphum 
gilvum SL003B-26A1]
Length=166

 Score = 45.8 bits (107),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/91 (31%), Positives = 44/91 (48%), Gaps = 7/91 (8%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQV-KLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            G + G P +   +    VQ  +    +L E     D+  T+WDE  S+ +V   L   + 
Sbjct  73   GLVLGLPLNMDGSEGPRVQATRAFARNLAEK---TDLPITYWDERLSTAAVTRTLIEADR  129

Query  563  HPVQSKTIVDKFAAVEILQGYLD---YVNRN  646
               +   +VDK AA  ILQG+LD   Y++R+
Sbjct  130  SRARRAELVDKMAAAYILQGFLDRLGYLSRS  160


 Score = 42.4 bits (98),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +1

Query  202  RLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            RL+GLD+G + +GLA+SD+   +ASPL  + R+K  +D
Sbjct  21   RLIGLDLGTRTIGLALSDLGRGIASPLETIRRRKFTLD  58



>ref|WP_015459774.1| Holliday junction resolvase-like protein [Sphingomonas sp. MM-1]
 ref|YP_007617402.1| Holliday junction resolvase-like protein [Sphingomonas sp. MM-1]
 gb|AGH50806.1| Holliday junction resolvase-like protein [Sphingomonas sp. MM-1]
Length=153

 Score = 46.2 bits (108),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +1

Query  175  FQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNIDL  318
            F+E +   GRL GLDVG K +G+A+ D    +ASP  ++ R+K  +DL
Sbjct  9    FREALPEGGRLAGLDVGTKTIGVALCDAMWTIASPAELIERRKFTVDL  56


 Score = 42.0 bits (97),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 24/89 (27%), Positives = 41/89 (46%), Gaps = 5/89 (6%)
 Frame = +2

Query  383  KGFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLN  559
            +G + G P +    ++P    V+  + +L   G    +    WDE +S+ +V   L   +
Sbjct  69   RGLVVGLPLNMDGSDSPRTQSVRAFVRNLEPLG----LPVLLWDERWSTAAVTRTLLEAD  124

Query  560  LHPVQSKTIVDKFAAVEILQGYLDYVNRN  646
                +   +VDK AA  ILQG +D + R 
Sbjct  125  ASRARRAELVDKMAAAYILQGAIDALTRG  153



>ref|WP_010125183.1| Holliday junction resolvase [Sphingomonas sp. KC8]
Length=152

 Score = 47.4 bits (111),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +1

Query  175  FQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNIDL  318
            F+E     GRL GLDVG K +G+AV D    +ASP  ++ R+K  +DL
Sbjct  9    FREAFPEGGRLAGLDVGTKTIGVAVCDAMWTIASPAELIERRKFTVDL  56


 Score = 40.8 bits (94),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 41/88 (47%), Gaps = 5/88 (6%)
 Frame = +2

Query  383  KGFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLN  559
            +G + G P +    ++P    V+  + +L   G    +    WDE +S+ +V   L   +
Sbjct  69   RGLVVGLPLNMDGSDSPRTQSVRAFVRNLDPLG----LPILLWDERWSTAAVTRTLLEAD  124

Query  560  LHPVQSKTIVDKFAAVEILQGYLDYVNR  643
                +   +VDK AA  ILQG +D + R
Sbjct  125  ASRARRAELVDKMAAAYILQGAIDGLTR  152



>ref|WP_008552975.1| Holliday junction resolvase [Pseudovibrio sp. JE062]
 gb|EEA91932.1| conserved hypothetical protein TIGR00250 [Pseudovibrio sp. JE062]
Length=165

 Score = 46.2 bits (108),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 40/86 (47%), Gaps = 4/86 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            G + G P +      P     +  + +L +     ++  T+WDE  S+ +V   L   + 
Sbjct  73   GLVIGLPLNMDGTEGPRCQATRAFVRNLAQK---TEIPITYWDERLSTAAVTRTLIEADR  129

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVN  640
               +   +VDK AA  ILQG+LD VN
Sbjct  130  SRARRAELVDKMAATYILQGFLDRVN  155


 Score = 42.0 bits (97),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +1

Query  166  LNLFQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNIDL  318
            L  F + +    RL+G+D+G K +GLA++D   ++ASPL  + RKK   D+
Sbjct  9    LEDFCDALYDDDRLIGIDLGTKTIGLALTDSGRQIASPLETIKRKKFTQDV  59



>ref|WP_014286226.1| Holliday junction resolvase [Pseudovibrio sp. FO-BEG1]
 ref|YP_005082302.1| Resolvase, holliday junction-type, YqgF-like protein [Pseudovibrio 
sp. FO-BEG1]
 gb|AEV38280.1| Resolvase, holliday junction-type, YqgF-like protein [Pseudovibrio 
sp. FO-BEG1]
Length=165

 Score = 46.2 bits (108),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 40/86 (47%), Gaps = 4/86 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            G + G P +      P     +  + +L +     ++  T+WDE  S+ +V   L   + 
Sbjct  73   GLVIGLPLNMDGTEGPRCQATRAFVRNLAQK---TEIPITYWDERLSTAAVTRTLIEADR  129

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVN  640
               +   +VDK AA  ILQG+LD VN
Sbjct  130  SRARRAELVDKMAATYILQGFLDRVN  155


 Score = 42.0 bits (97),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +1

Query  166  LNLFQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNIDL  318
            L  F + +    RL+G+D+G K +GLA++D   ++ASPL  + RKK   D+
Sbjct  9    LEDFCDALYDDDRLIGIDLGTKTIGLALTDSGRQIASPLETIKRKKFTQDV  59



>sp|Q1QL26.2|RUVX_NITHX RecName: Full=Putative Holliday junction resolvase [Nitrobacter 
hamburgensis X14]
Length=163

 Score = 47.8 bits (112),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 43/85 (51%), Gaps = 4/85 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ G P +   +  P A   +    +L    +L D+    WDE  S+ +VE  L  +++
Sbjct  72   GFVLGLPINMDGSEGPRAQSTRAFARNLA---RLTDLAIGLWDERLSTVAVERELIGMDM  128

Query  563  HPVQSKTIVDKFAAVEILQGYLDYV  637
               +   ++D+ AA+ ILQG LD +
Sbjct  129  SRAKRAKVIDEHAAIFILQGALDRL  153


 Score = 40.4 bits (93),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +1

Query  196  RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            RG L+GLD+G K +G+AVSD + +LA+ +  L RK    D
Sbjct  18   RGALVGLDLGTKTIGVAVSDPDRRLATGVETLQRKTFTAD  57



>ref|WP_011510748.1| Holliday junction resolvase [Nitrobacter hamburgensis]
 ref|YP_577531.1| Holliday junction resolvase-like protein [Nitrobacter hamburgensis 
X14]
 gb|ABE63071.1| Holliday junction resolvase YqgF [Nitrobacter hamburgensis X14]
Length=168

 Score = 47.4 bits (111),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 43/85 (51%), Gaps = 4/85 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ G P +   +  P A   +    +L    +L D+    WDE  S+ +VE  L  +++
Sbjct  77   GFVLGLPINMDGSEGPRAQSTRAFARNLA---RLTDLAIGLWDERLSTVAVERELIGMDM  133

Query  563  HPVQSKTIVDKFAAVEILQGYLDYV  637
               +   ++D+ AA+ ILQG LD +
Sbjct  134  SRAKRAKVIDEHAAIFILQGALDRL  158


 Score = 40.4 bits (93),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +1

Query  196  RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            RG L+GLD+G K +G+AVSD + +LA+ +  L RK    D
Sbjct  23   RGALVGLDLGTKTIGVAVSDPDRRLATGVETLQRKTFTAD  62



>ref|WP_036766962.1| Holliday junction resolvase [Parvularcula oceani]
Length=157

 Score = 45.8 bits (107),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 38/86 (44%), Gaps = 4/86 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            G + G P +      P A   +  + +L    +  D+   FWDE  S+ + E  L  L+ 
Sbjct  68   GLVMGLPLNMDGTEGPRAQSARAFVRNLS---RHSDLPVAFWDERLSTAAAERELIALDT  124

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVN  640
               +   I+D  AA  ILQG LD + 
Sbjct  125  KRAKRARIIDAHAAAHILQGALDRLR  150


 Score = 42.0 bits (97),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +1

Query  199  GRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            G L+GLD+G K +G+AVS+ E  LASP++ + R K   D
Sbjct  15   GPLIGLDLGTKTIGVAVSNPERNLASPVTTIKRSKFTAD  53



>ref|WP_034996497.1| Holliday junction resolvase [Beijerinckia mobilis]
Length=170

 Score = 47.0 bits (110),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +1

Query  184  LVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            L+ SR RL+G+D+G K +GL++SD+E ++A+PL  + R K   D
Sbjct  14   LLASRQRLIGIDLGTKTIGLSLSDLERRIATPLETIRRTKFTKD  57


 Score = 40.8 bits (94),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 38/89 (43%), Gaps = 2/89 (2%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
             F+ G P +        VQ        C    L +  + +WDE  S+ +V   L   +  
Sbjct  72   AFVIGLPLNMDGTAGPRVQATEAFVRNC--AALTNRPFCYWDERLSTAAVTRDLIAQDAS  129

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNRNDK  652
              +   +VDK AA  ILQG LD +  +D+
Sbjct  130  RAKRAAVVDKLAAAFILQGALDRLAWSDE  158



>ref|WP_024575135.1| MULTISPECIES: Holliday junction resolvase [Afipia]
Length=163

 Score = 44.3 bits (103),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 42/85 (49%), Gaps = 4/85 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ G P +   +  P A   +    +     KL ++    WDE  S+ +VE  L  +++
Sbjct  72   GFVLGLPINMDGSEGPRAQSTRAFARNFA---KLTELAIGLWDERLSTVAVERELIDMDM  128

Query  563  HPVQSKTIVDKFAAVEILQGYLDYV  637
               +   ++D+ AA+ ILQG LD +
Sbjct  129  SRAKRAKVIDEHAAIFILQGALDRL  153


 Score = 43.5 bits (101),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = +1

Query  163  PLNLFQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            PL     L  +RG L+GLD+G K +G+AVSD + KLA+ +  + RK    D
Sbjct  7    PLIEAAALWPARGALIGLDLGTKTIGVAVSDPDRKLATGIETIQRKTFTAD  57



>ref|WP_029006906.1| Holliday junction resolvase [Azospirillum halopraeferens]
Length=180

 Score = 44.3 bits (103),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 47/96 (49%), Gaps = 4/96 (4%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLV--DVKYTFWDESFSSKSVE-MLLKP  553
            G + G P +   +  P A   +   ++L     L+  D +  FWDE  S+ +VE  ++  
Sbjct  69   GLVIGMPLNMDGSEGPRAQSTRQFAENLLARPDLLGWDPRIAFWDERLSTAAVERFMIGQ  128

Query  554  LNLHPVQSKTIVDKFAAVEILQGYLDYVNRNDKMKL  661
             ++   +   +VDK AA  ILQG LD+++   +  L
Sbjct  129  ADMTRKRRDEVVDKMAAAYILQGALDWLSNERRRAL  164


 Score = 43.5 bits (101),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 31/50 (62%), Gaps = 5/50 (10%)
 Frame = +1

Query  199  GRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNIDLMATDFQSLVR  348
            GRLLGLDVG K +GLAVSD    +ASP+  + R K     +A D + L R
Sbjct  16   GRLLGLDVGTKTIGLAVSDPGLVVASPIGTIRRTK-----LAQDARELAR  60



>ref|WP_013299526.1| Holliday junction resolvase [Parvularcula bermudensis]
 ref|YP_003853693.1| endonuclease [Parvularcula bermudensis HTCC2503]
 gb|ADM08552.1| putative endonuclease [Parvularcula bermudensis HTCC2503]
Length=158

 Score = 44.7 bits (104),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/88 (30%), Positives = 38/88 (43%), Gaps = 4/88 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            G I G P +   +  P A   +    +L + G L      +WDE  SS + E  L   + 
Sbjct  68   GLIIGVPLNMDGSEGPRAQSARTFGRNLSQRGPL---PVAYWDERLSSVAAERALLATDT  124

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVNRN  646
               +   ++D  AA  ILQG LD +  N
Sbjct  125  SRARRAEVIDAHAATHILQGALDRLATN  152


 Score = 42.4 bits (98),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  196  RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            +G LLGLD G+K +G+AVS  E +LA+P++V+ R K   D
Sbjct  14   KGPLLGLDPGSKTIGVAVSTPERRLATPVTVIRRTKFGKD  53



>ref|WP_033368506.1| Holliday junction resolvase, partial [Thalassospira lucentensis]
Length=146

 Score = 46.2 bits (108),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 47/88 (53%), Gaps = 5/88 (6%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAV-QVKLLIDDLCETGKLVDVKYTFWDESFSSKSVE-MLLKPLN  559
            G + G+P +       A  +V   ID   E  K +D+    WDE  S+ +VE +L++ ++
Sbjct  62   GIVIGFPRELDGTIGKACHRVYAFID---EMEKYIDLPVLMWDERLSTNAVERILIQEVD  118

Query  560  LHPVQSKTIVDKFAAVEILQGYLDYVNR  643
            +   +   +VDK AA  ILQG LD +NR
Sbjct  119  MTRKRRAEVVDKTAAAYILQGALDNLNR  146


 Score = 40.4 bits (93),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  199  GRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNIDL  318
             R+LGLD+G K +G+A+SDV  ++ASP  ++ RKK   D+
Sbjct  9    ARVLGLDLGTKTIGVALSDVGLQIASPYELISRKKFTRDV  48



>ref|WP_002715494.1| RNAse H-fold protein YqgF [Afipia felis]
 gb|EKS27893.1| RNAse H-fold protein YqgF [Afipia felis ATCC 53690]
Length=167

 Score = 47.0 bits (110),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 42/85 (49%), Gaps = 4/85 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ G P +   +  P A   +    +     KL D+    WDE  S+ +VE  L  +++
Sbjct  77   GFVLGLPINMDGSEGPRAQSTRAFARNFA---KLTDLAIGLWDERLSTAAVERELISIDV  133

Query  563  HPVQSKTIVDKFAAVEILQGYLDYV  637
               +   ++D+ AA+ ILQG LD +
Sbjct  134  SRARRAEVIDEHAAIFILQGALDRL  158


 Score = 39.7 bits (91),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 22/65 (34%), Positives = 37/65 (57%), Gaps = 5/65 (8%)
 Frame = +1

Query  196  RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNIDLMATDFQSLVRLSFLNYL*A  375
            RG L+GLD+G K +G+AVSD + +LA+ ++ + R+         D   L+R+S       
Sbjct  23   RGALIGLDLGTKTIGVAVSDPDRRLATGVTTIQRRN-----FTKDAAELLRISAERACAG  77

Query  376  FLEGI  390
            F+ G+
Sbjct  78   FVLGL  82



>ref|WP_013411951.1| Holliday junction resolvase [Caldicellulosiruptor owensensis]
 ref|YP_004002365.1| holliday junction resolvase yqgf [Caldicellulosiruptor owensensis 
OL]
 gb|ADQ04565.1| Holliday junction resolvase YqgF [Caldicellulosiruptor owensensis 
OL]
Length=138

 Score = 56.2 bits (134),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 52/87 (60%), Gaps = 5/87 (6%)
 Frame = +2

Query  392  IFGYPFDRQRNNPDAVQVKLL-IDDLCE-TGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            + GYP  +   +PD    KL  ID++ E  G   +V+   WDE FS+K+VE ++    L+
Sbjct  55   VIGYPLSKL--HPDLKDEKLKKIDEISEKIGSRYNVEIVKWDERFSTKAVERVMNE-ELN  111

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNRN  646
              + K ++DK AAV ILQGYLD+ N N
Sbjct  112  WKRKKKVIDKVAAVYILQGYLDFYNGN  138


 Score = 30.4 bits (67),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 17/46 (37%), Positives = 27/46 (59%), Gaps = 1/46 (2%)
 Frame = +1

Query  202  RLLGLDVGNKYVGLAVSDVENKLASP-LSVLIRKKSNIDLMATDFQ  336
            R+L LD+GN  VG+A+SD     A P +++ ++ K   D +   FQ
Sbjct  2    RILCLDIGNSRVGVAISDPLKITAQPVMTIELKNKDLFDELDKIFQ  47



>ref|WP_010302895.1| Holliday junction resolvase [Candidatus Odyssella thessalonicensis]
Length=156

 Score = 47.4 bits (111),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 35/51 (69%), Gaps = 6/51 (12%)
 Frame = +1

Query  172  LFQE----LVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNI  312
            +FQE    L   R R LGLDVGNK VG+AVSD    +ASPL++L  K+SN+
Sbjct  4    IFQEEFFKLKSKRKRALGLDVGNKTVGMAVSDATWLIASPLTLL--KRSNL  52


 Score = 39.3 bits (90),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 39/88 (44%), Gaps = 4/88 (5%)
 Frame = +2

Query  389  FIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
             + G P +      P A  V   ID L    K+ D+    WDE  S+ +V   L   +L 
Sbjct  71   IVAGLPLNMNGTQGPQAEVVHTFIDFLL---KIQDIPVFLWDERLSTVAVTRTLLDADLS  127

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNRND  649
              +   ++DK AA  ILQG LD    ++
Sbjct  128  RKRRSEVIDKMAATYILQGSLDLCRTHE  155



>ref|WP_009764515.1| Holliday junction resolvase [Microvirga lotononidis]
 gb|EIM28465.1| RNAse H-fold protein YqgF [Microvirga lotononidis]
Length=186

 Score = 48.5 bits (114),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  175  FQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNIDL  318
            F + ++ R RL+GLD+G K +GLA+SDVE ++A+PL  + R K   D+
Sbjct  11   FIDGLQPRARLMGLDLGTKTIGLALSDVERRIATPLETIKRVKFTPDV  58


 Score = 37.7 bits (86),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/87 (29%), Positives = 37/87 (43%), Gaps = 4/87 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            G +FG P +      P +   +  + ++     L+ +   FWDE  S+  V   L   + 
Sbjct  72   GLVFGLPLNMDGTEGPRSQATRAFVRNMK---PLLPLPVLFWDERMSTMVVTRTLLDADA  128

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVNR  643
               +    VDK AA  ILQG LD   R
Sbjct  129  SRAKRADAVDKMAAAYILQGALDRYER  155



>ref|WP_012642118.1| Holliday junction resolvase [Thermomicrobium roseum]
 ref|YP_002521960.1| hypothetical protein trd_0729 [Thermomicrobium roseum DSM 5159]
 gb|ACM05389.1| conserved hypothetical protein TIGR00250 [Thermomicrobium roseum 
DSM 5159]
Length=161

 Score = 47.8 bits (112),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 37/82 (45%), Gaps = 4/82 (5%)
 Frame = +2

Query  389  FIFGYPFD-RQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
             + G P   R R    AV+ K     L E    +D    FWDE  +S + E LL    + 
Sbjct  59   IVVGLPVTMRGREGSQAVETKAFAARLAER---IDRPIVFWDERLTSSAAERLLTDAGVG  115

Query  566  PVQSKTIVDKFAAVEILQGYLD  631
              + + +VD  AA  +LQ YLD
Sbjct  116  RKRRRELVDAVAAALLLQSYLD  137


 Score = 38.5 bits (88),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +1

Query  199  GRLLGLDVGNKYVGLAVSDVENKLASPLSVL  291
            GR +GLDVG + VG+A+SD    +ASPL+ +
Sbjct  7    GRTMGLDVGGRRVGVAISDEMGMIASPLATI  37



>gb|EZQ05725.1| Holliday junction resolvase [Azospirillum brasilense]
 gb|AIB14016.1| Holliday junction resolvase [Azospirillum brasilense]
Length=187

 Score = 44.3 bits (103),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 42/86 (49%), Gaps = 4/86 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLV--DVKYTFWDESFSSKSVE-MLLKP  553
            G + G P +   +  P A   +    +L E   L+  D +  FWDE  S+ +VE  ++  
Sbjct  69   GLVIGLPLNMDGSEGPRAESTRAFAKNLMERSDLLGWDAEIAFWDERLSTSAVERFMIGE  128

Query  554  LNLHPVQSKTIVDKFAAVEILQGYLD  631
             ++   +   +VDK AA  ILQG LD
Sbjct  129  ADMTRKRRDEVVDKMAAAYILQGALD  154


 Score = 41.6 bits (96),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +1

Query  202  RLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            RLLGLDVG K VG+AVSD    +ASP+  L R K   D
Sbjct  17   RLLGLDVGTKTVGMAVSDPNFVVASPIGTLKRTKFTQD  54



>sp|Q2W6Y3.2|RUVX_MAGSA RecName: Full=Putative Holliday junction resolvase [Magnetospirillum 
magneticum AMB-1]
Length=155

 Score = 45.4 bits (106),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 33/56 (59%), Gaps = 1/56 (2%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            M  + P  L   L + + RLLGLD+G+K +GLA+SDV   +A+P   + R K   D
Sbjct  1    MPILAPAELLASLSRDQ-RLLGLDLGSKTIGLALSDVSRTIATPFDTIRRTKFTQD  55


 Score = 40.4 bits (93),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 40/88 (45%), Gaps = 6/88 (7%)
 Frame = +2

Query  386  GFIFGYPFDRQR-NNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            G + G P +      P    V+    +L    +L D+   +WDE  S+ +V   L   + 
Sbjct  70   GLVLGLPVEMDGFEGPRCQSVRSFAANLA---RLRDMPIAYWDERLSTSAVTRTLLEADS  126

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVNRN  646
               +   +VDK AA  ILQG LD  NR+
Sbjct  127  SRKRRAEVVDKMAAAYILQGLLD--NRS  152



>ref|WP_029355133.1| Holliday junction resolvase [Bosea sp. 117]
Length=161

 Score = 43.1 bits (100),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = +1

Query  163  PLNLFQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            PL     L+ +RG L+GLD+G K +G+A  D E +LA+ +  + RK+   D
Sbjct  7    PLIEAAALIPARGALIGLDLGTKTIGVASCDPERRLATAVETIARKQFTPD  57


 Score = 42.7 bits (99),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 23/86 (27%), Positives = 40/86 (47%), Gaps = 4/86 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ G P +   +  P A   +    +     +L ++    WDE  S+ +VE  L   ++
Sbjct  72   GFVLGLPVNMDGSEGPRAQSTRAFARNFA---RLTELPIALWDERLSTAAVERELIGADV  128

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVN  640
               +   ++D+ AA  ILQG LD + 
Sbjct  129  SRAKRAAVIDQHAAAFILQGALDRLR  154



>ref|WP_008391369.1| Holliday junction resolvase [Rhodovulum sp. PH10]
 gb|EJW09523.1| Putative Holliday junction resolvase [Rhodovulum sp. PH10]
Length=170

 Score = 43.1 bits (100),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +1

Query  163  PLNLFQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            PL      +  RG L+GLD+G+K +G+AVSD + +LA+ +  ++RK+   D
Sbjct  7    PLAELSPHLPQRGALIGLDLGDKTIGVAVSDPDRRLATGVETVMRKRFTED  57


 Score = 42.7 bits (99),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 37/80 (46%), Gaps = 4/80 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ G P +      P A   +    +L    KL  +    WDE  S+ +VE  L   + 
Sbjct  72   GFVLGLPLNMNGTEGPRAQSTRAFARNLA---KLTALPIGLWDERLSTAAVERELIAADA  128

Query  563  HPVQSKTIVDKFAAVEILQG  622
               + K ++D+ AA+ ILQG
Sbjct  129  SRAKRKAVIDQHAAIFILQG  148



>ref|WP_035678774.1| Holliday junction resolvase [Azospirillum brasilense]
Length=186

 Score = 44.3 bits (103),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 43/88 (49%), Gaps = 4/88 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLV--DVKYTFWDESFSSKSVE-MLLKP  553
            G + G P +   +  P A   +    +L E   L+  D +  FWDE  S+ +VE  ++  
Sbjct  69   GLVIGLPLNMDGSEGPRAESTRAFAKNLMERSDLLGWDAEIAFWDERLSTSAVERFMIGE  128

Query  554  LNLHPVQSKTIVDKFAAVEILQGYLDYV  637
             ++   +   +VDK AA  ILQG LD +
Sbjct  129  ADMTRKRRDEVVDKMAAAYILQGALDAL  156


 Score = 41.2 bits (95),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +1

Query  202  RLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            RLLGLDVG K VG+AVSD    +ASP+  L R K   D
Sbjct  17   RLLGLDVGTKTVGMAVSDPNFVVASPIGTLKRTKFTQD  54



>ref|WP_014198423.1| Holliday junction resolvase [Azospirillum brasilense]
 ref|YP_004985706.1| putative Holliday junction resolvase [Azospirillum brasilense 
Sp245]
 emb|CCD00971.1| putative Holliday junction resolvase [Azospirillum brasilense 
Sp245]
Length=191

 Score = 44.3 bits (103),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 43/88 (49%), Gaps = 4/88 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLV--DVKYTFWDESFSSKSVE-MLLKP  553
            G + G P +   +  P A   +    +L E   L+  D +  FWDE  S+ +VE  ++  
Sbjct  69   GLVIGLPLNMDGSEGPRAESTRAFAKNLMERSDLLGWDAEIAFWDERLSTSAVERFMIGE  128

Query  554  LNLHPVQSKTIVDKFAAVEILQGYLDYV  637
             ++   +   +VDK AA  ILQG LD +
Sbjct  129  ADMTRKRRDEVVDKMAAAYILQGALDAL  156


 Score = 41.6 bits (96),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +1

Query  202  RLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            RLLGLDVG K VG+AVSD    +ASP+  L R K   D
Sbjct  17   RLLGLDVGTKTVGMAVSDPNFVVASPIGTLKRTKFTQD  54



>ref|WP_013946770.1| Holliday junction resolvase [Hyphomicrobium sp. MC1]
 ref|YP_004674937.1| Holliday junction resolvase [Hyphomicrobium sp. MC1]
 emb|CCB64363.1| putative Holliday junction resolvase [Hyphomicrobium sp. MC1]
Length=166

 Score = 47.8 bits (112),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 29/47 (62%), Gaps = 0/47 (0%)
 Frame = +1

Query  175  FQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            F++     GRL+G+D G K +GLA+SDV   +ASPL  + R K   D
Sbjct  20   FRDATTGAGRLIGIDAGTKTLGLALSDVRRTIASPLETIRRTKFTAD  66


 Score = 38.1 bits (87),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/93 (28%), Positives = 41/93 (44%), Gaps = 12/93 (13%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-----NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLK  550
            GF+ G P    RN      P A   + L  +L    KL  +    WDE  ++   E +L 
Sbjct  81   GFVLGLP----RNLDGTEGPRAQATRALARNL---NKLSPLPILLWDERLTTAEAERMLI  133

Query  551  PLNLHPVQSKTIVDKFAAVEILQGYLDYVNRND  649
              +    +   ++DK AA  ILQ  LD + +++
Sbjct  134  DADQTRKRRAAVIDKLAATIILQSALDRLKQDN  166



>ref|WP_011383998.1| Holliday junction resolvase [Magnetospirillum magneticum]
 ref|YP_420951.1| putative Holliday junction resolvase [Magnetospirillum magneticum 
AMB-1]
 dbj|BAE50392.1| Putative Holliday junction resolvase [Magnetospirillum magneticum 
AMB-1]
Length=159

 Score = 45.4 bits (106),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 33/56 (59%), Gaps = 1/56 (2%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            M  + P  L   L + + RLLGLD+G+K +GLA+SDV   +A+P   + R K   D
Sbjct  5    MPILAPAELLASLSRDQ-RLLGLDLGSKTIGLALSDVSRTIATPFDTIRRTKFTQD  59


 Score = 40.4 bits (93),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 40/88 (45%), Gaps = 6/88 (7%)
 Frame = +2

Query  386  GFIFGYPFDRQR-NNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            G + G P +      P    V+    +L    +L D+   +WDE  S+ +V   L   + 
Sbjct  74   GLVLGLPVEMDGFEGPRCQSVRSFAANLA---RLRDMPIAYWDERLSTSAVTRTLLEADS  130

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVNRN  646
               +   +VDK AA  ILQG LD  NR+
Sbjct  131  SRKRRAEVVDKMAAAYILQGLLD--NRS  156



>ref|WP_036351830.1| Holliday junction resolvase [Microvirga sp. BSC39]
 gb|KFG68729.1| Holliday junction resolvase [Microvirga sp. BSC39]
Length=185

 Score = 48.1 bits (113),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +1

Query  175  FQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNIDL  318
            F + +  R RL+GLD+G K +GLA+SDVE ++A+PL  + R K   D+
Sbjct  11   FIDGLSPRARLMGLDLGTKTIGLALSDVERRIATPLETIKRVKFTPDV  58


 Score = 37.4 bits (85),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 36/83 (43%), Gaps = 4/83 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            G +FG P +      P +   +  I ++     L+ +   FWDE  S+  V   L   + 
Sbjct  72   GLVFGLPLNMDGTEGPRSQATRAFIRNMKP---LLPLPVLFWDERMSTMVVTRTLLDADT  128

Query  563  HPVQSKTIVDKFAAVEILQGYLD  631
               +    VDK AA  ILQG LD
Sbjct  129  SRAKRADAVDKMAAAYILQGALD  151



>ref|WP_009029367.1| Holliday junction resolvase [Bradyrhizobium sp. ORS 375]
 emb|CCD94429.1| putative Holliday junction resolvase [Bradyrhizobium sp. ORS 
375]
Length=161

 Score = 45.4 bits (106),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 41/86 (48%), Gaps = 4/86 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ G P +   +  P A   +    +L     L D+    WDE  S+ +VE  L  +++
Sbjct  72   GFVLGLPINMDGSEGPRAQSTRAFARNLA---GLTDLPIGLWDERLSTAAVERELIGMDV  128

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVN  640
               +   ++D  AA+ ILQG LD + 
Sbjct  129  SRAKRAEVIDTHAAIFILQGALDRLT  154


 Score = 40.0 bits (92),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +1

Query  196  RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            RG L+GLD+G K +G+AVSD + KLA+ +  + RK    D
Sbjct  18   RGALVGLDLGTKTIGVAVSDPDRKLATGVETIQRKAFKAD  57



>ref|WP_015907703.1| Holliday junction resolvase [Caldicellulosiruptor bescii]
 ref|YP_002573084.1| Holliday junction resolvase YqgF [Caldicellulosiruptor bescii 
DSM 6725]
 sp|B9MRK7.1|RUVX_CALBD RecName: Full=Putative Holliday junction resolvase [Caldicellulosiruptor 
bescii DSM 6725]
 gb|ACM60311.1| Holliday junction resolvase YqgF [Caldicellulosiruptor bescii 
DSM 6725]
Length=138

 Score = 55.1 bits (131),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 51/85 (60%), Gaps = 5/85 (6%)
 Frame = +2

Query  392  IFGYPFDRQRNNPDAVQVKLL-IDDLCE-TGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            + GYP  +   +PD    KL  ID++ E  G   +V+   WDE FS+K+VE ++    L+
Sbjct  55   VIGYPLSKL--HPDQKDEKLKKIDEISEKIGSRYNVEIVKWDERFSTKAVERVIDE-ELN  111

Query  566  PVQSKTIVDKFAAVEILQGYLDYVN  640
              + K I+DK AAV ILQGYLD+ N
Sbjct  112  WKRKKKIIDKVAAVYILQGYLDFYN  136


 Score = 30.4 bits (67),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 17/46 (37%), Positives = 27/46 (59%), Gaps = 1/46 (2%)
 Frame = +1

Query  202  RLLGLDVGNKYVGLAVSDVENKLASP-LSVLIRKKSNIDLMATDFQ  336
            R+L LD+GN  VG+A+SD     A P +++ +R K   + +   FQ
Sbjct  2    RILCLDIGNSRVGVAISDPLKITAQPVMTIELRNKDLFEELDKIFQ  47



>ref|WP_009469358.1| Holliday junction resolvase [Roseibium sp. TrichSKD4]
 gb|EFO29337.1| putative Holliday junction resolvase [Roseibium sp. TrichSKD4]
Length=160

 Score = 43.1 bits (100),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 24/86 (28%), Positives = 40/86 (47%), Gaps = 4/86 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            G + G P +   +  P A   +    +L +     ++  T+WDE  S+ +V   L   + 
Sbjct  73   GLVLGLPLNMDGSEGPRAQATRAFCRNLSQK---TELPITYWDERLSTAAVTRTLLEADS  129

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVN  640
               +   +VDK AA  ILQG+LD + 
Sbjct  130  SRAKRAEVVDKMAAAFILQGFLDRLG  155


 Score = 42.4 bits (98),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +1

Query  166  LNLFQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            L+ F  ++    RL+GLD+G K +GLA+SD+   +A+P+  + RKK   D
Sbjct  9    LDDFLSVLPPNSRLIGLDLGTKTIGLALSDLGRGIATPMETIRRKKFTQD  58



>dbj|BAQ17653.1| putative Holliday junction resolvase [Methyloceanibacter caenitepidi]
Length=156

 Score = 43.1 bits (100),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (55%), Gaps = 0/51 (0%)
 Frame = +1

Query  163  PLNLFQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            P+      ++   RLLG DVG K +GLA+SDV   +A+P   + R K   D
Sbjct  6    PIEELPSKLQPGARLLGFDVGTKTIGLALSDVTRSIATPYETVRRTKFTTD  56


 Score = 42.4 bits (98),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 40/85 (47%), Gaps = 4/85 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            G + G P +   +  P A   +    +L +    +D+   FWDE  S+ +VE  L   + 
Sbjct  71   GLVIGLPLNLDGSEGPRAQSTRAFARNLAQH---LDLPTAFWDERLSTAAVERHLIEADA  127

Query  563  HPVQSKTIVDKFAAVEILQGYLDYV  637
               +   ++D+ AA  ILQG LD +
Sbjct  128  SRKRRAEVIDRMAAAYILQGALDRM  152



>ref|WP_009340925.1| Holliday junction resolvase [Afipia sp. 1NLS2]
 gb|EFI50318.1| Holliday junction resolvase YqgF [Afipia sp. 1NLS2]
Length=165

 Score = 44.7 bits (104),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 41/86 (48%), Gaps = 4/86 (5%)
 Frame = +2

Query  383  KGFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLN  559
             GF+ G P +   +  P A   +    +     KL D+    WDE  S+ +VE  L   +
Sbjct  76   SGFVLGLPINMDGSEGPRAQSTRAFARNFS---KLTDLAIGLWDERLSTAAVERELIAND  132

Query  560  LHPVQSKTIVDKFAAVEILQGYLDYV  637
            +   +   ++D+ AA+ ILQG LD +
Sbjct  133  VSRARRAEVIDEHAAIFILQGALDRL  158


 Score = 40.8 bits (94),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = +1

Query  163  PLNLFQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            PL         RG L+GLD+G K +G+AVSD + +LA+ ++ + RK    D
Sbjct  12   PLTEAATHWTPRGALIGLDLGTKTIGVAVSDPDRRLATGVTTIQRKTFTKD  62



>ref|WP_024275552.1| Holliday junction resolvase [Hyphomicrobium sp. 802]
Length=166

 Score = 47.8 bits (112),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 29/47 (62%), Gaps = 0/47 (0%)
 Frame = +1

Query  175  FQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            F++     GRL+G+D G K +GLA+SDV   +ASPL  + R K   D
Sbjct  20   FRDATTGAGRLIGIDAGTKTLGLALSDVRRTIASPLETIRRTKFTAD  66


 Score = 37.4 bits (85),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/93 (28%), Positives = 41/93 (44%), Gaps = 12/93 (13%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-----NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLK  550
            GF+ G P    RN      P A   + L  +L    KL  +    WDE  ++   E +L 
Sbjct  81   GFVLGLP----RNLDGTEGPRAQATRALARNL---NKLSPLPILLWDERLTTAEAERMLI  133

Query  551  PLNLHPVQSKTIVDKFAAVEILQGYLDYVNRND  649
              +    +   ++DK AA  ILQ  LD + +++
Sbjct  134  DADQTRKRRAEVIDKLAATIILQSALDRLKQDN  166



>ref|WP_008621989.1| putative Holliday junction resolvase [Magnetospirillum sp. SO-1]
 gb|EME67751.1| putative Holliday junction resolvase [Magnetospirillum sp. SO-1]
Length=155

 Score = 44.7 bits (104),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 33/56 (59%), Gaps = 1/56 (2%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            M  + P  L   L + + RLLGLD+G+K +GLA+SDV   +A+P   + R K   D
Sbjct  1    MPILSPAELLASLARDQ-RLLGLDLGSKTIGLALSDVSRTIATPFDTIRRIKFTKD  55


 Score = 40.4 bits (93),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 40/88 (45%), Gaps = 6/88 (7%)
 Frame = +2

Query  386  GFIFGYPFDRQR-NNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            G + G P +      P    V+    +L    +L D+   +WDE  S+ +V   L   + 
Sbjct  70   GLVLGLPVEMDGFEGPRCQSVRSFAANLA---RLRDMPIAYWDERLSTSAVTRTLLEADS  126

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVNRN  646
               +   +VDK AA  ILQG LD  NR+
Sbjct  127  SRKRRAEVVDKMAAAYILQGLLD--NRS  152



>ref|WP_006611220.1| Holliday junction resolvase [Bradyrhizobium sp. ORS 285]
 emb|CCD85879.1| putative Holliday junction resolvase [Bradyrhizobium sp. ORS 
285]
Length=161

 Score = 45.8 bits (107),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 41/86 (48%), Gaps = 4/86 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ G P +   +  P A   +    +L     L D+    WDE  S+ +VE  L  +++
Sbjct  72   GFVLGLPINMDGSEGPRAQSTRAFARNLA---SLTDLPIGLWDERLSTAAVERELIGMDV  128

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVN  640
               +   ++D  AA+ ILQG LD + 
Sbjct  129  SRARRAEVIDTHAAIFILQGALDRLT  154


 Score = 39.3 bits (90),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +1

Query  196  RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            RG L+GLD+G K +G+AVSD + +LA+ +  + RK    D
Sbjct  18   RGALVGLDLGTKTIGVAVSDPDRRLATGVETIQRKAFKAD  57



>ref|WP_009360144.1| Holliday junction resolvase [alpha proteobacterium HIMB114]
 gb|EMH80059.1| hypothetical protein HIMB114_00004380 [alpha proteobacterium 
HIMB114]
Length=156

 Score = 45.1 bits (105),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/88 (30%), Positives = 45/88 (51%), Gaps = 4/88 (5%)
 Frame = +2

Query  383  KGFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLN  559
            KG + G P +    + P +   +    ++ +  KL     T WDE  SS+    L+  L+
Sbjct  72   KGIVIGNPINMDGTSGPRSQSARDFAQNISKNTKL---PITLWDERLSSEGAFNLMGDLD  128

Query  560  LHPVQSKTIVDKFAAVEILQGYLDYVNR  643
            ++  +    +D+ AA  ILQGYLD++N+
Sbjct  129  INSSKKSKNLDQHAAAFILQGYLDFLNK  156


 Score = 40.0 bits (92),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +1

Query  187  VKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKK  303
            V    R+LG+D G K +GL+VSD   K+A+P  +++ KK
Sbjct  16   VGKNSRILGIDPGKKNIGLSVSDPNQKIATPFKIIVMKK  54



>ref|WP_024512422.1| Holliday junction resolvase [Bradyrhizobium sp. ARR65]
Length=159

 Score = 45.4 bits (106),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 43/85 (51%), Gaps = 4/85 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ G P +   +  P A   +    +L +   L ++    WDE  S+ +VE  L  +++
Sbjct  72   GFVLGLPINMDGSEGPRAQSTRAFARNLSQ---LTELPIALWDERLSTAAVERELIGMDV  128

Query  563  HPVQSKTIVDKFAAVEILQGYLDYV  637
               +   ++D+ AA+ ILQG LD +
Sbjct  129  SRAKRAEVIDEHAAIFILQGALDRL  153


 Score = 39.7 bits (91),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +1

Query  193  SRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            +RG L+GLD+G K +G+AVSD + +LA+ +  + RK    D
Sbjct  17   ARGALVGLDLGTKTIGVAVSDPDRRLATGVQTIKRKAFKAD  57



>ref|WP_012615413.1| Holliday junction resolvase [Chloroflexus aggregans]
 ref|YP_002461483.1| Holliday junction resolvase YqgF [Chloroflexus aggregans DSM 
9485]
 sp|B8GC73.1|RUVX_CHLAD RecName: Full=Putative Holliday junction resolvase [Chloroflexus 
aggregans DSM 9485]
 gb|ACL23047.1| Holliday junction resolvase YqgF [Chloroflexus aggregans DSM 
9485]
Length=142

 Score = 43.5 bits (101),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 44/89 (49%), Gaps = 5/89 (6%)
 Frame = +2

Query  383  KGFIFGYPFD-RQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLN  559
            +  + G P   R  + P A  ++  +D L     +++     +DE  +S + E +L+ L 
Sbjct  56   RRVVVGLPLTMRGEHGPQAAAIQRFVDALA---AVLNCPVEMFDERLTSVAAEQMLRNLG  112

Query  560  LHPVQSKTIVDKFAAVEILQGYLDYVNRN  646
            + P + K  +D+ AA  ILQ YLD   RN
Sbjct  113  VKPAKIKEQIDQVAASIILQDYLD-ARRN  140


 Score = 41.6 bits (96),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  205  LLGLDVGNKYVGLAVSDVENKLASPLSVL  291
            +LGLDVG + +G+A+SDVE ++A+PL+ +
Sbjct  6    ILGLDVGERRIGVAISDVEARIAAPLTTI  34



>ref|WP_022006335.1| putative Holliday junction resolvase [Proteobacteria bacterium 
CAG:495]
 emb|CCZ30814.1| putative Holliday junction resolvase [Proteobacteria bacterium 
CAG:495]
Length=152

 Score = 45.1 bits (105),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 43/83 (52%), Gaps = 3/83 (4%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVE-MLLKPLNL  562
              ++G P   Q N  +    K +     +  + + + Y FWDE  SSK++E  L+K +++
Sbjct  67   ALVYGLPL--QMNGEEGDTAKAVRSFAQKLAQEIPLPYAFWDERLSSKAMENFLIKEVDM  124

Query  563  HPVQSKTIVDKFAAVEILQGYLD  631
               + K I+D  +A  ILQG LD
Sbjct  125  SRAKRKDILDSSSAAYILQGVLD  147


 Score = 40.0 bits (92),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +1

Query  175  FQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNIDLMA  324
            F++ +K    +LG D G K +G+AVSD+   +A+P   + R   N DL A
Sbjct  6    FKQQIKPYKAILGFDFGTKRLGVAVSDLLWTVATPQKTIFRSDWNADLKA  55



>ref|WP_024582082.1| Holliday junction resolvase [Bradyrhizobium sp. OHSU_III]
Length=160

 Score = 44.3 bits (103),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 44/92 (48%), Gaps = 6/92 (7%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ G P +   +  P A   +    +L     L  +    WDE  S+ +VE  L  +++
Sbjct  72   GFVLGLPINMDGSEGPRAQSTRAFARNLA---GLTTLAIGLWDERLSTAAVERELIGMDV  128

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVN--RNDK  652
               +   ++D+ AA+ ILQG LD +   R D+
Sbjct  129  SRARRAEVIDEHAAIFILQGALDRLAKLRGDR  160


 Score = 40.4 bits (93),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +1

Query  196  RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            RG L+GLD+G K +G+AVSD + +LA+ +  + RK+   D
Sbjct  18   RGALIGLDLGTKTIGVAVSDPDRRLATGVETIQRKQFKTD  57



>ref|WP_008962752.1| Holliday junction resolvase [Bradyrhizobium sp. STM 3809]
 emb|CCE00165.1| putative Holliday junction resolvase [Bradyrhizobium sp. STM 
3809]
Length=161

 Score = 45.8 bits (107),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 41/86 (48%), Gaps = 4/86 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ G P +   +  P A   +    +L     L D+    WDE  S+ +VE  L  +++
Sbjct  72   GFVLGLPINMDGSEGPRAQSTRAFARNLA---GLTDLPIGLWDERLSTAAVERELIGMDV  128

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVN  640
               +   ++D  AA+ ILQG LD + 
Sbjct  129  SRARRAEVIDTHAAIFILQGALDRLT  154


 Score = 39.3 bits (90),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +1

Query  196  RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            RG L+GLD+G K +G+AVSD + +LA+ +  + RK    D
Sbjct  18   RGALVGLDLGTKTIGVAVSDPDRRLATGVETIQRKAFKAD  57



>ref|WP_011503423.1| Holliday junction resolvase [Rhodopseudomonas palustris]
 ref|YP_570150.1| Holliday junction resolvase-like protein [Rhodopseudomonas palustris 
BisB5]
 sp|Q135J0.1|RUVX_RHOPS RecName: Full=Putative Holliday junction resolvase [Rhodopseudomonas 
palustris BisB5]
 gb|ABE40249.1| Holliday junction resolvase YqgF [Rhodopseudomonas palustris 
BisB5]
Length=160

 Score = 43.9 bits (102),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 4/85 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ G P +   +  P A   +    +     +L ++    WDE  S+ +VE  L   ++
Sbjct  72   GFVLGLPLNMDGSEGPRAQSTRAFARNFA---RLTELPIGLWDERLSTAAVERALIANDV  128

Query  563  HPVQSKTIVDKFAAVEILQGYLDYV  637
               +   I+D+ AA+ ILQG LD +
Sbjct  129  SRAKRAKIIDEHAAIYILQGALDRL  153


 Score = 41.2 bits (95),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  193  SRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            +RG LLGLD+G K +G+AVSD + KLA+ +  + R     D
Sbjct  17   ARGALLGLDLGTKTIGVAVSDPDRKLATGIETVARTAFTAD  57



>ref|WP_022691764.1| Holliday junction resolvase [Sphingomonas-like bacterium B12]
Length=157

 Score = 44.7 bits (104),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +1

Query  175  FQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNIDLMA  324
            F++L+   GRL GLDVG K +GLA  D    +A+P   + R K   DL A
Sbjct  9    FRDLLPKGGRLAGLDVGTKTIGLAYCDAGWTIATPAETIRRTKFGADLEA  58


 Score = 40.0 bits (92),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 40/84 (48%), Gaps = 5/84 (6%)
 Frame = +2

Query  383  KGFIFGYPFDR-QRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLN  559
            +G + G P +    ++P    ++    +L    K +D+    WDE +S+ +V   L   +
Sbjct  69   RGLVLGLPLNMDGTDSPRTQAIRAFARNL----KPLDLPILLWDERWSTAAVTRTLLDAD  124

Query  560  LHPVQSKTIVDKFAAVEILQGYLD  631
                +   +VDK AA  ILQG +D
Sbjct  125  ASRARRAEVVDKMAAAYILQGAID  148



>emb|CEG07742.1| Putative Holliday junction resolvase [Afipia felis]
Length=165

 Score = 44.3 bits (103),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 41/86 (48%), Gaps = 4/86 (5%)
 Frame = +2

Query  383  KGFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLN  559
             GF+ G P +   +  P A   +    +     KL D+    WDE  S+ +VE  L   +
Sbjct  76   SGFVLGLPINMDGSEGPRAQSTRAFARNFS---KLTDLAIGLWDERLSTAAVERELIAND  132

Query  560  LHPVQSKTIVDKFAAVEILQGYLDYV  637
            +   +   ++D+ AA+ ILQG LD +
Sbjct  133  VSRARRAEVIDEHAAIFILQGALDRL  158


 Score = 40.4 bits (93),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = +1

Query  163  PLNLFQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            PL         RG L+GLD+G K +G+AVSD + +LA+ ++ + RK    D
Sbjct  12   PLTEAAPHWTPRGALIGLDLGTKTIGVAVSDPDRRLATGVTTIQRKTFTKD  62



>ref|WP_023454492.1| Holliday junction resolvase [Asticcacaulis sp. AC460]
 gb|ESQ88157.1| Holliday junction resolvase [Asticcacaulis sp. AC460]
Length=157

 Score = 44.7 bits (104),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/91 (30%), Positives = 45/91 (49%), Gaps = 5/91 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSV-EMLLKPLN  559
            G + G P +      P A   +    +L    +L D+   FWDE +SS ++   L++  +
Sbjct  70   GLVIGLPVNMDGTEGPRAQSCRAFARNLL---RLRDLPIAFWDERWSSAAMNRFLIEEAD  126

Query  560  LHPVQSKTIVDKFAAVEILQGYLDYVNRNDK  652
            L   +   ++D+ AA  ILQG LD +  ND+
Sbjct  127  LSRSKRAEVIDRNAAAYILQGALDRIRDNDQ  157


 Score = 40.0 bits (92),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 26/35 (74%), Gaps = 1/35 (3%)
 Frame = +1

Query  196  RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRK  300
            R  LLGLD+G K +G+AVSD+   LASPL  LIRK
Sbjct  16   RRALLGLDLGEKTIGVAVSDISLTLASPLE-LIRK  49



>ref|WP_024515553.1| Holliday junction resolvase [Bradyrhizobium sp. Tv2a-2]
Length=158

 Score = 46.2 bits (108),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 43/85 (51%), Gaps = 4/85 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ G P +   +  P A   +    +L +   L ++    WDE  S+ +VE  L  +++
Sbjct  72   GFVLGLPINMDGSEGPRAQSTRAFARNLAQ---LTELAIALWDERLSTAAVERELIGMDV  128

Query  563  HPVQSKTIVDKFAAVEILQGYLDYV  637
               +   ++D+ AA+ ILQG LD +
Sbjct  129  SRAKRAEVIDEHAAIFILQGALDRL  153


 Score = 38.5 bits (88),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +1

Query  193  SRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            +RG L+GLD+G K +G+AVSD + +LA  +  + RK   +D
Sbjct  17   ARGALIGLDLGTKTIGVAVSDPDRRLAIGVETVKRKAFKLD  57



>gb|KEO59161.1| Holliday junction resolvase [Thalassospira permensis NBRC 106175]
Length=176

 Score = 43.1 bits (100),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 36/53 (68%), Gaps = 3/53 (6%)
 Frame = +1

Query  169  NLFQELVK---SRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNIDL  318
            N  QEL++      R+LGLD+G K +G+A+SDV  ++ASP S++ RKK   D+
Sbjct  4    NDTQELLRFLTPAARVLGLDLGTKTIGVALSDVGLQIASPYSLISRKKFTRDI  56


 Score = 41.6 bits (96),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 45/87 (52%), Gaps = 5/87 (6%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAV-QVKLLIDDLCETGKLVDVKYTFWDESFSSKSVE-MLLKPLN  559
            G I G+P +       A  +V   +D   E    +D+    WDE  S+ +VE +L++ ++
Sbjct  70   GIIIGFPRELDGTVGKACHRVYAFVD---EMQNYIDLPILLWDERLSTNAVERILIEDVD  126

Query  560  LHPVQSKTIVDKFAAVEILQGYLDYVN  640
            +   +   +VDK AA  ILQG LD +N
Sbjct  127  MTRKRRAQVVDKTAAAYILQGALDNLN  153



>ref|WP_011927345.1| Holliday junction resolvase [Bradyrhizobium sp. ORS 278]
 ref|YP_001206455.1| Holliday junction resolvase-like protein [Bradyrhizobium sp. 
ORS 278]
 sp|A4YWF9.1|RUVX_BRASO RecName: Full=Putative Holliday junction resolvase [Bradyrhizobium 
sp. ORS 278]
 emb|CAL78235.1| putative Holliday junction resolvase [Bradyrhizobium sp. ORS 
278]
Length=161

 Score = 45.4 bits (106),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 41/86 (48%), Gaps = 4/86 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ G P +   +  P A   +    +L     L D+    WDE  S+ +VE  L  +++
Sbjct  72   GFVLGLPINMDGSEGPRAQSTRAFARNLA---GLTDLPIGLWDERLSTAAVERELIGMDV  128

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVN  640
               +   ++D  AA+ ILQG LD + 
Sbjct  129  SRAKRAEVIDTHAAIFILQGALDRLT  154


 Score = 39.3 bits (90),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +1

Query  196  RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            RG L+GLD+G K +G+AVSD + +LA+ +  + RK    D
Sbjct  18   RGALVGLDLGTKTIGVAVSDPDRRLATGVETIQRKAFKAD  57



>ref|WP_021078329.1| YqgF family RNAse H domain-containing protein [Bradyrhizobium 
sp. DFCI-1]
 gb|ERF82579.1| YqgF family RNAse H domain-containing protein [Bradyrhizobium 
sp. DFCI-1]
Length=160

 Score = 43.5 bits (101),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 44/92 (48%), Gaps = 6/92 (7%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ G P +   +  P A   +    +L     L  +    WDE  S+ +VE  L  +++
Sbjct  72   GFVLGLPINMDGSEGPRAQSTRAFARNLS---NLTALAIGLWDERLSTAAVERELIGMDV  128

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVN--RNDK  652
               +   ++D+ AA+ ILQG LD +   R D+
Sbjct  129  SRARRAEVIDEHAAIFILQGALDRLAKLRGDR  160


 Score = 41.2 bits (95),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  196  RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            RG L+GLD+G K +G+AVSD + +LA+ +  + RK+  +D
Sbjct  18   RGALVGLDLGTKTIGVAVSDPDRRLATGVQTIQRKQFKVD  57



>ref|WP_012044734.1| Holliday junction resolvase [Bradyrhizobium sp. BTAi1]
 ref|YP_001240654.1| Holliday junction resolvase-like protein [Bradyrhizobium sp. 
BTAi1]
 sp|A5EKQ4.1|RUVX_BRASB RecName: Full=Putative Holliday junction resolvase [Bradyrhizobium 
sp. BTAi1]
 gb|ABQ36748.1| putative Holliday junction resolvase [Bradyrhizobium sp. BTAi1]
Length=161

 Score = 45.4 bits (106),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 41/85 (48%), Gaps = 4/85 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ G P +   +  P A   +    +L     L D+    WDE  S+ +VE  L  +++
Sbjct  72   GFVLGLPINMDGSEGPRAQSTRAFARNLA---NLTDLPIGLWDERLSTAAVERELIGMDV  128

Query  563  HPVQSKTIVDKFAAVEILQGYLDYV  637
               +   ++D  AA+ ILQG LD +
Sbjct  129  SRARRAEVIDTHAAIFILQGALDRL  153


 Score = 39.3 bits (90),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +1

Query  196  RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            RG L+GLD+G K +G+AVSD + +LA+ +  + RK    D
Sbjct  18   RGALVGLDLGTKTIGVAVSDPDRRLATGVETIQRKAFKAD  57



>ref|WP_016407548.1| putative Holliday junction resolvase [Firmicutes bacterium CAG:102]
 emb|CCX40104.1| putative Holliday junction resolvase [Firmicutes bacterium CAG:102]
Length=142

 Score = 53.1 bits (126),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 45/84 (54%), Gaps = 7/84 (8%)
 Frame = +2

Query  389  FIFGYPFDRQRNNPD-AVQVKLLIDDLCETGK--LVDVKYTFWDESFSSKSVEMLLKPLN  559
             + GYP +   +  D  V+ K    D CE  K      +   WDE FS+ + E  L+ + 
Sbjct  58   IVLGYPKNLDGSEGDRCVKTK----DFCERVKRRFPKAEVLLWDERFSTIAAERSLREVG  113

Query  560  LHPVQSKTIVDKFAAVEILQGYLD  631
            L+  Q K+++DK AAV ILQGYLD
Sbjct  114  LNHNQRKSVIDKMAAVHILQGYLD  137


 Score = 31.2 bits (69),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  202  RLLGLDVGNKYVGLAVSDVENKLASPLSVLIRK  300
            R+LGLD G+K +G+AVSD     A  + ++ R+
Sbjct  2    RILGLDFGDKTIGVAVSDPFGWTAQGVEIIRRE  34



>ref|WP_013432500.1| MULTISPECIES: Holliday junction resolvase [Caldicellulosiruptor]
 ref|YP_004026313.1| holliday junction resolvase yqgf [Caldicellulosiruptor kristjanssonii 
I77R1B]
 ref|YP_004798228.1| Holliday junction resolvase [Caldicellulosiruptor lactoaceticus 
6A]
 gb|ADQ40700.1| Holliday junction resolvase YqgF [Caldicellulosiruptor kristjanssonii 
I77R1B]
 gb|AEM73251.1| Holliday junction resolvase [Caldicellulosiruptor lactoaceticus 
6A]
Length=138

 Score = 53.1 bits (126),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 51/85 (60%), Gaps = 5/85 (6%)
 Frame = +2

Query  392  IFGYPFDRQRNNPDAVQVKLL-IDDLCETGK-LVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            + GYP  +   +PD    KL  ID++ E  K   +V+   WDE FS+K+VE ++    L+
Sbjct  55   VIGYPLSKL--HPDQKDEKLKKIDEISEKIKSRYNVEIVKWDERFSTKAVERVMNE-ELN  111

Query  566  PVQSKTIVDKFAAVEILQGYLDYVN  640
              + K ++DK AAV ILQGYLD+ N
Sbjct  112  WKRKKKVIDKVAAVYILQGYLDFYN  136


 Score = 31.6 bits (70),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 1/48 (2%)
 Frame = +1

Query  202  RLLGLDVGNKYVGLAVSDVENKLASP-LSVLIRKKSNIDLMATDFQSL  342
            R+L LD+GN  VG+A+SD     A P +++ +R K   + + + FQ  
Sbjct  2    RILCLDIGNSRVGVAISDPLKITAQPVMTIELRNKDLFEELDSIFQRF  49



>ref|WP_011441319.1| Holliday junction resolvase [Rhodopseudomonas palustris]
 ref|YP_486045.1| Holliday junction resolvase-like protein [Rhodopseudomonas palustris 
HaA2]
 sp|Q2IXC6.1|RUVX_RHOP2 RecName: Full=Putative Holliday junction resolvase [Rhodopseudomonas 
palustris HaA2]
 gb|ABD07134.1| Holliday junction resolvase YqgF [Rhodopseudomonas palustris 
HaA2]
Length=160

 Score = 42.4 bits (98),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 44/92 (48%), Gaps = 7/92 (8%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQ-VKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ G P +   +    VQ  +    +     +L ++    WDE  S+ +VE  L   ++
Sbjct  72   GFVLGLPLNMDGSEGPRVQSTRAFARNFA---RLTELPIGLWDERLSTAAVERELIANDV  128

Query  563  HPVQSKTIVDKFAAVEILQGYLD---YVNRND  649
               +   I+D+ AA+ ILQG LD    +NR D
Sbjct  129  SRAKRAKIIDEHAAIYILQGALDRLATLNRAD  160


 Score = 42.0 bits (97),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +1

Query  193  SRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            +RG LLGLD+G K +G+AVSD + +LA+ +  + RK    D
Sbjct  17   ARGSLLGLDLGTKTIGVAVSDPDRRLATGIETVARKAFTAD  57



>ref|WP_006275012.1| Holliday junction resolvase [Asticcacaulis biprosthecium]
 gb|EGF89816.1| hypothetical UPF0081 family protein [Asticcacaulis biprosthecum 
C19]
Length=157

 Score = 43.1 bits (100),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/91 (31%), Positives = 45/91 (49%), Gaps = 6/91 (7%)
 Frame = +2

Query  386  GFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSV-EMLLKPLN  559
            G + G P +      P A   +    +L    +L DV   FWDE +SS ++   L++  +
Sbjct  70   GLVIGLPVNMDGTEGPRAQSCRAFARNLL---RLRDVPIAFWDERWSSAAMNRFLIEEAD  126

Query  560  LHPVQSKTIVDKFAAVEILQGYLDYVNRNDK  652
            L   +   ++D+ AA  ILQG LD + + DK
Sbjct  127  LSRAKRAEVIDRNAAAYILQGALDRI-KGDK  156


 Score = 41.2 bits (95),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 1/36 (3%)
 Frame = +1

Query  193  SRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRK  300
            +R  LLGLD+G K +G+AVSD+   LASPL  LIRK
Sbjct  15   ARHALLGLDLGEKTIGVAVSDISLTLASPLE-LIRK  49



>ref|WP_006562377.1| Holliday junction resolvase [Oscillochloris trichoides]
 gb|EFO80357.1| Holliday junction resolvase YqgF [Oscillochloris trichoides DG-6]
Length=148

 Score = 45.1 bits (105),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/87 (29%), Positives = 43/87 (49%), Gaps = 4/87 (5%)
 Frame = +2

Query  383  KGFIFGYPFD-RQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLN  559
            +G + G P   R    P A Q +    +L    + V +    +DE +++   E LL+ + 
Sbjct  56   QGIVVGLPLTLRGEIGPQAEQTRSFAQELE---RQVGLPVMLFDERYTTTVAEQLLREMG  112

Query  560  LHPVQSKTIVDKFAAVEILQGYLDYVN  640
            + P + K  +D+ AA  ILQ YLD++ 
Sbjct  113  VKPEKRKQQIDQVAASIILQDYLDHIR  139


 Score = 39.3 bits (90),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +1

Query  202  RLLGLDVGNKYVGLAVSDVENKLASPLSVL  291
            RLLGLDVG++ +G+A+SD    LASPL+ +
Sbjct  5    RLLGLDVGDRRIGVALSDALGMLASPLTTI  34



>ref|WP_012115894.1| Holliday junction resolvase [Xanthobacter autotrophicus]
 ref|YP_001418803.1| Holliday junction resolvase YqgF [Xanthobacter autotrophicus 
Py2]
 gb|ABS69146.1| Holliday junction resolvase YqgF [Xanthobacter autotrophicus 
Py2]
Length=176

 Score = 45.4 bits (106),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 43/88 (49%), Gaps = 4/88 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ G P +   +  P A   +    +L    +L  +    WDE  S+ +VE  L   ++
Sbjct  77   GFVLGLPLNMDASEGPRAQASRAFARNLA---RLTALPIALWDERLSTAAVERALISADV  133

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVNRN  646
               +   +VD+ AA  IL+G L +++R+
Sbjct  134  SRARRAAVVDQHAAAFILEGALGFLSRH  161


 Score = 38.5 bits (88),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (57%), Gaps = 0/51 (0%)
 Frame = +1

Query  163  PLNLFQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            PL     L+  RG LLGLD+G K +G+A  D + ++A+ +  + R K   D
Sbjct  12   PLADIAPLLPPRGALLGLDLGTKTIGVASCDPDRRVATVVETVQRTKFTAD  62



>ref|WP_027276837.1| Holliday junction resolvase [Rhodopseudomonas palustris]
Length=164

 Score = 44.7 bits (104),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 43/86 (50%), Gaps = 4/86 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            G++ G P +   +  P A   +    +L    KL ++   FWDE  S+ +VE  L   ++
Sbjct  72   GWVLGLPLNMDGSEGPRAQSTRAFARNLA---KLTELPIGFWDERLSTAAVERELIANDV  128

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVN  640
               +   ++D+ AA+ ILQG LD + 
Sbjct  129  SRAKRAKVIDQHAAIFILQGALDRLT  154


 Score = 39.3 bits (90),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +1

Query  157  MKPLNLFQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRK  300
            + PL     L  + G L+GLD+G K +G+AVSD   +LA+ +  ++RK
Sbjct  5    IHPLVETAALWPATGALIGLDLGTKTIGVAVSDPARRLATGVETVLRK  52



>ref|WP_018583542.1| Holliday junction resolvase [Salinispora arenicola]
Length=153

 Score = 45.1 bits (105),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 41/87 (47%), Gaps = 3/87 (3%)
 Frame = +2

Query  389  FIFGYPFD-RQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
             + G P +   R+ P AVQV+  +  L E   +  V  T  DE  S+      L    + 
Sbjct  67   VVVGLPVNLAGRHGPAAVQVQEYVGRLVEV--ISPVPVTLADERMSTVVASRRLAERGVR  124

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNRN  646
              + + +VD+ AAVEILQ +LD   R 
Sbjct  125  GRRQRAVVDQAAAVEILQSWLDAQRRR  151


 Score = 39.3 bits (90),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 31/54 (57%), Gaps = 1/54 (2%)
 Frame = +1

Query  193  SRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIR-KKSNIDLMATDFQSLVRL  351
            SRG  LG+DVG   VG+A SD    LA+PL  L R + +  D + +D   LV L
Sbjct  5    SRGVRLGVDVGQVRVGVARSDPHGVLATPLVTLARDRDAAPDAVPSDIAELVAL  58



>ref|WP_013846532.1| Holliday junction resolvase [Sphingobium chlorophenolicum]
 ref|YP_004552772.1| Holliday junction resolvase [Sphingobium chlorophenolicum L-1]
 gb|AEG48266.1| Holliday junction resolvase [Sphingobium chlorophenolicum L-1]
Length=156

 Score = 45.8 bits (107),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +1

Query  172  LFQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNIDLMA  324
            LF+E +   GRL+GLDVG K +GLA+ D    +ASP   + R K + D +A
Sbjct  10   LFREALPHGGRLIGLDVGTKTIGLALCDAGWSIASPAHTVSRGKFSKDKIA  60


 Score = 38.1 bits (87),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 42/84 (50%), Gaps = 5/84 (6%)
 Frame = +2

Query  383  KGFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLN  559
            KG + G P +   + +P +   +    ++ + G    +   FWDE +S+++V   L   +
Sbjct  71   KGVVIGLPLNLDGSESPRSQASRAFGRNIADLG----LPILFWDERWSTQAVTRTLLEAD  126

Query  560  LHPVQSKTIVDKFAAVEILQGYLD  631
                + + +VDK AA  ILQG +D
Sbjct  127  ASRARREELVDKLAASYILQGAID  150



>ref|WP_027537113.1| Holliday junction resolvase [Bradyrhizobium sp. URHA0002]
Length=160

 Score = 47.0 bits (110),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 45/92 (49%), Gaps = 6/92 (7%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ G P +   +  P A   +    +     KL D+    WDE  S+ +VE  L  +++
Sbjct  72   GFVLGLPINMDGSEGPRAQSTRAFARNFS---KLTDLALALWDERLSTVAVERELIGMDM  128

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVN--RNDK  652
               +   ++D+ AA+ ILQG LD +   R D+
Sbjct  129  SRARRAEVIDEHAAIFILQGALDRLATLRGDR  160


 Score = 37.0 bits (84),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +1

Query  196  RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            RG L+GLD+G K +G+AVS+ + +LA+ +  + RK    D
Sbjct  18   RGALVGLDLGTKTIGVAVSNPDRRLATGVETIQRKAFKAD  57



>ref|WP_007089906.1| Holliday junction resolvase [Thalassospira xiamenensis]
 gb|AJD51912.1| putative Holliday junction resolvase [Thalassospira xiamenensis 
M-5 = DSM 17429]
Length=176

 Score = 43.1 bits (100),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 36/53 (68%), Gaps = 3/53 (6%)
 Frame = +1

Query  169  NLFQELVK---SRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNIDL  318
            N  QEL++      R+LGLD+G K +G+A+SDV  ++ASP S++ RKK   D+
Sbjct  4    NDTQELLRFLSPAARVLGLDLGTKTIGVALSDVGLQIASPYSLISRKKFTRDI  56


 Score = 40.8 bits (94),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 45/87 (52%), Gaps = 5/87 (6%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAV-QVKLLIDDLCETGKLVDVKYTFWDESFSSKSVE-MLLKPLN  559
            G I G+P +       A  +V   +D   E    +D+    WDE  S+ +VE +L++ ++
Sbjct  70   GIIIGFPRELDGMIGKACHRVYAFVD---EMQNYIDLPILLWDERLSTNAVERILIEDVD  126

Query  560  LHPVQSKTIVDKFAAVEILQGYLDYVN  640
            +   +   +VDK AA  ILQG LD +N
Sbjct  127  MTRKRRAQVVDKTAAAYILQGALDNLN  153



>ref|WP_012562947.1| Holliday junction resolvase [Oligotropha carboxidovorans]
 ref|YP_002288784.1| Holliday junction resolvase-like protein [Oligotropha carboxidovorans 
OM5]
 ref|YP_004633161.1| holliday junction resolvase [Oligotropha carboxidovorans OM5]
 ref|YP_005951224.1| putative holliday junction resolvase [Oligotropha carboxidovorans 
OM4]
 gb|ACI92919.1| holliday junction resolvase YqgF [Oligotropha carboxidovorans 
OM5]
 gb|AEI03343.1| putative holliday junction resolvase [Oligotropha carboxidovorans 
OM4]
 gb|AEI06920.1| putative holliday junction resolvase [Oligotropha carboxidovorans 
OM5]
Length=204

 Score = 42.7 bits (99),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/86 (28%), Positives = 41/86 (48%), Gaps = 4/86 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ G P +   +  P A   +    +     KL ++    WDE  S+ +VE  L   ++
Sbjct  114  GFVLGLPINMDGSEGPRAQSTRAFARNFA---KLTELAIGLWDERLSTAAVERELLANDV  170

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVN  640
               +   ++D+ AA+ ILQG LD + 
Sbjct  171  SRARRAEVIDEHAAIFILQGALDRLT  196


 Score = 40.8 bits (94),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = +1

Query  163  PLNLFQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            PL     L   RG L+GLD+G K +G+AVSD + +LA+ ++ + RK    D
Sbjct  49   PLIDAAALWAPRGALIGLDLGTKTIGVAVSDPDRRLATGVTTIQRKNFTKD  99



>ref|WP_037987590.1| Holliday junction resolvase [Thalassospira permensis]
Length=168

 Score = 42.4 bits (98),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  199  GRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNIDL  318
             R+LGLD+G K +G+A+SDV  ++ASP S++ RKK   D+
Sbjct  9    ARVLGLDLGTKTIGVALSDVGLQIASPYSLISRKKFTRDI  48


 Score = 41.6 bits (96),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 45/87 (52%), Gaps = 5/87 (6%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAV-QVKLLIDDLCETGKLVDVKYTFWDESFSSKSVE-MLLKPLN  559
            G I G+P +       A  +V   +D   E    +D+    WDE  S+ +VE +L++ ++
Sbjct  62   GIIIGFPRELDGTVGKACHRVYAFVD---EMQNYIDLPILLWDERLSTNAVERILIEDVD  118

Query  560  LHPVQSKTIVDKFAAVEILQGYLDYVN  640
            +   +   +VDK AA  ILQG LD +N
Sbjct  119  MTRKRRAQVVDKTAAAYILQGALDNLN  145



>ref|WP_037457292.1| Holliday junction resolvase [Sphingobium chlorophenolicum]
 gb|KEQ51332.1| putative Holliday junction resolvase [Sphingobium chlorophenolicum]
Length=156

 Score = 46.2 bits (108),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +1

Query  172  LFQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNIDLMA  324
            LF+E +   GRL+GLDVG K +GLA+ D    +ASP   + R K + D +A
Sbjct  10   LFREALPHGGRLIGLDVGTKTIGLALCDAGWSIASPAHTVSRGKFSKDKIA  60


 Score = 37.7 bits (86),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 41/84 (49%), Gaps = 5/84 (6%)
 Frame = +2

Query  383  KGFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLN  559
            KG + G P +   + +P +   +    ++ + G    +   FWDE +S+++V   L   +
Sbjct  71   KGVVIGLPLNLDGSESPRSQASRAFGRNIADLG----LPILFWDERWSTQAVTRTLLEAD  126

Query  560  LHPVQSKTIVDKFAAVEILQGYLD  631
                +   +VDK AA  ILQG +D
Sbjct  127  ASRARRGELVDKLAASYILQGAID  150



>ref|WP_009736661.1| Holliday junction resolvase [Bradyrhizobiaceae bacterium SG-6C]
 gb|EGP07113.1| putative Holliday junction resolvase [Bradyrhizobiaceae bacterium 
SG-6C]
Length=163

 Score = 42.4 bits (98),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 41/85 (48%), Gaps = 4/85 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GFI G P +   +  P A   +    +     +  ++    WDE  S+ +VE  L  +++
Sbjct  72   GFILGLPINMDGSEGPRAQSTRAFARNFA---RQTELAIGLWDERLSTVAVERELIGMDM  128

Query  563  HPVQSKTIVDKFAAVEILQGYLDYV  637
               +   ++D+ AA+ ILQG LD +
Sbjct  129  SRARRAKVIDEHAAIFILQGALDRL  153


 Score = 41.6 bits (96),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +1

Query  196  RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            RG L+GLD+G K +G+AVSD + KLA+ +  + RK    D
Sbjct  18   RGALIGLDLGTKTIGVAVSDPDRKLATGIETIQRKTFTAD  57



>ref|WP_031337408.1| Holliday junction resolvase [Rhodopseudomonas sp. B29]
Length=161

 Score = 42.4 bits (98),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/86 (28%), Positives = 42/86 (49%), Gaps = 4/86 (5%)
 Frame = +2

Query  383  KGFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLN  559
             GF+ G P +   +  P A   +    +L    +L ++    WDE  S+ +VE  L   +
Sbjct  71   SGFVLGLPLNMDGSEGPRAQSTRAFARNLS---RLTELPIGLWDERLSTVAVERELIAQD  127

Query  560  LHPVQSKTIVDKFAAVEILQGYLDYV  637
            +   +   ++D+ AA+ ILQG LD +
Sbjct  128  VSRAKRGKVIDEHAAIFILQGALDRL  153


 Score = 41.2 bits (95),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +1

Query  184  LVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            L  +RG LLGLD+G K +G+A SD + +LA+ +  + RK    D
Sbjct  14   LWPARGALLGLDLGTKTIGVAASDPDRRLATGVETIARKAFTAD  57



>ref|WP_029026330.1| Holliday junction resolvase [Salinispora arenicola]
Length=153

 Score = 45.1 bits (105),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 41/87 (47%), Gaps = 3/87 (3%)
 Frame = +2

Query  389  FIFGYPFD-RQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
             + G P +   R+ P AVQV+  +  L E   +  V  T  DE  S+      L    + 
Sbjct  67   VVVGLPVNLAGRHGPAAVQVQEYVGRLVEV--ISPVPVTLADERMSTVVASRRLAERGVR  124

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNRN  646
              + + +VD+ AAVEILQ +LD   R 
Sbjct  125  GRRQRAVVDQAAAVEILQSWLDAQRRR  151


 Score = 38.5 bits (88),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 30/54 (56%), Gaps = 1/54 (2%)
 Frame = +1

Query  193  SRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIR-KKSNIDLMATDFQSLVRL  351
            SRG  LG+DVG   VG+A SD    LA+PL  L R + +  D + +D   L  L
Sbjct  5    SRGVRLGVDVGQARVGVARSDPHGVLATPLVTLARDRDAAPDAVPSDMAELAAL  58



>ref|WP_002712148.1| RNAse H-fold protein YqgF [Afipia clevelandensis]
 gb|EKS38813.1| RNAse H-fold protein YqgF [Afipia clevelandensis ATCC 49720]
Length=163

 Score = 42.0 bits (97),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 41/85 (48%), Gaps = 4/85 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GFI G P +   +  P A   +    +     +  ++    WDE  S+ +VE  L  +++
Sbjct  72   GFILGLPINMDGSEGPRAQSTRAFARNFA---RQTELAIGLWDERLSTVAVERELIGMDM  128

Query  563  HPVQSKTIVDKFAAVEILQGYLDYV  637
               +   ++D+ AA+ ILQG LD +
Sbjct  129  SRAKRAKVIDEHAAIFILQGALDRL  153


 Score = 41.6 bits (96),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +1

Query  196  RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            RG L+GLD+G K +G+AVSD + KLA+ +  + RK    D
Sbjct  18   RGALIGLDLGTKTIGVAVSDPDRKLATGIETIQRKTFTAD  57



>ref|WP_028166680.1| Holliday junction resolvase [Bradyrhizobium elkanii]
Length=160

 Score = 44.3 bits (103),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/87 (29%), Positives = 42/87 (48%), Gaps = 4/87 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ G P +   +  P A   +    +L     L  +    WDE  S+ +VE  L  L++
Sbjct  72   GFVLGLPINMDGSEGPRAQSTRAFARNLS---NLTTLAIGLWDERLSTAAVERELIGLDV  128

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVNR  643
               +   ++D+ AA+ ILQG LD + +
Sbjct  129  SRAKRAEVIDEHAAIFILQGALDRLAK  155


 Score = 39.3 bits (90),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +1

Query  196  RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            RG L+GLD+G K +G+AVSD + +LA+ +  + RK    D
Sbjct  18   RGALIGLDLGTKTIGIAVSDPDRRLATGVETVQRKAFKAD  57



>ref|WP_029081064.1| Holliday junction resolvase [Bradyrhizobium sp. th.b2]
Length=160

 Score = 43.9 bits (102),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 44/92 (48%), Gaps = 6/92 (7%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ G P +   +  P A   +    +L     L  +    WDE  S+ +VE  L  +++
Sbjct  72   GFVLGLPINMDGSEGPRAQSTRAFARNLA---GLTALAIGLWDERLSTAAVERELIGMDV  128

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVN--RNDK  652
               +   ++D+ AA+ ILQG LD +   R D+
Sbjct  129  SRARRAEVIDEHAAIFILQGALDRLAKLRGDR  160


 Score = 39.7 bits (91),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +1

Query  196  RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            RG L+GLD+G K +G+AVSD + +LA+ +  + RK+   D
Sbjct  18   RGALVGLDLGTKTIGVAVSDPDRRLATGVETIKRKQFKAD  57



>ref|WP_022671178.1| Holliday junction resolvase [Hippea alviniae]
Length=134

 Score = 42.4 bits (98),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 35/52 (67%), Gaps = 2/52 (4%)
 Frame = +1

Query  202  RLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNIDLMA--TDFQSLVRL  351
            R+LG+D G K +GLA+SD  N +A PLSV+   +++ID +   T+  ++ R+
Sbjct  2    RILGIDYGTKKIGLAISDETNTIALPLSVIDSDENSIDEIKRITEINNITRI  53


 Score = 41.2 bits (95),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 36/60 (60%), Gaps = 4/60 (7%)
 Frame = +2

Query  455  IDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLHPVQSKT-IVDKFAAVEILQGYLD  631
            ID L E   ++D++   WDE  S++  E +L   N+   ++K  ++DK AA  ILQGYLD
Sbjct  76   IDKLRE---VLDIEIVEWDERMSTRFSERILNNANVKGRKNKKKVIDKIAATFILQGYLD  132



>ref|WP_025780035.1| hypothetical protein [Dehalococcoidia bacterium DscP2]
Length=137

 Score = 43.1 bits (100),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  202  RLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNIDLMA  324
            R LGLD+G+K +G+A+SD E KLASP +++  K    D+ A
Sbjct  3    RSLGLDIGDKRIGVALSDPEGKLASPFTIISCKGDVADVEA  43


 Score = 40.4 bits (93),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 32/66 (48%), Gaps = 3/66 (5%)
 Frame = +2

Query  434  AVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLHPVQSKTIVDKFAAVEI  613
            A +VK     LC      +V   F DE  ++ S + L++  N    +SK   D  AA  I
Sbjct  72   AEKVKAFTQKLCSH---TEVPVEFRDERLTTVSAKRLMRAANTKKAKSKARYDAIAAALI  128

Query  614  LQGYLD  631
            LQGYLD
Sbjct  129  LQGYLD  134



>ref|WP_023462781.1| Holliday junction resolvase [Asticcacaulis sp. YBE204]
 gb|ESQ78791.1| Holliday junction resolvase [Asticcacaulis sp. YBE204]
Length=156

 Score = 45.8 bits (107),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 43/87 (49%), Gaps = 5/87 (6%)
 Frame = +2

Query  386  GFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSV-EMLLKPLN  559
            G + G P +      P    V+    +L    +L D+  TFWDE +SS  +   L++ +N
Sbjct  70   GMVIGLPVNMDGTEGPRCQSVRAFARNLL---RLRDIPITFWDERWSSSVMNRFLIEEVN  126

Query  560  LHPVQSKTIVDKFAAVEILQGYLDYVN  640
            L   +   ++D+ AA  ILQG LD + 
Sbjct  127  LTRAKRAEVIDRSAAAYILQGALDRIR  153


 Score = 37.7 bits (86),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 31/50 (62%), Gaps = 2/50 (4%)
 Frame = +1

Query  196  RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNIDLMATDFQSLV  345
            R  LLGLD G K +G+AVSD+   +ASPL ++  KKS   L A    +L+
Sbjct  16   RTGLLGLDHGEKTIGVAVSDIGLSIASPLELI--KKSKFTLEAERLFALM  63



>ref|WP_029004526.1| Holliday junction resolvase [Azorhizobium doebereinerae]
Length=151

 Score = 46.6 bits (109),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/87 (29%), Positives = 40/87 (46%), Gaps = 2/87 (2%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
             F+ G P +   +    VQ            +L      FWDE  S+ +VE  L   ++ 
Sbjct  65   AFVLGLPLNMDGSEGPRVQASRAFAR--NFARLSGRPIAFWDERLSTVAVERALISADMS  122

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNRN  646
              +  T++D+ AA  ILQG +D++NR 
Sbjct  123  RAKRATVIDQHAAAFILQGAIDFLNRR  149


 Score = 37.0 bits (84),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 17/45 (38%), Positives = 28/45 (62%), Gaps = 0/45 (0%)
 Frame = +1

Query  181  ELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            +L+  RG +LGLD+G K +G+A  D + +LA+ +  + R K   D
Sbjct  6    DLLPPRGAILGLDLGTKTIGVASCDPDRRLATIVETIQRSKFTPD  50



>ref|WP_028098158.1| Holliday junction resolvase [Dongia sp. URHE0060]
Length=157

 Score = 42.7 bits (99),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/88 (30%), Positives = 41/88 (47%), Gaps = 4/88 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            G I G P +      P    V+    +L     + D+   FWDE  S+ +V   +  ++L
Sbjct  70   GLIIGLPLNMDGTEGPRCQSVRQFATNLT---PIRDLPIAFWDERLSTMAVTRDMIGMDL  126

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVNRN  646
               +   +VD+ AA  ILQG LD ++R 
Sbjct  127  SRAKRAKVVDQSAAAFILQGALDSLHRG  154


 Score = 40.8 bits (94),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 32/56 (57%), Gaps = 1/56 (2%)
 Frame = +1

Query  148  MKYMKPLNLFQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            M Y  P  L   L ++  RL  LD+G K +G+A+ D  +++ASPL+ + R K   D
Sbjct  1    MIYPTPTELAAALPRN-ARLAALDLGEKTIGIAIGDPGHRVASPLTTIRRTKFTKD  55



>ref|WP_015514593.1| hypothetical protein [Coprococcus catus]
 ref|YP_007770443.1| conserved hypothetical protein TIGR00250 [Coprococcus catus GD/7]
 emb|CBK81034.1| conserved hypothetical protein TIGR00250 [Coprococcus catus GD/7]
Length=155

 Score = 49.3 bits (116),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/97 (31%), Positives = 47/97 (48%), Gaps = 2/97 (2%)
 Frame = +2

Query  389  FIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLHP  568
             + GYP +      + V+  L   +  E  +   ++   WDE  S+ + E +L   N+  
Sbjct  60   IVLGYPKNMNDTEGERVEKTLAFKEALE--RRTGLEVILWDERMSTVASERVLMEGNVRR  117

Query  569  VQSKTIVDKFAAVEILQGYLDYVNRNDKMKLSARSEE  679
               KT +DK AA  ILQGYLDY + ++    S  SE+
Sbjct  118  EDRKTYIDKMAAAFILQGYLDYQSFSENQAESEDSED  154


 Score = 34.3 bits (77),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 22/36 (61%), Gaps = 0/36 (0%)
 Frame = +1

Query  202  RLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSN  309
            R++GLD G+K VG+AVSD     A  L  + RK  N
Sbjct  4    RIIGLDYGSKTVGVAVSDPLGFTAQGLETITRKDEN  39



>ref|WP_028031877.1| Holliday junction resolvase [Gemmobacter nectariphilus]
Length=159

 Score = 42.4 bits (98),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 39/86 (45%), Gaps = 4/86 (5%)
 Frame = +2

Query  383  KGFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLN  559
            KG + G P +   +  P A   +    +L    KL  +  TFWDE  S+ + E  L   +
Sbjct  71   KGIVLGLPRNMDGSEGPRAQSTRAFARNLA---KLTPLPITFWDERLSTVAAERALLEAD  127

Query  560  LHPVQSKTIVDKFAAVEILQGYLDYV  637
                +   ++D  AA  ILQG LD +
Sbjct  128  TSRARRAQVIDHVAAGYILQGALDRL  153


 Score = 40.8 bits (94),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 27/42 (64%), Gaps = 0/42 (0%)
 Frame = +1

Query  199  GRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNIDLMA  324
            G L GLD+G K +G+AVSD    +ASPL  + R+K  ID  A
Sbjct  19   GALAGLDLGTKTIGVAVSDSLRSVASPLLTIRREKFTIDAEA  60



>ref|WP_018996080.1| Holliday junction resolvase [Hirschia maritima]
Length=151

 Score = 45.8 bits (107),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 41/83 (49%), Gaps = 4/83 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQ-VKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            G + G P +   ++   VQ VK L  ++ E     DV   FWDE  S+ +VE  L   + 
Sbjct  67   GLVMGLPVNMDGSHGPRVQAVKALSRNILEK---RDVPIAFWDERLSTAAVERTLLEADT  123

Query  563  HPVQSKTIVDKFAAVEILQGYLD  631
               +   +VDK AA  ILQG +D
Sbjct  124  SRAKRAEVVDKMAASYILQGAID  146


 Score = 37.4 bits (85),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = +1

Query  199  GRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKK  303
            G LLGLD G K +G+A +D    +ASPL  + R K
Sbjct  13   GPLLGLDPGTKTIGVAAADTTRTIASPLETIKRGK  47



>ref|WP_015666364.1| putative holliday junction resolvase [Bradyrhizobium oligotrophicum]
 ref|YP_007512831.1| putative holliday junction resolvase [Bradyrhizobium oligotrophicum 
S58]
 dbj|BAM89244.1| putative holliday junction resolvase [Bradyrhizobium oligotrophicum 
S58]
Length=161

 Score = 44.3 bits (103),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 40/86 (47%), Gaps = 4/86 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ G P +   +  P A   +    +L     L  +    WDE  S+ +VE  L  L++
Sbjct  72   GFVLGLPINMDGSEGPRAQSTRAFARNLA---NLTTLPIGLWDERLSTAAVERELIGLDV  128

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVN  640
               +   ++D  AA+ ILQG LD + 
Sbjct  129  SRARRAEVIDTHAAIFILQGALDRLT  154


 Score = 38.9 bits (89),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +1

Query  196  RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            RG L+GLD+G K +G+AVSD + +LA+ +  + RK    D
Sbjct  18   RGALVGLDLGTKTIGVAVSDPDRRLATGVETIQRKAFKAD  57



>ref|WP_016745426.1| Holliday junction resolvase [Sphingomonas wittichii]
Length=151

 Score = 46.6 bits (109),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  175  FQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            F++ +  RGRL GLDVG + +G+A+ D    +ASP   ++R K ++D
Sbjct  9    FRDALPDRGRLAGLDVGTRTIGVALCDAGWTIASPAETILRAKFSVD  55


 Score = 36.6 bits (83),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/86 (27%), Positives = 40/86 (47%), Gaps = 5/86 (6%)
 Frame = +2

Query  383  KGFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLN  559
            KG + G P +    ++P    V+    ++   G    +    WDE +S+++V   L   +
Sbjct  69   KGLVIGLPLNLDGTDSPRTQSVRAFARNVEPFG----LPILLWDERWSTQAVTRTLLDAD  124

Query  560  LHPVQSKTIVDKFAAVEILQGYLDYV  637
                +   +VDK AA  ILQG +D +
Sbjct  125  ASRARRAELVDKLAAAYILQGAIDAM  150



>ref|WP_011951449.1| MULTISPECIES: Holliday junction resolvase [Sphingomonas]
 ref|YP_001261107.1| Holliday junction resolvase YqgF [Sphingomonas wittichii RW1]
 sp|A5V3V3.1|RUVX_SPHWW RecName: Full=Putative Holliday junction resolvase [Sphingomonas 
wittichii RW1]
 gb|ABQ66969.1| Holliday junction resolvase YqgF [Sphingomonas wittichii RW1]
Length=151

 Score = 46.6 bits (109),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  175  FQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            F++ +  RGRL GLDVG + +G+A+ D    +ASP   ++R K ++D
Sbjct  9    FRDALPDRGRLAGLDVGTRTIGVALCDAGWTIASPAETILRAKFSVD  55


 Score = 36.6 bits (83),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/86 (27%), Positives = 40/86 (47%), Gaps = 5/86 (6%)
 Frame = +2

Query  383  KGFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLN  559
            KG + G P +    ++P    V+    ++   G    +    WDE +S+++V   L   +
Sbjct  69   KGLVIGLPLNLDGSDSPRTQSVRAFARNVEPFG----LPILLWDERWSTQAVTRTLLDAD  124

Query  560  LHPVQSKTIVDKFAAVEILQGYLDYV  637
                +   +VDK AA  ILQG +D +
Sbjct  125  ASRARRAELVDKLAAAYILQGAIDAM  150



>ref|WP_029563669.1| Holliday junction resolvase [alpha proteobacterium SCGC AAA240-E13]
Length=156

 Score = 43.5 bits (101),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 40/85 (47%), Gaps = 2/85 (2%)
 Frame = +2

Query  383  KGFIFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            +G + G P +   +   + Q  L  D      K   +  T WDE  SS++   L KPLN 
Sbjct  72   RGIVIGKPINMDGSLGKSAQSAL--DFAKNISKNFTIPITLWDERLSSQAAFNLTKPLNT  129

Query  563  HPVQSKTIVDKFAAVEILQGYLDYV  637
            +       +DK +A  ILQG +DY+
Sbjct  130  NTSNKIKNLDKNSAAFILQGAIDYL  154


 Score = 39.7 bits (91),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = +1

Query  175  FQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKK  303
            F++ + +  RLLG+D G K +G+A+ D    +A+PL+ + +KK
Sbjct  12   FKKKIGNNSRLLGIDPGKKKIGIAICDENTAVATPLTTIKKKK  54



>ref|WP_014248137.1| Holliday junction resolvase [Azospirillum lipoferum]
 ref|YP_005039362.1| putative Holliday junction resolvase [Azospirillum lipoferum 
4B]
 emb|CBS87133.1| putative Holliday junction resolvase [Azospirillum lipoferum 
4B]
Length=187

 Score = 43.1 bits (100),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 43/88 (49%), Gaps = 4/88 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLV--DVKYTFWDESFSSKSVE-MLLKP  553
            G + G P +      P A  V+    +L E   L+  + +  FWDE  S+ +VE  ++  
Sbjct  69   GLVVGLPLNMDGTEGPRAESVRAFAKNLLERPDLLGWEAEIAFWDERLSTSAVERFMIGE  128

Query  554  LNLHPVQSKTIVDKFAAVEILQGYLDYV  637
             ++   +   +VDK AA  ILQG LD +
Sbjct  129  ADMTRKRRDEVVDKMAAAYILQGALDML  156


 Score = 40.0 bits (92),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +1

Query  202  RLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            RLLGLDVG K VGLAV+D    +ASP+  L R K   D
Sbjct  17   RLLGLDVGTKTVGLAVADPGLIVASPIGTLKRTKFTQD  54



>ref|WP_027553107.1| Holliday junction resolvase [Bradyrhizobium sp. Cp5.3]
Length=163

 Score = 43.5 bits (101),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 4/85 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ G P +   +  P A   +    +L     L  +    WDE  S+ +VE  L  +++
Sbjct  72   GFVLGLPINMDGSEGPRAQSTRAFARNLA---GLTALPIGLWDERLSTAAVERELIGMDV  128

Query  563  HPVQSKTIVDKFAAVEILQGYLDYV  637
               +   ++D+ AA+ ILQG LD +
Sbjct  129  SRARRAEVIDEHAAIFILQGALDRL  153


 Score = 39.7 bits (91),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +1

Query  193  SRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            +RG L+GLD+G K +G+AVSD + +LA+ +  + RK    D
Sbjct  17   ARGALIGLDLGTKTIGVAVSDPDRRLATGVETIQRKAFKQD  57



>ref|WP_011158658.1| Holliday junction resolvase [Rhodopseudomonas palustris]
 ref|NP_948452.1| Holliday junction resolvase-like protein [Rhodopseudomonas palustris 
CGA009]
 ref|YP_001992498.1| Holliday junction resolvase-like protein [Rhodopseudomonas palustris 
TIE-1]
 sp|Q6N569.1|RUVX_RHOPA RecName: Full=Putative Holliday junction resolvase [Rhodopseudomonas 
palustris CGA009]
 sp|B3Q9X0.1|RUVX_RHOPT RecName: Full=Putative Holliday junction resolvase [Rhodopseudomonas 
palustris TIE-1]
 emb|CAE28554.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
 gb|ACF02023.1| Holliday junction resolvase YqgF [Rhodopseudomonas palustris 
TIE-1]
Length=160

 Score = 43.1 bits (100),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 42/85 (49%), Gaps = 4/85 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ G P +   +  P A   +    +L    +L ++    WDE  S+ +VE  L   ++
Sbjct  72   GFVLGLPLNMDGSEGPRAQSTRAFARNLS---RLTELPIGLWDERLSTAAVERELIANDV  128

Query  563  HPVQSKTIVDKFAAVEILQGYLDYV  637
               +   ++D+ AA+ ILQG LD +
Sbjct  129  SRAKRAKVIDEHAAIFILQGALDRL  153


 Score = 39.7 bits (91),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  196  RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRK  300
            RG LLGLD+G K +G+A SD + KLA+ +  + RK
Sbjct  18   RGALLGLDLGTKTIGVAASDPDRKLATGVETIARK  52



>ref|WP_013068027.1| Holliday junction resolvase [Rhodobacter capsulatus]
 ref|YP_003578455.1| holliday junction resolvase YqgF [Rhodobacter capsulatus SB 1003]
 sp|Q52673.2|RUVX_RHOCB RecName: Full=Putative Holliday junction resolvase [Rhodobacter 
capsulatus SB 1003]
 gb|ADE86048.1| holliday junction resolvase YqgF [Rhodobacter capsulatus SB 1003]
Length=159

 Score = 41.6 bits (96),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 40/85 (47%), Gaps = 4/85 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ G P +   +  P A   +    +L    KL  +  TFWDE  S+ + E  +   +L
Sbjct  70   GFVLGLPVNMDGSEGPRAQSTRAFARNLE---KLTPLPITFWDERLSTVAAERAMLEADL  126

Query  563  HPVQSKTIVDKFAAVEILQGYLDYV  637
               +   +VD  AA  ILQG LD +
Sbjct  127  SRKRRAELVDHVAAGFILQGALDRL  151


 Score = 41.2 bits (95),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +1

Query  199  GRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNIDL  318
            G L GLD+G K +G+AVSD    +A+PL  + R+K ++DL
Sbjct  17   GALAGLDLGTKTIGVAVSDTLRGIATPLRTIRREKFSLDL  56



>ref|WP_008967052.1| Holliday junction resolvase [Bradyrhizobium sp. STM 3843]
 emb|CCE04527.1| putative Holliday junction resolvase [Bradyrhizobium sp. STM 
3843]
Length=161

 Score = 43.5 bits (101),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/87 (28%), Positives = 41/87 (47%), Gaps = 4/87 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            G + G P +   +  P A   +    +L     L D+    WDE  S+ +VE  L  +++
Sbjct  72   GIVLGLPINMDGSEGPRAQSTRAFARNLA---GLTDLPIGLWDERLSTAAVERELIGMDV  128

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVNR  643
               +   ++D  AA+ ILQG LD + +
Sbjct  129  SRARRAEVIDTHAAIFILQGALDRLAK  155


 Score = 39.7 bits (91),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  196  RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRK  300
            RG L+GLD+G K +G+AVSD + KLA+ +  + RK
Sbjct  18   RGALIGLDLGTKTIGVAVSDPDRKLATGVETIQRK  52



>ref|WP_018390671.1| Holliday junction resolvase [Ancylobacter sp. FA202]
Length=160

 Score = 42.4 bits (98),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +1

Query  184  LVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            L+  RG L+GLD+G K +G+A SD + +LA+P+  + RK+   D
Sbjct  14   LLPLRGGLIGLDLGTKTIGVASSDPDRRLAAPVETIARKQFTPD  57


 Score = 40.8 bits (94),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/86 (27%), Positives = 41/86 (48%), Gaps = 4/86 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            G + G P +   +  P A   +    +L    +L ++    WDE  S+ +VE  +  +++
Sbjct  72   GIVLGLPVNMDGSEGPRAQSSRAFARNLA---RLTELPIILWDERLSTAAVERDMIAMDM  128

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVN  640
               +   +VD+ AA  ILQG LD + 
Sbjct  129  SRARRAEVVDQQAAAFILQGALDRLR  154



>ref|WP_028143927.1| MULTISPECIES: Holliday junction resolvase [Bradyrhizobium]
Length=161

 Score = 43.1 bits (100),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 4/85 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ G P +   +  P A   +    +L     L  +    WDE  S+ +VE  L  +++
Sbjct  72   GFVLGLPINMDGSEGPRAQSTRAFARNLA---GLTALPIGLWDERLSTAAVERELIGMDV  128

Query  563  HPVQSKTIVDKFAAVEILQGYLDYV  637
               +   ++D+ AA+ ILQG LD +
Sbjct  129  SRAKRAEVIDEHAAIFILQGALDRL  153


 Score = 39.7 bits (91),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  193  SRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            +RG L+GLD+G K +G+AVSD + +LA+ +  + RK+   D
Sbjct  17   ARGALVGLDLGTKTIGVAVSDPDRRLATGVETIQRKQFKQD  57



>ref|WP_013495637.1| Holliday junction resolvase [Thermaerobacter marianensis]
 ref|YP_004102059.1| Holliday junction resolvase YqgF [Thermaerobacter marianensis 
DSM 12885]
 gb|ADU51332.1| Holliday junction resolvase YqgF [Thermaerobacter marianensis 
DSM 12885]
Length=326

 Score = 45.8 bits (107),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 41/89 (46%), Gaps = 6/89 (7%)
 Frame = +2

Query  386  GFIFGYP--FDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLN  559
            G + G+P   D  R  P+A   +   D L E G     + T WDE  S+   E +L   +
Sbjct  54   GVVVGWPRRLDGTRG-PEAEAAERFADALREAGV---PRVTLWDERLSTVEAERVLIAAD  109

Query  560  LHPVQSKTIVDKFAAVEILQGYLDYVNRN  646
            L   + K I+D+ AA  ILQ +L    R 
Sbjct  110  LSRRRRKQIIDRMAATVILQAFLQSQRRQ  138


 Score = 37.0 bits (84),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +1

Query  202  RLLGLDVGNKYVGLAVSDVENKLASPLSVLIRK  300
            R LGLD+G++ +G+A+SD E  +A PL  L R+
Sbjct  2    RWLGLDLGSRVIGVAISDPEGIVARPLGSLPRR  34



>ref|WP_020175304.1| hypothetical protein [Methyloferula stellata]
Length=161

 Score = 45.1 bits (105),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +1

Query  202  RLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNIDL  318
            RL+G+D+G K +GLA+SDVE +LASPL  + R     D+
Sbjct  20   RLIGIDLGTKTIGLALSDVERRLASPLETIRRTTFTKDV  58


 Score = 37.7 bits (86),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 39/85 (46%), Gaps = 4/85 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRNNPDAVQ-VKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
             F+ G P +   +    VQ  +  + +L   G   D  + +WDE  S+ +V   L   + 
Sbjct  72   AFVIGLPLNMDGSEGPRVQSTRAFVRNL---GLKTDRPFVYWDERLSTAAVIRELLAQDA  128

Query  563  HPVQSKTIVDKFAAVEILQGYLDYV  637
               +   +VD+ AA  ILQG LD +
Sbjct  129  SRAKRAEVVDRMAAAFILQGALDRL  153



>ref|WP_018321099.1| Holliday junction resolvase [Bradyrhizobium sp. WSM2793]
Length=161

 Score = 43.1 bits (100),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 4/85 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ G P +   +  P A   +    +L     L  +    WDE  S+ +VE  L  +++
Sbjct  72   GFVLGLPINMDGSEGPRAQSTRAFARNLA---GLTALPIGLWDERLSTAAVERELIGMDV  128

Query  563  HPVQSKTIVDKFAAVEILQGYLDYV  637
               +   ++D+ AA+ ILQG LD +
Sbjct  129  SRAKRAEVIDEHAAIFILQGALDRL  153


 Score = 39.7 bits (91),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  193  SRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            +RG L+GLD+G K +G+AVSD + +LA+ +  + RK+   D
Sbjct  17   ARGALVGLDLGTKTIGVAVSDPDRRLATGVETIQRKQFKQD  57



>ref|WP_025036743.1| Holliday junction resolvase [Bradyrhizobium sp. DOA9]
 dbj|GAJ35790.1| putative Holliday junction resolvase [Bradyrhizobium sp. DOA9]
Length=161

 Score = 43.1 bits (100),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 4/85 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ G P +   +  P A   +    +L     L  +    WDE  S+ +VE  L  +++
Sbjct  72   GFVLGLPINMDGSEGPRAQSTRAFARNLA---GLTALPIGLWDERLSTAAVERELIGMDV  128

Query  563  HPVQSKTIVDKFAAVEILQGYLDYV  637
               +   ++D+ AA+ ILQG LD +
Sbjct  129  SRAKRAEVIDEHAAIFILQGALDRL  153


 Score = 39.7 bits (91),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  193  SRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            +RG L+GLD+G K +G+AVSD + +LA+ +  + RK+   D
Sbjct  17   ARGALVGLDLGTKTIGVAVSDPDRRLATGVETIQRKQFKQD  57



>ref|WP_007707490.1| Holliday junction resolvase [Sphingobium sp. AP49]
 gb|EJK85096.1| RNAse H-fold protein YqgF [Sphingobium sp. AP49]
Length=157

 Score = 43.9 bits (102),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +1

Query  172  LFQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            LF+  +   GRL+G+DVG K +GLA+ D +  +ASP   + R K + D
Sbjct  10   LFRAALPEGGRLIGMDVGTKTIGLALCDAQWSIASPAYTVTRGKFSKD  57


 Score = 38.9 bits (89),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 40/84 (48%), Gaps = 5/84 (6%)
 Frame = +2

Query  383  KGFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLN  559
            KG + G P +    N+P +   +    ++ + G    +    WDE +S+++V   L   +
Sbjct  71   KGIVIGLPLNLDGTNSPRSQASRAFAHNVADIG----LPVLLWDERWSTQAVTRTLLEAD  126

Query  560  LHPVQSKTIVDKFAAVEILQGYLD  631
                +   +VDK AA  ILQG +D
Sbjct  127  ASRARRDELVDKLAASYILQGAID  150



>ref|WP_019403549.1| hypothetical protein [Chelatococcus sp. GW1]
Length=167

 Score = 42.7 bits (99),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 33/51 (65%), Gaps = 5/51 (10%)
 Frame = +1

Query  202  RLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNIDLMATDFQSLVRLS  354
            RL+G+D+G + +GLA+SDV   +ASPL  + R K      +TD + LV L+
Sbjct  19   RLIGVDLGTRTIGLALSDVGRSIASPLETIKRTK-----FSTDVKRLVELA  64


 Score = 40.0 bits (92),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/105 (27%), Positives = 44/105 (42%), Gaps = 11/105 (10%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            G + G P +   +  P A   +  + +L      + +    WDE  ++ +V   L   + 
Sbjct  71   GLVIGLPLNMDGSEGPRAQATRAFVRNLAAH---LPLPVALWDERLTTAAVTRTLLEADA  127

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVNRNDKMKLSARSEEPADEDG  697
               +   +VDK AA  ILQG LD +        SAR    A+ DG
Sbjct  128  SRARRSDLVDKMAASYILQGALDRLA-------SARRAAMAERDG  165



>ref|WP_028180845.1| MULTISPECIES: Holliday junction resolvase [Bradyrhizobium]
Length=163

 Score = 43.5 bits (101),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 4/85 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ G P +   +  P A   +    +L     L  +    WDE  S+ +VE  L  +++
Sbjct  72   GFVLGLPINMDGSEGPRAQSTRAFARNLA---GLTQLPIGLWDERLSTAAVERELIGMDV  128

Query  563  HPVQSKTIVDKFAAVEILQGYLDYV  637
               +   ++D+ AA+ ILQG LD +
Sbjct  129  SRAKRAEVIDEHAAIFILQGALDRL  153


 Score = 39.3 bits (90),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +1

Query  196  RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            RG L+GLD+G K +G+AVSD + +LA+ +  + RK    D
Sbjct  18   RGALVGLDLGTKTIGVAVSDPDRRLATGVETIARKAFKQD  57



>ref|WP_023450219.1| Holliday junction resolvase [Asticcacaulis sp. AC402]
 gb|ESQ74638.1| Holliday junction resolvase [Asticcacaulis sp. AC402]
Length=157

 Score = 42.7 bits (99),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/87 (29%), Positives = 42/87 (48%), Gaps = 5/87 (6%)
 Frame = +2

Query  386  GFIFGYPFDRQ-RNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSV-EMLLKPLN  559
            G + G P +      P A   +    +L    +L D+   FWDE +SS ++   L++  +
Sbjct  70   GLVIGLPVNMDGSEGPRAQSCRAFARNLL---RLRDIPIAFWDERWSSAAMNRFLIEEAD  126

Query  560  LHPVQSKTIVDKFAAVEILQGYLDYVN  640
            L   +   ++D+ AA  ILQG LD + 
Sbjct  127  LSRAKRAEVIDRNAAAYILQGALDRIR  153


 Score = 39.7 bits (91),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 26/35 (74%), Gaps = 1/35 (3%)
 Frame = +1

Query  196  RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRK  300
            R  LLGLD+G K +G+AVSD+   LASPL  LIRK
Sbjct  16   RRALLGLDLGEKTIGVAVSDISLTLASPLE-LIRK  49



>ref|WP_028051332.1| Holliday junction resolvase [Carboxydothermus ferrireducens]
Length=138

 Score = 51.2 bits (121),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 43/85 (51%), Gaps = 2/85 (2%)
 Frame = +2

Query  392  IFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLHPV  571
            + GYP  R  N     + +L+     E  K   +K  FWDE  S+   E LL   ++   
Sbjct  56   VIGYP--RNMNGTAGPRAELVERFAWELYKFTGIKPVFWDERLSTVEAEKLLISGDISRR  113

Query  572  QSKTIVDKFAAVEILQGYLDYVNRN  646
            + K ++DK AA  IL GYL+Y ++N
Sbjct  114  KRKKVIDKLAATLILSGYLNYKSKN  138


 Score = 31.6 bits (70),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 25/39 (64%), Gaps = 0/39 (0%)
 Frame = +1

Query  202  RLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNIDL  318
            ++LGLDVG+K +G+A+SD     A  L+V+ R     DL
Sbjct  2    KVLGLDVGDKKIGVALSDELGLTAQGLTVIYRTSLKKDL  40



>ref|WP_029019183.1| Holliday junction resolvase [Salinispora arenicola]
Length=153

 Score = 45.1 bits (105),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 41/87 (47%), Gaps = 3/87 (3%)
 Frame = +2

Query  389  FIFGYPFD-RQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
             + G P +   R+ P AVQV+  +  L E   +  V  T  DE  S+      L    + 
Sbjct  67   VVVGLPVNLAGRHGPAAVQVQEYVGRLVEV--ISPVPVTLADERMSTVVASRRLAERGVR  124

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNRN  646
              + + +VD+ AAVEILQ +LD   R 
Sbjct  125  GRRQRAVVDQAAAVEILQSWLDAQRRR  151


 Score = 37.7 bits (86),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 30/54 (56%), Gaps = 1/54 (2%)
 Frame = +1

Query  193  SRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIR-KKSNIDLMATDFQSLVRL  351
            SRG  LG+DVG   VG+A SD    LA+PL  L R + +  D + +D   L  L
Sbjct  5    SRGVRLGVDVGQVRVGVARSDPHGVLATPLVTLARDRDAAPDAVPSDMAELAAL  58



>ref|WP_028183293.1| Holliday junction resolvase [Salinispora arenicola]
Length=153

 Score = 45.1 bits (105),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 41/87 (47%), Gaps = 3/87 (3%)
 Frame = +2

Query  389  FIFGYPFD-RQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
             + G P +   R+ P AVQV+  +  L E   +  V  T  DE  S+      L    + 
Sbjct  67   VVVGLPVNLAGRHGPAAVQVQEYVGRLVEV--ISPVPVTLADERMSTVVASRRLAERGVR  124

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNRN  646
              + + +VD+ AAVEILQ +LD   R 
Sbjct  125  GRRQRAVVDQAAAVEILQSWLDAQRRR  151


 Score = 37.7 bits (86),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 30/54 (56%), Gaps = 1/54 (2%)
 Frame = +1

Query  193  SRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIR-KKSNIDLMATDFQSLVRL  351
            SRG  LG+DVG   VG+A SD    LA+PL  L R + +  D + +D   L  L
Sbjct  5    SRGVRLGVDVGQVRVGVARSDPHGVLATPLVTLARDRDAAPDAVPSDIAELAAL  58



>ref|WP_027559624.1| MULTISPECIES: Holliday junction resolvase [Bradyrhizobium]
Length=161

 Score = 43.5 bits (101),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 4/85 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ G P +   +  P A   +    +L     L  +    WDE  S+ +VE  L  +++
Sbjct  72   GFVLGLPINMDGSEGPRAQSTRAFARNLA---GLTALPIGLWDERLSTAAVERELIGMDV  128

Query  563  HPVQSKTIVDKFAAVEILQGYLDYV  637
               +   ++D+ AA+ ILQG LD +
Sbjct  129  SRAKRAEVIDEHAAIFILQGALDRL  153


 Score = 39.3 bits (90),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +1

Query  196  RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            RG L+GLD+G K +G+AVSD + +LA+ +  + RK+   D
Sbjct  18   RGALVGLDLGTKTIGVAVSDPDRRLATGVETIQRKQFKQD  57



>ref|WP_036025537.1| Holliday junction resolvase [Bradyrhizobium yuanmingense]
Length=163

 Score = 42.7 bits (99),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 4/85 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ G P +   +  P A   +    +L     L  +    WDE  S+ +VE  L  +++
Sbjct  72   GFVLGLPINMDGSEGPRAQSTRAFARNLA---GLTALPIGLWDERLSTAAVERELIGMDV  128

Query  563  HPVQSKTIVDKFAAVEILQGYLDYV  637
               +   ++D+ AA+ ILQG LD +
Sbjct  129  SRAKRAEVIDEHAAIFILQGALDRL  153


 Score = 39.7 bits (91),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  193  SRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            +RG L+GLD+G K +G+AVSD + +LA+ +  + RK+   D
Sbjct  17   ARGALVGLDLGTKTIGVAVSDPDRRLATGVETIQRKQFKQD  57



>ref|WP_019032717.1| Holliday junction resolvase [Salinispora arenicola]
Length=153

 Score = 45.1 bits (105),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 41/87 (47%), Gaps = 3/87 (3%)
 Frame = +2

Query  389  FIFGYPFD-RQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
             + G P +   R+ P AVQV+  +  L E   +  V  T  DE  S+      L    + 
Sbjct  67   VVVGLPVNLAGRHGPAAVQVQEYVGRLVEV--ISPVPVTLADERMSTVVASRRLAERGVR  124

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNRN  646
              + + +VD+ AAVEILQ +LD   R 
Sbjct  125  GRRQRAVVDQAAAVEILQSWLDAQRRR  151


 Score = 37.7 bits (86),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 30/54 (56%), Gaps = 1/54 (2%)
 Frame = +1

Query  193  SRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIR-KKSNIDLMATDFQSLVRL  351
            SRG  LG+DVG   VG+A SD    LA+PL  L R + +  D + +D   L  L
Sbjct  5    SRGVRLGVDVGQVRVGVARSDPHGVLATPLVTLARDRDAAPDAVPSDIAELAAL  58



>ref|WP_012182011.1| Holliday junction resolvase [Salinispora arenicola]
 ref|YP_001536697.1| Holliday junction resolvase YqgF [Salinispora arenicola CNS-205]
 gb|ABV97706.1| Holliday junction resolvase YqgF [Salinispora arenicola CNS-205]
Length=153

 Score = 45.1 bits (105),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 41/87 (47%), Gaps = 3/87 (3%)
 Frame = +2

Query  389  FIFGYPFD-RQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
             + G P +   R+ P AVQV+  +  L E   +  V  T  DE  S+      L    + 
Sbjct  67   VVVGLPVNLAGRHGPAAVQVQEYVGRLVEV--ISPVPVTLADERMSTVVASRRLAERGVR  124

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNRN  646
              + + +VD+ AAVEILQ +LD   R 
Sbjct  125  GRRQRAVVDQAAAVEILQSWLDAQRRR  151


 Score = 37.7 bits (86),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 30/54 (56%), Gaps = 1/54 (2%)
 Frame = +1

Query  193  SRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIR-KKSNIDLMATDFQSLVRL  351
            SRG  LG+DVG   VG+A SD    LA+PL  L R + +  D + +D   L  L
Sbjct  5    SRGVRLGVDVGQVRVGVARSDPHGVLATPLVTLARDRDAAPDAVPSDIAELAAL  58



>ref|WP_018644551.1| Holliday junction resolvase [Bradyrhizobium japonicum]
Length=159

 Score = 43.1 bits (100),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 4/85 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ G P +   +  P A   +    +L     L  +    WDE  S+ +VE  L  +++
Sbjct  72   GFVLGLPINMDGSEGPRAQSTRAFARNLA---GLTALPIGLWDERLSTAAVERELIGMDV  128

Query  563  HPVQSKTIVDKFAAVEILQGYLDYV  637
               +   ++D+ AA+ ILQG LD +
Sbjct  129  SRAKRAEVIDEHAAIFILQGALDRL  153


 Score = 39.3 bits (90),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +1

Query  196  RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            RG L+GLD+G K +G+AVSD + +LA+ +  + RK+   D
Sbjct  18   RGALVGLDLGTKTIGVAVSDPDRRLATGVETIQRKQFKQD  57



>ref|WP_036015081.1| Holliday junction resolvase [Bradyrhizobium yuanmingense]
Length=163

 Score = 42.7 bits (99),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 4/85 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ G P +   +  P A   +    +L     L  +    WDE  S+ +VE  L  +++
Sbjct  72   GFVLGLPINMDGSEGPRAQSTRAFARNLA---GLTALPIGLWDERLSTAAVERELIGMDV  128

Query  563  HPVQSKTIVDKFAAVEILQGYLDYV  637
               +   ++D+ AA+ ILQG LD +
Sbjct  129  SRAKRAEVIDEHAAIFILQGALDRL  153


 Score = 39.7 bits (91),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  193  SRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            +RG L+GLD+G K +G+AVSD + +LA+ +  + RK+   D
Sbjct  17   ARGALVGLDLGTKTIGVAVSDPDRRLATGVETIQRKQFKQD  57



>gb|EXS69297.1| Holliday junction resolvase [Sphingobium sp. Ant17]
Length=157

 Score = 45.1 bits (105),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 29/47 (62%), Gaps = 0/47 (0%)
 Frame = +1

Query  175  FQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            F+E +   GRL+G+DVG K +GLA+ D    +ASP   + R K + D
Sbjct  11   FREALPQGGRLVGMDVGTKTIGLALCDARWSIASPAHTITRSKFSKD  57


 Score = 37.4 bits (85),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 39/84 (46%), Gaps = 5/84 (6%)
 Frame = +2

Query  383  KGFIFGYPFDR-QRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLN  559
            KG + G P +     +P +   +    +L + G    +    WDE +S+++V   L   +
Sbjct  71   KGIVIGLPLNLDGTGSPRSQSSRAFAHNLADFG----LPVLLWDERWSTQAVTRTLIEAD  126

Query  560  LHPVQSKTIVDKFAAVEILQGYLD  631
                +   +VDK AA  ILQG +D
Sbjct  127  ASRARRDVLVDKLAASYILQGAID  150



>ref|WP_017184652.1| Holliday junction resolvase [Sphingobium xenophagum]
Length=156

 Score = 43.5 bits (101),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +1

Query  175  FQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNIDLMA  324
            F+E +   GRL+G+DVG K +GLA+ D    +ASP   + R K   D +A
Sbjct  11   FRECLPEGGRLIGMDVGTKTIGLALCDDRWSIASPAHTINRGKFTKDKIA  60


 Score = 38.9 bits (89),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 40/84 (48%), Gaps = 5/84 (6%)
 Frame = +2

Query  383  KGFIFGYPFDR-QRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLN  559
            KG + G P +     +P +   +    +L + G    +    WDE +S+++V   L   +
Sbjct  71   KGIVIGLPLNLDGTGSPRSQSSRAFAQNLTDLG----LPILLWDERWSTQAVTRTLLEAD  126

Query  560  LHPVQSKTIVDKFAAVEILQGYLD  631
                + + +VDK AA  ILQG +D
Sbjct  127  ASRARREVLVDKLAASYILQGAID  150



>ref|WP_011343476.1| Holliday junction resolvase [Carboxydothermus hydrogenoformans]
 ref|YP_359400.1| hypothetical protein CHY_0542 [Carboxydothermus hydrogenoformans 
Z-2901]
 sp|Q3AEN4.1|RUVX_CARHZ RecName: Full=Putative Holliday junction resolvase [Carboxydothermus 
hydrogenoformans Z-2901]
 gb|ABB15214.1| conserved hypothetical protein TIGR00250 [Carboxydothermus hydrogenoformans 
Z-2901]
Length=138

 Score = 51.2 bits (121),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 43/85 (51%), Gaps = 2/85 (2%)
 Frame = +2

Query  392  IFGYPFDRQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLHPV  571
            + GYP  R  N     + +L+     E  K   +K  FWDE  S+   E LL   ++   
Sbjct  56   VIGYP--RNMNGTAGPRAELVKRFARELYKFTGIKPVFWDERLSTVEAEKLLISGDISRR  113

Query  572  QSKTIVDKFAAVEILQGYLDYVNRN  646
            + K ++DK AA  IL GYL+Y ++N
Sbjct  114  KRKKVIDKLAATLILSGYLNYKSKN  138


 Score = 31.2 bits (69),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 25/39 (64%), Gaps = 0/39 (0%)
 Frame = +1

Query  202  RLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNIDL  318
            ++LGLDVG+K +G+A+SD     A  L+V+ R     DL
Sbjct  2    KVLGLDVGDKKIGVALSDELGLTAQGLTVIYRTSLKKDL  40



>ref|WP_038036414.1| Holliday junction resolvase [Thermopetrobacter sp. TC1]
Length=155

 Score = 48.1 bits (113),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 41/86 (48%), Gaps = 4/86 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GFI GYP +   +  P A   +    +L +   + D+    WDE  S+  VE  L   ++
Sbjct  69   GFILGYPVNMNGSVGPRAQATRAFARNLEQ---ISDIPVVLWDERLSTAGVERTLLEADV  125

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVN  640
               +   +VDK AA  ILQG LD + 
Sbjct  126  SRKRRADVVDKMAAAWILQGALDRLR  151


 Score = 34.3 bits (77),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = +1

Query  202  RLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            RLLGLD+G K +GLA+SD     A+PL  + R +   D
Sbjct  17   RLLGLDLGTKTIGLALSDGLLLTATPLETIKRTRFRKD  54



>ref|WP_028345629.1| Holliday junction resolvase [Bradyrhizobium elkanii]
Length=160

 Score = 43.1 bits (100),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 43/92 (47%), Gaps = 6/92 (7%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ G P +   +  P A   +    +      L  +    WDE  S+ +VE  L  +++
Sbjct  72   GFVLGLPINMDGSEGPRAQSTRAFARNFS---NLTGLAIALWDERLSTAAVERELIGMDV  128

Query  563  HPVQSKTIVDKFAAVEILQGYLDYVN--RNDK  652
               +   ++D+ AA+ ILQG LD +   R D+
Sbjct  129  SRARRAEVIDEHAAIFILQGALDRLKKLRGDR  160


 Score = 39.3 bits (90),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +1

Query  196  RGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            RG L+GLD+G K +G+AVSD + +LA+ +  + RK    D
Sbjct  18   RGALIGLDLGTKTIGVAVSDPDRRLATGVETIQRKAFKAD  57



>ref|WP_013430445.1| Holliday junction resolvase [Caldicellulosiruptor kronotskyensis]
 ref|YP_004024164.1| holliday junction resolvase yqgf [Caldicellulosiruptor kronotskyensis 
2002]
 gb|ADQ46345.1| Holliday junction resolvase YqgF [Caldicellulosiruptor kronotskyensis 
2002]
Length=138

 Score = 52.0 bits (123),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 50/85 (59%), Gaps = 5/85 (6%)
 Frame = +2

Query  392  IFGYPFDRQRNNPDAVQVKLL-IDDLCE-TGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
            + GYP  +   +PD    KL  ID++ E      +V+   WDE FS+K+VE ++    L+
Sbjct  55   VIGYPLSKL--HPDQKDEKLKKIDEISEKIESRYNVEIVKWDERFSTKAVERVIDE-ELN  111

Query  566  PVQSKTIVDKFAAVEILQGYLDYVN  640
              + K I+DK AAV ILQGYLD+ N
Sbjct  112  WKRKKKIIDKVAAVYILQGYLDFYN  136


 Score = 30.4 bits (67),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 17/46 (37%), Positives = 27/46 (59%), Gaps = 1/46 (2%)
 Frame = +1

Query  202  RLLGLDVGNKYVGLAVSDVENKLASP-LSVLIRKKSNIDLMATDFQ  336
            R+L LD+GN  VG+A+SD     A P +++ +R K   + +   FQ
Sbjct  2    RILCLDIGNSRVGVAISDPLKITAQPVMTIELRNKDLFEELDKIFQ  47



>ref|WP_015598724.1| Holliday junction resolvase YqgF [Hyphomicrobium denitrificans]
 ref|YP_007915204.1| Holliday junction resolvase YqgF [Hyphomicrobium denitrificans 
1NES1]
 gb|AGK58705.1| Holliday junction resolvase YqgF [Hyphomicrobium denitrificans 
1NES1]
Length=170

 Score = 42.7 bits (99),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/65 (37%), Positives = 35/65 (54%), Gaps = 0/65 (0%)
 Frame = +1

Query  118  ISQSHSGFFEMKYMKPLNLFQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIR  297
            +SQS S     +  +    F     S GRL+G+D G K +GLA+SDV   +AS L  + R
Sbjct  5    MSQSASPATPGRTTEDPQEFIAAAASSGRLIGIDGGTKTLGLALSDVTRTIASALETIRR  64

Query  298  KKSNI  312
             K ++
Sbjct  65   TKFSV  69


 Score = 39.3 bits (90),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 39/92 (42%), Gaps = 12/92 (13%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-----NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLK  550
            G + G P    RN      P A   + L  +L    KL  +    WDE  ++   E +L 
Sbjct  85   GLVLGLP----RNLDGTEGPRAQATRALARNL---NKLSPLPILLWDERLTTVEAERMLI  137

Query  551  PLNLHPVQSKTIVDKFAAVEILQGYLDYVNRN  646
              +    +   ++DK AA  ILQG LD + R 
Sbjct  138  DADQSRKRRGEVIDKLAATIILQGALDRLGRQ  169



>ref|WP_024341101.1| Holliday junction resolvase [Bradyrhizobium japonicum]
Length=161

 Score = 42.4 bits (98),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 4/85 (5%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNL  562
            GF+ G P +   +  P A   +    +L     L  +    WDE  S+ +VE  L  +++
Sbjct  72   GFVLGLPINMDGSEGPRAQSTRAFARNLA---GLTALPIGLWDERLSTAAVERELIGMDV  128

Query  563  HPVQSKTIVDKFAAVEILQGYLDYV  637
               +   ++D+ AA+ ILQG LD +
Sbjct  129  SRAKRAEVIDEHAAMFILQGALDRL  153


 Score = 39.7 bits (91),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  193  SRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            +RG L+GLD+G K +G+AVSD + +LA+ +  + RK+   D
Sbjct  17   ARGALVGLDLGTKTIGVAVSDPDRRLATGVETIQRKQFKQD  57



>ref|WP_035376057.1| Holliday junction resolvase, partial [Acetobacter nitrogenifigens]
Length=150

 Score = 41.6 bits (96),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 1/44 (2%)
 Frame = +1

Query  172  LFQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKK  303
            LF +L   + RLLG+D G + VGLA+SDV   +ASP SVL R K
Sbjct  9    LFADLSPGK-RLLGIDPGARLVGLALSDVMRMVASPYSVLKRDK  51


 Score = 40.4 bits (93),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 39/84 (46%), Gaps = 5/84 (6%)
 Frame = +2

Query  386  GFIFGYPFDRQRN-NPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSV-EMLLKPLN  559
            G + G P     N  P A   +    DL +    + V    WDE  SS +V  +L++  +
Sbjct  70   GIVVGLPLSLDGNFGPAAQAARDWAQDLSQR---IGVPAALWDERLSSSAVNRLLIQEAD  126

Query  560  LHPVQSKTIVDKFAAVEILQGYLD  631
            +   + +  VDK AA  +LQG LD
Sbjct  127  MTRKRRQETVDKMAAAYMLQGALD  150



>ref|WP_018909000.1| Holliday junction resolvase [Salinispora arenicola]
Length=153

 Score = 44.3 bits (103),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 41/87 (47%), Gaps = 3/87 (3%)
 Frame = +2

Query  389  FIFGYPFD-RQRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLNLH  565
             + G P +   R+ P AVQV+  +  L E   +  V  T  DE  S+      L    + 
Sbjct  67   VVVGLPVNLAGRHGPAAVQVQEYVGRLVEL--ISPVPVTLADERMSTVVASRRLAERGVR  124

Query  566  PVQSKTIVDKFAAVEILQGYLDYVNRN  646
              + + +VD+ AAVEILQ +LD   R 
Sbjct  125  GRRQRAVVDQAAAVEILQSWLDAQRRR  151


 Score = 37.7 bits (86),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 30/54 (56%), Gaps = 1/54 (2%)
 Frame = +1

Query  193  SRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIR-KKSNIDLMATDFQSLVRL  351
            SRG  LG+DVG   VG+A SD    LA+PL  L R + +  D + +D   L  L
Sbjct  5    SRGVRLGVDVGQVRVGVARSDPHGVLATPLVTLARDRDAAPDAVPSDIAELAAL  58



>ref|WP_037480049.1| Holliday junction resolvase [Sphingobium sp. ba1]
 gb|KFL44953.1| putative Holliday junction resolvase [Sphingobium sp. ba1]
Length=157

 Score = 44.3 bits (103),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 29/47 (62%), Gaps = 0/47 (0%)
 Frame = +1

Query  175  FQELVKSRGRLLGLDVGNKYVGLAVSDVENKLASPLSVLIRKKSNID  315
            F+E +   GRL+G+DVG K +GLA+ D    +ASP   + R K + D
Sbjct  11   FREALPEGGRLVGMDVGTKTIGLALCDARWSIASPAHTITRGKFSKD  57


 Score = 37.4 bits (85),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 39/84 (46%), Gaps = 5/84 (6%)
 Frame = +2

Query  383  KGFIFGYPFDR-QRNNPDAVQVKLLIDDLCETGKLVDVKYTFWDESFSSKSVEMLLKPLN  559
            KG + G P +     +P +   +    +L + G    +    WDE +S+++V   L   +
Sbjct  71   KGIVIGLPLNLDGTGSPRSQSSRAFAHNLADFG----LPVLLWDERWSTQAVTRTLIEAD  126

Query  560  LHPVQSKTIVDKFAAVEILQGYLD  631
                +   +VDK AA  ILQG +D
Sbjct  127  ASRARRDVLVDKLAASYILQGAID  150



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1899776125104