BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c2414_g1_i1 len=927 path=[874:0-818 1693:819-872 1693:873-926]

Length=927
                                                                      Score     E

ref|XP_008453481.1|  PREDICTED: probable ADP-ribosylation factor ...    244   6e-77   
emb|CDO98346.1|  unnamed protein product                                242   4e-76   
ref|XP_008374850.1|  PREDICTED: probable ADP-ribosylation factor ...    242   5e-76   
ref|XP_007036844.1|  Calcium-dependent lipid-binding (CaLB domain...    242   6e-76   
ref|XP_007209663.1|  hypothetical protein PRUPE_ppa012140mg             240   3e-75   
ref|XP_008393427.1|  PREDICTED: probable ADP-ribosylation factor ...    240   5e-75   
gb|KDP23927.1|  hypothetical protein JCGZ_27087                         239   6e-75   
ref|XP_009783267.1|  PREDICTED: probable ADP-ribosylation factor ...    239   7e-75   
ref|XP_009360077.1|  PREDICTED: probable ADP-ribosylation factor ...    239   1e-74   
ref|XP_010033755.1|  PREDICTED: probable ADP-ribosylation factor ...    239   1e-74   
ref|XP_004299529.1|  PREDICTED: probable ADP-ribosylation factor ...    238   1e-74   
ref|XP_009356038.1|  PREDICTED: probable ADP-ribosylation factor ...    238   2e-74   
ref|XP_009614861.1|  PREDICTED: probable ADP-ribosylation factor ...    236   5e-74   
ref|XP_008240150.1|  PREDICTED: probable ADP-ribosylation factor ...    237   6e-74   
ref|XP_002530486.1|  ARF GTPase activator, putative                     236   9e-74   Ricinus communis
ref|XP_010036952.1|  PREDICTED: probable ADP-ribosylation factor ...    236   1e-73   
ref|XP_010097555.1|  putative ADP-ribosylation factor GTPase-acti...    233   2e-72   
ref|XP_010663685.1|  PREDICTED: probable ADP-ribosylation factor ...    233   3e-72   
ref|XP_010274726.1|  PREDICTED: probable ADP-ribosylation factor ...    232   3e-72   
emb|CAN69475.1|  hypothetical protein VITISV_014376                     232   3e-72   Vitis vinifera
ref|XP_006341525.1|  PREDICTED: probable ADP-ribosylation factor ...    231   4e-72   
ref|XP_004235813.1|  PREDICTED: probable ADP-ribosylation factor ...    231   4e-72   
ref|XP_011072997.1|  PREDICTED: probable ADP-ribosylation factor ...    231   4e-72   
ref|XP_004235812.1|  PREDICTED: probable ADP-ribosylation factor ...    231   6e-72   
ref|XP_004137344.1|  PREDICTED: probable ADP-ribosylation factor ...    231   7e-72   
gb|KHG01667.1|  hypothetical protein F383_21926                         231   1e-71   
ref|XP_006490774.1|  PREDICTED: probable ADP-ribosylation factor ...    231   2e-71   
ref|XP_006451620.1|  hypothetical protein CICLE_v10009524mg             231   2e-71   
ref|XP_006346641.1|  PREDICTED: probable ADP-ribosylation factor ...    229   9e-71   
dbj|BAO02515.1|  predicted C2 domain containing protein                 228   1e-70   
gb|EYU24145.1|  hypothetical protein MIMGU_mgv1a018362mg                228   1e-70   
gb|ACD40010.1|  pollen-specific C2 domain containing protein            228   2e-70   Nicotiana alata [flowering tobacco]
ref|XP_009796427.1|  PREDICTED: probable ADP-ribosylation factor ...    227   2e-70   
ref|XP_009761742.1|  PREDICTED: probable ADP-ribosylation factor ...    228   2e-70   
ref|XP_009595957.1|  PREDICTED: probable ADP-ribosylation factor ...    227   2e-70   
gb|ACD40015.1|  pollen-specific C2 domain containing protein            226   9e-70   Nicotiana bonariensis
ref|XP_010314227.1|  PREDICTED: probable ADP-ribosylation factor ...    226   1e-69   
ref|XP_006341526.1|  PREDICTED: probable ADP-ribosylation factor ...    224   2e-69   
ref|XP_009628522.1|  PREDICTED: probable ADP-ribosylation factor ...    225   3e-69   
gb|ACD40018.1|  pollen-specific C2 domain containing protein            225   3e-69   Nicotiana tabacum [American tobacco]
ref|XP_011039132.1|  PREDICTED: probable ADP-ribosylation factor ...    224   3e-69   
ref|XP_006365412.1|  PREDICTED: probable ADP-ribosylation factor ...    224   4e-69   
ref|XP_003631121.1|  Pollen-specific C2 domain containing protein       224   8e-69   
ref|XP_002317873.1|  GTPase activating family protein                   223   8e-69   Populus trichocarpa [western balsam poplar]
gb|ACD40017.1|  pollen-specific C2 domain containing protein            223   2e-68   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_011084199.1|  PREDICTED: probable ADP-ribosylation factor ...    222   3e-68   
ref|XP_004503269.1|  PREDICTED: probable ADP-ribosylation factor ...    220   1e-67   
gb|AFK44826.1|  unknown                                                 220   1e-67   
ref|XP_010678069.1|  PREDICTED: probable ADP-ribosylation factor ...    220   2e-67   
gb|KGN63876.1|  hypothetical protein Csa_1G025080                       219   6e-67   
ref|XP_006587472.1|  PREDICTED: probable ADP-ribosylation factor ...    218   8e-67   
ref|XP_006584907.1|  PREDICTED: probable ADP-ribosylation factor ...    218   8e-67   
ref|XP_003534141.2|  PREDICTED: probable ADP-ribosylation factor ...    219   1e-66   
gb|AFK34568.1|  unknown                                                 217   2e-66   
ref|XP_003528987.1|  PREDICTED: probable ADP-ribosylation factor ...    217   2e-66   
ref|XP_004241660.1|  PREDICTED: probable ADP-ribosylation factor ...    216   3e-66   
ref|XP_010540029.1|  PREDICTED: probable ADP-ribosylation factor ...    216   3e-66   
ref|XP_008464579.1|  PREDICTED: probable ADP-ribosylation factor ...    217   4e-66   
gb|EYU33973.1|  hypothetical protein MIMGU_mgv1a014822mg                216   6e-66   
ref|XP_004137503.1|  PREDICTED: probable ADP-ribosylation factor ...    216   1e-65   
ref|XP_008464514.1|  PREDICTED: probable ADP-ribosylation factor ...    218   2e-65   
ref|XP_009370093.1|  PREDICTED: probable ADP-ribosylation factor ...    214   2e-65   
ref|XP_010533970.1|  PREDICTED: probable ADP-ribosylation factor ...    215   2e-65   
ref|XP_003619827.1|  Multiple C2 and transmembrane domain-contain...    214   2e-65   
gb|KHG03449.1|  hypothetical protein F383_28229                         214   3e-65   
ref|XP_008381348.1|  PREDICTED: probable ADP-ribosylation factor ...    214   4e-65   
ref|XP_003525186.2|  PREDICTED: probable ADP-ribosylation factor ...    213   5e-65   
emb|CDY51927.1|  BnaAnng11040D                                          213   1e-64   
emb|CDX75953.1|  BnaC03g40360D                                          212   2e-64   
ref|XP_002891444.1|  C2 domain-containing protein                       211   3e-64   
ref|XP_004288398.1|  PREDICTED: probable ADP-ribosylation factor ...    211   6e-64   
ref|XP_006304555.1|  hypothetical protein CARUB_v10011546mg             211   7e-64   
ref|XP_004233475.1|  PREDICTED: probable ADP-ribosylation factor ...    210   9e-64   
ref|XP_006346891.1|  PREDICTED: probable ADP-ribosylation factor ...    210   1e-63   
ref|XP_010916494.1|  PREDICTED: probable ADP-ribosylation factor ...    209   2e-63   
ref|XP_010263871.1|  PREDICTED: probable ADP-ribosylation factor ...    210   2e-63   
ref|XP_010032690.1|  PREDICTED: probable ADP-ribosylation factor ...    209   3e-63   
ref|XP_009145950.1|  PREDICTED: probable ADP-ribosylation factor ...    209   3e-63   
ref|XP_006406667.1|  hypothetical protein EUTSA_v10022004mg             209   4e-63   
ref|XP_006346892.1|  PREDICTED: probable ADP-ribosylation factor ...    208   5e-63   
ref|XP_011099467.1|  PREDICTED: probable ADP-ribosylation factor ...    207   8e-63   
ref|NP_175292.2|  calcium-dependent lipid-binding family protein        207   9e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009135561.1|  PREDICTED: probable ADP-ribosylation factor ...    208   9e-63   
ref|XP_006383322.1|  hypothetical protein POPTR_0005s14500g             207   1e-62   
ref|XP_004288393.1|  PREDICTED: probable ADP-ribosylation factor ...    207   1e-62   
ref|NP_001185174.1|  calcium-dependent lipid-binding family protein     208   1e-62   
ref|XP_004288396.1|  PREDICTED: probable ADP-ribosylation factor ...    207   2e-62   
ref|NP_188425.2|  calcium-dependent lipid-binding domain-containi...    207   2e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007215077.1|  hypothetical protein PRUPE_ppa012537mg             207   2e-62   
ref|XP_007217177.1|  hypothetical protein PRUPE_ppa012484mg             207   2e-62   
ref|XP_010461749.1|  PREDICTED: probable ADP-ribosylation factor ...    207   2e-62   
ref|XP_010670143.1|  PREDICTED: probable ADP-ribosylation factor ...    207   2e-62   
ref|XP_011073630.1|  PREDICTED: probable ADP-ribosylation factor ...    206   2e-62   
ref|XP_010032686.1|  PREDICTED: probable ADP-ribosylation factor ...    206   3e-62   
ref|XP_009381108.1|  PREDICTED: probable ADP-ribosylation factor ...    206   5e-62   
ref|XP_011021393.1|  PREDICTED: probable ADP-ribosylation factor ...    206   5e-62   
ref|XP_006299051.1|  hypothetical protein CARUB_v10015190mg             206   6e-62   
ref|XP_004512742.1|  PREDICTED: probable ADP-ribosylation factor ...    206   6e-62   
ref|XP_004145835.1|  PREDICTED: probable ADP-ribosylation factor ...    206   6e-62   
ref|XP_008229191.1|  PREDICTED: probable ADP-ribosylation factor ...    206   6e-62   
gb|AFK33467.1|  unknown                                                 205   7e-62   
ref|XP_004233474.1|  PREDICTED: probable ADP-ribosylation factor ...    205   9e-62   
ref|XP_010066605.1|  PREDICTED: probable ADP-ribosylation factor ...    205   1e-61   
gb|KDP33163.1|  hypothetical protein JCGZ_13428                         204   1e-61   
ref|XP_010032689.1|  PREDICTED: probable ADP-ribosylation factor ...    204   1e-61   
ref|XP_008353839.1|  PREDICTED: probable ADP-ribosylation factor ...    204   1e-61   
ref|XP_010461682.1|  PREDICTED: probable ADP-ribosylation factor ...    204   2e-61   
ref|XP_009793873.1|  PREDICTED: probable ADP-ribosylation factor ...    204   2e-61   
ref|XP_004503138.1|  PREDICTED: probable ADP-ribosylation factor ...    204   2e-61   
ref|XP_009107346.1|  PREDICTED: probable ADP-ribosylation factor ...    204   2e-61   
emb|CDX82060.1|  BnaC02g22300D                                          204   2e-61   
ref|XP_004160109.1|  PREDICTED: probable ADP-ribosylation factor ...    204   2e-61   
ref|XP_007160540.1|  hypothetical protein PHAVU_002G330200g             204   2e-61   
gb|KHG02007.1|  hypothetical protein F383_24715                         204   2e-61   
ref|XP_010506220.1|  PREDICTED: probable ADP-ribosylation factor ...    204   3e-61   
ref|XP_006390540.1|  hypothetical protein EUTSA_v10019153mg             205   3e-61   
ref|XP_008457050.1|  PREDICTED: probable ADP-ribosylation factor ...    204   3e-61   
gb|ACJ83963.1|  unknown                                                 204   3e-61   Medicago truncatula
ref|XP_002534010.1|  ARF GTPase activator, putative                     204   3e-61   Ricinus communis
ref|XP_010428284.1|  PREDICTED: probable ADP-ribosylation factor ...    204   3e-61   
emb|CDY47746.1|  BnaA02g16490D                                          204   3e-61   
ref|XP_006430620.1|  hypothetical protein CICLE_v10012950mg             203   4e-61   
ref|XP_010928845.1|  PREDICTED: probable ADP-ribosylation factor ...    203   5e-61   
ref|XP_010471418.1|  PREDICTED: probable ADP-ribosylation factor ...    203   5e-61   
ref|XP_010471417.1|  PREDICTED: probable ADP-ribosylation factor ...    203   5e-61   
ref|XP_009127999.1|  PREDICTED: probable ADP-ribosylation factor ...    202   8e-61   
emb|CDX77307.1|  BnaC08g03520D                                          203   8e-61   
ref|XP_007152688.1|  hypothetical protein PHAVU_004G150800g             202   1e-60   
ref|XP_010465871.1|  PREDICTED: probable ADP-ribosylation factor ...    202   1e-60   
ref|XP_008789738.1|  PREDICTED: probable ADP-ribosylation factor ...    202   1e-60   
ref|XP_008368712.1|  PREDICTED: LOW QUALITY PROTEIN: probable ADP...    202   1e-60   
ref|XP_009381107.1|  PREDICTED: probable ADP-ribosylation factor ...    202   1e-60   
ref|XP_008343060.1|  PREDICTED: probable ADP-ribosylation factor ...    202   2e-60   
ref|XP_010416168.1|  PREDICTED: probable ADP-ribosylation factor ...    202   2e-60   
ref|XP_009370100.1|  PREDICTED: probable ADP-ribosylation factor ...    202   2e-60   
ref|XP_009334450.1|  PREDICTED: probable ADP-ribosylation factor ...    202   2e-60   
ref|XP_006482135.1|  PREDICTED: probable ADP-ribosylation factor ...    201   2e-60   
ref|XP_011038617.1|  PREDICTED: probable ADP-ribosylation factor ...    202   3e-60   
ref|XP_009606380.1|  PREDICTED: probable ADP-ribosylation factor ...    201   3e-60   
ref|XP_010500393.1|  PREDICTED: probable ADP-ribosylation factor ...    201   4e-60   
ref|XP_002275235.1|  PREDICTED: probable ADP-ribosylation factor ...    201   5e-60   Vitis vinifera
ref|XP_002887489.1|  C2 domain-containing protein                       201   5e-60   
ref|XP_010551808.1|  PREDICTED: probable ADP-ribosylation factor ...    201   5e-60   
gb|KDO50844.1|  hypothetical protein CISIN_1g031128mg                   200   7e-60   
ref|XP_002314800.1|  C2 domain-containing family protein                200   7e-60   Populus trichocarpa [western balsam poplar]
ref|XP_008381350.1|  PREDICTED: probable ADP-ribosylation factor ...    200   7e-60   
ref|XP_008358166.1|  PREDICTED: LOW QUALITY PROTEIN: probable ADP...    200   7e-60   
ref|XP_004289564.1|  PREDICTED: probable ADP-ribosylation factor ...    200   8e-60   
ref|XP_009370097.1|  PREDICTED: probable ADP-ribosylation factor ...    200   9e-60   
ref|XP_010527744.1|  PREDICTED: probable ADP-ribosylation factor ...    200   1e-59   
ref|XP_007216470.1|  hypothetical protein PRUPE_ppa025942mg             200   1e-59   
ref|NP_177499.1|  C2 domain-containing protein                          199   1e-59   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001132168.1|  uncharacterized protein LOC100193590               199   1e-59   Zea mays [maize]
ref|XP_009135560.1|  PREDICTED: probable ADP-ribosylation factor ...    200   2e-59   
ref|XP_010109009.1|  putative ADP-ribosylation factor GTPase-acti...    199   2e-59   
ref|XP_007033034.1|  Calcium-dependent lipid-binding (CaLB domain...    199   2e-59   
ref|XP_006301267.1|  hypothetical protein CARUB_v10021667mg             198   4e-59   
ref|XP_011023699.1|  PREDICTED: probable ADP-ribosylation factor ...    198   4e-59   
ref|XP_011023692.1|  PREDICTED: probable ADP-ribosylation factor ...    198   4e-59   
ref|XP_003552975.1|  PREDICTED: probable ADP-ribosylation factor ...    198   4e-59   
ref|XP_009403742.1|  PREDICTED: probable ADP-ribosylation factor ...    198   5e-59   
ref|XP_007163391.1|  hypothetical protein PHAVU_001G230800g             199   6e-59   
ref|XP_002305199.1|  hypothetical protein POPTR_0004s08840g             197   7e-59   Populus trichocarpa [western balsam poplar]
gb|AGV54351.1|  ADP-ribosylation factor GTPase-activating protein...    197   8e-59   
ref|XP_004292368.1|  PREDICTED: probable ADP-ribosylation factor ...    197   9e-59   
emb|CDX95800.1|  BnaC05g35510D                                          211   9e-59   
ref|XP_009413360.1|  PREDICTED: probable ADP-ribosylation factor ...    197   9e-59   
ref|XP_008804356.1|  PREDICTED: probable ADP-ribosylation factor ...    197   1e-58   
ref|XP_010032687.1|  PREDICTED: probable ADP-ribosylation factor ...    197   1e-58   
ref|XP_006379768.1|  hypothetical protein POPTR_0008s13070g             197   1e-58   
ref|XP_002312449.1|  C2 domain-containing family protein                197   1e-58   Populus trichocarpa [western balsam poplar]
ref|XP_011023686.1|  PREDICTED: probable ADP-ribosylation factor ...    197   1e-58   
ref|XP_009370095.1|  PREDICTED: probable ADP-ribosylation factor ...    196   2e-58   
ref|XP_010500394.1|  PREDICTED: probable ADP-ribosylation factor ...    196   2e-58   
ref|XP_009370096.1|  PREDICTED: probable ADP-ribosylation factor ...    196   4e-58   
emb|CDP02696.1|  unnamed protein product                                196   4e-58   
ref|XP_008381349.1|  PREDICTED: probable ADP-ribosylation factor ...    196   5e-58   
ref|XP_002527798.1|  ARF GTPase activator, putative                     196   5e-58   Ricinus communis
gb|KEH36497.1|  calcium-dependent lipid-binding (CaLB domain) fam...    195   7e-58   
ref|XP_008809823.1|  PREDICTED: probable ADP-ribosylation factor ...    195   9e-58   
ref|XP_002455977.1|  hypothetical protein SORBIDRAFT_03g028370          194   1e-57   Sorghum bicolor [broomcorn]
gb|EYU44565.1|  hypothetical protein MIMGU_mgv1a015143mg                194   1e-57   
ref|XP_006647209.1|  PREDICTED: probable ADP-ribosylation factor ...    194   1e-57   
gb|KDO50845.1|  hypothetical protein CISIN_1g031128mg                   194   2e-57   
ref|XP_011002782.1|  PREDICTED: probable ADP-ribosylation factor ...    194   2e-57   
ref|XP_009370098.1|  PREDICTED: probable ADP-ribosylation factor ...    194   2e-57   
ref|NP_001235515.1|  uncharacterized protein LOC100306214               194   2e-57   
ref|XP_009418909.1|  PREDICTED: probable ADP-ribosylation factor ...    193   4e-57   
ref|XP_009144399.1|  PREDICTED: probable ADP-ribosylation factor ...    193   4e-57   
ref|NP_001046709.1|  Os02g0327000                                       193   4e-57   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009388652.1|  PREDICTED: probable ADP-ribosylation factor ...    193   6e-57   
ref|XP_009370094.1|  PREDICTED: probable ADP-ribosylation factor ...    192   1e-56   
ref|XP_002868538.1|  C2 domain-containing protein                       192   2e-56   
ref|XP_006469315.1|  PREDICTED: probable ADP-ribosylation factor ...    192   2e-56   
ref|XP_004231984.1|  PREDICTED: probable ADP-ribosylation factor ...    191   2e-56   
gb|KFK41793.1|  hypothetical protein AALP_AA2G172800                    205   2e-56   
ref|XP_004952325.1|  PREDICTED: probable ADP-ribosylation factor ...    191   2e-56   
emb|CDY27005.1|  BnaC06g12210D                                          191   2e-56   
emb|CDY07499.1|  BnaA07g25780D                                          191   3e-56   
ref|XP_006405837.1|  hypothetical protein EUTSA_v10027968mg             191   3e-56   
ref|XP_009612263.1|  PREDICTED: probable ADP-ribosylation factor ...    190   5e-56   
ref|XP_006843793.1|  hypothetical protein AMTR_s00007p00249830          190   6e-56   
ref|XP_006357769.1|  PREDICTED: probable ADP-ribosylation factor ...    190   6e-56   
ref|XP_003528543.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    190   7e-56   
gb|KDO64606.1|  hypothetical protein CISIN_1g048685mg                   190   7e-56   
ref|XP_009392867.1|  PREDICTED: probable ADP-ribosylation factor ...    190   9e-56   
ref|XP_010062251.1|  PREDICTED: probable ADP-ribosylation factor ...    189   1e-55   
ref|XP_009105201.1|  PREDICTED: probable ADP-ribosylation factor ...    190   1e-55   
ref|XP_010109008.1|  putative ADP-ribosylation factor GTPase-acti...    189   1e-55   
ref|XP_006448228.1|  hypothetical protein CICLE_v10017596mg             189   1e-55   
ref|XP_003561505.1|  PREDICTED: probable ADP-ribosylation factor ...    189   1e-55   
gb|KFK41059.1|  hypothetical protein AALP_AA2G080100                    189   1e-55   
emb|CDX96152.1|  BnaA07g25790D                                          189   2e-55   
ref|XP_007045191.1|  Calcium-dependent lipid-binding family protein     192   3e-55   
ref|XP_010511455.1|  PREDICTED: probable ADP-ribosylation factor ...    188   3e-55   
ref|XP_009139749.1|  PREDICTED: probable ADP-ribosylation factor ...    188   4e-55   
ref|XP_010470512.1|  PREDICTED: probable ADP-ribosylation factor ...    187   5e-55   
ref|XP_009370099.1|  PREDICTED: probable ADP-ribosylation factor ...    187   5e-55   
ref|XP_006300898.1|  hypothetical protein CARUB_v10021265mg             187   6e-55   
gb|KHN08064.1|  ADP-ribosylation factor GTPase-activating protein...    187   6e-55   
ref|XP_010109014.1|  Bifunctional glutamate/proline--tRNA ligase        197   7e-55   
gb|ADZ44599.1|  C2 domain-containing protein                            187   8e-55   
ref|NP_564873.1|  calcium-dependent lipid-binding domain-containi...    187   9e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009403741.1|  PREDICTED: probable ADP-ribosylation factor ...    187   1e-54   
gb|ADZ44598.1|  C2 domain-containing protein                            187   1e-54   
emb|CDX92180.1|  BnaA05g22270D                                          200   1e-54   
gb|EMT18411.1|  hypothetical protein F775_32222                         187   1e-54   
gb|KFK33274.1|  hypothetical protein AALP_AA6G353800                    187   1e-54   
emb|CDY01709.1|  BnaC04g30430D                                          186   2e-54   
gb|ACT32453.1|  C2 domain-containing protein                            186   2e-54   
gb|AGJ81360.1|  small C2 domain protein                                 186   2e-54   
ref|XP_009787765.1|  PREDICTED: probable ADP-ribosylation factor ...    186   2e-54   
ref|XP_006282746.1|  hypothetical protein CARUB_v10005899mg             186   3e-54   
ref|XP_010419006.1|  PREDICTED: probable ADP-ribosylation factor ...    189   4e-54   
ref|XP_010670150.1|  PREDICTED: probable ADP-ribosylation factor ...    185   5e-54   
ref|XP_008358047.1|  PREDICTED: probable ADP-ribosylation factor ...    185   5e-54   
ref|NP_198590.1|  calcium-dependent lipid-binding domain-containi...    185   5e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010670144.1|  PREDICTED: probable ADP-ribosylation factor ...    185   6e-54   
ref|XP_002887025.1|  predicted protein                                  185   6e-54   
ref|NP_001288469.1|  probable ADP-ribosylation factor GTPase-acti...    185   7e-54   
ref|XP_006843797.1|  hypothetical protein AMTR_s00007p00250850          184   8e-54   
ref|XP_010450531.1|  PREDICTED: probable ADP-ribosylation factor ...    184   1e-53   
ref|XP_003572790.1|  PREDICTED: probable ADP-ribosylation factor ...    184   1e-53   
ref|XP_002284632.1|  PREDICTED: probable ADP-ribosylation factor ...    184   1e-53   Vitis vinifera
gb|EMT29454.1|  hypothetical protein F775_30986                         184   1e-53   
ref|XP_006657398.1|  PREDICTED: probable ADP-ribosylation factor ...    184   1e-53   
gb|AGJ81361.1|  small C2 domain protein                                 184   2e-53   
ref|XP_010435613.1|  PREDICTED: probable ADP-ribosylation factor ...    184   2e-53   
gb|EMS65900.1|  putative ADP-ribosylation factor GTPase-activatin...    182   5e-53   
ref|XP_009139747.1|  PREDICTED: probable ADP-ribosylation factor ...    182   6e-53   
ref|XP_008221419.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    182   7e-53   
ref|XP_006416121.1|  hypothetical protein EUTSA_v10008947mg             182   7e-53   
ref|XP_010498819.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    182   9e-53   
gb|EYU30081.1|  hypothetical protein MIMGU_mgv1a015056mg                181   1e-52   
gb|EYU30082.1|  hypothetical protein MIMGU_mgv11b012631mg               181   2e-52   
ref|XP_007227534.1|  hypothetical protein PRUPE_ppa012480mg             181   2e-52   
ref|XP_010460095.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    181   2e-52   
ref|XP_011070611.1|  PREDICTED: probable ADP-ribosylation factor ...    181   2e-52   
ref|XP_009140159.1|  PREDICTED: probable ADP-ribosylation factor ...    181   2e-52   
ref|XP_004498288.1|  PREDICTED: probable ADP-ribosylation factor ...    181   2e-52   
emb|CDX99693.1|  BnaC04g34500D                                          181   3e-52   
gb|KFK41508.1|  hypothetical protein AALP_AA2G138800                    181   3e-52   
ref|XP_010095718.1|  ADP-ribosylation factor GTPase-activating pr...    181   3e-52   
ref|XP_008229192.1|  PREDICTED: probable ADP-ribosylation factor ...    180   4e-52   
gb|KFK38033.1|  hypothetical protein AALP_AA3G061600                    189   4e-52   
ref|XP_010477602.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    180   4e-52   
ref|XP_009602442.1|  PREDICTED: probable ADP-ribosylation factor ...    179   7e-52   
ref|XP_002887329.1|  C2 domain-containing protein                       180   7e-52   
ref|NP_001242572.1|  uncharacterized protein LOC100788395               179   1e-51   
ref|XP_006391390.1|  hypothetical protein EUTSA_v10019623mg             183   1e-51   
ref|XP_010670148.1|  PREDICTED: probable ADP-ribosylation factor ...    179   1e-51   
ref|XP_010926483.1|  PREDICTED: probable ADP-ribosylation factor ...    179   1e-51   
ref|XP_010471084.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    179   2e-51   
ref|XP_006304266.1|  hypothetical protein CARUB_v10010496mg             178   2e-51   
ref|XP_002461315.1|  hypothetical protein SORBIDRAFT_02g000790          178   2e-51   Sorghum bicolor [broomcorn]
gb|EYU41340.1|  hypothetical protein MIMGU_mgv1a015009mg                178   3e-51   
ref|XP_006350734.1|  PREDICTED: probable ADP-ribosylation factor ...    177   4e-51   
ref|NP_001132406.1|  uncharacterized protein LOC100193853               177   4e-51   Zea mays [maize]
ref|XP_004150594.1|  PREDICTED: probable ADP-ribosylation factor ...    177   5e-51   
gb|AFD22862.1|  GTPase activator ARF                                    179   5e-51   
ref|NP_565002.1|  Calcium-dependent lipid-binding (CaLB domain) f...    177   6e-51   
ref|XP_009388888.1|  PREDICTED: probable ADP-ribosylation factor ...    177   6e-51   
ref|XP_006301188.1|  hypothetical protein CARUB_v10021587mg             177   8e-51   
ref|XP_010427874.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    177   8e-51   
emb|CDY71117.1|  BnaCnng71390D                                          176   9e-51   
ref|XP_002893267.1|  C2 domain-containing protein                       176   1e-50   
ref|NP_001190431.1|  calcium-dependent lipid-binding domain-conta...    177   1e-50   
ref|XP_010415770.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    176   1e-50   
ref|XP_009420619.1|  PREDICTED: probable ADP-ribosylation factor ...    176   2e-50   
ref|XP_009115560.1|  PREDICTED: probable ADP-ribosylation factor ...    176   2e-50   
tpg|DAA59366.1|  TPA: putative MATE efflux family protein isoform 1     177   2e-50   
ref|XP_002887330.1|  C2 domain-containing protein                       176   2e-50   
ref|XP_003553851.1|  PREDICTED: probable ADP-ribosylation factor ...    176   2e-50   
gb|AAK25852.1|AF360142_1  unknown protein                               176   3e-50   
ref|XP_004240994.1|  PREDICTED: probable ADP-ribosylation factor ...    176   3e-50   
ref|XP_010415769.1|  PREDICTED: probable ADP-ribosylation factor ...    175   4e-50   
gb|AAY86774.1|  C2 domain-containing protein                            175   4e-50   
ref|XP_006586679.1|  PREDICTED: uncharacterized protein LOC100788...    175   6e-50   
gb|KHN05765.1|  Putative ADP-ribosylation factor GTPase-activatin...    175   7e-50   
gb|ACU14102.1|  unknown                                                 175   7e-50   
ref|XP_008467129.1|  PREDICTED: probable ADP-ribosylation factor ...    174   8e-50   
ref|NP_177237.1|  protein ENHANCED BENDING 1                            174   9e-50   
gb|EYU24180.1|  hypothetical protein MIMGU_mgv1a018771mg                174   1e-49   
emb|CDY27654.1|  BnaUnng00040D                                          174   1e-49   
gb|AFK36306.1|  unknown                                                 174   1e-49   
ref|XP_010415768.1|  PREDICTED: probable ADP-ribosylation factor ...    174   2e-49   
ref|XP_006390837.1|  hypothetical protein EUTSA_v10019241mg             173   2e-49   
ref|XP_004955323.1|  PREDICTED: probable ADP-ribosylation factor ...    173   2e-49   
ref|XP_009402847.1|  PREDICTED: probable ADP-ribosylation factor ...    173   2e-49   
ref|XP_010527786.1|  PREDICTED: probable ADP-ribosylation factor ...    173   2e-49   
emb|CDY11544.1|  BnaC06g31950D                                          173   3e-49   
ref|XP_003589656.1|  ADP-ribosylation factor GTPase-activating pr...    173   3e-49   
ref|XP_009105748.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    172   3e-49   
gb|EYU23809.1|  hypothetical protein MIMGU_mgv1a015207mg                172   3e-49   
ref|XP_006390839.1|  hypothetical protein EUTSA_v10019195mg             173   4e-49   
ref|XP_004505288.1|  PREDICTED: probable ADP-ribosylation factor ...    172   4e-49   
ref|XP_010552702.1|  PREDICTED: probable ADP-ribosylation factor ...    173   5e-49   
ref|XP_010066604.1|  PREDICTED: probable ADP-ribosylation factor ...    172   6e-49   
ref|XP_006843794.1|  hypothetical protein AMTR_s00007p00250120          172   7e-49   
ref|NP_001288871.1|  probable ADP-ribosylation factor GTPase-acti...    172   1e-48   
ref|XP_010263947.1|  PREDICTED: probable ADP-ribosylation factor ...    171   1e-48   
ref|NP_173727.1|  calcium-dependent lipid-binding domain-containi...    171   1e-48   
ref|XP_007153401.1|  hypothetical protein PHAVU_003G031900g             171   1e-48   
ref|XP_010427870.1|  PREDICTED: probable ADP-ribosylation factor ...    172   1e-48   
gb|KDP38077.1|  hypothetical protein JCGZ_04720                         171   1e-48   
gb|KFK41507.1|  hypothetical protein AALP_AA2G138700                    172   1e-48   
ref|XP_010926484.1|  PREDICTED: probable ADP-ribosylation factor ...    171   1e-48   
emb|CAN67438.1|  hypothetical protein VITISV_020351                     171   1e-48   
ref|XP_004298475.1|  PREDICTED: probable ADP-ribosylation factor ...    171   2e-48   
ref|XP_010471082.1|  PREDICTED: probable ADP-ribosylation factor ...    171   2e-48   
emb|CDX74562.1|  BnaA04g08270D                                          171   2e-48   
gb|KFK44406.1|  hypothetical protein AALP_AA1G253000                    171   2e-48   
ref|XP_006395883.1|  hypothetical protein EUTSA_v10004998mg             171   2e-48   
ref|XP_010264070.1|  PREDICTED: probable ADP-ribosylation factor ...    170   2e-48   
gb|KFK38029.1|  hypothetical protein AALP_AA3G061000                    181   3e-48   
ref|XP_007157760.1|  hypothetical protein PHAVU_002G096400g             171   3e-48   
ref|XP_004505290.1|  PREDICTED: probable ADP-ribosylation factor ...    170   4e-48   
ref|XP_004298477.1|  PREDICTED: probable ADP-ribosylation factor ...    170   4e-48   
ref|XP_006302873.1|  hypothetical protein CARUB_v10021004mg             171   4e-48   
ref|XP_002876756.1|  C2 domain-containing protein                       170   4e-48   
ref|XP_009626201.1|  PREDICTED: probable ADP-ribosylation factor ...    170   4e-48   
ref|XP_010533347.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    170   4e-48   
ref|NP_001288983.1|  probable ADP-ribosylation factor GTPase-acti...    170   4e-48   
ref|XP_010427869.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    172   4e-48   
ref|XP_002887328.1|  C2 domain-containing protein                       170   4e-48   
gb|KFK33376.1|  hypothetical protein AALP_AA5G005300                    170   6e-48   
ref|XP_004955318.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    169   7e-48   
gb|AFK46959.1|  unknown                                                 169   1e-47   
ref|NP_565001.1|  calcium-dependent lipid-binding domain-containi...    169   1e-47   
ref|XP_010427873.1|  PREDICTED: probable ADP-ribosylation factor ...    169   1e-47   
ref|XP_010424926.1|  PREDICTED: probable ADP-ribosylation factor ...    169   1e-47   
ref|XP_003563062.1|  PREDICTED: probable ADP-ribosylation factor ...    168   1e-47   
ref|XP_010502133.1|  PREDICTED: probable ADP-ribosylation factor ...    169   1e-47   
ref|XP_009114231.1|  PREDICTED: probable ADP-ribosylation factor ...    169   1e-47   
ref|XP_010513880.1|  PREDICTED: probable ADP-ribosylation factor ...    169   1e-47   
ref|XP_009129225.1|  PREDICTED: probable ADP-ribosylation factor ...    169   2e-47   
ref|XP_010263993.1|  PREDICTED: probable ADP-ribosylation factor ...    168   2e-47   
ref|XP_006657399.1|  PREDICTED: probable ADP-ribosylation factor ...    168   2e-47   
gb|EMS61908.1|  ADP-ribosylation factor GTPase-activating protein...    169   2e-47   
ref|NP_001058718.1|  Os07g0108500                                       167   3e-47   
ref|XP_010471080.1|  PREDICTED: probable ADP-ribosylation factor ...    168   3e-47   
ref|XP_006604072.1|  PREDICTED: probable ADP-ribosylation factor ...    167   4e-47   
ref|NP_178263.1|  calcium-dependent lipid-binding domain-containi...    167   5e-47   
ref|XP_006291920.1|  hypothetical protein CARUB_v10018104mg             167   6e-47   
ref|XP_010264139.1|  PREDICTED: probable ADP-ribosylation factor ...    166   7e-47   
emb|CDY70365.1|  BnaC09g52190D                                          167   7e-47   
gb|KCW64560.1|  hypothetical protein EUGRSUZ_G02165                     170   7e-47   
ref|XP_009101338.1|  PREDICTED: probable ADP-ribosylation factor ...    167   8e-47   
ref|XP_008229238.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    166   9e-47   
ref|NP_001059720.1|  Os07g0501700                                       166   1e-46   
emb|CDY17665.1|  BnaA06g34840D                                          166   1e-46   
gb|EMT16533.1|  hypothetical protein F775_30156                         166   2e-46   
gb|EAZ03980.1|  hypothetical protein OsI_26119                          166   2e-46   
ref|XP_003607906.1|  ADP-ribosylation factor GTPase-activating pr...    165   3e-46   
ref|XP_008464698.1|  PREDICTED: probable ADP-ribosylation factor ...    165   4e-46   
emb|CCW28844.1|  putative C2 domain contatining protein                 165   5e-46   
ref|NP_001058717.2|  Os07g0108400                                       164   6e-46   
gb|EPS67821.1|  hypothetical protein M569_06955                         164   8e-46   
ref|XP_004142273.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    164   1e-45   
gb|ABK24539.1|  unknown                                                 164   1e-45   
ref|XP_009803722.1|  PREDICTED: probable ADP-ribosylation factor ...    163   1e-45   
ref|XP_007157761.1|  hypothetical protein PHAVU_002G096400g             161   6e-45   
emb|CCW28850.1|  putative fatty acid elongase                           168   9e-45   
ref|XP_002459233.1|  hypothetical protein SORBIDRAFT_02g001095          160   1e-44   
ref|XP_010419142.1|  PREDICTED: probable ADP-ribosylation factor ...    162   1e-44   
ref|XP_010109013.1|  putative ADP-ribosylation factor GTPase-acti...    160   1e-44   
ref|XP_006367963.1|  PREDICTED: probable ADP-ribosylation factor ...    160   2e-44   
ref|XP_006367634.1|  PREDICTED: probable ADP-ribosylation factor ...    160   2e-44   
ref|XP_009104934.1|  PREDICTED: probable ADP-ribosylation factor ...    160   3e-44   
ref|XP_004237015.1|  PREDICTED: probable ADP-ribosylation factor ...    160   3e-44   
ref|XP_006587473.1|  PREDICTED: probable ADP-ribosylation factor ...    160   3e-44   
ref|XP_010552703.1|  PREDICTED: probable ADP-ribosylation factor ...    160   4e-44   
gb|EYU24182.1|  hypothetical protein MIMGU_mgv1a019298mg                159   5e-44   
ref|NP_001148249.1|  GTPase activating protein                          159   6e-44   
gb|EEC81393.1|  hypothetical protein OsI_24613                          167   7e-44   
ref|XP_009104933.1|  PREDICTED: probable ADP-ribosylation factor ...    160   7e-44   
ref|XP_002460737.1|  hypothetical protein SORBIDRAFT_02g034060          158   1e-43   
ref|XP_010692569.1|  PREDICTED: probable ADP-ribosylation factor ...    158   2e-43   
ref|XP_006657732.1|  PREDICTED: probable ADP-ribosylation factor ...    158   2e-43   
ref|XP_004957784.1|  PREDICTED: probable ADP-ribosylation factor ...    157   2e-43   
gb|EYU24171.1|  hypothetical protein MIMGU_mgv1a026122mg                157   3e-43   
emb|CDY70119.1|  BnaA07g38530D                                          159   4e-43   
gb|EYU24166.1|  hypothetical protein MIMGU_mgv1a000858mg                168   8e-43   
ref|XP_010276305.1|  PREDICTED: probable ADP-ribosylation factor ...    155   9e-43   
gb|EPS69666.1|  hypothetical protein M569_05100                         155   2e-42   
emb|CBI26876.3|  unnamed protein product                                154   3e-42   
ref|XP_008651946.1|  PREDICTED: probable ADP-ribosylation factor ...    153   1e-41   
ref|XP_008653112.1|  PREDICTED: probable ADP-ribosylation factor ...    154   1e-41   
ref|XP_003557682.1|  PREDICTED: probable ADP-ribosylation factor ...    153   2e-41   
tpg|DAA62814.1|  TPA: putative calcium-dependent lipid-binding (C...    152   2e-41   
ref|XP_011075455.1|  PREDICTED: probable ADP-ribosylation factor ...    153   2e-41   
tpg|DAA59402.1|  TPA: hypothetical protein ZEAMMB73_829423              154   3e-41   
gb|EMS58039.1|  ADP-ribosylation factor GTPase-activating protein...    154   9e-41   
gb|ABR17953.1|  unknown                                                 150   1e-40   
gb|EMT32657.1|  hypothetical protein F775_07404                         150   1e-40   
ref|NP_001185175.1|  calcium-dependent lipid-binding family protein     150   2e-40   
emb|CDP00802.1|  unnamed protein product                                149   3e-40   
gb|EYU24153.1|  hypothetical protein MIMGU_mgv1a020450mg                148   7e-40   
ref|XP_006602006.1|  PREDICTED: probable ADP-ribosylation factor ...    147   7e-40   
ref|XP_006346893.1|  PREDICTED: probable ADP-ribosylation factor ...    145   4e-39   
gb|EYU24179.1|  hypothetical protein MIMGU_mgv1a023415mg                146   4e-39   
gb|EYU24160.1|  hypothetical protein MIMGU_mgv1a024244mg                144   1e-38   
ref|XP_008439551.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    145   1e-38   
ref|XP_010500395.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    144   1e-38   
ref|XP_002462882.1|  hypothetical protein SORBIDRAFT_02g033760          144   2e-38   
ref|XP_003563063.1|  PREDICTED: probable ADP-ribosylation factor ...    144   4e-38   
ref|XP_010245699.1|  PREDICTED: probable ADP-ribosylation factor ...    148   5e-38   
gb|EYU24164.1|  hypothetical protein MIMGU_mgv1a023048mg                143   5e-38   
gb|EYU19118.1|  hypothetical protein MIMGU_mgv1a009770mg                148   6e-38   
gb|AFW76343.1|  putative calcium-dependent lipid-binding (CaLB do...    143   7e-38   
ref|XP_010032310.1|  PREDICTED: probable ADP-ribosylation factor ...    148   8e-38   
ref|XP_008813423.1|  PREDICTED: probable ADP-ribosylation factor ...    149   9e-38   
ref|XP_008813422.1|  PREDICTED: probable ADP-ribosylation factor ...    149   9e-38   
ref|XP_004965911.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    147   9e-38   
ref|XP_006857788.1|  hypothetical protein AMTR_s00061p00212500          143   1e-37   
ref|XP_010032309.1|  PREDICTED: probable ADP-ribosylation factor ...    148   1e-37   
gb|ACN85270.1|  ZAC                                                     146   3e-37   
ref|XP_010105094.1|  putative ADP-ribosylation factor GTPase-acti...    141   3e-37   
ref|XP_009411745.1|  PREDICTED: probable ADP-ribosylation factor ...    147   3e-37   
gb|EMT32329.1|  hypothetical protein F775_06095                         141   3e-37   
ref|XP_002523190.1|  ARF GTPase activator, putative                     145   4e-37   
ref|XP_002437267.1|  hypothetical protein SORBIDRAFT_10g023880          145   4e-37   
ref|XP_006396607.1|  hypothetical protein EUTSA_v10028788mg             145   5e-37   
ref|XP_010098566.1|  ADP-ribosylation factor GTPase-activating pr...    145   6e-37   
ref|NP_001149756.1|  LOC100283383                                       145   6e-37   
ref|XP_010938593.1|  PREDICTED: probable ADP-ribosylation factor ...    146   6e-37   
gb|ACN85216.1|  ZAC                                                     145   7e-37   
ref|XP_006377669.1|  hypothetical protein POPTR_0011s10090g             145   7e-37   
gb|KCW75779.1|  hypothetical protein EUGRSUZ_D00176                     142   1e-36   
ref|XP_008782354.1|  PREDICTED: probable ADP-ribosylation factor ...    139   1e-36   
gb|EMT30400.1|  hypothetical protein F775_27208                         140   1e-36   
gb|AAF21204.1|AC013483_28  putative GTPase activating protein           145   1e-36   
ref|NP_187451.2|  putative ADP-ribosylation factor GTPase-activat...    145   1e-36   
gb|ACN85166.1|  ZAC                                                     144   1e-36   
gb|ACN85257.1|  ZAC                                                     144   2e-36   
ref|XP_011012078.1|  PREDICTED: probable ADP-ribosylation factor ...    144   2e-36   
dbj|BAD35631.1|  putative zinc finger and C2 domain protein             144   2e-36   
emb|CDP17304.1|  unnamed protein product                                144   2e-36   
ref|XP_002874839.1|  ARF-GAP domain 13                                  144   2e-36   
ref|XP_009385341.1|  PREDICTED: probable ADP-ribosylation factor ...    139   2e-36   
emb|CAN79725.1|  hypothetical protein VITISV_014535                     139   2e-36   
emb|CDY01706.1|  BnaC04g30460D                                          141   2e-36   
ref|XP_010245698.1|  PREDICTED: probable ADP-ribosylation factor ...    144   2e-36   
emb|CAB81075.1|  putative protein                                       144   3e-36   
ref|XP_002298890.1|  zinc finger family protein                         143   3e-36   
gb|ACN85316.1|  ZAC                                                     143   3e-36   
gb|AFW76344.1|  putative calcium-dependent lipid-binding (CaLB do...    143   3e-36   
gb|ACN85330.1|  ZAC                                                     141   3e-36   
ref|XP_001775397.1|  predicted protein                                  143   4e-36   
ref|XP_009401045.1|  PREDICTED: probable ADP-ribosylation factor ...    144   4e-36   
ref|XP_008811224.1|  PREDICTED: probable ADP-ribosylation factor ...    144   4e-36   
ref|XP_008647899.1|  PREDICTED: LOC100283383 isoform X2                 143   4e-36   
ref|NP_001059718.1|  Os07g0500300                                       139   4e-36   
gb|EYU43231.1|  hypothetical protein MIMGU_mgv1a009769mg                143   4e-36   
ref|XP_004134589.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    143   4e-36   
gb|AET04392.2|  ADP-ribosylation factor GTPase-activating protein...    142   4e-36   
ref|XP_010486369.1|  PREDICTED: probable ADP-ribosylation factor ...    144   5e-36   
gb|EMS61741.1|  putative ADP-ribosylation factor GTPase-activatin...    139   6e-36   
ref|XP_006656236.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    143   6e-36   
ref|XP_007022881.1|  ARF-GAP domain 13 isoform 3                        140   6e-36   
gb|EPS58515.1|  hypothetical protein M569_16298                         142   7e-36   
ref|XP_011000555.1|  PREDICTED: probable ADP-ribosylation factor ...    143   7e-36   
ref|XP_009362231.1|  PREDICTED: probable ADP-ribosylation factor ...    142   7e-36   
ref|XP_003629916.1|  ADP-ribosylation factor GTPase-activating pr...    142   7e-36   
gb|KGN49461.1|  hypothetical protein Csa_6G525470                       143   7e-36   
ref|XP_010942507.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   8e-36   
ref|XP_010051951.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    142   8e-36   
emb|CAA71759.1|  hypothetical protein                                   138   9e-36   
ref|XP_009344408.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    142   9e-36   
ref|XP_004504221.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    140   1e-35   
gb|ACN85244.1|  ZAC                                                     142   1e-35   
ref|XP_006396608.1|  hypothetical protein EUTSA_v10028788mg             142   1e-35   
ref|NP_567292.1|  putative ADP-ribosylation factor GTPase-activat...    142   1e-35   
ref|XP_002882559.1|  hypothetical protein ARALYDRAFT_478135             143   1e-35   
ref|XP_010051949.1|  PREDICTED: probable ADP-ribosylation factor ...    142   1e-35   
ref|XP_002299211.2|  zinc finger family protein                         142   1e-35   
ref|XP_002533397.1|  ARF GTPase activator, putative                     137   1e-35   
ref|XP_010051947.1|  PREDICTED: probable ADP-ribosylation factor ...    142   1e-35   
ref|XP_008383402.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    142   1e-35   
ref|XP_010460091.1|  PREDICTED: probable ADP-ribosylation factor ...    142   1e-35   



>ref|XP_008453481.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Cucumis melo]
Length=180

 Score =   244 bits (624),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 138/169 (82%), Gaps = 1/169 (1%)
 Frame = -1

Query  792  SAGNKVEMDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWN  613
            S G    M++LLGLL++RI RG+NLAVRD RSSDPYV+VKMGKQKL+T V+K+DVNP WN
Sbjct  10   SGGRLSLMENLLGLLRIRIIRGVNLAVRDVRSSDPYVVVKMGKQKLKTRVIKKDVNPVWN  69

Query  612  EDLTLYVSDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVAR  433
            EDLTL VSDP+LPIK+TVYDHDTFSKDDKMGYAE DIK  +EALKM N  N      + R
Sbjct  70   EDLTLSVSDPNLPIKLTVYDHDTFSKDDKMGYAEFDIKAFMEALKM-NLKNLPSGTTITR  128

Query  432  VPPGRSNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPS  286
            + P R NCLA ESCVV KDGKV QD+ LRL+NVE GEV++Q+QWINLPS
Sbjct  129  MLPARQNCLAEESCVVWKDGKVVQDIYLRLRNVECGEVEVQLQWINLPS  177



>emb|CDO98346.1| unnamed protein product [Coffea canephora]
Length=164

 Score =   242 bits (617),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 138/161 (86%), Gaps = 1/161 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MD+LLGLL++R+KRG+NLAVRD R+SDPYV+VKMGKQKL+T V+ +DVNPEWNEDLTL V
Sbjct  1    MDNLLGLLRIRVKRGVNLAVRDVRTSDPYVVVKMGKQKLKTRVINKDVNPEWNEDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            SDP++P+K+TVYDHD FSKDDKMG AE DIK  +EALKM   N      IV+RV P R+N
Sbjct  61   SDPNIPVKLTVYDHDMFSKDDKMGEAEFDIKAFIEALKM-KLNGLPNGTIVSRVIPLRTN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLP  289
            CL+ ESCV+ KDGK+TQDMCLRL+NVE GEV+IQ+QWI+LP
Sbjct  120  CLSEESCVIWKDGKITQDMCLRLRNVECGEVEIQLQWIDLP  160



>ref|XP_008374850.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Malus domestica]
Length=182

 Score =   242 bits (618),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 139/165 (84%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL++R+KRG+NLAVRD RSSDPYV++KMGKQKL+T V+K+DVNPEWNEDLTL V
Sbjct  18   MENLLGLLRIRVKRGVNLAVRDVRSSDPYVVIKMGKQKLKTRVIKKDVNPEWNEDLTLSV  77

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DPS+PIK+TVYDHDTFSKDDKMG AE  I   +EALKM N        IV R+ P R+N
Sbjct  78   TDPSIPIKLTVYDHDTFSKDDKMGDAEFGISTYIEALKM-NLEGVPSGTIVTRIQPSRAN  136

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ESC++ KDGKV QDMCLRL+NVE GEV+IQ+QWI+LP GSK
Sbjct  137  CLAEESCILWKDGKVVQDMCLRLRNVECGEVEIQLQWIDLP-GSK  180



>ref|XP_007036844.1| Calcium-dependent lipid-binding (CaLB domain) family protein 
[Theobroma cacao]
 gb|EOY21345.1| Calcium-dependent lipid-binding (CaLB domain) family protein 
[Theobroma cacao]
Length=181

 Score =   242 bits (617),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 141/165 (85%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MD+LLGLL++RIKRG+NLAVRD RSSDPYV+VKMG+QKL+T V+K+DVNPEWNEDLTL +
Sbjct  17   MDNLLGLLRIRIKRGVNLAVRDVRSSDPYVVVKMGRQKLKTRVIKKDVNPEWNEDLTLSI  76

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DPSLPIK+TVYDHDTFSKDDKMG AE DI+  +EALKM N        I+++V PGR+N
Sbjct  77   TDPSLPIKLTVYDHDTFSKDDKMGDAEFDIRTYIEALKM-NLGEIPSGTIISKVQPGRNN  135

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ES +  KDGKV QD+CLRL+NVE GEV+IQ+QWI+LP GSK
Sbjct  136  CLAEESTIDWKDGKVVQDICLRLRNVECGEVEIQLQWIDLP-GSK  179



>ref|XP_007209663.1| hypothetical protein PRUPE_ppa012140mg [Prunus persica]
 ref|XP_007209664.1| hypothetical protein PRUPE_ppa012140mg [Prunus persica]
 ref|XP_007209665.1| hypothetical protein PRUPE_ppa012140mg [Prunus persica]
 gb|EMJ10862.1| hypothetical protein PRUPE_ppa012140mg [Prunus persica]
 gb|EMJ10863.1| hypothetical protein PRUPE_ppa012140mg [Prunus persica]
 gb|EMJ10864.1| hypothetical protein PRUPE_ppa012140mg [Prunus persica]
Length=182

 Score =   240 bits (612),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 141/174 (81%), Gaps = 2/174 (1%)
 Frame = -1

Query  789  AGNKVEMDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNE  610
             G+K  M++LLGLL++R+KRG+NLAVRD RSSDPYV++KMGKQKL+T V+K+DVNPEWNE
Sbjct  11   GGSKSLMENLLGLLRIRVKRGVNLAVRDVRSSDPYVVIKMGKQKLKTRVIKKDVNPEWNE  70

Query  609  DLTLYVSDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARV  430
            DLTL V+DPS+PIK+TVYDHDTFSKDDKMG  E  I   +EALKM N         V R+
Sbjct  71   DLTLSVTDPSIPIKLTVYDHDTFSKDDKMGDGEFGIVPYIEALKM-NLEGVASGTTVMRI  129

Query  429  PPGRSNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSKQQS  268
             P R+NCLA ESC++ KDGKV QDMCLRL+NVE GEV+IQ+QWI+LP GSK  S
Sbjct  130  QPSRANCLAEESCILWKDGKVVQDMCLRLRNVECGEVEIQLQWIDLP-GSKGLS  182



>ref|XP_008393427.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Malus domestica]
Length=182

 Score =   240 bits (612),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 142/175 (81%), Gaps = 2/175 (1%)
 Frame = -1

Query  801  RSGSAGNKVEMDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNP  622
            +    G+K  M++LLGLL++R+KRG+NLAVRD RSSDPYV++KMGKQKL+T V+K+D+NP
Sbjct  8    KPAQGGSKSLMENLLGLLRIRVKRGVNLAVRDVRSSDPYVVIKMGKQKLKTRVIKKDINP  67

Query  621  EWNEDLTLYVSDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERI  442
            EWNEDLTL ++DPS+PIK+TV+DHDTFSKDDKMG AE  I   LEALKM N         
Sbjct  68   EWNEDLTLSITDPSIPIKLTVFDHDTFSKDDKMGDAEFGISPYLEALKM-NLEGVPSGTT  126

Query  441  VARVPPGRSNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            V+R+ P R+NCLA ESC+  KDGKV QDMCLRL+NVE GEV++Q+QWI+LP GSK
Sbjct  127  VSRIQPDRANCLAEESCIQWKDGKVVQDMCLRLRNVECGEVEVQLQWIDLP-GSK  180



>gb|KDP23927.1| hypothetical protein JCGZ_27087 [Jatropha curcas]
Length=184

 Score =   239 bits (611),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 144/178 (81%), Gaps = 7/178 (4%)
 Frame = -1

Query  795  GSAGNKVE-----MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRD  631
            GS G KV      M+SLLGLL++R+KRG+NLAVRD RSSDPYV+VKMG+QKL+T V+K+D
Sbjct  7    GSPGKKVATPSTLMESLLGLLRIRVKRGVNLAVRDVRSSDPYVVVKMGRQKLKTRVIKKD  66

Query  630  VNPEWNEDLTLYVSDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDE  451
            VNPEWNEDLTL ++DP+LPIK+ VYDHDTFSKDDKMG AEID+K  ++ALKM N      
Sbjct  67   VNPEWNEDLTLSITDPNLPIKLIVYDHDTFSKDDKMGDAEIDVKPYIQALKM-NLAGVPS  125

Query  450  ERIVARVPPGRSNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
              +++R+ PGR NCLA E+C+   DGKV QD CLRL+NVE GEV++Q+QWI+LP GSK
Sbjct  126  GTVISRMQPGRHNCLAEETCITYVDGKVIQDFCLRLRNVECGEVEVQLQWIDLP-GSK  182



>ref|XP_009783267.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Nicotiana sylvestris]
Length=165

 Score =   239 bits (609),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 139/165 (84%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MD+LLGLL++R+K+G+NLAVRD RSSDPYV+VKMGKQKL+T V+K+DVNPEWNEDLTL V
Sbjct  1    MDNLLGLLRIRVKKGVNLAVRDVRSSDPYVVVKMGKQKLKTRVVKKDVNPEWNEDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP+LP+K+TVYDHD FSKDDKMG AE DIK  LEALKM N        I+ R+ P RSN
Sbjct  61   ADPNLPVKLTVYDHDLFSKDDKMGDAEFDIKPFLEALKM-NLTGLPGGTIITRIQPCRSN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ES VV KDG+V QDMCLRL+NVE GEV++Q+QWINLP GS+
Sbjct  120  CLAEESNVVWKDGQVVQDMCLRLRNVECGEVELQLQWINLP-GSR  163



>ref|XP_009360077.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Pyrus x bretschneideri]
Length=180

 Score =   239 bits (609),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 141/175 (81%), Gaps = 2/175 (1%)
 Frame = -1

Query  801  RSGSAGNKVEMDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNP  622
            +    G+K  M++LLGLL++ +KRG+NLAVRD RSSDPYV++KMGKQKL+T V+K+DVNP
Sbjct  6    KPAKGGSKSCMENLLGLLRIHVKRGVNLAVRDVRSSDPYVVIKMGKQKLKTRVIKKDVNP  65

Query  621  EWNEDLTLYVSDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERI  442
            EWNEDLTL V+DPS+PIK+TV+DHDTFSKDDKMG AE  I   LEALKM N         
Sbjct  66   EWNEDLTLSVTDPSIPIKLTVFDHDTFSKDDKMGDAEFGISPFLEALKM-NLEGVPSGTT  124

Query  441  VARVPPGRSNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            V+R+ P R+NCLA ESC+  KDGKV QDMCLRL+NVE GEV+IQ+QWI+LP GSK
Sbjct  125  VSRIQPDRANCLAEESCIQWKDGKVVQDMCLRLRNVECGEVEIQLQWIDLP-GSK  178



>ref|XP_010033755.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Eucalyptus grandis]
 ref|XP_010033762.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Eucalyptus grandis]
 ref|XP_010033770.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Eucalyptus grandis]
 gb|KCW84067.1| hypothetical protein EUGRSUZ_B00949 [Eucalyptus grandis]
 gb|KCW84068.1| hypothetical protein EUGRSUZ_B00949 [Eucalyptus grandis]
 gb|KCW84069.1| hypothetical protein EUGRSUZ_B00949 [Eucalyptus grandis]
Length=184

 Score =   239 bits (609),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 136/165 (82%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL++R+KRG+NLAVRD RSSDPYV+VKM KQKL+T V+K+DVNPEWNEDLTL V
Sbjct  20   MENLLGLLRIRVKRGVNLAVRDVRSSDPYVVVKMAKQKLKTRVIKKDVNPEWNEDLTLSV  79

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            SDPS+P+K+TVYDHDTFSKDDKMG AE DIK  +EALKM N        ++ RV P R N
Sbjct  80   SDPSIPVKLTVYDHDTFSKDDKMGDAEFDIKPFIEALKM-NLQGLPSGTVITRVQPSRQN  138

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CL  ESCV+  + +V QDMCLRL+NVE GEV+IQ+QWINLP GSK
Sbjct  139  CLVEESCVIWSEDRVVQDMCLRLRNVECGEVEIQLQWINLP-GSK  182



>ref|XP_004299529.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Fragaria vesca subsp. vesca]
Length=179

 Score =   238 bits (608),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 142/173 (82%), Gaps = 2/173 (1%)
 Frame = -1

Query  795  GSAGNKVEMDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEW  616
            G  G+K  M++LLGLL++R+KRG+NLAVRD RSSDPY+++KMGKQKL+T V+K+DVNPEW
Sbjct  6    GGRGSKSLMENLLGLLRIRVKRGVNLAVRDVRSSDPYIVIKMGKQKLKTRVIKKDVNPEW  65

Query  615  NEDLTLYVSDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVA  436
            NEDLTL V+DPS+P+K+TVYDHDTFSKDDKMG AE DI   +EALKMD +       I+ 
Sbjct  66   NEDLTLSVTDPSIPVKLTVYDHDTFSKDDKMGDAEFDIVPYIEALKMD-YGGIPSGTIIT  124

Query  435  RVPPGRSNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            RV P R NCL+ ESCV   +GKV QD+CLRL+NVE GEV+IQ+QWI+LP GSK
Sbjct  125  RVQPCRQNCLSEESCVRWSEGKVIQDLCLRLRNVECGEVEIQLQWIDLP-GSK  176



>ref|XP_009356038.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Pyrus x bretschneideri]
Length=182

 Score =   238 bits (607),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 139/171 (81%), Gaps = 2/171 (1%)
 Frame = -1

Query  789  AGNKVEMDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNE  610
              +K  M++LLGLL++R+KRG+NLAVRD RSSDPYV++KMGKQKL+T V+K+DVNPEWNE
Sbjct  12   GSSKSLMENLLGLLRIRVKRGVNLAVRDVRSSDPYVVIKMGKQKLKTRVIKKDVNPEWNE  71

Query  609  DLTLYVSDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARV  430
            DLTL V+DPS+PIK+TVYDHDTFSKDDKMG AE  I   +EALK+ N         V R+
Sbjct  72   DLTLSVTDPSIPIKLTVYDHDTFSKDDKMGDAEFGISTYIEALKV-NLEGVPSGTTVTRI  130

Query  429  PPGRSNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
             P R+NCLA ESC+  KDGKV QDMCLRL+NVE GEV+IQ+QWI+LP GSK
Sbjct  131  QPSRANCLAEESCIQWKDGKVVQDMCLRLRNVECGEVEIQLQWIDLP-GSK  180



>ref|XP_009614861.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Nicotiana tomentosiformis]
Length=165

 Score =   236 bits (603),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 138/165 (84%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MD+LLGLL++R+K+G+NLAVRD RSSDPYV+VKMGKQKL+T V+K+DVNPEWNEDLTL V
Sbjct  1    MDNLLGLLRIRVKKGVNLAVRDVRSSDPYVVVKMGKQKLKTRVIKKDVNPEWNEDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP+LP+K+TVYDHD FSKDDKMG AE DIK  LEALKM N        I+ R+ P RSN
Sbjct  61   ADPNLPVKLTVYDHDLFSKDDKMGDAEFDIKPFLEALKM-NLTGLPGGTIITRIQPCRSN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA E  VV KDG+V QDMCLRL+NVE GEV++Q+QWINLP GS+
Sbjct  120  CLAEECNVVWKDGQVVQDMCLRLRNVECGEVELQLQWINLP-GSR  163



>ref|XP_008240150.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Prunus mume]
Length=182

 Score =   237 bits (604),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 141/174 (81%), Gaps = 2/174 (1%)
 Frame = -1

Query  789  AGNKVEMDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNE  610
             G+K  M++LLGLL++R+KRG+NLAVRD RSSDPYV++KMGKQKL+T V+K+DVNPEWNE
Sbjct  11   GGSKSLMENLLGLLRIRVKRGVNLAVRDVRSSDPYVVIKMGKQKLKTRVIKKDVNPEWNE  70

Query  609  DLTLYVSDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARV  430
            DLTL V+DPS+PIK+TVYDHDTFSKDDKMG  E  I   +EALK+ N        IV R+
Sbjct  71   DLTLSVTDPSIPIKLTVYDHDTFSKDDKMGDGEFGIVPYIEALKV-NLEGVPSGTIVTRI  129

Query  429  PPGRSNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSKQQS  268
             P R+NCLA ES ++ KDGKV QDMCLRL+NVE GEV+IQ+QWI+LP GSK  S
Sbjct  130  QPSRANCLAEESSILWKDGKVVQDMCLRLRNVECGEVEIQLQWIDLP-GSKGLS  182



>ref|XP_002530486.1| ARF GTPase activator, putative [Ricinus communis]
 gb|EEF31909.1| ARF GTPase activator, putative [Ricinus communis]
Length=183

 Score =   236 bits (603),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 140/174 (80%), Gaps = 2/174 (1%)
 Frame = -1

Query  798  SGSAGNKVEMDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPE  619
            SG   +   M++LLGLL++R+KRG+NLAVRD RSSDPY++VKMGKQKL+T V+K+DVNPE
Sbjct  10   SGKKTSSSLMENLLGLLRIRVKRGVNLAVRDVRSSDPYIVVKMGKQKLKTRVIKKDVNPE  69

Query  618  WNEDLTLYVSDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIV  439
            WNEDLTL V DP+LP+K+TVYDHDTFSKDDKMG AE DI+  +EAL+M N        I+
Sbjct  70   WNEDLTLSVIDPTLPVKLTVYDHDTFSKDDKMGDAEFDIRPYIEALRM-NLAGFPTGTII  128

Query  438  ARVPPGRSNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
             R+ P R NCL+ E+C+   DGKV QD+CLRL+NVE GEV+IQ+QWI+LP GSK
Sbjct  129  KRIQPSRQNCLSEETCITYTDGKVVQDLCLRLRNVECGEVEIQLQWIDLP-GSK  181



>ref|XP_010036952.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Eucalyptus grandis]
 gb|KCW48605.1| hypothetical protein EUGRSUZ_K02272 [Eucalyptus grandis]
Length=180

 Score =   236 bits (602),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 136/163 (83%), Gaps = 1/163 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL++R+KRGINLAVRD R+SDPY+++KM KQKL+T V+K+DVNPEWNEDLTL V
Sbjct  16   METLLGLLRIRVKRGINLAVRDVRTSDPYIVIKMSKQKLKTRVIKKDVNPEWNEDLTLSV  75

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            SDP +PIK+TVYDHDTFSKDDKMG AE DIK  ++AL+MD         I++RV PGR+N
Sbjct  76   SDPDIPIKLTVYDHDTFSKDDKMGDAEFDIKAFIDALRMDLQGLP-SGTIISRVQPGRTN  134

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSG  283
            CL+ ES +V  +G++ QDMCLRLKNVE GEV+IQ+QWI+LP  
Sbjct  135  CLSEESSIVWSEGRIVQDMCLRLKNVECGEVEIQLQWIDLPGA  177



>ref|XP_010097555.1| putative ADP-ribosylation factor GTPase-activating protein AGD11 
[Morus notabilis]
 gb|EXB69087.1| putative ADP-ribosylation factor GTPase-activating protein AGD11 
[Morus notabilis]
Length=186

 Score =   233 bits (595),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 135/165 (82%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MD+LLGLL++R+KRGINLAVRD RSSDPYV+VKMGKQKL+T V+K+DVNPEWNEDLTL V
Sbjct  22   MDNLLGLLRIRVKRGINLAVRDVRSSDPYVVVKMGKQKLKTRVIKKDVNPEWNEDLTLSV  81

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP LP+K+TVYDHDTFS DDKMG AE DIK  +EALKM N        I+ R+ P R N
Sbjct  82   TDPKLPVKLTVYDHDTFSMDDKMGDAEFDIKAYIEALKM-NLEGLPSGTIITRIQPSRQN  140

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CL  ES ++  +GKV QD+CLRL+NVE GEV++Q+QWI+LP GSK
Sbjct  141  CLVEESSIMWNEGKVIQDLCLRLRNVECGEVEVQLQWIDLP-GSK  184



>ref|XP_010663685.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Vitis vinifera]
Length=181

 Score =   233 bits (593),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 137/165 (83%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL+VR+KRGINLAVRD RSSDPY ++KMGKQKL+T V+K++VNPEWNEDLTL +
Sbjct  17   MENLLGLLRVRVKRGINLAVRDVRSSDPYAVIKMGKQKLKTRVMKKNVNPEWNEDLTLSI  76

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            SDP+LPIK+TVYDHDTFSKDDKMG AE  I   LEAL+M +        I++RV P R N
Sbjct  77   SDPNLPIKLTVYDHDTFSKDDKMGDAEFTINPYLEALRM-HLEGLPSGTIISRVQPSRQN  135

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ESC+V  DG+V QD+CLRL+NVE GEV++Q+QWI+LP GSK
Sbjct  136  CLAEESCIVWTDGRVVQDICLRLRNVECGEVELQLQWIDLP-GSK  179



>ref|XP_010274726.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Nelumbo nucifera]
Length=165

 Score =   232 bits (591),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 135/166 (81%), Gaps = 1/166 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MD+LLGLL++R+KRG+NLAVRD RSSDPY+++KMGKQKL+T V+K+++NPEWNEDLTL V
Sbjct  1    MDNLLGLLRIRVKRGVNLAVRDVRSSDPYLVIKMGKQKLKTRVVKKNINPEWNEDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            SDP LP+K+TVYD DTFS DDKMG AE+DI+  LEA+KMD  N      ++ R  P R N
Sbjct  61   SDPKLPVKLTVYDKDTFSLDDKMGQAELDIRPFLEAVKMDLRNYPSGT-VITRELPSRQN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSKQ  274
            CLA ESC+V +DGKV QD+C+RLKNVE GEV++Q QWI LP  + +
Sbjct  120  CLAEESCIVWQDGKVIQDVCVRLKNVERGEVELQFQWIKLPGSNSE  165



>emb|CAN69475.1| hypothetical protein VITISV_014376 [Vitis vinifera]
 emb|CBI15582.3| unnamed protein product [Vitis vinifera]
Length=165

 Score =   232 bits (591),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 137/165 (83%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL+VR+KRGINLAVRD RSSDPY ++KMGKQKL+T V+K++VNPEWNEDLTL +
Sbjct  1    MENLLGLLRVRVKRGINLAVRDVRSSDPYAVIKMGKQKLKTRVMKKNVNPEWNEDLTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            SDP+LPIK+TVYDHDTFSKDDKMG AE  I   LEAL+M +        I++RV P R N
Sbjct  61   SDPNLPIKLTVYDHDTFSKDDKMGDAEFTINPYLEALRM-HLEGLPSGTIISRVQPSRQN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ESC+V  DG+V QD+CLRL+NVE GEV++Q+QWI+LP GSK
Sbjct  120  CLAEESCIVWTDGRVVQDICLRLRNVECGEVELQLQWIDLP-GSK  163



>ref|XP_006341525.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13-like [Solanum tuberosum]
Length=165

 Score =   231 bits (590),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 138/165 (84%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL+VR+KRGINLAVRD RSSDPYV+VKM KQKL+T V+K+DVNPEWNEDLTL V
Sbjct  1    MENLLGLLRVRVKRGINLAVRDVRSSDPYVVVKMAKQKLKTRVVKKDVNPEWNEDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP+LP+ +TVYDHD FSKDDKMG AE DI+  LEALKM N +      I+ R+ P RSN
Sbjct  61   ADPNLPVMLTVYDHDMFSKDDKMGDAEFDIRPFLEALKM-NLSGLPGGTIITRIQPCRSN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CL+ ES VV +DG+V QDMCLRL+NVE GE+++Q+QWINLP GS+
Sbjct  120  CLSEESNVVWQDGQVVQDMCLRLRNVECGEIELQLQWINLP-GSR  163



>ref|XP_004235813.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Solanum lycopersicum]
Length=165

 Score =   231 bits (590),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 138/165 (84%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL+VR+KRGINLAVRD RSSDPYV+VKM KQKL+T V+K+DVNPEWNEDLTL V
Sbjct  1    MENLLGLLRVRVKRGINLAVRDVRSSDPYVVVKMAKQKLKTRVVKKDVNPEWNEDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP+LP+ +TVYDHD FSKDDKMG AE DI+  LEALKM N +      I+ R+ P RSN
Sbjct  61   ADPNLPVMLTVYDHDIFSKDDKMGDAEFDIRPFLEALKM-NLSGLPGGTIITRIQPCRSN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CL+ ES VV +DG+V QDMCLRL+NVE GE+++Q+QWINLP GS+
Sbjct  120  CLSEESNVVWQDGQVVQDMCLRLRNVECGEIELQLQWINLP-GSR  163



>ref|XP_011072997.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Sesamum indicum]
Length=165

 Score =   231 bits (590),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 136/165 (82%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MD+LLGLL++R+KRGINLAVRD RSSDPYV++KMGKQKL+T V+++DVNPEWNEDLTL V
Sbjct  1    MDNLLGLLRIRVKRGINLAVRDVRSSDPYVVIKMGKQKLKTRVIRKDVNPEWNEDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            SDP  PI +TV+DHDTFSKDDKMG A+ DI+  +EA++M      D   ++ ++ P R+N
Sbjct  61   SDPGRPISLTVFDHDTFSKDDKMGEAQFDIEPFIEAVRMKLEGLPDGT-VITKIQPSRNN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CL+ ES VV KDG+V QDMCLRLKNVE GEV+IQ+QWI LP GSK
Sbjct  120  CLSEESTVVWKDGRVVQDMCLRLKNVECGEVEIQLQWIELP-GSK  163



>ref|XP_004235812.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Solanum lycopersicum]
Length=165

 Score =   231 bits (589),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 140/165 (85%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL++R+K+G+NLAVRD RSSD YV+++M +QKL+T V+K+DVNPEWNEDLTL V
Sbjct  1    MENLLGLLRIRVKKGVNLAVRDVRSSDTYVVIQMAEQKLKTRVIKKDVNPEWNEDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP+LP+ +TVYDHD+FSKDDKMG AE DIK L+EALKM N +   E  I+ R+ P RSN
Sbjct  61   ADPNLPVMLTVYDHDSFSKDDKMGDAEFDIKPLIEALKM-NLSGLPEGTIITRIQPSRSN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CL+ ES +V KDG+V QDMCLRL+NVE GEV++Q+QWIN+P GSK
Sbjct  120  CLSGESNIVWKDGQVVQDMCLRLRNVECGEVELQLQWINIP-GSK  163



>ref|XP_004137344.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Cucumis sativus]
 ref|XP_004160416.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Cucumis sativus]
Length=181

 Score =   231 bits (590),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 128/154 (83%), Gaps = 1/154 (1%)
 Frame = -1

Query  747  KVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYVSDPSLPIK  568
            ++RI RG+NLAVRD RSSDPYV+VKMGKQKL+T V+K+DVNP WNEDLTL VSDP+LPIK
Sbjct  26   RIRIVRGVNLAVRDVRSSDPYVVVKMGKQKLKTRVIKKDVNPVWNEDLTLSVSDPNLPIK  85

Query  567  VTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSNCLAAESCV  388
            +TVYDHDTFSKDDKMGYAE DIK  +EALKM N  N      + R+ P R NCLA ESCV
Sbjct  86   LTVYDHDTFSKDDKMGYAEFDIKAFMEALKM-NLKNLSSGTTITRMLPARQNCLAEESCV  144

Query  387  VIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPS  286
            V KDGKV QD+ LRL+NVE GEV+IQ+QWINLP+
Sbjct  145  VWKDGKVVQDIYLRLRNVECGEVEIQLQWINLPN  178



>gb|KHG01667.1| hypothetical protein F383_21926 [Gossypium arboreum]
Length=181

 Score =   231 bits (588),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 138/165 (84%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MD+LLGLL++RIKRG+NLAVRD RSSDPYV+VK+ KQKL+T V+K+DVNPEWNEDLTL +
Sbjct  16   MDNLLGLLRIRIKRGVNLAVRDVRSSDPYVVVKLDKQKLKTRVIKKDVNPEWNEDLTLSI  75

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DPS PIK+TVYDHDTFSKDDKMG AEIDI+  +EALK+D  +  +   I ARV P R+N
Sbjct  76   TDPSTPIKLTVYDHDTFSKDDKMGNAEIDIRPYIEALKVDVDDIPNGTTI-ARVQPCRTN  134

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CL+ ES + + D KV QD+CLRL+NVE GEV+IQ+QWI LP GSK
Sbjct  135  CLSEESAITLVDRKVVQDICLRLRNVECGEVEIQLQWIELP-GSK  178



>ref|XP_006490774.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Citrus sinensis]
 gb|KDO63829.1| hypothetical protein CISIN_1g028875mg [Citrus sinensis]
Length=202

 Score =   231 bits (589),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 140/165 (85%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL++RIKRG+NLAVRD RSSDPYV+VKMGKQKL+T V+K+DVNPEWNEDLTL +
Sbjct  38   METLLGLLRIRIKRGVNLAVRDVRSSDPYVVVKMGKQKLKTRVIKKDVNPEWNEDLTLSI  97

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP++PI +TVYDHD FSKDD+MG AE DIK  +EALKM N ++     I++RV P R N
Sbjct  98   TDPNVPITLTVYDHDLFSKDDRMGDAEFDIKTYIEALKM-NLDSLPTGTIISRVMPSRHN  156

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CL+ +SCVV K+GKV QD+ LRL+NVE GE++IQ+QWI+LP GSK
Sbjct  157  CLSEQSCVVWKEGKVVQDLVLRLRNVECGELEIQLQWIDLP-GSK  200



>ref|XP_006451620.1| hypothetical protein CICLE_v10009524mg [Citrus clementina]
 gb|ESR64860.1| hypothetical protein CICLE_v10009524mg [Citrus clementina]
Length=202

 Score =   231 bits (589),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 140/165 (85%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL++RIKRG+NLAVRD RSSDPYV+VKMGKQKL+T V+K+DVNPEWNEDLTL +
Sbjct  38   METLLGLLRIRIKRGVNLAVRDVRSSDPYVVVKMGKQKLKTRVIKKDVNPEWNEDLTLSI  97

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP++PI +TVYDHD FSKDD+MG AE DIK  +EALKM N ++     I++RV P R N
Sbjct  98   TDPNVPITLTVYDHDLFSKDDRMGDAEFDIKTYIEALKM-NLDSLPTGTIISRVMPSRHN  156

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CL+ +SCVV K+GKV QD+ LRL+NVE GE++IQ+QWI+LP GSK
Sbjct  157  CLSEQSCVVWKEGKVVQDLILRLRNVECGELEIQLQWIDLP-GSK  200



>ref|XP_006346641.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Solanum tuberosum]
Length=181

 Score =   229 bits (583),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 140/174 (80%), Gaps = 3/174 (2%)
 Frame = -1

Query  795  GSAGNKVEMDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGK-QKLRTHVLKRDVNPE  619
            G +  K  MD+LLGLL+++IK+G+NLAVRD R+SDPY +VKMGK QKL+T V+K+D+NPE
Sbjct  8    GGSATKSLMDNLLGLLRIKIKKGVNLAVRDVRTSDPYCVVKMGKKQKLKTRVIKKDINPE  67

Query  618  WNEDLTLYVSDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIV  439
            WNEDLTL VSDPSLP+K+TVYDHDTFS DDKMG AE DIK  +EALKM+ H       ++
Sbjct  68   WNEDLTLSVSDPSLPVKLTVYDHDTFSMDDKMGDAEFDIKSFVEALKMNLHGLP-SGTVI  126

Query  438  ARVPPGRSNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
             RV P R+NCLA ES V+  DGKV QDM LRL+NVE GEV++Q+QWI+LP GSK
Sbjct  127  TRVLPCRTNCLAEESRVIWDDGKVVQDMILRLRNVECGEVELQLQWIDLP-GSK  179



>dbj|BAO02515.1| predicted C2 domain containing protein [Nicotiana alata]
Length=188

 Score =   228 bits (582),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 140/174 (80%), Gaps = 3/174 (2%)
 Frame = -1

Query  795  GSAGNKVEMDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGK-QKLRTHVLKRDVNPE  619
             ++  K  MD+LLGLL+++IKRG+NLAVRD R+SDPY +VKMGK QKL+T V+K+D+NPE
Sbjct  15   AASATKSLMDNLLGLLRIKIKRGVNLAVRDVRTSDPYCVVKMGKKQKLKTRVIKKDINPE  74

Query  618  WNEDLTLYVSDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIV  439
            WNE+LTL VSDPSLP+K+TVYDHDTFS DDKMG AE DIK  +EALKM N +      ++
Sbjct  75   WNEELTLSVSDPSLPVKLTVYDHDTFSMDDKMGDAEFDIKPFIEALKM-NLDGLPSGTVI  133

Query  438  ARVPPGRSNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
             RV P R+NCLA ES VV +DGKV QDM LRL+NVE GEV++Q+QWI LP GSK
Sbjct  134  TRVLPCRTNCLAEESRVVWQDGKVVQDMILRLRNVECGEVELQLQWIELP-GSK  186



>gb|EYU24145.1| hypothetical protein MIMGU_mgv1a018362mg [Erythranthe guttata]
Length=185

 Score =   228 bits (582),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 133/161 (83%), Gaps = 1/161 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MDSLLGLL++R+KRGINLAVRD RSSDPYV+V+MGKQ+++T V+++D+NPEWNEDLTL V
Sbjct  21   MDSLLGLLRIRVKRGINLAVRDVRSSDPYVVVRMGKQRMKTRVIRKDINPEWNEDLTLSV  80

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            SDP  P+ +TVYDHDTFS DDKMG AE DI+  +E +KM + N      I+ R+ P RSN
Sbjct  81   SDPKHPVSLTVYDHDTFSMDDKMGDAEFDIRPFIEGMKM-HPNGLPNGTIITRIYPSRSN  139

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLP  289
            CL+ ES VV +DG+V QDMCLRLKNVE GE+++Q+QWI+LP
Sbjct  140  CLSEESSVVWRDGRVMQDMCLRLKNVECGEIELQLQWIDLP  180



>gb|ACD40010.1| pollen-specific C2 domain containing protein [Nicotiana alata]
 gb|ACD40012.1| pollen-specific C2 domain containing protein [Nicotiana forgetiana]
 gb|ACD40013.1| pollen-specific C2 domain containing protein [Nicotiana langsdorffii]
 gb|ACD40014.1| pollen-specific C2 domain containing protein [Nicotiana mutabilis]
 gb|ACD40016.1| pollen-specific C2 domain containing protein [Nicotiana longiflora]
Length=187

 Score =   228 bits (581),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 140/174 (80%), Gaps = 3/174 (2%)
 Frame = -1

Query  795  GSAGNKVEMDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGK-QKLRTHVLKRDVNPE  619
             ++  K  MD+LLGLL+++IKRG+NLAVRD R+SDPY +VKMGK QKL+T V+K+D+NPE
Sbjct  14   AASATKSLMDNLLGLLRIKIKRGVNLAVRDVRTSDPYCVVKMGKKQKLKTRVIKKDINPE  73

Query  618  WNEDLTLYVSDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIV  439
            WNE+LTL VSDPSLP+K+TVYDHDTFS DDKMG AE DIK  +EALKM N +      ++
Sbjct  74   WNEELTLSVSDPSLPVKLTVYDHDTFSMDDKMGDAEFDIKPFVEALKM-NLDGLPSGTVI  132

Query  438  ARVPPGRSNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
             RV P R+NCLA ES VV +DGKV QDM LRL+NVE GEV++Q+QWI LP GSK
Sbjct  133  TRVLPCRTNCLAEESRVVWQDGKVVQDMILRLRNVECGEVELQLQWIELP-GSK  185



>ref|XP_009796427.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Nicotiana sylvestris]
Length=165

 Score =   227 bits (579),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 139/166 (84%), Gaps = 2/166 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MD+LLGLL+++IKRG+NLAVRD RSSDPYV+VKMGKQKL+T V+ +DVNPEWNEDLTL V
Sbjct  1    MDNLLGLLRIKIKRGVNLAVRDVRSSDPYVVVKMGKQKLKTRVINKDVNPEWNEDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            SDP+LP+K+TVYDHD FS DDKMG AE +IK  L+ALKM N +      +++RV P RSN
Sbjct  61   SDPNLPVKLTVYDHDMFSMDDKMGDAEFEIKPFLDALKM-NLDGLPCGTVISRVTPCRSN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSKQ  274
            CL+ E+ VV +D KV QDMCLRL+NVE GEV++Q+QWI+LP GSK+
Sbjct  120  CLSEETKVVWQDNKVVQDMCLRLRNVECGEVELQLQWIDLP-GSKR  164



>ref|XP_009761742.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Nicotiana sylvestris]
 gb|ACD40011.1| pollen-specific C2 domain containing protein [Nicotiana sp. variant 
'Rastroensis']
Length=188

 Score =   228 bits (581),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 140/174 (80%), Gaps = 3/174 (2%)
 Frame = -1

Query  795  GSAGNKVEMDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGK-QKLRTHVLKRDVNPE  619
             ++  K  MD+LLGLL+++IKRG+NLAVRD R+SDPY +VKMGK QKL+T V+K+D+NPE
Sbjct  15   AASATKSLMDNLLGLLRIKIKRGVNLAVRDVRTSDPYCVVKMGKKQKLKTRVIKKDINPE  74

Query  618  WNEDLTLYVSDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIV  439
            WNE+LTL VSDPSLP+K+TVYDHDTFS DDKMG AE DIK  +EALKM N +      ++
Sbjct  75   WNEELTLSVSDPSLPVKLTVYDHDTFSMDDKMGDAEFDIKPFVEALKM-NLDGLPSGTVI  133

Query  438  ARVPPGRSNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
             RV P R+NCLA ES VV +DGKV QDM LRL+NVE GEV++Q+QWI LP GSK
Sbjct  134  TRVLPCRTNCLAEESRVVWQDGKVVQDMILRLRNVECGEVELQLQWIELP-GSK  186



>ref|XP_009595957.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Nicotiana tomentosiformis]
Length=164

 Score =   227 bits (578),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 137/166 (83%), Gaps = 2/166 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MD+LLGLL+++IKRG+NLAVRD RSSDPYV+VKMGKQKL+T V+ +DVNPEWNEDLTL V
Sbjct  1    MDNLLGLLRIKIKRGVNLAVRDVRSSDPYVVVKMGKQKLKTRVINKDVNPEWNEDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            SDP+L +K+TVYDHD FS DDKMG AE DIK  L+ALKM N +      ++ RV P RSN
Sbjct  61   SDPNLTVKLTVYDHDMFSMDDKMGDAEFDIKPFLDALKM-NLDGLPCGTVITRVTPCRSN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSKQ  274
            CLA E+ VV +D KV QDMCLRL+NVE GEV++Q+QWI+LP GSK+
Sbjct  120  CLAEETKVVWQDNKVVQDMCLRLRNVECGEVELQLQWIDLP-GSKR  164



>gb|ACD40015.1| pollen-specific C2 domain containing protein [Nicotiana bonariensis]
Length=187

 Score =   226 bits (577),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 138/174 (79%), Gaps = 3/174 (2%)
 Frame = -1

Query  795  GSAGNKVEMDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGK-QKLRTHVLKRDVNPE  619
             ++  K  MD LLGLL+++IKRG+NLAVRD R+SDPY +VKMGK QKL+T V+K+D+NPE
Sbjct  14   AASATKSLMDRLLGLLRIKIKRGVNLAVRDVRTSDPYCVVKMGKKQKLKTRVIKKDINPE  73

Query  618  WNEDLTLYVSDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIV  439
            WNE+LTL VSDPSLP+K+TVYDHDTFS DDKMG AE DIK  +EALKM N        ++
Sbjct  74   WNEELTLSVSDPSLPVKLTVYDHDTFSMDDKMGDAEFDIKPFVEALKM-NLYGLPSGTVI  132

Query  438  ARVPPGRSNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
             RV P R+NCLA ES VV +DGKV QDM LRL+NVE GEV++Q+QWI LP GSK
Sbjct  133  TRVLPCRTNCLAEESRVVWQDGKVVQDMILRLRNVECGEVELQLQWIELP-GSK  185



>ref|XP_010314227.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Solanum lycopersicum]
Length=178

 Score =   226 bits (575),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 140/174 (80%), Gaps = 3/174 (2%)
 Frame = -1

Query  795  GSAGNKVEMDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGK-QKLRTHVLKRDVNPE  619
            G +  +  MD+L+GLL+++IK+G+NLAVRD R+SDPY +VKMGK QKL+T V+K+D+NPE
Sbjct  5    GGSATQSLMDNLMGLLRIKIKKGVNLAVRDVRTSDPYCVVKMGKKQKLKTRVIKKDINPE  64

Query  618  WNEDLTLYVSDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIV  439
            WNEDLTL VSDPSLP+K+TVYDHDTF+ DDKMG AE DIK  +EALKM+ H       ++
Sbjct  65   WNEDLTLSVSDPSLPVKLTVYDHDTFTMDDKMGDAEFDIKSFVEALKMNLHGLP-SGTVI  123

Query  438  ARVPPGRSNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
             RV P R+NCLA ES V+  DGKV QDM LRL+NVE GEV++Q+QWI+LP G+K
Sbjct  124  TRVLPCRTNCLAEESRVIWDDGKVVQDMILRLRNVECGEVELQLQWIDLP-GTK  176



>ref|XP_006341526.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Solanum tuberosum]
Length=165

 Score =   224 bits (572),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 138/165 (84%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL++R+K+G+NLAVRD RSSD YV+V+M KQKL+T V+++DVNPEWNEDLTL V
Sbjct  1    MENLLGLLRIRVKKGVNLAVRDVRSSDTYVVVQMAKQKLKTRVIRKDVNPEWNEDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP+LP+ +TV+DHD+FS DDKMG  E DIK L+EALKM N +   +  I+ R+ P RSN
Sbjct  61   ADPNLPVMLTVFDHDSFSNDDKMGDTEFDIKPLIEALKM-NLSGLPDGTIITRIQPSRSN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CL+ ES VV KDG+V Q+MCLRL+NVE GEV++Q+QWIN+P GSK
Sbjct  120  CLSEESNVVWKDGQVVQNMCLRLRNVECGEVELQLQWINIP-GSK  163



>ref|XP_009628522.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Nicotiana tomentosiformis]
 ref|XP_009628523.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Nicotiana tomentosiformis]
 ref|XP_009628524.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Nicotiana tomentosiformis]
Length=186

 Score =   225 bits (573),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 140/176 (80%), Gaps = 3/176 (2%)
 Frame = -1

Query  801  RSGSAGNKVEMDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGK-QKLRTHVLKRDVN  625
            +  ++  K  MD+LLGLL+++IKRG+NLAVRD R+SDPY +VKMGK QKL+T V+K+D+N
Sbjct  11   KGAASATKSLMDNLLGLLRIKIKRGVNLAVRDVRTSDPYCVVKMGKKQKLKTRVIKKDIN  70

Query  624  PEWNEDLTLYVSDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEER  445
            PEWNE+LTL VSDP+LP+K+TVYDHDTFS DDKMG AE DIK  +EALKM N +      
Sbjct  71   PEWNEELTLSVSDPTLPVKLTVYDHDTFSMDDKMGDAEFDIKPFVEALKM-NLDGLPSGT  129

Query  444  IVARVPPGRSNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            ++ RV P R+NCLA ES VV +D KV QDM LRL+NVE GEV++Q+QWI LP GSK
Sbjct  130  VITRVLPCRTNCLAEESRVVWQDDKVVQDMILRLRNVECGEVELQLQWIELP-GSK  184



>gb|ACD40018.1| pollen-specific C2 domain containing protein [Nicotiana tabacum]
Length=188

 Score =   225 bits (573),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 139/174 (80%), Gaps = 3/174 (2%)
 Frame = -1

Query  795  GSAGNKVEMDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGK-QKLRTHVLKRDVNPE  619
             ++  K  MD+LLGLL+++IKRG+NLAVRD R+SDPY +VKMGK QKL+T V+K+D+NPE
Sbjct  15   AASATKSLMDNLLGLLRIKIKRGVNLAVRDVRTSDPYCVVKMGKKQKLKTRVIKKDINPE  74

Query  618  WNEDLTLYVSDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIV  439
            WNE+LTL VSDPSLP+K+TVYDHDTFS DDKMG AE  IK  +EALKM N +      ++
Sbjct  75   WNEELTLSVSDPSLPVKLTVYDHDTFSMDDKMGDAEFYIKPFVEALKM-NLDGLPSGTVI  133

Query  438  ARVPPGRSNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
             RV P R+NCLA ES VV +DGKV QDM LRL+NVE GEV++Q+QWI LP GSK
Sbjct  134  TRVLPCRTNCLAEESRVVWQDGKVVQDMILRLRNVECGEVELQLQWIELP-GSK  186



>ref|XP_011039132.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Populus euphratica]
Length=165

 Score =   224 bits (571),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 130/162 (80%), Gaps = 1/162 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+S+LGLL++R+KRGINLAVRD RSSDPYV+++MG QKL+T V+K+DVNP WNEDLTL V
Sbjct  1    MESILGLLRIRVKRGINLAVRDVRSSDPYVVIRMGNQKLKTRVIKKDVNPHWNEDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP+LP+K+ VYDHD F+KDDKMG AEIDI+  +E LKM N        ++ R+ P R N
Sbjct  61   TDPNLPVKLIVYDHDLFTKDDKMGEAEIDIRPFIETLKM-NLAGLSSGTVITRIQPSRQN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPS  286
            CL+ +SC++  DGKV QD+ LRLKNVE GE++IQ+QWI  PS
Sbjct  120  CLSEDSCIIYSDGKVVQDLYLRLKNVECGELEIQLQWITFPS  161



>ref|XP_006365412.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13-like [Solanum tuberosum]
Length=165

 Score =   224 bits (570),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 137/166 (83%), Gaps = 2/166 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MD+LLGLL+++IKRGINLAVRD RSSDPYV+VKMGKQKL+T V+K+DVNPEWNEDLTL V
Sbjct  1    MDNLLGLLRIKIKRGINLAVRDVRSSDPYVVVKMGKQKLKTRVIKKDVNPEWNEDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            SD +LP+K+TVYDHD FS DDKMG AE DIK  L+ALKM N ++     ++ R  P R+N
Sbjct  61   SDANLPVKLTVYDHDMFSMDDKMGDAEFDIKPFLDALKM-NLDSLPCGTVITRATPCRAN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSKQ  274
            CL+ ES V  +D +V QDMCLRL+NVE GEV++Q+QWI++P GSK+
Sbjct  120  CLSEESKVTWQDNQVVQDMCLRLRNVECGEVELQLQWIDIP-GSKR  164



>ref|XP_003631121.1| Pollen-specific C2 domain containing protein [Medicago truncatula]
 gb|AET05597.1| calcium-dependent lipid-binding (CaLB domain) family protein 
[Medicago truncatula]
Length=182

 Score =   224 bits (570),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 131/171 (77%), Gaps = 1/171 (1%)
 Frame = -1

Query  795  GSAGNKVEMDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEW  616
            G    K  M+ LLGLL++RIKRG+NLAVRD  +SDPY +VKMGKQ+L+THV+K+DVNPEW
Sbjct  9    GGDSGKSLMEDLLGLLRIRIKRGVNLAVRDVNTSDPYAVVKMGKQRLKTHVIKKDVNPEW  68

Query  615  NEDLTLYVSDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVA  436
            NEDLTL ++DP +P K+TVYD+DTFSKDDKMG AE D+   +EALK  N     E  I+ 
Sbjct  69   NEDLTLSITDPVVPFKLTVYDYDTFSKDDKMGDAEFDLSPYIEALKT-NLEGLPEGTIIT  127

Query  435  RVPPGRSNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSG  283
            R+ P R NCL+ ESC+   DGKV QD+ LRL+NVE GEV+IQ+QWI+LP  
Sbjct  128  RIQPCRQNCLSEESCITYSDGKVVQDVVLRLRNVECGEVEIQLQWIDLPGA  178



>ref|XP_002317873.1| GTPase activating family protein [Populus trichocarpa]
 gb|EEE96093.1| GTPase activating family protein [Populus trichocarpa]
Length=165

 Score =   223 bits (568),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 129/162 (80%), Gaps = 1/162 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+S+LGLL++R+KRGINLAVRD RSSDPYV+++MG QKL+T V+K+DVNP WNEDLTL V
Sbjct  1    MESILGLLRIRVKRGINLAVRDVRSSDPYVVIRMGNQKLKTRVIKKDVNPHWNEDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP+LP+K+ VYDHD F+KDDKMG AE DI+  +E LKM N        ++ R+ P R N
Sbjct  61   TDPNLPVKLIVYDHDLFTKDDKMGEAEFDIRPFIETLKM-NLAGVSSGTVITRIQPSRQN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPS  286
            CL+ +SC++  DGKV QD+ LRLKNVE GE++IQ+QWI  PS
Sbjct  120  CLSEDSCIIYSDGKVVQDLYLRLKNVECGELEIQLQWITFPS  161



>gb|ACD40017.1| pollen-specific C2 domain containing protein [Nicotiana plumbaginifolia]
Length=179

 Score =   223 bits (567),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 135/167 (81%), Gaps = 2/167 (1%)
 Frame = -1

Query  795  GSAGNKVEMDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGK-QKLRTHVLKRDVNPE  619
             ++  K  MD+LLGLL+++IKRG+NLAVRD R+SDPY +VKMGK QKL+T V+K+D+NPE
Sbjct  14   AASATKSLMDNLLGLLRIKIKRGVNLAVRDVRTSDPYCVVKMGKKQKLKTRVIKKDINPE  73

Query  618  WNEDLTLYVSDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIV  439
            WNE+LTL VSDPSLP+K+TVYDHDTFS DDKMG AE DIK  +EALKM N +      ++
Sbjct  74   WNEELTLSVSDPSLPVKLTVYDHDTFSMDDKMGDAEFDIKPFVEALKM-NLDGLPSGTVI  132

Query  438  ARVPPGRSNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWI  298
             RV P R+NCLA ES VV +DGKV QDM LRL+NVE GEV++Q+QWI
Sbjct  133  TRVLPCRTNCLAEESRVVWQDGKVVQDMILRLRNVECGEVELQLQWI  179



>ref|XP_011084199.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Sesamum indicum]
Length=189

 Score =   222 bits (566),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 130/164 (79%), Gaps = 2/164 (1%)
 Frame = -1

Query  768  DSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYVS  589
            D+LLGLL++R+KRGINLAVRD RSSDPYV+V+MGKQKL+T V+ +D+NPEWNEDLTL VS
Sbjct  26   DTLLGLLRIRVKRGINLAVRDVRSSDPYVVVRMGKQKLKTRVINKDINPEWNEDLTLSVS  85

Query  588  DPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSNC  409
            DP+ P+ +TV+DHDTFS DD MG AE  I   LEA+ M      D   I+ +V P R+NC
Sbjct  86   DPNHPVSLTVFDHDTFSPDDPMGDAEFRITQFLEAVSMQLDGVPDGT-IITKVQPCRANC  144

Query  408  LAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            LA ESC+V  DG+V QDMCLRLKNVE GE++IQ+QWI LP GSK
Sbjct  145  LAEESCIVWTDGQVLQDMCLRLKNVECGELEIQLQWIQLP-GSK  187



>ref|XP_004503269.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Cicer arietinum]
Length=176

 Score =   220 bits (561),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 136/174 (78%), Gaps = 3/174 (2%)
 Frame = -1

Query  798  SGSAGNKVEMDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPE  619
             G++G  + M+ LLGLL++RIKRG+NLAVRD  +SDPYV+VKMGKQKL+T V+K+D+NPE
Sbjct  4    EGNSGKSL-MEDLLGLLRIRIKRGVNLAVRDVNTSDPYVVVKMGKQKLKTRVIKKDINPE  62

Query  618  WNEDLTLYVSDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIV  439
            WNEDLTL V+DP LP  +TVYDHDTF+ DDKMG AE D+   ++ALKM N  +     ++
Sbjct  63   WNEDLTLSVTDPVLPFILTVYDHDTFTADDKMGDAEFDLSPYIDALKM-NLADIPNGTVI  121

Query  438  ARVPPGRSNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
             R+ P R NCLA ESC+   DGK+ QD+ LRL+NVE GE++IQ+QWI+LP GSK
Sbjct  122  TRIQPSRQNCLAEESCITCTDGKIVQDVVLRLRNVECGELEIQLQWIDLP-GSK  174



>gb|AFK44826.1| unknown [Lotus japonicus]
Length=168

 Score =   220 bits (560),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 128/163 (79%), Gaps = 1/163 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+ +LGLL++RIKRG+NLAVRD  +SDPYV+VKMGKQKL+T V+ +D+NPEWNEDLTL +
Sbjct  1    MEDILGLLRIRIKRGVNLAVRDVNTSDPYVVVKMGKQKLKTRVIHKDINPEWNEDLTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP  P  +TVYDHDTFSKDDKMG AE D+   +EALKM N        IV RV P R+N
Sbjct  61   TDPFKPFVLTVYDHDTFSKDDKMGDAEFDLSPFIEALKM-NLEGLPSGTIVTRVQPCRTN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSG  283
            CLA ESC+ + DGKV QD+ LRL++VE GEV+IQ+QWI+LP  
Sbjct  120  CLAEESCITVNDGKVVQDVVLRLRHVECGEVEIQLQWIDLPGA  162



>ref|XP_010678069.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Beta vulgaris subsp. vulgaris]
Length=185

 Score =   220 bits (561),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 142/174 (82%), Gaps = 4/174 (2%)
 Frame = -1

Query  804  CRSG--SAGNKVEMDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRD  631
            C SG  S+G+ + M++LLGLL+V+I RGINLA+RD R+SDPYV++KMGKQKL+T V+K+D
Sbjct  9    CDSGRPSSGSSL-MENLLGLLRVKIIRGINLAIRDVRTSDPYVVIKMGKQKLKTRVIKKD  67

Query  630  VNPEWNEDLTLYVSDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDE  451
            VNPEWNEDLTL VSDP+LPI++TVYDHD FSKDDKMG AE DI   ++ALKM N ++   
Sbjct  68   VNPEWNEDLTLSVSDPNLPIQLTVYDHDMFSKDDKMGEAEFDISPFIDALKM-NLDSLPS  126

Query  450  ERIVARVPPGRSNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLP  289
              +++RV P R NCLA ES ++  + +V Q++CLRLKNVE GEV++Q+QWI+LP
Sbjct  127  GTLISRVQPCRKNCLAEESKIMWTESRVIQNICLRLKNVECGEVELQLQWIDLP  180



>gb|KGN63876.1| hypothetical protein Csa_1G025080 [Cucumis sativus]
Length=201

 Score =   219 bits (559),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 111/174 (64%), Positives = 128/174 (74%), Gaps = 21/174 (12%)
 Frame = -1

Query  747  KVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYVSDPSLPIK  568
            ++RI RG+NLAVRD RSSDPYV+VKMGKQKL+T V+K+DVNP WNEDLTL VSDP+LPIK
Sbjct  26   RIRIVRGVNLAVRDVRSSDPYVVVKMGKQKLKTRVIKKDVNPVWNEDLTLSVSDPNLPIK  85

Query  567  V--------------------TVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEE  448
            +                    TVYDHDTFSKDDKMGYAE DIK  +EALKM N  N    
Sbjct  86   LGSSKRSFLVSDGIFHGRHTSTVYDHDTFSKDDKMGYAEFDIKAFMEALKM-NLKNLSSG  144

Query  447  RIVARVPPGRSNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPS  286
              + R+ P R NCLA ESCVV KDGKV QD+ LRL+NVE GEV+IQ+QWINLP+
Sbjct  145  TTITRMLPARQNCLAEESCVVWKDGKVVQDIYLRLRNVECGEVEIQLQWINLPN  198



>ref|XP_006587472.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X2 [Glycine max]
 gb|KHN23718.1| ADP-ribosylation factor GTPase-activating protein AGD12 [Glycine 
soja]
Length=176

 Score =   218 bits (556),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 131/165 (79%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL+VR+KRG+NLAVRD RSSDPYV++KM  QKL+T V+K+DVNPEWNEDLTL V
Sbjct  12   MENLLGLLRVRVKRGVNLAVRDVRSSDPYVVIKMYNQKLKTRVIKKDVNPEWNEDLTLSV  71

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
             +P+  IK+TVYDHDTFSKDDKMG AE DI   +EALKM N        +V R+ P + N
Sbjct  72   INPNHKIKLTVYDHDTFSKDDKMGDAEFDIFPFIEALKM-NLTGLPNGTVVTRIQPSKHN  130

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ESC+   +GKV QDM LRL+NVE GEV+IQ+QWI+LP GSK
Sbjct  131  CLADESCITYSNGKVVQDMILRLQNVECGEVEIQLQWIDLP-GSK  174



>ref|XP_006584907.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13-like [Glycine max]
 gb|KHN00147.1| Putative ADP-ribosylation factor GTPase-activating protein AGD13 
[Glycine soja]
Length=165

 Score =   218 bits (555),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 130/165 (79%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+ LLGLL++ IKRG+NLAVRD  +SDPYV+VKMGKQKL+T V+K+DVNPEW EDLTL V
Sbjct  1    MEDLLGLLRIHIKRGVNLAVRDVNTSDPYVVVKMGKQKLKTRVIKKDVNPEWKEDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP  P  +TVYD+DTFSKDDKMG AE DI   +EALKM N  +     I+ R+ P R N
Sbjct  61   TDPIHPFILTVYDYDTFSKDDKMGDAECDISAYIEALKM-NLEDLPSGTIITRIQPSRQN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ESC+   +GKV QD+ LRL++VESGEV+IQ+QWINLP GSK
Sbjct  120  CLAEESCITYSNGKVIQDLVLRLRHVESGEVEIQLQWINLP-GSK  163



>ref|XP_003534141.2| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X1 [Glycine max]
Length=204

 Score =   219 bits (557),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 131/165 (79%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL+VR+KRG+NLAVRD RSSDPYV++KM  QKL+T V+K+DVNPEWNEDLTL V
Sbjct  40   MENLLGLLRVRVKRGVNLAVRDVRSSDPYVVIKMYNQKLKTRVIKKDVNPEWNEDLTLSV  99

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
             +P+  IK+TVYDHDTFSKDDKMG AE DI   +EALKM N        +V R+ P + N
Sbjct  100  INPNHKIKLTVYDHDTFSKDDKMGDAEFDIFPFIEALKM-NLTGLPNGTVVTRIQPSKHN  158

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ESC+   +GKV QDM LRL+NVE GEV+IQ+QWI+LP GSK
Sbjct  159  CLADESCITYSNGKVVQDMILRLQNVECGEVEIQLQWIDLP-GSK  202



>gb|AFK34568.1| unknown [Lotus japonicus]
Length=168

 Score =   217 bits (553),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/163 (63%), Positives = 127/163 (78%), Gaps = 1/163 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+ +LGLL++RIKRG+NLAVRD  +SDPYV+VKMGKQKL+T V+ +D+NPEWNEDLTL +
Sbjct  1    MEDILGLLRIRIKRGVNLAVRDVNTSDPYVVVKMGKQKLKTRVIHKDINPEWNEDLTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP  P  +TVYDHDTFSKDDKMG AE D    +EALKM N        IV R+ P R+N
Sbjct  61   TDPVKPFVLTVYDHDTFSKDDKMGDAEFDPSPFIEALKM-NLEGLPSGTIVTRIQPCRTN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSG  283
            CLA ESC+ + DGKV QD+ LRL++VE GEV+IQ+QWI+LP  
Sbjct  120  CLAEESCIAVNDGKVVQDVVLRLRHVECGEVEIQLQWIDLPGA  162



>ref|XP_003528987.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13-like [Glycine max]
 gb|KHN44628.1| ADP-ribosylation factor GTPase-activating protein AGD12 [Glycine 
soja]
Length=176

 Score =   217 bits (553),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 131/165 (79%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL+VR+KRG+NLAVRD RSSDPYV++KM +QKL+T V+K+DVNPEWNEDLTL V
Sbjct  12   MENLLGLLRVRVKRGVNLAVRDVRSSDPYVVIKMYRQKLKTRVIKKDVNPEWNEDLTLSV  71

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
             +P+  +K+TVYDHDTFSKDDKMG AE DI   +EALKM N        +V R+ P + N
Sbjct  72   INPNHKVKLTVYDHDTFSKDDKMGDAEFDILPFIEALKM-NLTGLANGTVVTRIQPSKHN  130

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CL  ESC+   +GKV QDM LRL+NVE GEV+IQ+QWI+LP GSK
Sbjct  131  CLVDESCITYSNGKVVQDMILRLQNVECGEVEIQLQWIDLP-GSK  174



>ref|XP_004241660.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Solanum lycopersicum]
Length=165

 Score =   216 bits (551),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 134/166 (81%), Gaps = 2/166 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MD+L GLL+++IKRGINLAVRD RSSDPYV+VKMG QKL+T V+K+DVNPEWNE LTL V
Sbjct  1    MDNLFGLLRIKIKRGINLAVRDVRSSDPYVVVKMGNQKLKTRVIKKDVNPEWNEYLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            SD +LP+K+TVYDHD FS DDKMG AE DIK  L+ALKM N ++     ++ R  P R+N
Sbjct  61   SDANLPVKLTVYDHDRFSMDDKMGDAEFDIKPFLDALKM-NLDSLPCGTVITRETPCRTN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSKQ  274
            CL+ ES V  +D +V QD+CLRL+NVE GEV++Q+QWIN+P GSK+
Sbjct  120  CLSEESKVTWQDNQVVQDLCLRLRNVECGEVELQLQWINIP-GSKR  164



>ref|XP_010540029.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Tarenaya hassleriana]
Length=168

 Score =   216 bits (551),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 134/165 (81%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++L+GLL+VR+K G+NLAVRD RSSDPYV++++G+QKL+T V+K+DVNPEWNEDLT  +
Sbjct  4    MENLMGLLRVRVKCGVNLAVRDVRSSDPYVVLRVGRQKLKTRVVKKDVNPEWNEDLTFTI  63

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP+LP+++TVYDHD FSKDDKMG AEIDI   +EAL+M+     D   I+ R+ P R N
Sbjct  64   TDPNLPVQLTVYDHDLFSKDDKMGDAEIDIGPYIEALRMELSGLPDGT-IITRIQPRRCN  122

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ESCV    G++ QD+CLRL+NVE GEV +Q+QWI+LP GSK
Sbjct  123  CLAEESCVRWSGGRIVQDLCLRLRNVECGEVQVQLQWIDLP-GSK  166



>ref|XP_008464579.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X2 [Cucumis melo]
Length=194

 Score =   217 bits (553),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 134/165 (81%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+SLLGLL++RI RG+NLAVRD RSSDPY++VKM KQKL+T V+K+D+NPEWNEDLTL V
Sbjct  30   MESLLGLLRIRIIRGVNLAVRDVRSSDPYIVVKMSKQKLKTRVIKKDINPEWNEDLTLSV  89

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP+  +K+TVYDHDTFS DDKMG AE +I   +EALKMD  +      IV+RV P R N
Sbjct  90   TDPNALVKLTVYDHDTFSMDDKMGDAEFEIGPYIEALKMD-LSGLPSGTIVSRVQPSRQN  148

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ES +V  +GKV Q++CLRL+NVE GE++IQ+QWI+LP GSK
Sbjct  149  CLAEESGIVWVEGKVVQNICLRLRNVECGELEIQLQWIDLP-GSK  192



>gb|EYU33973.1| hypothetical protein MIMGU_mgv1a014822mg [Erythranthe guttata]
Length=177

 Score =   216 bits (550),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 135/167 (81%), Gaps = 2/167 (1%)
 Frame = -1

Query  777  VEMDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTL  598
            V MD++LGLL++R+K+GINLAVRD RSSDPYV++KMGKQKL+T V++++VNPEWNEDLTL
Sbjct  11   VSMDNMLGLLRIRVKKGINLAVRDVRSSDPYVVIKMGKQKLKTRVIRKNVNPEWNEDLTL  70

Query  597  YVSDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGR  418
             ++DP+  I +TVYDHDTFS DDKMG AE DI+  +EA+KM      D   I+ ++ P R
Sbjct  71   SIADPNHTISLTVYDHDTFSLDDKMGVAEFDIRPFIEAIKMKLDGLPDGT-IITKIQPSR  129

Query  417  SNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            +NCL+ ES V+ K+GKV Q M LRLKNVE GEV+I++QWI++P GS+
Sbjct  130  TNCLSEESSVIWKEGKVVQGMMLRLKNVECGEVEIELQWIDIP-GSR  175



>ref|XP_004137503.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Cucumis sativus]
 ref|XP_004161839.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Cucumis sativus]
 gb|KGN64176.1| hypothetical protein Csa_1G042830 [Cucumis sativus]
Length=190

 Score =   216 bits (549),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 132/165 (80%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+SLLGLL+VRI RG+NLAVRD RSSDPY++VKM  QKL+T V+K+D+NPEWNEDLTL V
Sbjct  26   MESLLGLLRVRIIRGVNLAVRDVRSSDPYIVVKMSNQKLKTRVIKKDINPEWNEDLTLSV  85

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP+  +K+TVYDHDTFS DDKMG AE +I   +EALKMD  +      IV +V P R N
Sbjct  86   TDPNALVKLTVYDHDTFSMDDKMGDAEFEIGSYIEALKMD-LSGLPSGTIVTKVQPSRQN  144

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ES +V  +GKV Q++CLRL+NVE GE++IQ+QWI+LP GSK
Sbjct  145  CLAEESGIVWNEGKVVQNICLRLRNVECGELEIQLQWIDLP-GSK  188



>ref|XP_008464514.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X1 [Cucumis melo]
Length=276

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 134/165 (81%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+SLLGLL++RI RG+NLAVRD RSSDPY++VKM KQKL+T V+K+D+NPEWNEDLTL V
Sbjct  30   MESLLGLLRIRIIRGVNLAVRDVRSSDPYIVVKMSKQKLKTRVIKKDINPEWNEDLTLSV  89

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP+  +K+TVYDHDTFS DDKMG AE +I   +EALKMD  +      IV+RV P R N
Sbjct  90   TDPNALVKLTVYDHDTFSMDDKMGDAEFEIGPYIEALKMD-LSGLPSGTIVSRVQPSRQN  148

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ES +V  +GKV Q++CLRL+NVE GE++IQ+QWI+LP GSK
Sbjct  149  CLAEESGIVWVEGKVVQNICLRLRNVECGELEIQLQWIDLP-GSK  192



>ref|XP_009370093.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Pyrus x bretschneideri]
Length=165

 Score =   214 bits (546),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 131/165 (79%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+ LLGLL+VR+ RG NLAVRD RSSDPYV+VKMGKQKL+T V+K+ VNPEWNEDLTL V
Sbjct  1    MEHLLGLLRVRVVRGTNLAVRDIRSSDPYVVVKMGKQKLKTRVVKKTVNPEWNEDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DPSLPIK+ VYD DTFS DDKMG AE +I   ++AL++          I++R  P R N
Sbjct  61   ADPSLPIKLFVYDKDTFSLDDKMGDAEFEIGPFVQALRV-GLQGVPSGTIISRFQPSRQN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ESC+V  DG++ Q+MC+RL+NVESGE+++Q+QWI++P GS+
Sbjct  120  CLAEESCIVYTDGQIVQNMCIRLRNVESGELELQLQWIDVP-GSR  163



>ref|XP_010533970.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Tarenaya hassleriana]
Length=184

 Score =   215 bits (547),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 132/165 (80%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MDSLLGLL++R+ RG+NLAVRD RSSDPYV+VKMG+QKL+T V+ +DVNPEWNEDLTL V
Sbjct  20   MDSLLGLLRIRVIRGVNLAVRDVRSSDPYVVVKMGRQKLKTRVVYKDVNPEWNEDLTLSV  79

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP+L + +TVYDHDTFSKDDKMG AE +IK  +EAL+M    +     I+ R+ P R N
Sbjct  80   TDPNLNVLLTVYDHDTFSKDDKMGDAEFEIKSYVEALRM-QLEDLPSGTIITRITPSRHN  138

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ES +   DGK+ QD+ LRL++VE GEV++Q+QWI+LP GSK
Sbjct  139  CLADESHITWSDGKLVQDLFLRLRHVECGEVEVQLQWIDLP-GSK  182



>ref|XP_003619827.1| Multiple C2 and transmembrane domain-containing protein [Medicago 
truncatula]
 gb|AES76045.1| calcium-dependent ARF-type GTPase activating family protein [Medicago 
truncatula]
Length=177

 Score =   214 bits (546),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 131/174 (75%), Gaps = 2/174 (1%)
 Frame = -1

Query  798  SGSAGNKVEMDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPE  619
            S S   K  M++LLGLL+VR+KRG+NLAVRD RSSDPYV++KM  QKL+THV K++VNPE
Sbjct  4    SPSTSRKSLMENLLGLLRVRVKRGVNLAVRDVRSSDPYVVIKMYNQKLKTHVKKKNVNPE  63

Query  618  WNEDLTLYVSDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIV  439
            WNEDLTL V DP+ P+ +TVYDHDTFSKDDKMG A  D    +EAL+M N        ++
Sbjct  64   WNEDLTLSVIDPNHPVTLTVYDHDTFSKDDKMGDAVFDASTFIEALRM-NVTGLANGTVL  122

Query  438  ARVPPGRSNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
             R+PP + NCLA ESC+   +GK+ QDM LRL+NVE GEV+I + WI+LP GSK
Sbjct  123  KRIPPSKHNCLAEESCIYYSNGKIIQDMILRLQNVECGEVEITLHWIDLP-GSK  175



>gb|KHG03449.1| hypothetical protein F383_28229 [Gossypium arboreum]
Length=176

 Score =   214 bits (546),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 131/161 (81%), Gaps = 1/161 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MD L+GLL++ +KRGINLAVRD R+SDPYV+V+MG Q+L+T V+ +DVNP WNEDLTL +
Sbjct  4    MDELMGLLRIHVKRGINLAVRDVRTSDPYVVVRMGTQRLKTKVINKDVNPVWNEDLTLPI  63

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP  PIK+TV+D+DTFS DD+MG AE DI+  ++AL+MD  +  D   I+A+V P R N
Sbjct  64   TDPGEPIKLTVFDYDTFSMDDEMGDAEFDIQAFVQALRMDYADFPD-GTILAKVQPCRKN  122

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLP  289
            CLA ES VV+K+GKV QD+CLRL+NVE GEV++Q++WI +P
Sbjct  123  CLAEESVVVVKEGKVLQDLCLRLRNVECGEVELQLEWIEVP  163



>ref|XP_008381348.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Malus domestica]
Length=165

 Score =   214 bits (544),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 130/165 (79%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+ LLGLL+VR+ RG NLAVRD RSSDPYV+VKMGKQKL+T V+K+ VNPEWNEDLTL V
Sbjct  1    MEHLLGLLRVRVVRGTNLAVRDIRSSDPYVVVKMGKQKLKTRVVKKTVNPEWNEDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DPSLPIK+ VYD DTFS DDKMG AE +I   ++AL++          I++R  P R N
Sbjct  61   ADPSLPIKLFVYDKDTFSLDDKMGDAEFEIGPFVQALRV-GLQGVPXGTIISRFQPSRQN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ESC+V  DG+V Q+MC+RL+NVESGE+ +Q+QWI++P GS+
Sbjct  120  CLAEESCIVXTDGQVVQNMCIRLRNVESGELXLQLQWIDVP-GSR  163



>ref|XP_003525186.2| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Glycine max]
 gb|KHN10537.1| Putative ADP-ribosylation factor GTPase-activating protein AGD11 
[Glycine soja]
Length=165

 Score =   213 bits (543),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 127/165 (77%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+ LLGLL++ IKRG+NLAVRD  +SDPY +VKMGKQKL+T V+K+DVNPEW EDLTL V
Sbjct  1    MEDLLGLLRIHIKRGVNLAVRDVNTSDPYCVVKMGKQKLKTRVIKKDVNPEWKEDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP  P  +TVYDHDTFSKDDKMG AE DI   +EALKM N  +     I+ R+ P R N
Sbjct  61   TDPVHPFILTVYDHDTFSKDDKMGDAEFDISAYIEALKM-NLEDLPSGTIITRIQPSRQN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ESC+   +GK+ QD  LRL++VE GEV+IQ+QWI+LP GSK
Sbjct  120  CLAEESCITYSNGKIIQDAVLRLRHVECGEVEIQLQWIDLP-GSK  163



>emb|CDY51927.1| BnaAnng11040D [Brassica napus]
Length=177

 Score =   213 bits (542),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 131/174 (75%), Gaps = 2/174 (1%)
 Frame = -1

Query  798  SGSAGNKVEMDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPE  619
            +G A     MD LLGLL++RIKRG+NLAVRD  SSDPY++VKMGKQKL+T V+ +DVNPE
Sbjct  4    TGPARTSSLMDDLLGLLRIRIKRGVNLAVRDINSSDPYIVVKMGKQKLKTRVINKDVNPE  63

Query  618  WNEDLTLYVSDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIV  439
            WNEDLTL V+DPSL + +TVYDHD FSKDDKMG AE +IK  +EAL+M   +      IV
Sbjct  64   WNEDLTLSVTDPSLTVLLTVYDHDMFSKDDKMGDAEFEIKPYIEALRM-QLDGLPSGTIV  122

Query  438  ARVPPGRSNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
              V P R NCLA ES V   DGK+ QD+ LRL++VE GEV+ Q+QWI+LP GSK
Sbjct  123  TTVQPSRRNCLAEESKVTWIDGKLVQDLVLRLRHVECGEVEAQLQWIDLP-GSK  175



>emb|CDX75953.1| BnaC03g40360D [Brassica napus]
Length=177

 Score =   212 bits (540),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 131/174 (75%), Gaps = 2/174 (1%)
 Frame = -1

Query  798  SGSAGNKVEMDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPE  619
            +G A     MD LLGLL++RI+RG+NLAVRD  SSDPY++VKMGKQKL+T V+ +DVNPE
Sbjct  4    TGPARTSSLMDDLLGLLRIRIRRGVNLAVRDINSSDPYIVVKMGKQKLKTRVISKDVNPE  63

Query  618  WNEDLTLYVSDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIV  439
            WNEDLTL V+DPSL + +TVYDHD FSKDDKMG AE +IK  +EAL+M   +      IV
Sbjct  64   WNEDLTLSVTDPSLTVLLTVYDHDMFSKDDKMGDAEFEIKPYIEALRM-QLDGLLSGTIV  122

Query  438  ARVPPGRSNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
              V P R NCLA ES V   DGK+ QD+ LRL++VE GEV+ Q+QWI+LP GSK
Sbjct  123  TTVQPSRRNCLAEESKVTWIDGKLVQDLVLRLRHVECGEVEAQLQWIDLP-GSK  175



>ref|XP_002891444.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67703.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=170

 Score =   211 bits (538),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 130/165 (79%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MDSLLGLL++RIKRG+NLAVRD  SSDPYV+VKMGKQK++T V+ +DVNPEWNEDLTL V
Sbjct  6    MDSLLGLLRIRIKRGVNLAVRDLNSSDPYVVVKMGKQKMKTRVIYKDVNPEWNEDLTLSV  65

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            SDP+L + +TVYD+DTF+KDDKMG AE  IK  + ALKM  H+      IV  V P R N
Sbjct  66   SDPNLTVLLTVYDYDTFTKDDKMGDAEFVIKPFVNALKMHLHDLP-SGTIVTTVQPSRDN  124

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ES V+  DGK+ QD+ LRL++VE GEV+ Q+QWI+LP GSK
Sbjct  125  CLAEESRVIWSDGKLVQDIVLRLRHVECGEVEAQLQWIDLP-GSK  168



>ref|XP_004288398.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Fragaria vesca subsp. vesca]
Length=163

 Score =   211 bits (536),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 129/163 (79%), Gaps = 1/163 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL++ I+RG++LAVRD  SSDPY+IVKMGKQKL+T V+KR+VNPEWNE LTL V
Sbjct  1    MENLLGLLRIHIQRGVDLAVRDMTSSDPYIIVKMGKQKLKTRVVKRNVNPEWNEKLTLTV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            SDP++P+K+ VYD DTF+ DDKMG AE +I   ++ L+M       E  I+ARV P R N
Sbjct  61   SDPNIPVKLFVYDKDTFTFDDKMGDAEFEIATFVKVLQM-RLEGLPEGTIIARVQPTRQN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSG  283
            CLA ESC++  +GKV Q+M LRL+NVE GEV++Q+QWI++P G
Sbjct  120  CLAEESCIIWSNGKVVQNMVLRLRNVERGEVELQLQWIHVPKG  162



>ref|XP_006304555.1| hypothetical protein CARUB_v10011546mg [Capsella rubella]
 gb|EOA37453.1| hypothetical protein CARUB_v10011546mg [Capsella rubella]
Length=170

 Score =   211 bits (536),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 126/163 (77%), Gaps = 1/163 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MD+LLGLL++RIKRG+NLAVRD  SSDPYV+VKMGKQKL+T V+  +VNPEWNEDLTL V
Sbjct  6    MDNLLGLLRIRIKRGVNLAVRDLNSSDPYVVVKMGKQKLKTRVIYNNVNPEWNEDLTLSV  65

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DPSL + +TVYDHDTF+KDDKMG AE  IK  + A+KM  H+      IV  V P R N
Sbjct  66   TDPSLTVLLTVYDHDTFTKDDKMGDAEFKIKSFVNAVKMHLHDLP-SGTIVTTVQPSRDN  124

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSG  283
            CLA ES V+  DGK+ QD+ LRLK+VE GE++ Q+QWI+LP  
Sbjct  125  CLAEESRVIWTDGKLIQDLVLRLKHVECGEIEAQLQWIDLPRA  167



>ref|XP_004233475.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Solanum lycopersicum]
Length=166

 Score =   210 bits (535),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 132/165 (80%), Gaps = 1/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++ LGLL++RI RGINLA+RD RSSDPYV+V+MGKQKL+T V+K++VNPEWNEDLTL V
Sbjct  1    MENHLGLLRIRIIRGINLAIRDLRSSDPYVVVRMGKQKLKTRVVKKNVNPEWNEDLTLGV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            + P LPIK+ VYD DTFS+DDKMG AE+DI   ++A++M  + N     I++R+ P R N
Sbjct  61   AQPILPIKLQVYDKDTFSRDDKMGDAELDIVPFIDAVRMTRYKNIPNGVIISRIMPNRQN  120

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            C + ESC+V ++GKV Q+  LRL+NVE GE+ +Q+QWI++P GSK
Sbjct  121  CYSEESCIVYENGKVVQNAFLRLRNVERGEIQLQLQWIHIP-GSK  164



>ref|XP_006346891.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Solanum tuberosum]
Length=166

 Score =   210 bits (534),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 132/165 (80%), Gaps = 1/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++ LGLL++RI RGINLA+RD RSSDPYV+V+MGKQKL+T V+K++VNPEWN+DLTL V
Sbjct  1    MENQLGLLRIRIIRGINLAIRDLRSSDPYVVVRMGKQKLKTRVVKKNVNPEWNDDLTLCV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            + P LPIK+ VYD DTFS+DDKMG AEIDI   ++A++M  + N     I++R+ P R N
Sbjct  61   AQPILPIKLQVYDKDTFSRDDKMGDAEIDIIPFIDAVRMTRYKNIPNGVIISRIMPNRQN  120

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            C + ESC+V ++GKV Q+  LRL+NVE GE+ +Q+QWI++P GSK
Sbjct  121  CYSEESCIVYENGKVVQNAFLRLRNVERGEIQLQLQWIHIP-GSK  164



>ref|XP_010916494.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Elaeis guineensis]
Length=166

 Score =   209 bits (532),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 124/160 (78%), Gaps = 1/160 (1%)
 Frame = -1

Query  762  LLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYVSDP  583
            LLGLLKVR++RG+NLAVRD RSSDPYVI++MG+QKL+T  +KR+ NPEWNEDLTL V DP
Sbjct  5    LLGLLKVRVQRGVNLAVRDVRSSDPYVILQMGRQKLKTRTIKRNTNPEWNEDLTLSVEDP  64

Query  582  SLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSNCLA  403
            +LP+++ VYD DTFS DD MG AE DI+  LEA++M N        I+ +V P R NCLA
Sbjct  65   TLPVRLQVYDKDTFSSDDPMGNAEFDIQPFLEAVRM-NPEAVPNGTIITKVVPNRQNCLA  123

Query  402  AESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSG  283
             ES +   DGKVTQD+ LRL+NVE GEV++Q+QWI++P  
Sbjct  124  EESRIYWSDGKVTQDIVLRLRNVECGEVELQLQWISIPGA  163



>ref|XP_010263871.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X1 [Nelumbo nucifera]
Length=182

 Score =   210 bits (534),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 127/157 (81%), Gaps = 2/157 (1%)
 Frame = -1

Query  747  KVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYVSDPSLPIK  568
            ++ I RGINLAVRD  SSDPY+++KMGKQKL+T V+K+++NPEWNEDLTL V+DP LPIK
Sbjct  26   RIHIHRGINLAVRDVVSSDPYIVIKMGKQKLKTRVMKKNINPEWNEDLTLSVADPELPIK  85

Query  567  VTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSNCLAAESCV  388
            +TVYD D FS DDKMG A+IDIK  LEA+KM +  N     I+ RV P R NCLA ESC+
Sbjct  86   LTVYDKDKFSLDDKMGDADIDIKPFLEAVKM-HLVNLPSGTIIQRVQPNRQNCLAEESCI  144

Query  387  VIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            + +DGKV QDM LRLKNVESGEV++Q+QWI++P GS+
Sbjct  145  IWQDGKVVQDMYLRLKNVESGEVELQLQWIDIP-GSR  180



>ref|XP_010032690.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Eucalyptus grandis]
 ref|XP_010032691.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Eucalyptus grandis]
 gb|KCW52144.1| hypothetical protein EUGRSUZ_J01590 [Eucalyptus grandis]
Length=166

 Score =   209 bits (532),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 128/168 (76%), Gaps = 2/168 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+  LGLL++ + RG+NLA+RD RSSDPYV+++MGKQKL++ V+K++ NPEWN+DLTL +
Sbjct  1    MEHFLGLLRIHVHRGVNLAIRDVRSSDPYVVIRMGKQKLKSRVIKQNTNPEWNDDLTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP LP+KV VYD DTFS DDKMG AE  I   LEAL+    +      ++ARVPP R N
Sbjct  61   TDPGLPVKVLVYDKDTFSLDDKMGDAEFHIGPFLEALRAPT-DGVPNGTVIARVPPSREN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSKQQS  268
            CLA ESC+V  D KV QDM LRL+NVE GEV++Q+QWI++P GS+  S
Sbjct  120  CLAEESCIVWSDSKVVQDMVLRLRNVERGEVELQLQWIDVP-GSRGLS  166



>ref|XP_009145950.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Brassica rapa]
Length=172

 Score =   209 bits (532),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 130/165 (79%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL++RIKRG+NLAVRD  SSDPYV+VKMGKQKL+T V+ +DVNPEWNEDLTL V
Sbjct  8    MNNLLGLLRIRIKRGVNLAVRDINSSDPYVVVKMGKQKLKTRVINKDVNPEWNEDLTLSV  67

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP+L + +TVYDHD FSKDDKMG AE +IK  +EALKM + +      IV  V P R N
Sbjct  68   TDPTLTVLLTVYDHDMFSKDDKMGDAEFEIKPYIEALKM-HLDGLPSGTIVTTVQPCRRN  126

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ES V   DGK+ QD+ LRL++VE GEV+ Q+QWI+LP GSK
Sbjct  127  CLAEESKVTWVDGKLVQDLVLRLRHVECGEVEAQLQWIDLP-GSK  170



>ref|XP_006406667.1| hypothetical protein EUTSA_v10022004mg [Eutrema salsugineum]
 gb|ESQ48120.1| hypothetical protein EUTSA_v10022004mg [Eutrema salsugineum]
Length=177

 Score =   209 bits (531),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 130/174 (75%), Gaps = 2/174 (1%)
 Frame = -1

Query  798  SGSAGNKVEMDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPE  619
            +G A     MD LLGLL++RIKRG+NLAVRD  SSDPYV+VKMGKQKL+T V+ +DVNPE
Sbjct  4    AGPARTSSLMDDLLGLLRIRIKRGVNLAVRDINSSDPYVVVKMGKQKLKTRVINKDVNPE  63

Query  618  WNEDLTLYVSDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIV  439
            WNEDLTL V+D +L + +TVYDHD FSKDDKMG AE +IK  +EAL+M   +      IV
Sbjct  64   WNEDLTLSVTDSNLTVLLTVYDHDMFSKDDKMGDAEFEIKPYIEALRM-QLDGLPSGTIV  122

Query  438  ARVPPGRSNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
              V P R NCLA ES V   DGK+ QD+ LRL++VE GEV+ Q+QWI+LP GSK
Sbjct  123  TTVQPSRRNCLAEESRVTWVDGKLVQDLVLRLRHVECGEVEAQLQWIDLP-GSK  175



>ref|XP_006346892.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like isoform X1 [Solanum tuberosum]
Length=162

 Score =   208 bits (529),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 129/162 (80%), Gaps = 0/162 (0%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++ LGLL+VRI RGINLA+RD RSSDPYV+V MGKQKL+T V+K++VNPEWNEDLTL +
Sbjct  1    MENQLGLLRVRIIRGINLAIRDLRSSDPYVVVTMGKQKLKTRVVKKNVNPEWNEDLTLCI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            S+P LPIK+ VYD DTFS DDKMG AE+D+   ++A++M    N     I++R+ P R N
Sbjct  61   SEPILPIKLQVYDKDTFSYDDKMGDAELDVVPFIDAVRMTRFKNIPNGVILSRIMPNRQN  120

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPS  286
            C + ESC+V ++GKV Q++ LRL+NVE GE+ +Q+QWI++PS
Sbjct  121  CYSEESCIVYENGKVVQNVFLRLRNVECGEIQLQLQWIDVPS  162



>ref|XP_011099467.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Sesamum indicum]
Length=165

 Score =   207 bits (528),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 132/165 (80%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+++LGLL+++I RGI LAVRD RSSDPYVIV+MGKQKL+T V+K++VNPEWNE+LTL +
Sbjct  1    MENILGLLRIKILRGIKLAVRDTRSSDPYVIVRMGKQKLKTRVVKKNVNPEWNEELTLTI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            SDP+LPIK+ VYD DTF++DDKMG AE DIK  ++ LKM + +N     ++  V P R N
Sbjct  61   SDPNLPIKLQVYDRDTFTRDDKMGDAEFDIKEFVDVLKM-HLDNVPSGTVIKNVKPNREN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ES +V ++GKVTQ M LRL+NVE GE+++Q+ WI +P GS+
Sbjct  120  CLAEESSIVWENGKVTQHMFLRLRNVECGEIELQLHWIEVP-GSR  163



>ref|NP_175292.2| calcium-dependent lipid-binding family protein [Arabidopsis thaliana]
 gb|ACF88483.1| At1g48590 [Arabidopsis thaliana]
 gb|AEE32319.1| calcium-dependent lipid-binding family protein [Arabidopsis thaliana]
Length=169

 Score =   207 bits (528),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 126/161 (78%), Gaps = 1/161 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MDSLLGLL++RIKRG+NLAVRD  SSDPYV+VKM KQKL+T V+ ++VNPEWNEDLTL V
Sbjct  6    MDSLLGLLRIRIKRGVNLAVRDLNSSDPYVVVKMAKQKLKTRVIYKNVNPEWNEDLTLSV  65

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            SDP+L + +TVYD+DTF+KDDKMG AE  IK  + ALKM  H+      IV  V P R N
Sbjct  66   SDPNLTVLLTVYDYDTFTKDDKMGDAEFGIKPFVNALKMHLHDLP-SGTIVTTVQPSRDN  124

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLP  289
            CLA ES V+  DGK+ QD+ LRL++VE GEV+ Q+QWI+LP
Sbjct  125  CLAEESRVIWSDGKLVQDIVLRLRHVECGEVEAQLQWIDLP  165



>ref|XP_009135561.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X2 [Brassica rapa]
Length=177

 Score =   208 bits (529),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 130/174 (75%), Gaps = 2/174 (1%)
 Frame = -1

Query  798  SGSAGNKVEMDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPE  619
            +G A     MD LLGLL++RIKRG+NLAVRD  SSDPY++VKMGKQKL+T V+ +DVNPE
Sbjct  4    TGPARTSSLMDDLLGLLRIRIKRGVNLAVRDINSSDPYIVVKMGKQKLKTRVINKDVNPE  63

Query  618  WNEDLTLYVSDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIV  439
            WNEDLTL V+DPSL + +TVYDHD FSKDDKMG AE +IK  +EAL+M   +      IV
Sbjct  64   WNEDLTLSVTDPSLTVLLTVYDHDMFSKDDKMGDAEFEIKPYIEALRM-QLDGLPSGTIV  122

Query  438  ARVPPGRSNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            A V P R+NCLA ES V   DGK+ Q+  LRL++ E GEV+ Q+ WI+LP GSK
Sbjct  123  ATVHPSRANCLAEESRVTWIDGKLVQERVLRLRHAECGEVEAQLHWIDLP-GSK  175



>ref|XP_006383322.1| hypothetical protein POPTR_0005s14500g [Populus trichocarpa]
 gb|ERP61119.1| hypothetical protein POPTR_0005s14500g [Populus trichocarpa]
Length=165

 Score =   207 bits (528),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 133/165 (81%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL++ + RGI+LA+RD RSSDPYV+VKMGKQKL+T V+K+++NPEWN+DLTL V
Sbjct  1    MENLLGLLRIHVTRGIDLAIRDIRSSDPYVVVKMGKQKLKTRVIKQNINPEWNDDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
             DP+LP+ + VYD DTFS DDKMG AE DI+  +E +KM   +N     I++++ P R N
Sbjct  61   VDPNLPVLIKVYDKDTFSLDDKMGDAEFDIRQFIEVVKM-QLDNLPTGTIISKIQPSREN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ESC+V  +GKV Q+M LRL++VESGEV++Q++WI++P GS+
Sbjct  120  CLAEESCIVWANGKVIQNMFLRLRHVESGEVELQLEWIDIP-GSR  163



>ref|XP_004288393.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13-like [Fragaria vesca subsp. vesca]
Length=165

 Score =   207 bits (527),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 130/167 (78%), Gaps = 6/167 (4%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+ LLGLL++R++RG NLAVRD RSSDPYV+V MGKQKL+T V+K+ VNPEWNEDLTL +
Sbjct  1    MEHLLGLLRIRVQRGRNLAVRDVRSSDPYVVVNMGKQKLKTRVVKKSVNPEWNEDLTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKM--DNHNNSDEERIVARVPPGR  418
            SD S PI + VYD DTF++DDKMG AEI+I   LEA++M  D   N     + +RV P +
Sbjct  61   SDSSHPIHIAVYDKDTFTQDDKMGDAEIEIGPFLEAIRMRLDGVANG---MVASRVEPSK  117

Query  417  SNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
             NCLA +SC++  DG + Q+M +RL+NVESGEV++Q+QWIN+P GS+
Sbjct  118  ENCLAEQSCIIYSDGNIIQNMTVRLRNVESGEVELQLQWINIP-GSR  163



>ref|NP_001185174.1| calcium-dependent lipid-binding family protein [Arabidopsis thaliana]
 gb|AAF79703.1|AC020889_11 T1N15.21 [Arabidopsis thaliana]
 gb|AEE32320.1| calcium-dependent lipid-binding family protein [Arabidopsis thaliana]
Length=200

 Score =   208 bits (530),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 126/161 (78%), Gaps = 1/161 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MDSLLGLL++RIKRG+NLAVRD  SSDPYV+VKM KQKL+T V+ ++VNPEWNEDLTL V
Sbjct  37   MDSLLGLLRIRIKRGVNLAVRDLNSSDPYVVVKMAKQKLKTRVIYKNVNPEWNEDLTLSV  96

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            SDP+L + +TVYD+DTF+KDDKMG AE  IK  + ALKM  H+      IV  V P R N
Sbjct  97   SDPNLTVLLTVYDYDTFTKDDKMGDAEFGIKPFVNALKMHLHDLPSGT-IVTTVQPSRDN  155

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLP  289
            CLA ES V+  DGK+ QD+ LRL++VE GEV+ Q+QWI+LP
Sbjct  156  CLAEESRVIWSDGKLVQDIVLRLRHVECGEVEAQLQWIDLP  196



>ref|XP_004288396.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Fragaria vesca subsp. vesca]
Length=165

 Score =   207 bits (526),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 128/163 (79%), Gaps = 1/163 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+++LGLL++ I+RG+NLAVRD RSSDPYVIVKM KQKL+T V+K+ VNPEWNE LTL +
Sbjct  1    MENMLGLLRIHIQRGVNLAVRDMRSSDPYVIVKMSKQKLKTRVVKKSVNPEWNEQLTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
             DPSLPI V+VYD DTFS DDKMG A+ +I   ++A+KM N  +  +  I+++V   + N
Sbjct  61   VDPSLPILVSVYDKDTFSFDDKMGDAQFEIGPFIKAMKM-NFQDLQDGAIISKVQANKQN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSG  283
            CLA ESC++   GK+ Q+M LRLKNVE GEV++Q+QWI++PS 
Sbjct  120  CLAEESCIIYSKGKLVQNMVLRLKNVECGEVELQLQWIDIPSS  162



>ref|NP_188425.2| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
 ref|XP_002883099.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 pdb|4V29|A Chain A, The Crystal Structure Of Arabidopsis Thaliana Car4 In 
Complex With Two Calcium Ions
 pdb|4V29|B Chain B, The Crystal Structure Of Arabidopsis Thaliana Car4 In 
Complex With Two Calcium Ions
 dbj|BAB02719.1| GTPase activating protein-like [Arabidopsis thaliana]
 gb|AAY17416.1| At3g17980 [Arabidopsis thaliana]
 gb|ABR46206.1| At3g17980 [Arabidopsis thaliana]
 gb|EFH59358.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|AEE76031.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
Length=177

 Score =   207 bits (527),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 127/165 (77%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MD LLGLL++RIKRG+NLAVRD  SSDPYV+VKMGKQKL+T V+ +DVNPEWNEDLTL V
Sbjct  13   MDDLLGLLRIRIKRGVNLAVRDISSSDPYVVVKMGKQKLKTRVINKDVNPEWNEDLTLSV  72

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +D +L + +TVYDHD FSKDDKMG AE +IK  +EAL+M   +      IV  V P R N
Sbjct  73   TDSNLTVLLTVYDHDMFSKDDKMGDAEFEIKPYIEALRM-QLDGLPSGTIVTTVKPSRRN  131

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ES V   DGK+ QD+ LRL++VE GEV+ Q+QWI+LP GSK
Sbjct  132  CLAEESRVTWVDGKLVQDLVLRLRHVECGEVEAQLQWIDLP-GSK  175



>ref|XP_007215077.1| hypothetical protein PRUPE_ppa012537mg [Prunus persica]
 gb|EMJ16276.1| hypothetical protein PRUPE_ppa012537mg [Prunus persica]
Length=165

 Score =   207 bits (526),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/162 (60%), Positives = 129/162 (80%), Gaps = 1/162 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++L+GLL++ I+RG+NLAVRD RSSDPYV++KMGKQKL+T V+KR+VNPEW+E LTL V
Sbjct  1    MENLMGLLRIHIQRGVNLAVRDMRSSDPYVVIKMGKQKLKTRVVKRNVNPEWDESLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +D +LPI V VYD DTFS DDKMG AE +I   + ALKM +   +D   I+ RV P R N
Sbjct  61   ADANLPIMVCVYDKDTFSFDDKMGDAEFEIGSFITALKMRSEGLTDGT-IIDRVKPNREN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPS  286
            CLA ESC++  +GK+ Q++ LRL+NVE GEV++Q+QWI++PS
Sbjct  120  CLAEESCIIWSNGKLVQNLVLRLRNVECGEVELQLQWIDVPS  161



>ref|XP_007217177.1| hypothetical protein PRUPE_ppa012484mg [Prunus persica]
 gb|EMJ18376.1| hypothetical protein PRUPE_ppa012484mg [Prunus persica]
Length=167

 Score =   207 bits (526),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 131/167 (78%), Gaps = 4/167 (2%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRD--ARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTL  598
            M+ LLGLL+VR+++G+NLA+RD  AR+SDPYV++KMGKQKL+T V+K   NPEWNEDLTL
Sbjct  1    MEHLLGLLRVRVQKGVNLAIRDVTARTSDPYVVIKMGKQKLKTRVVKNSTNPEWNEDLTL  60

Query  597  YVSDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGR  418
             ++DP+LP+ + VYD DTF+ DDKMG AE +I   LEAL+M          +++RV P R
Sbjct  61   SIADPTLPVNIHVYDKDTFTLDDKMGDAEFEIGPFLEALRM-RVQGVPSGTVLSRVQPSR  119

Query  417  SNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
             NCLA ESC++  DG+V Q+MC+RL+NVE GE+++Q+QWI++P GS+
Sbjct  120  QNCLAEESCIIYTDGQVVQNMCIRLRNVERGELELQLQWIDIP-GSR  165



>ref|XP_010461749.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Camelina sativa]
Length=165

 Score =   207 bits (526),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 129/165 (78%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL++RIKRG+NLAVRD  SSDPYV+VKMGKQKL+T V+  +VNPEWNEDLTL V
Sbjct  1    MNNLLGLLRIRIKRGVNLAVRDLHSSDPYVVVKMGKQKLKTRVIYHNVNPEWNEDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP+L + +TVYDHDTF+KDDKMG AE  IK  + A+KM  H+      IV  V P R N
Sbjct  61   TDPNLTVLLTVYDHDTFTKDDKMGDAEFMIKPFVNAVKMQLHDLP-SGTIVTTVQPSRDN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ES V+  DGK+ QD+ LRL++VE GE++ Q+QWI+LP GSK
Sbjct  120  CLAEESRVIWSDGKLIQDLVLRLRHVECGEIEAQLQWIDLP-GSK  163



>ref|XP_010670143.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Beta vulgaris subsp. vulgaris]
Length=173

 Score =   207 bits (526),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 129/158 (82%), Gaps = 1/158 (1%)
 Frame = -1

Query  759  LGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYVSDPS  580
            +GLL++R+ RGINLAVRD +SSDPYVIV++GKQKL+T ++K+ +NPEWNEDLTL V DP+
Sbjct  13   MGLLRIRVIRGINLAVRDVKSSDPYVIVRLGKQKLKTRIIKKSLNPEWNEDLTLCVMDPN  72

Query  579  LPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSNCLAA  400
             P+++ VYDHDTFS DDKMG AE D++  L+A+K  N   + +  ++ ++ P R NC+A 
Sbjct  73   EPVRLFVYDHDTFSLDDKMGDAEFDMRPFLDAVK-SNSQGAPDGTVIRKLIPDRQNCIAE  131

Query  399  ESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPS  286
            ESC+V KDGKVTQ+M LRL+NVE GE+++Q+QWI+LPS
Sbjct  132  ESCIVWKDGKVTQNMFLRLRNVECGEIELQLQWIDLPS  169



>ref|XP_011073630.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Sesamum indicum]
Length=165

 Score =   206 bits (525),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 132/165 (80%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL++ + RGINLA RDA SSDPYVIV+MGKQKL+T V+K++VNPEWNE+LTL +
Sbjct  1    MENLLGLLRINVLRGINLAKRDATSSDPYVIVRMGKQKLKTRVVKKNVNPEWNEELTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP+LP+K+ VYD DTFS DDKMG AE DIK  LEALKM +  +     I+ +V P R N
Sbjct  61   ADPNLPVKLQVYDKDTFSLDDKMGDAEFDIKSFLEALKM-HLEDVPSGTIITKVKPTREN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CL+ ES +V ++GKV Q M LRL+NVE GE+++Q+QWI++P GS+
Sbjct  120  CLSEESTIVWENGKVIQRMFLRLRNVECGEIELQLQWIDVP-GSR  163



>ref|XP_010032686.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Eucalyptus grandis]
 gb|KCW52141.1| hypothetical protein EUGRSUZ_J01587 [Eucalyptus grandis]
Length=167

 Score =   206 bits (524),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 124/159 (78%), Gaps = 1/159 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MD  LGLL++ I RGINLAVRD RSSDPYV+V+MGKQKLRT V+++++NPEWNE+LTL V
Sbjct  1    MDDTLGLLRIHISRGINLAVRDVRSSDPYVVVRMGKQKLRTRVVRKNLNPEWNENLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEE-RIVARVPPGRS  415
            +DP LP+K+ VYD D FS DDKMG AE DI+ LLEA++M       E+  +V RV P R 
Sbjct  61   ADPDLPVKLAVYDRDRFSLDDKMGDAEFDIRPLLEAVRMAADLQGLEDGTVVKRVLPNRQ  120

Query  414  NCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWI  298
            NCLA ESC+++ +GKV Q M LRL+NVE GE+ +Q+QW+
Sbjct  121  NCLAEESCIIVSNGKVVQHMFLRLRNVECGEIQLQLQWV  159



>ref|XP_009381108.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X2 [Musa acuminata subsp. malaccensis]
Length=162

 Score =   206 bits (523),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 124/161 (77%), Gaps = 1/161 (1%)
 Frame = -1

Query  762  LLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYVSDP  583
            +LGLLKVR+ RG+NLAVRD RSSDPYVI+KMGKQKL+T V+KR+ NP WNE+LTL V DP
Sbjct  1    MLGLLKVRVLRGVNLAVRDLRSSDPYVILKMGKQKLKTRVIKRNTNPIWNEELTLSVEDP  60

Query  582  SLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSNCLA  403
            +LP+++ VYD DTFS DD MG AE DI+  +EA++M N        ++ +V PGR NCLA
Sbjct  61   ALPVRLEVYDKDTFSLDDPMGNAEFDIRPFVEAVRM-NLQGVPNGTMITKVAPGRQNCLA  119

Query  402  AESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGS  280
             ES +   DGKV QD+ LRLK+VE GEV++Q+QW+++P  S
Sbjct  120  DESAIYWSDGKVLQDLVLRLKDVERGEVELQLQWVSIPGAS  160



>ref|XP_011021393.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Populus euphratica]
Length=165

 Score =   206 bits (523),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 129/161 (80%), Gaps = 1/161 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL++ + RGI+LA+RD RSSDPYV+VKMGKQKL+T V+K+++NPEWN+DLTL V
Sbjct  1    MENLLGLLRIHVTRGIDLAIRDIRSSDPYVVVKMGKQKLKTRVIKQNINPEWNDDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
             DP+LP+ + VYD DTFS DDKMG AE DI+  +E +KM   +N     I+ ++ P R N
Sbjct  61   VDPNLPVLIKVYDKDTFSLDDKMGDAEFDIRQFIEVVKM-QLDNLPSGTIIRKIQPTREN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLP  289
            CLA ESC+V  +GKV Q+M LRL++VESGEV++Q++WI++P
Sbjct  120  CLAEESCIVWANGKVIQNMFLRLRHVESGEVELQLEWIDIP  160



>ref|XP_006299051.1| hypothetical protein CARUB_v10015190mg [Capsella rubella]
 gb|EOA31949.1| hypothetical protein CARUB_v10015190mg [Capsella rubella]
Length=177

 Score =   206 bits (524),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 129/174 (74%), Gaps = 2/174 (1%)
 Frame = -1

Query  798  SGSAGNKVEMDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPE  619
            +G A     MD LLGLL++RIKRG+NLAVRD  SSDPYV+VKMGKQKL+T V+ +DVNPE
Sbjct  4    AGPARTSSLMDDLLGLLRIRIKRGVNLAVRDISSSDPYVVVKMGKQKLKTRVINKDVNPE  63

Query  618  WNEDLTLYVSDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIV  439
            WNEDLTL V+D +L + +TVYDHD FSKDDKMG AE +IK  +EAL+M   +      I+
Sbjct  64   WNEDLTLSVTDSNLTVLLTVYDHDMFSKDDKMGDAEFEIKPYIEALRM-QLDGLPSGTII  122

Query  438  ARVPPGRSNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
              V P R NCLA  S V   DGK+ QD+ LRL++VE GEV+ Q+QWI+LP GSK
Sbjct  123  TTVQPSRHNCLAEASRVTWVDGKLVQDLVLRLRHVECGEVEAQLQWIDLP-GSK  175



>ref|XP_004512742.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13-like [Cicer arietinum]
Length=176

 Score =   206 bits (524),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 127/165 (77%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL++R+KRG+NLAVRD RSSDPY+++KM  QKL+T V+K+DVNPEWNEDLTL +
Sbjct  12   MENLLGLLRIRVKRGVNLAVRDVRSSDPYLVIKMYNQKLKTRVIKKDVNPEWNEDLTLSI  71

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
             DP+  + +TVYDHDTFSKDDKMG A+ DI   +EAL+M N        ++ R+ P   N
Sbjct  72   IDPNHQVSLTVYDHDTFSKDDKMGDADFDISAYIEALRM-NVTGLANGTVLKRIQPSNQN  130

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ESC+   +GK+ QDM LRL+NVE GEV+I + WI+LP GSK
Sbjct  131  CLADESCIYYTNGKIIQDMILRLQNVECGEVEISLHWIDLP-GSK  174



>ref|XP_004145835.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Cucumis sativus]
 gb|KGN57815.1| hypothetical protein Csa_3G316280 [Cucumis sativus]
Length=165

 Score =   206 bits (523),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 129/165 (78%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++L+GLL++ + RG+NLAVRD  SSDPYVI KMGKQKL+T V+K+++NPEWNEDLTL +
Sbjct  1    MENLMGLLRIHVFRGVNLAVRDVSSSDPYVIFKMGKQKLKTRVVKQNINPEWNEDLTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
             DPSLP+ V VYD D FS DDKMG AE D++  +EA+KM   NN     I+ ++ P R N
Sbjct  61   QDPSLPVNVLVYDKDLFSLDDKMGDAEFDVRPFVEAVKM-RLNNLPSGTIIRKIQPSREN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CL+ ESC++  +G+V Q M LRL+NVESGE+++Q+QWI++P GS+
Sbjct  120  CLSEESCIIWVNGQVIQKMFLRLRNVESGEIELQLQWIDIP-GSR  163



>ref|XP_008229191.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Prunus mume]
Length=167

 Score =   206 bits (523),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 131/167 (78%), Gaps = 4/167 (2%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRD--ARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTL  598
            M+ LLGLL+VR++RG NLA+RD  AR+SDPYV++KMGKQKL+T V+K+  NPEWNEDLTL
Sbjct  1    MEHLLGLLRVRVQRGANLAIRDVTARTSDPYVVIKMGKQKLKTRVVKKSTNPEWNEDLTL  60

Query  597  YVSDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGR  418
             ++DP+LP+ + VYD DTF+ DDKMG AE +I   LEAL++          +++RV P R
Sbjct  61   SIADPTLPVNIHVYDKDTFTLDDKMGDAEFEIGPFLEALRV-RVQGVPSGTVLSRVQPNR  119

Query  417  SNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
             NCLA ESC++  DG+V Q+MC+RL+NVE GE+++Q+QWI++P GS+
Sbjct  120  QNCLAEESCIIYTDGQVVQNMCIRLRNVERGELELQLQWIDIP-GSR  165



>gb|AFK33467.1| unknown [Lotus japonicus]
Length=165

 Score =   205 bits (522),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 126/165 (76%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL+VR+KRG+NLAVRD RSSDPYV+VKM  QKL+T V+K+DVNPEWNEDLTL V
Sbjct  1    MENLLGLLRVRVKRGVNLAVRDVRSSDPYVVVKMYNQKLKTRVIKKDVNPEWNEDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
             DP   + +TVYDHDTFSKDDKMG AE +I   +EALKM N        ++ R+ P + N
Sbjct  61   IDPHHSVLLTVYDHDTFSKDDKMGDAEFEIFPYIEALKM-NVTGLPNGTVIKRIQPSKEN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ESC+    GK+ QDM LRL++VE GEV+I + WI+LP GSK
Sbjct  120  CLADESCIYYNSGKIIQDMILRLRHVECGEVEISLHWIDLP-GSK  163



>ref|XP_004233474.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Solanum lycopersicum]
Length=166

 Score =   205 bits (522),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 127/163 (78%), Gaps = 0/163 (0%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++ LGLL+VRI RGINLA+RD RSSDPYV+V MGKQKL+T V+K++VNPEWNEDLTL +
Sbjct  1    MENQLGLLRVRIIRGINLAIRDLRSSDPYVVVTMGKQKLKTRVVKKNVNPEWNEDLTLCI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            ++P LPIK+ VYD DTFS DDKMG AE+DI   ++A+ M    N     I++R+ P R N
Sbjct  61   TEPILPIKLQVYDKDTFSYDDKMGDAELDIVPFIDAVTMTRFKNIPNGVIISRIMPSRQN  120

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSG  283
            C + ES +V +DGKV Q+  LRL+NVE GE+++Q+QWI++PS 
Sbjct  121  CYSEESRIVYEDGKVVQNAFLRLRNVECGEIELQLQWIDVPSS  163



>ref|XP_010066605.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Eucalyptus grandis]
Length=166

 Score =   205 bits (521),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 130/166 (78%), Gaps = 1/166 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+++ GLLK+R+KRGINL VRD+ SSDPYV+V M  QKL+T V+K + NPEWN++LTL +
Sbjct  1    MENVKGLLKIRVKRGINLVVRDSLSSDPYVVVSMADQKLKTRVVKNNCNPEWNDELTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DPS+PI +TVYD DTF+ DDKMG A+IDIK  L+A++M    N      +ARV P ++N
Sbjct  61   TDPSIPICLTVYDKDTFTVDDKMGEAKIDIKPYLDAIEM-RLQNLPTPTTIARVQPSKTN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSKQ  274
            CLA ESC+V KDGK+ QDM LRL NVE+GEV++Q++WI+L  GS+ 
Sbjct  120  CLADESCIVWKDGKIYQDMMLRLANVETGEVEVQLEWIDLSGGSRH  165



>gb|KDP33163.1| hypothetical protein JCGZ_13428 [Jatropha curcas]
Length=165

 Score =   204 bits (520),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 128/161 (80%), Gaps = 1/161 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+++LGLL++ + RGINLAVRD  SSDPYV+VKMGKQKL+T V+K++VNPEWNEDLTL +
Sbjct  1    MENILGLLRIHVHRGINLAVRDVMSSDPYVVVKMGKQKLKTRVVKQNVNPEWNEDLTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
             +P+LPIK+ VYD DTFS+DDKMG AE DI+  LEA+KM    +     I+ R+ P R N
Sbjct  61   ENPNLPIKIVVYDKDTFSRDDKMGDAEFDIRPFLEAVKM-RLEDLPSGTIITRIQPNRQN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLP  289
            CLA ES ++  +GKV Q++ LRL+NVE GEV++Q+QWI++P
Sbjct  120  CLADESQIIWVEGKVIQNIILRLRNVECGEVELQLQWIDVP  160



>ref|XP_010032689.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Eucalyptus grandis]
 gb|KCW52143.1| hypothetical protein EUGRSUZ_J01589 [Eucalyptus grandis]
Length=165

 Score =   204 bits (520),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 129/165 (78%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+ LLGLL++ + RG+NLA+RD RSSDPY +++MGK KL+T V+KR++NPEWN+DLTL +
Sbjct  1    MEHLLGLLRIHVLRGVNLAIRDIRSSDPYAVIRMGKHKLKTRVVKRNLNPEWNDDLTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DPSL IK+ VYD D FS DDKMG AEI I   L+ L+M   ++     ++ RV PGR N
Sbjct  61   ADPSLSIKLMVYDKDNFSLDDKMGDAEIHIAPFLDTLRM-RLDDVPSGTVITRVKPGRDN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ESC+V +DGKV QDM LRL+NVE GEV++Q++WI++P GS+
Sbjct  120  CLAEESCIVWRDGKVVQDMVLRLRNVEHGEVELQLEWIDIP-GSR  163



>ref|XP_008353839.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Malus domestica]
Length=165

 Score =   204 bits (520),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 129/162 (80%), Gaps = 1/162 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++++GLL++ ++RG+NLAVRD +SSDPYV+VKMGKQKL+T V+KR+VNPEW+E LTL V
Sbjct  1    MENMMGLLRIHVQRGVNLAVRDMKSSDPYVVVKMGKQKLKTRVVKRNVNPEWDERLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            ++PSLPI ++VYD DTFS DDKMG AE DI   ++ L+M      D   ++ +V P R N
Sbjct  61   TEPSLPITLSVYDKDTFSFDDKMGDAEFDIALFIQVLRMRLEGLPDGT-VITKVQPSREN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPS  286
            CLA ESC++  +GK+ Q+M LRL+NVE GE+++Q+QWI++PS
Sbjct  120  CLAEESCIIWSNGKLVQNMILRLRNVECGEIELQLQWIDVPS  161



>ref|XP_010461682.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Camelina sativa]
Length=165

 Score =   204 bits (520),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 128/165 (78%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL++RIKRG+NLAVRD  SSDPYV+VKMGKQKL+T V+  +VNPEWNEDLTL V
Sbjct  1    MNNLLGLLRIRIKRGVNLAVRDLNSSDPYVVVKMGKQKLKTRVIYHNVNPEWNEDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP+L + +TVYDHDTF+KDDKMG AE  IK  + A+KM  H +     IV  V   R N
Sbjct  61   TDPNLTVLLTVYDHDTFTKDDKMGDAEFTIKPFVNAVKMQLH-DLPSGTIVTTVQSSRDN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ES V+  DGK+ QD+ LRL++VE GE++ Q+QWI+LP GSK
Sbjct  120  CLAEESRVIWSDGKLIQDLVLRLRHVECGEIEAQLQWIDLP-GSK  163



>ref|XP_009793873.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Nicotiana sylvestris]
Length=166

 Score =   204 bits (520),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 132/165 (80%), Gaps = 1/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++ LGLL++RI RGINLA+RD RSSDPYVIV+MG+QKL+T V+K++VNPEWN+DLTL +
Sbjct  1    MENQLGLLRIRIIRGINLAIRDFRSSDPYVIVRMGRQKLKTRVVKKNVNPEWNDDLTLCI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            ++P LPIK+ VYD DTFS+DDKMGYAE+DI   + A++     N  +  I+ ++ P R N
Sbjct  61   AEPILPIKLQVYDKDTFSRDDKMGYAELDIVPFINAVRTKRVKNIPDGTIITKIIPSRQN  120

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            C + ESC+V ++GKV Q++ LRL+NVE GE+++++ WI++P GSK
Sbjct  121  CYSEESCIVYENGKVVQNVFLRLRNVECGEIELRLHWIDIP-GSK  164



>ref|XP_004503138.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Cicer arietinum]
Length=167

 Score =   204 bits (519),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 128/165 (78%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLLK+ ++RG+NLA+RD  SSDPYV++KMGKQKL+T V+K+++NPEWNEDLTL +
Sbjct  3    MENLLGLLKIHVQRGVNLAIRDVVSSDPYVVIKMGKQKLKTRVVKKNLNPEWNEDLTLSI  62

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            SDP  PI + VYD D FS DDKMG AE DI   +EA+KM        E IV +V P R N
Sbjct  63   SDPRTPISLHVYDKDMFSMDDKMGDAEFDIGPFVEAVKM-RLEGLPNETIVTKVQPCRKN  121

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ES +V+KDGK  Q+M LRL+NVESGEV++Q+ WI++P GSK
Sbjct  122  CLAEESHIVLKDGKYFQNMVLRLRNVESGEVELQLNWIDIP-GSK  165



>ref|XP_009107346.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Brassica rapa]
 emb|CDY16452.1| BnaA08g03150D [Brassica napus]
Length=170

 Score =   204 bits (520),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 129/165 (78%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+SLLGLL++R+KRG+NLAVRD  SSDPYV+VKMGKQKL+T V+  DVNPEWNEDLTL V
Sbjct  6    MESLLGLLRIRVKRGVNLAVRDLNSSDPYVVVKMGKQKLKTRVIYNDVNPEWNEDLTLSV  65

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DPSL + +TVYDHDTF+KDDKMG AE +IK  + AL M +  +     IV  V P R N
Sbjct  66   TDPSLKVLLTVYDHDTFTKDDKMGDAEFEIKPYINALTM-HLQDLPCGTIVTTVQPSRDN  124

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA  S ++  DGK+ QD+ LRLK+VE GEV++Q++WI+LP GSK
Sbjct  125  CLAEGSRIIWSDGKLVQDIVLRLKHVECGEVEVQLKWIDLP-GSK  168



>emb|CDX82060.1| BnaC02g22300D [Brassica napus]
Length=168

 Score =   204 bits (519),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 131/165 (79%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MD+LLG+L+VR+KRG+NLAVRD  SSDPYV++K+G+QKL+T V+K++VNP+W EDLT  V
Sbjct  4    MDNLLGILRVRVKRGVNLAVRDVSSSDPYVVLKLGRQKLKTKVVKKNVNPQWEEDLTFTV  63

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP+LP+ + VYDHD FSKDDKMG AEID+K  +EAL+M+     D   I++ + P RSN
Sbjct  64   TDPNLPLNLVVYDHDFFSKDDKMGDAEIDLKPYIEALRMELSGLPDGT-IISTIHPNRSN  122

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ES +   + ++ Q  CLRL+NVE GEV++++QWI+LP GSK
Sbjct  123  CLAEESYIRWSNDRIVQSFCLRLRNVERGEVELELQWIDLP-GSK  166



>ref|XP_004160109.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Cucumis sativus]
Length=165

 Score =   204 bits (519),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 128/165 (78%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++L+GLL + + RG+NLAVRD  SSDPYVI KMGKQKL+T V+K+++NPEWNEDLTL +
Sbjct  1    MENLMGLLGIHVFRGVNLAVRDVSSSDPYVIFKMGKQKLKTRVVKQNINPEWNEDLTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
             DPSLP+ V VYD D FS DDKMG AE D++  +EA+KM   NN     I+ ++ P R N
Sbjct  61   QDPSLPVNVLVYDKDLFSLDDKMGDAEFDVRPFVEAVKM-RLNNLPSGTIIRKIQPSREN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CL+ ESC++  +G+V Q M LRL+NVESGE+++Q+QWI++P GS+
Sbjct  120  CLSEESCIIWVNGQVIQKMFLRLRNVESGEIELQLQWIDIP-GSR  163



>ref|XP_007160540.1| hypothetical protein PHAVU_002G330200g [Phaseolus vulgaris]
 gb|ESW32534.1| hypothetical protein PHAVU_002G330200g [Phaseolus vulgaris]
Length=166

 Score =   204 bits (519),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 129/163 (79%), Gaps = 1/163 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MD LLGLL++ +KRG++LA+RD  +SDPYV+VKM KQKL+T V+K+D+NPEWNEDLT  V
Sbjct  1    MDGLLGLLRIHVKRGVDLAIRDVSTSDPYVVVKMDKQKLKTSVIKKDINPEWNEDLTFSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DPS P+ +TVYDHDTFS DDKMG AE DI   +EA+KM+  ++     I+ R+ P R+N
Sbjct  61   TDPSCPLIMTVYDHDTFSMDDKMGDAEFDISPYIEAVKMEV-DDLPNGTIITRMLPCRTN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSG  283
            CLA ESCVV ++GK+ Q++ LRL++VE GE++ Q++WI+LP  
Sbjct  120  CLAEESCVVYENGKILQNVVLRLRHVECGELEFQLEWISLPGA  162



>gb|KHG02007.1| hypothetical protein F383_24715 [Gossypium arboreum]
Length=165

 Score =   204 bits (519),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 132/165 (80%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL++ ++RG+NLAVRD  +SDPYV+++MGKQKL+T V+K++VNPEWN+DLTL +
Sbjct  1    MENLLGLLRIHVQRGVNLAVRDVLTSDPYVVIRMGKQKLKTRVIKKNVNPEWNDDLTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +D SLP+K+TVYD DTFS DDKMG AE +I  L+ A+KM          I+ +V P R N
Sbjct  61   ADLSLPVKLTVYDRDTFSLDDKMGDAEFEIGPLVNAVKM-RLEGLPNGTIITKVQPSREN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CL+ ESC++  +GKV QDM LRL+NVE+GEVD+Q++WI++P GS+
Sbjct  120  CLSQESCIIWNNGKVVQDMFLRLRNVETGEVDLQLEWIHVP-GSR  163



>ref|XP_010506220.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Camelina sativa]
 ref|XP_010487708.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Camelina sativa]
Length=177

 Score =   204 bits (519),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 127/165 (77%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MD LLGLL++RIKRG+NLAVRD  SSDPYV+VKMGKQKL+T V+ +DVNPEWNEDLTL V
Sbjct  13   MDDLLGLLRIRIKRGVNLAVRDISSSDPYVVVKMGKQKLKTRVINKDVNPEWNEDLTLSV  72

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +D +L + +TVYDHD FSKDDKMG AE +IK  ++AL+M   +      IV  V P R N
Sbjct  73   TDSNLNVLLTVYDHDMFSKDDKMGDAEFEIKPYIQALRM-QLDGLPSGTIVTTVQPSRHN  131

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA +S V   DGK+ QD+ LRL++VE GEV+ Q+QWI+LP GSK
Sbjct  132  CLAEQSQVTWVDGKLVQDLVLRLRHVECGEVEAQLQWIDLP-GSK  175



>ref|XP_006390540.1| hypothetical protein EUTSA_v10019153mg [Eutrema salsugineum]
 gb|ESQ27826.1| hypothetical protein EUTSA_v10019153mg [Eutrema salsugineum]
Length=201

 Score =   205 bits (521),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 131/165 (79%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MD+LLG+L+VR+KRG+NLAVRD  SSDPYV++K+G+QKL+T V+K++VNP+W EDLT  V
Sbjct  37   MDNLLGILRVRVKRGVNLAVRDVSSSDPYVVLKLGRQKLKTRVVKKNVNPQWEEDLTFTV  96

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP+LP+ + VYDHD FSKDDKMG AEID+   +EAL+M+     D   I+  + P RSN
Sbjct  97   TDPNLPLNLVVYDHDFFSKDDKMGDAEIDLNPYIEALRMELSGLPDGT-IITTIHPSRSN  155

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ES +   + ++ Q++CLRL+NVE GEV+I++QWI+LP GSK
Sbjct  156  CLAEESFIRWSNDRIVQNICLRLRNVERGEVEIELQWIDLP-GSK  199



>ref|XP_008457050.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Cucumis melo]
Length=165

 Score =   204 bits (518),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 129/165 (78%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++L+GLL++ + RG+NLAVRD  SSDPYVI KMGKQKL+T V+K+++NPEWNEDLTL +
Sbjct  1    MENLMGLLRIHVFRGVNLAVRDVCSSDPYVIFKMGKQKLKTRVVKQNINPEWNEDLTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
             DPSLP+ V VYD D FS DDKMG AE D++  +EA+KM   NN     I+ ++ P R N
Sbjct  61   QDPSLPVNVLVYDKDLFSLDDKMGDAEFDVRPFVEAVKM-RLNNLPSGTIIRKIQPSREN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CL+ ESC++  +G+V Q M LRL+NVESGE+++Q+QWI++P GS+
Sbjct  120  CLSEESCIIWVNGQVIQKMFLRLRNVESGEIELQLQWIDIP-GSR  163



>gb|ACJ83963.1| unknown [Medicago truncatula]
 gb|AFK42924.1| unknown [Medicago truncatula]
 gb|KEH34667.1| calcium-dependent lipid-binding (CaLB domain) family protein 
[Medicago truncatula]
Length=165

 Score =   204 bits (518),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 126/165 (76%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLLK+ ++RG+NLA+RD  SSDPYV++KM KQKL+T V+K+++NPEWNEDLTL +
Sbjct  1    MENLLGLLKIHVQRGVNLAIRDVVSSDPYVVIKMAKQKLKTRVVKKNLNPEWNEDLTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            SDP  PI + VYD DTFS DDKMG AE DI    EA+KM        E IV RV P R N
Sbjct  61   SDPHTPIHLYVYDKDTFSLDDKMGDAEFDIGPFFEAVKM-RLAGLPNEAIVTRVQPSRQN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ES +V KDGK+ Q+M LRL+NVE GEV++Q+ W+++P GSK
Sbjct  120  CLAEESHIVWKDGKIFQNMVLRLRNVECGEVELQLHWVDIP-GSK  163



>ref|XP_002534010.1| ARF GTPase activator, putative [Ricinus communis]
 gb|EEF28372.1| ARF GTPase activator, putative [Ricinus communis]
Length=169

 Score =   204 bits (518),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 131/165 (79%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            ++SL+GLL++ + RG+NLA+RD  +SDPY++VK+GKQKL+T V+K+++NPEWNEDLTL +
Sbjct  5    IESLMGLLRIHVHRGVNLAIRDVLTSDPYIVVKLGKQKLKTRVVKKNINPEWNEDLTLSI  64

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            S+P+LP+K+ VYD DTFS+DDKMG AE DI   LEALKM +        I+ R+ P R N
Sbjct  65   SNPNLPVKIGVYDRDTFSRDDKMGDAEFDIHPFLEALKM-HLQGLPSGTIITRIQPSREN  123

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ES V+  DGKV Q++ LRL+NVE GE+++Q+QWI++P GS+
Sbjct  124  CLAEESHVLWVDGKVVQNLFLRLRNVECGEIELQLQWIDIP-GSR  167



>ref|XP_010428284.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Camelina sativa]
Length=168

 Score =   204 bits (518),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 132/165 (80%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MD+LLG+L+VR+KRG+NLAVRD  SSDPYV++K+G+QKL+T V+K+++NP+W EDLT  V
Sbjct  4    MDNLLGILRVRVKRGVNLAVRDVSSSDPYVVLKLGRQKLKTRVVKKNINPQWEEDLTFTV  63

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP+LP+ + VYDHD FSKDDKMG AEID+K  +EAL+M+  +   E  I+  + P R N
Sbjct  64   TDPNLPLTLIVYDHDLFSKDDKMGNAEIDLKPYIEALRME-LSGLPEGTIITTIGPNRGN  122

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ES +   + ++ Q++CLRL+NVE GEV+I++QWI+LP GSK
Sbjct  123  CLAEESYIRWINDRIVQNICLRLRNVERGEVEIELQWIDLP-GSK  166



>emb|CDY47746.1| BnaA02g16490D [Brassica napus]
Length=168

 Score =   204 bits (518),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 131/165 (79%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MD+LLG+L+VR+KRG+NLAVRD  SSDPYV++K+G+QKL+T V+K+++NP+W EDLT  V
Sbjct  4    MDNLLGILRVRVKRGVNLAVRDVSSSDPYVVLKLGRQKLKTKVVKKNINPQWEEDLTFTV  63

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP+LP+ + VYDHD FSKDDKMG AEID+K  +EAL+M+     D   I++ + P RSN
Sbjct  64   TDPNLPLNLVVYDHDFFSKDDKMGDAEIDLKPYIEALRMELSGLPDGT-IISTIHPNRSN  122

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ES +   + ++ Q  CLRL+NVE GEV++++QWI+LP GSK
Sbjct  123  CLAEESYIRWSNDRIVQSFCLRLRNVERGEVELELQWIDLP-GSK  166



>ref|XP_006430620.1| hypothetical protein CICLE_v10012950mg [Citrus clementina]
 gb|ESR43860.1| hypothetical protein CICLE_v10012950mg [Citrus clementina]
Length=165

 Score =   203 bits (517),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 127/165 (77%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++L+GLL+V + RG+NLAVRD  SSDPYV++KMGKQKL+T V+K +VNPEWNEDLTL +
Sbjct  1    MENLMGLLRVHVLRGVNLAVRDVVSSDPYVVIKMGKQKLKTRVVKNNVNPEWNEDLTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            SDP+LPIK+TVYD DTFS DDKMG AE  I   LEALKM          IV ++ P R N
Sbjct  61   SDPNLPIKLTVYDKDTFSLDDKMGDAEFYITPFLEALKM-RLEGLPNGTIVTKIQPSREN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ES +V  DGK+ Q++ LRL+NVE GEV IQ++WI++P GS+
Sbjct  120  CLAEESHIVWTDGKLVQNLFLRLRNVEVGEVKIQLEWIDIP-GSR  163



>ref|XP_010928845.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Elaeis guineensis]
Length=165

 Score =   203 bits (516),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 129/164 (79%), Gaps = 1/164 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+ LLGL++VR+ RG+NLA RD R SDPYV+++MG+QKL+T V K++VNPEWNEDLTL V
Sbjct  1    MEHLLGLIRVRVVRGVNLAYRDTRGSDPYVVLRMGRQKLKTSVKKKNVNPEWNEDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            SDP+  I++ V+D DTFS+DD+MG AE  I+  LEA++MD  +      I+  V P R+N
Sbjct  61   SDPTQTIRLEVFDKDTFSRDDRMGDAEFGIQSFLEAVRMD-LSGLPNGTIITTVRPARNN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGS  280
            CL+ +S +V KDG++TQD+ LRL+NVESGEV++Q+QW+++P  +
Sbjct  120  CLSGDSSIVWKDGRITQDLVLRLRNVESGEVELQLQWVSIPGAA  163



>ref|XP_010471418.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X2 [Camelina sativa]
Length=168

 Score =   203 bits (517),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 132/165 (80%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MD+LLG+L+VR+KRG+NLAVRD  SSDPYV++K+G+QKL+T V+K+++NP+W EDLT  V
Sbjct  4    MDNLLGILRVRVKRGVNLAVRDVSSSDPYVVLKLGRQKLKTRVVKKNINPQWEEDLTFTV  63

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP+LP+ + VYDHD FSKDDKMG AEID+K  +EAL+M+  +   E  I+  + P R N
Sbjct  64   TDPNLPLTLIVYDHDLFSKDDKMGDAEIDLKPYIEALRME-LSGLPEGTIITTIGPNRGN  122

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ES +   + ++ Q++CLRL+NVE GEV+I++QWI+LP GSK
Sbjct  123  CLAEESYIRWINDRIVQNICLRLRNVERGEVEIELQWIDLP-GSK  166



>ref|XP_010471417.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X1 [Camelina sativa]
Length=173

 Score =   203 bits (517),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 132/165 (80%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MD+LLG+L+VR+KRG+NLAVRD  SSDPYV++K+G+QKL+T V+K+++NP+W EDLT  V
Sbjct  9    MDNLLGILRVRVKRGVNLAVRDVSSSDPYVVLKLGRQKLKTRVVKKNINPQWEEDLTFTV  68

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP+LP+ + VYDHD FSKDDKMG AEID+K  +EAL+M+  +   E  I+  + P R N
Sbjct  69   TDPNLPLTLIVYDHDLFSKDDKMGDAEIDLKPYIEALRME-LSGLPEGTIITTIGPNRGN  127

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ES +   + ++ Q++CLRL+NVE GEV+I++QWI+LP GSK
Sbjct  128  CLAEESYIRWINDRIVQNICLRLRNVERGEVEIELQWIDLP-GSK  171



>ref|XP_009127999.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Brassica rapa]
Length=168

 Score =   202 bits (515),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 131/165 (79%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MD+LLG+L+VR+KRG+NLAVRD  SSDPYV++K+G+QKL+T V+K+++NP+W EDLT  V
Sbjct  4    MDNLLGILRVRVKRGVNLAVRDVSSSDPYVVLKLGRQKLKTKVVKKNINPQWEEDLTFTV  63

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP+LP+ + VYDHD FSKDDKMG A+ID+K  +EAL+M+     D   I++ + P RSN
Sbjct  64   TDPNLPLNLVVYDHDFFSKDDKMGDAQIDLKPYIEALRMELSGLPDGT-IISTIHPNRSN  122

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ES +   + ++ Q  CLRL+NVE GEV++++QWI+LP GSK
Sbjct  123  CLAEESYIRWSNDRIVQSFCLRLRNVERGEVELELQWIDLP-GSK  166



>emb|CDX77307.1| BnaC08g03520D [Brassica napus]
Length=170

 Score =   203 bits (516),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 129/165 (78%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+SLLGLL++R+KRG+NLAVRD  SSDPYV+VKMGKQKL+T V+  DVNPEWNEDLTL V
Sbjct  6    MESLLGLLRIRVKRGVNLAVRDLNSSDPYVVVKMGKQKLKTRVIYNDVNPEWNEDLTLSV  65

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP+L + +TVYDHDTF+KDDKMG AE +IK  + AL M +  +     IV  V P R N
Sbjct  66   TDPNLKVLLTVYDHDTFTKDDKMGDAEFEIKPYINALTM-HLQDLPCGTIVTTVQPSRDN  124

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA  S ++  DGK+ Q++ LRLK+VE GEV++Q+QWI+LP GSK
Sbjct  125  CLAEGSRIIWSDGKLIQEIVLRLKHVECGEVEVQLQWIDLP-GSK  168



>ref|XP_007152688.1| hypothetical protein PHAVU_004G150800g [Phaseolus vulgaris]
 gb|ESW24682.1| hypothetical protein PHAVU_004G150800g [Phaseolus vulgaris]
Length=176

 Score =   202 bits (515),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 125/165 (76%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL+VR+KRGINLAVRD RSSDPYV++KM  QKL+T  +++DVNPEWNEDLTL +
Sbjct  12   MENLLGLLRVRVKRGINLAVRDVRSSDPYVVIKMFNQKLKTRFIRKDVNPEWNEDLTLSI  71

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
             DP+  +K+ VYDHDTFSKDD+MG AE DI   +EALK  N        ++ R  P   N
Sbjct  72   IDPNHQVKLIVYDHDTFSKDDRMGDAEFDIFPFIEALK-SNITGLPNGTVIKRTQPSAEN  130

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
             LA ESC+   +GK+ QDM LRL+NVE GEV+IQ+QWI+LP GSK
Sbjct  131  FLADESCITCVNGKLVQDMILRLQNVECGEVEIQLQWIDLP-GSK  174



>ref|XP_010465871.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Camelina sativa]
Length=176

 Score =   202 bits (515),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 127/165 (77%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MD LLGLL++RIKRG+NLAVRD  SSDPYV+VKMGKQK++T V+ +DVNPEWNEDLTL V
Sbjct  12   MDDLLGLLRIRIKRGVNLAVRDISSSDPYVVVKMGKQKVKTRVINKDVNPEWNEDLTLSV  71

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +D +L + +TVYDHD FSKDDKMG AE +IK  ++AL+M   +      IV  V P R N
Sbjct  72   TDSNLNVLLTVYDHDMFSKDDKMGDAEFEIKPYIQALRM-QLDGLPSGTIVTTVQPSRHN  130

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA +S V   DGK+ QD+ LRL++VE GEV+ Q+QWI+LP GSK
Sbjct  131  CLAEQSQVTWVDGKLVQDLVLRLRHVECGEVEAQLQWIDLP-GSK  174



>ref|XP_008789738.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Phoenix dactylifera]
Length=165

 Score =   202 bits (514),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 129/164 (79%), Gaps = 1/164 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+ LLGL++VR+ RG+NLA RD R SDPY++++MG+QKL+T V K++VNPEWNEDLTL V
Sbjct  1    MEHLLGLIRVRVVRGVNLAYRDTRGSDPYIVLRMGRQKLKTSVKKKNVNPEWNEDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            SDP+  I++ V+D D FS+DD+MG AE +++  LEA++MD  +      I+  V P R+N
Sbjct  61   SDPTQTIRLEVFDKDIFSRDDRMGDAEFEMQSFLEAVRMD-LSGLPSGTIITTVKPERTN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGS  280
            CLA ES +V KDG++TQD+ LRL+NVESGEV++Q+QW+++P  +
Sbjct  120  CLAGESPIVWKDGRITQDLVLRLRNVESGEVELQLQWVSIPGAA  163



>ref|XP_008368712.1| PREDICTED: LOW QUALITY PROTEIN: probable ADP-ribosylation factor 
GTPase-activating protein AGD11 [Malus domestica]
Length=165

 Score =   202 bits (514),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 129/162 (80%), Gaps = 1/162 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++++GLL++ ++RG+NLAVRD +SSDPYV+VKMGKQKL+T V+KR+VNPEW+E LTL V
Sbjct  1    MENMMGLLRIHVQRGVNLAVRDMKSSDPYVVVKMGKQKLKTRVVKRNVNPEWDERLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            ++PSLPI ++VYD DTFS DDKMG AE DI   ++ L+M      D   ++ +V P + N
Sbjct  61   TEPSLPITLSVYDKDTFSFDDKMGDAEFDIALFIQVLRMRLEGLPDGT-VITKVQPXQEN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPS  286
            CLA ESC++  +GK+ Q+M LRL+NVE GE+++Q+QWI++PS
Sbjct  120  CLAEESCIIWSNGKLVQNMILRLRNVECGEIELQLQWIDVPS  161



>ref|XP_009381107.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X1 [Musa acuminata subsp. malaccensis]
Length=166

 Score =   202 bits (514),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 124/163 (76%), Gaps = 1/163 (1%)
 Frame = -1

Query  768  DSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYVS  589
            D LLGLL+VR++RG+NLAVRD  SSDPYVI++MG QKL+T V+KR+ NP WNE+LTL V 
Sbjct  3    DHLLGLLRVRVQRGVNLAVRDFISSDPYVILRMGNQKLKTRVIKRNTNPIWNEELTLSVE  62

Query  588  DPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSNC  409
            DP+LP+++ VYD DTFS DD MG AE DI+  +EA++M N        ++ +V PGR NC
Sbjct  63   DPALPVRLEVYDKDTFSLDDPMGNAEFDIRPFVEAVRM-NLQGVPNGTMITKVAPGRQNC  121

Query  408  LAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGS  280
            LA ES +   DGKV QD+ LRLK+VE GEV++Q+QW+++P  S
Sbjct  122  LADESAIYWSDGKVLQDLVLRLKDVERGEVELQLQWVSIPGAS  164



>ref|XP_008343060.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Malus domestica]
Length=165

 Score =   202 bits (513),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 127/162 (78%), Gaps = 1/162 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++++GLL++ ++RG+NLAVRD +SSDPYV+VKMGKQKL+T V+KR+VNPEW+E LTL V
Sbjct  1    MENMMGLLRIHVQRGVNLAVRDMKSSDPYVVVKMGKQKLKTRVVKRNVNPEWDERLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            ++P LPI + VYD DTFS DDKMG AE DI   ++ L+M      D   ++ +V P R N
Sbjct  61   TEPXLPITLXVYDKDTFSFDDKMGDAEFDIALFIQVLRMRLEGLPDGT-VITKVQPSREN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPS  286
            CLA ESC++  +GK+ Q+M LRL+NVE GE+++Q+QWI++PS
Sbjct  120  CLAEESCIIWSNGKLVQNMILRLRNVECGEIELQLQWIDVPS  161



>ref|XP_010416168.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Camelina sativa]
Length=168

 Score =   202 bits (513),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 131/165 (79%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MD+LLG+L+VR+KRG+NLAVRD  SSDPYV++K+G+QKL+T V+K+++NP+W EDLT  V
Sbjct  4    MDNLLGILRVRVKRGVNLAVRDVSSSDPYVVLKLGRQKLKTRVVKKNINPQWEEDLTFTV  63

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP+LP+ + VYDHD FSKDDKMG AEID+K  +EAL+M+  +   E  I+  + P R N
Sbjct  64   TDPNLPLTLIVYDHDLFSKDDKMGDAEIDLKPYIEALRME-LSGLPEGTIITTIGPNRGN  122

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ES +   + ++ Q++CLRL NVE GEV+I++QWI+LP GSK
Sbjct  123  CLAEESYIRWINDRIVQNICLRLGNVERGEVEIELQWIDLP-GSK  166



>ref|XP_009370100.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Pyrus x bretschneideri]
Length=165

 Score =   202 bits (513),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 128/162 (79%), Gaps = 1/162 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++++GLL++ ++RG+NLAVRD  SSDPYV+VKMGKQKL+T V+KR+VNPEWNE LTL V
Sbjct  1    METMMGLLRIHVQRGVNLAVRDLISSDPYVVVKMGKQKLKTGVVKRNVNPEWNERLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            ++P++PI ++VYD DTFS DDKMG AE DI   ++ L+M      D   ++ +V P R N
Sbjct  61   TEPNIPITLSVYDKDTFSFDDKMGDAEFDIALFIKVLRMQLEGLPDGT-VLTKVQPSREN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPS  286
            CLA ESC++  +GK+ Q+M LRL+NVE GEV++Q+QWI++PS
Sbjct  120  CLAEESCIIWSNGKLVQNMILRLRNVECGEVELQLQWIDVPS  161



>ref|XP_009334450.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Pyrus x bretschneideri]
Length=165

 Score =   202 bits (513),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 127/162 (78%), Gaps = 1/162 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+ ++GLL++ ++RG+NLAVRD +SSDPYV+VKMGKQKL+T V+KR+VNPEW+E LTL V
Sbjct  1    MEDMMGLLRIHVQRGVNLAVRDMKSSDPYVVVKMGKQKLKTRVVKRNVNPEWDERLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            ++P++PI + VYD DTFS DDKMG A  DI   +E L+M +    D   ++ +V P R N
Sbjct  61   TEPNIPITLFVYDKDTFSFDDKMGDAHFDIAQFVEVLRMRSEGLPDGT-VITKVQPSREN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPS  286
            CLA ESC++  +GK+ Q+M LRL+NVE GE+++Q+QWI++PS
Sbjct  120  CLAEESCIIWSNGKLVQNMILRLRNVECGEIELQLQWIDVPS  161



>ref|XP_006482135.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Citrus sinensis]
Length=165

 Score =   201 bits (512),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 127/165 (77%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++L+GLL+V + RG+NLAVRD  SSDPYV++KMGKQKL+T V+K +VNPEWNEDLTL +
Sbjct  1    MENLMGLLRVHVLRGVNLAVRDVVSSDPYVVIKMGKQKLKTRVVKNNVNPEWNEDLTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            SD +LPIK+TVYD DTFS DDKMG AE  I   LEALKM          IV ++ P R N
Sbjct  61   SDSNLPIKLTVYDKDTFSPDDKMGDAEFYITPFLEALKM-RLEGLPNGTIVTKIQPSREN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ES +V  DGK+ Q++ LRL+NVE GEV+IQ++WI++P GS+
Sbjct  120  CLAEESHIVWTDGKLVQNLFLRLRNVEVGEVEIQLEWIDIP-GSR  163



>ref|XP_011038617.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Populus euphratica]
Length=181

 Score =   202 bits (513),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 128/161 (80%), Gaps = 1/161 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MD+LLGLL++R+KRG NLAVRD  +SDPYV++ MGKQKL+T V+K++ NPEWNE++TL +
Sbjct  1    MDNLLGLLRIRVKRGNNLAVRDLGTSDPYVVITMGKQKLKTRVVKKNCNPEWNEEITLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +D ++PI +TV+D D F+ DDKMG AEIDIK  + +LKM    N     +V+RV P R+N
Sbjct  61   TDLNVPINLTVFDKDRFTVDDKMGEAEIDIKAYIASLKM-GLQNLPNGCVVSRVKPSRNN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLP  289
            CLA ESCVV  +GK+ QDM LRL+NVESGEV IQI+WIN+P
Sbjct  120  CLADESCVVWDNGKILQDMILRLRNVESGEVMIQIEWINVP  160



>ref|XP_009606380.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Nicotiana tomentosiformis]
Length=166

 Score =   201 bits (511),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 130/165 (79%), Gaps = 1/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++ LGLL++RI RGINLA+RD RSSDPYV+V+MG+QKLRT V+K++VNPEWN+DLTL +
Sbjct  1    MENQLGLLRIRILRGINLAIRDFRSSDPYVVVRMGRQKLRTRVVKKNVNPEWNDDLTLCI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            ++P LPIK+ VYD DTFS+DDKMG AE+DI   + A +     N     I+A++ P R N
Sbjct  61   AEPILPIKLIVYDKDTFSRDDKMGDAELDIVPFINAARTKRVKNIPNGTIIAKIIPNRQN  120

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            C + ESC+  ++GKV Q++ LRL+NVE GE+++++QWI++P GSK
Sbjct  121  CYSEESCIASENGKVVQNVFLRLRNVECGEIELRLQWIDIP-GSK  164



>ref|XP_010500393.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X1 [Camelina sativa]
Length=168

 Score =   201 bits (511),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 129/168 (77%), Gaps = 5/168 (3%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL++RIKRG+NLAVRD  SSDPYV+VKMGKQKL+T V+  +VNPEWNEDLTL V
Sbjct  1    MNNLLGLLRIRIKRGVNLAVRDLHSSDPYVVVKMGKQKLKTRVIYHNVNPEWNEDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDK---MGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPG  421
            +DP+L + +TVYDHDTF+KDDK   MG AE  IK  + A+KM  H+      IV  V P 
Sbjct  61   TDPNLTVLLTVYDHDTFTKDDKMGDMGDAEFIIKPFVNAVKMQLHDLP-SGTIVTTVQPS  119

Query  420  RSNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            R NCLA ES V+  DGK+ QD+ LRL++VE GE++ Q+QWI+LP GSK
Sbjct  120  RDNCLAEESRVIWSDGKLIQDLVLRLRHVECGEIEAQLQWIDLP-GSK  166



>ref|XP_002275235.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Vitis vinifera]
 emb|CBI33522.3| unnamed protein product [Vitis vinifera]
Length=165

 Score =   201 bits (510),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 126/165 (76%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+ L GLL++ + RG+NLA RD  SSDPYVIV+MGKQKL+T V+ ++VNPEWNEDLTL V
Sbjct  1    MEHLHGLLRIHVHRGVNLAKRDVLSSDPYVIVRMGKQKLKTRVVNKNVNPEWNEDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
             D +LP+K+ VYD DTFS DDKMG AE  I   +EAL+M+  N      I+ RV P R N
Sbjct  61   DDTNLPVKIFVYDRDTFSLDDKMGDAEFQIGPFVEALRME-LNGLPSGTIITRVQPNREN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ESC++  +GKV Q++ LRL+NVESGEV++Q+QWI++P GS+
Sbjct  120  CLAEESCIIWTEGKVVQNLVLRLRNVESGEVELQLQWIDIP-GSR  163



>ref|XP_002887489.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63748.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=168

 Score =   201 bits (510),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 132/165 (80%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            +D+LLG+L+VR+KRG+NLAVRD  SSDPYV++K+G+QKL+T V+K++VNP+W EDL+  V
Sbjct  4    LDNLLGILRVRVKRGVNLAVRDVSSSDPYVVLKLGRQKLKTKVVKKNVNPQWEEDLSFTV  63

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP+LP+ + VYDHD FSKDDKMG AEID+K  +EAL+M+     D   I++ + P R N
Sbjct  64   TDPNLPLTLIVYDHDFFSKDDKMGDAEIDLKPYIEALRMELSGLPDGT-IISTIGPSRGN  122

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ES +   + ++ Q++CLRL+NVE GEV+I++QWI+LP GSK
Sbjct  123  CLAEESYIRWINDRIVQNICLRLRNVERGEVEIELQWIDLP-GSK  166



>ref|XP_010551808.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Tarenaya hassleriana]
Length=167

 Score =   201 bits (510),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 128/166 (77%), Gaps = 2/166 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+ L+GLL++ +KRG+NLA+RD  SSDPY +V+MGKQKL+T V+K++VNPEWNEDLTL V
Sbjct  1    MEDLMGLLRLHVKRGVNLAIRDVSSSDPYAVVRMGKQKLKTRVVKKNVNPEWNEDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNH-NNSDEERIVARVPPGRS  415
            +DP+LP+K+TVYD D FS DD+MG AE  I   LEA+K+ +      E  I+ +V P R 
Sbjct  61   TDPTLPVKITVYDRDIFSADDRMGEAEFTIGTFLEAIKIRHQLGGLPEGTIIMKVQPTRE  120

Query  414  NCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            NCL+ ES +V   GK+ QDM LRL++VE GEV++Q++WI++P GS+
Sbjct  121  NCLSEESQIVWSKGKIVQDMFLRLRHVECGEVELQLEWIDIP-GSR  165



>gb|KDO50844.1| hypothetical protein CISIN_1g031128mg [Citrus sinensis]
Length=165

 Score =   200 bits (509),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 126/165 (76%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++L+GLL+V + RG+NLAVRD  SSDPYV++KMGKQKL+T V+K +VNPEWNEDLTL +
Sbjct  1    MENLMGLLRVHVLRGVNLAVRDVVSSDPYVVIKMGKQKLKTRVVKNNVNPEWNEDLTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            SD +LPIK+TVYD DTFS DDKMG AE  I   LEALKM          IV ++ P R N
Sbjct  61   SDSNLPIKLTVYDKDTFSLDDKMGDAEFYITPFLEALKM-RLEGLPNGTIVTKIQPSREN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ES +V  DGK+ Q++ LRL+NVE GEV IQ++WI++P GS+
Sbjct  120  CLAEESHIVWTDGKLVQNLFLRLRNVEVGEVKIQLEWIDIP-GSR  163



>ref|XP_002314800.1| C2 domain-containing family protein [Populus trichocarpa]
 gb|EEF00971.1| C2 domain-containing family protein [Populus trichocarpa]
Length=171

 Score =   200 bits (509),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 128/162 (79%), Gaps = 1/162 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MD+LLGLL++R+KRG NLAVRD  +SDPY ++ MGKQKL+T V+K++ NPEWNE+LTL +
Sbjct  1    MDNLLGLLRIRVKRGNNLAVRDLGTSDPYAVITMGKQKLKTRVVKKNCNPEWNEELTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +D ++PI +TV+D D F+ DDKMG AEIDIK  + +LKM   N  +   +V+R+ P R+N
Sbjct  61   TDLNVPINLTVFDKDRFTVDDKMGEAEIDIKAYIASLKMGLQNLPN-GCVVSRIKPSRNN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPS  286
            CLA ESCVV  +GK+ QDM LRL+NVESGEV IQI+W+N+P 
Sbjct  120  CLADESCVVWDNGKILQDMILRLRNVESGEVMIQIEWMNVPG  161



>ref|XP_008381350.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X2 [Malus domestica]
Length=165

 Score =   200 bits (509),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 126/162 (78%), Gaps = 1/162 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++++GLL++ I++G+NLAVRD  SSDPYV+VKMGKQKL+T V+K++VNPEWNE LTL V
Sbjct  1    MENMMGLLRIHIQKGVNLAVRDMXSSDPYVVVKMGKQKLKTRVVKKNVNPEWNEKLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP+LPI+++VYD DTFS DDKMG AE +I   ++ L+M      D   I+ +V P R N
Sbjct  61   ADPNLPIRLSVYDKDTFSFDDKMGDAEFEIGTFIKVLRMGLEGLPDGT-IITKVQPSRKN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPS  286
            CLA ES +V   GKV  +M LRL+NVE GEV++Q+QWIN+PS
Sbjct  120  CLAEESYIVWSKGKVVXNMVLRLRNVECGEVELQLQWINVPS  161



>ref|XP_008358166.1| PREDICTED: LOW QUALITY PROTEIN: probable ADP-ribosylation factor 
GTPase-activating protein AGD11 [Malus domestica]
Length=165

 Score =   200 bits (509),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 127/162 (78%), Gaps = 1/162 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++++GLL++ ++RG+NLAVRD  SSDPYV+VKMGKQKL+T V+KR+VNPEW+E LTL V
Sbjct  1    METMMGLLRIHVQRGLNLAVRDLTSSDPYVVVKMGKQKLKTRVVKRNVNPEWDERLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            ++P+LPI ++VYD DTFS DDK G AE DI   ++ L+M      D   I+ +V P R N
Sbjct  61   AEPNLPITLSVYDKDTFSFDDKXGEAEFDIALFIKVLRMQLEGLPDGT-ILXKVQPSREN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPS  286
            CLA ESC++  +GK+ Q+M LRL+NVE GEV++Q+QWI++PS
Sbjct  120  CLAEESCIIWSNGKLVQNMILRLRNVECGEVELQLQWIDVPS  161



>ref|XP_004289564.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Fragaria vesca subsp. vesca]
Length=168

 Score =   200 bits (509),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 126/163 (77%), Gaps = 1/163 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+++LGLL++ I+RG+NLAVRD RSSDPY+IVKMGKQKL+T V+K+ +NPEWNE LTL +
Sbjct  1    MENMLGLLRIHIQRGVNLAVRDMRSSDPYLIVKMGKQKLKTRVVKKSLNPEWNEQLTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEE-RIVARVPPGRS  415
             DP LPI V+VYD DTFS DDKMG A+ +I    +A+K       D++  I+++V   + 
Sbjct  61   VDPDLPILVSVYDKDTFSFDDKMGDAQFEIGPFFKAMKTGFQGLQDQDGAIISKVQVNKQ  120

Query  414  NCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPS  286
            NCLA ESC++   GK+ Q+M LRL+NVE GEV++Q+QWI++PS
Sbjct  121  NCLAEESCIIYSKGKLVQNMVLRLRNVECGEVELQLQWIDIPS  163



>ref|XP_009370097.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Pyrus x bretschneideri]
Length=165

 Score =   200 bits (508),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 129/162 (80%), Gaps = 1/162 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++++GLL++ ++RG+NLAVRD  SSDPYV+VKMGKQKL+T V+KR+VNPEW+E LTL V
Sbjct  1    METMMGLLRIHVQRGVNLAVRDLISSDPYVVVKMGKQKLKTGVVKRNVNPEWDERLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            ++P+LP++++VYD DTFS DDKMG AE DI   ++ L+M      D   ++ +V P R N
Sbjct  61   TEPNLPMELSVYDKDTFSFDDKMGDAEFDIALFIKVLRMQLEGLPDGT-VLTKVQPSREN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPS  286
            CLA ESC++  +GK+ Q+M LRL+NVE GEV++Q+QWI++PS
Sbjct  120  CLAEESCIIWSNGKLVQNMILRLRNVECGEVELQLQWIDVPS  161



>ref|XP_010527744.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Tarenaya hassleriana]
Length=167

 Score =   200 bits (508),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 127/166 (77%), Gaps = 2/166 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MD+L+GLL++ +K+G+NLA+RD  SSDPYV+V+MGKQKL+T V+K++VNPEWNEDLTL V
Sbjct  1    MDNLMGLLRLHVKKGVNLAIRDVSSSDPYVVVRMGKQKLKTRVVKKNVNPEWNEDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNH-NNSDEERIVARVPPGRS  415
            +DP+LP+ +TVYD D FS DDKMG AE  I   LEA+K+ +      E  ++ +V P R 
Sbjct  61   ADPTLPVTITVYDKDLFSADDKMGEAEFKIGPFLEAVKIRHQLGLVPEGSVIMKVQPNRE  120

Query  414  NCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            NCL+ ES +V   GK+ QDM LRL+NVE GEV +Q++WI +P GS+
Sbjct  121  NCLSEESQIVWSKGKIAQDMFLRLRNVECGEVQLQLEWIEVP-GSR  165



>ref|XP_007216470.1| hypothetical protein PRUPE_ppa025942mg [Prunus persica]
 gb|EMJ17669.1| hypothetical protein PRUPE_ppa025942mg [Prunus persica]
Length=165

 Score =   200 bits (508),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 127/162 (78%), Gaps = 1/162 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++L+GLL++ I+RG+NLAVRD RSSDPY ++KMGKQK++T V+K++VNPEWNEDLTL V
Sbjct  1    MENLMGLLRIHIQRGVNLAVRDMRSSDPYAVIKMGKQKVKTRVVKKNVNPEWNEDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP+LPI++ VYD DTFS DDKMG AE ++   ++ LKM      D   I+ +V P R N
Sbjct  61   ADPNLPIRLCVYDRDTFSFDDKMGDAEFEVATFIKVLKMRLEGLPDGT-IITKVQPNRQN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPS  286
            CLA ES +V   GK+ Q+M LRL+NVE GEV++Q++WI++P+
Sbjct  120  CLAEESYIVWSKGKLVQNMVLRLRNVECGEVELQLKWIDVPT  161



>ref|NP_177499.1| C2 domain-containing protein [Arabidopsis thaliana]
 gb|AAG51808.1|AC079676_3 hypothetical protein; 22552-21875 [Arabidopsis thaliana]
 gb|AEE35478.1| C2 domain-containing protein [Arabidopsis thaliana]
Length=168

 Score =   199 bits (507),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 131/165 (79%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MD+LLG+L+VR++RG+NLAVRD  SSDPYV++K+G+QKL+T V+K++VNP+W EDL+  V
Sbjct  4    MDNLLGILRVRVQRGVNLAVRDVSSSDPYVVLKLGRQKLKTKVVKQNVNPQWQEDLSFTV  63

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP+LP+ + VYDHD FSKDDKMG AEID+K  +EAL+M+     D   I++ + P R N
Sbjct  64   TDPNLPLTLIVYDHDFFSKDDKMGDAEIDLKPYIEALRMELSGLPDGT-IISTIGPSRGN  122

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ES +   + ++ Q +CLRL+NVE GEV+I++QWI+LP GSK
Sbjct  123  CLAEESYIRWINDRIVQHICLRLRNVERGEVEIELQWIDLP-GSK  166



>ref|NP_001132168.1| uncharacterized protein LOC100193590 [Zea mays]
 gb|ACF80900.1| unknown [Zea mays]
 gb|ACG39522.1| GTPase activating protein [Zea mays]
 tpg|DAA58507.1| TPA: putative calcium-dependent lipid-binding (CaLB domain) family 
protein [Zea mays]
Length=165

 Score =   199 bits (507),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 132/165 (80%), Gaps = 3/165 (2%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            +D L+GLLK+R+ RG+NLAVRD RSSDPYV+V++GKQKL+T V+K+ VNPEW+++LTL +
Sbjct  2    LDHLVGLLKLRVVRGVNLAVRDLRSSDPYVVVRIGKQKLKTRVVKKSVNPEWDDELTLSI  61

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
             DP++PI++ V+D DTF  DD MG AE+DI+ L+E +KM   + +D   +V ++ P R N
Sbjct  62   EDPAVPIRLEVFDKDTFV-DDTMGNAEVDIRPLVEIVKMKLQDVADRT-VVKKLVPNRQN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ES + I +GKV QDM +RL+NVESGE+++Q+QWI+LP GSK
Sbjct  120  CLAEESSIYISEGKVKQDMVVRLRNVESGEIELQLQWIDLP-GSK  163



>ref|XP_009135560.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X1 [Brassica rapa]
Length=187

 Score =   200 bits (508),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 130/184 (71%), Gaps = 12/184 (7%)
 Frame = -1

Query  798  SGSAGNKVEMDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQ----------KLRT  649
            +G A     MD LLGLL++RIKRG+NLAVRD  SSDPY++VKMGKQ          KL+T
Sbjct  4    TGPARTSSLMDDLLGLLRIRIKRGVNLAVRDINSSDPYIVVKMGKQVHTIYHRIFTKLKT  63

Query  648  HVLKRDVNPEWNEDLTLYVSDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDN  469
             V+ +DVNPEWNEDLTL V+DPSL + +TVYDHD FSKDDKMG AE +IK  +EAL+M  
Sbjct  64   RVINKDVNPEWNEDLTLSVTDPSLTVLLTVYDHDMFSKDDKMGDAEFEIKPYIEALRM-Q  122

Query  468  HNNSDEERIVARVPPGRSNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLP  289
             +      IVA V P R+NCLA ES V   DGK+ Q+  LRL++ E GEV+ Q+ WI+LP
Sbjct  123  LDGLPSGTIVATVHPSRANCLAEESRVTWIDGKLVQERVLRLRHAECGEVEAQLHWIDLP  182

Query  288  SGSK  277
             GSK
Sbjct  183  -GSK  185



>ref|XP_010109009.1| putative ADP-ribosylation factor GTPase-activating protein AGD11 
[Morus notabilis]
 gb|EXC20649.1| putative ADP-ribosylation factor GTPase-activating protein AGD11 
[Morus notabilis]
Length=165

 Score =   199 bits (506),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 126/162 (78%), Gaps = 1/162 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++ LGLL++ IKRG+NLA+RD RSSDPYV++K+G+QKL+T V+K+++NPEWNE LTL V
Sbjct  1    MENWLGLLRIHIKRGVNLAIRDTRSSDPYVLLKLGRQKLKTRVVKKNLNPEWNELLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            SDP+ PIK+ VYD DTFS DDKMG AE +I   L ALKM      D   I+++  P R N
Sbjct  61   SDPNTPIKLFVYDKDTFSFDDKMGDAEFEIGPFLNALKMRLQGLPDGT-IISKAQPTRKN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPS  286
            CLA ES +V  +GK+ QD+ LRL+NVE GEV++Q+QWI++P+
Sbjct  120  CLAEESRIVFSNGKLVQDLVLRLRNVECGEVELQLQWIDVPT  161



>ref|XP_007033034.1| Calcium-dependent lipid-binding (CaLB domain) family protein 
[Theobroma cacao]
 gb|EOY03960.1| Calcium-dependent lipid-binding (CaLB domain) family protein 
[Theobroma cacao]
Length=165

 Score =   199 bits (506),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 130/165 (79%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+ L+GLL++ ++RG+NLAVRD  SSDPYV+V+MGKQKL+T V+K++ NPEWN+DLTL +
Sbjct  1    MEDLMGLLRIHVQRGVNLAVRDVVSSDPYVVVRMGKQKLKTRVIKKNTNPEWNDDLTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +D SLP+K+ VYD DTFS DDKMG AE +I   +EA+KM +        ++ ++ P R N
Sbjct  61   ADQSLPVKLAVYDKDTFSFDDKMGDAEFEIGPFIEAVKM-HLEGLPSGTVIKKIQPSRQN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CL+ +SC++  +GKV Q+M LRL+NVESGEV++Q+QWI++P GS+
Sbjct  120  CLSEDSCIIWSNGKVVQNMFLRLRNVESGEVELQLQWIHVP-GSR  163



>ref|XP_006301267.1| hypothetical protein CARUB_v10021667mg [Capsella rubella]
 gb|EOA34165.1| hypothetical protein CARUB_v10021667mg [Capsella rubella]
Length=168

 Score =   198 bits (504),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 130/165 (79%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MD+LLG+L+VR+KRG+NLAVRD  SSDPYV++K+G+QKL+T V+K+++NP+W EDLT  V
Sbjct  4    MDNLLGILRVRVKRGVNLAVRDVSSSDPYVVLKLGRQKLKTRVVKKNINPQWEEDLTFTV  63

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP+ P+ + VYDHD FSKDDKMG A ID+K  +EAL+M+  +   E  I+  + P R N
Sbjct  64   TDPNHPLTLIVYDHDLFSKDDKMGDAAIDLKPYIEALRME-LSGLPEGTIITTIGPNRGN  122

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ES +   + ++ Q++CLRL+NVE GEV+I++QWI+LP GSK
Sbjct  123  CLAEESYIRWINNRIVQNICLRLRNVERGEVEIELQWIDLP-GSK  166



>ref|XP_011023699.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X3 [Populus euphratica]
Length=171

 Score =   198 bits (504),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 95/162 (59%), Positives = 127/162 (78%), Gaps = 1/162 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MDS LGLL++R+KRG+NLAVRD  SSDPYV++ MG QKL+T V+K++ NP WNE+LTL +
Sbjct  1    MDSFLGLLRIRVKRGVNLAVRDLGSSDPYVVITMGNQKLKTRVVKKNCNPVWNEELTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +D ++PI +TV+D DTF+ DDKMG A IDI+  + +LKM    N  +  +V+RV P ++N
Sbjct  61   TDLNVPINLTVFDKDTFTVDDKMGEAGIDIQPYIASLKM-GLQNLPKGCVVSRVQPSQNN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPS  286
            CLA ESC+V  DGK+ QDM LRL+NVESGEV IQI+WI++P 
Sbjct  120  CLADESCIVWDDGKLLQDMVLRLRNVESGEVMIQIEWIDVPG  161



>ref|XP_011023692.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X2 [Populus euphratica]
Length=173

 Score =   198 bits (504),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 127/161 (79%), Gaps = 1/161 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MDS LGLL++R+KRG+NLAVRD  SSDPYV++ MG QKL+T V+K++ NP WNE+LTL +
Sbjct  1    MDSFLGLLRIRVKRGVNLAVRDLGSSDPYVVITMGNQKLKTRVVKKNCNPVWNEELTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +D ++PI +TV+D DTF+ DDKMG A IDI+  + +LKM    N  +  +V+RV P ++N
Sbjct  61   TDLNVPINLTVFDKDTFTVDDKMGEAGIDIQPYIASLKM-GLQNLPKGCVVSRVQPSQNN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLP  289
            CLA ESC+V  DGK+ QDM LRL+NVESGEV IQI+WI++P
Sbjct  120  CLADESCIVWDDGKLLQDMVLRLRNVESGEVMIQIEWIDVP  160



>ref|XP_003552975.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoformX1 [Glycine max]
 gb|KHN07551.1| Putative ADP-ribosylation factor GTPase-activating protein AGD11 
[Glycine soja]
Length=165

 Score =   198 bits (503),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 129/166 (78%), Gaps = 2/166 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL++ +++G+NLA+RD  SSDPYV++KMG+QKL+T V+K+++NPEWN+DLTL +
Sbjct  1    MENLLGLLRIHVEKGVNLAIRDVVSSDPYVVIKMGRQKLKTRVVKKNLNPEWNDDLTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            SDP  PI + VYD DTFS DDKMG AE  I   +EA+KM   +      IV +V P R N
Sbjct  61   SDPHAPIHLHVYDKDTFSMDDKMGDAEFFIGPFIEAVKM-RLSGLPNNTIVTKVLPSRQN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSKQ  274
            CLA ES +++KDGKV Q+M LRL+NVESGEV++Q+ WI++P GS+ 
Sbjct  120  CLAEESHIMLKDGKVVQNMVLRLRNVESGEVELQLHWIDIP-GSRH  164



>ref|XP_009403742.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X2 [Musa acuminata subsp. malaccensis]
Length=166

 Score =   198 bits (503),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 125/163 (77%), Gaps = 1/163 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            ++ LLGLL+VR+ RG+NLAVRD  +SDPYV+++MGKQKL+T V+K++ NP WNEDLTL +
Sbjct  2    VEHLLGLLRVRVARGVNLAVRDVTTSDPYVVLRMGKQKLKTRVIKKNTNPVWNEDLTLCI  61

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
             DPSLP+++ V+D D F+KDD MG+AE DI+  LEA+KM N     E  I+ +V P R N
Sbjct  62   EDPSLPVRLQVFDKDRFTKDDAMGHAEFDIRPFLEAVKM-NPQGVPEGTIIRKVVPCRQN  120

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSG  283
            CLA ES V    G+VTQD+ LRLK+VE GEV++Q+QW+++P  
Sbjct  121  CLAEESVVRWCHGQVTQDLALRLKDVERGEVELQLQWVDIPGA  163



>ref|XP_007163391.1| hypothetical protein PHAVU_001G230800g [Phaseolus vulgaris]
 gb|ESW35385.1| hypothetical protein PHAVU_001G230800g [Phaseolus vulgaris]
Length=189

 Score =   199 bits (505),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 129/169 (76%), Gaps = 8/169 (5%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL++ +++G+NLA+RD  SSDPYV++KMGKQKL+T V+K+++NPEWN+DLTL +
Sbjct  25   MENLLGLLRIHVEKGVNLAIRDVVSSDPYVVIKMGKQKLKTRVVKKNLNPEWNDDLTLSI  84

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNH---NNSDEERIVARVPPG  421
            SDP  PI + VYD DTFS DDKMG A+  I    EA+KM      NN+    IV +V P 
Sbjct  85   SDPHTPIHLQVYDKDTFSMDDKMGDADFSIVPFTEAVKMRLAGLPNNT----IVTKVLPS  140

Query  420  RSNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSKQ  274
            R NCLA ES +V KDGKV Q+M LRLKNVESGEV++Q+ WI++P GS+ 
Sbjct  141  RQNCLAEESHIVWKDGKVVQNMVLRLKNVESGEVELQLNWIDIP-GSRH  188



>ref|XP_002305199.1| hypothetical protein POPTR_0004s08840g [Populus trichocarpa]
 gb|ABK92911.1| unknown [Populus trichocarpa]
 gb|EEE85710.1| hypothetical protein POPTR_0004s08840g [Populus trichocarpa]
Length=165

 Score =   197 bits (502),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 128/165 (78%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++L+GLL++ + RG+NLAVRD  SSDPYV+VKMGKQKL+T V+K+++NPEWN+DLTL +
Sbjct  1    MENLMGLLRIHVIRGVNLAVRDVCSSDPYVVVKMGKQKLKTRVIKQNINPEWNDDLTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
             DP LP+ + VYD DTFS DDKMG AE DI   +E +KM   +N     I+ ++ P R N
Sbjct  61   VDPKLPVLIRVYDKDTFSLDDKMGDAEFDISQFIEVVKM-RLDNLPSGTIIRKIQPSREN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ESC+V   GK+ Q++ LRLK+VE+GEV++Q++WI++P GS+
Sbjct  120  CLAEESCIVWATGKLVQNLFLRLKHVETGEVELQLEWIDIP-GSR  163



>gb|AGV54351.1| ADP-ribosylation factor GTPase-activating protein AGD11-like 
protein [Phaseolus vulgaris]
Length=165

 Score =   197 bits (502),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 129/169 (76%), Gaps = 8/169 (5%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL++ +++G+NLA+RD  SSDPYV++KMGKQKL+T V+K+++NPEWN+DLTL +
Sbjct  1    MENLLGLLRIHVEKGVNLAIRDVVSSDPYVVIKMGKQKLKTRVVKKNLNPEWNDDLTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNH---NNSDEERIVARVPPG  421
            SDP  PI + VYD DTFS DDKMG A+  I    EA+KM      NN+    IV +V P 
Sbjct  61   SDPHTPIHLQVYDKDTFSMDDKMGDADFSIVPFTEAVKMRLAGLPNNT----IVTKVLPS  116

Query  420  RSNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSKQ  274
            R NCLA ES +V KDGKV Q+M LRLKNVESGEV++Q+ WI++P GS+ 
Sbjct  117  RQNCLAEESHIVWKDGKVVQNMVLRLKNVESGEVELQLNWIDIP-GSRH  164



>ref|XP_004292368.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Fragaria vesca subsp. vesca]
Length=163

 Score =   197 bits (501),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 127/163 (78%), Gaps = 1/163 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL++ I+RG++LA+RD  SSDPY+IV+MGK KL+T ++KR VNPEW+E LTL V
Sbjct  1    MENLLGLLRIHIQRGVDLALRDMISSDPYIIVEMGKHKLKTRLVKRSVNPEWDEKLTLTV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            SDP++P+K+ VYD DTF+ DDKMG AE +I   +E ++M       E  I+A+V P R N
Sbjct  61   SDPNIPVKLFVYDKDTFTFDDKMGDAEFEIATFVEVVQM-LLEGLPEGTIIAKVQPTRQN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSG  283
            CLA ESC+++ +GK+ Q+M LRL+NVE GEV++Q+ WI++P G
Sbjct  120  CLAEESCIILSNGKLVQNMVLRLRNVERGEVELQLHWIHVPMG  162



>emb|CDX95800.1| BnaC05g35510D [Brassica napus]
Length=765

 Score =   211 bits (538),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 130/165 (79%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL++RIKRG+NLAVRD  SSDPYV+VKMGKQKL+T V+ +DVNPEWNEDLTL V
Sbjct  601  MNNLLGLLRIRIKRGVNLAVRDINSSDPYVVVKMGKQKLKTRVINKDVNPEWNEDLTLSV  660

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP+L + +TVYDHD FSKDDKMG AE +IK  +EALKM + +      IV  V P R N
Sbjct  661  TDPTLTVLLTVYDHDMFSKDDKMGDAEFEIKPYIEALKM-HLDGLPSGTIVTTVQPCRRN  719

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ES V   DGK+ QD+ LRL++VE GEV+ Q+QWI+LP GSK
Sbjct  720  CLAEESKVTWVDGKLVQDLVLRLRHVECGEVEAQLQWIDLP-GSK  763



>ref|XP_009413360.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Musa acuminata subsp. malaccensis]
Length=165

 Score =   197 bits (501),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 123/163 (75%), Gaps = 1/163 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+ ++GLL+VR+ RG+NLA RDAR SDPYV+++MG QKL+T V K +VNP WNEDLTL V
Sbjct  1    MEHMMGLLRVRVVRGVNLAYRDARGSDPYVVMRMGGQKLKTSVKKHNVNPVWNEDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            S+P  PIK+ VYD DTFS+DDKMG AEIDI+  +EA+KM N +      I+  + P R N
Sbjct  61   SEPLRPIKLQVYDKDTFSRDDKMGDAEIDIQPFVEAVKM-NFSGLPNGTIIKTLTPNRQN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSG  283
            CLA ES +V KD  + QD+ LRL+NVESGE+++Q+ WIN+P  
Sbjct  120  CLAEESAIVWKDDMIVQDVVLRLRNVESGELELQLNWINIPGA  162



>ref|XP_008804356.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Phoenix dactylifera]
Length=165

 Score =   197 bits (501),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 126/166 (76%), Gaps = 1/166 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+ LLGLL+VR+ RG+N+A RD R SDPYV++++G QKL+T V K++ NPEWNE+LTL V
Sbjct  1    MEHLLGLLRVRVVRGVNIAYRDTRGSDPYVVLRLGHQKLKTSVKKKNNNPEWNEELTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            SDP+  I++ V+D DTFS DD+MG AE +I+   EA+KMD         IV  V P R+N
Sbjct  61   SDPTQTIRLEVFDKDTFSGDDRMGDAEFEIQPFFEAVKMD-LTGLPNGTIVTTVKPERNN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSKQ  274
            CL+ ES ++ KDG+VTQD+ LRL+NVESGEV++Q+QW+++P  + Q
Sbjct  120  CLSGESVILWKDGRVTQDLVLRLRNVESGEVELQLQWVSIPGAAGQ  165



>ref|XP_010032687.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Eucalyptus grandis]
 ref|XP_010032688.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Eucalyptus grandis]
 gb|KCW52142.1| hypothetical protein EUGRSUZ_J01588 [Eucalyptus grandis]
Length=165

 Score =   197 bits (501),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 129/165 (78%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+ LLGLL++ + RG+NLA+RD RSSDPYV+++ GK KL+T V+KR++NPEWN++LTL +
Sbjct  1    MEHLLGLLRIHVLRGVNLAIRDVRSSDPYVVIRTGKHKLKTRVVKRNLNPEWNDELTLAI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DPSL I++ VYD D FS DDKMG AEI I   L+AL+M   ++     ++ RV PGR N
Sbjct  61   ADPSLSIELMVYDKDKFSLDDKMGDAEIHIVPFLDALRM-RLDDVPSGTVITRVKPGRDN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ES +V ++GKV QDM LRL+NVE GEV++Q++WI++P GS+
Sbjct  120  CLAEESSIVWRNGKVVQDMVLRLRNVERGEVELQLEWIDIP-GSR  163



>ref|XP_006379768.1| hypothetical protein POPTR_0008s13070g [Populus trichocarpa]
 gb|ERP57565.1| hypothetical protein POPTR_0008s13070g [Populus trichocarpa]
Length=173

 Score =   197 bits (502),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 127/161 (79%), Gaps = 1/161 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MDS LGLL++R+KRG+NLAVRD  SSDPYV++ MG QKL+T V+K++ NP WNE+LTL +
Sbjct  1    MDSFLGLLRIRVKRGVNLAVRDLGSSDPYVVITMGNQKLKTRVVKKNCNPVWNEELTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +D ++PI +TV+D DTF+ DDKMG A ID++  + +LKM    N  +  +V+RV P ++N
Sbjct  61   TDLNVPINLTVFDKDTFTVDDKMGEAGIDLQPYIASLKM-GLQNLPKGCVVSRVQPSQNN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLP  289
            CLA ESC+V  DGK+ QDM LRL+NVESGEV IQI+WI++P
Sbjct  120  CLADESCIVWDDGKLHQDMILRLRNVESGEVTIQIEWIDVP  160



>ref|XP_002312449.1| C2 domain-containing family protein [Populus trichocarpa]
 gb|EEE89816.1| C2 domain-containing family protein [Populus trichocarpa]
Length=171

 Score =   197 bits (501),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 127/162 (78%), Gaps = 1/162 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MDS LGLL++R+KRG+NLAVRD  SSDPYV++ MG QKL+T V+K++ NP WNE+LTL +
Sbjct  1    MDSFLGLLRIRVKRGVNLAVRDLGSSDPYVVITMGNQKLKTRVVKKNCNPVWNEELTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +D ++PI +TV+D DTF+ DDKMG A ID++  + +LKM    N  +  +V+RV P ++N
Sbjct  61   TDLNVPINLTVFDKDTFTVDDKMGEAGIDLQPYIASLKM-GLQNLPKGCVVSRVQPSQNN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPS  286
            CLA ESC+V  DGK+ QDM LRL+NVESGEV IQI+WI++P 
Sbjct  120  CLADESCIVWDDGKLHQDMILRLRNVESGEVTIQIEWIDVPG  161



>ref|XP_011023686.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X1 [Populus euphratica]
Length=181

 Score =   197 bits (501),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 127/161 (79%), Gaps = 1/161 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MDS LGLL++R+KRG+NLAVRD  SSDPYV++ MG QKL+T V+K++ NP WNE+LTL +
Sbjct  1    MDSFLGLLRIRVKRGVNLAVRDLGSSDPYVVITMGNQKLKTRVVKKNCNPVWNEELTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +D ++PI +TV+D DTF+ DDKMG A IDI+  + +LKM    N  +  +V+RV P ++N
Sbjct  61   TDLNVPINLTVFDKDTFTVDDKMGEAGIDIQPYIASLKM-GLQNLPKGCVVSRVQPSQNN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLP  289
            CLA ESC+V  DGK+ QDM LRL+NVESGEV IQI+WI++P
Sbjct  120  CLADESCIVWDDGKLLQDMVLRLRNVESGEVMIQIEWIDVP  160



>ref|XP_009370095.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X2 [Pyrus x bretschneideri]
Length=165

 Score =   196 bits (499),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++++GLL++ I++G+NLAVRD RSSDPYV+V MGKQKL+T V+K++VNPEWNE +TL V
Sbjct  1    MENVMGLLRIHIQKGVNLAVRDMRSSDPYVVVNMGKQKLKTRVVKKNVNPEWNEKVTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +D  LPI+++VYD DTFS DDKMG AE +I   ++ L+M      D   I+ +V P R N
Sbjct  61   ADAILPIRLSVYDKDTFSFDDKMGDAEFEIGTFIKVLRMGLVGLPDGT-IITKVQPSRKN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPS  286
            CLA ES +V   GKV Q+M LRL+NVE GEV++Q+QWIN+PS
Sbjct  120  CLAEESYIVWSKGKVVQNMVLRLRNVECGEVELQLQWINVPS  161



>ref|XP_010500394.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X2 [Camelina sativa]
Length=169

 Score =   196 bits (499),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 129/169 (76%), Gaps = 6/169 (4%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQ-KLRTHVLKRDVNPEWNEDLTLY  595
            M++LLGLL++RIKRG+NLAVRD  SSDPYV+VKMGKQ KL+T V+  +VNPEWNEDLTL 
Sbjct  1    MNNLLGLLRIRIKRGVNLAVRDLHSSDPYVVVKMGKQQKLKTRVIYHNVNPEWNEDLTLS  60

Query  594  VSDPSLPIKVTVYDHDTFSKDDK---MGYAEIDIKHLLEALKMDNHNNSDEERIVARVPP  424
            V+DP+L + +TVYDHDTF+KDDK   MG AE  IK  + A+KM  H+      IV  V P
Sbjct  61   VTDPNLTVLLTVYDHDTFTKDDKMGDMGDAEFIIKPFVNAVKMQLHDLP-SGTIVTTVQP  119

Query  423  GRSNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
             R NCLA ES V+  DGK+ QD+ LRL++VE GE++ Q+QWI+LP GSK
Sbjct  120  SRDNCLAEESRVIWSDGKLIQDLVLRLRHVECGEIEAQLQWIDLP-GSK  167



>ref|XP_009370096.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Pyrus x bretschneideri]
Length=165

 Score =   196 bits (497),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++++GLL V ++RG+NLAVRD RSSDPYV+VKMGKQKL+T V+KR+VNP W+E LTL V
Sbjct  1    MENIMGLLSVHVQRGVNLAVRDMRSSDPYVVVKMGKQKLKTGVVKRNVNPVWDETLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            ++P+LPI + VYD D FS DDKMG AE +I   ++ L+M      D   ++A+V P R N
Sbjct  61   TEPNLPITLCVYDKDRFSFDDKMGDAEFEIALFVKVLRMRLEGLLDGT-VIAKVQPNREN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPS  286
            CLA ESC++   GK+ Q+M LRL+NVE GEV++Q+QWI++PS
Sbjct  120  CLAEESCIIWSKGKLVQNMALRLRNVECGEVELQLQWIDVPS  161



>emb|CDP02696.1| unnamed protein product [Coffea canephora]
Length=166

 Score =   196 bits (497),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 127/162 (78%), Gaps = 2/162 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQ-KLRTHVLKRDVNPEWNEDLTLY  595
            M++LLGLL++ + RG+NLA+RD RSSDPY+IV+MGKQ KL+T V+K++VNPEWNEDLTL 
Sbjct  1    MENLLGLLRIHVIRGVNLAIRDVRSSDPYIIVRMGKQQKLKTRVVKKNVNPEWNEDLTLS  60

Query  594  VSDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRS  415
            ++DPS+PIK+ V+D DTFS DDKMG AE DI   +EA++M    N     ++  V P R 
Sbjct  61   IADPSIPIKLQVFDKDTFSFDDKMGDAEFDIGPFIEAVRM-RLENIPSGTVITNVKPSRQ  119

Query  414  NCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLP  289
            NCLA +S +V ++GKV Q M LRL+NVE GEV+++++WI++P
Sbjct  120  NCLAEDSNIVWENGKVKQHMFLRLRNVERGEVELRLEWIDIP  161



>ref|XP_008381349.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X1 [Malus domestica]
Length=166

 Score =   196 bits (497),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 126/163 (77%), Gaps = 2/163 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQ-KLRTHVLKRDVNPEWNEDLTLY  595
            M++++GLL++ I++G+NLAVRD  SSDPYV+VKMGKQ KL+T V+K++VNPEWNE LTL 
Sbjct  1    MENMMGLLRIHIQKGVNLAVRDMXSSDPYVVVKMGKQQKLKTRVVKKNVNPEWNEKLTLS  60

Query  594  VSDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRS  415
            V+DP+LPI+++VYD DTFS DDKMG AE +I   ++ L+M      D   I+ +V P R 
Sbjct  61   VADPNLPIRLSVYDKDTFSFDDKMGDAEFEIGTFIKVLRMGLEGLPDGT-IITKVQPSRK  119

Query  414  NCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPS  286
            NCLA ES +V   GKV  +M LRL+NVE GEV++Q+QWIN+PS
Sbjct  120  NCLAEESYIVWSKGKVVXNMVLRLRNVECGEVELQLQWINVPS  162



>ref|XP_002527798.1| ARF GTPase activator, putative [Ricinus communis]
 gb|EEF34608.1| ARF GTPase activator, putative [Ricinus communis]
Length=171

 Score =   196 bits (497),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 127/161 (79%), Gaps = 1/161 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+++LGLL++R+KRG+NLAVRD  +SDP+V+V MG Q L+T V+K++ NPEWNE+LTL +
Sbjct  1    MENILGLLRIRVKRGVNLAVRDLGASDPFVVVNMGHQTLKTRVVKKNCNPEWNEELTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
             DP +PIK+ V+D DTF+ DDKMG A IDIK  + +LKM      +   +V+RV P + N
Sbjct  61   EDPIVPIKLAVFDKDTFTLDDKMGDAHIDIKPYIASLKMGLQTLPN-GCVVSRVQPSKDN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLP  289
            CLA ESC+V  +GK+TQDM LRL+NVESGEV++Q++WI++P
Sbjct  120  CLADESCIVWNNGKITQDMHLRLRNVESGEVEVQVEWIDVP  160



>gb|KEH36497.1| calcium-dependent lipid-binding (CaLB domain) family protein 
[Medicago truncatula]
Length=164

 Score =   195 bits (495),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 125/163 (77%), Gaps = 2/163 (1%)
 Frame = -1

Query  765  SLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYVSD  586
            +LLGLL + ++RG+NLA+RD  SSDPYVI+KMGKQKL+T V+K+++NP+WN+DLTL +SD
Sbjct  2    NLLGLLGIHVERGVNLAIRDVISSDPYVIIKMGKQKLKTRVVKKNLNPKWNDDLTLTISD  61

Query  585  PSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSNCL  406
            P  PI + VYD D FS DDKMG AE DI   +EA+KM      ++  I+ RV P R NCL
Sbjct  62   PHTPIHLHVYDKDRFSMDDKMGDAEFDISPFVEAVKMRLQGLPNDT-IITRVQPSRQNCL  120

Query  405  AAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            A ES +V+K+GKV Q + LRL+NVE GEV+IQ+ WI++P GSK
Sbjct  121  AGESHIVLKNGKVVQKLVLRLRNVECGEVEIQLHWIDIP-GSK  162



>ref|XP_008809823.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Phoenix dactylifera]
Length=166

 Score =   195 bits (495),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 123/163 (75%), Gaps = 1/163 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            ++ LLGLL+VR+++G+NLAVRD RSSDPYV+++MG+QKL+T  ++++ NP WNE+LTL V
Sbjct  2    VEHLLGLLRVRVQKGVNLAVRDVRSSDPYVVLRMGRQKLKTRTIQKNTNPVWNEELTLSV  61

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
             DP  P+++ VYD DTFS DD MG AE DI+  LEA++MD     +   I+ +V P R N
Sbjct  62   EDPPPPVRLQVYDKDTFSFDDPMGDAEFDIQPFLEAVRMDPEGVPNGT-IITKVRPNRQN  120

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSG  283
            CLA ES +   DGKV QD+ LRL+NVE GEV++Q+QWI++P  
Sbjct  121  CLAEESLIYWSDGKVIQDLVLRLRNVECGEVELQLQWISIPGA  163



>ref|XP_002455977.1| hypothetical protein SORBIDRAFT_03g028370 [Sorghum bicolor]
 gb|EES01097.1| hypothetical protein SORBIDRAFT_03g028370 [Sorghum bicolor]
Length=166

 Score =   194 bits (494),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 130/165 (79%), Gaps = 3/165 (2%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            +D L+GL+KVR+ RG+NLA+RD RSSDPYV+V++GKQKL+T V+K+  NPEWNE+LTL +
Sbjct  2    LDHLVGLVKVRVVRGVNLAIRDLRSSDPYVVVRIGKQKLKTRVVKKSTNPEWNEELTLSI  61

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
             DP++P+++ V+D DTF  DD MG AE+DI+ L+E +KM   + +D+  +V ++ P R N
Sbjct  62   EDPAVPVRLEVFDKDTFV-DDTMGNAEVDIRPLVEIVKMKLQDVADKT-VVKKLVPNRQN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ES + I +GKV QD+ LRL+NVE GE+++Q+ W++LP GSK
Sbjct  120  CLAEESSIYISEGKVKQDLVLRLRNVECGEIELQLHWVDLP-GSK  163



>gb|EYU44565.1| hypothetical protein MIMGU_mgv1a015143mg [Erythranthe guttata]
Length=167

 Score =   194 bits (494),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 125/161 (78%), Gaps = 1/161 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+++LGLL+++I RGINLA+RDA SSDPYVIV+M KQKL+T V+K+++NPEWNE+LTL +
Sbjct  1    MENILGLLRIKIIRGINLAIRDAISSDPYVIVRMAKQKLKTRVVKKNLNPEWNEELTLTI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            SDP++PIK+ VYD DTF+ DDKMG A   IK  +EA+KM    N     IV +V P R N
Sbjct  61   SDPNIPIKLQVYDKDTFTLDDKMGDAYFSIKEFVEAVKM-KLENIPSGTIVTKVRPNREN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLP  289
            CL+ +S +  ++GKVTQ M LRL NVE GE+++Q+ WI++P
Sbjct  120  CLSEDSFIKWENGKVTQSMFLRLNNVECGEIELQLHWIDIP  160



>ref|XP_006647209.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Oryza brachyantha]
Length=165

 Score =   194 bits (494),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 128/162 (79%), Gaps = 3/162 (2%)
 Frame = -1

Query  762  LLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYVSDP  583
            L+GL+KVR+ RG+NLAVRD RSSDPYVIV+MGKQKL+T V+K+  NPEWN++LTL + DP
Sbjct  5    LVGLVKVRVVRGVNLAVRDLRSSDPYVIVRMGKQKLKTRVIKKTTNPEWNDELTLSIEDP  64

Query  582  SLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSNCLA  403
            ++P+++ VYD DTF  DD MG AE+DI+ L+E +KM     +D+  +V +V P R NCLA
Sbjct  65   AVPVRLEVYDKDTFI-DDAMGNAELDIRPLVEVVKMKIEGVADDT-VVKKVAPNRQNCLA  122

Query  402  AESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
             ES + I +GKV QD+ LRL++VE GE+++Q+QW+++P GSK
Sbjct  123  EESAIYISEGKVKQDVVLRLRDVECGEIELQLQWVDIP-GSK  163



>gb|KDO50845.1| hypothetical protein CISIN_1g031128mg [Citrus sinensis]
Length=164

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 125/165 (76%), Gaps = 3/165 (2%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++L+GLL+V + RG+NLAVRD  SSDPYV++KMGKQ L+T V+K +VNPEWNEDLTL +
Sbjct  1    MENLMGLLRVHVLRGVNLAVRDVVSSDPYVVIKMGKQ-LKTRVVKNNVNPEWNEDLTLSI  59

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            SD +LPIK+TVYD DTFS DDKMG AE  I   LEALKM          IV ++ P R N
Sbjct  60   SDSNLPIKLTVYDKDTFSLDDKMGDAEFYITPFLEALKM-RLEGLPNGTIVTKIQPSREN  118

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ES +V  DGK+ Q++ LRL+NVE GEV IQ++WI++P GS+
Sbjct  119  CLAEESHIVWTDGKLVQNLFLRLRNVEVGEVKIQLEWIDIP-GSR  162



>ref|XP_011002782.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Populus euphratica]
Length=165

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 128/165 (78%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++L+GLL++ + RG+NLAVRD  SSDP V+VKMGKQKL+T V+K+++NPEWN+DLTL +
Sbjct  1    MENLMGLLRIHVIRGVNLAVRDVCSSDPDVVVKMGKQKLKTRVVKKNINPEWNDDLTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
             DP LP+ + VYD DTFS DDKMG AE DI   +E +KM   +N     I+ ++ P R N
Sbjct  61   VDPKLPVLIRVYDKDTFSLDDKMGDAEFDISQFIEVVKM-RLDNLPSGTIIRKIQPNREN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ESC+V  +GKV Q++ LRL++VE+GEV++Q++WI++P GS+
Sbjct  120  CLAEESCIVWANGKVVQNLFLRLRHVETGEVELQLEWIDIP-GSR  163



>ref|XP_009370098.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X1 [Pyrus x bretschneideri]
Length=165

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 124/162 (77%), Gaps = 1/162 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++++GLL V ++RG+NLAVRD RSSDPYV+VKMGKQKL+T V+KR+VNP W+E L L V
Sbjct  1    MENIMGLLSVHVQRGVNLAVRDMRSSDPYVVVKMGKQKLKTGVVKRNVNPVWDETLALSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            ++P+LPI + VYD D FS DDKMG AE +I   ++ L+M      D   ++A+V P R N
Sbjct  61   TEPNLPITLCVYDKDRFSFDDKMGDAEFEIALFVKVLRMRLEGLLDGT-VIAKVQPNREN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPS  286
            CLA ESC++   GK+ Q+M LRL+NVE GEV++Q+QWI++PS
Sbjct  120  CLAEESCIIWSKGKLVQNMALRLRNVECGEVELQLQWIDVPS  161



>ref|NP_001235515.1| uncharacterized protein LOC100306214 [Glycine max]
 gb|ACU14285.1| unknown [Glycine max]
 gb|KHN17942.1| Putative ADP-ribosylation factor GTPase-activating protein AGD13 
[Glycine soja]
Length=165

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 127/166 (77%), Gaps = 2/166 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL++ +++G+NLA+RD  SSDPYV++KMGKQKL+T V+ +++NPEWN+DLTL +
Sbjct  1    MENLLGLLRIHVEKGVNLAIRDVVSSDPYVVIKMGKQKLKTRVVNKNLNPEWNDDLTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            SDP  PI + VYD DTFS DDKMG AE  I   +EA+KM   ++     IV +V P R N
Sbjct  61   SDPHAPIHLHVYDKDTFSMDDKMGDAEFFIGPFIEAVKM-RLSSLPNNTIVTKVLPSRQN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSKQ  274
             LA ES +V KDGKV Q+M LRL+NVE+GEV++Q+ WI++P GS+ 
Sbjct  120  SLAEESHIVWKDGKVVQNMVLRLRNVETGEVELQLHWIDIP-GSRH  164



>ref|XP_009418909.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Musa acuminata subsp. malaccensis]
Length=170

 Score =   193 bits (491),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 127/162 (78%), Gaps = 2/162 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMG-KQKLRTHVLKRDVNPEWNEDLTLY  595
            MD LLGLL+VR+ RG++LA RDA  SDPYV+V+MG +QKL+T V K +VNP WNEDLTL 
Sbjct  1    MDHLLGLLRVRVVRGVSLAYRDATGSDPYVVVRMGGQQKLKTSVKKHNVNPVWNEDLTLT  60

Query  594  VSDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRS  415
            VSDP+ P+K+ VYD DTFS+DDKMG AEIDI   +EA+KM N ++   + I+  + P R 
Sbjct  61   VSDPTQPVKIRVYDKDTFSRDDKMGDAEIDIVPFVEAVKM-NLSDIPNDTIIKTMNPNRH  119

Query  414  NCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLP  289
            NCLA +S +V K+GKV QD+ +RL+NVESGE+++Q+ W+++P
Sbjct  120  NCLAEDSAIVWKEGKVVQDIIVRLRNVESGELELQLLWVDIP  161



>ref|XP_009144399.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Brassica rapa]
 emb|CDY38572.1| BnaA05g13010D [Brassica napus]
Length=168

 Score =   193 bits (490),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 124/167 (74%), Gaps = 3/167 (2%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL++ +KRG+NLA+RD  SSDPYV+V  GKQKL+THV+K  VNPEWN+DLTL V
Sbjct  1    MENLLGLLRIHVKRGVNLAIRDISSSDPYVVVHSGKQKLKTHVIKHSVNPEWNDDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKM--DNHNNSDEERIVARVPPGR  418
            +DP+LPIK+TVYD D FS DDKMG AE  I   LEA+K             I+ ++ P R
Sbjct  61   TDPNLPIKLTVYDKDLFSADDKMGEAEFSIATYLEAVKYRPKVEGGLPNGTIIMKIQPTR  120

Query  417  SNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
             NCL+ ES +V   GK+ Q+M LRL++VE GEV+IQ++WI++P GSK
Sbjct  121  QNCLSEESHIVWNQGKLVQNMFLRLQHVECGEVEIQLEWIDVP-GSK  166



>ref|NP_001046709.1| Os02g0327000 [Oryza sativa Japonica Group]
 dbj|BAD15699.1| C2 domain-containing protein-like [Oryza sativa Japonica Group]
 dbj|BAD16390.1| C2 domain-containing protein-like [Oryza sativa Japonica Group]
 dbj|BAF08623.1| Os02g0327000 [Oryza sativa Japonica Group]
 gb|EAY85639.1| hypothetical protein OsI_07012 [Oryza sativa Indica Group]
 gb|EAZ22831.1| hypothetical protein OsJ_06508 [Oryza sativa Japonica Group]
 gb|ABU62827.1| G-protein binding protein [Oryza sativa Japonica Group]
 dbj|BAG96469.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93560.1| unnamed protein product [Oryza sativa Japonica Group]
Length=165

 Score =   193 bits (490),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 127/162 (78%), Gaps = 3/162 (2%)
 Frame = -1

Query  762  LLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYVSDP  583
            L+GL+KVR+ RG+NLAVRD RSSDPYVIV+MGKQKL+T V+K+  NPEWN++LTL + DP
Sbjct  5    LVGLVKVRVVRGVNLAVRDLRSSDPYVIVRMGKQKLKTRVIKKTTNPEWNDELTLSIEDP  64

Query  582  SLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSNCLA  403
            ++P+++ VYD DTF  DD MG AE+DI+ L+E +KM     +D   +V +V P R NCLA
Sbjct  65   AVPVRLEVYDKDTFI-DDAMGNAELDIRPLVEVVKMKIEGVADNT-VVKKVVPNRQNCLA  122

Query  402  AESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
             ES + I +GKV QD+ LRL++VE GE+++Q+QW+++P GSK
Sbjct  123  EESTIYISEGKVKQDVVLRLRDVECGEIELQLQWVDIP-GSK  163



>ref|XP_009388652.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Musa acuminata subsp. malaccensis]
Length=173

 Score =   193 bits (490),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 120/159 (75%), Gaps = 1/159 (1%)
 Frame = -1

Query  765  SLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYVSD  586
             ++GLLKVR+ RG+NLAVRD  SSDPYVI+KMGKQKL+T V+K + NP WNE+LTLYV D
Sbjct  11   QMVGLLKVRVLRGVNLAVRDLWSSDPYVILKMGKQKLKTRVIKCNTNPVWNEELTLYVED  70

Query  585  PSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSNCL  406
            P+LP+++ VYD DTFS DD+MG AE DI   +EA+KM N        I+ +V P R NCL
Sbjct  71   PTLPVRLEVYDKDTFSLDDRMGNAEFDIHPFVEAVKM-NLEGLPNGTIIRKVVPCRRNCL  129

Query  405  AAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLP  289
            A ES V   DG+V QD+ LRL+NVE GEV++Q+ WI++P
Sbjct  130  AEESHVYWSDGEVVQDLVLRLRNVERGEVELQLHWISIP  168



>ref|XP_009370094.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 isoform X1 [Pyrus x bretschneideri]
Length=166

 Score =   192 bits (487),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 125/163 (77%), Gaps = 2/163 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQ-KLRTHVLKRDVNPEWNEDLTLY  595
            M++++GLL++ I++G+NLAVRD RSSDPYV+V MGKQ KL+T V+K++VNPEWNE +TL 
Sbjct  1    MENVMGLLRIHIQKGVNLAVRDMRSSDPYVVVNMGKQQKLKTRVVKKNVNPEWNEKVTLS  60

Query  594  VSDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRS  415
            V+D  LPI+++VYD DTFS DDKMG AE +I   ++ L+M      D   I+ +V P R 
Sbjct  61   VADAILPIRLSVYDKDTFSFDDKMGDAEFEIGTFIKVLRMGLVGLPDGT-IITKVQPSRK  119

Query  414  NCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPS  286
            NCLA ES +V   GKV Q+M LRL+NVE GEV++Q+QWIN+PS
Sbjct  120  NCLAEESYIVWSKGKVVQNMVLRLRNVECGEVELQLQWINVPS  162



>ref|XP_002868538.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44797.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=168

 Score =   192 bits (487),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 123/165 (75%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL++ +KRG+NLA+RD  SSDPYV+V  GKQKL+T V+K  VNPEWN+DLTL V
Sbjct  1    MENLLGLLRIHVKRGVNLAIRDISSSDPYVVVHSGKQKLKTRVVKHSVNPEWNDDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSD--EERIVARVPPGR  418
            +DP+LPIK+TVYD+D FS DDKMG AE  I   LEA+K  +          I+ ++ P R
Sbjct  61   TDPNLPIKLTVYDYDLFSADDKMGEAEFHIGPFLEAIKFCHQLGPGLPSGTIIRKIEPSR  120

Query  417  SNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSG  283
             NCL+ ES +V+  GK+ Q+M LRL++VE GEV++Q++WI++P  
Sbjct  121  KNCLSEESHIVLNQGKIVQNMFLRLQHVECGEVELQLEWIDVPGA  165



>ref|XP_006469315.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13-like [Citrus sinensis]
Length=172

 Score =   192 bits (487),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 121/161 (75%), Gaps = 1/161 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            ++S+LGLLK+R+KRGINLAVRDA SSDPYV++ MGKQK++THV+  + NP WN DLTL +
Sbjct  5    VESMLGLLKIRVKRGINLAVRDALSSDPYVVITMGKQKMKTHVINSNCNPVWNCDLTLPI  64

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
             DP+LP+ +TVYD DTFS DDKMG A IDIK  +  LKM   N  +   I  ++ P R+N
Sbjct  65   RDPNLPVHLTVYDKDTFSVDDKMGEANIDIKPYIACLKMGLENLPNGCAI-KKIQPTRTN  123

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLP  289
            CL  ES ++  +GK+TQDM LRL NVE GEV+IQ+ W+ +P
Sbjct  124  CLLDESSIIWNNGKITQDMSLRLNNVECGEVEIQLDWVEVP  164



>ref|XP_004231984.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Solanum lycopersicum]
Length=165

 Score =   191 bits (486),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 129/165 (78%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGL++VRI RGINLA+RD  +SDPYV+V+MGKQKL+T V+K+++NPEWNE+LTL +
Sbjct  1    MENLLGLMRVRIHRGINLAIRDVTTSDPYVVVRMGKQKLKTRVVKKNLNPEWNEELTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            ++P LPIK+ VYD D FS DDKMG AE+DI+  ++A +   + N     I+ ++ P R N
Sbjct  61   TEPILPIKLHVYDKDIFSLDDKMGDAEVDIQPFIDAAR-KRYKNIPSGTIITKIKPSRQN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            C + ES +V ++ +V Q++ +RL+NVE GE+++Q+QWI++P GSK
Sbjct  120  CFSEESSIVWENDQVVQNVFIRLRNVERGEIELQLQWIDIP-GSK  163



>gb|KFK41793.1| hypothetical protein AALP_AA2G172800 [Arabis alpina]
Length=808

 Score =   205 bits (522),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 132/165 (80%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MD+LLG+L+VR+KRGINLAVRD  SSDPYV++K+G+QKL+T V+K++VNP+W EDLT  V
Sbjct  644  MDNLLGILRVRVKRGINLAVRDVCSSDPYVVLKLGRQKLKTKVVKKNVNPKWEEDLTFTV  703

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP+LP+ + VYDHD FSKDDKMG AEID+K  +EAL+M+     D   I++ + P R N
Sbjct  704  TDPNLPLNLIVYDHDFFSKDDKMGDAEIDLKPYIEALRMELSGLPDGT-IISTINPSRGN  762

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ES V   + ++ Q++CLRL+NVE GEV++++QWI+LP GSK
Sbjct  763  CLAEESYVRCINDRIIQNICLRLRNVERGEVEVELQWIDLP-GSK  806



>ref|XP_004952325.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Setaria italica]
Length=165

 Score =   191 bits (485),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 129/165 (78%), Gaps = 3/165 (2%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            +D L+GL+KVR+ RG+NLA+RD RSSDPYV+V++GKQKL+T V+K+  NPEWNE+LTL +
Sbjct  2    LDHLVGLVKVRVVRGVNLAIRDLRSSDPYVVVRIGKQKLKTRVIKKSTNPEWNEELTLSI  61

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
             +P+ P+++ V+D DTF  DD MG AE+DI+ L++ +KM   +  D+  IV +V P R N
Sbjct  62   ENPADPVRLEVFDKDTFV-DDSMGNAELDIRPLVDVVKMKLQDVPDKT-IVKKVVPNREN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ES + + +GKV QD+ +RLKNVE GE+++Q+QW++LP GSK
Sbjct  120  CLAEESSIYVSEGKVKQDLVVRLKNVECGEIELQLQWVDLP-GSK  163



>emb|CDY27005.1| BnaC06g12210D [Brassica napus]
Length=168

 Score =   191 bits (485),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 124/167 (74%), Gaps = 3/167 (2%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL++ +KRG+NLA+RD  SSDPYV+V  GKQKL+THV+K+ VNPEWN+DLTL V
Sbjct  1    MENLLGLLRIHVKRGVNLAIRDISSSDPYVVVHSGKQKLKTHVIKQSVNPEWNDDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKM--DNHNNSDEERIVARVPPGR  418
            +DP+ PIK+TVYD D FS DDKMG AE  I   LEA+K             I+ ++ P R
Sbjct  61   TDPNQPIKLTVYDKDLFSADDKMGEAEFSIATYLEAVKYRPKVEGGLPNGTIIMKIQPTR  120

Query  417  SNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
             NCL+ ES +V   GK+ Q+M LRL++VE GEV+IQ++WI++P GSK
Sbjct  121  QNCLSEESHIVWNQGKLVQNMFLRLQHVECGEVEIQLEWIDVP-GSK  166



>emb|CDY07499.1| BnaA07g25780D [Brassica napus]
Length=175

 Score =   191 bits (485),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 125/161 (78%), Gaps = 1/161 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+++LGLL++ + RG+NLA+RD++SSDPYVIV+MG+QKLRT V+K+++NPEWNEDLTL +
Sbjct  1    MENMLGLLRLHVIRGVNLAIRDSKSSDPYVIVRMGQQKLRTRVVKKNLNPEWNEDLTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNS-DEERIVARVPPGRS  415
            SDP LPIK+ VYD D FS+DDKMG A   I   LEA+++ N      E  ++ ++   R 
Sbjct  61   SDPVLPIKIMVYDRDWFSRDDKMGDAFFHIDPFLEAIRIQNQFRGLPEGTVIMKIQASRQ  120

Query  414  NCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINL  292
            NCL+ ES +V  +GK+ Q+M L+L+NVE GEVD+Q++WI++
Sbjct  121  NCLSEESKIVWNNGKIVQNMFLKLQNVECGEVDLQLEWIDV  161



>ref|XP_006405837.1| hypothetical protein EUTSA_v10027968mg [Eutrema salsugineum]
 gb|ESQ47290.1| hypothetical protein EUTSA_v10027968mg [Eutrema salsugineum]
Length=168

 Score =   191 bits (484),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 125/167 (75%), Gaps = 3/167 (2%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL++ +KRG+NLA+RD  SSDPYV+V  GKQKL+T V+K  VNPEWN+DLTL V
Sbjct  1    MENLLGLLRIHVKRGVNLAIRDISSSDPYVVVHSGKQKLKTRVIKHSVNPEWNDDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDN--HNNSDEERIVARVPPGR  418
            +DP+LPIK+TVYD D FS DDKMG AE +I   LEA+K  +          I+ ++ P R
Sbjct  61   TDPNLPIKLTVYDKDLFSADDKMGEAEFNIATYLEAIKFRHKLEGGLPNGTIIMKIQPSR  120

Query  417  SNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
             NCL+ ES +V   GK+ Q+M LRL++VE GEV++Q++WI++P GS+
Sbjct  121  QNCLSEESHIVWNQGKLVQNMFLRLQHVECGEVELQLEWIDVP-GSR  166



>ref|XP_009612263.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Nicotiana tomentosiformis]
Length=165

 Score =   190 bits (483),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 126/163 (77%), Gaps = 1/163 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL++ I RGINLA+RD  SSDPYV+V++G+QKL+T V+K++VNPEWNEDLTL +
Sbjct  1    MENLLGLLRIHIHRGINLAIRDVTSSDPYVVVRLGRQKLKTRVVKKNVNPEWNEDLTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            ++P  PIK+ VYD D FS DDKMG AE+DI   ++A++     N     I+ ++ P R N
Sbjct  61   TEPIQPIKLQVYDKDIFSLDDKMGDAELDIFPFIDAVR-KRFENIPNGTIITKIKPSREN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSG  283
            C + ESC+V ++G+V Q++ +RL+NVE GE+++Q++WI++P+ 
Sbjct  120  CFSEESCIVWENGQVVQNVFIRLRNVERGEIELQLRWIDIPNS  162



>ref|XP_006843793.1| hypothetical protein AMTR_s00007p00249830 [Amborella trichopoda]
 gb|ERN05468.1| hypothetical protein AMTR_s00007p00249830 [Amborella trichopoda]
Length=165

 Score =   190 bits (483),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 123/160 (77%), Gaps = 1/160 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+ ++GLL+VR+ +G+NLAVRD RSSDPYV++ MGKQKL+T V++++VNP WNE+LT  +
Sbjct  1    MERVIGLLRVRVIKGVNLAVRDIRSSDPYVVLTMGKQKLKTRVIEKNVNPVWNEELTFSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            S P LP+K+ VYD D FS+DDKMG AE +I+  +E++++ N        ++ +V P R N
Sbjct  61   SHPILPVKLNVYDKDIFSRDDKMGDAEFEIESFMESVRL-NLEGVRSGTVIRKVAPCRQN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINL  292
            CLA ES +   DGKV QD+CLRL+NVE GEV++Q++WIN+
Sbjct  120  CLAEESLIRWVDGKVIQDLCLRLRNVECGEVELQLEWINV  159



>ref|XP_006357769.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11-like [Solanum tuberosum]
Length=165

 Score =   190 bits (483),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 129/165 (78%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGL++VRI RGINLA+RD  +SDPYV+V+MGKQKL+T V+K+++NPEWNE+LTL +
Sbjct  1    MENLLGLMRVRIHRGINLAIRDVTTSDPYVVVRMGKQKLKTRVVKKNLNPEWNEELTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            ++P LPI + VYD D FS DDKMG AEIDI   ++A++   + N     I+ ++ P R N
Sbjct  61   TEPILPINLHVYDKDIFSLDDKMGDAEIDIHPFIDAVR-KRYKNIPSGTIITKIKPSRQN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CL+ ES +V ++ +V Q++ +RL+NVE GE+++Q+QWI++P GSK
Sbjct  120  CLSEESPIVWENDQVVQNVFIRLRNVERGEIELQLQWIDIP-GSK  163



>ref|XP_003528543.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD12-like [Glycine max]
 gb|KHN43004.1| ADP-ribosylation factor GTPase-activating protein AGD12 [Glycine 
soja]
Length=170

 Score =   190 bits (483),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 126/161 (78%), Gaps = 1/161 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+++LGL+K+RIKRG NL   D R+SDPYV V M +QKL+T V+K ++NPEWNE+LTLYV
Sbjct  1    MENILGLIKLRIKRGTNLKACDTRTSDPYVFVTMAEQKLKTGVVKDNINPEWNEELTLYV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            SD ++P+ +TV D DTF+ DD MG AEID+K  L+ +KM N ++  +  ++ RV P R+N
Sbjct  61   SDVNIPVHLTVSDKDTFTVDDSMGDAEIDLKPYLQCVKM-NLSDLPDGHVIKRVQPDRTN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLP  289
            CLA ES  + K+GKVTQ+M LRL+NV+SGE+ ++I+W+NLP
Sbjct  120  CLAEESNCIWKNGKVTQEMSLRLRNVKSGEITVEIEWVNLP  160



>gb|KDO64606.1| hypothetical protein CISIN_1g048685mg [Citrus sinensis]
Length=172

 Score =   190 bits (483),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 120/161 (75%), Gaps = 1/161 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            ++S+LGLLK+R+KRGINLAVRDA SSDPYV++ MGKQK++THV+  + NP WN DLTL +
Sbjct  5    VESMLGLLKIRVKRGINLAVRDALSSDPYVVITMGKQKMKTHVINSNCNPVWNCDLTLPI  64

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
             DP+LP+ +TVYD DTFS DDKMG A IDIK  +  LKM   N  +   I  ++ P R N
Sbjct  65   RDPNLPVHLTVYDKDTFSVDDKMGEANIDIKPYIACLKMGLENLPNGCAI-KKIQPTRIN  123

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLP  289
            CL  ES ++  +GK+TQDM LRL NVE GEV+IQ+ W+ +P
Sbjct  124  CLLDESSIIWNNGKITQDMSLRLNNVECGEVEIQLDWVEVP  164



>ref|XP_009392867.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Musa acuminata subsp. malaccensis]
Length=183

 Score =   190 bits (483),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 120/164 (73%), Gaps = 1/164 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            ++ LLGLLKVR+ RG+NLA RDAR SDPYV+++MG QK++T V K++VNPEWNE+LTL V
Sbjct  11   VEHLLGLLKVRVLRGVNLAYRDARGSDPYVVLRMGSQKVKTGVKKKNVNPEWNEELTLSV  70

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            SD   PIK+ VYD DTFS+DD+MG AE+DI  LLEA KMD     D   I+  V PGR N
Sbjct  71   SDHIQPIKLEVYDKDTFSRDDQMGEAELDILPLLEAAKMDLSGVPDSS-IITSVKPGRQN  129

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGS  280
            CL  ES +    GK+ QD+ LRL+NVE GEV++Q+ W+    GS
Sbjct  130  CLVGESHIKWMGGKLVQDIILRLRNVECGEVELQLTWVKNSGGS  173



>ref|XP_010062251.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Eucalyptus grandis]
 gb|KCW69362.1| hypothetical protein EUGRSUZ_F02846 [Eucalyptus grandis]
Length=165

 Score =   189 bits (481),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 125/165 (76%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+ L+GLL++ I RG+NLA+RD +SSDPY+IVK GKQKL+T V++++ NPEWNEDLTL V
Sbjct  1    MEHLMGLLRIHIHRGVNLAIRDVKSSDPYIIVKFGKQKLKTRVIRKNTNPEWNEDLTLTV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +D +LP+++ VYD D  S DDKMG AE +I   +EAL+M   +      I+ RV P R N
Sbjct  61   ADHNLPVQLFVYDKDRLSFDDKMGDAEFEIGPFVEALRM-RLDELPSGTIITRVLPTRQN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ES VV  DGKV Q+M LRL+NVESGE++++++W ++P GS+
Sbjct  120  CLADESRVVWADGKVVQEMVLRLRNVESGEIELRLEWTDIP-GSR  163



>ref|XP_009105201.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Brassica rapa]
Length=175

 Score =   190 bits (482),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 125/161 (78%), Gaps = 1/161 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+++LGLL++ + RG+NLA+RD++SSDPYVIV+MG+QKLRT V+K+++NPEWNEDLTL +
Sbjct  1    MENMLGLLRLHVIRGVNLAIRDSKSSDPYVIVRMGQQKLRTRVVKKNLNPEWNEDLTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNS-DEERIVARVPPGRS  415
            SDP LPIK+ VYD D FS+DDKMG A   I   LEA+++ N      E  ++ ++   R 
Sbjct  61   SDPVLPIKIMVYDRDWFSRDDKMGDAFFHIDPFLEAIRIQNQFRGLPEGTVIMKIQASRQ  120

Query  414  NCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINL  292
            NCL+ ES +V  +GK+ Q+M L+L+NVE GEV++Q++WI++
Sbjct  121  NCLSEESKIVWNNGKIVQNMFLKLQNVECGEVELQLEWIDV  161



>ref|XP_010109008.1| putative ADP-ribosylation factor GTPase-activating protein AGD11 
[Morus notabilis]
 gb|EXC20648.1| putative ADP-ribosylation factor GTPase-activating protein AGD11 
[Morus notabilis]
Length=170

 Score =   189 bits (481),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 128/169 (76%), Gaps = 1/169 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++ LGLL++ ++RG+NLA+RD+ SSDPYV+V+MGKQKL+T V+KR+VNPEWN+ LTL V
Sbjct  1    MENWLGLLRIHVQRGVNLAIRDSISSDPYVVVRMGKQKLKTRVVKRNVNPEWNDFLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMD-NHNNSDEERIVARVPPGRS  415
            +DP+ P+K+ VYD DTFS DDKMG AE +I    +A+KM        +  I+++V   R 
Sbjct  61   TDPNTPVKLFVYDKDTFSFDDKMGDAEFEIGPFFKAVKMGLQLQGLPDGTIISKVEANRQ  120

Query  414  NCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSKQQS  268
            NC+A ES +++ + KV Q+M LRL+NVE GEV++Q+QWI++P+    Q+
Sbjct  121  NCVAEESKILVSNDKVVQNMVLRLRNVECGEVELQLQWIDVPTSKALQN  169



>ref|XP_006448228.1| hypothetical protein CICLE_v10017596mg [Citrus clementina]
 gb|ESR61468.1| hypothetical protein CICLE_v10017596mg [Citrus clementina]
Length=165

 Score =   189 bits (480),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 118/158 (75%), Gaps = 1/158 (1%)
 Frame = -1

Query  762  LLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYVSDP  583
            +LGLLK+R+KRGINLAVRDA SSDPYV++ MGKQK++THV+  + NP WN DLTL + DP
Sbjct  1    MLGLLKIRVKRGINLAVRDALSSDPYVVITMGKQKMKTHVINSNCNPVWNCDLTLPIRDP  60

Query  582  SLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSNCLA  403
            +LP+ +TVYD DTFS DDKMG A IDIK  +  LKM   N  +   I  ++ P R+NCL 
Sbjct  61   NLPVHLTVYDKDTFSVDDKMGEANIDIKPYIACLKMGLENLPNGCAI-KKIQPTRTNCLL  119

Query  402  AESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLP  289
             ES ++  +GK+TQDM LRL NVE GEV+IQ+ W+ +P
Sbjct  120  DESSIIWNNGKITQDMSLRLNNVECGEVEIQLDWVEVP  157



>ref|XP_003561505.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Brachypodium distachyon]
Length=164

 Score =   189 bits (480),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 123/165 (75%), Gaps = 1/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MD L+GLLKVR+ RG NLA RDAR SDPYV++++GKQKL+T V KR VNP W+E+LTL +
Sbjct  1    MDGLVGLLKVRVVRGYNLAYRDARGSDPYVVLRLGKQKLKTSVKKRSVNPIWHEELTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            ++P++PIK+ V+D DTFS+DD MG AEI+++ L+E L MD  N  +   ++  + P   N
Sbjct  61   TNPNVPIKLEVFDKDTFSRDDPMGDAEIEVEPLMEVLNMDPENMRNGT-VIRSIRPSNRN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ES +  K+G+  QD+ LRLKNVESGE+ +Q+QW+ +P   K
Sbjct  120  CLADESQLCWKNGRFIQDVILRLKNVESGEIQLQLQWVQIPGSKK  164



>gb|KFK41059.1| hypothetical protein AALP_AA2G080100 [Arabis alpina]
Length=167

 Score =   189 bits (480),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 124/161 (77%), Gaps = 1/161 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+++LGLL++ + RG+NLA+RD+ SSDPYVIV+MGKQKLRT V+K+++NPEWNEDLTL +
Sbjct  1    MENMLGLLRLHVIRGVNLAIRDSSSSDPYVIVRMGKQKLRTRVMKKNLNPEWNEDLTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNH-NNSDEERIVARVPPGRS  415
            +DP+LP+K+ VYD D FS+DDKMG A   I   LEA+++ N      +  ++ ++   R 
Sbjct  61   TDPTLPVKILVYDRDWFSRDDKMGDAVFHIDPFLEAIRIQNQLGGLPDGTVIMKIQASRQ  120

Query  414  NCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINL  292
            NCL+ ES +V   GK+ Q+M LRL+NVE GEV++Q++WI++
Sbjct  121  NCLSEESKIVWHKGKIVQNMFLRLQNVERGEVELQLEWIDV  161



>emb|CDX96152.1| BnaA07g25790D [Brassica napus]
Length=175

 Score =   189 bits (479),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 124/161 (77%), Gaps = 1/161 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+ +LGLL++ + RG+NLA+RD++SSDPYVIV+MG+QKLRT V+K+++NPEWNEDLTL +
Sbjct  1    MEDMLGLLRLHVIRGVNLAIRDSKSSDPYVIVRMGQQKLRTRVVKKNLNPEWNEDLTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNS-DEERIVARVPPGRS  415
            SDP LPIK+ VYD D FS+DDKMG A   I   LEA+++ N      E  ++ ++   R 
Sbjct  61   SDPILPIKIMVYDRDWFSRDDKMGDAFFHIDPFLEAIRIQNQFRGLPEGTVIMKIQASRQ  120

Query  414  NCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINL  292
            NCL+ ES +V  +GK+ Q+M L+L+NVE GEV++Q++WI++
Sbjct  121  NCLSEESKIVWNNGKIVQNMFLKLQNVECGEVELQLEWIDV  161



>ref|XP_007045191.1| Calcium-dependent lipid-binding family protein [Theobroma cacao]
 gb|EOY01023.1| Calcium-dependent lipid-binding family protein [Theobroma cacao]
Length=269

 Score =   192 bits (487),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 122/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  759  LGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYVSDPS  580
            +GLL+VR++RGINLA+RD  SSDPYV++ MG QKL+T V+K + NPEWN++LTL ++DP+
Sbjct  85   IGLLRVRVRRGINLAIRDTVSSDPYVVLIMGHQKLKTRVVKNNCNPEWNDELTLSINDPN  144

Query  579  LPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNH-NNSDEERIVARVPPGRSNCLA  403
            +PI +TVYD DTF+ DD+MG AEIDIK  + ALKM     N      + R+ PGR+NCLA
Sbjct  145  VPIILTVYDKDTFTVDDQMGNAEIDIKPYIAALKMGKGLQNLPNGCALKRIQPGRTNCLA  204

Query  402  AESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPS  286
             ES +V  DGK+TQDM LRLKNVE GEV IQ++WI +P 
Sbjct  205  DESSIVWNDGKITQDMHLRLKNVECGEVLIQLEWIEIPG  243



>ref|XP_010511455.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Camelina sativa]
Length=167

 Score =   188 bits (478),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 122/161 (76%), Gaps = 1/161 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL++ + RG+NLA+R++ SSDPYVIV+MGKQKLRT V+K+++NPEWNEDLTL +
Sbjct  1    MENLLGLLRLHVIRGVNLAIRNSHSSDPYVIVRMGKQKLRTRVMKKNLNPEWNEDLTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNH-NNSDEERIVARVPPGRS  415
            +DP+LPI + VYD D FS+DDKMG A   I   LEA+++ N      E  ++ ++   R 
Sbjct  61   TDPTLPINIMVYDRDWFSRDDKMGDAVFHIDPFLEAIRIQNELGGLPEGTVIMKIQASRQ  120

Query  414  NCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINL  292
            NCL+ ES +V   GK+ Q+M LRL+NVE GEV +Q++WI++
Sbjct  121  NCLSEESKIVWHKGKIVQNMFLRLQNVERGEVQLQLEWIDV  161



>ref|XP_009139749.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Brassica rapa]
 emb|CDX74561.1| BnaA04g08280D [Brassica napus]
Length=168

 Score =   188 bits (477),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 124/167 (74%), Gaps = 3/167 (2%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL++ +KRG+NLA+RD  SSDPY++   G +KL+THV+K+ VNPEWN+DLTL V
Sbjct  1    MENLLGLLRIHVKRGVNLAIRDIASSDPYIVFHFGNKKLKTHVVKQSVNPEWNDDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDN--HNNSDEERIVARVPPGR  418
            +DP+LP+K+TVYD D  S DDKMG AE  I   LEA+K  +          I+ ++ P R
Sbjct  61   TDPNLPVKLTVYDKDLLSADDKMGEAEFSIAPYLEAIKFRHKIQGGLPNGTIIMKIQPNR  120

Query  417  SNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
             NCL+ ES +V   GK+ Q+M +RL+NVE+GEV++Q++WI++P GS+
Sbjct  121  QNCLSEESHIVWNHGKLVQNMFIRLQNVETGEVELQLEWIDVP-GSR  166



>ref|XP_010470512.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Camelina sativa]
Length=167

 Score =   187 bits (476),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 120/161 (75%), Gaps = 1/161 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL++ + RG+NLA+RD+ SSDPYVIV+MGKQKLRT V+K+++NPEWNE LTL +
Sbjct  1    MENLLGLLRLHVIRGVNLAIRDSHSSDPYVIVRMGKQKLRTRVMKKNLNPEWNEGLTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNH-NNSDEERIVARVPPGRS  415
            +DP+LPI + VYD D FS+DD MG A   I   LEA+++ N      E  ++ ++   R 
Sbjct  61   TDPTLPINIMVYDRDWFSRDDTMGDAVFHIDPFLEAIRIQNELGGLPEGTVIMKIQASRQ  120

Query  414  NCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINL  292
            NCL+ ES +V   GK+ Q+M LRL+NVE GEV +Q++WIN+
Sbjct  121  NCLSEESKIVWHKGKIVQNMFLRLQNVERGEVQLQLEWINV  161



>ref|XP_009370099.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X2 [Pyrus x bretschneideri]
Length=170

 Score =   187 bits (476),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 124/167 (74%), Gaps = 6/167 (4%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQ-----KLRTHVLKRDVNPEWNED  607
            M++++GLL V ++RG+NLAVRD RSSDPYV+VKMGKQ     KL+T V+KR+VNP W+E 
Sbjct  1    MENIMGLLSVHVQRGVNLAVRDMRSSDPYVVVKMGKQVFIWLKLKTGVVKRNVNPVWDET  60

Query  606  LTLYVSDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVP  427
            L L V++P+LPI + VYD D FS DDKMG AE +I   ++ L+M      D   ++A+V 
Sbjct  61   LALSVTEPNLPITLCVYDKDRFSFDDKMGDAEFEIALFVKVLRMRLEGLLDGT-VIAKVQ  119

Query  426  PGRSNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPS  286
            P R NCLA ESC++   GK+ Q+M LRL+NVE GEV++Q+QWI++PS
Sbjct  120  PNRENCLAEESCIIWSKGKLVQNMALRLRNVECGEVELQLQWIDVPS  166



>ref|XP_006300898.1| hypothetical protein CARUB_v10021265mg [Capsella rubella]
 gb|EOA33796.1| hypothetical protein CARUB_v10021265mg [Capsella rubella]
Length=167

 Score =   187 bits (476),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 123/161 (76%), Gaps = 1/161 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL++ + RG+NLA+RD++SSDPYVIV+MGKQKLRT V+K+ +NPEWNEDLTL +
Sbjct  1    MENLLGLLRLHVIRGVNLAIRDSQSSDPYVIVRMGKQKLRTRVMKKILNPEWNEDLTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNH-NNSDEERIVARVPPGRS  415
            SDP+LP+K+ VYD D FS+DDKMG A   I   LEA+++ N      +  ++ ++   R 
Sbjct  61   SDPTLPVKIMVYDRDWFSRDDKMGDAVFYIDPFLEAIRIQNELGGLPDGTVIMKIQASRQ  120

Query  414  NCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINL  292
            NCL+ ES ++   GK+ Q+M LRL+NVE GEV +Q++WI++
Sbjct  121  NCLSEESKILWNKGKIVQNMFLRLQNVERGEVQLQLEWIDV  161



>gb|KHN08064.1| ADP-ribosylation factor GTPase-activating protein AGD12 [Glycine 
soja]
Length=170

 Score =   187 bits (476),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 123/161 (76%), Gaps = 1/161 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+++LGL+K+RIKRG NL V D R+ DPYV V M +QKL+T V+K  +NPEWNE+LTLYV
Sbjct  1    MENILGLIKLRIKRGTNLKVCDTRTCDPYVFVTMAEQKLKTGVVKDSINPEWNEELTLYV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            S+ ++P+ +TV D DTFS DD MG AEID+K  L+ +KMD  +  D   +V RV P R+N
Sbjct  61   SNVNIPVHLTVSDKDTFSVDDSMGDAEIDLKPYLQCVKMDLSDLPD-SHVVKRVQPDRTN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLP  289
            CLA ES  + K+GK+ Q+M LRL+NV+SGE+ ++I+W+NLP
Sbjct  120  CLAEESSCIWKNGKLIQEMSLRLRNVKSGEITVEIEWVNLP  160



>ref|XP_010109014.1| Bifunctional glutamate/proline--tRNA ligase [Morus notabilis]
 gb|EXC20654.1| Bifunctional glutamate/proline--tRNA ligase [Morus notabilis]
Length=499

 Score =   197 bits (500),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 127/165 (77%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+ L+GLL++ + RG+NLA+RD  SSDPYV++KMGKQKL+T V+ + VNPEWNEDLTL +
Sbjct  1    MELLMGLLRIHVNRGVNLAIRDVVSSDPYVVIKMGKQKLKTRVVNKCVNPEWNEDLTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP+LPI + VYD DTFS DDKMG AE +I   +EALKM          I+ +V P R N
Sbjct  61   ADPTLPIHLLVYDKDTFSLDDKMGDAEFEIGPFIEALKM-RLAGLPSGTIITKVHPSRQN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            CLA ES ++  DGK+ Q++CLRL+NVESGE+++Q++WI++P GS+
Sbjct  120  CLAEESRILWTDGKLVQNLCLRLRNVESGEIELQLEWIDIP-GSR  163



>gb|ADZ44599.1| C2 domain-containing protein [Brassica napus]
Length=168

 Score =   187 bits (475),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 124/167 (74%), Gaps = 3/167 (2%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++L+GLL++ +KRG+NLA+RD  SSDPY++   G +KL+THV+K+ VNPEWN+DLTL V
Sbjct  1    MENLVGLLRIHVKRGVNLAIRDIASSDPYIVFHFGNKKLKTHVVKQSVNPEWNDDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDN--HNNSDEERIVARVPPGR  418
            +DP+LP+K+TVYD D  S DDKMG AE  I   LEA+K  +          I+ ++ P R
Sbjct  61   TDPNLPVKLTVYDKDLLSADDKMGEAEFSIAPYLEAIKFRHKIQGGLPHGTIIMKIQPNR  120

Query  417  SNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
             NCL+ ES +V   GK+ Q+M +RL+NVE+GEV++Q++WI++P GS+
Sbjct  121  QNCLSEESHIVWNQGKLVQNMFIRLQNVETGEVELQLEWIDVP-GSR  166



>ref|NP_564873.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AAG52156.1|AC020665_1 hypothetical protein; 53078-54254 [Arabidopsis thaliana]
 gb|AEE34500.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
Length=174

 Score =   187 bits (475),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 124/161 (77%), Gaps = 1/161 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+++LGLL++ + RG+NLA+RD++SSDPYVIV+MGKQKLRT V+K+++N EWNEDLTL V
Sbjct  1    MENMLGLLRLHVIRGVNLAIRDSQSSDPYVIVRMGKQKLRTRVMKKNLNTEWNEDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNH-NNSDEERIVARVPPGRS  415
            +DP+LP+K+ VYD D FS+DDKMG A   I   LEA+++ N      E  ++ ++   R 
Sbjct  61   TDPTLPVKIMVYDRDRFSRDDKMGDAIFHIDPFLEAIRIQNQLGGLPEGTVIMKIQASRQ  120

Query  414  NCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINL  292
            NCL+ ES +V   GK+ Q+M L+L+NVE GE+++Q++WI++
Sbjct  121  NCLSEESKIVWHKGKIVQNMFLKLQNVERGEIELQLEWIDV  161



>ref|XP_009403741.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X1 [Musa acuminata subsp. malaccensis]
Length=182

 Score =   187 bits (475),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/179 (51%), Positives = 125/179 (70%), Gaps = 17/179 (9%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQ----------------KLRTHVL  640
            ++ LLGLL+VR+ RG+NLAVRD  +SDPYV+++MGKQ                KL+T V+
Sbjct  2    VEHLLGLLRVRVARGVNLAVRDVTTSDPYVVLRMGKQWFSLRFFFSFFFILLQKLKTRVI  61

Query  639  KRDVNPEWNEDLTLYVSDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNN  460
            K++ NP WNEDLTL + DPSLP+++ V+D D F+KDD MG+AE DI+  LEA+KM N   
Sbjct  62   KKNTNPVWNEDLTLCIEDPSLPVRLQVFDKDRFTKDDAMGHAEFDIRPFLEAVKM-NPQG  120

Query  459  SDEERIVARVPPGRSNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSG  283
              E  I+ +V P R NCLA ES V    G+VTQD+ LRLK+VE GEV++Q+QW+++P  
Sbjct  121  VPEGTIIRKVVPCRQNCLAEESVVRWCHGQVTQDLALRLKDVERGEVELQLQWVDIPGA  179



>gb|ADZ44598.1| C2 domain-containing protein [Brassica napus]
Length=168

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 124/167 (74%), Gaps = 3/167 (2%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++L+GLL++ +KRG+NLA+RD  SSDPY++   G +KL+THV+K+ VNPEWN+DLTL V
Sbjct  1    MENLVGLLRIHVKRGVNLAIRDIASSDPYIVFHFGNKKLKTHVVKQSVNPEWNDDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDN--HNNSDEERIVARVPPGR  418
            +DP+LP+K+TVYD D  S DDKMG AE  I   LEA+K  +          I+ ++ P R
Sbjct  61   TDPNLPVKLTVYDKDLLSADDKMGEAEFSIAPYLEAIKFRHKIQGGLPNGTIIMKIQPNR  120

Query  417  SNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
             NCL+ ES +V   GK+ Q+M +RL+NVE+GEV++Q++WI++P GS+
Sbjct  121  QNCLSEESHIVWNHGKLVQNMFIRLQNVETGEVELQLEWIDVP-GSR  166



>emb|CDX92180.1| BnaA05g22270D [Brassica napus]
Length=798

 Score =   200 bits (508),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 123/158 (78%), Gaps = 2/158 (1%)
 Frame = -1

Query  750  LKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYVSDPSLPI  571
            +++RIKRG+NLAVRD  SSDPYV+VKMGKQKL+T V+ +DVNPEWNEDLTL V+DP+L +
Sbjct  641  VRIRIKRGVNLAVRDINSSDPYVVVKMGKQKLKTRVINKDVNPEWNEDLTLSVTDPTLTV  700

Query  570  KVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSNCLAAESC  391
             +TVYDHD FSKDDKMG AE +IK  +EALKM + +      IV  V P R NCLA ES 
Sbjct  701  LLTVYDHDMFSKDDKMGDAEFEIKPYIEALKM-HLDGLPSGTIVTTVQPCRRNCLAEESK  759

Query  390  VVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            V   DGK+ QD+ LRL++VE GEV+ Q+QWI+LP GSK
Sbjct  760  VTWVDGKLVQDLVLRLRHVECGEVEAQLQWIDLP-GSK  796



>gb|EMT18411.1| hypothetical protein F775_32222 [Aegilops tauschii]
Length=170

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 125/166 (75%), Gaps = 3/166 (2%)
 Frame = -1

Query  762  LLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYVSDP  583
            L+GL+KVR+ RG+NLA+RD RSSDPYV+V+MGKQKL+T V+++ +NPEWN++LTL + DP
Sbjct  5    LVGLVKVRVTRGVNLAIRDLRSSDPYVVVRMGKQKLKTRVVRKSINPEWNDELTLSIEDP  64

Query  582  SLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMD-NHNNSDEERIVARVPPGRSNCL  406
            ++P+K+ V+D DTF  DD MG AE+DI  L+EA  M        +  +V ++ P R NCL
Sbjct  65   TIPVKLDVFDKDTFF-DDPMGNAELDIGPLVEAATMRIQLQGVADNSVVKKLVPNRQNCL  123

Query  405  AAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSKQQS  268
            A ES + + +G V QD+ LRL+NVE GEV++Q+QWI++P GSK  S
Sbjct  124  AEESAIYLSEGTVKQDVVLRLRNVECGEVELQLQWIDIP-GSKGAS  168



>gb|KFK33274.1| hypothetical protein AALP_AA6G353800 [Arabis alpina]
Length=168

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 123/167 (74%), Gaps = 3/167 (2%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL++ +KRG+NLA+RD  SSDPYV++  GKQKL+T V+K  +NPEWN+DLTL V
Sbjct  1    MENLLGLLRIHVKRGVNLAIRDISSSDPYVVIHYGKQKLKTRVVKHSINPEWNDDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDN--HNNSDEERIVARVPPGR  418
            +DP+ P+K+TVYD D FS DDKMG AE  I   LEA+K  +          I+ ++ P R
Sbjct  61   TDPNSPVKLTVYDKDLFSADDKMGQAEFHIAPYLEAIKFRHKLEGGLPNGTIIMKIQPSR  120

Query  417  SNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
             NCL+ ES +V   GK+ Q+M LRL++VE GEV++Q++WI++P GS+
Sbjct  121  QNCLSEESHIVWNQGKIVQNMFLRLQHVECGEVELQLEWIDVP-GSR  166



>emb|CDY01709.1| BnaC04g30430D [Brassica napus]
Length=168

 Score =   186 bits (473),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 124/167 (74%), Gaps = 3/167 (2%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL++ +KRG+NLA+RD  SSDPYV+V  GKQKL+T V+K  +NPEWN+ LTL V
Sbjct  1    MENLLGLLRIHVKRGVNLAIRDISSSDPYVVVHSGKQKLKTRVVKHSLNPEWNDHLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDN--HNNSDEERIVARVPPGR  418
            +DP+LP+K+ VYD+D  S DDKMG AE +I   LEA+K  +       +  I+ ++ P R
Sbjct  61   TDPNLPVKLMVYDYDVLSADDKMGEAEFNIAQYLEAIKFRHTLEGGLPDGTIIMKIQPSR  120

Query  417  SNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
             NCL+ ES +V   GK+ Q+M LRL++VE GEV+IQ++WI++P GS+
Sbjct  121  QNCLSEESHIVWNQGKLVQNMFLRLQHVECGEVEIQLEWIDIP-GSR  166



>gb|ACT32453.1| C2 domain-containing protein [Triticum aestivum]
Length=170

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 125/163 (77%), Gaps = 3/163 (2%)
 Frame = -1

Query  762  LLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYVSDP  583
            L+GL+KVR+ RG+NLA+RD RSSDPYV+V+MGKQKL+T V+++ +NPEWN++LTL + DP
Sbjct  5    LVGLVKVRVTRGVNLAIRDLRSSDPYVVVRMGKQKLKTRVVRKSINPEWNDELTLSIEDP  64

Query  582  SLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNH-NNSDEERIVARVPPGRSNCL  406
            ++P+K+ V+D DTF  DD MG AE+DI  L+EA +M        +  +V ++ P R NCL
Sbjct  65   TIPVKLDVFDKDTFF-DDPMGNAELDIGPLVEAARMRVQLQGVADNTVVKKLVPNRQNCL  123

Query  405  AAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            A +S + + +G V QD+ LRL+NVE GEV++Q+QWI++P GSK
Sbjct  124  AEQSAIYLSEGTVKQDVVLRLRNVECGEVELQLQWIDIP-GSK  165



>gb|AGJ81360.1| small C2 domain protein [Brassica napus]
Length=168

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 123/167 (74%), Gaps = 3/167 (2%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++L+GLL++ +KRG+NLA+RD  SSDPY++   G +KL THV+K+ VNPEWN+DLTL V
Sbjct  1    MENLVGLLRIHVKRGVNLAIRDIASSDPYIVFHFGNKKLETHVVKQSVNPEWNDDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDN--HNNSDEERIVARVPPGR  418
            +DP+LP+K+TVYD D  S DDKMG AE  I   LEA+K  +          I+ ++ P R
Sbjct  61   TDPNLPVKLTVYDKDLLSADDKMGEAEFSIAPYLEAIKFRHKIQGGLPNGTIIMKIQPNR  120

Query  417  SNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
             NCL+ ES +V   GK+ Q+M +RL+NVE+GEV++Q++WI++P GS+
Sbjct  121  QNCLSEESHIVWNHGKLVQNMFIRLQNVETGEVELQLEWIDVP-GSR  166



>ref|XP_009787765.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Nicotiana sylvestris]
Length=167

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 121/155 (78%), Gaps = 1/155 (1%)
 Frame = -1

Query  759  LGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYVSDPS  580
            LG+LK+R++RGINLAVRDA  SDPYV++ MG QK++T V+K ++NP WNE+L+L + DPS
Sbjct  4    LGVLKIRVRRGINLAVRDAFGSDPYVVITMGGQKVKTRVIKENINPVWNEELSLALYDPS  63

Query  579  LPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSNCLAA  400
            LPI +TVYD DTF+ DDKMG A+IDIK  ++A+ M      D  R V RV P R NCL+ 
Sbjct  64   LPITLTVYDKDTFTADDKMGDAKIDIKPYIDAINMGLEGLPDGVR-VDRVQPNRDNCLSD  122

Query  399  ESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWIN  295
            ESC+V ++GK+TQ+M LRL++VE GE++IQI+ IN
Sbjct  123  ESCIVWENGKMTQNMILRLQHVECGEIEIQIELIN  157



>ref|XP_006282746.1| hypothetical protein CARUB_v10005899mg [Capsella rubella]
 gb|EOA15644.1| hypothetical protein CARUB_v10005899mg [Capsella rubella]
Length=168

 Score =   186 bits (471),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 125/167 (75%), Gaps = 3/167 (2%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++L+GLL++ +KRG+NLA+RD  SSDPYV+V  GKQKL+T V+K  +NPEWN+ LTL V
Sbjct  1    MENLMGLLRIHVKRGVNLAIRDLNSSDPYVVVHSGKQKLKTRVVKHSINPEWNDLLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSD--EERIVARVPPGR  418
            +DPSLPIK+TVYD+D FS DDKMG AE  I   +EA+K  +          I+ ++ P R
Sbjct  61   TDPSLPIKLTVYDYDVFSADDKMGQAEFHIGPYIEAIKFCHQVGPGLPNGTIIRKLEPSR  120

Query  417  SNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            +NCL+ ES +V   GK+ Q+M LRL++VE GEV+IQ++W+++P GS+
Sbjct  121  NNCLSEESHIVWNQGKIVQNMFLRLQHVECGEVEIQLEWVDVP-GSR  166



>ref|XP_010419006.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Camelina sativa]
Length=296

 Score =   189 bits (481),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 124/168 (74%), Gaps = 1/168 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL++ + RG+NLA+RD+ SSDPYVIV+MGKQKLRT V+K+++NPEWNEDLTL +
Sbjct  1    MENLLGLLRLHVIRGVNLAIRDSHSSDPYVIVRMGKQKLRTRVMKKNLNPEWNEDLTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNH-NNSDEERIVARVPPGRS  415
            +DP+LPI + VYD D FS+DDKMG A   I   LEA+++ N      E  ++ ++   R 
Sbjct  61   TDPTLPINIMVYDRDWFSRDDKMGDAVFHIDPFLEAIRIQNELGGLPEGTVIMKIQASRQ  120

Query  414  NCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSKQQ  271
            NCL+ ES +V   GK+ Q+M LRL+NVE GEV +Q++WI++    + +
Sbjct  121  NCLSEESKIVWHKGKIVQNMFLRLQNVERGEVQLQLEWIDVSGAMRYE  168



>ref|XP_010670150.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Beta vulgaris subsp. vulgaris]
Length=168

 Score =   185 bits (470),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 124/165 (75%), Gaps = 1/165 (1%)
 Frame = -1

Query  777  VEMDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTL  598
            V + + +G L++RIKRGI+LA+RDA SSDPYVIV + +QKL+T  +K+ +NP W+EDLTL
Sbjct  2    VNISNAMGALRIRIKRGIDLAIRDATSSDPYVIVLLDQQKLKTRTIKKSLNPVWDEDLTL  61

Query  597  YVSDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGR  418
             V++P+ P+K+ VYD+D FS DD+MG AEID++  LE +K  N        IV +V P R
Sbjct  62   CVTNPNEPLKLFVYDYDIFSPDDRMGEAEIDLRPFLEVVKW-NLKGVSNGTIVTQVKPNR  120

Query  417  SNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSG  283
             NC+A +S +V  DGKVTQ++ LRL+NVESGE+++Q+ WI+LP+ 
Sbjct  121  HNCIAEDSPIVFSDGKVTQNIFLRLRNVESGEIELQLNWIDLPTS  165



>ref|XP_008358047.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Malus domestica]
Length=170

 Score =   185 bits (470),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 127/166 (77%), Gaps = 2/166 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+++LGLL++RIKRG+NLA+RD ++SDPY+ + MG QKL+T V+KR+ NPEWNE+LTL +
Sbjct  1    MNNILGLLRLRIKRGVNLAIRDVKTSDPYLTLTMGSQKLKTKVIKRNCNPEWNEELTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMD-NHNNSDEERIVARVPPGRS  415
            ++   PI + VYD DT + DDKMG A+IDIK  +E LKM  + +   +   + +V P R+
Sbjct  61   TNLEEPIHLQVYDKDTLTVDDKMGDADIDIKPYVECLKMGLDADALPKGCALKKVQPNRT  120

Query  414  NCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            NCL+ ESC V ++GK+ QDM L+L+NVE GE+ +QI+WINLP GSK
Sbjct  121  NCLSTESCCVWENGKIVQDMILKLRNVECGEIVLQIEWINLP-GSK  165



>ref|NP_198590.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
 dbj|BAB08320.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL67050.1| unknown protein [Arabidopsis thaliana]
 gb|AAM45023.1| unknown protein [Arabidopsis thaliana]
 gb|AAN31823.1| unknown protein [Arabidopsis thaliana]
 gb|AED94225.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
Length=168

 Score =   185 bits (470),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 124/167 (74%), Gaps = 3/167 (2%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++L+GLL++ +KRG+NLA+RD  SSDPY++V  GKQKL+T V+K  VNPEWN+DLTL V
Sbjct  1    MENLVGLLRIHVKRGVNLAIRDISSSDPYIVVHCGKQKLKTRVVKHSVNPEWNDDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSD--EERIVARVPPGR  418
            +DP+LPIK+TVYD+D  S DDKMG AE  I   +EA+K  +          I+ ++ P R
Sbjct  61   TDPNLPIKLTVYDYDLLSADDKMGEAEFHIGPFIEAIKFAHQLGPGLPNGTIIKKIEPSR  120

Query  417  SNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
             NCL+  S +V+  GK+ Q+M LRL++VE GEV++Q++WI++P GS+
Sbjct  121  KNCLSESSHIVLNQGKIVQNMFLRLQHVECGEVELQLEWIDVP-GSR  166



>ref|XP_010670144.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010670145.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010670146.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=170

 Score =   185 bits (470),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 123/162 (76%), Gaps = 1/162 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M + +G +++R+KRGINLAVRD+++SDPY+IV +G+QK+RT  +K  +NPEWNEDLTL V
Sbjct  6    MSNAIGAIRIRMKRGINLAVRDSKTSDPYIIVALGEQKVRTRTIKNTLNPEWNEDLTLCV  65

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            +DP+ P+K+ VYD+DTFS DD MG AEID++  L A+K  N        I+ +V P R N
Sbjct  66   TDPNQPLKLFVYDYDTFSPDDVMGEAEIDLRPFLNAVK-SNVEGIPNGTIITQVTPNRLN  124

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPS  286
             ++ +S +V  DG+VTQ+M LRL NVE GEV+++++WI+LP+
Sbjct  125  SISEDSSIVFNDGEVTQNMFLRLHNVECGEVELELKWIDLPT  166



>ref|XP_002887025.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63284.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=168

 Score =   185 bits (469),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 124/162 (77%), Gaps = 2/162 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M+++LGLL++ + RG+NLA+RD+ SSDPYVIV+MGKQKLRT V+K+++NPEWNEDLTL V
Sbjct  1    MENMLGLLRLHVIRGVNLAIRDSHSSDPYVIVRMGKQKLRTRVMKKNLNPEWNEDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNH-NNSDEERIVARVPPGRS  415
            +DP+LP+K+ VYD D FS+DDKMG A   I   LEA+++ N      +  ++ ++   R 
Sbjct  61   TDPTLPVKIMVYDRDWFSRDDKMGDAVFHIDPFLEAIRIQNQLGGLPDGTVIMKIQASRQ  120

Query  414  NCLAAESCVVIKDG-KVTQDMCLRLKNVESGEVDIQIQWINL  292
            NCL+ ES +V   G K+ Q+M LRL+NVE GEV++Q++WI++
Sbjct  121  NCLSEESKIVWHKGKKIVQNMFLRLQNVERGEVELQLEWIDV  162



>ref|NP_001288469.1| probable ADP-ribosylation factor GTPase-activating protein AGD11 
[Zea mays]
 gb|ACG45569.1| GTPase activating protein [Zea mays]
 gb|AFW83322.1| putative calcium-dependent lipid-binding (CaLB domain) family 
protein [Zea mays]
Length=176

 Score =   185 bits (470),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 129/166 (78%), Gaps = 4/166 (2%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGK-QKLRTHVLKRDVNPEWNEDLTLY  595
            +D L GLL+VR+ RG++LA+RD RSSDPYV++++GK QK++T V+K+ +NPEWNE LTL 
Sbjct  12   LDHLAGLLEVRVVRGVDLAIRDLRSSDPYVVLRIGKAQKVKTRVVKKSINPEWNEKLTLS  71

Query  594  VSDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRS  415
            + DP++PI++ V+D DTF  DD MG AE+DI+ L+E +KM     +D+  +V ++ P R 
Sbjct  72   IEDPAVPIRLEVFDKDTFV-DDAMGNAELDIRPLVEIVKMKLQGVADKT-VVKKLVPNRQ  129

Query  414  NCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
            NCLA ES + I +GKV QD+ +RL+NVE GE+++Q+QW++LP GSK
Sbjct  130  NCLAEESSIYISEGKVKQDLVVRLRNVECGEIELQLQWVHLP-GSK  174



>ref|XP_006843797.1| hypothetical protein AMTR_s00007p00250850 [Amborella trichopoda]
 gb|ERN05472.1| hypothetical protein AMTR_s00007p00250850 [Amborella trichopoda]
Length=166

 Score =   184 bits (468),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 116/155 (75%), Gaps = 1/155 (1%)
 Frame = -1

Query  762  LLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYVSDP  583
            L GLL+V++ RG+NLAVRD  SSDPYVI+ MGKQ+L+T V+KR+ NP WNE+LTL VS+P
Sbjct  5    LTGLLRVQVIRGVNLAVRDLLSSDPYVILSMGKQRLKTRVIKRNTNPTWNENLTLVVSNP  64

Query  582  SLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSNCLA  403
             +PIK  VYD DTFS+DDKMG AE+DI+  +EA+ MD         I+ ++ P R NCLA
Sbjct  65   IMPIKFRVYDKDTFSRDDKMGDAELDIQPFMEAVNMD-LKGVPSGTIIRKLIPSRQNCLA  123

Query  402  AESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWI  298
              SC+  +   V QD+CLRL+NVE GEV++Q++WI
Sbjct  124  EVSCISWEVNTVVQDVCLRLRNVERGEVELQLKWI  158



>ref|XP_010450531.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Camelina sativa]
Length=168

 Score =   184 bits (467),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 120/162 (74%), Gaps = 2/162 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++L+GLL++ +KRG+NLA+RD  SSDPYV+V  GKQKL+T V+K  VNPEWN+ LTL V
Sbjct  1    MENLMGLLRIHVKRGVNLAIRDLSSSDPYVVVHFGKQKLKTRVVKHSVNPEWNDLLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSD--EERIVARVPPGR  418
            +DP+LP+K+TVYD+D FS DDKMG AE  I   +EA+K  +          I+ ++ P R
Sbjct  61   TDPNLPVKLTVYDYDVFSPDDKMGEAEFHIGPYIEAIKFCHQLGPGLPSGTIIRKIEPSR  120

Query  417  SNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINL  292
             NCL+ ES +V   GK+ Q+M LRL++VE GEV+IQ++W+N+
Sbjct  121  KNCLSEESHIVWNQGKIVQNMFLRLQHVECGEVEIQLEWVNV  162



>ref|XP_003572790.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD11 [Brachypodium distachyon]
Length=165

 Score =   184 bits (467),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 123/162 (76%), Gaps = 3/162 (2%)
 Frame = -1

Query  762  LLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYVSDP  583
            L+GL+KVR+ RG+NLA+RD  SSDPYV+++MGKQKL+T V+K+  NPEWN++LTL + DP
Sbjct  5    LVGLVKVRVLRGVNLAIRDLCSSDPYVVIRMGKQKLKTRVIKKTTNPEWNDELTLSIEDP  64

Query  582  SLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSNCLA  403
             +PI++ V+D DTF  DD MG AE+DI+ L+E +KM       E  +V ++ P R NCLA
Sbjct  65   EVPIRLDVFDKDTFI-DDAMGNAELDIQPLVEVVKM-KLQGVPENTVVKKLVPNRQNCLA  122

Query  402  AESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
             ES + I +G V QDM LRL+NVE GE+++Q++WI++P GSK
Sbjct  123  EESAIRISEGAVKQDMVLRLRNVECGEIELQLEWIDIP-GSK  163



>ref|XP_002284632.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Vitis vinifera]
 emb|CAN75112.1| hypothetical protein VITISV_043576 [Vitis vinifera]
Length=166

 Score =   184 bits (467),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 112/146 (77%), Gaps = 1/146 (1%)
 Frame = -1

Query  726  INLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYVSDPSLPIKVTVYDHD  547
            INLAVRDARSSDPYV V MG+QKL+T V+K + NPEWNE+LTL ++D  +PI + VYD D
Sbjct  16   INLAVRDARSSDPYVAVTMGEQKLKTRVVKDNCNPEWNEELTLSIADTDVPINLVVYDSD  75

Query  546  TFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSNCLAAESCVVIKDGKV  367
            TF+ DDKMG AEIDIK  +E LKM    N     +++RV P R+NCLA ESC V  +GK+
Sbjct  76   TFTLDDKMGDAEIDIKPYVECLKM-GLENLPTGTVISRVQPSRTNCLADESCCVWDNGKI  134

Query  366  TQDMCLRLKNVESGEVDIQIQWINLP  289
             QDM LRL+NVE GEV++QI+WIN+P
Sbjct  135  RQDMLLRLRNVECGEVEVQIEWINIP  160



>gb|EMT29454.1| hypothetical protein F775_30986 [Aegilops tauschii]
Length=161

 Score =   184 bits (466),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 119/160 (74%), Gaps = 1/160 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MD L+GLLKVR+ RGINLA RDAR SDPYV++++GKQKL+T V KR VNP W+E+LTL +
Sbjct  1    MDGLVGLLKVRVVRGINLAYRDARGSDPYVVLRLGKQKLKTSVKKRSVNPIWHEELTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            ++P+ PIK+ V+D DTFSKDD MG A+I++    E L++D     +   +V  V P   N
Sbjct  61   TNPNAPIKLAVFDKDTFSKDDPMGNADIEVLPFTEVLELDTEGIRNGT-VVRSVAPSSGN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINL  292
            CLA ES V  K+GK  QDM LRL+NVESGE+ ++++W+N+
Sbjct  120  CLAEESRVCWKNGKFVQDMILRLRNVESGEIMLKLEWVNM  159



>ref|XP_006657398.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13-like [Oryza brachyantha]
Length=163

 Score =   184 bits (466),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 122/161 (76%), Gaps = 1/161 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MD L+GLLKVR+ RGINLA RDAR SDPYV++++GKQKL+T V KR VNP W+E+LTL +
Sbjct  1    MDGLVGLLKVRVVRGINLAYRDARGSDPYVVLRLGKQKLKTSVKKRSVNPIWHEELTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSDEERIVARVPPGRSN  412
            ++ + PIK+ V+D DTFS+DD MG AEID++ L+E L +D  N  +   IV+ + P   N
Sbjct  61   TNRTAPIKLEVFDKDTFSRDDPMGDAEIDLEPLMEVLNLDPENIRNGT-IVSTIRPCNQN  119

Query  411  CLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLP  289
            CLA ES +  ++GK  QD+ LRL+NVESGE+ +Q+QW+ +P
Sbjct  120  CLADESHLCWRNGKFVQDIILRLRNVESGELQLQLQWVKIP  160



>gb|AGJ81361.1| small C2 domain protein [Brassica napus]
Length=168

 Score =   184 bits (466),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 123/167 (74%), Gaps = 3/167 (2%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++L+GLL++ +KRG+NLA RD  SSDPY++   G +KL+THV+K+ VNPEW++DLTL V
Sbjct  1    MENLVGLLRIHVKRGVNLATRDIASSDPYIVFHFGNKKLKTHVVKQSVNPEWDDDLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDN--HNNSDEERIVARVPPGR  418
            +DP+LP+K+TVYD D  S DDKMG AE  I   LEA+K  +          I+ ++ P R
Sbjct  61   TDPNLPVKLTVYDKDLLSADDKMGEAEFSIAPYLEAIKFRHKIQGGLPNGTIIMKIQPNR  120

Query  417  SNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
             NCL+ ES +V   GK+ Q+M +RL+NVE+GEV++Q++WI++P GS+
Sbjct  121  QNCLSEESHIVWNHGKLVQNMFIRLQNVETGEVELQLEWIDVP-GSR  166



>ref|XP_010435613.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Camelina sativa]
Length=168

 Score =   184 bits (466),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 120/165 (73%), Gaps = 2/165 (1%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++L+GLL++ +KRG+NLA+RD  SSDPY++V  GKQKL+T V+K  VNPEWN+ LTL V
Sbjct  1    MENLMGLLRIHVKRGVNLAIRDISSSDPYIVVHFGKQKLKTRVVKHSVNPEWNDLLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHNNSD--EERIVARVPPGR  418
            +DP+LP+K+TVYD+D FS DDKMG AE  I   +EA+K  +          I+ ++ P R
Sbjct  61   TDPNLPVKLTVYDYDVFSADDKMGEAEFHIGPYIEAIKFCHQLGPGLPSGTIIRKIEPSR  120

Query  417  SNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSG  283
             NCL+ ES +V    K+ Q+M LRL++VE GEV+IQ++W+N+P  
Sbjct  121  KNCLSEESHIVWNQDKIVQNMFLRLQHVECGEVEIQLEWVNVPGA  165



>gb|EMS65900.1| putative ADP-ribosylation factor GTPase-activating protein AGD13 
[Triticum urartu]
Length=161

 Score =   182 bits (462),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 120/162 (74%), Gaps = 5/162 (3%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            MD L+GLLKVR+ RGINLA RDAR SDPYV++++GKQKL+T V +R VNP W+E+LTL +
Sbjct  1    MDGLVGLLKVRVVRGINLAYRDARGSDPYVVLRLGKQKLKTSVKRRSVNPIWHEELTLSI  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDNHN--NSDEERIVARVPPGR  418
            ++P+ PIK+ V+D DTFSKDD MG AEI++    E L++D     N    R+VA   P  
Sbjct  61   TNPNAPIKLAVFDKDTFSKDDPMGNAEIEVLPFTEVLELDTEGIRNGTVVRLVA---PSS  117

Query  417  SNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINL  292
             NCLA ES V  K+GK  QDM LRL++VESGE+ ++++W+N+
Sbjct  118  GNCLAEESRVCWKNGKFVQDMILRLRDVESGEIMLKLEWVNM  159



>ref|XP_009139747.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD13 [Brassica rapa]
Length=168

 Score =   182 bits (463),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 123/167 (74%), Gaps = 3/167 (2%)
 Frame = -1

Query  771  MDSLLGLLKVRIKRGINLAVRDARSSDPYVIVKMGKQKLRTHVLKRDVNPEWNEDLTLYV  592
            M++LLGLL++ +KRG+NLA+RD  SSDPYV+V  GKQKL+T V+K  +NP+WN+ LTL V
Sbjct  1    MENLLGLLRIHVKRGVNLAIRDISSSDPYVVVHSGKQKLKTRVVKHSLNPDWNDHLTLSV  60

Query  591  SDPSLPIKVTVYDHDTFSKDDKMGYAEIDIKHLLEALKMDN--HNNSDEERIVARVPPGR  418
            +DP+LP+K+TVYD+D  S DDKMG AE +I   LEA+K          +  I+ ++ P R
Sbjct  61   TDPNLPVKLTVYDYDLLSADDKMGEAEFNIAAYLEAIKFRYALEGGLPDGTIIMKIQPSR  120

Query  417  SNCLAAESCVVIKDGKVTQDMCLRLKNVESGEVDIQIQWINLPSGSK  277
             NCL+ ES +V   GK+ Q+M LRL++VE GEV+I ++WI++P GS+
Sbjct  121  QNCLSEESHIVWNQGKLVQNMFLRLQHVECGEVEIHLEWIDIP-GSR  166



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1960666385524