BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24147_g4_i1 len=1413 path=[8977:0-643 9621:644-725 9703:726-763
9740:764-796 8676:797-833 9808:834-876 13161:877-886 8482:887-931
9903:932-977 13196:978-992 9964:993-1227 10199:1228-1412]

Length=1413
                                                                      Score     E

ref|XP_009592779.1|  PREDICTED: uncharacterized protein LOC104089557    408   2e-136   
ref|XP_011072365.1|  PREDICTED: uncharacterized protein LOC105157642    404   6e-135   
ref|XP_006343072.1|  PREDICTED: uncharacterized protein LOC102588977    400   2e-133   
ref|XP_004235669.1|  PREDICTED: uncharacterized protein LOC101263095    395   8e-132   
ref|XP_002284456.1|  PREDICTED: uncharacterized protein LOC100261724    392   2e-130   Vitis vinifera
emb|CDO98030.1|  unnamed protein product                                384   3e-127   
ref|XP_010062482.1|  PREDICTED: uncharacterized protein LOC104449880    376   4e-124   
gb|EYU21459.1|  hypothetical protein MIMGU_mgv1a010181mg                371   6e-122   
ref|XP_007150628.1|  hypothetical protein PHAVU_005G168300g             369   2e-121   
ref|XP_007024179.1|  Uncharacterized protein TCM_028754                 368   4e-121   
gb|AGV54202.1|  hypothetical protein                                    368   5e-121   
ref|XP_010098075.1|  hypothetical protein L484_026207                   367   2e-120   
ref|XP_011000507.1|  PREDICTED: uncharacterized protein LOC105108056    365   8e-120   
ref|NP_001241341.1|  uncharacterized protein LOC100818121               364   1e-119   
ref|XP_002516033.1|  conserved hypothetical protein                     363   3e-119   Ricinus communis
ref|XP_003597750.1|  hypothetical protein MTR_2g101870                  360   4e-118   
gb|KDP37241.1|  hypothetical protein JCGZ_06297                         360   4e-118   
gb|KHG06240.1|  hypothetical protein F383_31810                         358   3e-117   
ref|XP_008228551.1|  PREDICTED: uncharacterized protein LOC103327949    355   4e-116   
ref|XP_006426961.1|  hypothetical protein CICLE_v10026158mg             355   6e-116   
ref|XP_004302904.1|  PREDICTED: uncharacterized protein LOC101293317    355   6e-116   
ref|XP_010249708.1|  PREDICTED: uncharacterized protein LOC104592183    353   4e-115   
ref|XP_006426960.1|  hypothetical protein CICLE_v10026158mg             352   5e-115   
ref|XP_004486742.1|  PREDICTED: uncharacterized protein LOC101509865    352   7e-115   
ref|XP_002304204.1|  hypothetical protein POPTR_0003s05170g             352   9e-115   Populus trichocarpa [western balsam poplar]
ref|XP_007215722.1|  hypothetical protein PRUPE_ppa008966mg             348   3e-113   
ref|XP_010103052.1|  hypothetical protein L484_001883                   348   4e-113   
ref|XP_008342685.1|  PREDICTED: uncharacterized protein LOC103405458    348   5e-113   
ref|XP_008795060.1|  PREDICTED: uncharacterized protein LOC103710911    347   7e-113   
ref|XP_009353613.1|  PREDICTED: uncharacterized protein LOC103944863    347   8e-113   
ref|XP_010691334.1|  PREDICTED: uncharacterized protein LOC104904684    345   3e-112   
ref|XP_009380553.1|  PREDICTED: uncharacterized protein LOC103968920    345   3e-112   
ref|XP_009404447.1|  PREDICTED: uncharacterized protein LOC103987774    345   7e-112   
ref|XP_010254099.1|  PREDICTED: uncharacterized protein LOC104595183    343   3e-111   
ref|XP_002299711.1|  hypothetical protein POPTR_0001s18410g             341   1e-110   Populus trichocarpa [western balsam poplar]
ref|XP_010925854.1|  PREDICTED: uncharacterized protein LOC105048287    341   2e-110   
ref|XP_010915827.1|  PREDICTED: uncharacterized protein LOC105040822    338   3e-109   
ref|XP_008242663.1|  PREDICTED: uncharacterized protein LOC103340971    336   1e-108   
ref|XP_007202282.1|  hypothetical protein PRUPE_ppa009043mg             336   2e-108   
ref|XP_004141769.1|  PREDICTED: uncharacterized protein LOC101220910    334   8e-108   
ref|XP_008799324.1|  PREDICTED: uncharacterized protein LOC103713983    334   9e-108   
ref|XP_009409454.1|  PREDICTED: uncharacterized protein LOC103991661    334   1e-107   
ref|XP_006451178.1|  hypothetical protein CICLE_v10009029mg             332   4e-107   
ref|XP_004287400.1|  PREDICTED: uncharacterized protein LOC101296029    332   5e-107   
ref|XP_008462165.1|  PREDICTED: uncharacterized protein LOC103500589    331   2e-106   
ref|XP_004150755.1|  PREDICTED: uncharacterized protein LOC101205854    330   2e-106   
gb|EPS69114.1|  hypothetical protein M569_05653                         330   4e-106   
ref|XP_008463399.1|  PREDICTED: uncharacterized protein LOC103501566    328   2e-105   
ref|XP_006833312.1|  hypothetical protein AMTR_s00109p00054230          328   3e-105   
gb|KDP33684.1|  hypothetical protein JCGZ_07255                         325   4e-104   
ref|XP_007013150.1|  Uncharacterized protein isoform 1                  318   1e-101   
ref|XP_009374029.1|  PREDICTED: uncharacterized protein LOC103962975    315   2e-100   
gb|KHG20321.1|  hypothetical protein F383_09129                         314   6e-100   
ref|XP_010049670.1|  PREDICTED: uncharacterized protein LOC104438267    313   9e-100   
ref|XP_008337374.1|  PREDICTED: uncharacterized protein LOC103400494    313   1e-99    
ref|XP_007013151.1|  Uncharacterized protein isoform 2                  311   8e-99    
ref|XP_009371452.1|  PREDICTED: uncharacterized protein LOC103960695    305   2e-96    
gb|KHN32621.1|  hypothetical protein glysoja_022303                     303   3e-96    
ref|XP_008343971.1|  PREDICTED: uncharacterized protein LOC103406754    302   2e-95    
ref|XP_009355422.1|  PREDICTED: uncharacterized protein LOC103946437    302   2e-95    
ref|XP_008386345.1|  PREDICTED: uncharacterized protein LOC103448864    302   2e-95    
ref|XP_004964763.1|  PREDICTED: uncharacterized protein LOC101752...    302   3e-95    
ref|NP_001149360.1|  LOC100282984                                       300   2e-94    Zea mays [maize]
ref|XP_006655820.1|  PREDICTED: uncharacterized protein LOC102712638    297   3e-93    
gb|AFW75623.1|  harpin-induced protein                                  302   5e-93    
ref|XP_011044497.1|  PREDICTED: uncharacterized protein LOC105139664    294   3e-92    
ref|NP_001056895.2|  Os06g0163300                                       292   2e-91    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006381719.1|  hypothetical protein POPTR_0006s16310g             290   2e-90    
ref|XP_007152854.1|  hypothetical protein PHAVU_004G165600g             274   1e-84    
ref|XP_006465732.1|  PREDICTED: uncharacterized protein LOC102622098    277   8e-84    
ref|XP_004513002.1|  PREDICTED: uncharacterized protein LOC101500301    270   5e-83    
ref|XP_006645672.1|  PREDICTED: uncharacterized protein LOC102699360    269   2e-82    
ref|XP_007013148.1|  Uncharacterized protein TCM_037864                 267   6e-82    
ref|XP_004967420.1|  PREDICTED: uncharacterized protein LOC101773256    267   1e-81    
gb|ACF82685.1|  unknown                                                 267   2e-81    Zea mays [maize]
ref|XP_003620624.1|  hypothetical protein MTR_6g087880                  265   9e-81    
gb|ACG35435.1|  harpin-induced protein                                  264   2e-80    Zea mays [maize]
ref|XP_003528931.1|  PREDICTED: uncharacterized protein LOC100793619    262   1e-79    
ref|XP_010487458.1|  PREDICTED: uncharacterized protein LOC104765...    261   3e-79    
ref|XP_009624499.1|  PREDICTED: uncharacterized protein LOC104115...    259   1e-78    
ref|XP_002885125.1|  hypothetical protein ARALYDRAFT_897912             257   8e-78    
ref|XP_010487457.1|  PREDICTED: uncharacterized protein LOC104765...    256   1e-77    
gb|AFK36620.1|  unknown                                                 251   4e-77    
ref|XP_009793474.1|  PREDICTED: uncharacterized protein LOC104240342    251   1e-75    
gb|EEC70230.1|  hypothetical protein OsI_01000                          251   3e-75    Oryza sativa Indica Group [Indian rice]
ref|XP_006298203.1|  hypothetical protein CARUB_v10014254mg             249   1e-74    
ref|XP_002284373.1|  PREDICTED: uncharacterized protein LOC100257732    248   1e-74    Vitis vinifera
ref|XP_009800428.1|  PREDICTED: uncharacterized protein LOC104246323    243   1e-74    
gb|KHN45629.1|  hypothetical protein glysoja_031500                     246   2e-73    
ref|XP_003534207.1|  PREDICTED: uncharacterized protein LOC100800719    244   1e-72    
emb|CDM82381.1|  unnamed protein product                                244   1e-72    
ref|XP_006406876.1|  hypothetical protein EUTSA_v10021190mg             243   1e-72    
emb|CDP03322.1|  unnamed protein product                                242   4e-72    
gb|EMT30475.1|  hypothetical protein F775_16987                         241   6e-72    
ref|XP_003565917.1|  PREDICTED: uncharacterized protein LOC100834094    241   1e-71    
ref|NP_001042478.1|  Os01g0228500                                       237   6e-70    Oryza sativa Japonica Group [Japonica rice]
gb|AFW85694.1|  hypothetical protein ZEAMMB73_163634                    236   7e-70    
gb|EEE54160.1|  hypothetical protein OsJ_00970                          235   3e-69    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002514290.1|  conserved hypothetical protein                     233   1e-68    Ricinus communis
ref|XP_009146171.1|  PREDICTED: uncharacterized protein LOC103869...    232   2e-68    
emb|CDY30134.1|  BnaC05g37280D                                          232   2e-68    
ref|XP_011078314.1|  PREDICTED: uncharacterized protein LOC105162087    232   2e-68    
ref|XP_010503818.1|  PREDICTED: uncharacterized protein LOC104780961    230   3e-68    
ref|XP_006451179.1|  hypothetical protein CICLE_v10009029mg             227   2e-67    
gb|ADE76556.1|  unknown                                                 230   2e-67    
ref|XP_010688223.1|  PREDICTED: uncharacterized protein LOC104902222    224   5e-65    
ref|XP_010468203.1|  PREDICTED: uncharacterized protein LOC104748226    219   8e-64    
gb|EMT02142.1|  hypothetical protein F775_28959                         217   5e-63    
ref|XP_010269473.1|  PREDICTED: uncharacterized protein LOC104606113    218   6e-63    
emb|CDP01320.1|  unnamed protein product                                218   8e-63    
ref|XP_006847089.1|  hypothetical protein AMTR_s00017p00215910          217   1e-62    
ref|XP_003564273.1|  PREDICTED: uncharacterized protein LOC100823357    217   2e-62    
emb|CDX97721.1|  BnaA05g23580D                                          220   2e-62    
ref|XP_004291094.1|  PREDICTED: uncharacterized protein LOC101300780    216   5e-62    
ref|XP_008220240.1|  PREDICTED: uncharacterized protein LOC103320347    216   5e-62    
ref|XP_007222947.1|  hypothetical protein PRUPE_ppa008855mg             215   9e-62    
ref|XP_008444608.1|  PREDICTED: uncharacterized protein LOC103487879    214   1e-61    
ref|XP_004142871.1|  PREDICTED: uncharacterized protein LOC101203977    210   9e-60    
emb|CDP02504.1|  unnamed protein product                                207   6e-59    
ref|XP_010263513.1|  PREDICTED: uncharacterized protein LOC104601752    207   6e-59    
ref|XP_011083882.1|  PREDICTED: uncharacterized protein LOC105166274    207   9e-59    
ref|XP_010688841.1|  PREDICTED: uncharacterized protein LOC104902677    207   1e-58    
ref|XP_002301174.1|  hypothetical protein POPTR_0002s12620g             206   3e-58    Populus trichocarpa [western balsam poplar]
ref|XP_009146172.1|  PREDICTED: uncharacterized protein LOC103869...    201   7e-57    
gb|KHG02664.1|  hypothetical protein F383_26016                         202   8e-57    
ref|XP_009414850.1|  PREDICTED: uncharacterized protein LOC103995857    201   1e-56    
ref|XP_010533303.1|  PREDICTED: uncharacterized protein LOC104809106    209   1e-56    
ref|XP_009107444.1|  PREDICTED: uncharacterized protein LOC103833105    202   1e-56    
gb|KHN23741.1|  hypothetical protein glysoja_033624                     201   2e-56    
ref|XP_006587484.1|  PREDICTED: uncharacterized protein LOC100817451    200   3e-56    
ref|XP_004238140.1|  PREDICTED: uncharacterized protein LOC101250...    200   4e-56    
ref|XP_009405343.1|  PREDICTED: uncharacterized protein LOC103988523    200   7e-56    
ref|XP_002510197.1|  conserved hypothetical protein                     199   2e-55    Ricinus communis
ref|XP_009604889.1|  PREDICTED: uncharacterized protein LOC104099562    198   3e-55    
ref|XP_009611037.1|  PREDICTED: uncharacterized protein LOC104104606    198   3e-55    
ref|XP_003528962.1|  PREDICTED: uncharacterized protein LOC100811519    197   3e-55    
ref|XP_004512880.1|  PREDICTED: uncharacterized protein LOC101513762    197   3e-55    
gb|KHN44600.1|  hypothetical protein glysoja_027211                     197   3e-55    
ref|XP_006354866.1|  PREDICTED: uncharacterized protein LOC102592145    198   4e-55    
ref|XP_009772483.1|  PREDICTED: uncharacterized protein LOC104222860    197   4e-55    
gb|KHG23014.1|  hypothetical protein F383_29948                         197   5e-55    
ref|XP_009771087.1|  PREDICTED: uncharacterized protein LOC104221676    197   5e-55    
gb|KHG23694.1|  hypothetical protein F383_01880                         197   1e-54    
ref|XP_009123524.1|  PREDICTED: uncharacterized protein LOC103848363    196   2e-54    
ref|XP_008393793.1|  PREDICTED: uncharacterized protein LOC103455958    196   2e-54    
emb|CDY06769.1|  BnaA10g05480D                                          196   3e-54    
gb|KDP41715.1|  hypothetical protein JCGZ_16122                         195   3e-54    
ref|XP_011017528.1|  PREDICTED: uncharacterized protein LOC105120843    194   4e-54    
ref|XP_009359769.1|  PREDICTED: uncharacterized protein LOC103950301    194   5e-54    
gb|ADE76287.1|  unknown                                                 189   7e-54    
ref|XP_007017196.1|  CAA30379.1 protein, putative                       193   3e-53    
ref|XP_003631048.1|  hypothetical protein MTR_8g106580                  192   3e-53    
ref|XP_010912464.1|  PREDICTED: uncharacterized protein LOC105038371    192   4e-53    
emb|CDY17052.1|  BnaA08g04160D                                          191   4e-53    
ref|XP_002310135.2|  hypothetical protein POPTR_0007s10910g             192   6e-53    Populus trichocarpa [western balsam poplar]
gb|AFK40819.1|  unknown                                                 191   6e-53    
ref|XP_011075336.1|  PREDICTED: uncharacterized protein LOC105159829    191   8e-53    
ref|XP_002284845.1|  PREDICTED: uncharacterized protein LOC100254049    191   9e-53    Vitis vinifera
ref|XP_004232022.1|  PREDICTED: uncharacterized protein LOC101266178    191   9e-53    
ref|XP_002523601.1|  conserved hypothetical protein                     191   1e-52    Ricinus communis
ref|XP_006374914.1|  hypothetical protein POPTR_0014s02660g             191   1e-52    
ref|XP_010112178.1|  hypothetical protein L484_009544                   191   2e-52    
gb|EEC78302.1|  hypothetical protein OsI_18024                          191   2e-52    Oryza sativa Indica Group [Indian rice]
dbj|BAK05954.1|  predicted protein                                      192   2e-52    
ref|XP_007152713.1|  hypothetical protein PHAVU_004G153000g             190   2e-52    
ref|XP_011029651.1|  PREDICTED: uncharacterized protein LOC105129340    190   2e-52    
emb|CAE01801.2|  OSJNBa0039K24.20                                       190   2e-52    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011043531.1|  PREDICTED: uncharacterized protein LOC105138964    190   3e-52    
ref|NP_001054346.1|  Os04g0689500                                       190   4e-52    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007047284.1|  CAA30379.1 protein, putative                       189   6e-52    
ref|XP_006339887.1|  PREDICTED: uncharacterized protein LOC102589271    191   9e-52    
gb|KDP31944.1|  hypothetical protein JCGZ_12405                         189   1e-51    
gb|KHG05483.1|  hypothetical protein F383_30625                         187   3e-51    
emb|CAB53482.1|  CAA30379.1 protein                                     196   3e-51    Oryza sativa [red rice]
ref|XP_004503314.1|  PREDICTED: uncharacterized protein LOC101508885    186   7e-51    
emb|CAJ86345.1|  H0814G11.12                                            196   7e-51    Oryza sativa [red rice]
emb|CBI19503.3|  unnamed protein product                                185   1e-50    
ref|XP_006466733.1|  PREDICTED: uncharacterized protein LOC102607882    185   2e-50    
ref|XP_010912033.1|  PREDICTED: uncharacterized protein LOC105038045    185   2e-50    
ref|XP_008784188.1|  PREDICTED: uncharacterized protein LOC103703193    185   3e-50    
ref|XP_006653072.1|  PREDICTED: uncharacterized protein LOC102708149    184   3e-50    
ref|XP_009368173.1|  PREDICTED: uncharacterized protein LOC103957702    184   3e-50    
ref|NP_564495.1|  uncharacterized protein                               185   4e-50    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006425910.1|  hypothetical protein CICLE_v10027302mg             184   5e-50    
ref|XP_006434739.1|  hypothetical protein CICLE_v10001851mg             183   9e-50    
ref|XP_010526725.1|  PREDICTED: uncharacterized protein LOC104804214    182   9e-50    
ref|XP_008347617.1|  PREDICTED: uncharacterized protein LOC103410...    182   2e-49    
ref|XP_010538128.1|  PREDICTED: uncharacterized protein LOC104812578    183   2e-49    
ref|XP_009343297.1|  PREDICTED: uncharacterized protein LOC103935257    182   2e-49    
ref|XP_002891325.1|  hypothetical protein ARALYDRAFT_473858             182   3e-49    
ref|XP_006393635.1|  hypothetical protein EUTSA_v10011627mg             182   3e-49    
ref|XP_003579535.1|  PREDICTED: uncharacterized protein LOC100833843    182   4e-49    
ref|XP_007202978.1|  hypothetical protein PRUPE_ppa018646mg             181   5e-49    
ref|XP_008241489.1|  PREDICTED: uncharacterized protein LOC103339911    181   6e-49    
ref|XP_003525209.1|  PREDICTED: uncharacterized protein LOC100787767    180   7e-49    
ref|XP_008363142.1|  PREDICTED: uncharacterized protein LOC103426839    181   8e-49    
ref|XP_008347616.1|  PREDICTED: uncharacterized protein LOC103410...    181   9e-49    
ref|XP_008378032.1|  PREDICTED: uncharacterized protein LOC103441111    181   1e-48    
ref|XP_010479103.1|  PREDICTED: uncharacterized protein LOC104758001    181   1e-48    
dbj|BAB02013.1|  unnamed protein product                                180   1e-48    Arabidopsis thaliana [mouse-ear cress]
gb|EAZ32502.1|  hypothetical protein OsJ_16721                          189   1e-48    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008363141.1|  PREDICTED: uncharacterized protein LOC103426838    180   1e-48    
ref|XP_004509134.1|  PREDICTED: uncharacterized protein LOC101501112    180   2e-48    
ref|XP_003525811.2|  PREDICTED: uncharacterized protein LOC100798888    180   2e-48    
dbj|BAJ96526.1|  predicted protein                                      180   2e-48    
gb|AFK41834.1|  unknown                                                 172   4e-48    
ref|XP_003550061.2|  PREDICTED: uncharacterized protein LOC100798077    179   6e-48    
ref|XP_010500209.1|  PREDICTED: uncharacterized protein LOC104777627    179   8e-48    
ref|XP_006296796.1|  hypothetical protein CARUB_v10016215mg             177   1e-47    
ref|XP_010540370.1|  PREDICTED: uncharacterized protein LOC104814169    178   2e-47    
emb|CDY17105.1|  BnaC06g00380D                                          176   2e-47    
gb|EYU25436.1|  hypothetical protein MIMGU_mgv1a010185mg                177   3e-47    
ref|XP_010093627.1|  hypothetical protein L484_011050                   177   3e-47    
ref|XP_009761920.1|  PREDICTED: uncharacterized protein LOC104214021    171   4e-47    
gb|EPS58954.1|  hypothetical protein M569_15857                         175   8e-47    
gb|KHG00396.1|  45 kDa immediate-early 2                                175   8e-47    
ref|XP_007160489.1|  hypothetical protein PHAVU_002G326000g             174   1e-46    
gb|KFK44646.1|  hypothetical protein AALP_AA1G285700                    176   1e-46    
ref|XP_006304997.1|  hypothetical protein CARUB_v10009363mg             176   2e-46    
gb|KFK39781.1|  hypothetical protein AALP_AA3G286700                    173   3e-46    
ref|XP_008785866.1|  PREDICTED: uncharacterized protein LOC103704383    173   6e-46    
ref|XP_002277867.1|  PREDICTED: uncharacterized protein LOC100249074    171   2e-45    Vitis vinifera
gb|EMS68593.1|  Glyoxylate reductase                                    177   2e-45    
gb|EYU39327.1|  hypothetical protein MIMGU_mgv1a011308mg                169   9e-45    
ref|XP_003620361.1|  hypothetical protein MTR_6g081930                  169   1e-44    
ref|NP_199100.1|  uncharacterized protein                               169   1e-44    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007155918.1|  hypothetical protein PHAVU_003G243200g             169   2e-44    
ref|NP_001143549.1|  LOC100276241                                       169   2e-44    Zea mays [maize]
ref|XP_002863727.1|  hypothetical protein ARALYDRAFT_494732             168   4e-44    
ref|XP_010481937.1|  PREDICTED: uncharacterized protein LOC104760674    168   5e-44    
ref|XP_009624500.1|  PREDICTED: uncharacterized protein LOC104115...    165   5e-44    
gb|AAO42869.1|  At5g42860                                               167   7e-44    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010266959.1|  PREDICTED: uncharacterized protein LOC104604355    166   1e-43    
emb|CDX77406.1|  BnaA07g05440D                                          166   1e-43    
gb|KFK31809.1|  hypothetical protein AALP_AA6G161400                    166   2e-43    
ref|XP_009413040.1|  PREDICTED: uncharacterized protein LOC103994436    166   2e-43    
ref|XP_004959968.1|  PREDICTED: uncharacterized protein LOC101762...    166   3e-43    
ref|XP_010494244.1|  PREDICTED: uncharacterized protein LOC104771425    166   3e-43    
ref|XP_006280823.1|  hypothetical protein CARUB_v10026791mg             166   3e-43    
emb|CDY39534.1|  BnaC07g07020D                                          165   3e-43    
gb|EYU38006.1|  hypothetical protein MIMGU_mgv1a010019mg                166   3e-43    
ref|XP_006299053.1|  hypothetical protein CARUB_v10015193mg             164   4e-43    
ref|XP_004173619.1|  PREDICTED: uncharacterized protein LOC101226858    162   4e-43    
ref|XP_010442112.1|  PREDICTED: uncharacterized protein LOC104725191    165   6e-43    
emb|CDY39535.1|  BnaC07g07030D                                          164   1e-42    
emb|CDX77407.1|  BnaA07g05450D                                          164   1e-42    
gb|AAR95998.1|  hypothetical protein kinase                             162   1e-42    Musa acuminata [banana]
ref|XP_004238141.1|  PREDICTED: uncharacterized protein LOC101250...    163   2e-42    
ref|XP_004172052.1|  PREDICTED: uncharacterized protein LOC101232653    163   2e-42    
ref|XP_010513616.1|  PREDICTED: uncharacterized protein LOC104789645    167   3e-42    
ref|XP_008440289.1|  PREDICTED: uncharacterized protein LOC103484782    163   4e-42    
ref|XP_011046312.1|  PREDICTED: uncharacterized protein LOC105140957    161   9e-42    
gb|KFK39780.1|  hypothetical protein AALP_AA3G286600                    161   1e-41    
ref|XP_011092945.1|  PREDICTED: uncharacterized protein LOC105173008    161   1e-41    
gb|KCW59061.1|  hypothetical protein EUGRSUZ_H01684                     161   2e-41    
ref|XP_010488567.1|  PREDICTED: uncharacterized protein LOC104766388    165   2e-41    
ref|XP_010026307.1|  PREDICTED: uncharacterized protein LOC104416646    161   2e-41    
dbj|BAB02012.1|  unnamed protein product                                160   4e-41    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010466874.1|  PREDICTED: uncharacterized protein LOC104747011    164   5e-41    
ref|XP_009102749.1|  PREDICTED: uncharacterized protein LOC103828863    164   7e-41    
gb|EMS55377.1|  hypothetical protein TRIUR3_07549                       156   8e-41    
ref|XP_010059920.1|  PREDICTED: uncharacterized protein LOC104447885    159   1e-40    
ref|XP_002447370.1|  hypothetical protein SORBIDRAFT_06g033890          166   2e-40    Sorghum bicolor [broomcorn]
gb|KEH30613.1|  late embryogenesis abundant protein                     158   2e-40    
ref|XP_010313063.1|  PREDICTED: uncharacterized protein LOC101261986    157   2e-40    
ref|XP_003570065.1|  PREDICTED: uncharacterized protein LOC100835413    158   4e-40    
ref|XP_006362724.1|  PREDICTED: uncharacterized protein LOC102598022    156   6e-40    
ref|XP_002279423.1|  PREDICTED: uncharacterized protein LOC100258993    156   9e-40    Vitis vinifera
ref|XP_002305543.2|  hypothetical protein POPTR_0004s18760g             158   9e-40    Populus trichocarpa [western balsam poplar]
ref|XP_010026438.1|  PREDICTED: uncharacterized protein LOC104416792    156   9e-40    
gb|KCW59357.1|  hypothetical protein EUGRSUZ_H02051                     156   1e-39    
ref|XP_006418715.1|  hypothetical protein EUTSA_v10002953mg             155   1e-39    
ref|XP_009770741.1|  PREDICTED: uncharacterized protein LOC104221...    155   1e-39    
emb|CDX95150.1|  BnaC09g17200D                                          155   1e-39    
emb|CBI37766.3|  unnamed protein product                                155   2e-39    
ref|XP_002885659.1|  hypothetical protein ARALYDRAFT_319165             159   3e-39    
ref|NP_189103.1|  Late embryogenesis abundant protein, group 2          158   3e-39    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009607708.1|  PREDICTED: uncharacterized protein LOC104101877    154   7e-39    
emb|CDP14525.1|  unnamed protein product                                154   1e-38    
gb|KDP47153.1|  hypothetical protein JCGZ_00044                         152   2e-38    
ref|XP_004505674.1|  PREDICTED: uncharacterized protein LOC101514813    152   3e-38    
ref|XP_002313684.1|  hypothetical protein POPTR_0009s14270g             151   3e-38    
ref|XP_003540447.1|  PREDICTED: uncharacterized protein LOC100783160    152   4e-38    
gb|KHN05479.1|  hypothetical protein glysoja_020444                     151   5e-38    
ref|XP_010103304.1|  hypothetical protein L484_014344                   150   8e-38    
ref|XP_006648919.1|  PREDICTED: uncharacterized protein LOC102712060    149   1e-37    
ref|XP_007131582.1|  hypothetical protein PHAVU_011G025200g             150   1e-37    
ref|XP_009114032.1|  PREDICTED: uncharacterized protein LOC103839276    150   1e-37    
ref|XP_002528420.1|  hypothetical protein RCOM_0615680                  149   3e-37    
ref|XP_010918212.1|  PREDICTED: uncharacterized protein LOC105042627    149   3e-37    
ref|NP_001170707.1|  uncharacterized protein LOC100384786               150   3e-37    
dbj|BAK06205.1|  predicted protein                                      149   3e-37    
ref|XP_011045411.1|  PREDICTED: uncharacterized protein LOC105140316    149   4e-37    
ref|XP_006854590.1|  hypothetical protein AMTR_s00030p00122220          147   6e-37    
ref|XP_003537752.1|  PREDICTED: uncharacterized protein LOC100817846    147   1e-36    
ref|XP_010667410.1|  PREDICTED: uncharacterized protein LOC104884460    147   2e-36    
ref|NP_001047682.1|  Os02g0667600                                       147   2e-36    
ref|XP_009389504.1|  PREDICTED: uncharacterized protein LOC103976048    147   2e-36    
gb|KDO68238.1|  hypothetical protein CISIN_1g021795mg                   147   2e-36    
ref|XP_008236099.1|  PREDICTED: uncharacterized protein LOC103334887    146   3e-36    
ref|XP_006422493.1|  hypothetical protein CICLE_v10028720mg             147   6e-36    
ref|XP_010028799.1|  PREDICTED: uncharacterized protein LOC104419000    145   6e-36    
ref|XP_010690284.1|  PREDICTED: uncharacterized protein LOC104903...    145   7e-36    
ref|XP_008348521.1|  PREDICTED: uncharacterized protein LOC103411669    145   8e-36    
ref|XP_006486659.1|  PREDICTED: uncharacterized protein LOC102607477    145   9e-36    
gb|KHG25254.1|  hypothetical protein F383_08949                         144   1e-35    
ref|XP_002452776.1|  hypothetical protein SORBIDRAFT_04g032310          145   2e-35    
ref|XP_007199453.1|  hypothetical protein PRUPE_ppa026873mg             144   2e-35    
dbj|BAJ97016.1|  predicted protein                                      144   2e-35    
ref|XP_002960876.1|  hypothetical protein SELMODRAFT_75450              144   2e-35    
ref|XP_009402095.1|  PREDICTED: uncharacterized protein LOC103985968    143   3e-35    
emb|CDY29514.1|  BnaA06g14560D                                          143   3e-35    
emb|CAN73167.1|  hypothetical protein VITISV_027982                     143   4e-35    
ref|XP_010555197.1|  PREDICTED: uncharacterized protein LOC104824744    143   5e-35    
ref|XP_004953399.1|  PREDICTED: uncharacterized protein LOC101772467    143   7e-35    
ref|XP_002962033.1|  hypothetical protein SELMODRAFT_77584              142   1e-34    
ref|XP_007041702.1|  Group 2 isoform 1                                  141   1e-34    
ref|XP_008348934.1|  PREDICTED: uncharacterized protein LOC103412113    141   2e-34    
emb|CAH67003.1|  OSIGBa0160I14.1                                        142   2e-34    
ref|XP_004959967.1|  PREDICTED: uncharacterized protein LOC101762...    142   2e-34    
ref|XP_011088670.1|  PREDICTED: uncharacterized protein LOC105169831    141   3e-34    
ref|XP_008671179.1|  PREDICTED: uncharacterized protein LOC103648495    141   5e-34    
ref|NP_001052819.1|  Os04g0430600                                       141   7e-34    
ref|XP_004292277.1|  PREDICTED: uncharacterized protein LOC101299929    139   1e-33    
ref|XP_006422492.1|  hypothetical protein CICLE_v10028720mg             139   3e-33    
ref|XP_006418717.1|  hypothetical protein EUTSA_v10002796mg             137   3e-33    
ref|XP_008671180.1|  PREDICTED: uncharacterized protein LOC103648496    138   3e-33    
ref|NP_973982.1|  uncharacterized protein                               136   4e-33    
emb|CAE03026.1|  OSJNBa0084A10.1                                        140   6e-33    
gb|EPS63095.1|  hypothetical protein M569_11691                         135   2e-32    
ref|XP_004144875.1|  PREDICTED: uncharacterized protein LOC101215215    135   3e-32    
gb|EEE57538.1|  hypothetical protein OsJ_07860                          132   8e-32    
ref|XP_008447896.1|  PREDICTED: uncharacterized protein LOC103490245    133   1e-31    
gb|EAY94158.1|  hypothetical protein OsI_15933                          133   2e-31    
ref|XP_003579756.1|  PREDICTED: uncharacterized protein LOC100828851    132   4e-31    
ref|XP_010548129.1|  PREDICTED: uncharacterized protein LOC104819664    131   7e-31    
tpg|DAA36772.1|  TPA: hypothetical protein ZEAMMB73_294784              127   1e-30    
ref|XP_006412139.1|  hypothetical protein EUTSA_v10025836mg             129   2e-30    
gb|ACG44324.1|  hypothetical protein                                    128   3e-30    
ref|XP_010446968.1|  PREDICTED: uncharacterized protein LOC104729693    129   4e-30    
ref|XP_009385250.1|  PREDICTED: uncharacterized protein LOC103972629    129   5e-30    
gb|KHN45599.1|  hypothetical protein glysoja_042637                     124   1e-29    
emb|CBI21415.3|  unnamed protein product                                132   1e-29    
gb|EMS58465.1|  hypothetical protein TRIUR3_30260                       126   2e-29    
tpg|DAA36773.1|  TPA: hypothetical protein ZEAMMB73_576173              124   2e-29    
emb|CDY40644.1|  BnaA03g53190D                                          126   2e-29    
gb|EYU36315.1|  hypothetical protein MIMGU_mgv1a016055mg                121   3e-29    
ref|XP_009420580.1|  PREDICTED: uncharacterized protein LOC104000294    126   4e-29    
ref|XP_002869103.1|  hypothetical protein ARALYDRAFT_491133             125   4e-29    
gb|EMT26330.1|  hypothetical protein F775_29441                         121   5e-29    
ref|NP_195243.2|  late embryogenesis abundant hydroxyproline-rich...    125   8e-29    
ref|XP_010432318.1|  PREDICTED: uncharacterized protein LOC104716616    124   1e-28    
ref|XP_009138348.1|  PREDICTED: uncharacterized protein LOC103862395    124   2e-28    
gb|EYU32930.1|  hypothetical protein MIMGU_mgv11b016439mg               124   2e-28    
ref|XP_006652295.1|  PREDICTED: uncharacterized protein LOC102711611    124   3e-28    
ref|XP_006284172.1|  hypothetical protein CARUB_v10005311mg             123   4e-28    
ref|XP_010437513.1|  PREDICTED: uncharacterized protein LOC104721268    122   8e-28    
gb|EAZ30780.1|  hypothetical protein OsJ_14845                          123   1e-27    
gb|KHN09262.1|  hypothetical protein glysoja_043120                     116   2e-27    
gb|KDO56908.1|  hypothetical protein CISIN_1g047056mg                   115   3e-27    
ref|XP_003629794.1|  hypothetical protein MTR_8g086610                  118   1e-26    
ref|XP_003631035.1|  Retinoblastoma-binding protein                     118   2e-26    
ref|XP_001770486.1|  predicted protein                                  115   1e-25    
ref|XP_009146173.1|  PREDICTED: uncharacterized protein LOC103869...    113   2e-25    
gb|KEH16525.1|  late embryogenesis abundant protein                     110   2e-25    
ref|XP_002446492.1|  hypothetical protein SORBIDRAFT_06g016840          115   2e-25    
ref|XP_010508633.1|  PREDICTED: uncharacterized protein LOC104785177    114   4e-25    
ref|XP_010517707.1|  PREDICTED: uncharacterized protein LOC104793116    112   1e-24    
gb|KFK37081.1|  hypothetical protein AALP_AA4G210200                    112   3e-24    
ref|NP_001170054.1|  hypothetical protein                               112   4e-24    
ref|NP_001130191.1|  uncharacterized protein LOC100191285               111   5e-24    
ref|XP_009383563.1|  PREDICTED: uncharacterized protein LOC103971296    109   7e-24    
ref|XP_008661309.1|  PREDICTED: uncharacterized protein LOC100191...    112   1e-23    
ref|XP_010506000.1|  PREDICTED: uncharacterized protein LOC104782692    110   1e-23    
ref|XP_002454896.1|  hypothetical protein SORBIDRAFT_03g000960          104   2e-23    
ref|XP_002879963.1|  hypothetical protein ARALYDRAFT_903544             109   2e-23    
gb|AFK36076.1|  unknown                                                 106   4e-23    
ref|NP_181730.1|  uncharacterized protein                               107   9e-23    
ref|XP_006404532.1|  hypothetical protein EUTSA_v10000260mg             107   1e-22    
ref|XP_010446967.1|  PREDICTED: uncharacterized protein LOC104729692    102   3e-22    
emb|CDX83187.1|  BnaA03g23190D                                          105   4e-22    
ref|XP_009134019.1|  PREDICTED: uncharacterized protein LOC103858409    104   9e-22    
ref|XP_001761904.1|  predicted protein                                  103   4e-21    
ref|NP_001130431.1|  uncharacterized protein LOC100191528             99.8    7e-21    
emb|CDY21458.1|  BnaC03g27390D                                          102   9e-21    
ref|XP_006295605.1|  hypothetical protein CARUB_v10024717mg             100   2e-20    
emb|CDX72524.1|  BnaC07g45460D                                        97.8    2e-19    
ref|XP_009770746.1|  PREDICTED: uncharacterized protein LOC104221...  96.3    3e-19    
gb|KEH33461.1|  late embryogenesis abundant protein                   95.9    8e-19    
ref|XP_006422491.1|  hypothetical protein CICLE_v10028720mg           96.7    1e-18    
emb|CDY18096.1|  BnaA01g23570D                                        93.2    1e-18    
gb|KEH30614.1|  late embryogenesis abundant protein                   94.0    3e-18    
ref|XP_009796787.1|  PREDICTED: uncharacterized protein LOC104243305  94.0    5e-18    
ref|XP_008661310.1|  PREDICTED: uncharacterized protein LOC100191...  92.4    5e-17    
ref|XP_008661308.1|  PREDICTED: uncharacterized protein LOC100191...  92.4    9e-17    
gb|EMS53977.1|  hypothetical protein TRIUR3_17588                     85.9    5e-16    
ref|XP_007041703.1|  Group 2 isoform 2                                84.0    5e-15    
dbj|BAG98884.1|  unnamed protein product                              82.4    4e-14    
gb|AFW72719.1|  hypothetical protein ZEAMMB73_165173                  72.0    1e-11    
ref|XP_009354743.1|  PREDICTED: uncharacterized protein LOC103945878  75.5    2e-11    
ref|XP_004306533.1|  PREDICTED: uncharacterized protein LOC101295559  74.7    2e-11    
ref|XP_002313304.2|  hypothetical protein POPTR_0009s06610g           73.9    3e-11    
ref|XP_002299943.2|  hypothetical protein POPTR_0001s27420g           73.9    3e-11    
ref|XP_009396389.1|  PREDICTED: uncharacterized protein LOC103981392  73.9    4e-11    
ref|XP_010032431.1|  PREDICTED: uncharacterized protein LOC104421948  73.6    5e-11    
ref|XP_011025437.1|  PREDICTED: uncharacterized protein LOC105126310  73.6    6e-11    
ref|XP_008231296.1|  PREDICTED: uncharacterized protein LOC103330485  73.2    1e-10    
gb|KHG03510.1|  Delta-latroinsectotoxin-Lt1a                          72.8    1e-10    
ref|XP_011047406.1|  PREDICTED: uncharacterized protein LOC105141758  72.4    2e-10    
ref|XP_008801956.1|  PREDICTED: uncharacterized protein LOC103715936  72.4    2e-10    
ref|XP_010547259.1|  PREDICTED: uncharacterized protein LOC104819073  70.9    3e-10    
ref|XP_003599451.1|  hypothetical protein MTR_3g033530                71.2    4e-10    
gb|ABK92537.1|  unknown                                               70.9    4e-10    
ref|XP_006369631.1|  hypothetical protein POPTR_0001s27420g           70.9    4e-10    
ref|XP_008375174.1|  PREDICTED: uncharacterized protein LOC103438399  70.9    5e-10    
ref|XP_010906070.1|  PREDICTED: uncharacterized protein LOC105033...  70.5    6e-10    
ref|XP_006482882.1|  PREDICTED: uncharacterized protein LOC102619227  69.7    7e-10    
ref|XP_007052535.1|  Group 2, putative                                70.5    8e-10    
ref|XP_010257248.1|  PREDICTED: uncharacterized protein LOC104597425  70.1    1e-09    
ref|XP_009365070.1|  PREDICTED: uncharacterized protein LOC103954938  69.7    1e-09    
ref|XP_006439120.1|  hypothetical protein CICLE_v10032915mg           67.4    1e-09    
gb|EAY89050.1|  hypothetical protein OsI_10534                        69.3    1e-09    
ref|XP_007221095.1|  hypothetical protein PRUPE_ppa017396mg           69.3    2e-09    
ref|XP_010524000.1|  PREDICTED: uncharacterized protein LOC104802214  67.0    2e-09    
ref|NP_001049384.1|  Os03g0216500                                     69.3    2e-09    
gb|KDP43471.1|  hypothetical protein JCGZ_16758                       68.9    2e-09    
gb|KDO83400.1|  hypothetical protein CISIN_1g022378mg                 68.6    2e-09    
ref|XP_004499930.1|  PREDICTED: uncharacterized protein LOC101504...  68.2    4e-09    
emb|CDY72183.1|  BnaAnng40240D                                        64.7    8e-09    
ref|XP_008349871.1|  PREDICTED: uncharacterized protein LOC103413154  67.0    8e-09    
dbj|BAJ94921.1|  predicted protein                                    67.0    8e-09    
ref|XP_002275403.1|  PREDICTED: uncharacterized protein LOC100261971  67.0    9e-09    
emb|CBI24883.3|  unnamed protein product                              66.6    1e-08    
gb|KDO83399.1|  hypothetical protein CISIN_1g047150mg                 64.7    1e-08    
ref|XP_006483680.1|  PREDICTED: uncharacterized protein LOC102610090  66.2    2e-08    
ref|XP_006439121.1|  hypothetical protein CICLE_v10031819mg           66.2    2e-08    
gb|KHN39935.1|  hypothetical protein glysoja_041613                   63.5    2e-08    
ref|XP_003545979.2|  PREDICTED: uncharacterized protein LOC100792233  64.7    5e-08    
ref|XP_010088237.1|  hypothetical protein L484_012520                 63.9    9e-08    
ref|XP_008461795.1|  PREDICTED: uncharacterized protein LOC103500312  63.9    9e-08    
ref|XP_004499931.1|  PREDICTED: uncharacterized protein LOC101504...  63.2    1e-07    
ref|XP_008364710.1|  PREDICTED: uncharacterized protein LOC103428380  60.8    2e-07    
ref|XP_004149613.1|  PREDICTED: uncharacterized protein LOC101209149  62.8    2e-07    
ref|XP_009106389.1|  PREDICTED: uncharacterized protein LOC103832175  58.5    9e-07    
ref|XP_006298302.1|  hypothetical protein CARUB_v10014366mg           59.7    1e-06    
ref|XP_008652745.1|  PREDICTED: uncharacterized protein LOC103632788  59.3    3e-06    
gb|ACG41932.1|  hypothetical protein                                  59.3    3e-06    
ref|XP_010690285.1|  PREDICTED: uncharacterized protein LOC104903...  58.5    3e-06    
ref|XP_010695274.1|  PREDICTED: uncharacterized protein LOC104907942  59.3    3e-06    
ref|XP_002465639.1|  hypothetical protein SORBIDRAFT_01g042760        58.5    5e-06    
ref|XP_004985182.1|  PREDICTED: uncharacterized protein LOC101767...  58.5    6e-06    
ref|XP_007148877.1|  hypothetical protein PHAVU_005G021800g           57.8    9e-06    
ref|XP_003561882.1|  PREDICTED: uncharacterized protein LOC100842927  57.4    1e-05    
ref|XP_004985181.1|  PREDICTED: uncharacterized protein LOC101767...  57.4    1e-05    
ref|XP_011087649.1|  PREDICTED: uncharacterized protein LOC105169070  57.0    1e-05    
gb|KDO45909.1|  hypothetical protein CISIN_1g035215mg                 53.5    2e-05    
gb|KDP29417.1|  hypothetical protein JCGZ_18338                       52.0    7e-05    
ref|XP_001775621.1|  predicted protein                                51.6    6e-04    
ref|XP_004977338.1|  PREDICTED: uncharacterized protein LOC101753190  50.4    8e-04    



>ref|XP_009592779.1| PREDICTED: uncharacterized protein LOC104089557 [Nicotiana tomentosiformis]
Length=310

 Score =   408 bits (1048),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 230/320 (72%), Positives = 270/320 (84%), Gaps = 14/320 (4%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             MLHTKSESD+TSLA SSPS      VYYVQSPSRDSHD   G+KST MQPTP+F SP+ES
Sbjct  1     MLHTKSESDITSLAPSSPSRSPKRPVYYVQSPSRDSHD---GDKSTYMQPTPSFNSPMES  57

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDS  580
             PSHPS GRHSR SS +RFSGIFRSSSGRK   KR   NDKGWPECNVIMEEGKYDE +D 
Sbjct  58    PSHPSFGRHSRNSSASRFSGIFRSSSGRKNGRKR---NDKGWPECNVIMEEGKYDEYDDD  114

Query  581   WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
               ++RR  ALLAL GF++LF++FCLIIWGA RPYKA++T++SL+V+N YIGEGSDF+GV 
Sbjct  115   KGVTRRCQALLALLGFIVLFSIFCLIIWGAGRPYKAEITVRSLAVNNFYIGEGSDFSGVV  174

Query  761   TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVN  940
             T++++VNGSLRISVYNPATFYGIHVSSTP+NL++SDITVA+GQLKKYYQ RKSRR VLVN
Sbjct  175   TKMMTVNGSLRISVYNPATFYGIHVSSTPVNLIYSDITVASGQLKKYYQPRKSRRAVLVN  234

Query  941   IQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCEL  1120
             I+ TK PLYGAGS L A+ N    GG +VPL LDFE++S+GDVVGKLVRT  +++I C+L
Sbjct  235   IESTKFPLYGAGSGLDASNN----GGFKVPLKLDFEIRSRGDVVGKLVRTKNKKQISCDL  290

Query  1121  IIDSAGNKPIKFKKDSCAYS  1180
             +IDS  +KPIKFKK+SC YS
Sbjct  291   VIDSTSSKPIKFKKNSCVYS  310



>ref|XP_011072365.1| PREDICTED: uncharacterized protein LOC105157642 [Sesamum indicum]
 ref|XP_011072366.1| PREDICTED: uncharacterized protein LOC105157642 [Sesamum indicum]
 ref|XP_011072368.1| PREDICTED: uncharacterized protein LOC105157642 [Sesamum indicum]
Length=310

 Score =   404 bits (1037),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 228/320 (71%), Positives = 267/320 (83%), Gaps = 14/320 (4%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             MLHTKSESD+TSLA SSPS      VYYVQSPSRDSHD   G+KS+SM  TP F SP+ES
Sbjct  1     MLHTKSESDITSLAPSSPSRSPKRPVYYVQSPSRDSHD---GDKSSSMHATPNFNSPMES  57

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDS  580
             PSHPS GRHSR SS +RFSGIFRSSSGRKG  KR   NDKGWPECNVI+EEG YDE +D 
Sbjct  58    PSHPSFGRHSRNSSASRFSGIFRSSSGRKGGRKR---NDKGWPECNVIVEEGNYDEFDDD  114

Query  581   WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
                +RR  AL+ALCGF++LFTVFCLIIWGA RPYKA+V +KSL+V+N+Y+G G+DFTGVP
Sbjct  115   KAFTRRCQALMALCGFIVLFTVFCLIIWGAGRPYKAEVAVKSLTVNNLYLGSGADFTGVP  174

Query  761   TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVN  940
             T++L+VNGSLRISVYNPATFYGIHVS+TP+NL++SD+ VATGQLKKYYQ RKSR+ VLV+
Sbjct  175   TKMLNVNGSLRISVYNPATFYGIHVSATPVNLIYSDVVVATGQLKKYYQHRKSRKNVLVH  234

Query  941   IQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCEL  1120
             I+GTKVPLYGAGS+L  + N      VQVPL L+FE++S+GDVVGKLVRT + R++ C L
Sbjct  235   IEGTKVPLYGAGSNLVVSSNN----AVQVPLTLEFEIRSRGDVVGKLVRTKHHRRVSCSL  290

Query  1121  IIDSAGNKPIKFKKDSCAYS  1180
             +IDS  NKPIKFKKDSC YS
Sbjct  291   VIDSTSNKPIKFKKDSCTYS  310



>ref|XP_006343072.1| PREDICTED: uncharacterized protein LOC102588977 [Solanum tuberosum]
Length=310

 Score =   400 bits (1027),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 225/320 (70%), Positives = 267/320 (83%), Gaps = 14/320 (4%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             MLH KSESD+TSLA SSPS      VYYVQSPSRDS D   G+KS SMQPTP+F SP+ES
Sbjct  1     MLHAKSESDITSLAPSSPSRSPKRPVYYVQSPSRDSQD---GDKSASMQPTPSFNSPMES  57

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDS  580
             PSHPS GRHSR SS +RFSGIFRSSSGRK   KR   NDKGWPECNVI+EEGKYDE ++ 
Sbjct  58    PSHPSFGRHSRNSSASRFSGIFRSSSGRKNGRKR---NDKGWPECNVILEEGKYDEFDEE  114

Query  581   WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
               L+RR  ALLAL GF++LFT+FCLIIWGA RP+KA++T++S+ V+N Y+GEGSDFTGV 
Sbjct  115   KGLTRRCQALLALLGFVVLFTIFCLIIWGAGRPFKAEITVRSMVVNNFYVGEGSDFTGVV  174

Query  761   TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVN  940
             T++++VN SLRISVYNPATFYGIHV+STPINL++SDI VA+GQLKKY+Q RKSRRTVLV+
Sbjct  175   TKMMTVNASLRISVYNPATFYGIHVTSTPINLIYSDIVVASGQLKKYFQPRKSRRTVLVS  234

Query  941   IQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCEL  1120
             I+ TKVPLYGAGSSL A  N    GG +VPL L+FE+KS+GDVVGKLVRT ++++I C+L
Sbjct  235   IEATKVPLYGAGSSLDAATN----GGFKVPLKLEFEIKSRGDVVGKLVRTKHKKEISCDL  290

Query  1121  IIDSAGNKPIKFKKDSCAYS  1180
             +IDS   KPIKFKK+SC YS
Sbjct  291   VIDSISTKPIKFKKNSCVYS  310



>ref|XP_004235669.1| PREDICTED: uncharacterized protein LOC101263095 [Solanum lycopersicum]
Length=310

 Score =   395 bits (1016),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 222/320 (69%), Positives = 266/320 (83%), Gaps = 14/320 (4%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             MLHTKSESD+TSLA SSPS      VYYVQSPSRDS D   G+KS SMQPTP+F SP+ES
Sbjct  1     MLHTKSESDITSLAPSSPSRSPKRPVYYVQSPSRDSQD---GDKSASMQPTPSFNSPMES  57

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDS  580
             PSHPS GRHSR SS +RFSGIFRSSSGRK   KR   NDKGWPECNVI+EEGKYDE ++ 
Sbjct  58    PSHPSFGRHSRNSSASRFSGIFRSSSGRKNGRKR---NDKGWPECNVILEEGKYDEFDEE  114

Query  581   WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
               L+RR  ALLAL GF++LF++FCLIIWGA RP+KA++T++S+ V+N Y+GEGSDFTGV 
Sbjct  115   KGLTRRCQALLALLGFVVLFSIFCLIIWGAGRPFKAEITVRSMVVNNFYVGEGSDFTGVV  174

Query  761   TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVN  940
             T++++VN SLRISVYNPATFYGIHV+STPINL++SDI VA+GQL+KY+Q RKSRRT LV+
Sbjct  175   TKMMTVNASLRISVYNPATFYGIHVTSTPINLIYSDIVVASGQLRKYFQPRKSRRTELVS  234

Query  941   IQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCEL  1120
             I+ TKVPLYGAGSSL A  N    GG +VPL L+FE+KS+GDVVGKLVRT ++++I C L
Sbjct  235   IEATKVPLYGAGSSLDAATN----GGFKVPLKLEFEIKSRGDVVGKLVRTKHKKEISCNL  290

Query  1121  IIDSAGNKPIKFKKDSCAYS  1180
             +IDS   KPIKFKK+SC Y+
Sbjct  291   VIDSTSTKPIKFKKNSCVYT  310



>ref|XP_002284456.1| PREDICTED: uncharacterized protein LOC100261724 [Vitis vinifera]
 emb|CBI36121.3| unnamed protein product [Vitis vinifera]
Length=310

 Score =   392 bits (1008),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 228/319 (71%), Positives = 264/319 (83%), Gaps = 14/319 (4%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             MLHTKSESD+TSLA SSPS      VYYVQSPSRDSHD   G+KS+SM  TP + SP+ES
Sbjct  1     MLHTKSESDITSLAPSSPSRSPKRPVYYVQSPSRDSHD---GDKSSSMHATPIYNSPMES  57

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDS  580
             PSHPS GRHSR SS +RFSGIFRSSSGRKG  KR   NDKGWPECNVI+EEG YDELE  
Sbjct  58    PSHPSFGRHSRNSSASRFSGIFRSSSGRKGSRKR---NDKGWPECNVIVEEGNYDELEHK  114

Query  581   WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
                SRRF AL+AL  F+LLFTVFCLIIWGA+RPYKA+VT+KSL+V+NIY GEGSD TGVP
Sbjct  115   GF-SRRFQALIALTSFVLLFTVFCLIIWGASRPYKAEVTVKSLTVNNIYAGEGSDSTGVP  173

Query  761   TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVN  940
             T++L++NGSLRISVYNPAT +GIHVSSTPINLV+S+I VATGQLKKYYQ RKSRRTV V 
Sbjct  174   TKMLTLNGSLRISVYNPATLFGIHVSSTPINLVYSEIVVATGQLKKYYQPRKSRRTVSVI  233

Query  941   IQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCEL  1120
             ++GTKVPLYGAGSSL  + N +    V+ P  L+FE+KS+GDVVGKLVRT ++RK+ C L
Sbjct  234   LEGTKVPLYGAGSSLAVSNNNN---VVEYPFTLEFEIKSRGDVVGKLVRTKHKRKVSCPL  290

Query  1121  IIDSAGNKPIKFKKDSCAY  1177
             +IDS   KPIKFK+++CAY
Sbjct  291   VIDSIRTKPIKFKRNTCAY  309



>emb|CDO98030.1| unnamed protein product [Coffea canephora]
Length=310

 Score =   384 bits (986),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 220/319 (69%), Positives = 264/319 (83%), Gaps = 14/319 (4%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             MLH KSESD+TSLA SSPS      VY+VQSPSRDS+D   G+KS SMQPTP+F SP+ES
Sbjct  1     MLHAKSESDITSLAPSSPSRSPKRPVYFVQSPSRDSND---GDKSASMQPTPSFNSPMES  57

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDS  580
             PSHPS GRHSR SS +RFSGIFRSSSGRKG  KR   NDKGWPECNVI+EEGKYDE +D 
Sbjct  58    PSHPSFGRHSRNSSASRFSGIFRSSSGRKGGRKR---NDKGWPECNVIVEEGKYDEFDDD  114

Query  581   WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
                +RRF AL+ALCGF++LFTVFCLIIWGA R Y+A+V++KSL V N+Y+G GSDFTGVP
Sbjct  115   KGFTRRFQALMALCGFIVLFTVFCLIIWGAGRNYRAEVSVKSLVVHNVYMGSGSDFTGVP  174

Query  761   TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVN  940
             T++ +VNG+LR+++YNPATFYGIHVSS+P+NL++SDI VAT ++KKYYQ RKS RTVLV+
Sbjct  175   TKMFTVNGTLRMAIYNPATFYGIHVSSSPVNLIYSDIVVATAEMKKYYQPRKSHRTVLVD  234

Query  941   IQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCEL  1120
             I+GTKVPLYGAGS+L  + N    G V+VPL LDF ++S+GDVVGKLVRT +RR + C L
Sbjct  235   IEGTKVPLYGAGSNLVESVN----GVVRVPLTLDFWIRSRGDVVGKLVRTKHRRHVSCSL  290

Query  1121  IIDSAGNKPIKFKKDSCAY  1177
             +IDS  +KPIKF KDSC Y
Sbjct  291   VIDSTISKPIKFLKDSCVY  309



>ref|XP_010062482.1| PREDICTED: uncharacterized protein LOC104449880 [Eucalyptus grandis]
 gb|KCW69618.1| hypothetical protein EUGRSUZ_F03033 [Eucalyptus grandis]
Length=310

 Score =   376 bits (965),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 221/320 (69%), Positives = 256/320 (80%), Gaps = 15/320 (5%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             ML TKSESD+TSLA SSPS      VYYVQSPSRDSHD   G+KS+SM  TP   SP+ES
Sbjct  2     MLSTKSESDITSLAPSSPSRSPKRPVYYVQSPSRDSHD---GDKSSSMHATPMSHSPMES  58

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDS  580
             PSHPS GRHSR SS +RFSGIFRSSSGRKG  KR   NDKGWPECNVI+EEG YDELED 
Sbjct  59    PSHPSFGRHSRNSSYSRFSGIFRSSSGRKGGRKR---NDKGWPECNVILEEGSYDELEDK  115

Query  581   WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
               + RRF AL+AL  F+LLFTVFCLIIWGA+RPYKA++T+KSL+VSN Y+GEGSDF+GV 
Sbjct  116   AFM-RRFQALIALFSFVLLFTVFCLIIWGASRPYKAEITVKSLAVSNFYVGEGSDFSGVA  174

Query  761   TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVN  940
             T++L+ NGSLR+SVYNPA  +GIHVSSTPINL + D+TVATGQLKKYYQ RKSRR+VLV 
Sbjct  175   TKMLTFNGSLRMSVYNPAPLFGIHVSSTPINLEYLDLTVATGQLKKYYQPRKSRRSVLVY  234

Query  941   IQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCEL  1120
             ++GTKVPLYGAGSS+  + N    G   VP  L FE+ S+GDVVGKLVRT +R++I C +
Sbjct  235   LEGTKVPLYGAGSSITISPN----GAEVVPFTLQFEIHSRGDVVGKLVRTRHRKRITCPV  290

Query  1121  IIDSAGNKPIKFKKDSCAYS  1180
              IDS   KP+ FKKDSC YS
Sbjct  291   TIDSTSTKPMTFKKDSCTYS  310



>gb|EYU21459.1| hypothetical protein MIMGU_mgv1a010181mg [Erythranthe guttata]
Length=320

 Score =   371 bits (952),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 214/318 (67%), Positives = 254/318 (80%), Gaps = 12/318 (4%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH-----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVE  397
             M HTKSESD+TSLA SSPS       VYYVQSPSRDSHD   G+KS+SM  TP F SP+E
Sbjct  1     MQHTKSESDITSLAPSSPSRSPKRHPVYYVQSPSRDSHD---GDKSSSMHATPNFHSPME  57

Query  398   SPSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELED  577
             SPSHPS GRHSR SS +RFSGIFRSSSGRKG G     NDKGWPEC+VI+EEG YDELE+
Sbjct  58    SPSHPSFGRHSRNSSASRFSGIFRSSSGRKGGGGGRKRNDKGWPECDVIVEEGNYDELEN  117

Query  578   SWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGV  757
                 +RR  AL+ALCGF++LFTVFCLIIWGA RPYK  V +KSL+V+N+YI  G+DFTGV
Sbjct  118   EKTFTRRCQALMALCGFIVLFTVFCLIIWGAGRPYKPDVAVKSLTVNNVYISSGTDFTGV  177

Query  758   PTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLV  937
             P + L+VNGSLRI+VYNPATFYGIHVS+TP+NLV+S++ VATG+LKKYYQ RKS + VLV
Sbjct  178   PMKTLNVNGSLRINVYNPATFYGIHVSATPVNLVYSEVIVATGELKKYYQQRKSHKNVLV  237

Query  938   NIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCE  1117
             +I+GTKVPLYGAGS+L  T N       ++PL L+FE+ SQGDVVGKLVRT +RR++ C 
Sbjct  238   HIEGTKVPLYGAGSNLVITDN----AVFKLPLRLEFELISQGDVVGKLVRTKHRRRVSCP  293

Query  1118  LIIDSAGNKPIKFKKDSC  1171
             ++IDS  +KPI   KDSC
Sbjct  294   VVIDSTSSKPIVLNKDSC  311



>ref|XP_007150628.1| hypothetical protein PHAVU_005G168300g [Phaseolus vulgaris]
 ref|XP_007150629.1| hypothetical protein PHAVU_005G168300g [Phaseolus vulgaris]
 gb|ESW22622.1| hypothetical protein PHAVU_005G168300g [Phaseolus vulgaris]
 gb|ESW22623.1| hypothetical protein PHAVU_005G168300g [Phaseolus vulgaris]
Length=310

 Score =   369 bits (948),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 203/319 (64%), Positives = 259/319 (81%), Gaps = 15/319 (5%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             ML TKS+SD+TSLA SSPS      VYYVQSPSRDSHD   G+KS+SMQ TP   SPVES
Sbjct  2     MLSTKSDSDITSLAPSSPSRSPKRPVYYVQSPSRDSHD---GDKSSSMQATPVSNSPVES  58

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDS  580
             PSHPS GRHSR SS +RFSGIFRSSS  +  G++   NDKGWPEC+VI+EEG Y E +D 
Sbjct  59    PSHPSFGRHSRNSSASRFSGIFRSSSSGRKGGRKR--NDKGWPECDVILEEGSYHEFQDK  116

Query  581   WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
                +RR  AL+A+  F+L+FTVFCLIIWGA+RPYK +V +KSL+V N+Y+GEG DFTGVP
Sbjct  117   GF-TRRLQALIAVFTFVLVFTVFCLIIWGASRPYKTEVNVKSLTVHNLYVGEGLDFTGVP  175

Query  761   TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVN  940
             T++L+VN +LR+S+YNPATF+GIHV STPINLVFSDIT+ATG++KKYYQ RKS+R + VN
Sbjct  176   TKMLTVNVTLRMSIYNPATFFGIHVHSTPINLVFSDITIATGEVKKYYQPRKSQRILSVN  235

Query  941   IQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCEL  1120
             ++G KVPLYGAGS++  ++      GV+VPL L+FE++S+GDVVGKLV+T + ++I C L
Sbjct  236   VEGAKVPLYGAGSTITVSQT-----GVEVPLTLNFEIRSRGDVVGKLVKTKHHKQITCPL  290

Query  1121  IIDSAGNKPIKFKKDSCAY  1177
             +I+S+G+KPIKFK+++C Y
Sbjct  291   VINSSGSKPIKFKRNACTY  309



>ref|XP_007024179.1| Uncharacterized protein TCM_028754 [Theobroma cacao]
 gb|EOY26801.1| Uncharacterized protein TCM_028754 [Theobroma cacao]
Length=305

 Score =   368 bits (945),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 218/320 (68%), Positives = 256/320 (80%), Gaps = 22/320 (7%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             ML  KSESD+TSLA SSPS      VYYVQSPSRDSHD   G+KS+SMQP     SP+ES
Sbjct  2     MLSAKSESDITSLAPSSPSRSPKRPVYYVQSPSRDSHD---GDKSSSMQP-----SPMES  53

Query  401   PSHPS-LGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELED  577
             PSHPS  GRHSR SS +RFSGIFRSSSGRKG  KR   NDKGWPECNVIMEEG YDE ED
Sbjct  54    PSHPSSFGRHSRNSSASRFSGIFRSSSGRKGSRKR---NDKGWPECNVIMEEGSYDEYED  110

Query  578   SWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGV  757
                 +RRF AL+A+  F++LFTVFCLIIWGA++PYKA++T+KSL+V N YIGEGSDF+GV
Sbjct  111   K-AFTRRFQALIAVLTFVVLFTVFCLIIWGASKPYKAEITVKSLAVHNFYIGEGSDFSGV  169

Query  758   PTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLV  937
             PT++L+VNGSL++SVYNPAT +GIHVSS PINL++S+I VATGQLKKYYQ RKSRRTV V
Sbjct  170   PTKMLTVNGSLKLSVYNPATIFGIHVSSNPINLIYSEIPVATGQLKKYYQPRKSRRTVSV  229

Query  938   NIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCE  1117
              ++G KVPLYGAGSSL  T+N     G ++PL L FEV S+G+VVGKLVRT +RR+I C 
Sbjct  230   VLEGKKVPLYGAGSSLTFTQN-----GAEIPLTLKFEVHSRGNVVGKLVRTKHRRQISCP  284

Query  1118  LIIDSAGNKPIKFKKDSCAY  1177
             L++DS    PIKFKK +C Y
Sbjct  285   LVMDSTRTNPIKFKKGTCTY  304



>gb|AGV54202.1| hypothetical protein [Phaseolus vulgaris]
Length=309

 Score =   368 bits (945),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 207/319 (65%), Positives = 259/319 (81%), Gaps = 16/319 (5%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             ML TKS+SD+TSLA SSPS      VYYVQSPSRDSHD   G+KS+SMQ TP   SPVES
Sbjct  2     MLSTKSDSDITSLAPSSPSRSPKRPVYYVQSPSRDSHD---GDKSSSMQATPVSNSPVES  58

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDS  580
             PSHPS GRHSR SS +RFSGIFRS  GRKG  KR   NDKGWPEC+VI+EEG Y E +D 
Sbjct  59    PSHPSFGRHSRNSSASRFSGIFRSFFGRKGGRKR---NDKGWPECDVILEEGFYHEFQDK  115

Query  581   WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
                 RR  AL+A+  F+L+FTVFCLIIWGA+RPYKA+V +KSL+V N+Y+GEG DFTGVP
Sbjct  116   GF-PRRLQALIAVFTFVLVFTVFCLIIWGASRPYKAEVNVKSLTVHNLYVGEGLDFTGVP  174

Query  761   TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVN  940
             T++L+VN +LR+S+YNPATF+GIHV STPINLVFSDIT+ATG++KKYYQ RKS+R + VN
Sbjct  175   TKMLTVNVTLRMSIYNPATFFGIHVHSTPINLVFSDITIATGEVKKYYQPRKSQRILSVN  234

Query  941   IQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCEL  1120
             ++G KVPLYGAGS++  ++      GV+VPL L+FE++S+GDVVGKLV+T + ++I C L
Sbjct  235   VEGAKVPLYGAGSTITVSQT-----GVEVPLTLNFEIRSRGDVVGKLVKTKHHKQITCPL  289

Query  1121  IIDSAGNKPIKFKKDSCAY  1177
             +I+S+G+KPIKFK+++C Y
Sbjct  290   VINSSGSKPIKFKRNACTY  308



>ref|XP_010098075.1| hypothetical protein L484_026207 [Morus notabilis]
 gb|EXB74512.1| hypothetical protein L484_026207 [Morus notabilis]
Length=316

 Score =   367 bits (941),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 209/323 (65%), Positives = 257/323 (80%), Gaps = 16/323 (5%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFT-SPVE  397
             M+ TKSESD+TSLA SSPS      VYYVQSPSRDSHD GD + S+SMQ TP +  SP+E
Sbjct  1     MISTKSESDITSLAPSSPSRSPKRAVYYVQSPSRDSHD-GD-KSSSSMQATPIYNNSPME  58

Query  398   SPSHPS--LGRHSRTssgtrfs-gifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDE  568
             SPSH S   GRHSR SS +RFS     SS  + G G++   NDKGWPECNVI+EEG YD+
Sbjct  59    SPSHSSTSFGRHSRNSSASRFSGIFRSSSGRKGGGGRKHGRNDKGWPECNVILEEGPYDD  118

Query  569   LEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDF  748
             LED   L RR  AL+AL  F +LFTVFCLIIWGA+RP+KA++T+KS +V+N Y+G GSDF
Sbjct  119   LEDK-ALPRRVQALIALFSFFVLFTVFCLIIWGASRPFKAEITVKSFAVNNFYVGSGSDF  177

Query  749   TGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRT  928
             +GVPT++L+VNGSL++SVYNPAT +GIHVSS  +NLV+S+ITVATGQLKKYYQ RKSRR+
Sbjct  178   SGVPTKMLTVNGSLKLSVYNPATIFGIHVSSKTMNLVYSEITVATGQLKKYYQPRKSRRS  237

Query  929   VLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKI  1108
             VLVN++GTKVPLYGAGS+L  ++N     GV VPL L+FE++S+G+VVGKLVRT ++R+I
Sbjct  238   VLVNLEGTKVPLYGAGSTLTVSQN-----GVVVPLTLNFEIRSRGNVVGKLVRTKHKRQI  292

Query  1109  WCELIIDSAGNKPIKFKKDSCAY  1177
              C +IIDS   KPIKFKK+SC Y
Sbjct  293   SCPVIIDSTRTKPIKFKKNSCTY  315



>ref|XP_011000507.1| PREDICTED: uncharacterized protein LOC105108056 [Populus euphratica]
 ref|XP_011009821.1| PREDICTED: uncharacterized protein LOC105114828 [Populus euphratica]
Length=309

 Score =   365 bits (937),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 212/323 (66%), Positives = 259/323 (80%), Gaps = 23/323 (7%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             ML  KSESD+TSLA SSPS       YYVQSPSRDSHD   G+KS+SMQP     SP+ES
Sbjct  1     MLSAKSESDITSLAPSSPSRSPKRPAYYVQSPSRDSHD---GDKSSSMQP-----SPMES  52

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsN----DKGWPECNVIMEEGKYDE  568
             PSHPS GRHSR SS +RFSGIFRSSSGRK   ++   N    DKGWPECNVIMEEG YD+
Sbjct  53    PSHPSYGRHSRNSSASRFSGIFRSSSGRKSGSRKRNDNKGWNDKGWPECNVIMEEGNYDD  112

Query  569   LEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDF  748
              + ++  +RRF AL+AL  F+ LFTVFCLIIWGA+RPYKA++T+KSL+V+N Y+GEG+D 
Sbjct  113   EDKAF--TRRFQALIALLSFVFLFTVFCLIIWGASRPYKAEITVKSLAVNNFYVGEGTDS  170

Query  749   TGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRT  928
             +GVPT+LL+VNGSLR+SVYNPAT +GIHVSSTPINL++S++ +ATGQLKKYYQ RKSRRT
Sbjct  171   SGVPTKLLTVNGSLRMSVYNPATLFGIHVSSTPINLIYSEVPIATGQLKKYYQPRKSRRT  230

Query  929   VLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKI  1108
             V V ++G KVPLYGAGSSL  ++      G+ VPL L F+VKS+G+VVGKLVRT +RR+I
Sbjct  231   VSVIVEGNKVPLYGAGSSLTVSQT-----GIVVPLTLKFDVKSRGNVVGKLVRTKHRRQI  285

Query  1109  WCELIIDSAGNKPIKFKKDSCAY  1177
              C L+IDS+ +KPIKFKK++C Y
Sbjct  286   SCPLVIDSSSSKPIKFKKNTCTY  308



>ref|NP_001241341.1| uncharacterized protein LOC100818121 [Glycine max]
 ref|XP_006597065.1| PREDICTED: uncharacterized protein LOC100818121 isoform X1 [Glycine 
max]
 ref|XP_006597066.1| PREDICTED: uncharacterized protein LOC100818121 isoform X2 [Glycine 
max]
 gb|ACU18152.1| unknown [Glycine max]
 gb|KHM98751.1| hypothetical protein glysoja_030804 [Glycine soja]
Length=309

 Score =   364 bits (935),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 210/319 (66%), Positives = 262/319 (82%), Gaps = 16/319 (5%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             ML  KSESD+TSLA SSPS      VYYVQSPSRDSHD   G+KS+SMQ TP   SP+ES
Sbjct  2     MLSAKSESDITSLAPSSPSRSPKRPVYYVQSPSRDSHD---GDKSSSMQATPISNSPMES  58

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDS  580
             PSHPS GRHSR SS +RFSGIFRSSSGRKG  KR   NDKGWPEC+VI+EEG Y E +D 
Sbjct  59    PSHPSFGRHSRNSSASRFSGIFRSSSGRKGSRKR---NDKGWPECDVILEEGSYHEFQDK  115

Query  581   WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
                +RRF AL+A+  F+++FTVFCLIIWGA+RPYKA++ +KSL+V N Y+GEGSDFTGV 
Sbjct  116   GF-TRRFQALIAVLTFVVVFTVFCLIIWGASRPYKAEIAVKSLTVHNFYVGEGSDFTGVL  174

Query  761   TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVN  940
             T++L+VNG+LR+S+YNPATF+GIHV STPINLVFS+ITVATG+LKK+YQ RKS R V VN
Sbjct  175   TKMLTVNGTLRMSIYNPATFFGIHVHSTPINLVFSEITVATGELKKHYQPRKSHRIVSVN  234

Query  941   IQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCEL  1120
             ++GTKVPLYGAGS++  ++      GV+VPL L+FE++S+G+VVGKLV+T +R++I C L
Sbjct  235   LEGTKVPLYGAGSTITVSQT-----GVEVPLTLNFEIRSRGNVVGKLVKTRHRKEITCPL  289

Query  1121  IIDSAGNKPIKFKKDSCAY  1177
             +++S+ +KPIKFKK+SC Y
Sbjct  290   VLNSSRSKPIKFKKNSCTY  308



>ref|XP_002516033.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46453.1| conserved hypothetical protein [Ricinus communis]
Length=306

 Score =   363 bits (933),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 215/321 (67%), Positives = 258/321 (80%), Gaps = 22/321 (7%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             ML TKSESD+TSLA SSPS      VYYVQSPSRDSHD   G+KS+SMQP     SP+ES
Sbjct  1     MLSTKSESDITSLAPSSPSRSPKRPVYYVQSPSRDSHD---GDKSSSMQP-----SPMES  52

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmms--NDKGWPECNVIMEEGKYDELE  574
             PSHPS GRHSR SS +RFSGIFRSSSGRK   KR     NDKGWPECNVIMEEG YDE +
Sbjct  53    PSHPSFGRHSRNSSASRFSGIFRSSSGRKSNRKRNEKGWNDKGWPECNVIMEEGDYDEDK  112

Query  575   DSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTG  754
                  +RR  AL+ALC F+LLFTVFCLIIWGA+RPYKA++ +KSLSVSN+Y+GEGSDF+G
Sbjct  113   ---AFTRRCQALIALCSFILLFTVFCLIIWGASRPYKAEIIVKSLSVSNLYVGEGSDFSG  169

Query  755   VPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVL  934
             VPT++L+VNGSLR+S+YNPA+ +GIHVSSTPINL++S+I VATGQLKKYYQ RKSRRT+ 
Sbjct  170   VPTKMLTVNGSLRMSIYNPASIFGIHVSSTPINLIYSEIPVATGQLKKYYQPRKSRRTIS  229

Query  935   VNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWC  1114
             V ++G KVPLYGAGS L  ++      G+ VPL L FE++S+G+VVGKLVRT +R+ I C
Sbjct  230   VIVKGEKVPLYGAGSGLTVSQT-----GIIVPLTLQFEIRSRGNVVGKLVRTKHRKFISC  284

Query  1115  ELIIDSAGNKPIKFKKDSCAY  1177
              +++DS  +KPIKFKKD+C Y
Sbjct  285   PVVLDSTKSKPIKFKKDTCTY  305



>ref|XP_003597750.1| hypothetical protein MTR_2g101870 [Medicago truncatula]
 gb|AES68001.1| late embryogenesis abundant protein [Medicago truncatula]
Length=309

 Score =   360 bits (925),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 205/319 (64%), Positives = 257/319 (81%), Gaps = 15/319 (5%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             ML  KSESD+TSLA SSPS      VYYVQSPSRDSHD   G+KS+SMQ TP   SP+ES
Sbjct  1     MLSAKSESDITSLAPSSPSRSPKRPVYYVQSPSRDSHD---GDKSSSMQATPISNSPMES  57

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDS  580
             PSHPS GRHSR SS +RFSGIFRSSSGRKG  KR   NDKGWPEC VI+EEG Y E ED 
Sbjct  58    PSHPSFGRHSRNSSASRFSGIFRSSSGRKGSRKR---NDKGWPECGVILEEGSYREFED-  113

Query  581   WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
                +RRF AL+A+  FL++FTVFCLIIWGA+RP+KA+VT+KSL+V N+Y+ EG+D TGVP
Sbjct  114   MSFARRFQALIAVFTFLVVFTVFCLIIWGASRPFKAEVTVKSLAVHNLYVWEGTDHTGVP  173

Query  761   TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVN  940
             T++L++N +L +++YNPATF+GIHV ++PINLV+SDI++ATG+LKK+YQ RKS R V VN
Sbjct  174   TKILTINSTLHMNIYNPATFFGIHVHTSPINLVYSDISIATGELKKHYQPRKSHRIVSVN  233

Query  941   IQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCEL  1120
             ++G K+PLYGAGS++  ++    TG V+V L L FE++S+GDVVGKLVRT + ++I C L
Sbjct  234   LEGNKIPLYGAGSTITVSQ----TGSVEVALVLKFEIRSRGDVVGKLVRTRHHKEITCPL  289

Query  1121  IIDSAGNKPIKFKKDSCAY  1177
             +I+SAG KPIKFKK+SC Y
Sbjct  290   VINSAGTKPIKFKKNSCTY  308



>gb|KDP37241.1| hypothetical protein JCGZ_06297 [Jatropha curcas]
Length=306

 Score =   360 bits (925),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 216/321 (67%), Positives = 257/321 (80%), Gaps = 22/321 (7%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             ML TKSESD+TSLA SSPS      VYYVQSPSRDSHD   G+KS+SMQP     SP+ES
Sbjct  1     MLSTKSESDITSLAPSSPSRSPKRPVYYVQSPSRDSHD---GDKSSSMQP-----SPMES  52

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmms--NDKGWPECNVIMEEGKYDELE  574
             PSHPS GRHSR SS +RFSGIFRSSSGRKG  KR     N+KGWPECNVIMEEG YDE +
Sbjct  53    PSHPSFGRHSRNSSASRFSGIFRSSSGRKGSRKRNEKGWNEKGWPECNVIMEEGDYDEDK  112

Query  575   DSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTG  754
                  +RRF AL+ALC F++LFTVFCLIIWGA+RPYKA++T+KSLSVSN+Y GEGSDF+G
Sbjct  113   ---AFTRRFQALIALCSFIILFTVFCLIIWGASRPYKAEITVKSLSVSNVYAGEGSDFSG  169

Query  755   VPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVL  934
             VPT++L+VNGSLRIS+ NPAT +GIHVSSTPINL++S+I VATGQLKK+YQ RKSRRTV 
Sbjct  170   VPTKMLTVNGSLRISINNPATIFGIHVSSTPINLIYSEIPVATGQLKKHYQPRKSRRTVS  229

Query  935   VNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWC  1114
             V ++G KVPLYGAGSSL  ++      G+ +PL L FE++S+G+VVGKLVRT ++ +I C
Sbjct  230   VIVEGDKVPLYGAGSSLTVSQT-----GIVIPLTLKFEIRSRGNVVGKLVRTRHKTQISC  284

Query  1115  ELIIDSAGNKPIKFKKDSCAY  1177
              ++IDS   KPIKFKK  C Y
Sbjct  285   PVVIDSTSTKPIKFKKGICTY  305



>gb|KHG06240.1| hypothetical protein F383_31810 [Gossypium arboreum]
Length=305

 Score =   358 bits (919),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 214/320 (67%), Positives = 255/320 (80%), Gaps = 21/320 (7%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             ML TKSESD+TSLA SSPS      VYYVQSPSRDSHD   G+KS++MQP     SP+ES
Sbjct  1     MLSTKSESDITSLAPSSPSRSPKRPVYYVQSPSRDSHD---GDKSSTMQP-----SPMES  52

Query  401   PSHPS-LGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELED  577
             PSHPS +GRHSR SS +RFSGIFRSSSGRKG  KR   NDKGWPEC VIMEEG YDE ED
Sbjct  53    PSHPSSVGRHSRNSSASRFSGIFRSSSGRKGGRKR---NDKGWPECGVIMEEGPYDEFED  109

Query  578   SWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGV  757
                 +RR  AL+AL  F++LFTVFCLIIWGA+RPYKA++ +KS +V N YIGEGSDF+GV
Sbjct  110   K-AFTRRCQALIALFTFVVLFTVFCLIIWGASRPYKAEILVKSFAVHNFYIGEGSDFSGV  168

Query  758   PTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLV  937
             PT+LL+VNG+L++SVYNPAT +GIHV+S P+NLV+S+I VATGQLKKYYQ RKSRRTV V
Sbjct  169   PTKLLTVNGTLKLSVYNPATIFGIHVTSNPVNLVYSEIPVATGQLKKYYQPRKSRRTVSV  228

Query  938   NIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCE  1117
              ++G KVPLYGAGS+L  T+N    G  ++PL L FEV+S+G+VVGKLVRT +R++I C 
Sbjct  229   VLEGKKVPLYGAGSTLTFTQN----GAAEIPLVLKFEVRSRGNVVGKLVRTKHRKQISCP  284

Query  1118  LIIDSAGNKPIKFKKDSCAY  1177
             L+IDS   K IKFKK +C Y
Sbjct  285   LVIDSTKTKLIKFKKTTCTY  304



>ref|XP_008228551.1| PREDICTED: uncharacterized protein LOC103327949 [Prunus mume]
Length=312

 Score =   355 bits (912),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 216/322 (67%), Positives = 251/322 (78%), Gaps = 18/322 (6%)
 Frame = +2

Query  233   MLH-TKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFT-SPV  394
             MLH TKSESDVTSLA SSPS      VYYVQSPSRDSHD   G+KS+SMQ TP +  SP+
Sbjct  1     MLHSTKSESDVTSLAPSSPSRSPKVPVYYVQSPSRDSHD---GDKSSSMQATPIYNNSPM  57

Query  395   ESPSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELE  574
             ESPSHPS GRHSR SS +RFSGIFRSSSGRKG  K+   NDKGWPEC VIMEEG YD+ +
Sbjct  58    ESPSHPSFGRHSRNSSASRFSGIFRSSSGRKGGRKQR--NDKGWPECKVIMEEGAYDDFD  115

Query  575   DSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTG  754
                 LSRR    +AL  F++LFT+FCLIIWGA+RPY A V +KSL +SN YIGEGSDF+G
Sbjct  116   KG--LSRRVQVCIALLSFVMLFTIFCLIIWGASRPYNATVVVKSLEISNFYIGEGSDFSG  173

Query  755   VPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVL  934
             VPT+LL+VNGSLR+SV+N A+ +GIHVSS PI L +S+I+VATGQLKKYYQ RKS RTV 
Sbjct  174   VPTKLLTVNGSLRLSVHNSASMFGIHVSSAPIILAYSEISVATGQLKKYYQPRKSLRTVS  233

Query  935   VNIQGTKVPLYGAGSSLPATKNKDGTGG-VQVPLALDFEVKSQGDVVGKLVRTDYRRKIW  1111
             VN+QGTKVPLYGAGSSL  TK    TGG V +PL L  E++S+  VVGKLV+T +RR+I 
Sbjct  234   VNLQGTKVPLYGAGSSLTYTK----TGGLVPIPLTLKLEIRSRAFVVGKLVKTKHRRRIS  289

Query  1112  CELIIDSAGNKPIKFKKDSCAY  1177
             C L++D    KPIKFKK SC Y
Sbjct  290   CPLVLDPTVTKPIKFKKSSCTY  311



>ref|XP_006426961.1| hypothetical protein CICLE_v10026158mg [Citrus clementina]
 gb|ESR40201.1| hypothetical protein CICLE_v10026158mg [Citrus clementina]
Length=304

 Score =   355 bits (911),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 211/319 (66%), Positives = 253/319 (79%), Gaps = 21/319 (7%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             ML  KSESD+TSLA SSPS      VYYVQSPSRDS D   G+KS+S+QP     SP+ES
Sbjct  2     MLSAKSESDITSLAPSSPSRSPKRPVYYVQSPSRDSQD---GDKSSSLQP-----SPMES  53

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDS  580
             PSHPS GRHSR SS +RFSGIFRSSSGRKG  KR   NDKGWPECNVI+EEGKYDE ED 
Sbjct  54    PSHPSFGRHSRNSSASRFSGIFRSSSGRKGTRKR---NDKGWPECNVILEEGKYDEFEDK  110

Query  581   WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
               + RRF A +AL  F+LLFTVFCLIIWGA+RP+KA++T+KSLS+ N Y+GEGSD TGVP
Sbjct  111   GFV-RRFQAFIALFSFVLLFTVFCLIIWGASRPFKAEITVKSLSMHNFYVGEGSDSTGVP  169

Query  761   TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVN  940
             T++L++NGSL+ISVYNPAT +GIHVSSTPI++V+S+I +ATGQLKKYYQ RKS RTV VN
Sbjct  170   TKMLTMNGSLKISVYNPATIFGIHVSSTPIDVVYSEIVIATGQLKKYYQPRKSHRTVSVN  229

Query  941   IQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCEL  1120
             +QG KVPLYGAGS L  T     TGG +VP  L F ++S+G+ VGKLV+T ++++I C L
Sbjct  230   LQGNKVPLYGAGSGLTITP----TGG-EVPSTLKFGIRSRGEAVGKLVKTTHKKQITCPL  284

Query  1121  IIDSAGNKPIKFKKDSCAY  1177
             +ID    KPIKFKK++C Y
Sbjct  285   VIDILSTKPIKFKKNACTY  303



>ref|XP_004302904.1| PREDICTED: uncharacterized protein LOC101293317 [Fragaria vesca 
subsp. vesca]
Length=316

 Score =   355 bits (911),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 211/322 (66%), Positives = 256/322 (80%), Gaps = 12/322 (4%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFT-SPVE  397
             ML  KSESD+TSLAASSPS      VYYVQSPSRDS    DG+KS+SMQ TP +  SP+E
Sbjct  1     MLSAKSESDMTSLAASSPSRSPKVPVYYVQSPSRDSQVSHDGDKSSSMQATPIYNNSPME  60

Query  398   SPSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELED  577
             SPSHPS GRHSR SS +RFSGIFRSSSGRKG  K+  +NDKGWPEC VIMEEG YD+L+ 
Sbjct  61    SPSHPSFGRHSRNSSASRFSGIFRSSSGRKGGRKQHRNNDKGWPECKVIMEEGDYDDLDK  120

Query  578   SWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGV  757
              +  SRR   L+AL GF++LFTVFCLIIWGA++P+KA+V +KSL+VSN+Y+GEGSDF+GV
Sbjct  121   EF--SRRMQILMALFGFVVLFTVFCLIIWGASKPFKAEVLVKSLTVSNVYVGEGSDFSGV  178

Query  758   PTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLV  937
             PT++L+VNGSL+ +V NPA+ +GIHVSSTPINL++SDI+VATGQLKKYYQ RKS RTV V
Sbjct  179   PTKMLTVNGSLKFTVRNPASIFGIHVSSTPINLLYSDISVATGQLKKYYQPRKSSRTVSV  238

Query  938   NIQGTKVPLYGAGSSLPATKNKDGTGGVQ-VPLALDFEVKSQGDVVGKLVRTDYRRKIWC  1114
              + GTKVPLYGAGSSL  +     TG +  VPL L+FE+KS+G VVG LV+T + R I C
Sbjct  239   ILAGTKVPLYGAGSSLMYS----STGALAPVPLTLNFEIKSRGYVVGHLVKTKHIRAISC  294

Query  1115  ELIIDSAGNKPIKFKKDSCAYS  1180
              L+ID    KP+KFK+ SC Y+
Sbjct  295   PLVIDPTVTKPLKFKESSCTYN  316



>ref|XP_010249708.1| PREDICTED: uncharacterized protein LOC104592183 [Nelumbo nucifera]
 ref|XP_010249709.1| PREDICTED: uncharacterized protein LOC104592183 [Nelumbo nucifera]
Length=309

 Score =   353 bits (906),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 209/319 (66%), Positives = 253/319 (79%), Gaps = 15/319 (5%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             M+H KS+SDVTSLA SSPS      VYYVQSPSRDSHD   G+KS+SMQ TP + SP+ES
Sbjct  1     MMHAKSDSDVTSLAPSSPSRSPKRPVYYVQSPSRDSHD---GDKSSSMQATPIYNSPMES  57

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDS  580
             PSHPS GRHSR SS +RFSG FRSSSGRK   KR   NDKGWPECNVI EEG YD+L+  
Sbjct  58    PSHPSFGRHSRASSSSRFSGTFRSSSGRKANRKR---NDKGWPECNVIQEEGSYDDLDGE  114

Query  581   WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
               LSRR  AL+AL GF+LLFTVF LIIWGA+RPY+A++ +KS++V+N Y GEGSD TGVP
Sbjct  115   KGLSRRCQALIALLGFVLLFTVFSLIIWGASRPYRAKIVVKSMAVNNFYSGEGSDSTGVP  174

Query  761   TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVN  940
             T++L++N SLR+SVYNPA  +GIHVSSTP+NL+FS+I VATGQLK+YYQ RKSRR + V+
Sbjct  175   TKMLTLNCSLRMSVYNPANLFGIHVSSTPVNLIFSEIAVATGQLKRYYQPRKSRRIIAVS  234

Query  941   IQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCEL  1120
             ++G KVPLYGAG+SL  + NK       VPL LDFE++++GDVVGKLVRT +RR I C +
Sbjct  235   LEGNKVPLYGAGASLAVSDNKGA-----VPLTLDFEIRTRGDVVGKLVRTKHRRHISCPV  289

Query  1121  IIDSAGNKPIKFKKDSCAY  1177
             +ID +  KPIKFK+ SC Y
Sbjct  290   VIDPSSTKPIKFKEGSCIY  308



>ref|XP_006426960.1| hypothetical protein CICLE_v10026158mg [Citrus clementina]
 gb|ESR40200.1| hypothetical protein CICLE_v10026158mg [Citrus clementina]
Length=304

 Score =   352 bits (904),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 210/319 (66%), Positives = 253/319 (79%), Gaps = 21/319 (7%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             ML  KSESD+TSLA SSPS      VYYVQSPSRDS D   G+KS+S+QP     SP+ES
Sbjct  2     MLSAKSESDITSLAPSSPSRSPKRPVYYVQSPSRDSQD---GDKSSSLQP-----SPMES  53

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDS  580
             PSHPS GRHSR SS +RFSGIFRSSSGRKG  KR   NDKGWPECNVI+EEGKYDE ED 
Sbjct  54    PSHPSFGRHSRNSSASRFSGIFRSSSGRKGTRKR---NDKGWPECNVILEEGKYDEFEDK  110

Query  581   WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
               + RRF A +AL  F+LLFTVFCLIIWGA+RP+KA++T+KSLS+ N Y+GEGSD TGVP
Sbjct  111   GFV-RRFQAFIALFSFVLLFTVFCLIIWGASRPFKAEITVKSLSMHNFYVGEGSDSTGVP  169

Query  761   TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVN  940
             T++L++NGSL+ISVYNPAT +GIHVSSTPI++V+S+I +ATGQLKKYYQ RKS RTV VN
Sbjct  170   TKMLTMNGSLKISVYNPATIFGIHVSSTPIDVVYSEIVIATGQLKKYYQPRKSHRTVSVN  229

Query  941   IQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCEL  1120
             +Q  KVPLYGAGS L  +     TGG +VP  L F ++S+G+VVGKLV+T ++++I C L
Sbjct  230   LQSNKVPLYGAGSGLTISP----TGG-EVPSTLKFGIRSRGEVVGKLVKTTHKKQITCPL  284

Query  1121  IIDSAGNKPIKFKKDSCAY  1177
             +ID    KPIKFKK++C Y
Sbjct  285   VIDILSTKPIKFKKNACTY  303



>ref|XP_004486742.1| PREDICTED: uncharacterized protein LOC101509865 [Cicer arietinum]
Length=309

 Score =   352 bits (904),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 205/319 (64%), Positives = 255/319 (80%), Gaps = 15/319 (5%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             ML  KSESD+TSLA SSPS      VYYVQSPSRDSHD   G+KS+SM  TP   SP+ES
Sbjct  1     MLSAKSESDITSLAPSSPSRSPKRPVYYVQSPSRDSHD---GDKSSSMHATPISNSPMES  57

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDS  580
             PSHPS GRHSR SS +RFSGIFRSSSGRK   KR   NDKGWPEC VI+EEG Y E +D 
Sbjct  58    PSHPSFGRHSRNSSASRFSGIFRSSSGRKSGRKR---NDKGWPECGVILEEGSYREFDDK  114

Query  581   WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
                +RRF AL+A+  F+++FTVFCLIIWGA+RPYKA++T+KSL+V N+Y  EG+DFTGVP
Sbjct  115   -PFARRFQALIAVFTFVVVFTVFCLIIWGASRPYKAEITVKSLTVHNLYAWEGTDFTGVP  173

Query  761   TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVN  940
             T+++++N +L +S+YNPATF+GIHV S+PINLVFSDI+VATG+LKK+YQ RKS R V VN
Sbjct  174   TKIMTINSTLHMSIYNPATFFGIHVHSSPINLVFSDISVATGELKKHYQPRKSHRIVSVN  233

Query  941   IQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCEL  1120
             ++G KVPLYGAGSS+  ++     G V+V L L FE++S+GDVVGKLVRT + ++I C L
Sbjct  234   LKGNKVPLYGAGSSIMVSQ----MGSVEVALVLKFEMRSRGDVVGKLVRTKHDKEITCPL  289

Query  1121  IIDSAGNKPIKFKKDSCAY  1177
             +I+S+G+KPIKFKK+SC Y
Sbjct  290   VINSSGSKPIKFKKNSCTY  308



>ref|XP_002304204.1| hypothetical protein POPTR_0003s05170g [Populus trichocarpa]
 gb|EEE79183.1| hypothetical protein POPTR_0003s05170g [Populus trichocarpa]
Length=309

 Score =   352 bits (903),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 205/323 (63%), Positives = 253/323 (78%), Gaps = 23/323 (7%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             ML  KSESD+ SLA SSPS      VYYVQSPSRDSHD   G+K +SMQP     SP+ES
Sbjct  1     MLSAKSESDIASLAPSSPSRSPKRPVYYVQSPSRDSHD---GDKLSSMQP-----SPMES  52

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmms----NDKGWPECNVIMEEGKYDE  568
             PSHPS GRHSR SS +RFSGIFRSSSG+K   ++       NDKGWPECNVIMEEG YD+
Sbjct  53    PSHPSSGRHSRNSSASRFSGIFRSSSGKKSSSRKGNDDKEWNDKGWPECNVIMEEGNYDD  112

Query  569   LEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDF  748
              + ++  +RR  AL+AL  F+ LFTVFCLIIWGA+RPYKA++ +KS++V+N Y+GEGSD 
Sbjct  113   EDKAF--TRRSQALIALLSFVFLFTVFCLIIWGASRPYKAEIMVKSMAVNNFYVGEGSDS  170

Query  749   TGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRT  928
             +GVPT++L++NGSLR+SVYNPAT +GIHVSSTPINLV+S+I +ATGQLKKYYQ RKSRRT
Sbjct  171   SGVPTKMLTLNGSLRMSVYNPATLFGIHVSSTPINLVYSEIPIATGQLKKYYQPRKSRRT  230

Query  929   VLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKI  1108
             V + ++G KVPLYGAGSSL   +      G+ +PL L FE+ S+G+VVGKLVRT +RR+I
Sbjct  231   VSMFVEGNKVPLYGAGSSLTVAQT-----GIVIPLTLKFEILSRGNVVGKLVRTKHRRQI  285

Query  1109  WCELIIDSAGNKPIKFKKDSCAY  1177
              C L+IDS+  KPIKFKK++C Y
Sbjct  286   SCPLVIDSSSPKPIKFKKNTCTY  308



>ref|XP_007215722.1| hypothetical protein PRUPE_ppa008966mg [Prunus persica]
 gb|EMJ16921.1| hypothetical protein PRUPE_ppa008966mg [Prunus persica]
Length=312

 Score =   348 bits (893),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 212/322 (66%), Positives = 248/322 (77%), Gaps = 18/322 (6%)
 Frame = +2

Query  233   MLH-TKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFT-SPV  394
             M+H TKSESDVTSLA SSPS      VYYVQSPSRDSHD   G+KS+SMQ TP +  SP+
Sbjct  1     MMHSTKSESDVTSLAPSSPSRSPKVPVYYVQSPSRDSHD---GDKSSSMQATPIYNNSPM  57

Query  395   ESPSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELE  574
             ESPSHPS GRHSR SS +RFSGIFRSSSGRKG  K    NDKGWPEC VIMEEG YD+ +
Sbjct  58    ESPSHPSFGRHSRNSSASRFSGIFRSSSGRKGGRKPR--NDKGWPECKVIMEEGAYDDFD  115

Query  575   DSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTG  754
                 LSRR    +AL  F++LFT+FCLIIWGA+RPY A V +KSL +SN YIGEGSD +G
Sbjct  116   KG--LSRRVQVCIALLSFVMLFTIFCLIIWGASRPYNATVVVKSLEISNFYIGEGSDSSG  173

Query  755   VPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVL  934
             VPT++L+VNGSLR+SV+N A+ +GIHVSS PI L +S+I+VATGQLKKYYQ RKS RTV 
Sbjct  174   VPTKMLTVNGSLRLSVHNSASMFGIHVSSAPIILAYSEISVATGQLKKYYQPRKSLRTVS  233

Query  935   VNIQGTKVPLYGAGSSLPATKNKDGTGG-VQVPLALDFEVKSQGDVVGKLVRTDYRRKIW  1111
             VN+QGTKVPLYGA SSL  TK    TGG V +PL L  E++S+  VVGKLV+T +RR+I 
Sbjct  234   VNLQGTKVPLYGAASSLTYTK----TGGLVPIPLTLKLEIRSRAFVVGKLVKTKHRRRIS  289

Query  1112  CELIIDSAGNKPIKFKKDSCAY  1177
             C L++D    KPIKFKK SC Y
Sbjct  290   CPLVLDPTFTKPIKFKKSSCTY  311



>ref|XP_010103052.1| hypothetical protein L484_001883 [Morus notabilis]
 gb|EXB94675.1| hypothetical protein L484_001883 [Morus notabilis]
Length=324

 Score =   348 bits (893),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 208/333 (62%), Positives = 252/333 (76%), Gaps = 28/333 (8%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSG---HVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESP  403
             M+H KS+SD+TSL  SSP      VYYVQSPSRDSHDDGD  KS+SMQ TP F SP+ESP
Sbjct  1     MIHAKSDSDMTSLDPSSPRSPKRAVYYVQSPSRDSHDDGD--KSSSMQATPAFNSPMESP  58

Query  404   SHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDSW  583
             SHPS GRHSRTSS +RFSG FRSSSGRK RGKR   NDKGWPEC+VI EEG YDE     
Sbjct  59    SHPSYGRHSRTSSASRFSGTFRSSSGRKMRGKR---NDKGWPECDVIEEEGNYDEFYGDK  115

Query  584   LLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPT  763
              L+RR   L+ L GF+L+FTVFCLI+WGA+RPYKA+++LKSL+V N Y GEGSD TGVPT
Sbjct  116   GLTRRCQILMGLVGFVLIFTVFCLILWGASRPYKARISLKSLTVHNFYFGEGSDVTGVPT  175

Query  764   RLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATG---------------QLKK  898
             +LL++N S+R+SVYNPA+F+GIHVSS+PI+L++S+I VA G               QLKK
Sbjct  176   KLLTLNCSVRMSVYNPASFFGIHVSSSPISLMYSEIAVAKGQHMLVALKIENIDTLQLKK  235

Query  899   YYQSRKSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGK  1078
             YYQ RKS RTV VN+QG KVPLYGAG+SL  + N       +VP+ L FEV+S+G VVGK
Sbjct  236   YYQPRKSHRTVNVNLQGIKVPLYGAGASLAVSDNDS-----EVPMTLMFEVRSKGHVVGK  290

Query  1079  LVRTDYRRKIWCELIIDSAGNKPIKFKKDSCAY  1177
             LV++ ++R+I C L +DS   KPIKFK DSC++
Sbjct  291   LVKSTHKRRISCSLDVDSHVTKPIKFKHDSCSF  323



>ref|XP_008342685.1| PREDICTED: uncharacterized protein LOC103405458 [Malus domestica]
Length=313

 Score =   348 bits (892),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 210/322 (65%), Positives = 253/322 (79%), Gaps = 17/322 (5%)
 Frame = +2

Query  233   MLH-TKSESDVTSLAASSPS----GHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFT-SPV  394
             M+H TKSESD+TSLAASSPS      VYYVQSPSRDSHD   G+KS+SM  TP +  SP+
Sbjct  1     MMHSTKSESDITSLAASSPSRSPKAPVYYVQSPSRDSHD---GDKSSSMHATPIYNNSPM  57

Query  395   ESPSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELE  574
             ESPSHPS GRHSR SS ++FSGIFRSSSGRKG  K+   NDKGWPEC VIME+G YDE +
Sbjct  58    ESPSHPSFGRHSRNSSASKFSGIFRSSSGRKGGSKQR--NDKGWPECKVIMEDGAYDEFK  115

Query  575   DSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTG  754
             D+ L SRR   L+AL  F+LLFTVFCLIIWGA+RPYKA+V +KSL +SN YIGEGSDF+G
Sbjct  116   DNSL-SRRVQVLIALLSFVLLFTVFCLIIWGASRPYKAEVVVKSLEISNFYIGEGSDFSG  174

Query  755   VPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVL  934
             VP+++++VNGSLR+SV N A+ +GIHV+S+PI L++S+I VA GQLKKYYQ RKS RT  
Sbjct  175   VPSKMVTVNGSLRLSVRNSASIFGIHVTSSPIGLLYSEIAVAIGQLKKYYQPRKSLRTTS  234

Query  935   VNIQGTKVPLYGAGSSLPATKNKDGTGGVQ-VPLALDFEVKSQGDVVGKLVRTDYRRKIW  1111
             VN+ GTKVPLYGAGSSL  TK    TG +  +PL L+FE+ S+  VVGKLV+T +R++I 
Sbjct  235   VNLHGTKVPLYGAGSSLIYTK----TGALXPIPLTLNFEIWSRAYVVGKLVKTKHRKRIS  290

Query  1112  CELIIDSAGNKPIKFKKDSCAY  1177
             C LI+D    KPIKFKK SC Y
Sbjct  291   CPLILDPTVTKPIKFKKSSCTY  312



>ref|XP_008795060.1| PREDICTED: uncharacterized protein LOC103710911 [Phoenix dactylifera]
Length=310

 Score =   347 bits (890),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 202/319 (63%), Positives = 246/319 (77%), Gaps = 14/319 (4%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             M+H KS+SDVTSLA SSP       VYYVQSPSRDSHD   G+KS+SMQ TP + SP+ES
Sbjct  1     MMHAKSDSDVTSLAPSSPPRSPKRPVYYVQSPSRDSHD---GDKSSSMQATPVYNSPMES  57

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDS  580
             P+HPS GRHSRTSS +RFSG F SSSGRKG  KR+  NDKGWPECNVI EEG YD+L++ 
Sbjct  58    PTHPSFGRHSRTSSASRFSGTFWSSSGRKGNRKRV--NDKGWPECNVIQEEGSYDDLDED  115

Query  581   WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
               LSRRF  +LAL  F+LLFTVFCLIIWGAARPYKA+  +KSLS+ + Y  EGSD TGVP
Sbjct  116   KGLSRRFQIMLALLSFVLLFTVFCLIIWGAARPYKAEAVVKSLSMDDFYAREGSDSTGVP  175

Query  761   TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVN  940
             T++++VN S++I+VYNPAT +GIHV+S PINL++S+IT+ATGQLKKYYQ RKS RTV V 
Sbjct  176   TKMVTVNCSVKINVYNPATMFGIHVTSGPINLIYSEITIATGQLKKYYQPRKSHRTVSVI  235

Query  941   IQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCEL  1120
             + G KVPLYGAG+ L  +       G  VPL L+FE+ S+G VVGKLV+  +R+ + C L
Sbjct  236   LHGDKVPLYGAGAGLALSGK-----GAAVPLTLEFEIISRGYVVGKLVKVKHRKHVSCPL  290

Query  1121  IIDSAGNKPIKFKKDSCAY  1177
             ++ S   KPIKFKK+SC Y
Sbjct  291   VVASHNTKPIKFKKNSCTY  309



>ref|XP_009353613.1| PREDICTED: uncharacterized protein LOC103944863 [Pyrus x bretschneideri]
 ref|XP_009353614.1| PREDICTED: uncharacterized protein LOC103944863 [Pyrus x bretschneideri]
Length=313

 Score =   347 bits (891),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 211/322 (66%), Positives = 249/322 (77%), Gaps = 17/322 (5%)
 Frame = +2

Query  233   MLH-TKSESDVTSLAASSPS----GHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFT-SPV  394
             M+H TKSESDVTSLAASSPS      VYYVQSPSRDSHD   G+KS+SM  TP +  SP+
Sbjct  1     MMHSTKSESDVTSLAASSPSRSPKAPVYYVQSPSRDSHD---GDKSSSMHATPMYNNSPM  57

Query  395   ESPSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELE  574
             ESPSHPS GRHSR SS +RFSGIFRSSSGRKG  K    NDKGWPEC VIMEEG YD+  
Sbjct  58    ESPSHPSFGRHSRNSSASRFSGIFRSSSGRKGGRKPR--NDKGWPECKVIMEEGGYDDFN  115

Query  575   DSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTG  754
             D  L SRR   L+AL  F++LFTVFCLIIWGA+RPYK ++ +KSL +SN YIGEGSDF+G
Sbjct  116   DKSL-SRRVQVLIALLSFVVLFTVFCLIIWGASRPYKPEIVVKSLDISNFYIGEGSDFSG  174

Query  755   VPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVL  934
             VPT+L++VNGSLR+SV N A+ +GIHV+S+PI L++S+I VA GQLKKYYQ R S RT+ 
Sbjct  175   VPTKLVTVNGSLRLSVRNSASIFGIHVTSSPIGLLYSEIAVAIGQLKKYYQPRNSLRTIS  234

Query  935   VNIQGTKVPLYGAGSSLPATKNKDGTGG-VQVPLALDFEVKSQGDVVGKLVRTDYRRKIW  1111
             VN+QGTKVPLYGAGSSL  +K    TG  V +PL L FE++S+  VVGKLV+T  RR+I 
Sbjct  235   VNLQGTKVPLYGAGSSLTYSK----TGALVPIPLTLKFEIRSRAYVVGKLVKTKRRRRIS  290

Query  1112  CELIIDSAGNKPIKFKKDSCAY  1177
             C L++D    KPIKF K SCAY
Sbjct  291   CPLVLDPTVTKPIKFNKTSCAY  312



>ref|XP_010691334.1| PREDICTED: uncharacterized protein LOC104904684 [Beta vulgaris 
subsp. vulgaris]
Length=308

 Score =   345 bits (886),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 196/319 (61%), Positives = 247/319 (77%), Gaps = 16/319 (5%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             M+H KSESDVTSLA SSPS      +YYVQSPSRDSHD+GD  KSTS+  TP + SP ES
Sbjct  1     MIHNKSESDVTSLAPSSPSRSPKRPIYYVQSPSRDSHDEGD--KSTSLHATPMYNSPTES  58

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDS  580
             PSHPS+GRHSR SS +RFSGIFRSSSGRKG  +R   N+KGWPECNVI+EEG YD   D 
Sbjct  59    PSHPSMGRHSRNSSASRFSGIFRSSSGRKGSRRR---NEKGWPECNVILEEGNYD---DE  112

Query  581   WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
               LSRR  AL+ L  F++LFT+FCLIIWGA+RP+K QVTLKSL+V N+Y+ E +DF+GVP
Sbjct  113   KGLSRRIQALIGLLSFVVLFTLFCLIIWGASRPFKTQVTLKSLAVHNLYVSEATDFSGVP  172

Query  761   TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVN  940
             T++++ NGSL++ ++NPATF+GIHVSSTPI L++S+I VATGQL+K+YQ RKSR T  + 
Sbjct  173   TKVMTFNGSLKLGIHNPATFFGIHVSSTPITLLYSEIAVATGQLRKHYQPRKSRSTTSII  232

Query  941   IQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCEL  1120
             + G KVPLYGA S+L  +  + G    QVP  L+ EV S+GDVVGKLVRT +R  ++C +
Sbjct  233   VNGDKVPLYGAASNLDVSSQRSG----QVPFLLEMEVHSRGDVVGKLVRTRHRLHVFCNV  288

Query  1121  IIDSAGNKPIKFKKDSCAY  1177
              +D    KPIKF+K++C+Y
Sbjct  289   TVDYLSTKPIKFRKNTCSY  307



>ref|XP_009380553.1| PREDICTED: uncharacterized protein LOC103968920 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009380554.1| PREDICTED: uncharacterized protein LOC103968920 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009380555.1| PREDICTED: uncharacterized protein LOC103968920 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009380556.1| PREDICTED: uncharacterized protein LOC103968920 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009380557.1| PREDICTED: uncharacterized protein LOC103968920 [Musa acuminata 
subsp. malaccensis]
Length=310

 Score =   345 bits (886),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 202/319 (63%), Positives = 250/319 (78%), Gaps = 14/319 (4%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSP----SGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             M+H KSESDVTSLA SSP        YYVQSPSRDSHD   G+KS+SMQ TP + SP+ES
Sbjct  1     MMHAKSESDVTSLAPSSPPRSPKRATYYVQSPSRDSHD---GDKSSSMQATPVYNSPMES  57

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDS  580
             PSHPSLGRHSRTSS +RFSG FRSSSGRKG  KR+  N+KGWPEC+VI EEG YD+L+D 
Sbjct  58    PSHPSLGRHSRTSSASRFSGPFRSSSGRKGYRKRV--NEKGWPECDVIQEEGSYDDLDDD  115

Query  581   WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
               LSRR   +LAL  F+LLFTVF LIIWGAARPYK  V +KSLS+ + Y GEG+D TGVP
Sbjct  116   KGLSRRCQIILALLSFILLFTVFSLIIWGAARPYKPDVIVKSLSMDDFYAGEGTDTTGVP  175

Query  761   TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVN  940
             T++++VN SL+ISVYN AT +GIHV+S+PI L+FS+IT+ATG+++KYYQ RKS RTV   
Sbjct  176   TKMVTVNCSLKISVYNTATMFGIHVTSSPIQLMFSEITIATGEVQKYYQPRKSHRTVSAI  235

Query  941   IQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCEL  1120
             + G KVPLYGAG+ +  +     TGG QVPL LDF++ S+GDV+GKLVR  +R+ + C+L
Sbjct  236   LHGEKVPLYGAGAGMALS----STGG-QVPLTLDFDIISRGDVIGKLVRVKHRKHVSCQL  290

Query  1121  IIDSAGNKPIKFKKDSCAY  1177
             ++DS+ NKPIKF ++SC Y
Sbjct  291   VVDSSKNKPIKFARNSCTY  309



>ref|XP_009404447.1| PREDICTED: uncharacterized protein LOC103987774 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009404448.1| PREDICTED: uncharacterized protein LOC103987774 [Musa acuminata 
subsp. malaccensis]
Length=310

 Score =   345 bits (884),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 198/319 (62%), Positives = 251/319 (79%), Gaps = 14/319 (4%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSP----SGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             M+H KS+SDVTSLAASSP       VYYVQSPSRDSHD   G+KS+SMQ TP + SP+ES
Sbjct  1     MMHNKSDSDVTSLAASSPPRSPKRAVYYVQSPSRDSHD---GDKSSSMQATPVYNSPMES  57

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDS  580
             PSHPS GRHSRTSS +RFSG FRSSSGRKG  KR+  NDKGWPECNVI EEG YD+L++ 
Sbjct  58    PSHPSFGRHSRTSSASRFSGPFRSSSGRKGNRKRV--NDKGWPECNVIQEEGSYDDLDED  115

Query  581   WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
               LSRR   +LAL  F+LLFTVF LIIWGAARPYKA+V +KSL++ + Y GEGSD TGVP
Sbjct  116   RGLSRRCQIILALLSFVLLFTVFSLIIWGAARPYKAKVVVKSLAMDDFYAGEGSDTTGVP  175

Query  761   TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVN  940
             T++++VN SL+IS+YNPA+ +GIHV+S+ INL+FS+IT+ATG+LKKYYQ RKSRRT+ + 
Sbjct  176   TKMVTVNCSLKISIYNPASMFGIHVTSSSINLIFSEITIATGELKKYYQPRKSRRTLSLI  235

Query  941   IQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCEL  1120
             + G KVPLYGAG+ L  +     + G  VPL LD E+ S+G V+GKLV+  +R+ + C L
Sbjct  236   LHGEKVPLYGAGAGLALS-----SAGGAVPLTLDLEIISRGYVIGKLVKVKHRKHVSCPL  290

Query  1121  IIDSAGNKPIKFKKDSCAY  1177
             ++DS+  KPI+F +++C+Y
Sbjct  291   VVDSSNTKPIRFSQNACSY  309



>ref|XP_010254099.1| PREDICTED: uncharacterized protein LOC104595183 [Nelumbo nucifera]
Length=309

 Score =   343 bits (880),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 204/319 (64%), Positives = 249/319 (78%), Gaps = 15/319 (5%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             M+H KS+SDVTSLA SSPS      VYYVQSPSRDSHD   G+KS+SMQ TP + SP+ES
Sbjct  1     MMHAKSDSDVTSLAPSSPSRSPKRPVYYVQSPSRDSHD---GDKSSSMQATPIYNSPMES  57

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDS  580
             PSHPS GRHSR SS +RFSG+FRSSSGRK   KR   NDKGWPECNVI EEG YD+++  
Sbjct  58    PSHPSFGRHSRASSSSRFSGMFRSSSGRKANRKR---NDKGWPECNVIQEEGSYDDIDGE  114

Query  581   WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
               LSRR   L+AL  F+LLFTVF LIIWGA+RPY+A++ +KS++V+N Y GEGSD TGVP
Sbjct  115   KGLSRRCQVLIALLVFVLLFTVFSLIIWGASRPYRAKIVVKSMAVNNFYSGEGSDSTGVP  174

Query  761   TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVN  940
             T+LL++N SL++S+YNPAT +GIHVSSTP+NL+FS+ITVATGQLKKYYQ RKS R V V 
Sbjct  175   TKLLTMNCSLKLSIYNPATMFGIHVSSTPVNLIFSEITVATGQLKKYYQRRKSHRIVSVT  234

Query  941   IQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCEL  1120
             ++G KVPLYGAG+SL  + N        VPL L+ E++++GDVVGKLV+T +RR I C  
Sbjct  235   LEGNKVPLYGAGASLAISDNSGA-----VPLTLELEIRTRGDVVGKLVKTKHRRHISCPA  289

Query  1121  IIDSAGNKPIKFKKDSCAY  1177
             +ID +  KPIKFK+ SC Y
Sbjct  290   VIDPSSTKPIKFKEYSCTY  308



>ref|XP_002299711.1| hypothetical protein POPTR_0001s18410g [Populus trichocarpa]
 gb|EEE84516.1| hypothetical protein POPTR_0001s18410g [Populus trichocarpa]
Length=298

 Score =   341 bits (874),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 206/323 (64%), Positives = 249/323 (77%), Gaps = 34/323 (11%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             ML  KSESD+TSLA SSPS      VY+VQSPSRDSHD   G+KS+SMQP     SP+ES
Sbjct  1     MLSAKSESDITSLAPSSPSRSPKRPVYFVQSPSRDSHD---GDKSSSMQP-----SPMES  52

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsN----DKGWPECNVIMEEGKYDE  568
             PSHPS GRHSR SS +RFSGIFRSSSGRK   ++   N    DKGWPECNVIMEEG YD+
Sbjct  53    PSHPSYGRHSRNSSASRFSGIFRSSSGRKSGSRKRNDNKGWNDKGWPECNVIMEEGNYDD  112

Query  569   LEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDF  748
              + ++  +RRF AL+AL  F+ LFTVFCLIIWGA+RPYKA++T+KSL V+N Y+GEG+D 
Sbjct  113   EDKAF--TRRFQALIALLSFVFLFTVFCLIIWGASRPYKAEITVKSLVVNNFYVGEGTDS  170

Query  749   TGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRT  928
             +GVPT+LL+VNGSLR+SVYNPAT +GIHVSSTPINL           LKKYYQ RKSRRT
Sbjct  171   SGVPTKLLTVNGSLRMSVYNPATLFGIHVSSTPINL-----------LKKYYQPRKSRRT  219

Query  929   VLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKI  1108
             V V ++G KVPLYGAGSSL  ++      G+ VPL L F++KS+G+VVGKLVRT +RR+I
Sbjct  220   VSVIVEGNKVPLYGAGSSLTVSQT-----GIVVPLTLKFDIKSRGNVVGKLVRTKHRRQI  274

Query  1109  WCELIIDSAGNKPIKFKKDSCAY  1177
              C L+IDS+ +KPIKFKK++C Y
Sbjct  275   SCPLVIDSSSSKPIKFKKNTCTY  297



>ref|XP_010925854.1| PREDICTED: uncharacterized protein LOC105048287 [Elaeis guineensis]
Length=310

 Score =   341 bits (874),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 202/319 (63%), Positives = 247/319 (77%), Gaps = 14/319 (4%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             M+H KS+SDV+SLAASSP       VYYVQSPSRDSHD   G+K +SMQ TP + SP+ES
Sbjct  1     MMHAKSDSDVSSLAASSPPRSPKRPVYYVQSPSRDSHD---GDKLSSMQATPVYNSPMES  57

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDS  580
             PSHPS GRHSR SS +RFSG  RSSSGRKG  KR+  NDKGWPEC+VI EEG YD+L++ 
Sbjct  58    PSHPSFGRHSRASSASRFSGTLRSSSGRKGNQKRV--NDKGWPECDVIQEEGSYDDLDED  115

Query  581   WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
               LSRR   +L L  F+LLF+VFCLIIWGAARPY+A+V +KSL++ + Y GEGSD TGVP
Sbjct  116   KGLSRRCQIILGLLSFVLLFSVFCLIIWGAARPYRAEVVVKSLAMDDFYAGEGSDSTGVP  175

Query  761   TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVN  940
             T++++VN SL+I+VYNPAT +GIHV+S PINLV+S+IT+ATGQLKKYYQ RKS RTV V 
Sbjct  176   TKMVTVNCSLKINVYNPATMFGIHVTSGPINLVYSEITIATGQLKKYYQPRKSHRTVSVI  235

Query  941   IQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCEL  1120
             + G KVPLYGAG+ L  +     TGG  VPL LDFE+ S+G VVGKLV+  +R+ + C L
Sbjct  236   LHGEKVPLYGAGAGLALSS----TGGA-VPLTLDFEIISRGYVVGKLVKVKHRKHVSCPL  290

Query  1121  IIDSAGNKPIKFKKDSCAY  1177
             ++DS   KPIKFK+ SC Y
Sbjct  291   VVDSRNTKPIKFKQHSCTY  309



>ref|XP_010915827.1| PREDICTED: uncharacterized protein LOC105040822 [Elaeis guineensis]
Length=310

 Score =   338 bits (866),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 187/319 (59%), Positives = 235/319 (74%), Gaps = 14/319 (4%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             M+H KS+SD+TSLA SSPS      VYYVQSPSRDSHD   G+KS+SMQ TP + SP+ES
Sbjct  1     MMHAKSDSDITSLAPSSPSRSPKRPVYYVQSPSRDSHD---GDKSSSMQATPVYNSPMES  57

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDS  580
             P+HPS G    + S +         S    +G R   NDKGWPECNVI EEG YD+L++ 
Sbjct  58    PTHPSFG--RHSRSSSASRFSGTFWSSSGRKGNRKRVNDKGWPECNVIQEEGSYDDLDED  115

Query  581   WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
               LSRR   +LAL  F++LFTVFCLIIWGAARPYKA+V +KSLS+ + Y GEGSD TGVP
Sbjct  116   KGLSRRCQIILALLSFVMLFTVFCLIIWGAARPYKAEVVVKSLSMDDFYAGEGSDSTGVP  175

Query  761   TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVN  940
             T++++VN SL+I+VYNPAT +GIHV+S PI+L++S+IT+ATGQLKKYYQ RKS RTV V 
Sbjct  176   TKMVTVNCSLKINVYNPATMFGIHVTSGPISLIYSEITIATGQLKKYYQPRKSHRTVAVI  235

Query  941   IQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCEL  1120
             + G KVPLYGAG+ L  +     TGG  VPL L+FE+ S+G VVGKLV+  +R+ + C L
Sbjct  236   LHGEKVPLYGAGAGLALS----STGGA-VPLTLEFEIISRGYVVGKLVKVKHRKLVSCPL  290

Query  1121  IIDSAGNKPIKFKKDSCAY  1177
             ++DS   KPIKFK++SC Y
Sbjct  291   VVDSRNTKPIKFKQNSCTY  309



>ref|XP_008242663.1| PREDICTED: uncharacterized protein LOC103340971 [Prunus mume]
Length=307

 Score =   336 bits (862),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 198/317 (62%), Positives = 244/317 (77%), Gaps = 14/317 (4%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH---VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESPS  406
             +H KS+SDVTSLA SSP      VYYVQSPSRDS+D   G+KS++MQ TP F SP+ESPS
Sbjct  1     MHAKSDSDVTSLAPSSPRSPKRPVYYVQSPSRDSND---GDKSSTMQATPAFNSPMESPS  57

Query  407   HPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDSWL  586
             HPS GRHSR SS +R SG FRSSSG+KG  KR   NDKGWPECNVI EEG Y  L     
Sbjct  58    HPSYGRHSRASSASRVSGTFRSSSGQKGTRKR---NDKGWPECNVIEEEGDYGGLYKDKG  114

Query  587   LSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPTR  766
             +SRR    +AL GF+++F++FCLI+WGA+RPYKA+V +KSL+V N Y GEGSD TGVP++
Sbjct  115   ISRRCQIWIALFGFVVIFSIFCLILWGASRPYKARVAVKSLAVHNFYFGEGSDTTGVPSK  174

Query  767   LLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNIQ  946
             +L++N S+++SVYNPATF+GIHVSSTPINL++S+I VATGQLKKYYQ RKS R V VN+Q
Sbjct  175   MLTMNCSVKMSVYNPATFFGIHVSSTPINLMYSEIAVATGQLKKYYQPRKSYRNVTVNLQ  234

Query  947   GTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELII  1126
             G KVPLYGAG+SL  + N  G     VP+ L FEV+S+G+VVGKLVR+ ++R I C + I
Sbjct  235   GIKVPLYGAGASLAVSDNSGG-----VPMMLMFEVRSRGNVVGKLVRSKHQRHISCSMEI  289

Query  1127  DSAGNKPIKFKKDSCAY  1177
             +S  +KPIK K  SC Y
Sbjct  290   NSHNSKPIKLKTSSCTY  306



>ref|XP_007202282.1| hypothetical protein PRUPE_ppa009043mg [Prunus persica]
 gb|EMJ03481.1| hypothetical protein PRUPE_ppa009043mg [Prunus persica]
Length=308

 Score =   336 bits (861),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 196/318 (62%), Positives = 243/318 (76%), Gaps = 14/318 (4%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH---VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESP  403
             M+H KS+SDVTSLA SSP      VYYVQSPSRDS+D   G+KS++MQ TP F SP+ESP
Sbjct  1     MMHAKSDSDVTSLAPSSPRSPKRPVYYVQSPSRDSND---GDKSSTMQATPAFNSPMESP  57

Query  404   SHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDSW  583
             SHPS GRHSR SS +R SG FRSSSG+KG  KR   NDKGWPECNVI EEG Y       
Sbjct  58    SHPSYGRHSRASSASRVSGTFRSSSGQKGTRKR---NDKGWPECNVIEEEGDYGGFYKDK  114

Query  584   LLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPT  763
              +SRR    +AL GF+++F++FCLI+WGA+RPYKA++ +KS +V N Y GEGSD TGVP+
Sbjct  115   GISRRCQIWIALFGFVVIFSIFCLILWGASRPYKARIAVKSFAVHNFYFGEGSDTTGVPS  174

Query  764   RLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNI  943
             ++L++N S+++SVYNPATF+GIHVSSTPINL++S+I VATGQLKKYYQ RKS R V VN+
Sbjct  175   KMLTMNCSVKMSVYNPATFFGIHVSSTPINLMYSEIAVATGQLKKYYQPRKSYRNVTVNL  234

Query  944   QGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELI  1123
             QG KVPLYGAG+SL  + N  G     VP+ L FEV+S+G+VVGKLVR+ ++R I C + 
Sbjct  235   QGIKVPLYGAGASLAVSDNSGG-----VPMMLMFEVRSRGNVVGKLVRSKHQRHISCSME  289

Query  1124  IDSAGNKPIKFKKDSCAY  1177
             I+S  +KPIK K  SC Y
Sbjct  290   INSHNSKPIKLKTSSCTY  307



>ref|XP_004141769.1| PREDICTED: uncharacterized protein LOC101220910 [Cucumis sativus]
 ref|XP_004158991.1| PREDICTED: uncharacterized protein LOC101226433 [Cucumis sativus]
 gb|KGN45378.1| hypothetical protein Csa_7G446930 [Cucumis sativus]
Length=311

 Score =   334 bits (857),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 201/322 (62%), Positives = 250/322 (78%), Gaps = 19/322 (6%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFT-SPVE  397
             ML TKSESDVTSLA SSPS       YYVQSPSR S+D   G+KS+SM  TP +  SP+E
Sbjct  1     MLSTKSESDVTSLAPSSPSRSPKRPTYYVQSPSRCSND---GDKSSSMHTTPIYNNSPIE  57

Query  398   SPSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELED  577
             SPSHPS GRHSR SS +RFSGIFRSSSGRKG  K++  N+KGWPECNVIMEEG YD+LED
Sbjct  58    SPSHPSFGRHSRNSSASRFSGIFRSSSGRKGSKKQIS-NEKGWPECNVIMEEGPYDDLED  116

Query  578   SWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGV  757
                LSRRF  L+AL  F+ LFT+FCLIIWGA+RP+KAQ+++KSL+V N Y+GEGSD TGV
Sbjct  117   K-ALSRRFQVLIALLSFIALFTLFCLIIWGASRPFKAQISVKSLAVHNFYVGEGSDSTGV  175

Query  758   PTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLV  937
             PT+LL++N +LR+SVYNPAT +GIHV+STPI+L++S+I VA+GQLKKYYQ R S R V V
Sbjct  176   PTKLLTLNSTLRLSVYNPATIFGIHVTSTPIDLIYSEIVVASGQLKKYYQPRNSHRRVSV  235

Query  938   NIQGTKVPLYGAGSSL--PATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIW  1111
             N++G KVP+YGA S+L  P T +        VP+ L F+++S+G VVG+LV+T + ++I 
Sbjct  236   NLEGIKVPMYGAASTLTVPPTSSP-------VPMTLAFKIRSRGYVVGQLVKTTHIKQIS  288

Query  1112  CELIIDSAGNKPIKFKKDSCAY  1177
             C + IDS  NK I FKK+SC Y
Sbjct  289   CPVGIDSTSNKAIVFKKNSCTY  310



>ref|XP_008799324.1| PREDICTED: uncharacterized protein LOC103713983 [Phoenix dactylifera]
Length=310

 Score =   334 bits (856),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 197/319 (62%), Positives = 246/319 (77%), Gaps = 14/319 (4%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             M+H KS+SDV+SLA SSPS      VY+VQSPSRDSHD   G+KS++MQ TP + SP+ES
Sbjct  1     MMHAKSDSDVSSLAPSSPSRSPKRPVYFVQSPSRDSHD---GDKSSTMQATPVYNSPMES  57

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDS  580
             PSHPS GRHSR SS +RFSG  RSSSGRKG  KR+  NDKGWPEC+VI EEG YD+L++ 
Sbjct  58    PSHPSFGRHSRASSASRFSGTLRSSSGRKGNQKRV--NDKGWPECDVIQEEGSYDDLDED  115

Query  581   WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
               LSRR   +LA   F+LLFTVFCLIIWGAARPY+A V +KSL++ + Y GEGSD TGVP
Sbjct  116   KGLSRRCQIILAFLSFVLLFTVFCLIIWGAARPYRADVVVKSLTMDDFYAGEGSDSTGVP  175

Query  761   TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVN  940
             T++++ N SL+I+VYNPA  +GIHV+S PINL++S+IT+ATGQLKKYYQ RKS RTV V 
Sbjct  176   TKMVTANCSLKINVYNPAAMFGIHVTSGPINLIYSEITIATGQLKKYYQPRKSHRTVSVI  235

Query  941   IQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCEL  1120
             + G KVPLYGAG+ L  +     TGG  VPL LDFE+ S+G VVGKLV+  +R+ + C L
Sbjct  236   LHGEKVPLYGAGAGLALS----STGGA-VPLTLDFEIISRGYVVGKLVKVKHRKHVSCPL  290

Query  1121  IIDSAGNKPIKFKKDSCAY  1177
              ++S  +KP+KFK++SC Y
Sbjct  291   HVNSHNSKPVKFKQNSCTY  309



>ref|XP_009409454.1| PREDICTED: uncharacterized protein LOC103991661 [Musa acuminata 
subsp. malaccensis]
Length=310

 Score =   334 bits (856),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 201/320 (63%), Positives = 246/320 (77%), Gaps = 14/320 (4%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             M+H+KSESDVTSLA SSP        YYVQSPSRDSHD   G+KS+SM  TP + SP+ES
Sbjct  1     MMHSKSESDVTSLAPSSPPRSPKRPTYYVQSPSRDSHD---GDKSSSMHATPVYNSPMES  57

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDS  580
             PSHPS GRHSRTSS +RFSG FRSSSGRKG  KR+  ND GWPECNVI EEG YD+L++ 
Sbjct  58    PSHPSFGRHSRTSSASRFSGPFRSSSGRKGHRKRV--NDMGWPECNVIQEEGSYDDLDED  115

Query  581   WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
               LSRR   +LAL GF+LLFTVF LIIWGAARPYK    +KSLS+ + Y GEG+D TGVP
Sbjct  116   KGLSRRCQIILALLGFILLFTVFSLIIWGAARPYKPDAIVKSLSMDDFYAGEGTDSTGVP  175

Query  761   TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVN  940
             T++++VN SL+ISVYN A  +GIHV+S+PINL+FS+IT+ATG+L+KYYQ RKS RTV V 
Sbjct  176   TKMVTVNCSLKISVYNTAAMFGIHVTSSPINLMFSEITIATGELQKYYQPRKSHRTVSVV  235

Query  941   IQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCEL  1120
             + G +VPLYGAG+ L  +     TGG +VPL LDF++ S+G V+GKLVR  +R+ I C L
Sbjct  236   LHGERVPLYGAGAGLALSS----TGG-EVPLTLDFDIISRGYVIGKLVRVKHRKHITCLL  290

Query  1121  IIDSAGNKPIKFKKDSCAYS  1180
             + DS+ NKPIKF + SC Y+
Sbjct  291   VADSSKNKPIKFAQRSCTYT  310



>ref|XP_006451178.1| hypothetical protein CICLE_v10009029mg [Citrus clementina]
 ref|XP_006475637.1| PREDICTED: uncharacterized protein LOC102620635 [Citrus sinensis]
 gb|ESR64418.1| hypothetical protein CICLE_v10009029mg [Citrus clementina]
 gb|KDO48882.1| hypothetical protein CISIN_1g022177mg [Citrus sinensis]
Length=301

 Score =   332 bits (852),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 187/318 (59%), Positives = 238/318 (75%), Gaps = 21/318 (7%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSG---HVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESP  403
             MLH KS+SDVTSL  SSP     HVYYVQSPSRDS+D+   +KS+SMQ TP + +P +SP
Sbjct  1     MLHAKSDSDVTSLDPSSPRSPRRHVYYVQSPSRDSNDE---DKSSSMQHTPAYNTPTDSP  57

Query  404   SHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDSW  583
             SHPS GRHSR SS +RFSG FR              NDKGWPECNVI EEG YDE     
Sbjct  58    SHPSYGRHSRASSSSRFSGTFRGRKR----------NDKGWPECNVIEEEGDYDEFYADK  107

Query  584   LLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPT  763
               +RR   L+AL GF+L+F++FCLIIWGA+RPYKA++ ++SL+V N Y GEG+D TGVPT
Sbjct  108   GYTRRCQILIALLGFVLVFSIFCLIIWGASRPYKAKIAVRSLTVHNFYFGEGADLTGVPT  167

Query  764   RLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNI  943
             ++L++N S++++VYNPATF+GIHVSS+P+NL+FS+I VATGQL+KYYQ RKS R V VN+
Sbjct  168   KMLTMNCSVKMNVYNPATFFGIHVSSSPVNLMFSEIAVATGQLRKYYQPRKSHRVVTVNL  227

Query  944   QGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELI  1123
             QG KVPLYGAG+ L  +      G  +VPL L FEV+ +G+VVGKLV+T ++R+I C L+
Sbjct  228   QGNKVPLYGAGAGLAVSD-----GNRRVPLLLVFEVRQRGNVVGKLVKTRHQRRISCSLL  282

Query  1124  IDSAGNKPIKFKKDSCAY  1177
             +DS  NKP+K K+ SC Y
Sbjct  283   VDSRNNKPVKLKEKSCKY  300



>ref|XP_004287400.1| PREDICTED: uncharacterized protein LOC101296029 [Fragaria vesca 
subsp. vesca]
Length=301

 Score =   332 bits (851),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 192/317 (61%), Positives = 236/317 (74%), Gaps = 19/317 (6%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH---VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESPS  406
             +H KS+SDVTSLA SSP      VYYVQSPSRDS+D   G+KS++M  TP F SP+ESPS
Sbjct  1     MHAKSDSDVTSLAPSSPRSPKRPVYYVQSPSRDSND---GDKSSTMHATPAFNSPMESPS  57

Query  407   HPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDSWL  586
             HPS GRHSR SS +R SG F+ S  R         +DKGWPEC VI EEG YD L     
Sbjct  58    HPSYGRHSRASSASRVSGNFKGSRKRG--------HDKGWPECKVIEEEGDYDGLYGEKG  109

Query  587   LSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPTR  766
             LSRR   L+AL GF+++F++FCLI+WGA RPYKA+V++KSL+V N Y GEGSD TGVPT+
Sbjct  110   LSRRCQILMALFGFIVIFSIFCLILWGAGRPYKARVSVKSLAVHNFYFGEGSDMTGVPTK  169

Query  767   LLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNIQ  946
             ++++N S+R+SVYNPATF+GIHVSS  +NL++S+ITVATGQLKKYYQ RKS R VLVN+Q
Sbjct  170   MVTMNCSVRMSVYNPATFFGIHVSSDAVNLMYSEITVATGQLKKYYQPRKSNRIVLVNLQ  229

Query  947   GTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELII  1126
             G KVPLYGAG+SL      D  GG  VP+ L F+V+S+G+VVGKLVRT + R + C L++
Sbjct  230   GVKVPLYGAGASLAV---DDTNGG--VPMTLVFDVRSRGNVVGKLVRTKHWRHVNCSLVV  284

Query  1127  DSAGNKPIKFKKDSCAY  1177
             DS   KPI  K  SCAY
Sbjct  285   DSHKTKPITLKASSCAY  301



>ref|XP_008462165.1| PREDICTED: uncharacterized protein LOC103500589 [Cucumis melo]
Length=311

 Score =   331 bits (848),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 199/322 (62%), Positives = 249/322 (77%), Gaps = 19/322 (6%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFT-SPVE  397
             M+ TKSESDVTSLA SSPS       YYVQSPSR S+D   G+KS+SM  TP +  SP+E
Sbjct  1     MISTKSESDVTSLAPSSPSRSPKRPTYYVQSPSRCSND---GDKSSSMHTTPIYNNSPIE  57

Query  398   SPSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELED  577
             SPSHPS GRHSR SS +RFSGIFRSSSGRKG  K++  N+KGWPECNVIMEEG YD+LED
Sbjct  58    SPSHPSFGRHSRNSSASRFSGIFRSSSGRKGSKKQIS-NEKGWPECNVIMEEGPYDDLED  116

Query  578   SWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGV  757
                LSRR   L+AL  F+ LFT+FCLIIWGA+RP+KAQ+++KSL+V N Y+GEGSD TGV
Sbjct  117   K-ALSRRIQVLIALLSFIALFTLFCLIIWGASRPFKAQISVKSLAVHNFYVGEGSDSTGV  175

Query  758   PTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLV  937
             PT+LL++N +LR+SVYNPAT +GIHV+STPI+L++S+I VA+GQLKKYYQ R S R V V
Sbjct  176   PTKLLTLNSTLRLSVYNPATIFGIHVTSTPIDLIYSEIVVASGQLKKYYQPRNSHRRVSV  235

Query  938   NIQGTKVPLYGAGSSL--PATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIW  1111
             N++G KVP+YGA S+L  P T +        VP+ L F+++S+G VVG+LV+T + ++I 
Sbjct  236   NLEGIKVPMYGAASTLTVPPTSSP-------VPMTLSFKIRSRGYVVGQLVKTTHIKQIS  288

Query  1112  CELIIDSAGNKPIKFKKDSCAY  1177
             C + IDS  NK I FKK+SC Y
Sbjct  289   CPVGIDSTSNKAIVFKKNSCTY  310



>ref|XP_004150755.1| PREDICTED: uncharacterized protein LOC101205854 [Cucumis sativus]
 ref|XP_004169882.1| PREDICTED: uncharacterized protein LOC101227014 [Cucumis sativus]
Length=307

 Score =   330 bits (847),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 183/318 (58%), Positives = 231/318 (73%), Gaps = 15/318 (5%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH---VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESP  403
             M+H KS+SDVTSLA SSP      +YYVQSPSRDSHD   G+KS S   TP F SP+ESP
Sbjct  1     MMHAKSDSDVTSLAPSSPRSPKRPLYYVQSPSRDSHD---GDKS-STHATPAFNSPMESP  56

Query  404   SHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDSW  583
             SHPS   ++R S  +  S    +     GR      NDKGWPECNVI EEG YD+L    
Sbjct  57    SHPS---YTRHSRSSSASRFSGTFRSSLGRKGSRKRNDKGWPECNVIEEEGDYDDLNGDK  113

Query  584   LLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPT  763
              L+RR   L+ L  F+ +F +FCLIIWGA+RP+KA++ LKS++V N+Y GEGSD TGVPT
Sbjct  114   GLTRRCQILMILLAFVFIFLLFCLIIWGASRPFKAEIKLKSMTVHNVYFGEGSDTTGVPT  173

Query  764   RLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNI  943
             +LL++N SLRI+V+NPATF+GIHVSS+PINL++S I VA+GQLKKYYQ R+S R  LVN+
Sbjct  174   KLLTINCSLRITVHNPATFFGIHVSSSPINLMYSQIAVASGQLKKYYQPRQSNRIKLVNL  233

Query  944   QGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELI  1123
             QG KVPLYGAG++L A  +K+G     +P+ L FEV S+G+VVGKLVR+ +RR++ C L 
Sbjct  234   QGNKVPLYGAGATLEAL-DKNG----NIPMMLVFEVHSRGNVVGKLVRSKHRRRVSCSLE  288

Query  1124  IDSAGNKPIKFKKDSCAY  1177
             IDS  +KP+K K DSC Y
Sbjct  289   IDSRNSKPMKIKADSCTY  306



>gb|EPS69114.1| hypothetical protein M569_05653, partial [Genlisea aurea]
Length=314

 Score =   330 bits (846),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 195/323 (60%), Positives = 251/323 (78%), Gaps = 16/323 (5%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             M+H+KSESD+TS A SSPS      VYYVQSPSRDS  DGD  KS SM  TP F SP+ES
Sbjct  1     MMHSKSESDITSSAPSSPSRSPKRLVYYVQSPSRDSSHDGD--KSLSMHATPNFNSPMES  58

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELE--  574
             PSHPS GRHSR SS +RFSGIFRSSSGRK   ++   NDKGWPEC+VI+EEG YDE +  
Sbjct  59    PSHPSFGRHSRNSSASRFSGIFRSSSGRKMSSRKR--NDKGWPECSVILEEGNYDEFDAD  116

Query  575   DSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTG  754
             +   L+RR  AL+A  GFLLLFTVFCLIIWGAAR ++ Q+TL+SL+V+N+Y+G G+DFTG
Sbjct  117   NGKTLTRRCQALMAFLGFLLLFTVFCLIIWGAARNFEPQITLRSLTVNNLYVGSGADFTG  176

Query  755   VPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVL  934
             VPT++L++NG+LRIS+YNPATFYGIH+SS  ++L++SDI VATG+L++YYQ+R++ +  +
Sbjct  177   VPTKMLNLNGTLRISIYNPATFYGIHLSSPSVDLIYSDIVVATGKLQRYYQARRTHKNAV  236

Query  935   VNIQGTKVPLYGAGSSLPATKNKDGTGG-VQVPLALDFEVKSQGDVVGKLVRTDYRRKIW  1111
             + I+GTK+PLYGAGS+L  T     TGG VQ+PL L F + S GDVVGKLV T +R  + 
Sbjct  237   IVIEGTKIPLYGAGSTLAVT-----TGGPVQIPLTLSFVLVSNGDVVGKLVTTKHRTSVT  291

Query  1112  CELIIDSAGNKPIKFKKDSCAYS  1180
             C + +DS  N P+KF K++C ++
Sbjct  292   CPVNVDSTVNSPMKFSKNNCTFT  314



>ref|XP_008463399.1| PREDICTED: uncharacterized protein LOC103501566 [Cucumis melo]
Length=307

 Score =   328 bits (840),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 182/318 (57%), Positives = 232/318 (73%), Gaps = 15/318 (5%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH---VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESP  403
             M+H KS+SDVTSLA SSP      +YYVQSPSRDSHD   G+KS S   TP F SP+ESP
Sbjct  1     MMHAKSDSDVTSLAPSSPRSPKRPLYYVQSPSRDSHD---GDKS-STHATPAFNSPMESP  56

Query  404   SHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDSW  583
             SHPS   ++R S  +  S    +     GR      NDKGWPECNVI EEG YD+L    
Sbjct  57    SHPS---YTRHSRSSSASRFSGTFRSSLGRKGSRKRNDKGWPECNVIEEEGDYDDLNGDK  113

Query  584   LLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPT  763
              L+RR   L+AL  F+ +F +FCLIIWGA+RP+KA++ +KS++V N+Y GEGSD TGVPT
Sbjct  114   GLTRRCQILMALLAFIFIFLLFCLIIWGASRPFKAEIKVKSMTVHNVYFGEGSDTTGVPT  173

Query  764   RLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNI  943
             +LL++N SLRI+V+NPATF+GIHVSS+PINL++S I VA+GQLKKYYQ R+S R  LVN+
Sbjct  174   KLLTINCSLRITVHNPATFFGIHVSSSPINLMYSQIAVASGQLKKYYQPRQSNRIKLVNL  233

Query  944   QGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELI  1123
             QG KVPLYGAG++L A  +K+G     +P+ L FEV S+G+VVGKLVR+ +R+++ C L 
Sbjct  234   QGNKVPLYGAGATLEAL-DKNG----NIPMMLVFEVHSRGNVVGKLVRSKHRKRVSCSLE  288

Query  1124  IDSAGNKPIKFKKDSCAY  1177
             IDS  +KP+K K DSC Y
Sbjct  289   IDSRNSKPMKIKADSCTY  306



>ref|XP_006833312.1| hypothetical protein AMTR_s00109p00054230 [Amborella trichopoda]
 gb|ERM98590.1| hypothetical protein AMTR_s00109p00054230 [Amborella trichopoda]
Length=313

 Score =   328 bits (840),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 181/320 (57%), Positives = 240/320 (75%), Gaps = 14/320 (4%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESP  403
             +H KS+SDVTSLA SSPS      VYYVQSPSRDSHD   G+KS+S+Q TP + SP+ESP
Sbjct  1     MHAKSDSDVTSLAPSSPSRSPKRPVYYVQSPSRDSHD---GDKSSSLQATPVYNSPMESP  57

Query  404   SHPSLGRHSRTssgtrfsgifrs--ssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELED  577
             SHPS GRHSR SS +RFSG  RS               NDKGWPECNVI EEG YD++E+
Sbjct  58    SHPSFGRHSRASSASRFSGALRSYGRKINPHERGNKKMNDKGWPECNVIQEEGSYDDIEE  117

Query  578   SWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGV  757
             +   SRR   LLA+  F+L+FT+F +I+WGA+RPYK  V +KSL+V +  +G+G+D++GV
Sbjct  118   NAGFSRRCQVLLAVLCFVLIFTMFSVILWGASRPYKPDVIVKSLTVGDFSLGQGTDYSGV  177

Query  758   PTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLV  937
             PT++L+ N +L++S+YNPATF+GIHVSS+PIN++F++I +ATGQLKKYYQ R+S+RTV +
Sbjct  178   PTKMLNTNSTLKLSIYNPATFFGIHVSSSPINIMFTEIPIATGQLKKYYQPRQSQRTVSI  237

Query  938   NIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCE  1117
              +QG KVPLYGAG+SL  +          V L L+F++KS+G+VVGKLV++  RR+I C+
Sbjct  238   VLQGNKVPLYGAGASLTGSSTLGA-----VSLRLEFDIKSRGNVVGKLVKSRNRRRITCD  292

Query  1118  LIIDSAGNKPIKFKKDSCAY  1177
              ++DS+  KPIKF KDSC Y
Sbjct  293   FVLDSSKLKPIKFLKDSCTY  312



>gb|KDP33684.1| hypothetical protein JCGZ_07255 [Jatropha curcas]
Length=318

 Score =   325 bits (833),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 191/323 (59%), Positives = 239/323 (74%), Gaps = 14/323 (4%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH---VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESP  403
             M+H KS+SDVTSLA SSP      VYYVQSPSRDSHD   G+KS+S Q TP F SP+ESP
Sbjct  1     MMHAKSDSDVTSLAPSSPRSPKRPVYYVQSPSRDSHD---GDKSSSTQATPAFNSPMESP  57

Query  404   SHPSLGRHSRTssgtrfsgi----frsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDEL  571
             SHPS GRHSR SS +R SG       SSS   GR  R    +KGWPE NVI EEG Y E+
Sbjct  58    SHPSYGRHSRASSSSRVSGTYGSSAASSSMNAGRKGRNKRTEKGWPESNVIEEEGDYGEM  117

Query  572   EDSWLLSRR-FHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDF  748
               +   SRR    L+ + GF+++F++FCLIIWGA+RP+K ++++KSL+V + Y GEGSD 
Sbjct  118   YRNKEFSRRRCQVLMGVFGFVMIFSLFCLIIWGASRPFKPEISVKSLTVHSFYFGEGSDL  177

Query  749   TGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRT  928
             TGVPT++L+ N SL+++VYNPATF+GIHVSS P+NL++S+I +ATG+LKKYYQSRKS RT
Sbjct  178   TGVPTKMLTTNCSLKMNVYNPATFFGIHVSSVPLNLMYSEIVIATGELKKYYQSRKSHRT  237

Query  929   VLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKI  1108
             V VN++GTK+PLYGAG+S   + N  G G   VP+ L F+V S+GDVVGKLV+T   R +
Sbjct  238   VSVNLEGTKIPLYGAGASFAISDNNIGAG---VPMTLVFDVHSRGDVVGKLVKTRRTRHV  294

Query  1109  WCELIIDSAGNKPIKFKKDSCAY  1177
              C L IDS GNKPIK K+DSC Y
Sbjct  295   SCVLTIDSLGNKPIKLKEDSCKY  317



>ref|XP_007013150.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY30769.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=304

 Score =   318 bits (816),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 186/321 (58%), Positives = 235/321 (73%), Gaps = 25/321 (8%)
 Frame = +2

Query  236   LHTKSESDVTSL----AASSPSGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESP  403
             +HTKS+SDVTS     +  SP   +YYVQSPSRDSHD   G+KS+SMQ TP + SP+ESP
Sbjct  1     MHTKSDSDVTSSVDPSSPRSPKRQLYYVQSPSRDSHD---GDKSSSMQATPAYNSPMESP  57

Query  404   SHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDEL---E  574
             SHPS  RHSR SS +RFSG  +    R         N+KGW ECNVI EEG Y E     
Sbjct  58    SHPSYSRHSRASSASRFSGNLKKGRKR---------NEKGWTECNVIEEEGDYGEYFYGR  108

Query  575   DSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTG  754
             D  L +RR   L+ + GF+ +F++FCLIIWGA+RPYKAQVT+KSL+V N Y GEG+D TG
Sbjct  109   DKGL-TRRCQILMGVFGFVAVFSLFCLIIWGASRPYKAQVTVKSLTVHNFYFGEGADTTG  167

Query  755   VPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVL  934
             VP+++L++N S+R++VYNPATF+GIHVSS P+NL++S+I VATGQLKKYYQ RKS RTV+
Sbjct  168   VPSKMLTMNCSVRMTVYNPATFFGIHVSSNPVNLMYSEIAVATGQLKKYYQPRKSHRTVV  227

Query  935   VNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWC  1114
               ++G KVPLYGAG+SL  +   D  GG  VP+ L FEV+S+G+VVGKLVR+ +R+ I C
Sbjct  228   ATLEGDKVPLYGAGASLAVS---DDVGG--VPMKLIFEVRSRGNVVGKLVRSRHRKLISC  282

Query  1115  ELIIDSAGNKPIKFKKDSCAY  1177
              L+IDS  NKP+K K  SC Y
Sbjct  283   SLVIDSHSNKPLKLKNSSCVY  303



>ref|XP_009374029.1| PREDICTED: uncharacterized protein LOC103962975 [Pyrus x bretschneideri]
Length=309

 Score =   315 bits (808),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 185/318 (58%), Positives = 236/318 (74%), Gaps = 13/318 (4%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH---VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESP  403
             M+H KS+SDVTSL+ S P      VYYVQSPSRDS+D   G+KS++MQ TP F SP+ESP
Sbjct  1     MMHAKSDSDVTSLSPSPPRSPKRPVYYVQSPSRDSND---GDKSSTMQATPAFNSPMESP  57

Query  404   SHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDSW  583
             SHPS G HSR SS +R SG FRSS+  +   ++   NDKGWPECNVI E+G Y  L  + 
Sbjct  58    SHPSYGHHSRASSASRVSGPFRSSNSGQKGARKR--NDKGWPECNVIEEDGDYGGLYGNK  115

Query  584   LLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPT  763
              + RR    +AL GF+++F+VFCLI+WGA+RP +A+V +KSL+V N Y GEGSD TGVPT
Sbjct  116   GIPRRCQICVALFGFVVIFSVFCLILWGASRPNRARVAVKSLAVHNFYFGEGSDMTGVPT  175

Query  764   RLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNI  943
             ++L++N S+R++VYNPATF+GIHVSSTPI L++S+I VATGQLKKYYQ RKS R V VN+
Sbjct  176   KMLTMNCSVRMTVYNPATFFGIHVSSTPIKLMYSEIAVATGQLKKYYQPRKSYRNVTVNL  235

Query  944   QGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELI  1123
             QG KVPLYGAG+SL  + N  G     VP+ L FEV+S+G+VVGKLVR+ +RR + C + 
Sbjct  236   QGIKVPLYGAGASLAVSDNNGG-----VPMMLVFEVRSRGNVVGKLVRSKHRRHVSCTME  290

Query  1124  IDSAGNKPIKFKKDSCAY  1177
             + S  + PIK K  SC Y
Sbjct  291   VGSHISTPIKLKTSSCTY  308



>gb|KHG20321.1| hypothetical protein F383_09129 [Gossypium arboreum]
Length=304

 Score =   314 bits (804),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 175/320 (55%), Positives = 225/320 (70%), Gaps = 23/320 (7%)
 Frame = +2

Query  236   LHTKSESDVTSL----AASSPSGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESP  403
             +HTKS+SDVTS     +  SP   +YYVQSPSRDSHD   G+KSTSMQ TP ++SP+ESP
Sbjct  1     MHTKSDSDVTSSVDPSSPRSPKRQLYYVQSPSRDSHD---GDKSTSMQATPAYSSPMESP  57

Query  404   SHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDEL--ED  577
             SHPS          +R S    +S       K    N+KGW ECNVI EEG Y E    +
Sbjct  58    SHPSY---------SRHSRASSASRFSGTLKKGRKRNEKGWTECNVIEEEGDYGEYFYGN  108

Query  578   SWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGV  757
                 +RR   L+ + GF+ +F++FCLIIWGA+RPY AQ+ +KSL+V N Y GEG+D TGV
Sbjct  109   DKGFTRRCQILMGVFGFIAVFSLFCLIIWGASRPYNAQIAVKSLTVHNFYFGEGADMTGV  168

Query  758   PTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLV  937
             P+++L++N SLR++VYNPATF+GIHVSS  +NL++S+I VATGQLKKYYQ RKS RTV V
Sbjct  169   PSKMLTMNCSLRMTVYNPATFFGIHVSSNLVNLMYSEIAVATGQLKKYYQPRKSHRTVAV  228

Query  938   NIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCE  1117
              + G KVPLYGAG+SL  +   DG G   VP+ L FEV+S+G+VVGKLV++ +R++I C 
Sbjct  229   TLHGDKVPLYGAGASLAIS--DDGGG---VPMTLIFEVRSRGNVVGKLVKSRHRKRISCS  283

Query  1118  LIIDSAGNKPIKFKKDSCAY  1177
             L+IDS  NKP+K K  SC Y
Sbjct  284   LVIDSHSNKPLKLKNSSCQY  303



>ref|XP_010049670.1| PREDICTED: uncharacterized protein LOC104438267 [Eucalyptus grandis]
 gb|KCW82412.1| hypothetical protein EUGRSUZ_C03816 [Eucalyptus grandis]
Length=309

 Score =   313 bits (803),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 173/317 (55%), Positives = 228/317 (72%), Gaps = 15/317 (5%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSG---HVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESPS  406
             LH+KS+SDVTSL  SSP      VY+ QSPSR+S+D   G+KS+ MQ TP + SP+ESPS
Sbjct  4     LHSKSDSDVTSLDPSSPRSPKRAVYFYQSPSRESND---GDKSSLMQATPAYNSPMESPS  60

Query  407   HPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDSWL  586
             HP    HSR  S          SS           N+KGWPEC+VI EEG Y ++     
Sbjct  61    HPC---HSR-GSSESRFSGPFRSSYWTKGSNGRKRNEKGWPECDVIQEEGDYKDVFGDNG  116

Query  587   LSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPTR  766
             LSRRF  L+ + GF+++F+VFCLIIWGA+RPY+AQ+++KSL+V N Y+GEGSD TGVPT+
Sbjct  117   LSRRFQVLMGVLGFVVIFSVFCLIIWGASRPYRAQISVKSLTVHNFYVGEGSDSTGVPTK  176

Query  767   LLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNIQ  946
             ++++N S+R++VYN ATF+GIHV+STP+N++FS I VATGQL+KYYQ RKS RTV V ++
Sbjct  177   MVTMNCSMRMTVYNEATFFGIHVTSTPVNIMFSKIAVATGQLRKYYQPRKSHRTVAVVLE  236

Query  947   GTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELII  1126
             G KVPLYGAG+SL    N D  G  +VPL L FEV S+G+VVGKLVR+ +R+ + C L++
Sbjct  237   GDKVPLYGAGASL---TNSDYNG--EVPLTLVFEVLSRGNVVGKLVRSKHRKHVSCSLVV  291

Query  1127  DSAGNKPIKFKKDSCAY  1177
             +   N+ IKFK+ SC Y
Sbjct  292   NPNSNRIIKFKEHSCTY  308



>ref|XP_008337374.1| PREDICTED: uncharacterized protein LOC103400494 [Malus domestica]
Length=306

 Score =   313 bits (802),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 185/318 (58%), Positives = 237/318 (75%), Gaps = 16/318 (5%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH---VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESP  403
             M H KS+SDVTSL+ SSP      VYYVQSPSRDS+D   G+KS+++Q TP F SP+ESP
Sbjct  1     MXHAKSDSDVTSLSPSSPRSPKRPVYYVQSPSRDSND---GDKSSTVQATPAFNSPMESP  57

Query  404   SHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDSW  583
             SHPS G HSR SS +R SG FRSS+  +   ++   NDKGWPECNVI E+G    L  + 
Sbjct  58    SHPSYGHHSRASSXSRVSGPFRSSNSGQKGARKR--NDKGWPECNVIEEDGG---LYGNK  112

Query  584   LLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPT  763
              + RR    +AL GF+++F+VFCLI+WGA+RPYKA+V++KSL+V N Y GEGSD TGVPT
Sbjct  113   GIPRRCQICVALFGFVVIFSVFCLILWGASRPYKARVSVKSLAVHNFYFGEGSDMTGVPT  172

Query  764   RLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNI  943
             ++L++N S+R++VYNPATF+GIHVSSTPI L++S+I VATGQLKKYYQ RKS R V VN+
Sbjct  173   KMLTMNCSVRMTVYNPATFFGIHVSSTPIKLMYSEIAVATGQLKKYYQPRKSYRNVTVNL  232

Query  944   QGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELI  1123
             QG KVPLYGAG+SL  + N  G     VP+ L FEV+S+G+VVG+LVR+ +RR + C + 
Sbjct  233   QGIKVPLYGAGASLAVSDNNGG-----VPMMLVFEVRSRGNVVGRLVRSKHRRHVSCTME  287

Query  1124  IDSAGNKPIKFKKDSCAY  1177
             + S  + PIK K  SC Y
Sbjct  288   VGSHSSTPIKLKTSSCTY  305



>ref|XP_007013151.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY30770.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=302

 Score =   311 bits (796),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 185/321 (58%), Positives = 233/321 (73%), Gaps = 27/321 (8%)
 Frame = +2

Query  236   LHTKSESDVTSL----AASSPSGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESP  403
             +HTKS+SDVTS     +  SP   +YYVQSPSRDSHD   G+KS+SMQ TP + SP+ESP
Sbjct  1     MHTKSDSDVTSSVDPSSPRSPKRQLYYVQSPSRDSHD---GDKSSSMQATPAYNSPMESP  57

Query  404   SHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDEL---E  574
             SHPS  RHSR SS +RFSG  +    R         N+KGW ECNVI EEG Y E     
Sbjct  58    SHPSYSRHSRASSASRFSGNLKKGRKR---------NEKGWTECNVIEEEGDYGEYFYGR  108

Query  575   DSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTG  754
             D  L +RR   L+ + GF+ +F++FCLIIWGA+RPYKAQVT  SL+V N Y GEG+D TG
Sbjct  109   DKGL-TRRCQILMGVFGFVAVFSLFCLIIWGASRPYKAQVT--SLTVHNFYFGEGADTTG  165

Query  755   VPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVL  934
             VP+++L++N S+R++VYNPATF+GIHVSS P+NL++S+I VATGQLKKYYQ RKS RTV+
Sbjct  166   VPSKMLTMNCSVRMTVYNPATFFGIHVSSNPVNLMYSEIAVATGQLKKYYQPRKSHRTVV  225

Query  935   VNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWC  1114
               ++G KVPLYGAG+SL  +   D  GG  VP+ L FEV+S+G+VVGKLVR+ +R+ I C
Sbjct  226   ATLEGDKVPLYGAGASLAVS---DDVGG--VPMKLIFEVRSRGNVVGKLVRSRHRKLISC  280

Query  1115  ELIIDSAGNKPIKFKKDSCAY  1177
              L+IDS  NKP+K K  SC Y
Sbjct  281   SLVIDSHSNKPLKLKNSSCVY  301



>ref|XP_009371452.1| PREDICTED: uncharacterized protein LOC103960695 [Pyrus x bretschneideri]
Length=305

 Score =   305 bits (780),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 172/318 (54%), Positives = 224/318 (70%), Gaps = 17/318 (5%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH---VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESP  403
             M+H KS+SD+TSL+ SSP      +YYVQSPSRDS+D   G+KS++MQ +    SP+ESP
Sbjct  1     MMHAKSDSDMTSLSPSSPRSPKRPLYYVQSPSRDSND---GDKSSTMQAS----SPMESP  53

Query  404   SHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDSW  583
             SHPS      + + +         S   G+      N+KGWPECNVI EEG Y  L  + 
Sbjct  54    SHPSY--SRHSRASSASRVSGTFRSSNSGQKGGRKRNEKGWPECNVIEEEGDYGGLYGNK  111

Query  584   LLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPT  763
              +SRR    +AL GF+++F+VFCLI+WGA+RPY+A+V +KSL V N Y GEGSD TGVPT
Sbjct  112   GVSRRCQICVALFGFVVIFSVFCLILWGASRPYRARVDVKSLVVHNFYFGEGSDMTGVPT  171

Query  764   RLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNI  943
             ++L++N S+R++VYNPATF+GIHVS+TP+ L++S+I VATGQLKKYYQ RKS RTV VN+
Sbjct  172   KMLTMNCSVRMTVYNPATFFGIHVSATPVKLMYSEIAVATGQLKKYYQPRKSYRTVTVNL  231

Query  944   QGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELI  1123
             QG KVPLYGAG+SL    N  G     VP+ L FEV+S+G+VVGKLVR+ +RR + C + 
Sbjct  232   QGIKVPLYGAGASLAVADNNGG-----VPMMLVFEVRSRGNVVGKLVRSKHRRHVSCTME  286

Query  1124  IDSAGNKPIKFKKDSCAY  1177
             + S   KPIK K  SC Y
Sbjct  287   VGSHNTKPIKLKTSSCTY  304



>gb|KHN32621.1| hypothetical protein glysoja_022303 [Glycine soja]
Length=268

 Score =   303 bits (776),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 180/315 (57%), Positives = 224/315 (71%), Gaps = 55/315 (17%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             ML  KSESD+TSLA SSPS      VYYVQSPSRDSHD   G+KS+SMQ TP   SP+ES
Sbjct  1     MLSAKSESDITSLAPSSPSRSPKRPVYYVQSPSRDSHD---GDKSSSMQATPISNSPMES  57

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDS  580
             PSHPS GRHSR SS +RFSGIFRSSSGRKG  KR   NDKGWPEC+VI+EEG        
Sbjct  58    PSHPSFGRHSRNSSASRFSGIFRSSSGRKGSRKR---NDKGWPECDVILEEG--------  106

Query  581   WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
                                             PYKAQ+ +KSL+V N Y+GEGSDFT VP
Sbjct  107   --------------------------------PYKAQIAVKSLTVHNFYVGEGSDFTSVP  134

Query  761   TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVN  940
             T++L+VNG+LR+S+YNPAT +GIHV STPINLVFSDITVATG+LKK+YQ RKS R + VN
Sbjct  135   TKMLTVNGTLRMSIYNPATLFGIHVHSTPINLVFSDITVATGELKKHYQPRKSHRIISVN  194

Query  941   IQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCEL  1120
             ++GTKVPLYGAGS++  ++      GV+V L L+FE++S G+VVGKLV+T +R++I C L
Sbjct  195   LEGTKVPLYGAGSTITVSQT-----GVEVGLTLNFEIRSHGNVVGKLVKTRHRKEITCPL  249

Query  1121  IIDSAGNKPIKFKKD  1165
             +++S+ +KP + +K+
Sbjct  250   VLNSSRSKPYQIQKE  264



>ref|XP_008343971.1| PREDICTED: uncharacterized protein LOC103406754 [Malus domestica]
Length=305

 Score =   302 bits (774),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 172/318 (54%), Positives = 220/318 (69%), Gaps = 17/318 (5%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH---VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESP  403
             M+H KS+SD+TSL+ SSP      +YYVQSPSRDS+D   G+KS++MQ      SP+ESP
Sbjct  1     MMHAKSDSDMTSLSPSSPRSPKRPLYYVQSPSRDSND---GDKSSTMQAN----SPMESP  53

Query  404   SHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDSW  583
             SHPS      + + +         S   G+      N+KGWPECNVI EEG Y  L  + 
Sbjct  54    SHPSY--SRHSRASSASRVSGTFRSSNSGQKGGRKRNEKGWPECNVIEEEGDYGGLYGNK  111

Query  584   LLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPT  763
              +SRR    +AL GF+ +F+VFCLI+WGA+RPY+A+V +KSL+V N Y GEGSD TGVPT
Sbjct  112   GVSRRCQICVALFGFVFIFSVFCLILWGASRPYRARVDVKSLAVHNFYFGEGSDMTGVPT  171

Query  764   RLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNI  943
             ++L++N S+R++VYNPATF+GIHVS+TP+ L++ +I VATGQLKKYYQ RKS RTV VN+
Sbjct  172   KMLTMNCSVRMTVYNPATFFGIHVSATPVKLMYXEIAVATGQLKKYYQPRKSHRTVTVNL  231

Query  944   QGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELI  1123
             QG KVPLYGAG+SL    N  G     VP+ L FEV S+G+VVGKLVR+ +RR I C   
Sbjct  232   QGIKVPLYGAGASLAVADNNGG-----VPMMLVFEVXSRGNVVGKLVRSRHRRHISCXXE  286

Query  1124  IDSAGNKPIKFKKDSCAY  1177
             + S   KPIK K  SC Y
Sbjct  287   VGSHNTKPIKLKTSSCTY  304



>ref|XP_009355422.1| PREDICTED: uncharacterized protein LOC103946437 [Pyrus x bretschneideri]
Length=305

 Score =   302 bits (774),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 171/318 (54%), Positives = 224/318 (70%), Gaps = 17/318 (5%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH---VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESP  403
             M+H KS+SD+TSL+ SSP      +YYVQSPSRDS+D   G+KS++MQ +    SP+ESP
Sbjct  1     MMHAKSDSDMTSLSPSSPRSPKRPLYYVQSPSRDSND---GDKSSTMQAS----SPMESP  53

Query  404   SHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDSW  583
             SHPS      + + +         S   G+      N+KGWPECNVI EEG Y  L  + 
Sbjct  54    SHPSY--SRHSRASSASRVSGTFRSSNSGQKGGRKRNEKGWPECNVIEEEGDYGGLYGNK  111

Query  584   LLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPT  763
              +SRR    +AL GF+++F+VFCLI+WGA+RPY+A+V +KSL V N Y GEGSD TGVPT
Sbjct  112   GVSRRCQICVALFGFVVIFSVFCLILWGASRPYRARVDVKSLVVHNFYFGEGSDMTGVPT  171

Query  764   RLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNI  943
             ++L++N S+R++VYNPATF+GIHVS+TP+ L++S+I VATGQLKKY+Q RKS RTV VN+
Sbjct  172   KMLTMNCSVRMTVYNPATFFGIHVSATPVKLMYSEIAVATGQLKKYHQPRKSYRTVTVNL  231

Query  944   QGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELI  1123
             QG KVPLYGAG+SL    N  G     VP+ L FEV+S+G+VVGKLVR+ +RR + C + 
Sbjct  232   QGIKVPLYGAGASLAVADNNGG-----VPMMLVFEVRSRGNVVGKLVRSKHRRHVSCTME  286

Query  1124  IDSAGNKPIKFKKDSCAY  1177
             + S   KPIK K  SC Y
Sbjct  287   VGSHKTKPIKLKTSSCTY  304



>ref|XP_008386345.1| PREDICTED: uncharacterized protein LOC103448864 [Malus domestica]
 ref|XP_008354400.1| PREDICTED: uncharacterized protein LOC103418021 [Malus domestica]
Length=305

 Score =   302 bits (773),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 172/318 (54%), Positives = 220/318 (69%), Gaps = 17/318 (5%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH---VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESP  403
             M+H KS+SD+TSL+ SSP      +YYVQSPSRDS+D   G+KS++MQ      SP+ESP
Sbjct  1     MMHAKSDSDMTSLSPSSPRSPKRPLYYVQSPSRDSND---GDKSSTMQAN----SPMESP  53

Query  404   SHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDSW  583
             SHPS      + + +         S   G+      N+KGWPECNVI EEG Y  L  + 
Sbjct  54    SHPSY--SRHSRASSASRVSGTFRSSNSGQKGGRKRNEKGWPECNVIEEEGDYGGLYGNK  111

Query  584   LLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPT  763
              +SRR    +AL GF+ +F+VFCLI+WGA+RPY+A+V +KSL+V N Y GEGSD TGVPT
Sbjct  112   GVSRRCQICVALFGFVFIFSVFCLILWGASRPYRARVDVKSLAVHNFYFGEGSDMTGVPT  171

Query  764   RLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNI  943
             ++L++N S+R++VYNPATF+GIHVS+TP+ L++ +I VATGQLKKYYQ RKS RTV VN+
Sbjct  172   KMLTMNCSVRMTVYNPATFFGIHVSATPVKLMYXEIAVATGQLKKYYQPRKSXRTVTVNL  231

Query  944   QGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELI  1123
             QG KVPLYGAG+SL    N  G     VP+ L FEV S+G+VVGKLVR+ +RR I C   
Sbjct  232   QGIKVPLYGAGASLAVADNNGG-----VPMMLVFEVXSRGNVVGKLVRSRHRRHISCXXE  286

Query  1124  IDSAGNKPIKFKKDSCAY  1177
             + S   KPIK K  SC Y
Sbjct  287   VGSHNTKPIKLKTSSCTY  304



>ref|XP_004964763.1| PREDICTED: uncharacterized protein LOC101752982 isoform X1 [Setaria 
italica]
 ref|XP_004964764.1| PREDICTED: uncharacterized protein LOC101752982 isoform X2 [Setaria 
italica]
 ref|XP_004964765.1| PREDICTED: uncharacterized protein LOC101752982 isoform X3 [Setaria 
italica]
 ref|XP_004964766.1| PREDICTED: uncharacterized protein LOC101752982 isoform X4 [Setaria 
italica]
Length=322

 Score =   302 bits (774),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 176/328 (54%), Positives = 220/328 (67%), Gaps = 20/328 (6%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSP------------SGHVYYVQSPSRDSHDDGDGEKSTSMQPTP  376
             M+H KSESDVTSLAASSP             G+ YYVQSPSR+SHD G   KS+SMQ TP
Sbjct  1     MMHAKSESDVTSLAASSPPRSPKRGGGGAGGGNNYYVQSPSRESHDGG--YKSSSMQATP  58

Query  377   TFTSPVESPSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEG  556
              + SP ESPSHPS GR    SS            G    G+R   NDKGWPECNVI EEG
Sbjct  59    VYNSPNESPSHPSYGR-HSRSSSVSRFSGNLRKGGAGAGGERKALNDKGWPECNVIEEEG  117

Query  557   KYDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGE  736
              Y++L     LSRR   +L    F+LLFTVFCLIIWGAARPY+ +V +KSL + + Y GE
Sbjct  118   PYEDLAGDSGLSRRCQIILGFLTFVLLFTVFCLIIWGAARPYEPEVIVKSLVMDDFYAGE  177

Query  737   GSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRK  916
             G+D +GVPT+L++ N SL ISVYNPAT +GIHV+S PI+L++S+I++A GQL++YYQ RK
Sbjct  178   GTDHSGVPTKLVTTNCSLHISVYNPATMFGIHVTSGPIHLIYSEISIAVGQLRRYYQPRK  237

Query  917   SRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDY  1096
             S R V   I G KVPLYGAG SL  +     TGG  VPL LDF++ S+G V+GKLVR  +
Sbjct  238   SHRMVTAVIHGEKVPLYGAGGSLMLSS----TGGA-VPLTLDFDLTSRGYVIGKLVRVTH  292

Query  1097  RRKIWCELIIDSAGNKPIKFKKDSCAYS  1180
             +  + C +++D+   KPI+F K +C  S
Sbjct  293   KVHVTCPVVVDAKKTKPIRFSKKACTVS  320



>ref|NP_001149360.1| LOC100282984 [Zea mays]
 gb|ACG35152.1| harpin-induced protein [Zea mays]
 gb|ACN25808.1| unknown [Zea mays]
 gb|AFW75624.1| harpin-induced protein [Zea mays]
Length=319

 Score =   300 bits (768),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 177/325 (54%), Positives = 226/325 (70%), Gaps = 21/325 (6%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSP-----------SGHVYYVQSPSRDSHDDGDGEKSTSMQPTPT  379
             M+H KSESDVTSLAASSP               YYVQSPSR+SHD G   KS+SMQPTP 
Sbjct  1     MMHAKSESDVTSLAASSPPRSPKRGGGAAGNGGYYVQSPSRESHDGG--YKSSSMQPTPV  58

Query  380   FTSPVESPSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGK  559
             + SP ESPSHPS GRHSR+SS +RFSG  R  +    +      NDKGWPECNVI EEG 
Sbjct  59    YNSPNESPSHPSYGRHSRSSSVSRFSGNLRKGAAGDRKVL----NDKGWPECNVIEEEGP  114

Query  560   YDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEG  739
             Y++L     LSRR   +L    F+LLFTVFCLIIWGAARPY+ +V +KSL + + Y GEG
Sbjct  115   YEDLAGDSGLSRRCQIILGFLTFVLLFTVFCLIIWGAARPYEPEVIVKSLVMDDFYAGEG  174

Query  740   SDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKS  919
             +D +GVPT+L++ N SL I+VYNPAT +GIHV+S PI+L++S+I +A GQ+++YYQ RKS
Sbjct  175   TDHSGVPTKLVTTNCSLHIAVYNPATMFGIHVTSGPIHLMYSEIPIAVGQVRRYYQPRKS  234

Query  920   RRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYR  1099
              R V   I G KVPLYGAG SL  + +   TGG  VPL LD ++ S+G V+GKLVR  ++
Sbjct  235   HRMVTAVIHGEKVPLYGAGGSLMLSTS---TGGA-VPLTLDLDLTSRGYVIGKLVRVTHK  290

Query  1100  RKIWCELIIDSAGNKPIKFKKDSCA  1174
               + C +++D+   KP++F K +CA
Sbjct  291   VHVTCPVVVDAKKTKPVRFSKKACA  315



>ref|XP_006655820.1| PREDICTED: uncharacterized protein LOC102712638 [Oryza brachyantha]
Length=317

 Score =   297 bits (760),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 178/320 (56%), Positives = 226/320 (71%), Gaps = 13/320 (4%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSP----SGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             M+H KSESDVTSLA SSP        YYVQSPSR+SHD G   KS+SMQ TP + SP ES
Sbjct  1     MMHAKSESDVTSLAPSSPPRSPKRANYYVQSPSRESHDGG--YKSSSMQATPVYNSPNES  58

Query  401   PSHPSLGRHSRTssgtrfsgif--rsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELE  574
             PSHPS GRHSR+SS +RFSG        G  G G+R   NDKGWPECNVI EEG Y++L+
Sbjct  59    PSHPSYGRHSRSSSVSRFSGNLRDGGRKGGAGAGERKALNDKGWPECNVIEEEGPYEDLD  118

Query  575   DSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTG  754
                 LSRR   +L    F+LLFTVFCLIIWGAARPY+  V +KSL++ + Y GEG+D +G
Sbjct  119   GDSGLSRRCQIILGFLSFVLLFTVFCLIIWGAARPYEPDVVVKSLTMDDFYAGEGTDHSG  178

Query  755   VPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVL  934
             VPT+L+++N SL I+VYNPA  +GIHV+S PI+L++S+I++  GQ+++YYQ RKS R V 
Sbjct  179   VPTKLVTLNCSLHIAVYNPAAMFGIHVTSGPIHLLYSEISIGVGQVRRYYQPRKSHRVVT  238

Query  935   VNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWC  1114
               I G KVPLYGAG  L  +     TGG  VPL LDF++ S+G V+GKLVR  ++  + C
Sbjct  239   AVIHGEKVPLYGAGGGLMLSS----TGGA-VPLTLDFDLTSRGYVIGKLVRVTHKVHVTC  293

Query  1115  ELIIDSAGNKPIKFKKDSCA  1174
              +++D+   KPIKF K +CA
Sbjct  294   PIVVDAKKTKPIKFSKKACA  313



>gb|AFW75623.1| harpin-induced protein [Zea mays]
Length=475

 Score =   302 bits (773),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 171/332 (52%), Positives = 221/332 (67%), Gaps = 21/332 (6%)
 Frame = +2

Query  212   ISNSTTAMLHTKSESDVTSLAASSP-----------SGHVYYVQSPSRDSHDDGDGEKST  358
             +    T M+H KSESDVTSLAASSP               YYVQSPSR+SHD G   KS+
Sbjct  150   VGGKRTDMMHAKSESDVTSLAASSPPRSPKRGGGAAGNGGYYVQSPSRESHDGG--YKSS  207

Query  359   SMQPTPTFTSPVESPSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECN  538
             SMQPTP + SP ESPSHPS G      S +     F  +  +   G R + NDKGWPECN
Sbjct  208   SMQPTPVYNSPNESPSHPSYG----RHSRSSSVSRFSGNLRKGAAGDRKVLNDKGWPECN  263

Query  539   VIMEEGKYDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVS  718
             VI EEG Y++L     LSRR   +L    F+LLFTVFCLIIWGAARPY+ +V +KSL + 
Sbjct  264   VIEEEGPYEDLAGDSGLSRRCQIILGFLTFVLLFTVFCLIIWGAARPYEPEVIVKSLVMD  323

Query  719   NIYIGEGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKK  898
             + Y GEG+D +GVPT+L++ N SL I+VYNPAT +GIHV+S PI+L++S+I +A GQ+++
Sbjct  324   DFYAGEGTDHSGVPTKLVTTNCSLHIAVYNPATMFGIHVTSGPIHLMYSEIPIAVGQVRR  383

Query  899   YYQSRKSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGK  1078
             YYQ RKS R V   I G KVPLYGAG SL  + +   TGG  VPL LD ++ S+G V+GK
Sbjct  384   YYQPRKSHRMVTAVIHGEKVPLYGAGGSLMLSTS---TGGA-VPLTLDLDLTSRGYVIGK  439

Query  1079  LVRTDYRRKIWCELIIDSAGNKPIKFKKDSCA  1174
             LVR  ++  + C +++D+   KP++F K +CA
Sbjct  440   LVRVTHKVHVTCPVVVDAKKTKPVRFSKKACA  471



>ref|XP_011044497.1| PREDICTED: uncharacterized protein LOC105139664 [Populus euphratica]
Length=307

 Score =   294 bits (753),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 180/324 (56%), Positives = 233/324 (72%), Gaps = 27/324 (8%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSG---HV-YYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             MLH  SESD+TS+A SSP     HV YYVQSPSRDSHD   G+KS+SMQ TP + SP+ES
Sbjct  1     MLHAISESDMTSMAPSSPRSPKRHVLYYVQSPSRDSHD---GDKSSSMQTTPAYASPMES  57

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPE--CN-VIMEEGKYDEL  571
             PSH S GRHSR+SS +R SG      GR           KGWP+  C+ VI EEG YD  
Sbjct  58    PSHLSYGRHSRSSSASRVSGGGYGWKGRS--------KSKGWPQSKCDDVIEEEGDYDPY  109

Query  572   EDSWLLSRRF--HallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSD  745
              +   +SRR+    L+   GF+  F VFCLIIWGA+RP+K Q+ +KSL+V N Y GEGSD
Sbjct  110   RNG--VSRRWLCQVLIWALGFVSAFCVFCLIIWGASRPFKPQIAVKSLTVHNFYFGEGSD  167

Query  746   FTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRR  925
              TGVPT++L+V+ S++++VYN ATF+GIHVSS P+NL++S++TVATG+LK+Y+Q RKS R
Sbjct  168   MTGVPTKMLTVSCSVKMNVYNSATFFGIHVSSIPVNLMYSELTVATGELKRYFQPRKSHR  227

Query  926   TVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRK  1105
             TV VN++GTKVPLYGAG+   A+++  G     VP+ L FEV+S G+VVGKLV+  ++R+
Sbjct  228   TVSVNLKGTKVPLYGAGAGFAASEDNGG-----VPMTLVFEVRSIGNVVGKLVKPRHKRR  282

Query  1106  IWCELIIDSAGNKPIKFKKDSCAY  1177
             + C L IDS  +K IKFK+DSC Y
Sbjct  283   VACSLAIDSRSSKAIKFKEDSCTY  306



>ref|NP_001056895.2| Os06g0163300 [Oryza sativa Japonica Group]
 dbj|BAD67647.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG93658.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97545.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87408.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC80075.1| hypothetical protein OsI_21794 [Oryza sativa Indica Group]
 gb|EEE65146.1| hypothetical protein OsJ_20229 [Oryza sativa Japonica Group]
 dbj|BAF18809.2| Os06g0163300 [Oryza sativa Japonica Group]
Length=322

 Score =   292 bits (748),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 168/326 (52%), Positives = 216/326 (66%), Gaps = 20/326 (6%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSP------------SGHVYYVQSPSRDSHDDGDGEKSTSMQPTP  376
             M+H KSESDVTSLA SSP             G  YYVQSPSR+SHD G   KS+SMQ TP
Sbjct  1     MMHAKSESDVTSLAPSSPPRSPKRGGGVGVGGANYYVQSPSRESHDGG--YKSSSMQATP  58

Query  377   TFTSPVESPSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEG  556
              + SP ESPSHPS GR    SS             RK  G+R   NDKGWPECNVI EEG
Sbjct  59    VYNSPNESPSHPSYGR-HSRSSSVSRFSGTLRDGSRKAGGERKALNDKGWPECNVIEEEG  117

Query  557   KYDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGE  736
              Y++L     LSRR   +L    F+LLFTVFCLIIWGAARPY+  V +KSL++ + Y GE
Sbjct  118   PYEDLAGDTGLSRRCQIVLGFLCFVLLFTVFCLIIWGAARPYEPDVVVKSLTMDDFYAGE  177

Query  737   GSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRK  916
             G+D +GVPT+L+++N SL I+VYNPA+ +GIHV++ PI L++S+I++  GQ+++YYQ RK
Sbjct  178   GTDHSGVPTKLVTLNCSLHIAVYNPASMFGIHVTTGPIRLLYSEISIGVGQVRRYYQPRK  237

Query  917   SRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDY  1096
             S R V   + G KVPLYGAG  L  + +     G  VPL LDF++ S+G V+GKLVR  +
Sbjct  238   SHRLVTAVVHGNKVPLYGAGGGLMLSSS-----GGAVPLTLDFDLTSRGYVIGKLVRVTH  292

Query  1097  RRKIWCELIIDSAGNKPIKFKKDSCA  1174
             +  + C +++D+   KPIKF K +CA
Sbjct  293   KVHVTCPIVVDAKKTKPIKFSKKACA  318



>ref|XP_006381719.1| hypothetical protein POPTR_0006s16310g [Populus trichocarpa]
 gb|ERP59516.1| hypothetical protein POPTR_0006s16310g [Populus trichocarpa]
Length=307

 Score =   290 bits (741),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 175/324 (54%), Positives = 228/324 (70%), Gaps = 27/324 (8%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             MLH  SESD+TS++ SSP       +YYVQSPSRDSHD   G+KS+SMQ TP + S +ES
Sbjct  1     MLHAISESDMTSMSPSSPRSPKRPVLYYVQSPSRDSHD---GDKSSSMQTTPAYASSMES  57

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPE--CN-VIMEEGKYDEL  571
             PSH S GRHS +SS +R SG      GR           KGWP+  C+ VI EEG YD  
Sbjct  58    PSHLSYGRHSLSSSASRVSGGGYGWKGRS--------KSKGWPQSKCDDVIEEEGDYDPY  109

Query  572   EDSWLLSRRF--HallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSD  745
              +   +SRR+    L+   GF+    VFC IIWGA+RP+K Q+T+KSL+V N Y GEGSD
Sbjct  110   GNG--ISRRWLCQVLIWASGFVSALCVFCFIIWGASRPFKPQITVKSLTVHNFYFGEGSD  167

Query  746   FTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRR  925
              TGVPT++L+V+ S++++VYN ATF+GIHVSS P+NL++S++TVATG+LK+Y Q RKS R
Sbjct  168   MTGVPTKMLTVSCSVKMNVYNSATFFGIHVSSIPVNLMYSELTVATGELKRYSQPRKSHR  227

Query  926   TVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRK  1105
             TV VN++GTKVPLYGAG+ L A+++  G     VP+ L FEV+S G+VVGKLV+  +RR+
Sbjct  228   TVSVNLKGTKVPLYGAGAGLAASEDNGG-----VPMTLVFEVRSIGNVVGKLVKPRHRRR  282

Query  1106  IWCELIIDSAGNKPIKFKKDSCAY  1177
             + C L IDS  +K I FK+DSC Y
Sbjct  283   VACSLAIDSRSSKAIIFKEDSCTY  306



>ref|XP_007152854.1| hypothetical protein PHAVU_004G165600g [Phaseolus vulgaris]
 gb|ESW24848.1| hypothetical protein PHAVU_004G165600g [Phaseolus vulgaris]
Length=304

 Score =   274 bits (701),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 161/317 (51%), Positives = 216/317 (68%), Gaps = 14/317 (4%)
 Frame = +2

Query  233   MLHTKSESDVTSL-AASSPSGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESPSH  409
             M+H K++SDVTS+  +SSP   VYYVQSPSRDSHD   G+KS++M  TP F SP +SPSH
Sbjct  1     MMHAKTDSDVTSMDTSSSPKRAVYYVQSPSRDSHD---GDKSSTMHATPAFNSPTDSPSH  57

Query  410   PSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDSWLL  589
              S G     +S +       + +    +G R    +KG P+C VI EE   +       L
Sbjct  58    HSFGH-HSRASSSSRVSGSFNIATWGRKGNRKHGGEKGLPDCKVIEEEEDEERKG----L  112

Query  590   SRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPTRL  769
             SRR    + + GF L+FTVFC II GAA+ +K +V++KSL+V N Y GEGSD TGVPT++
Sbjct  113   SRRTQIFVGVVGFALIFTVFCFIIAGAAKVFKVRVSVKSLTVHNFYFGEGSDTTGVPTKM  172

Query  770   LSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNIQG  949
             L+VN S+RI ++NPATF+GIHVSS  +NL++S+ITVATG++KK Y  RK  RTV VN+QG
Sbjct  173   LTVNCSVRIKMHNPATFFGIHVSSKEVNLMYSEITVATGEVKKQYLPRKGTRTVSVNLQG  232

Query  950   TKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELIID  1129
             +KVPLYGAG+SL    +       +VPL L FE++S G+VVGKLVR+ +RR + C + ID
Sbjct  233   SKVPLYGAGASLTGLVDNG-----KVPLTLVFEIRSIGNVVGKLVRSKHRRHVSCSVAID  287

Query  1130  SAGNKPIKFKKDSCAYS  1180
             S  N PIK K+++C Y+
Sbjct  288   SHNNGPIKLKENACTYN  304



>ref|XP_006465732.1| PREDICTED: uncharacterized protein LOC102622098 [Citrus sinensis]
Length=462

 Score =   277 bits (709),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 170/240 (71%), Positives = 198/240 (83%), Gaps = 16/240 (7%)
 Frame = +2

Query  233  MLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
            ML TKSESD+TSLA SSPS      VYYVQSPSRDS D   G+KS+S+QP     SP+ES
Sbjct  2    MLSTKSESDITSLAPSSPSRSPKRPVYYVQSPSRDSQD---GDKSSSLQP-----SPMES  53

Query  401  PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDS  580
            PSHPS GRHSR SS +RFSGIFRSSSGRKG  KR   NDKGWPECNVI+EEGKYDE ED 
Sbjct  54   PSHPSFGRHSRNSSASRFSGIFRSSSGRKGTRKR---NDKGWPECNVILEEGKYDEFEDK  110

Query  581  WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
              + RRF A +AL  F+LLFTVFCLIIWGA+RP+KA++T+KSLS+ N Y+GEGSD TGVP
Sbjct  111  GFV-RRFQAFIALFSFVLLFTVFCLIIWGASRPFKAEITVKSLSMHNFYVGEGSDSTGVP  169

Query  761  TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVN  940
            T++L++NGSL+ISVYNPAT +GIHVSSTPI++V+S+I +ATGQLKKYYQ RKS RTV VN
Sbjct  170  TKMLTMNGSLKISVYNPATIFGIHVSSTPIDVVYSEIVIATGQLKKYYQPRKSHRTVSVN  229


 Score =   214 bits (545),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 134/165 (81%), Gaps = 5/165 (3%)
 Frame = +2

Query  683   KAQVTLKSLSVSNIYIGEGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVF  862
             +A++T+KSLS+ N Y+GEGSD TGVPT++L++NGSL+ISVYNPAT +GIHVSSTPI++V+
Sbjct  302   RAEITVKSLSMHNFYVGEGSDSTGVPTKMLTMNGSLKISVYNPATIFGIHVSSTPIDVVY  361

Query  863   SDITVATGQLKKYYQSRKSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALD  1042
             S+I +ATGQLKKYYQ RKS RTV VN+QG KVPLYGAGS L  T     TGG +VP  L 
Sbjct  362   SEIVIATGQLKKYYQPRKSHRTVSVNLQGNKVPLYGAGSGLTITP----TGG-EVPSTLK  416

Query  1043  FEVKSQGDVVGKLVRTDYRRKIWCELIIDSAGNKPIKFKKDSCAY  1177
             F ++S+G+VVGKLV+T ++ +I C L+ID    KPIKFKK++C Y
Sbjct  417   FGIRSRGEVVGKLVKTTHKTQITCPLVIDILSTKPIKFKKNACTY  461



>ref|XP_004513002.1| PREDICTED: uncharacterized protein LOC101500301 [Cicer arietinum]
Length=315

 Score =   270 bits (691),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 173/325 (53%), Positives = 227/325 (70%), Gaps = 22/325 (7%)
 Frame = +2

Query  236   LHTKSESDVTS----LAASSPSGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESP  403
             +H +++SDVTS    L++ SP   VYYVQSPS DSHDDGD  KS +MQP     SP+ SP
Sbjct  1     MHAQNDSDVTSFDPSLSSPSPKRTVYYVQSPSGDSHDDGD-NKSFTMQP-----SPMNSP  54

Query  404   SHPSLGRHSRTssgtrfsgifrsssgrk----grgkrmmsNDKGW--PECNVIMEEGKYD  565
             SH S   HSR SS +R SG + +++        +G R  ++DKGW   E  VI EE  Y 
Sbjct  55    SHQSYVHHSRASSSSRISGGYNNNNSNSFLGGKKGNRKRNDDKGWFEIESKVIEEESGYG  114

Query  566   ELED-SWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGS  742
             E  D    LSRR    +A  GF+L+F+VFC IIW A+  YK Q+++KSL+V N Y GEGS
Sbjct  115   EFYDGDKGLSRRTQFFIAFVGFVLVFSVFCFIIWVASLHYKPQLSVKSLTVHNFYFGEGS  174

Query  743   DFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSR  922
             D TGVPT++L+VN S+R+SV+NPATF+GI+VSS  +NL++S+ITVATG+LKKY+Q RKS 
Sbjct  175   DMTGVPTKMLTVNCSMRMSVHNPATFFGIYVSSKSVNLMYSEITVATGELKKYHQQRKSH  234

Query  923   RTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRR  1102
             RTVLVN+QG+KVPLYGAG+SL AT   +G    ++ + L  EVKS+G+VV KLVRT + R
Sbjct  235   RTVLVNLQGSKVPLYGAGASL-ATLADNG----KISMTLVVEVKSRGNVVWKLVRTKHTR  289

Query  1103  KIWCELIIDSAGNKPIKFKKDSCAY  1177
             ++ C + ID   NKPIK K++ C Y
Sbjct  290   RVSCSVAIDPHNNKPIKLKENDCRY  314



>ref|XP_006645672.1| PREDICTED: uncharacterized protein LOC102699360 [Oryza brachyantha]
Length=314

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 160/320 (50%), Positives = 214/320 (67%), Gaps = 20/320 (6%)
 Frame = +2

Query  248   SESDVTSLAASSPS-----GHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFT-SPVESPSH  409
             SESD+TSLA SSPS     G  YYVQSPSRDSHDDGD  KS+S Q TP +  SP++SPSH
Sbjct  6     SESDMTSLATSSPSRSPKAGPAYYVQSPSRDSHDDGD--KSSSTQATPVYNNSPLDSPSH  63

Query  410   -PSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVI--MEEGKYDELEDS  580
               S GRHSR SS +RFSG  RS  G   R      N KGW + + I   EEG YDE +D 
Sbjct  64    HSSFGRHSRVSSASRFSGNLRSGGGGGRRRM----NAKGWRDVHAIDEEEEGVYDEFDDG  119

Query  581   WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
             +  SR           ++ FT+ CLIIWG AR YK  + +KSL+V N Y GEG+D TGVP
Sbjct  120   YEPSRCCVFAFRFSVLVVAFTLLCLIIWGIARHYKPDIIVKSLTVGNFYAGEGTDRTGVP  179

Query  761   TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVN  940
             T+L+++N SL+I+V+NP+T +GIHVSST I +++S+I +A GQL+K+YQ R S       
Sbjct  180   TKLVTMNSSLQINVHNPSTMFGIHVSSTSIRIMYSEIAIANGQLEKFYQPRSSHHVASAI  239

Query  941   IQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCEL  1120
             + G K+PLYGAG++L A  N  G     VPL LD  V+S+G V+GKLVR  + +++ C +
Sbjct  240   LHGEKIPLYGAGATL-ALSNSGGA----VPLTLDLAVRSRGYVIGKLVRVTHTKRVKCPV  294

Query  1121  IIDSAGNKPIKFKKDSCAYS  1180
             +IDS+ +KP++F + +C+Y+
Sbjct  295   VIDSSSSKPVRFTQSACSYT  314



>ref|XP_007013148.1| Uncharacterized protein TCM_037864 [Theobroma cacao]
 gb|EOY30767.1| Uncharacterized protein TCM_037864 [Theobroma cacao]
Length=299

 Score =   267 bits (682),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 157/283 (55%), Positives = 198/283 (70%), Gaps = 25/283 (9%)
 Frame = +2

Query  236   LHTKSESDVTSL----AASSPSGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESP  403
             +HTKSESD TS     +  SP   +YYVQSPSRDS D   G+KS SMQ TP   SP+ESP
Sbjct  1     MHTKSESDATSSVDPSSPRSPKRQLYYVQSPSRDSQD---GDKSASMQATPANNSPMESP  57

Query  404   SHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDEL---E  574
             S PS  RHSR SS T FSG  +    R         N+KGW ECNVI EEG Y E     
Sbjct  58    SDPSYSRHSRASSATCFSGSLKRERKR---------NEKGWTECNVIEEEGDYGEYFYGR  108

Query  575   DSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTG  754
             D  L +RR   L+ + GF+++F++FCLIIWGA+RPY+AQV  +SL+V N Y G+G+D TG
Sbjct  109   DKGL-TRRCQILMGVFGFVVVFSLFCLIIWGASRPYEAQVAFESLTVHNFYFGDGADITG  167

Query  755   VPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVL  934
             VP+++L++N S+ ++VYNPATF+GIHVSS P+NL++S+I VATGQLKKYYQ RKS RTV 
Sbjct  168   VPSKMLTLNCSVTMTVYNPATFFGIHVSSNPVNLMYSEIAVATGQLKKYYQPRKSHRTVF  227

Query  935   VNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQG  1063
               +QG KVPLYGAG+SL A+ +  G     VP+ L FEV+S+G
Sbjct  228   ATLQGDKVPLYGAGASLGASVDVGG-----VPMELIFEVRSRG  265



>ref|XP_004967420.1| PREDICTED: uncharacterized protein LOC101773256 [Setaria italica]
Length=318

 Score =   267 bits (682),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 156/325 (48%), Positives = 210/325 (65%), Gaps = 16/325 (5%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSP-------SGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFT-S  388
             M HT SESDVTS+A +SP           YYVQSPSRDSHDDGD  KS++   TP +  S
Sbjct  1     MKHTTSESDVTSMATTSPPRTPKTPKRPAYYVQSPSRDSHDDGD--KSSTTHTTPVYNNS  58

Query  389   PVESPSHPSLGRHSR-TssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYD  565
             P+ESPSHPS GRHSR +S+      +  SS G    G R     KGW E   I EEG YD
Sbjct  59    PLESPSHPSTGRHSRISSATRFSGTLRSSSPGSCRAGGRKRLASKGWREVAAIDEEGAYD  118

Query  566   ELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSD  745
             EL++   L R   A   L   LL FTV CLI+WGAAR YK  V ++SL+V N Y+GEG+D
Sbjct  119   ELDEEPELPRCCVAAFWLSVVLLAFTVICLIVWGAARHYKPSVVVRSLTVHNFYVGEGTD  178

Query  746   FTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRR  925
              TGVPT+L+++N SL+I+V+NP+T +G+HVSS+ I L++S+I +A G L K+YQ R S R
Sbjct  179   RTGVPTKLVTLNCSLKINVHNPSTMFGVHVSSSSIRLMYSEIEIANGHLDKFYQPRTSHR  238

Query  926   TVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRK  1105
                  + G K PLYGAG++L A  N  G    +VPL L   V+++G V+GKLVR  + R+
Sbjct  239   VASAILHGEKTPLYGAGATL-APANAGG----RVPLTLQLAVRTRGYVMGKLVRVTHARR  293

Query  1106  IWCELIIDSAGNKPIKFKKDSCAYS  1180
             + C + ID   +KP++ ++ +C+++
Sbjct  294   VRCPVAIDPGSSKPVRIRQSACSHT  318



>gb|ACF82685.1| unknown [Zea mays]
Length=329

 Score =   267 bits (682),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 162/332 (49%), Positives = 211/332 (64%), Gaps = 25/332 (8%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSP---------------SGHVYYVQSPSRDSHDDGDGE-KSTSM  364
             M+H KSESDVTSLAASSP                G  YYVQSPSR+SHD G G  KS+SM
Sbjct  1     MMHAKSESDVTSLAASSPPRSPKRGVAAAGTGGGGGGYYVQSPSRESHDGGGGGYKSSSM  60

Query  365   QPTPTFTSPVESPSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVI  544
             Q TP + +                 S +     F       G G R + NDKGWPEC+VI
Sbjct  61    QATPVYNNSPSESPSHPS---YGRHSRSSSVSRFSGGLRGGGGGGRKVLNDKGWPECSVI  117

Query  545   MEEGKYDELE--DSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVS  718
              EEG Y+ L   DS L SRR   +L    F+LLFTVFCL+IWGAARPY+ +V +KSL + 
Sbjct  118   EEEGPYEGLGAGDSGL-SRRCQIVLGFLTFVLLFTVFCLVIWGAARPYEPEVVVKSLVMD  176

Query  719   NIYIGEGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKK  898
             + Y GEG+D +GVPT+L++ N SL +SVYNPAT +GIHV+S PI L++S+I++A GQ+++
Sbjct  177   DFYAGEGTDHSGVPTKLVTTNCSLHVSVYNPATMFGIHVTSGPIRLIYSEISIAVGQVRR  236

Query  899   YYQSRKSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGK  1078
             YYQ RKS RTV   I G KVPLYGAG  L  + +    GG  VPL LDF++ S+G V+G+
Sbjct  237   YYQPRKSHRTVTAVIHGEKVPLYGAGGGLTLSTS---AGGGAVPLTLDFDLTSRGYVIGR  293

Query  1079  LVRTDYRRKIWCELIIDSAGNKPIKFKKDSCA  1174
             LVR  +R  + C +++D+   KP++F K +CA
Sbjct  294   LVRVTHRAHVTCPVVVDARRTKPVRFSKKACA  325



>ref|XP_003620624.1| hypothetical protein MTR_6g087880 [Medicago truncatula]
 gb|AES76842.1| late embryogenesis abundant protein [Medicago truncatula]
Length=307

 Score =   265 bits (676),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 163/320 (51%), Positives = 222/320 (69%), Gaps = 19/320 (6%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGHV---YYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESPS  406
             +H K++SDVTS   SSP       YYVQSPSR+S  DGD  KS++MQP     SP++SPS
Sbjct  1     MHIKTDSDVTSFDPSSPRSQKQTPYYVQSPSRESSHDGD--KSSTMQP-----SPMDSPS  53

Query  407   HPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDSWL  586
             H S G HSR SS +R SG + SS   +   +++  NDKGW    VI EE       D   
Sbjct  54    HQSYGHHSRASSSSRISGGYNSSFLGRKVNRKV--NDKGWIGSKVIEEENGGYGDFDGDG  111

Query  587   --LSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
               +SRR    +A+ GF+L+F++FC IIW A+  YK Q+++KSL+V N Y GEGSD TGVP
Sbjct  112   NGVSRRVQFFVAVVGFVLVFSLFCFIIWAASLHYKPQLSVKSLTVHNFYFGEGSDVTGVP  171

Query  761   TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVN  940
             T++L+VN S+R+ V+NPATF+GI+VSS  +NL++SD+TVATG+LKKY+Q RKSRRTV VN
Sbjct  172   TKMLTVNCSMRMLVHNPATFFGIYVSSKSVNLMYSDLTVATGELKKYHQQRKSRRTVSVN  231

Query  941   IQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCEL  1120
             IQG+KVPLYGAG+ + ++ +       ++ L L FEVKS+G+VVGKLVRT + +++ C +
Sbjct  232   IQGSKVPLYGAGADVASSVDNG-----KISLTLVFEVKSRGNVVGKLVRTKHTQRVSCSI  286

Query  1121  IIDSAGNKPIKFKKDSCAYS  1180
              +D   NK IK K++ C Y+
Sbjct  287   AVDPHNNKYIKLKENECRYN  306



>gb|ACG35435.1| harpin-induced protein [Zea mays]
Length=329

 Score =   264 bits (675),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 160/332 (48%), Positives = 210/332 (63%), Gaps = 25/332 (8%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSP--------------SGHVYYVQSPSRDSHDDGDGE--KSTSM  364
             M+HTKSESDVTSLAASSP               G  YYVQSPSR+SHD G G   KS+SM
Sbjct  1     MMHTKSESDVTSLAASSPPRSPKXGVAXXGTGGGGGYYVQSPSRESHDGGGGGGYKSSSM  60

Query  365   QPTPTFTSPVESPSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVI  544
             Q TP + +                 S +     F         G R + N KGWPEC+VI
Sbjct  61    QATPVYNNSPSESPSHPS---YGRHSRSSSVSRFSGGLRGAXXGGRKVLNXKGWPECSVI  117

Query  545   MEEGKYDELE--DSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVS  718
               EG Y+ L   DS L SRR   +L    F+LLFTVFCL+IWGAARPY+ +V +KSL + 
Sbjct  118   EXEGPYEGLGAGDSGL-SRRCQIVLGFLTFVLLFTVFCLVIWGAARPYEPEVVVKSLVMD  176

Query  719   NIYIGEGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKK  898
             + Y GEG+D +GVPT+L++ N SL +SVYNPAT +GIHV+S PI L++S+I++A GQ+++
Sbjct  177   DFYAGEGTDHSGVPTKLVTTNCSLHVSVYNPATMFGIHVTSGPIRLIYSEISIAVGQVRR  236

Query  899   YYQSRKSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGK  1078
             YYQ RKS+RTV   I G KVPLYGAG  L  + +    GG  VPL LDF++ S+G V+G+
Sbjct  237   YYQPRKSQRTVTAVIHGEKVPLYGAGGGLTLSTS---AGGGAVPLTLDFDLTSRGYVIGR  293

Query  1079  LVRTDYRRKIWCELIIDSAGNKPIKFKKDSCA  1174
             LVR  +R  + C +++D+   KP++F K +CA
Sbjct  294   LVRVTHRAHVTCPVVVDARRTKPVRFSKKACA  325



>ref|XP_003528931.1| PREDICTED: uncharacterized protein LOC100793619 [Glycine max]
Length=308

 Score =   262 bits (669),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 160/318 (50%), Positives = 216/318 (68%), Gaps = 12/318 (4%)
 Frame = +2

Query  233   MLHTKSESDVTSL-AASSPSGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESPSH  409
             M H K++SDVTS+  +SSP   VYYVQSPSRDSHD GD + ST+   TP   SPV+SPSH
Sbjct  1     MAHAKTDSDVTSMDTSSSPKRAVYYVQSPSRDSHD-GD-KSSTATHATPACNSPVDSPSH  58

Query  410   PSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWP-ECNVIMEEGKYDELEDSWL  586
              S G HSR SS +R SG   + +    +  R   N  GWP EC VI EE +    E    
Sbjct  59    HSYGHHSRASSSSRVSGGSYNIASWGRKVTRK--NKLGWPHECKVIEEEEEGYYGERQGF  116

Query  587   LSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPTR  766
              SR+    + + GF  +FT+FC II  AARPY  ++++KS +V N   GEGSD TGVPT+
Sbjct  117   -SRKTQIFVGVLGFAFIFTLFCFIIAAAARPYNVRISVKSFTVHNFLFGEGSDMTGVPTK  175

Query  767   LLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNIQ  946
             +L+VN S R++V+NPATF+GIHVSS  +NL++S++TVATG+LKK+Y SRKS RTV VN+Q
Sbjct  176   MLTVNCSARMTVHNPATFFGIHVSSKAVNLMYSEMTVATGELKKHYLSRKSTRTVSVNLQ  235

Query  947   GTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELII  1126
             G+KV LYGA +SL    +       ++P+ L FEV S G++VG+LVR+ +RR++ C + I
Sbjct  236   GSKVSLYGADASLTGLVDNG-----KIPMTLVFEVGSLGNIVGRLVRSKHRRRVSCSVAI  290

Query  1127  DSAGNKPIKFKKDSCAYS  1180
             DS   +PIK K+++C Y+
Sbjct  291   DSHNIEPIKLKENACTYN  308



>ref|XP_010487458.1| PREDICTED: uncharacterized protein LOC104765445 isoform X2 [Camelina 
sativa]
Length=307

 Score =   261 bits (666),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 170/324 (52%), Positives = 227/324 (70%), Gaps = 29/324 (9%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH------VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPV  394
             ML TKSESDVTSLAASS S        VYYVQSPSRDS        ++ +QP     SP+
Sbjct  1     MLSTKSESDVTSLAASSSSLSRSSKRIVYYVQSPSRDS-------STSVIQP-----SPM  48

Query  395   ESPSH--PSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDE  568
             +SP+H   SLG H+R SS +RFSG+ RSSS  +   ++ MSN+K   EC VI+EEG YDE
Sbjct  49    DSPTHDSSSLGSHARNSSASRFSGLLRSSSSGRKSVRKCMSNEK---ECKVILEEGSYDE  105

Query  569   LEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDF  748
             ++D   + R+  ALLA+   ++LFT  C I WGA+RPYKAQ+++K+  + N Y+GEGSDF
Sbjct  106   VDDVTSI-RKCQALLAVFALVVLFTFLCFITWGASRPYKAQISVKTFELHNFYVGEGSDF  164

Query  749   TGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRT  928
             +GV T +L++NG+LRIS+YNPA  +G+HVSSTPINL F ++ +ATGQL+++YQ RKSR  
Sbjct  165   SGVRTTVLTINGTLRISIYNPAPVFGVHVSSTPINLFFYELPIATGQLEEHYQRRKSRIM  224

Query  929   VLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKI  1108
               V I+G +VPLYGAG+SL AT+      G ++P+ L FEV+S+ DVVGKLVR  + ++I
Sbjct  225   ESVVIEGRRVPLYGAGASLEATER-----GGKIPVKLRFEVQSRSDVVGKLVRIWHTKRI  279

Query  1109  WCELIIDSAGNKPIKFKKDSCAYS  1180
              C  +ID A NKPI   + SC Y+
Sbjct  280   SCTFVIDVASNKPIPLNQSSCRYT  303



>ref|XP_009624499.1| PREDICTED: uncharacterized protein LOC104115537 isoform X1 [Nicotiana 
tomentosiformis]
Length=303

 Score =   259 bits (661),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 157/319 (49%), Positives = 210/319 (66%), Gaps = 22/319 (7%)
 Frame = +2

Query  233   MLHTKSESD----VTSLAASSPSGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             M++++ ESD     TS + +SP   VYYVQSPSRDSHDD D + S+SMQ TP + SP++S
Sbjct  2     MMNSRDESDNASTATSSSLTSPKLPVYYVQSPSRDSHDDAD-KSSSSMQNTPAYHSPIDS  60

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDS  580
                        + S    S    S + R  RG     + KGW EC VI E+  YD +  +
Sbjct  61    ----------PSHSSRDSSSSRLSGNWRWARGYNRRRSGKGWQECAVIEEDLDYDHMNQA  110

Query  581   WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
             +  SRR    +AL GF   F  FCLI+WGA+RPY+  +++K+  V N Y G+GSD TGVP
Sbjct  111   Y--SRRCLFFIALMGFGAFFAFFCLILWGASRPYQPHISMKACRVHNFYFGQGSDRTGVP  168

Query  761   TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVN  940
             T+LL+VN S+ + +YNPATF+G+HVSS P+NL FS+ITVATGQL +YYQ +KS+R++ VN
Sbjct  169   TKLLTVNCSVTMVIYNPATFFGVHVSSNPVNLFFSEITVATGQLDEYYQPKKSQRSMSVN  228

Query  941   IQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCEL  1120
             + G +VPLYGAG +L  +   DG     VPL LDFE+ SQG +VGKLV+T +R+ I C L
Sbjct  229   LDGCRVPLYGAGIALVKSDGSDG-----VPLKLDFEILSQGYLVGKLVKTKHRKHISCSL  283

Query  1121  IIDSAGNKPIKFKKDSCAY  1177
             +I S   K IKFK+ SCA+
Sbjct  284   LISSRSTKEIKFKQGSCAF  302



>ref|XP_002885125.1| hypothetical protein ARALYDRAFT_897912 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61384.1| hypothetical protein ARALYDRAFT_897912 [Arabidopsis lyrata subsp. 
lyrata]
Length=304

 Score =   257 bits (656),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 161/298 (54%), Positives = 212/298 (71%), Gaps = 25/298 (8%)
 Frame = +2

Query  299   YYVQSPSRDSHDDGDGEKSTSM-QPTPTFTSPVESPSH--PSLGRHSRTssgtrfsgifr  469
             YYVQSPSRD       + STS+ QP     SP++SP+H   SLGRHSR SS +RFSG   
Sbjct  28    YYVQSPSRD-------DSSTSIIQP-----SPMDSPTHDSSSLGRHSRNSSASRFSGFRS  75

Query  470   sssgrkgrgkrmmsNDKGWPECNVIMEEGK-YDELEDSWLLSRRFHallalcgflllfTV  646
             SSSGRK   K   SN++   EC VI+EEG  YDE+ D+  + RR  ALLA+   ++LF  
Sbjct  76    SSSGRKNGRKWRKSNEQ---ECKVILEEGSSYDEMVDATCI-RRCQALLAVFTLVVLFIF  131

Query  647   FCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPTRLLSVNGSLRISVYNPATFYG  826
             FC I+WGA+RPYKAQ+++++  + N Y+GEGSDF+GV T+++++NG+LRI +YNPA  +G
Sbjct  132   FCFIVWGASRPYKAQISVQTFELHNFYVGEGSDFSGVSTKVVTLNGTLRIRIYNPAPVFG  191

Query  827   IHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNIQGTKVPLYGAGSSLPATKNKD  1006
             +HVSSTPINL F  + VATGQLK+YYQ +KS+ T  V I+G +VPLYGAG+SL AT+   
Sbjct  192   VHVSSTPINLFFYQLPVATGQLKEYYQLKKSQETESVVIEGRRVPLYGAGASLEATER--  249

Query  1007  GTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELIIDSAGNKPIKFKKDSCAYS  1180
                G ++P+ L FEV+S+GDVVGKLVR  + ++I C  +ID A NKPI F K SC YS
Sbjct  250   ---GGKIPVKLRFEVQSRGDVVGKLVRIWHTKRISCTFVIDVASNKPIPFNKSSCRYS  304



>ref|XP_010487457.1| PREDICTED: uncharacterized protein LOC104765445 isoform X1 [Camelina 
sativa]
Length=308

 Score =   256 bits (655),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 170/325 (52%), Positives = 227/325 (70%), Gaps = 30/325 (9%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH------VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPV  394
             ML TKSESDVTSLAASS S        VYYVQSPSRDS        ++ +QP     SP+
Sbjct  1     MLSTKSESDVTSLAASSSSLSRSSKRIVYYVQSPSRDS-------STSVIQP-----SPM  48

Query  395   ESPSH--PSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDE  568
             +SP+H   SLG H+R SS +RFSG+ RSSS  +   ++ MSN+K   EC VI+EEG YDE
Sbjct  49    DSPTHDSSSLGSHARNSSASRFSGLLRSSSSGRKSVRKCMSNEK---ECKVILEEGSYDE  105

Query  569   LEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDF  748
             ++D   + R+  ALLA+   ++LFT  C I WGA+RPYKAQ+++K+  + N Y+GEGSDF
Sbjct  106   VDDVTSI-RKCQALLAVFALVVLFTFLCFITWGASRPYKAQISVKTFELHNFYVGEGSDF  164

Query  749   TGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATG-QLKKYYQSRKSRR  925
             +GV T +L++NG+LRIS+YNPA  +G+HVSSTPINL F ++ +ATG QL+++YQ RKSR 
Sbjct  165   SGVRTTVLTINGTLRISIYNPAPVFGVHVSSTPINLFFYELPIATGQQLEEHYQRRKSRI  224

Query  926   TVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRK  1105
                V I+G +VPLYGAG+SL AT+      G ++P+ L FEV+S+ DVVGKLVR  + ++
Sbjct  225   MESVVIEGRRVPLYGAGASLEATER-----GGKIPVKLRFEVQSRSDVVGKLVRIWHTKR  279

Query  1106  IWCELIIDSAGNKPIKFKKDSCAYS  1180
             I C  +ID A NKPI   + SC Y+
Sbjct  280   ISCTFVIDVASNKPIPLNQSSCRYT  304



>gb|AFK36620.1| unknown [Lotus japonicus]
Length=193

 Score =   251 bits (641),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 149/176 (85%), Gaps = 4/176 (2%)
 Frame = +2

Query  650   CLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPTRLLSVNGSLRISVYNPATFYGI  829
             CLIIWGA+RP+KA+V +KSL+V N+YIGEGSDFTGVPT++L+VN +LR+S+YNPATF+GI
Sbjct  21    CLIIWGASRPFKAEVAVKSLTVHNLYIGEGSDFTGVPTKILTVNSTLRMSIYNPATFFGI  80

Query  830   HVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNIQGTKVPLYGAGSSLPATKNKDG  1009
             HV STPINLVFSDI+VATG+LKKYYQ RKS R V VN+ G KVPLYGAGS++  ++    
Sbjct  81    HVHSTPINLVFSDISVATGELKKYYQPRKSHRMVSVNLVGKKVPLYGAGSTITESQ----  136

Query  1010  TGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELIIDSAGNKPIKFKKDSCAY  1177
             TG V V L L FE+ S+G+VVGKLVRT + ++I C L+IDS+G+KPIKFKK+SC Y
Sbjct  137   TGVVVVSLKLKFEIVSRGNVVGKLVRTKHHKEITCPLVIDSSGSKPIKFKKNSCTY  192



>ref|XP_009793474.1| PREDICTED: uncharacterized protein LOC104240342 [Nicotiana sylvestris]
 ref|XP_009793475.1| PREDICTED: uncharacterized protein LOC104240342 [Nicotiana sylvestris]
Length=305

 Score =   251 bits (641),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 157/319 (49%), Positives = 213/319 (67%), Gaps = 22/319 (7%)
 Frame = +2

Query  233   MLHTKSESD----VTSLAASSPSGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             M++++ ESD     TS + +SP   VYYVQSPSRDSHDD D + S+SMQ TP + SP++S
Sbjct  4     MMNSRDESDNASTATSSSLTSPKLPVYYVQSPSRDSHDDVD-KSSSSMQNTPAYHSPIDS  62

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDS  580
                        + S    S    S + R  RG     + KGW EC VI E+  YD +  +
Sbjct  63    ----------PSYSSRDSSSSRLSGNWRWARGYNRRRSGKGWQECAVIEEDLDYDHINQA  112

Query  581   WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
             +  SRR   L+AL  F   F  FC I+WGA+RPY+  +T+K+  V N Y G+GSD TGVP
Sbjct  113   Y--SRRCLFLIALMAFGAFFAFFCFILWGASRPYQPHITMKAFRVHNFYFGQGSDRTGVP  170

Query  761   TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVN  940
             T+LL+VN S+ ++++NPATF+GIHVSS P+NL FS+ITVATGQL +YYQ +KS+R++ +N
Sbjct  171   TKLLTVNCSVTMAIHNPATFFGIHVSSNPVNLFFSEITVATGQLDEYYQPKKSQRSMSMN  230

Query  941   IQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCEL  1120
             + G +VPLYGAG +L  +   DG+ G  VPL LDFE+ S+G +VGKLV+T +R+ I C L
Sbjct  231   LDGCRVPLYGAGIALVKS---DGSEG--VPLKLDFEILSKGYLVGKLVKTKHRKHISCSL  285

Query  1121  IIDSAGNKPIKFKKDSCAY  1177
             +I S   K IKFK+DSCA+
Sbjct  286   LISSRSTKEIKFKQDSCAF  304



>gb|EEC70230.1| hypothetical protein OsI_01000 [Oryza sativa Indica Group]
Length=325

 Score =   251 bits (640),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 163/338 (48%), Positives = 212/338 (63%), Gaps = 35/338 (10%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPS-----GHVYYVQ-SPSRDSHDDGDGEKSTSMQPTPTFT-SP  391
             M    SESD+TSLA SSPS        YYVQ SPSRDSHDDGD  KS S Q TP +  SP
Sbjct  1     MKPATSESDMTSLATSSPSRSPKAAAAYYVQISPSRDSHDDGD--KSPSTQATPVYNNSP  58

Query  392   VESPSH--PSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIM---EEG  556
             ++SPSH   S GRHSR SS +RFSG  RS+S R   G R     KGW + + I+   EEG
Sbjct  59    LDSPSHHSSSFGRHSRVSSASRFSGNLRSASARSRPGGRRRLGAKGWRDVDAIIDEEEEG  118

Query  557   KYDELEDS----------WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKS  706
              YDE +D            +L+ RF          L FT+ CLI+WG AR YK  V +KS
Sbjct  119   AYDEFDDDDGGGYEPSRCCVLAFRF------SLLALAFTLVCLIVWGIARHYKPGVLVKS  172

Query  707   LSVSNIYIGEGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATG  886
             L+V N Y GEG D TGVPT+L+++N SL+I+V+NP+T +GIHVSST I ++FS I +A G
Sbjct  173   LTVGNFYAGEGIDRTGVPTKLVTMNCSLQINVHNPSTMFGIHVSSTSIQILFSQIAIANG  232

Query  887   QLKKYYQSRKSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGD  1066
             QL+K+YQ R S       + G K+PLYGAG +  A  N  G     VPL LD  V+++G 
Sbjct  233   QLEKFYQPRSSHHVASAIVHGEKIPLYGAGETF-ALSNAGGA----VPLTLDLVVRARGY  287

Query  1067  VVGKLVRTDYRRKIWCELIIDSAGNKPIKFKKDSCAYS  1180
             V+GKLVR  + +++ C ++IDS  +KPI+F + +C+Y+
Sbjct  288   VIGKLVRVTHTKRVKCPVVIDSGSSKPIRFTQSACSYT  325



>ref|XP_006298203.1| hypothetical protein CARUB_v10014254mg [Capsella rubella]
 gb|EOA31101.1| hypothetical protein CARUB_v10014254mg [Capsella rubella]
Length=304

 Score =   249 bits (635),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 167/323 (52%), Positives = 222/323 (69%), Gaps = 26/323 (8%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH------VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPV  394
             M  TKSESDVTSLAASS S         YYVQSPSRDS        ++ +QP+P   SP 
Sbjct  1     MPSTKSESDVTSLAASSSSPSRSSKRTFYYVQSPSRDS-------STSVVQPSP-MDSPT  52

Query  395   ESPSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEG-KYDEL  571
             +  S  SLGRHSR SS +RFSG+FRSSS  +    + M  +K   +C +I+EEG  YDE+
Sbjct  53    QDSS--SLGRHSRNSSASRFSGLFRSSSSGRKNSIKCMPKEK---QCKIILEEGGSYDEM  107

Query  572   EDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFT  751
             +D   + R+  ALLA+   ++LFT  C I WGA+RPYK Q+++K+  + N Y+GEGSD T
Sbjct  108   DDVTSI-RKCQALLAVFTLVVLFTFLCFIAWGASRPYKPQISVKTFELHNFYVGEGSDHT  166

Query  752   GVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTV  931
             GV T +L++NG+LRI +YNPA  +G+HVSSTPINL F ++ +ATGQLK++YQ++K+RRT 
Sbjct  167   GVRTTVLTINGTLRIGIYNPAPVFGVHVSSTPINLFFYELPIATGQLKEHYQTKKNRRTE  226

Query  932   LVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIW  1111
              V I+G +VPLYGAG+ L AT+      G ++P+ L FEVKS+GDVVGKLVR  + ++I 
Sbjct  227   SVVIEGRRVPLYGAGARLEATER-----GGKIPVELIFEVKSRGDVVGKLVRIWHTKRIS  281

Query  1112  CELIIDSAGNKPIKFKKDSCAYS  1180
             C  +I+ A N PI F K SC YS
Sbjct  282   CTFVINVASNNPIPFNKSSCRYS  304



>ref|XP_002284373.1| PREDICTED: uncharacterized protein LOC100257732 [Vitis vinifera]
 emb|CBI28061.3| unnamed protein product [Vitis vinifera]
Length=302

 Score =   248 bits (634),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 152/318 (48%), Positives = 206/318 (65%), Gaps = 20/318 (6%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH---VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESP  403
             M+H  S+SD TS + S P      +Y+VQSPSRDS+DD    KS+S+Q TP         
Sbjct  1     MMHATSDSDTTSRSPSPPRSPKRSMYFVQSPSRDSNDD---YKSSSIQATP---------  48

Query  404   SHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDSW  583
             S  S        S +R S    S+            N KGW EC VI+EE  YD+L    
Sbjct  49    SCSSPTDSPSHPSSSRHSRASSSTRFSGSLKGNRRKNGKGWRECKVIIEESDYDDLYYEK  108

Query  584   LLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPT  763
              L  R    LAL GF LLFT+FCL IWGA++PYK ++ + S +V N Y+GEG D TGVPT
Sbjct  109   GLLGRCRTFLALVGFALLFTIFCLGIWGASKPYKPEIKVMSFAVHNFYLGEGLDATGVPT  168

Query  764   RLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNI  943
             ++L+ N S+++SVYNPATF+GIHVSST +NL+++ IT A+GQ KKYYQ RKS+RT+LVN+
Sbjct  169   KMLTANCSMKMSVYNPATFFGIHVSSTSVNLMYAQITAASGQFKKYYQPRKSKRTLLVNL  228

Query  944   QGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELI  1123
             +G KVPLYGAG+SL      D  GG  VP+ L FEV+++G++VG+LVR+ + + I C ++
Sbjct  229   KGDKVPLYGAGASLAIA---DRNGG--VPMKLVFEVQTRGNLVGRLVRSKHGKHIACSVV  283

Query  1124  IDSAGNKPIKFKKDSCAY  1177
             IDS+  + +KF ++ C Y
Sbjct  284   IDSSNIRSMKFTENWCTY  301



>ref|XP_009800428.1| PREDICTED: uncharacterized protein LOC104246323 [Nicotiana sylvestris]
Length=161

 Score =   243 bits (620),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 139/161 (86%), Gaps = 4/161 (2%)
 Frame = +2

Query  695   TLKSLSVSNIYIGEGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDIT  874
             + +SL+V+N YIGEGSDF+GV T++++VNGSLRISVYNPATFYGIHVSSTPINL++SDIT
Sbjct  4     SFQSLAVNNFYIGEGSDFSGVVTKMMTVNGSLRISVYNPATFYGIHVSSTPINLIYSDIT  63

Query  875   VATGQLKKYYQSRKSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVK  1054
             VA+GQLKKYYQ RKSRRTVLVNI+ TK PLYGAGS L A+ N    GG +VPL LDFE++
Sbjct  64    VASGQLKKYYQPRKSRRTVLVNIESTKFPLYGAGSGLDASNN----GGFKVPLKLDFEIR  119

Query  1055  SQGDVVGKLVRTDYRRKIWCELIIDSAGNKPIKFKKDSCAY  1177
             S+GDVVGKLVRT  +R+I C+L+IDS   KPIKFKK+SC Y
Sbjct  120   SRGDVVGKLVRTKNKRQISCDLVIDSTSTKPIKFKKNSCVY  160



>gb|KHN45629.1| hypothetical protein glysoja_031500 [Glycine soja]
Length=314

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 146/327 (45%), Positives = 206/327 (63%), Gaps = 24/327 (7%)
 Frame = +2

Query  233   MLHTKSESDVTSL-AASSPSGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESPSH  409
             M H K++SDVTS+  +SSP   VYYVQSPSRDSHD GD + ST+   TP   SPV+SPSH
Sbjct  1     MAHAKTDSDVTSMDTSSSPKRAVYYVQSPSRDSHD-GD-KSSTATHATPACNSPVDSPSH  58

Query  410   PSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKG--------WP--ECNVIMEEGK  559
                  HS        S    S+            N+KG        W   +C VI +E +
Sbjct  59    -----HSYVHHSRASSSSRVSAGSYNNIASYWGRNNKGTRKNKLGSWTHDQCKVI-QEEE  112

Query  560   YDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEG  739
                 E      R+    + +  F  +FT+FC II G ARP+K ++++KS +V N   GEG
Sbjct  113   GYYGEREGFSRRKTQIFVGILAFAFIFTLFCFIIAGVARPHKVRISVKSFTVHNFLFGEG  172

Query  740   SDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKS  919
              D TGVPT++L+VN S+R++V+NPATF+GIHVSS  +NL++S++TVATG+LKK+Y  RKS
Sbjct  173   LDLTGVPTKMLTVNCSVRMTVHNPATFFGIHVSSKAVNLMYSEMTVATGELKKHYLPRKS  232

Query  920   RRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYR  1099
              R V +N+QG+KV LYGAG+SL    +       ++P+ L F+V+S+G++VGKLV + +R
Sbjct  233   TRIVSLNLQGSKVSLYGAGASLIGLVDNG-----KIPMTLVFDVRSRGNIVGKLVMSKHR  287

Query  1100  RKIWCELIIDSAGNKPIKFKKDSCAYS  1180
             R++ C + IDS   KPIK K+++C Y+
Sbjct  288   RRVSCSVAIDSHNIKPIKLKENACTYN  314



>ref|XP_003534207.1| PREDICTED: uncharacterized protein LOC100800719 [Glycine max]
Length=314

 Score =   244 bits (622),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 145/327 (44%), Positives = 205/327 (63%), Gaps = 24/327 (7%)
 Frame = +2

Query  233   MLHTKSESDVTSL-AASSPSGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESPSH  409
             M H K++SDVTS+  +SSP   VYYVQSPSRDSHD GD + ST+   TP   SPV+SPSH
Sbjct  1     MAHAKTDSDVTSMDTSSSPKRAVYYVQSPSRDSHD-GD-KSSTATHATPACNSPVDSPSH  58

Query  410   PSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKG--------WP--ECNVIMEEGK  559
                  HS        S    S+            N+KG        W   +C VI +E +
Sbjct  59    -----HSYVHHSRASSSSRVSAGSYNNIASYWGRNNKGTRKNKLGSWTHDQCKVI-QEEE  112

Query  560   YDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEG  739
                 E      R+    + +  F  +FT+FC II G ARP+K ++++KS +V N   GEG
Sbjct  113   GYYGEREGFSRRKTQIFVGILAFAFIFTLFCFIIAGVARPHKVRISVKSFTVHNFLFGEG  172

Query  740   SDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKS  919
              D TGVPT++L+VN S+R++V+NPATF+GIHVSS  +NL++S++TVATG+L K+Y  RKS
Sbjct  173   LDLTGVPTKMLTVNCSVRMTVHNPATFFGIHVSSKAVNLMYSEMTVATGELNKHYLPRKS  232

Query  920   RRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYR  1099
              R V +N+QG+KV LYGAG+SL    +       ++P+ L F+V+S+G++VGKLV + +R
Sbjct  233   TRIVSLNLQGSKVSLYGAGASLIGLVDNG-----KIPMTLVFDVRSRGNIVGKLVMSKHR  287

Query  1100  RKIWCELIIDSAGNKPIKFKKDSCAYS  1180
             R++ C + IDS   KPIK K+++C Y+
Sbjct  288   RRVSCSVAIDSHNIKPIKLKENACTYN  314



>emb|CDM82381.1| unnamed protein product [Triticum aestivum]
Length=314

 Score =   244 bits (622),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 154/322 (48%), Positives = 203/322 (63%), Gaps = 14/322 (4%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             M HT S+SDVTSLA +SPS       YYV SPSRDS DDGD  KS+S Q TP + SP++S
Sbjct  1     MKHTTSDSDVTSLATTSPSRSPKRAAYYVVSPSRDSRDDGD--KSSSTQATPVYNSPLDS  58

Query  401   PSH-PSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDE-LE  574
             PSH  S+G HSR SS +RFSG            KR   + KGW E +VI EE   D  +E
Sbjct  59    PSHHSSIGPHSRASSASRFSGNLTGGGRAAANRKRPHGHGKGWHEVDVIDEEDAEDAGVE  118

Query  575   DSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTG  754
                 LSR   A       +L FT+ CL++WGAAR  K  V +KSL V N Y GEG+D TG
Sbjct  119   QERELSRSCVAAFWFSVLVLAFTLVCLVVWGAARRDKPSVLVKSLRVENFYAGEGTDGTG  178

Query  755   VPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVL  934
             VPT+ +++N SL I V+NP+T  GIHVSST I L +S I +A+GQL+K+YQ +KSR    
Sbjct  179   VPTKFVTMNCSLEIDVHNPSTMSGIHVSSTSIQLYYSQIPIASGQLEKFYQPKKSRHVAS  238

Query  935   VNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWC  1114
             V + G K PLYGAG++   T N DG     VPL +D  V+++G V+G+LVR  + +++ C
Sbjct  239   VTLHGEKTPLYGAGATFVLT-NTDG-----VPLTVDLAVRTRGYVIGRLVRVTHAKRVRC  292

Query  1115  ELIIDSAGNKPIKFKKDSCAYS  1180
              +++ S  +KPI   + +C+YS
Sbjct  293   PVLVSSLTDKPIMIAQTACSYS  314



>ref|XP_006406876.1| hypothetical protein EUTSA_v10021190mg [Eutrema salsugineum]
 gb|ESQ48329.1| hypothetical protein EUTSA_v10021190mg [Eutrema salsugineum]
Length=309

 Score =   243 bits (621),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 163/325 (50%), Positives = 218/325 (67%), Gaps = 25/325 (8%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH------VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPV  394
             ML TKSESD+TSLAASS S        +YYV SPSRDS        STS+ P+    SP 
Sbjct  1     MLSTKSESDITSLAASSSSPSRSSKRALYYVHSPSRDS--------STSVHPSSMMDSPT  52

Query  395   ESPSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEG--KYDE  568
                S  S GRH R SS +RFSG+ RSSS  +  G+  M ++K W EC +I+EE    +DE
Sbjct  53    HESS--SFGRHYRNSSASRFSGMSRSSSSERKNGRNFMFSEKEWHECKIILEEDTDAFDE  110

Query  569   LEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDF  748
             ++D   + RR  ALLA+   LL+FTV   I+WG ++PYK Q+++++  + N Y G G+DF
Sbjct  111   MDDMTSI-RRCQALLAVLTLLLIFTVLLCIVWGVSKPYKTQISVQTFELHNFYDGHGTDF  169

Query  749   TGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRT  928
             +GVPT++L+ NG+LR  +YNPA+ +G+H+S TPINL FS++ +ATGQLK +YQS+KSR+ 
Sbjct  170   SGVPTKVLTSNGTLRFRIYNPASIFGVHLSFTPINLFFSELPIATGQLKNHYQSKKSRKM  229

Query  929   VLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKI  1108
               V I+G  VPLYGAG+SL AT+      G ++P+ L FEV+S+GDVVGKLVR  + R+I
Sbjct  230   ESVVIEGRNVPLYGAGASLEATER-----GGKIPVKLRFEVQSRGDVVGKLVRIWHTRRI  284

Query  1109  WCELIIDSA-GNKPIKFKKDSCAYS  1180
              C  +ID A   KPI FK  SC YS
Sbjct  285   SCTFVIDVAITTKPIPFKDGSCNYS  309



>emb|CDP03322.1| unnamed protein product [Coffea canephora]
Length=312

 Score =   242 bits (618),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 144/326 (44%), Positives = 206/326 (63%), Gaps = 24/326 (7%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH-----VYYVQSPSRDSHDDGDGEKST-SMQPTPTF---T  385
             M+H KSESD  +L+  S         VYYVQSPS DSHDD D   +T S Q TP +   +
Sbjct  1     MIHAKSESDFATLSPPSSYPASPKPPVYYVQSPSLDSHDDADKASATASCQATPAYNSSS  60

Query  386   SPVESPSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYD  565
             SP+ESP   + GR S   S +           R  R +    + KGW EC+++ EEG YD
Sbjct  61    SPMESPRTSTYGRQSNPRSSSASRVSGNWRWPRISRKR----SGKGWQECSLVEEEGVYD  116

Query  566   -ELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGS  742
                ED     +R   L A  G  ++FT  C+IIW A+RPY+ Q+T+KSL V N Y+G+GS
Sbjct  117   GSHEDD---EKRSPLLAAFVGVAVVFTACCVIIWAASRPYRPQITMKSLRVHNFYLGQGS  173

Query  743   DFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSR  922
             D TGVPT+LL+VN +  +S+ NPATF+GI+V S  ++L++ ++TVATG+LK+YYQ R S 
Sbjct  174   DRTGVPTKLLTVNCTATMSIRNPATFFGIYVGSKMVDLMYFEMTVATGELKRYYQPRTSS  233

Query  923   RTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRR  1102
             RT+ VN+ G  +PLYGAG++L    + D T   +VPL L+ E++S G +VGKLV+T Y++
Sbjct  234   RTISVNLDGRSIPLYGAGATL----DDDDT---EVPLKLNMEIQSLGYLVGKLVKTKYQK  286

Query  1103  KIWCELIIDSAGNKPIKFKKDSCAYS  1180
             ++ C ++ ++   + IKF  DSC ++
Sbjct  287   RVSCSMVFNTERMEEIKFHPDSCIFN  312



>gb|EMT30475.1| hypothetical protein F775_16987 [Aegilops tauschii]
Length=314

 Score =   241 bits (616),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 151/322 (47%), Positives = 203/322 (63%), Gaps = 14/322 (4%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             M HT S+SDVTSLA +SPS       YYV SPSRDS DDGD  KS+S Q TP + SP++S
Sbjct  1     MKHTTSDSDVTSLATTSPSRSPKRAAYYVVSPSRDSRDDGD--KSSSTQATPVYNSPLDS  58

Query  401   PSH-PSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDE-LE  574
             PSH  S+G HSR SS +RFSG            KR   + KGW E +VI EE   D  ++
Sbjct  59    PSHQSSIGPHSRASSASRFSGNLTGGGRAAATRKRPHGHGKGWHEVDVIDEEDAEDAGVD  118

Query  575   DSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTG  754
                 LSR   A       +L FT+ CL++WGAAR  K  V +KSL V N Y GEG+D TG
Sbjct  119   QERELSRSCAAAFWFSVLVLAFTLVCLVVWGAARRDKPSVLVKSLRVENFYAGEGTDGTG  178

Query  755   VPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVL  934
             VPT+ +++N SL I V+NP+T +GIHVSST I L +S I +A+GQL K+YQ +KSR    
Sbjct  179   VPTKFVTMNCSLEIDVHNPSTMFGIHVSSTSIQLYYSQIPIASGQLDKFYQPKKSRHVAS  238

Query  935   VNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWC  1114
             V + G K PLYGAG++   T + DG     VPL +D  V+++G V+G+LVR  + +++ C
Sbjct  239   VTLHGEKTPLYGAGATFVLT-DTDG-----VPLTVDLAVRTRGYVIGRLVRVTHAKRVRC  292

Query  1115  ELIIDSAGNKPIKFKKDSCAYS  1180
              +++ S  ++PI   + +C+YS
Sbjct  293   PVLVSSLTDRPIMIAQTACSYS  314



>ref|XP_003565917.1| PREDICTED: uncharacterized protein LOC100834094 [Brachypodium 
distachyon]
Length=326

 Score =   241 bits (616),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 152/338 (45%), Positives = 204/338 (60%), Gaps = 34/338 (10%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPS--------GHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTS  388
             M HT S+SDVTSLA +SPS        G  YYV SPSRDS +      S+S Q TP + S
Sbjct  1     MKHTTSDSDVTSLATTSPSRSPKRGSGGAAYYVVSPSRDSRE------SSSTQATPVYNS  54

Query  389   PVESPSHPS-LGRHS------------RTssgtrfsgifrsssgrkgrgkrmmsNDKGWP  529
             P+ESPSH S LG HS            R+ S    SG    S    GR +   ++ KGW 
Sbjct  55    PLESPSHQSSLGPHSRASSASRFSGVLRSPSAGSGSGSGPGSKPPTGRKRPRRAHGKGWH  114

Query  530   ECNVIME-EGKYDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKS  706
             E +VI E +G+Y EL+D   LSRR  A +     ++ FT+ CL++WG AR +K  V +KS
Sbjct  115   EVDVIDEGDGEYGELDDDQELSRRCLAAIWFSVLVVAFTLACLVVWGVARRHKPIVLVKS  174

Query  707   LSVSNIYIGEGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATG  886
             L V N Y GEG D TGVPT+L++VN SL+I V NP+T +GIHVSST I L+FS I +A G
Sbjct  175   LMVENFYAGEGVDRTGVPTKLVTVNCSLKIDVENPSTMFGIHVSSTSIQLIFSQIPIANG  234

Query  887   QLKKYYQSRKSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGD  1066
             QL+K+YQ + SR    V + G K PLYGAG++   T +        VPL LD  V+++G 
Sbjct  235   QLEKFYQPKASRHAAAVTLHGEKTPLYGAGATFGLTGDAGA-----VPLTLDLAVRTRGY  289

Query  1067  VVGKLVRTDYRRKIWCELIIDSAGNKPIKFKKDSCAYS  1180
             V+G LVR  + R+  C +++   G++PIKF + +C+Y+
Sbjct  290   VIGNLVRVTHTRRARCPVVV-RGGDQPIKFAQSACSYT  326



>ref|NP_001042478.1| Os01g0228500 [Oryza sativa Japonica Group]
 dbj|BAD82414.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF04392.1| Os01g0228500 [Oryza sativa Japonica Group]
 dbj|BAG99720.1| unnamed protein product [Oryza sativa Japonica Group]
Length=330

 Score =   237 bits (604),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 158/337 (47%), Positives = 206/337 (61%), Gaps = 38/337 (11%)
 Frame = +2

Query  248   SESDVTSLAASSPS------GHVYYVQ-SPSRDSHDDGDGEKSTSMQPTPTFT-SPVESP  403
             SESD+TSLA SSPS         YYVQ SPSRDSHDD DG+KS S Q TP +  SP++SP
Sbjct  6     SESDMTSLATSSPSRSPKAAAAAYYVQISPSRDSHDD-DGDKSPSTQATPVYNNSPLDSP  64

Query  404   SH--PSLGRHSRTssgtrfs---gifrsssgrkgrgkrmmsNDKGWPECNVIM---EEGK  559
             SH   S GRHSR SS +RFS         S   G G R     KGW + + I+   EEG 
Sbjct  65    SHHSSSFGRHSRVSSASRFSGNLRSASGRSRLGGGGGRRRLGAKGWRDVDAIIDEEEEGA  124

Query  560   YDEL----------EDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSL  709
             YDE               +L+ RF          L FT+ CLI+WG AR YK  V +KSL
Sbjct  125   YDEFDDDDDGGYEPSRCCVLAFRF------SLLALAFTLVCLIVWGIARHYKPGVLVKSL  178

Query  710   SVSNIYIGEGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQ  889
             +V N Y GEG D TGVPT+L+++N SL+I+V+NP+T +GIHVSST I ++FS I +A GQ
Sbjct  179   TVGNFYAGEGIDRTGVPTKLVTMNCSLQINVHNPSTMFGIHVSSTSIQILFSQIAIANGQ  238

Query  890   LKKYYQSRKSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDV  1069
             L+K+YQ R S       + G K+PLYGAG +  A  N  G     VPL LD  V+++G V
Sbjct  239   LEKFYQPRSSHHVASAIVHGEKIPLYGAGETF-ALSNAGGA----VPLTLDLVVRARGYV  293

Query  1070  VGKLVRTDYRRKIWCELIIDSAGNKPIKFKKDSCAYS  1180
             +GKLVR  + +++ C ++IDS  +KPI+F + +C+Y+
Sbjct  294   IGKLVRVTHTKRVKCPVVIDSGSSKPIRFIQSACSYT  330



>gb|AFW85694.1| hypothetical protein ZEAMMB73_163634 [Zea mays]
Length=314

 Score =   236 bits (603),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 120/223 (54%), Positives = 162/223 (73%), Gaps = 6/223 (3%)
 Frame = +2

Query  512   NDKGWPECNVIMEEGKYDELE--DSWLLSRRFHallalcgflllfTVFCLIIWGAARPYK  685
             NDKGWPEC+VI EEG Y+ L   DS L SRR   +L    F+LLFTVFCL+IWGAARPY+
Sbjct  92    NDKGWPECSVIEEEGPYEGLGAGDSGL-SRRCQIVLGFLTFVLLFTVFCLVIWGAARPYE  150

Query  686   AQVTLKSLSVSNIYIGEGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFS  865
              +V +KSL + + Y GEG+D +GVPT+L++ N SL +SVYNPAT +GIHV+S PI L++S
Sbjct  151   PEVVVKSLVMDDFYAGEGTDHSGVPTKLVTTNCSLHVSVYNPATMFGIHVTSGPIRLIYS  210

Query  866   DITVATGQLKKYYQSRKSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDF  1045
             +I++A GQ+++YYQ RKS RTV   I G KVPLYGAG  L  + +    GG  VPL LDF
Sbjct  211   EISIAVGQVRRYYQPRKSHRTVTAVIHGEKVPLYGAGGGLTLSTS---AGGGAVPLTLDF  267

Query  1046  EVKSQGDVVGKLVRTDYRRKIWCELIIDSAGNKPIKFKKDSCA  1174
             ++ S+G V+G+LVR  +R  + C +++D+   KP++F K +CA
Sbjct  268   DLTSRGYVIGRLVRVTHRAHVTCPVVVDARRTKPVRFSKKACA  310



>gb|EEE54160.1| hypothetical protein OsJ_00970 [Oryza sativa Japonica Group]
Length=330

 Score =   235 bits (600),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 157/337 (47%), Positives = 205/337 (61%), Gaps = 38/337 (11%)
 Frame = +2

Query  248   SESDVTSLAASSPS------GHVYYVQ-SPSRDSHDDGDGEKSTSMQPTPTFT-SPVESP  403
             SESD+TSLA SSPS         YYVQ SPSRDSHDD DG+KS S Q TP +  SP++SP
Sbjct  6     SESDMTSLATSSPSRSPKAAAAAYYVQISPSRDSHDD-DGDKSPSTQATPVYNNSPLDSP  64

Query  404   SH--PSLGRHSRTssgtrfs---gifrsssgrkgrgkrmmsNDKGWPECNVIM---EEGK  559
             SH   S GRHSR SS +RFS         S   G G R     KGW + + I+   EEG 
Sbjct  65    SHHSSSFGRHSRVSSASRFSGNLRSASGRSRLGGGGGRRRLGAKGWRDVDAIIDEEEEGA  124

Query  560   YDEL----------EDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSL  709
             YDE               +L+ RF          L FT+ CLI+WG AR YK  V +KSL
Sbjct  125   YDEFDDDDDGGYEPSRCCVLAFRF------SLLALAFTLVCLIVWGIARHYKPGVLVKSL  178

Query  710   SVSNIYIGEGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQ  889
             +V N Y GE  D TGVPT+L+++N SL+I+V+NP+T +GIHVSST I ++FS I +A GQ
Sbjct  179   TVGNFYAGEAIDRTGVPTKLVTMNCSLQINVHNPSTMFGIHVSSTSIQILFSQIAIANGQ  238

Query  890   LKKYYQSRKSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDV  1069
             L+K+YQ R S       + G K+PLYGAG +  A  N  G     VPL LD  V+++G V
Sbjct  239   LEKFYQPRSSHHVASAIVHGEKIPLYGAGETF-ALSNAGGA----VPLTLDLVVRARGYV  293

Query  1070  VGKLVRTDYRRKIWCELIIDSAGNKPIKFKKDSCAYS  1180
             +GKLVR  + +++ C ++IDS  +KPI+F + +C+Y+
Sbjct  294   IGKLVRVTHTKRVKCPVVIDSGSSKPIRFIQSACSYT  330



>ref|XP_002514290.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48244.1| conserved hypothetical protein [Ricinus communis]
Length=314

 Score =   233 bits (595),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 142/309 (46%), Positives = 192/309 (62%), Gaps = 14/309 (5%)
 Frame = +2

Query  254   SDVTSLAASSPSGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSP-VESPSHPSLGRHS  430
             + +T ++  SP    YYVQSPS  SH   D +KS+S   T   TSP V SP+        
Sbjct  18    TSLTPISLRSPKPSAYYVQSPS--SHHSHDEDKSSSTHAT---TSPAVTSPTDSPSHSSY  72

Query  431   RTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDSWLLSRRFHal  610
                S +  S            G+R     +   E NVI EE  +  +  +    R    L
Sbjct  73    SRHSRSSSSSRLSGPYATTAAGRRGGRYKRNDNEFNVIEEEELFYYVNHNNTNRR---VL  129

Query  611   lalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPTRLLSVNGSL  790
             +   GF+ +F+VFCLIIWGA+RP+K Q+ ++SLSV N Y G+GSD TGVPT++L+VN S+
Sbjct  130   IGALGFVFVFSVFCLIIWGASRPFKPQINVQSLSVHNFYFGQGSDMTGVPTKMLTVNCSV  189

Query  791   RISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNIQGTKVPLYG  970
              ISVYNPATF+GIHV+  P++L++ +I VATG+LKKYYQ RKSRR+V VN++G KVPLYG
Sbjct  190   NISVYNPATFFGIHVTFMPVHLMYYEIIVATGELKKYYQPRKSRRSVHVNVEGVKVPLYG  249

Query  971   AGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELIIDSAGNKPI  1150
             AG  L  + N       QVP  L F+V+S+G VVG++V++ + R + C L IDS  ++PI
Sbjct  250   AGVRLAVSDNNR-----QVPFTLAFDVRSRGYVVGRMVKSRHARHVSCSLAIDSRTDRPI  304

Query  1151  KFKKDSCAY  1177
             KF  DSCAY
Sbjct  305   KFNNDSCAY  313



>ref|XP_009146171.1| PREDICTED: uncharacterized protein LOC103869856 isoform X1 [Brassica 
rapa]
Length=295

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 149/314 (47%), Positives = 216/314 (69%), Gaps = 25/314 (8%)
 Frame = +2

Query  254   SDVTSLAAS---SPSGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESPSHPS--L  418
             SD+TSLAAS   S    +YYVQSPSRDS+       ++  QP+    + ++SP+H S  L
Sbjct  2     SDMTSLAASPSRSSKRAMYYVQSPSRDSY-------TSVTQPS----TMMDSPTHDSYSL  50

Query  419   GRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDSWLLSRR  598
             GRHSR SS +RFSGI RSSS  +   K+  SN+K   E   I+EEG Y+E++D   + RR
Sbjct  51    GRHSRNSSESRFSGISRSSSSDRKNVKKCRSNEK---EYETILEEGSYEEMDDVTSI-RR  106

Query  599   FHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPTRLLSV  778
               A+LA+  F+ LF   CLI WGA+RPYKAQ+++++  + N Y+G+GSDF G+ T+LL++
Sbjct  107   SQAILAVFIFISLFAFCCLITWGASRPYKAQISVQTFELRNFYVGQGSDFYGMHTKLLTL  166

Query  779   NGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNIQGTKV  958
             NG+LRI +YNPA  +GIHVSS P++L++  + +ATGQLK++YQ +KS+ T  V I+G ++
Sbjct  167   NGTLRIGIYNPAPTFGIHVSSKPVSLLYYQLPIATGQLKEHYQPKKSQYTEAVVIEGRRI  226

Query  959   PLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELIIDSAG  1138
             PLYGAG+SL AT+      G ++ + L FEVK++GDVVG+LV   ++++I C  +ID A 
Sbjct  227   PLYGAGASLEATER-----GGKIQVNLRFEVKTRGDVVGRLVTIRHKKRISCSFVIDVAI  281

Query  1139  NKPIKFKKDSCAYS  1180
             +K +   K  C+YS
Sbjct  282   SKRVPIDKSDCSYS  295



>emb|CDY30134.1| BnaC05g37280D [Brassica napus]
Length=296

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 153/313 (49%), Positives = 210/313 (67%), Gaps = 22/313 (7%)
 Frame = +2

Query  254   SDVTSLAAS---SPSGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESPSHPSLGR  424
             SD+TSLAAS   S    +YYVQSPSRDS+       ++  QP+    SP    S  SLGR
Sbjct  2     SDMTSLAASPTRSSKRAMYYVQSPSRDSY-------TSVTQPSTMMDSPTHDSS--SLGR  52

Query  425   HSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDSWLLSRRFH  604
             HSR SS +RFSGI RSSS      K+  SN+K   E   I+EEG Y+E++D   + RR  
Sbjct  53    HSRNSSESRFSGISRSSSSDGKNVKKCRSNEK---EYETILEEGSYEEMDDVTSI-RRSQ  108

Query  605   allalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPTRLLSVNG  784
             ALLA+  F++LF V CLI WGA+RPYKAQ+++++  + N Y+G+GSDF G+ T+LL++NG
Sbjct  109   ALLAVFIFIILFAVCCLITWGASRPYKAQISVQTFELRNFYVGQGSDFYGMHTKLLTLNG  168

Query  785   SLRISVYNPATFYGIHVSSTPINLVFSDITVATG-QLKKYYQSRKSRRTVLVNIQGTKVP  961
             +LRI +YNPA  +GIHVSSTP++L +  + +ATG QLK++YQ +K   T  V I+G ++P
Sbjct  169   TLRIGIYNPAPTFGIHVSSTPVSLFYYQLPIATGQQLKEHYQQKKRFYTEAVVIEGRRIP  228

Query  962   LYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELIIDSAGN  1141
             LYGAG+SL AT+      G ++P+ L FEVK++GDVVG+LV     ++I C  +ID A N
Sbjct  229   LYGAGASLEATER-----GGKIPVNLRFEVKTRGDVVGRLVTIRQTKRISCSFVIDVAIN  283

Query  1142  KPIKFKKDSCAYS  1180
             K +   K  C+YS
Sbjct  284   KRMPINKSDCSYS  296



>ref|XP_011078314.1| PREDICTED: uncharacterized protein LOC105162087 [Sesamum indicum]
 ref|XP_011078315.1| PREDICTED: uncharacterized protein LOC105162087 [Sesamum indicum]
Length=293

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 145/320 (45%), Positives = 201/320 (63%), Gaps = 31/320 (10%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESPSHP  412
             MLH  SESD TS+  SS S + YYVQSPSRDS+D+ D   S++ +      SP++SPS P
Sbjct  1     MLHDASESDFTSIGPSSSSPNAYYVQSPSRDSNDETDKCSSSNSR------SPLDSPSFP  54

Query  413   SLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPE--CNVIMEE-GKYDE-LEDS  580
                RHS  SS +  +                  N + W +  C+V+ EE G  DE     
Sbjct  55    ---RHSMASSSSTAASRISG-------------NRRRWNKHYCDVVAEEDGALDEDYYGD  98

Query  581   WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
                SR+   L+ +  F LLF+  CL+IWGA+RPYKAQV +KSL V N+Y GEGSD TGVP
Sbjct  99    RAYSRQCKWLMVVLAFGLLFSGICLVIWGASRPYKAQVRVKSLRVHNLYYGEGSDRTGVP  158

Query  761   TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVN  940
             T+ LS+N S  I +YNPA  +GIHVS    NL++S ITVAT QLKKYYQ +KSRR + V+
Sbjct  159   TKFLSLNCSATIVIYNPARLFGIHVSFRAANLIYSQITVATAQLKKYYQPKKSRRIMQVS  218

Query  941   IQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCEL  1120
             + G ++PLYG+G +L A+   D +GG  +P  L+  ++S+G +VG+LV+T + R++ C L
Sbjct  219   LVGQRIPLYGSGMALAAS---DASGG--IPFKLELGIESRGYLVGRLVKTKHTRRVSCSL  273

Query  1121  IIDSAGNKPIKFKKDSCAYS  1180
             +I+S   + I F+ +SC Y+
Sbjct  274   VINSQHTQDIIFETNSCKYT  293



>ref|XP_010503818.1| PREDICTED: uncharacterized protein LOC104780961 [Camelina sativa]
Length=255

 Score =   230 bits (586),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 137/265 (52%), Positives = 194/265 (73%), Gaps = 12/265 (5%)
 Frame = +2

Query  392   VESPSH--PSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYD  565
             ++SP+H   SLGRHSR SS +RFSG+FRSSS  +   ++ MSN+K   EC +I+EEG YD
Sbjct  1     MDSPTHDSSSLGRHSRKSSASRFSGLFRSSSSGRKSVRKCMSNEK---EC-IILEEGSYD  56

Query  566   ELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSD  745
             E++D   + R+  ALLA+   ++LFT  C I WGA+ PYKAQ+++K+  + N Y+G+GSD
Sbjct  57    EMDDVTSI-RKCQALLAVFALVVLFTFLCFISWGASIPYKAQISVKTFELHNFYVGDGSD  115

Query  746   FTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRR  925
             F+GV T +L++NG+LR+S+YNPA  +G+HVSSTPINL F ++ +ATGQL++YYQ +K+RR
Sbjct  116   FSGVRTTMLTINGTLRLSIYNPAPVFGVHVSSTPINLFFYELPIATGQLEEYYQRKKNRR  175

Query  926   TVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRK  1105
                V I+G +VP YGAG+SL AT+      G ++P+ L FEV+S+ DVVGKLVR  + ++
Sbjct  176   MESVVIEGRRVPSYGAGASLEATER-----GGKIPVKLKFEVQSRSDVVGKLVRIWHTKR  230

Query  1106  IWCELIIDSAGNKPIKFKKDSCAYS  1180
             I C  +ID A NKPI F + SC Y+
Sbjct  231   ISCTFVIDVASNKPIHFNERSCHYT  255



>ref|XP_006451179.1| hypothetical protein CICLE_v10009029mg [Citrus clementina]
 gb|ESR64419.1| hypothetical protein CICLE_v10009029mg [Citrus clementina]
Length=213

 Score =   227 bits (578),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 135/225 (60%), Positives = 171/225 (76%), Gaps = 16/225 (7%)
 Frame = +2

Query  233  MLHTKSESDVTSLAASSPSG---HVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESP  403
            MLH KS+SDVTSL  SSP     HVYYVQSPSRDS+D+   +KS+SMQ TP + +P +SP
Sbjct  1    MLHAKSDSDVTSLDPSSPRSPRRHVYYVQSPSRDSNDE---DKSSSMQHTPAYNTPTDSP  57

Query  404  SHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDSW  583
            SHPS GRHSR SS +RFSG FR              NDKGWPECNVI EEG YDE     
Sbjct  58   SHPSYGRHSRASSSSRFSGTFRGRKR----------NDKGWPECNVIEEEGDYDEFYADK  107

Query  584  LLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPT  763
              +RR   L+AL GF+L+F++FCLIIWGA+RPYKA++ ++SL+V N Y GEG+D TGVPT
Sbjct  108  GYTRRCQILIALLGFVLVFSIFCLIIWGASRPYKAKIAVRSLTVHNFYFGEGADLTGVPT  167

Query  764  RLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKK  898
            ++L++N S++++VYNPATF+GIHVSS+P+NL+FS+I VATGQ+ K
Sbjct  168  KMLTMNCSVKMNVYNPATFFGIHVSSSPVNLMFSEIAVATGQVMK  212



>gb|ADE76556.1| unknown [Picea sitchensis]
Length=312

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 147/326 (45%), Positives = 202/326 (62%), Gaps = 29/326 (9%)
 Frame = +2

Query  236   LHTKSESDVTSLAASS---PSGHVYYVQSP-SRDSHDDGDGEKSTSMQPTPTFTSPVESP  403
              H KSES+VTS+ ASS   P   +Y+VQSP SR+S  DGD  K+     +  FT P+ SP
Sbjct  3     FHAKSESEVTSMGASSSSTPRRPLYFVQSPTSRESFPDGD--KTPFSVHSANFT-PLGSP  59

Query  404   SH-------PSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKY  562
             SH          GRHSRTSSGT F                       WP  N I EE   
Sbjct  60    SHRSVSASASVSGRHSRTSSGTHFWSKVIPDESHSRTK---------WPHANAIAEEAFR  110

Query  563   DELEDSW-LLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEG  739
             D+  D   +L RR H +L +  F LLF VFCL +WGA+RPYK +V LKS+  S+ ++ EG
Sbjct  111   DDNSDGRKILPRRCHIVLFVLCFALLFAVFCLALWGASRPYKPKVILKSIVFSDFHVYEG  170

Query  740   SDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKS  919
             +D TGVPT ++S N +L++SVYNPA F+GIHV STP+NL++++++VATGQL++YYQSR S
Sbjct  171   ADETGVPTIMVSANSTLKLSVYNPAKFFGIHVVSTPVNLMYNELSVATGQLQEYYQSRMS  230

Query  920   RRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYR  1099
                  + + G +VPLYGAG SL  T N++G     +PL L F ++S+  V+GKLV+  +R
Sbjct  231   HSVASIVVDGERVPLYGAGGSLSGT-NENG----DIPLDLVFSIQSRAYVLGKLVKHKFR  285

Query  1100  RKIWCELIIDSAGNKPIKFKKDSCAY  1177
             R+I C++++DS   K I+  + +C Y
Sbjct  286   RRIHCKIVLDSNRLKVIRSLQKACQY  311



>ref|XP_010688223.1| PREDICTED: uncharacterized protein LOC104902222 [Beta vulgaris 
subsp. vulgaris]
Length=326

 Score =   224 bits (571),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 146/330 (44%), Positives = 201/330 (61%), Gaps = 22/330 (7%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH------VYYVQSPSRDSHDDGDGEKSTSMQP-----TPT  379
             M++TKSESD+TSLA SSP         VYYVQSPSRDSH++     S S        TP 
Sbjct  1     MMYTKSESDITSLATSSPRLSPKPPRPVYYVQSPSRDSHEEDKSSTSASATATQATNTPV  60

Query  380   -FTSPVESPSHPSL-GRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEE  553
              F SP +S S  SL  R +R+S  +R S        R+ R +  +  ++          E
Sbjct  61    GFRSPYDSISLLSLFSRQTRSSVTSRVSEPQGYRRKRRERERIRLLGERHHAAAEEEKRE  120

Query  554   G----KYDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSN  721
                  K+   E+   LS+    L+ +    L+F V C I+WGA+RP+ AQV LK +++ +
Sbjct  121   REVYVKWWRDEEEEELSKSCKVLMGMMVLGLVFMVGCFIVWGASRPFSAQVFLKDVTIHS  180

Query  722   IYIGEGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKY  901
              Y GEGSD TGVP+++L++N SLR+ V+NPATF+GIHVS + I+L + D+T+A+GQL+ Y
Sbjct  181   FYFGEGSDLTGVPSKILTINCSLRMRVHNPATFFGIHVSCSTIHLRYYDLTIASGQLESY  240

Query  902   YQSRKSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKL  1081
             YQ RKS RTV +NI+G KVPLYGAG     +   +G     VPL LDFE++S G+VVGKL
Sbjct  241   YQPRKSWRTVRINIEGKKVPLYGAGDGFVVSNKAEG-----VPLILDFEMRSHGEVVGKL  295

Query  1082  VRTDYRRKIWCELIIDSAGNKPIKFKKDSC  1171
             V+T +RR + C L I S   + +K  +DSC
Sbjct  296   VKTKHRRHVRCSLNISSYSIQIVKLTEDSC  325



>ref|XP_010468203.1| PREDICTED: uncharacterized protein LOC104748226 [Camelina sativa]
Length=258

 Score =   219 bits (557),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 135/267 (51%), Positives = 193/267 (72%), Gaps = 13/267 (5%)
 Frame = +2

Query  392   VESPSH--PSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVI-MEEGK-  559
             ++SP+H   SLGRHSR S  +RFSG+FRSSS  +   ++ MSN+K   EC VI +EEG+ 
Sbjct  1     MDSPTHDSSSLGRHSRNSWASRFSGLFRSSSSGRKSVRKCMSNEK---ECKVIILEEGRS  57

Query  560   YDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEG  739
             YDE++D   + R   ALLA+   ++LFT  C I WGA+ PYKAQ+++K+  + N Y+G+G
Sbjct  58    YDEMDDVTSI-RNCQALLAVFALVVLFTFLCFISWGASIPYKAQISVKTFELHNFYVGDG  116

Query  740   SDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKS  919
             SDF+GV T +L++NG+LR+S+YNPA  +G+HVSSTPINL F ++ +ATGQL++++Q +KS
Sbjct  117   SDFSGVRTAMLTINGTLRLSIYNPAPVFGVHVSSTPINLFFYELPIATGQLEEHHQRKKS  176

Query  920   RRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYR  1099
             R    V I+G +VPLYGAG+SL AT+      G ++P+ L FEV+S+ +VVGKLVR  + 
Sbjct  177   RIMESVVIEGRRVPLYGAGASLEATER-----GGKIPVKLKFEVRSRSNVVGKLVRIWHT  231

Query  1100  RKIWCELIIDSAGNKPIKFKKDSCAYS  1180
             ++I C  +ID A NKPI F + SC Y+
Sbjct  232   KRISCTFVIDVAINKPIPFNERSCRYT  258



>gb|EMT02142.1| hypothetical protein F775_28959 [Aegilops tauschii]
Length=270

 Score =   217 bits (553),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 144/273 (53%), Positives = 182/273 (67%), Gaps = 9/273 (3%)
 Frame = +2

Query  362   MQPTPTFTSPVESPSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNV  541
             MQ TP + SP ESPSHPS GRHSR SS +RFSGI R  SGRKG G     N KGWPEC+V
Sbjct  1     MQATPVYNSPNESPSHPSYGRHSRASSVSRFSGILRGGSGRKGGGDLKAVNAKGWPECSV  60

Query  542   IMEEGKYDELE--DSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSV  715
             I EEG Y+ L   DS L S R    LA   FLLLFTV CLI+WGAARPY+  V +KS+++
Sbjct  61    IEEEGSYEGLSGGDSGL-SGRCKLALAFVSFLLLFTVVCLIVWGAARPYEPDVVVKSIAM  119

Query  716   SNIYIGEGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLK  895
              N Y GEG+D +GVPT+++++N SL + VYNPA+ +GIHVSS P+ L++S+I +  GQ+ 
Sbjct  120   DNFYAGEGTDHSGVPTKMVTLNCSLNMVVYNPASMFGIHVSSGPVRLLYSEIAIGVGQVH  179

Query  896   KYYQSRKSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVG  1075
             KYYQ  KS R V   I G KVPLYGAG  L  + N      V VPL +DFE+ S+G V+G
Sbjct  180   KYYQPSKSHRLVSAVIHGEKVPLYGAGGGLLLSGND-----VTVPLTVDFELVSRGYVIG  234

Query  1076  KLVRTDYRRKIWCELIIDSAGNKPIKFKKDSCA  1174
             KLVR  ++  + C + +D A     +  K +CA
Sbjct  235   KLVRVTHKVHVTCRIAVD-AKRARTRIPKKACA  266



>ref|XP_010269473.1| PREDICTED: uncharacterized protein LOC104606113 [Nelumbo nucifera]
Length=319

 Score =   218 bits (556),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 144/326 (44%), Positives = 210/326 (64%), Gaps = 18/326 (6%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESP  403
             +H K++S+VTSL+ASSP+      VYYVQSPSRDSHD   GEK+T+   +    SP+ SP
Sbjct  1     MHAKTDSEVTSLSASSPTRSPRRPVYYVQSPSRDSHD---GEKTTTSFHSSPVLSPMGSP  57

Query  404   --SHPSLGRHSRTssgtrfsgifrsssgrkg----rgkrmmsNDKGWPECNVIMEEGKYD  565
               SH SLGRHSR SS +RFSG  +  S +               K W EC VI EEG  +
Sbjct  58    HHSHSSLGRHSRESSTSRFSGSLKPGSRKITPNDGSRGGQRKGQKPWKECAVIEEEGLLE  117

Query  566   ELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSD  745
             E      L RR + L  + GF+ LF++F LI+WGAARP K ++T+KS++   + I  G+D
Sbjct  118   EESTEKSLPRRCYFLAFILGFIFLFSLFSLILWGAARPQKPKITMKSITFEQVVIQSGTD  177

Query  746   FTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRR  925
              TGV T ++S+N +++++  N ATF+G+HV+STP++L ++ + VA+G +KK+YQSRKS+R
Sbjct  178   STGVATDMVSLNSTVKLTFRNTATFFGVHVTSTPLDLSYTQLNVASGTIKKFYQSRKSQR  237

Query  926   TVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRK  1105
             T+ V + G K+PLYG+G+ L ++    G   V VPL L F V+S+  V+G+LV+  + + 
Sbjct  238   TMTVVVMGNKIPLYGSGAGLSSS---TGKLTVPVPLKLSFTVRSRAYVLGRLVKPKFYKT  294

Query  1106  IWCELIIDSAG-NKPIKFKKDSCAYS  1180
             I C ++++    N PI   KDSC Y+
Sbjct  295   IECSVVLNPKKLNVPISL-KDSCTYT  319



>emb|CDP01320.1| unnamed protein product [Coffea canephora]
Length=323

 Score =   218 bits (555),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 150/330 (45%), Positives = 206/330 (62%), Gaps = 22/330 (7%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH---VYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPVESP  403
             +H K++S+VTSLA SSP      VYYVQSPSRDSHD   GEK+T S   TP   SP  SP
Sbjct  1     MHAKTDSEVTSLAPSSPDHARRPVYYVQSPSRDSHD---GEKTTTSFHSTPIL-SPAGSP  56

Query  404   --SHPSLGRHSRTssgtrfsgifrsssgrk--------grgkrmmsNDKGWPECNVIMEE  553
               SH S+GRHSR SS +RFSG  +  S +                   K W EC+VI EE
Sbjct  57    PHSHSSVGRHSRESSTSRFSGSLKPGSRKINPNDGGSGANRHPGHKGQKPWKECDVIEEE  116

Query  554   GKYDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIG  733
             G  ++ E    L RR + L  + GF LLF++F LI+WGA+RP K ++T+KSL+     I 
Sbjct  117   GLLEDQESRKPLPRRCYFLAFVVGFFLLFSLFSLILWGASRPQKPKITMKSLTFERFAIQ  176

Query  734   EGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSR  913
              GSD TGV T ++S+N +L+ +  N ATF+G+H +S+P++L + ++TV +G +K +YQSR
Sbjct  177   AGSDDTGVSTDMISINSTLKFNFRNTATFFGVHATSSPVDLSYFELTVGSGTMKNFYQSR  236

Query  914   KSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTD  1093
             KS+RTV V++ G K+PLYG+G+SL  T    GT    V L L+F V+S+  V+GKLV+  
Sbjct  237   KSQRTVTVSVIGNKIPLYGSGASLSTTPT--GTTSQPVRLKLNFVVRSRAYVLGKLVKPK  294

Query  1094  YRRKIWCELIIDSAG-NKPIKFKKDSCAYS  1180
             + +KI C ++ D    N PI  K D C Y+
Sbjct  295   FYKKIECSIVFDPKKLNAPIPLKND-CTYN  323



>ref|XP_006847089.1| hypothetical protein AMTR_s00017p00215910 [Amborella trichopoda]
 gb|ERN08670.1| hypothetical protein AMTR_s00017p00215910 [Amborella trichopoda]
Length=314

 Score =   217 bits (553),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 140/322 (43%), Positives = 202/322 (63%), Gaps = 18/322 (6%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESP  403
             +H KS+S+VTSLA SSP+      VYYVQSPSRDSHD   GEK TS Q TP   SP+ SP
Sbjct  1     MHAKSDSEVTSLAPSSPTRSPRRPVYYVQSPSRDSHD---GEK-TSFQSTPVL-SPMGSP  55

Query  404   --SHPSLGRHSR-TssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELE  574
               SH S+GRHSR +S+      +  S+              K W EC VI EEG  +E +
Sbjct  56    PHSHSSVGRHSRESSTSRFSGSLKSSNRKVGHHENGRGKGQKPWKECAVIEEEGLLEEED  115

Query  575   DSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTG  754
              +  + +R +  + +  F+LLF+ F LI+WGAARP K Q+T+KS++  +  +  G+D TG
Sbjct  116   GNKGIPKRCYFPIFVLSFVLLFSFFALILWGAARPQKPQITMKSITFESFTLQAGTDSTG  175

Query  755   VPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVL  934
             VPT +LS+N +L++   NPATF+G+HV+STPI+L +  ++VA+G +K +YQ RKS+R V 
Sbjct  176   VPTEMLSLNSTLKLIYRNPATFFGVHVASTPISLTYYQLSVASGNMKNFYQRRKSQRAVN  235

Query  935   VNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWC  1114
             V ++GT++PLYG GS+L ++     T    V L + FEV+S+  V+GKLV+  +  ++ C
Sbjct  236   VVVEGTRIPLYGGGSTLSSSD----TTKTSVGLNMTFEVRSKAYVLGKLVKPKFYTEVQC  291

Query  1115  ELIIDSAG-NKPIKFKKDSCAY  1177
               ++D      P    K+SC Y
Sbjct  292   SAVLDQTKLGTPFSL-KNSCQY  312



>ref|XP_003564273.1| PREDICTED: uncharacterized protein LOC100823357 [Brachypodium 
distachyon]
Length=326

 Score =   217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 138/327 (42%), Positives = 189/327 (58%), Gaps = 18/327 (6%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSP----SGHVYYVQSPSRDSHDDGDG------EKSTSMQPTP-T  379
             M+  KSESD TS+AASSP        Y+VQSPS                +S S+Q TP +
Sbjct  1     MMQAKSESDATSMAASSPPRSPKRASYFVQSPSSHGAGGSSSAAGGYKSRSPSVQATPVS  60

Query  380   FTSPVESPSHPSLG-RHSRTssgtrfsgifrsssgrkgrg-krmmsNDKGWPECNVIMEE  553
               SP  SP  PS   RHSR  + TRFS   R +         R   N KGWPEC VI EE
Sbjct  61    NNSPANSPLRPSYASRHSRGPAITRFSSKLRPAGSGVRTSWDRKAVNGKGWPECTVIEEE  120

Query  554   GKYDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIG  733
             G Y E      LSR    +L     +LLFT  CL+IWG +R  +  V +KSL + N Y G
Sbjct  121   GSYHEFSSDSGLSRGLKIVLGFISLVLLFTTICLVIWGVSRRQEPDVVVKSLVMDNFYAG  180

Query  734   EGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSR  913
              G+D +GVPT+L+++N SL + V NPA+ +GIHV+S P+ L++S+I +  GQ++KYYQ +
Sbjct  181   AGTDHSGVPTKLVTLNCSLNMVVSNPASIFGIHVTSGPVRLLYSEIAIGVGQVRKYYQQK  240

Query  914   KSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTD  1093
              S + V   I G KVPLYGAG +  +  +K G     VPL LDFE+ ++G ++G +VR  
Sbjct  241   NSHQAVSAVIHGEKVPLYGAGGAQ-SLSSKSG----MVPLTLDFELTTRGYIIGAMVRVT  295

Query  1094  YRRKIWCELIIDSAGNKPIKFKKDSCA  1174
             ++  + C++ ID    +PI+  KD+CA
Sbjct  296   HKLHVNCKIKIDPKKTRPIRLPKDACA  322



>emb|CDX97721.1| BnaA05g23580D [Brassica napus]
Length=437

 Score =   220 bits (561),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 146/301 (49%), Positives = 210/301 (70%), Gaps = 28/301 (9%)
 Frame = +2

Query  254   SDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESPSHPS--  415
             SD+TSLAAS PSG     +YYVQSPSRDS+       ++  QP+    + ++SP+H S  
Sbjct  2     SDMTSLAAS-PSGSSKRAMYYVQSPSRDSY-------TSVTQPS----TMMDSPTHDSYS  49

Query  416   LGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDSWLLSR  595
             LGRHSR SS +RFSGI RSSS  +   K+  SN+K   E   I+EEG Y+E++D   + R
Sbjct  50    LGRHSRNSSESRFSGISRSSSSDRKNVKKCRSNEK---EYETILEEGSYEEMDDVTSI-R  105

Query  596   RFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPTRLLS  775
             R  A+LA+  F+ LF   CLI WGA+RPYKAQ+++++  + N Y+G+GSDF G+ T+LL+
Sbjct  106   RSQAILAVFIFISLFAFCCLITWGASRPYKAQISVQTFELRNFYVGQGSDFYGMHTKLLT  165

Query  776   VNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATG-QLKKYYQSRKSRRTVLVNIQGT  952
             +NG+LRI +YNPA  +GIHVSS P++L++  + +ATG QLK++YQ +KS+ T  V I+G 
Sbjct  166   LNGTLRIGIYNPAPTFGIHVSSKPVSLLYYQLPIATGQQLKEHYQPKKSQYTEAVVIEGR  225

Query  953   KVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELIIDS  1132
             ++PLYGAG+SL AT+      G ++ + L FEVK++GDVVG+LV   ++++I C  +ID 
Sbjct  226   RIPLYGAGASLEATER-----GGKIQVNLRFEVKTRGDVVGRLVTIRHKKRISCSFVIDV  280

Query  1133  A  1135
             A
Sbjct  281   A  281



>ref|XP_004291094.1| PREDICTED: uncharacterized protein LOC101300780 [Fragaria vesca 
subsp. vesca]
Length=319

 Score =   216 bits (550),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 145/328 (44%), Positives = 205/328 (63%), Gaps = 22/328 (7%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPVES  400
             +H K++S+VTSLA SSP+      VYYVQSPSRDSHD   GEK+T S Q TP   SP  S
Sbjct  1     MHAKTDSEVTSLAPSSPTRSPRRPVYYVQSPSRDSHD---GEKTTTSFQSTPVL-SPAGS  56

Query  401   P--SHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsND-----KGWPECNVIMEEGK  559
             P  SH S+GRHSR SS TRFSG  +  S +         +      K W +C VI EEG 
Sbjct  57    PPHSHSSVGRHSRDSSSTRFSGSIKPGSKKIQPNNDSSRHHRKDGHKAWKDCAVIEEEGL  116

Query  560   YDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEG  739
              D+ +      RR +    + GF LLF++F LI++GA++P K ++T+KS+      I  G
Sbjct  117   LDDDDRERGFPRRCYFPAFVLGFFLLFSMFSLILYGASKPMKPKITMKSVKFEQFKIQAG  176

Query  740   SDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKS  919
             SD TGV T ++SVN +++ +  N  TF+G+HVS  P++L +S I +A+G +KK+YQSR+S
Sbjct  177   SDSTGVSTDMISVNSTVKFTFRNTGTFFGVHVSPEPLDLSYSQIAIASGIVKKFYQSRRS  236

Query  920   RRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYR  1099
             +RTV V++ G K+PLYG+G+S+ ++    GT  + VPL LDF +KS+  V+GKLV+  + 
Sbjct  237   QRTVTVSVIGDKIPLYGSGASISSST---GTTLLPVPLKLDFLIKSRAYVLGKLVKPKFN  293

Query  1100  RKIWCELIIDSAG-NKPIKFKKDSCAYS  1180
             R++ C +  D    N  I  K  +C YS
Sbjct  294   RRVGCTVTFDPKKLNVAIALK--NCTYS  319



>ref|XP_008220240.1| PREDICTED: uncharacterized protein LOC103320347 [Prunus mume]
Length=317

 Score =   216 bits (549),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 147/319 (46%), Positives = 205/319 (64%), Gaps = 18/319 (6%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPVES  400
             +H K++S+VTSLAASSP+      VYYVQSPSRDSHD   GEK+T S Q TP   SPV S
Sbjct  1     MHAKTDSEVTSLAASSPTRSPRRPVYYVQSPSRDSHD---GEKTTTSFQSTPVL-SPVGS  56

Query  401   P--SHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKG---WPECNVIMEEGKYD  565
             P  SH S+GRHSR SS TRFSG  +  S +         + KG   W E  VI EEG  +
Sbjct  57    PPHSHSSVGRHSRESSSTRFSGSLKPGSRKINPNDGSRQHRKGQKPWKEQAVIEEEGLLE  116

Query  566   ELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSD  745
               E S    RR +    + GF LLF++F LI+WGA++P K ++T+KS++     I  GSD
Sbjct  117   GEEGSKGFPRRCYFPAFVLGFFLLFSMFSLILWGASKPMKPKITMKSVTFEQFKIQAGSD  176

Query  746   FTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRR  925
              TGV T ++SVN +++ +  N  TF+G+HVS  P++L +S IT+A+G +KK+YQSRKS+R
Sbjct  177   ATGVATDMISVNSTVKFTFRNTGTFFGMHVSPKPLDLSYSQITIASGTIKKFYQSRKSQR  236

Query  926   TVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRK  1105
             ++ V++ G K+PLYG+G+S+  +    GT  + VPL L+F ++S+  V+GKLV+  + R+
Sbjct  237   SISVSVIGNKIPLYGSGASMSTS---TGTTALPVPLQLNFVIRSRAYVLGKLVKPKFNRR  293

Query  1106  IWCELIIDSAG-NKPIKFK  1159
             I C +  D    N PI  K
Sbjct  294   IQCSVTFDPKKLNVPISLK  312



>ref|XP_007222947.1| hypothetical protein PRUPE_ppa008855mg [Prunus persica]
 gb|EMJ24146.1| hypothetical protein PRUPE_ppa008855mg [Prunus persica]
Length=317

 Score =   215 bits (548),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 147/319 (46%), Positives = 205/319 (64%), Gaps = 18/319 (6%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPVES  400
             +H K++S+VTSLAASSP+      VYYVQSPSRDSHD   GEK+T S Q TP   SPV S
Sbjct  1     MHAKTDSEVTSLAASSPTRSPRRPVYYVQSPSRDSHD---GEKTTTSFQSTPVL-SPVGS  56

Query  401   P--SHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKG---WPECNVIMEEGKYD  565
             P  SH S+GRHSR SS TRFSG  +  S +         + KG   W E  VI EEG  +
Sbjct  57    PPHSHSSVGRHSRESSSTRFSGSLKPGSRKINPNDGSRHHRKGQKPWKEQAVIEEEGLLE  116

Query  566   ELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSD  745
               E S    RR +    + GF LLF++F LI+WGA++P K ++T+KS++     I  GSD
Sbjct  117   GEEGSKGFPRRCYFPAFVLGFFLLFSMFSLILWGASKPMKPKITMKSVTFEQFKIQAGSD  176

Query  746   FTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRR  925
              TGV T ++SVN +++ +  N  TF+G+HVS  P++L +S IT+A+G +KK+YQSRKS+R
Sbjct  177   ATGVATDMISVNSTVKFTFRNTGTFFGMHVSPKPLDLSYSQITIASGTIKKFYQSRKSQR  236

Query  926   TVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRK  1105
             ++ V++ G K+PLYG+G+S+  +    GT  + VPL L+F ++S+  V+GKLV+  + R+
Sbjct  237   SISVSVIGNKIPLYGSGASMSTS---TGTTALPVPLQLNFVIRSRAYVLGKLVKPKFNRR  293

Query  1106  IWCELIIDSAG-NKPIKFK  1159
             I C +  D    N PI  K
Sbjct  294   IQCSVTFDPKKLNVPISLK  312



>ref|XP_008444608.1| PREDICTED: uncharacterized protein LOC103487879 [Cucumis melo]
Length=319

 Score =   214 bits (546),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 142/324 (44%), Positives = 204/324 (63%), Gaps = 26/324 (8%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEK-STSMQPTPTFTSPVES  400
             +H K++S+VTS+A SSP+      VYYVQSPSRDSHD   GEK +TS   TP  TSP++S
Sbjct  1     MHAKTDSEVTSIAPSSPTRSPRRPVYYVQSPSRDSHD---GEKTATSFHSTPVLTSPMDS  57

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsND----------KGWPECNVIME  550
             P H      S     +R S   R S   K   +++  ND          K W EC+VI E
Sbjct  58    PPH----SRSSVGRHSRESSSSRFSGSLKPGSRKITPNDVSRGAHRKGQKPWKECDVIEE  113

Query  551   EGKYDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYI  730
             EG  ++ +    L RR + L  + GF +LF++F LI+WGA+RP K +VT+KS++     I
Sbjct  114   EGLLEDEDRGKSLPRRCYVLAFILGFFVLFSMFALILWGASRPMKPRVTMKSITFEQFKI  173

Query  731   GEGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQS  910
               GSDFTGV T + SVN ++++   N  +F+G+HVSSTP++L +S+ITVA+G +KK+YQS
Sbjct  174   QAGSDFTGVATDMASVNSTVKLIFRNTGSFFGVHVSSTPVDLTYSEITVASGTVKKFYQS  233

Query  911   RKSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRT  1090
             RKS R++ +N+ GT+VPLYG+G+SL ++    GT    +PL L F ++S+  V+G+LV+ 
Sbjct  234   RKSHRSLTINVIGTRVPLYGSGASLSSS---TGTPETPLPLKLSFVIRSRAYVLGQLVKP  290

Query  1091  DYRRKIWCELIIDSAG-NKPIKFK  1159
              + R I C +I DS   N P+  K
Sbjct  291   KFYRHIDCPIIFDSKKLNVPMSLK  314



>ref|XP_004142871.1| PREDICTED: uncharacterized protein LOC101203977 [Cucumis sativus]
 gb|KGN62494.1| hypothetical protein Csa_2G356680 [Cucumis sativus]
Length=319

 Score =   210 bits (534),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 139/324 (43%), Positives = 203/324 (63%), Gaps = 26/324 (8%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEK-STSMQPTPTFTSPVES  400
             +H K++S+VTS+A SSP+      VY+VQSPSRDSHD   GEK +TS   TP  TSP++S
Sbjct  1     MHAKTDSEVTSIAPSSPTRSPRRPVYFVQSPSRDSHD---GEKTATSFHSTPVLTSPMDS  57

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsND----------KGWPECNVIME  550
             P H      S     +R S   R S   K   +++  ND          K W EC+VI E
Sbjct  58    PPH----SRSSVGRHSRESSSSRFSGSLKPGSRKITPNDVSRGAHRKGQKPWKECDVIEE  113

Query  551   EGKYDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYI  730
             EG  ++ +    L RR + L  + GF++LF++F LI+WGA+RP K ++T+KS++     I
Sbjct  114   EGLLEDEDRGKSLPRRCYVLAFILGFVVLFSMFALILWGASRPMKPKITMKSITFEQFKI  173

Query  731   GEGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQS  910
               GSDFTGV T + SVN ++++   N  +F+G+HVS TP++L +S+ITVA+G +KK+YQS
Sbjct  174   QAGSDFTGVATDMASVNSTVKLIFRNTGSFFGVHVSPTPVDLSYSEITVASGTVKKFYQS  233

Query  911   RKSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRT  1090
             RKS R++ +N+ GT+VPLYG+G+SL  +    GT    +PL L F ++S+  V+G+LV+ 
Sbjct  234   RKSHRSMTINVIGTRVPLYGSGASLSGS---TGTPETPLPLKLRFVIRSRAYVLGQLVKP  290

Query  1091  DYRRKIWCELIIDSAG-NKPIKFK  1159
              + R I C +I DS   N P+  K
Sbjct  291   KFYRHIDCPIIFDSKKLNVPMSLK  314



>emb|CDP02504.1| unnamed protein product [Coffea canephora]
Length=310

 Score =   207 bits (528),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 143/320 (45%), Positives = 197/320 (62%), Gaps = 17/320 (5%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGHVYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPVESPSHP  412
             +H K++S+VTSLA SSP+  VYYVQSPSRDSHD   GEK+T S   TP   SPV SP   
Sbjct  1     MHAKTDSEVTSLATSSPNRPVYYVQSPSRDSHD---GEKTTNSFHSTPAALSPVGSP---  54

Query  413   SLGRHSRTssgtrfsgifrsssgrkgrgkrmmsN-----DKGWPECNVIMEEGKYDELED  577
               GRHSR SS TRFSG  +  S +   G R   +     +K W E + I EEG  DE   
Sbjct  55    --GRHSRDSSSTRFSGSLKPGSQKSSNGPRRHHHRLKGEEKQWKEFDAIEEEGLLDEEGG  112

Query  578   SWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGV  757
                + RR + L  + GF +LFT F LI+WGA+R  K  VT+KS+S     +  GSD +GV
Sbjct  113   RRGIPRRCYVLAFVVGFFVLFTFFSLILWGASRNQKPIVTMKSISFDQFIVQAGSDASGV  172

Query  758   PTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLV  937
              T +++ N +L++   N  TF+G+HV+STP++L F+ + V TG +KK+YQSR+S+RTV  
Sbjct  173   ATEMVTTNSTLKLIFRNKGTFFGVHVTSTPLDLSFTQLAVGTGTIKKFYQSRRSQRTVTA  232

Query  938   NIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCE  1117
              +QG+ +PLYG G+ L    +KDG     VPL L+F V+++  V+GKLV+  + R+I C 
Sbjct  233   VLQGSNIPLYGGGADL---SSKDGKPTSPVPLNLNFTVRARAYVLGKLVKPKFSRRIQCS  289

Query  1118  LIIDSAGNKPIKFKKDSCAY  1177
             +++D          K SC Y
Sbjct  290   MVMDPKKMGVAISLKTSCTY  309



>ref|XP_010263513.1| PREDICTED: uncharacterized protein LOC104601752 [Nelumbo nucifera]
Length=320

 Score =   207 bits (528),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 145/332 (44%), Positives = 204/332 (61%), Gaps = 29/332 (9%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPVES  400
             +H K++S+VTSLA SSP+      VYYVQSPSRDSHD   GEK+T S   TP   SP+ S
Sbjct  1     MHAKTDSEVTSLAPSSPTRSPRRPVYYVQSPSRDSHD---GEKTTTSFHSTPVL-SPMGS  56

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsND-----------KGWPECNVIM  547
             P H     HS     +R S   R S   K    ++  ND           K W EC VI 
Sbjct  57    PPH----SHSSVGRHSRESSSSRFSGSLKPGSHKITPNDGSRGGPHRKGQKPWKECAVIE  112

Query  548   EEGKYDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIY  727
             EEG  ++      L RR + L  + GF+LLF++F LI+WGA+RP K  +T+KS++   I 
Sbjct  113   EEGLLEDETAERSLPRRCYYLAFVLGFILLFSLFSLILWGASRPQKPTITMKSITFEQIV  172

Query  728   IGEGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQ  907
             I  G+D TGV T ++S+N ++++   N ATF+G+HV+STP++L +S ++VA+G +KK+YQ
Sbjct  173   IQSGTDATGVATDMVSLNSTVKLVFRNTATFFGVHVTSTPVDLSYSQLSVASGTIKKFYQ  232

Query  908   SRKSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVR  1087
             SRKS+RT+ V + G K+PLYG+G  L ++    GT  V VPL L F V+S+  V+GKLV+
Sbjct  233   SRKSQRTMTVVVMGNKIPLYGSGEGLSSS---TGTLTVPVPLKLSFMVRSRAYVLGKLVK  289

Query  1088  TDYRRKIWCELIIDSAG-NKPIKFKKDSCAYS  1180
               + + I C +++D    N PI   K+SC YS
Sbjct  290   PKFHKTIECSVVLDPKKLNVPISL-KNSCTYS  320



>ref|XP_011083882.1| PREDICTED: uncharacterized protein LOC105166274 [Sesamum indicum]
Length=323

 Score =   207 bits (528),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 140/328 (43%), Positives = 204/328 (62%), Gaps = 21/328 (6%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH---VYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPVESP  403
             +H K++S+VTSLA SSP  +   VYYVQSPSRDSHD   GEK+T S   TP   SP+ SP
Sbjct  1     MHAKTDSEVTSLAPSSPDHNRRPVYYVQSPSRDSHD---GEKTTMSFHSTPVMGSPMGSP  57

Query  404   --SHPSLGRHSRTssgtrfsgifrsssgrkg-------rgkrmmsNDKGWPECNVIMEEG  556
               SH S+GRHSR SS +RFSG  +  S +                  K   EC+VI EEG
Sbjct  58    PHSHSSVGRHSRESSTSRFSGSLKPGSRKISPNDVGSGGRGHGKGGQKNRKECDVIEEEG  117

Query  557   KYDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGE  736
               ++ E S  L RR + L  + GF +LF++F LI+WGA++P K ++T++S+ +    +  
Sbjct  118   LLEDEESSKGLPRRCYFLAFVVGFFVLFSLFALILWGASKPQKPEITMRSIKIERFVVQA  177

Query  737   GSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRK  916
             GSD TGV T ++S+N +++ +  N  TF+G+HVSS+P++L +S +T+ +G +KK+Y+ R+
Sbjct  178   GSDDTGVSTDMISMNSTVKFTFRNTGTFFGVHVSSSPLDLSYSQLTIGSGDMKKFYKGRR  237

Query  917   SRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDY  1096
               + V V + G K+PLYG+G+SL       G   + VPL LDF ++S+  V+GKLV+  +
Sbjct  238   GVKDVTVTVIGDKIPLYGSGASL---STPTGITTLPVPLKLDFTLRSRAYVLGKLVKPRF  294

Query  1097  RRKIWCELIIDSAG-NKPIKFKKDSCAY  1177
               KI C ++ D+   N PI  KK SC Y
Sbjct  295   HNKIECSIVFDAKKLNVPISLKK-SCTY  321



>ref|XP_010688841.1| PREDICTED: uncharacterized protein LOC104902677 [Beta vulgaris 
subsp. vulgaris]
Length=321

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 150/327 (46%), Positives = 198/327 (61%), Gaps = 20/327 (6%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH-----VYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPVE  397
             +H K++S+VTSLAASSP+       VYYVQSPSRDSHD   GEK+T S   TP   SP+ 
Sbjct  1     MHAKTDSEVTSLAASSPNRSPPRRPVYYVQSPSRDSHD---GEKTTTSFHSTPVL-SPMG  56

Query  398   SP--SHPSLGRHSR----TssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGK  559
             SP  SH SLGRHSR    T            ++ +    K+       W EC+VI EEG 
Sbjct  57    SPPHSHSSLGRHSRESSSTRFSGSRKISPNDAAKKAAHNKKQQQQQSPWKECDVIEEEGL  116

Query  560   YDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEG  739
              ++ E    L RR + L  + GFLLLF+ F LI+WGAARP K ++T+KS+      +  G
Sbjct  117   IEDEESHKPLPRRCYVLAFIFGFLLLFSFFSLILWGAARPQKPKITIKSIKFDRFMVSAG  176

Query  740   SDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKS  919
             SD TGV T + SVN +L+    N ATF+G+HV+STP++L +S I VATG LKK+YQSRKS
Sbjct  177   SDHTGVATEMASVNSTLKFLYRNTATFFGVHVTSTPLDLSYSQIVVATGNLKKFYQSRKS  236

Query  920   RRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYR  1099
             ++TV V I G K+PLYG+G SL  T     T  V   ++L F V+S+  V+G+LV+  + 
Sbjct  237   QKTVNVQIYGDKIPLYGSGQSLVGTSTGVPTAAVN--MSLSFTVRSRAYVLGRLVKPKFY  294

Query  1100  RKIWCELIID-SAGNKPIKFKKDSCAY  1177
             R I C ++ D    N  I  KK +C Y
Sbjct  295   RFIDCSVVYDPKKPNSAISLKK-ACTY  320



>ref|XP_002301174.1| hypothetical protein POPTR_0002s12620g [Populus trichocarpa]
 gb|EEE80447.1| hypothetical protein POPTR_0002s12620g [Populus trichocarpa]
Length=319

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 141/330 (43%), Positives = 205/330 (62%), Gaps = 28/330 (8%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPVES  400
             +H K++S+VTSLA SSP+      VYYVQSPSRDSHD   GEK+T S   TP   SP+ S
Sbjct  1     MHAKTDSEVTSLAPSSPTRSPRRPVYYVQSPSRDSHD---GEKTTTSFHSTPVL-SPMGS  56

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsND----------KGWPECNVIME  550
             P H     HS     +R S   R S   K   +++  ND          K W EC+VI E
Sbjct  57    PPH----SHSSVGRHSRESSSSRFSGSLKPGSRKISPNDASRGGQGKGQKQWKECDVIEE  112

Query  551   EGKYDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYI  730
             EG  ++ E    L RR + L  + GF +LF++F LI+WGA++P K ++T+KS++     I
Sbjct  113   EGLLEDEERRKGLPRRCYFLAFVLGFFILFSLFSLILWGASKPQKPKITMKSITFEQFRI  172

Query  731   GEGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQS  910
               GSD TGV T ++SVN +++++  N  TF+G+ V+STP++L +S+IT+A+G +KK+YQS
Sbjct  173   QAGSDSTGVATDMISVNSTVKMTYRNKGTFFGVRVTSTPLDLSYSEITIASGNIKKFYQS  232

Query  911   RKSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRT  1090
             RKS+R V + +   K+PLYG+G+ L ++    GT  + VPL ++F V+S+  V+GKLV+T
Sbjct  233   RKSQRPVAIPVISNKIPLYGSGAGLSSS---TGTTTLPVPLKMNFVVRSRAYVLGKLVKT  289

Query  1091  DYRRKIWCELIIDSAG-NKPIKFKKDSCAY  1177
              + RKI C+   D    N PI   K++C Y
Sbjct  290   KFNRKIECDFTFDPKKLNVPISL-KEACTY  318



>ref|XP_009146172.1| PREDICTED: uncharacterized protein LOC103869856 isoform X2 [Brassica 
rapa]
Length=276

 Score =   201 bits (511),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 140/314 (45%), Positives = 201/314 (64%), Gaps = 44/314 (14%)
 Frame = +2

Query  254   SDVTSLAAS---SPSGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESPSHPS--L  418
             SD+TSLAAS   S    +YYVQSPSRDS+       ++  QP+    + ++SP+H S  L
Sbjct  2     SDMTSLAASPSRSSKRAMYYVQSPSRDSY-------TSVTQPS----TMMDSPTHDSYSL  50

Query  419   GRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDSWLLSRR  598
             GRHSR SS +RFSGI RSSS  +   K+  SN+K   E   I+EEG Y+E++D   + RR
Sbjct  51    GRHSRNSSESRFSGISRSSSSDRKNVKKCRSNEK---EYETILEEGSYEEMDDVTSI-RR  106

Query  599   FHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPTRLLSV  778
               A+LA+  F+ LF   CLI WGA+RPYKAQ+++++  + N Y+G+GSDF G+ T+LL++
Sbjct  107   SQAILAVFIFISLFAFCCLITWGASRPYKAQISVQTFELRNFYVGQGSDFYGMHTKLLTL  166

Query  779   NGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNIQGTKV  958
             NG+LRI +YNPA  +GIH                   LK++YQ +KS+ T  V I+G ++
Sbjct  167   NGTLRIGIYNPAPTFGIH-------------------LKEHYQPKKSQYTEAVVIEGRRI  207

Query  959   PLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELIIDSAG  1138
             PLYGAG+SL AT+      G ++ + L FEVK++GDVVG+LV   ++++I C  +ID A 
Sbjct  208   PLYGAGASLEATER-----GGKIQVNLRFEVKTRGDVVGRLVTIRHKKRISCSFVIDVAI  262

Query  1139  NKPIKFKKDSCAYS  1180
             +K +   K  C+YS
Sbjct  263   SKRVPIDKSDCSYS  276



>gb|KHG02664.1| hypothetical protein F383_26016 [Gossypium arboreum]
Length=310

 Score =   202 bits (513),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 121/301 (40%), Positives = 182/301 (60%), Gaps = 14/301 (5%)
 Frame = +2

Query  281   SPSGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESPSHPSLGRHSRTssgtrfsg  460
             SP   +YYVQSPSRDSHD   GEK+T+   +    SP  S S+ SLG HS          
Sbjct  23    SPRRQMYYVQSPSRDSHD---GEKTTNSSNSTPVLSPTHSQSNSSLGPHS-------SRE  72

Query  461   ifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYD-ELEDSWLLSRRFHallalcgflll  637
                +   +    ++  +N + W E + I EE   D E     L  RR + L  L GF +L
Sbjct  73    SSSTRLSKHHGSRKPRTNKQSWKEFDAIEEEALLDGEAAHHALHRRRCYFLAFLVGFFVL  132

Query  638   fTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPTRLLSVNGSLRISVYNPAT  817
             FT F LI+WGA+R  K ++T+KS+S +   +  G+DF+GV T ++S+N +++++  N AT
Sbjct  133   FTTFSLILWGASRLQKPKITMKSISFNEFVVQAGADFSGVSTEMVSMNCTVKLTYRNTAT  192

Query  818   FYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNIQGTKVPLYGAGSSLPATK  997
             F+G+HV+STP++L +S +TVATG + K+YQSRKS+R ++V ++G+ +PLYG G+SL +  
Sbjct  193   FFGVHVTSTPLHLSYSQLTVATGSIHKFYQSRKSQRALIVMMKGSHIPLYGGGASLASL-  251

Query  998   NKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELIIDSAGNKPIKFKKDSCAY  1177
               +G     VPLALDF V+S+  V+GKLV+  + ++I C   +D          K+ C+Y
Sbjct  252   --NGAPTQPVPLALDFMVRSRAYVLGKLVKPKFYKRIQCWAAMDPKKMSKAISLKNKCSY  309

Query  1178  S  1180
             S
Sbjct  310   S  310



>ref|XP_009414850.1| PREDICTED: uncharacterized protein LOC103995857 [Musa acuminata 
subsp. malaccensis]
Length=316

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 132/327 (40%), Positives = 191/327 (58%), Gaps = 23/327 (7%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESPSHPS  415
             +H K++S+VTS+A SSP+  VYYVQSPSRDSHD   GEK+     T   +SPV SP+H  
Sbjct  1     MHAKTDSEVTSIAPSSPARPVYYVQSPSRDSHD---GEKTA----TSFHSSPVLSPAHSP  53

Query  416   LGRHSRTssgtrfsgifrsssgrkgrgkrmmsND-----------KGWPECNVIMEEGKY  562
                HS     +R S   R S   K   ++++ ND           K W EC VI EEG  
Sbjct  54    PHSHSSVGRHSRDSSSSRFSGSLKPGSRKILPNDGAGRGGRRKSDKAWKECAVIEEEGLL  113

Query  563   DELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGS  742
             D   D   + RR + L  +  F +LF+ F LI+WGA+R  K Q+ +KS+   N  I  G+
Sbjct  114   DGEADDKGIPRRCYVLGFVLAFFVLFSFFALILWGASRNQKPQIVMKSIKFENFIIQAGT  173

Query  743   DFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSR  922
             D + VPT + ++N +++ +  N  +F+G+HV+STP+ L +  +T+A G +K +YQSRKSR
Sbjct  174   DASLVPTDMSTLNSTVKFTYRNTGSFFGVHVTSTPLYLNYYQLTMANGDMKSFYQSRKSR  233

Query  923   RTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRR  1102
             R V V + G KVPLYG G SL +T  K  T G  V + L F ++S+  V+GKLV+  +  
Sbjct  234   RDVNVVVMGNKVPLYGGGPSLSSTGGK--TAG-PVNMTLSFTIRSRAYVLGKLVKPKFYN  290

Query  1103  KIWCELIIDSAG-NKPIKFKKDSCAYS  1180
              + C +++D    N P+   K+SC Y+
Sbjct  291   NVQCSVLMDQTKLNSPVSL-KNSCQYN  316



>ref|XP_010533303.1| PREDICTED: uncharacterized protein LOC104809106 [Tarenaya hassleriana]
Length=659

 Score =   209 bits (533),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 136/319 (43%), Positives = 188/319 (59%), Gaps = 33/319 (10%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSG---HVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESP  403
             M +  SESD+TSL  SSP      VYYVQSPSRDS DDGD   + ++    T T+P +SP
Sbjct  1     MANATSESDMTSLDLSSPRSPKRTVYYVQSPSRDSQDDGDKSSTVAL----TGTTPTDSP  56

Query  404   SHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKG-WPECNVIMEEGKYDELE-D  577
             SH S                  +S      G       +G W E +VI EEG  DE E +
Sbjct  57    SHQS-----------------SASRVSGSGGGFRWKGRRGRWSERHVIEEEGD-DEYEVN  98

Query  578   SWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGV  757
               + +     LL    F   F V CL +  AARP+   V +KSL V++ Y GEGSD TGV
Sbjct  99    RGISTGTCRILLGAFAFAFAFLVLCLSLLAAARPFSPIVDVKSLKVNSFYYGEGSDKTGV  158

Query  758   PTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSD-ITVATGQLKKYYQSRKSRRTVL  934
             PT++L++N SL++++ NPATF+GIHVS +   L++SD   +ATGQ+K YYQ RKS+   +
Sbjct  159   PTKILNMNSSLKMTIRNPATFFGIHVSFSTFKLIYSDHFVLATGQMKSYYQPRKSKHMAM  218

Query  935   VNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWC  1114
             V + G+K+PLYGAG+ L A+   D  GG  VP+ L+FE +S+G+VVG +V++ YR+ I C
Sbjct  219   VELLGSKIPLYGAGAYLAAS---DKNGG--VPVTLEFEFRSRGNVVGSMVKSKYRKSISC  273

Query  1115  ELIIDSAGNKPIKFKKDSC  1171
                I S     +KF +++C
Sbjct  274   FFFISSYVTNLVKFNENTC  292


 Score =   186 bits (472),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 130/328 (40%), Positives = 185/328 (56%), Gaps = 28/328 (9%)
 Frame = +2

Query  242   TKSESDVTSL-------AASSPSGHVYYVQSPS-RDSHDDGDGEKSTSMQPT----PTFT  385
             T SESD+ S        ++ SP    YYVQSPS RDSHD  D E ST+        P + 
Sbjct  341   TGSESDMMSFDLSSSSSSSPSPKPMAYYVQSPSSRDSHDVDDDESSTTALTQATATPIYD  400

Query  386   SPVESPSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIME--EGK  559
             SP ES S+   G  SR SS +   G                   +G    +V  E   G+
Sbjct  401   SPSESYSY---GPFSRLSSSSSSGGFRWKGRRGMWPPPPPPPRPEG----HVFHEVGGGR  453

Query  560   YDEL--EDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIG  733
             Y++L  +  W+ + +   LL +    L+FTVFC I+WGA++P+   V +KSL V    +G
Sbjct  454   YEDLYGDKGWISTWKCRVLLFMVAVALIFTVFCSIVWGASKPFIPVVIVKSLKVHGFELG  513

Query  734   EGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSR  913
              G D TGVPT +LS+  S+ ++V NPA+F+GIHVSS+P+ L+F D T+ATGQLK YYQ R
Sbjct  514   GGLDRTGVPTNILSMKSSVNMTVENPASFFGIHVSSSPLKLIFYDFTLATGQLKSYYQPR  573

Query  914   KSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTD  1093
             KS+   +V +   KVPLYGAG  L A+  K      +VP+ L+ E+++ G+++GKLVR+ 
Sbjct  574   KSKHMAMVELTAVKVPLYGAGPYLAASDRKG-----RVPVKLELEIQTCGNIIGKLVRSK  628

Query  1094  YRRKIWCELIIDSAGNKPIKFKKDSCAY  1177
             +R  + C   I S  +K I+F   +C +
Sbjct  629   HRNHLSCSFYISSRNSKLIQFTDKTCRH  656



>ref|XP_009107444.1| PREDICTED: uncharacterized protein LOC103833105 [Brassica rapa]
Length=341

 Score =   202 bits (514),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 139/323 (43%), Positives = 199/323 (62%), Gaps = 32/323 (10%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEK-STSMQPTPTFTSPVES  400
             +H K++S+VTS+AASSP+      VYYVQSPSRDSHD   GEK +TS   TP   SP+ S
Sbjct  1     MHAKTDSEVTSIAASSPARSPRRPVYYVQSPSRDSHD---GEKTATSFHSTPVL-SPMGS  56

Query  401   PSHP--SLGRHSRTssgtrfsgifrsssgrkgrgkrmmsN--DKGWPECNVIMEEGKYDE  568
             P H   S+GRHSR SS TRFSG  +  S +   G +   +  +K W EC +I EEG  D+
Sbjct  57    PPHSQSSMGRHSRESSSTRFSGSLKPGSRKVNDGSKRKGHGGEKQWKECAMIEEEGLLDD  116

Query  569   LEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDF  748
              E    L RR + L  + GF +L  +F LI++GAA+P K ++T+KS++   + +  G D 
Sbjct  117   GERDRGLPRRCYVLAFIVGFFILLGLFSLILYGAAKPQKPKITVKSITFETLKVQAGQDA  176

Query  749   TGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRT  928
              GV T ++++N +LR+   N  TF+G+HV+STPI+L FS + + +G +KK+YQSRKS+RT
Sbjct  177   GGVGTDMITMNATLRMLYRNTGTFFGVHVTSTPIDLSFSQMKIGSGSIKKFYQSRKSQRT  236

Query  929   VLVNIQGTKVPLYGAGSSL-------------------PATKNKDGTGGVQVPLALDFEV  1051
             VLV+I G K+PLYG+G++L                   P            VP+ L F V
Sbjct  237   VLVHITGEKIPLYGSGATLIPPAPPAPLPKPKKKKKGAPVVIPDPPAPPAPVPMKLSFIV  296

Query  1052  KSQGDVVGKLVRTDYRRKIWCEL  1120
             +S+G V+GKLV+  + +KI C++
Sbjct  297   RSRGYVLGKLVKPKFLKKIECDI  319



>gb|KHN23741.1| hypothetical protein glysoja_033624 [Glycine soja]
Length=297

 Score =   201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 131/320 (41%), Positives = 194/320 (61%), Gaps = 30/320 (9%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH-----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             +H K++S+VTSLAASSP+       +YYVQSPSRDSHD   GEK+ +   T   ++PV S
Sbjct  1     MHAKTDSEVTSLAASSPTRSPPRRPLYYVQSPSRDSHD---GEKTAT---TSFHSTPVLS  54

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDS  580
             PS                    R SS  +   K    + K W + +VI EEG     +  
Sbjct  55    PS--------------ASPPHSRHSSSTRFSKKDHSHSLKPWKQIDVIEEEGLLQGDDRR  100

Query  581   WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
               L RR + L  + GFL+LF+ F LI+WGA+RP K ++T++S++  ++ +  GSD TGV 
Sbjct  101   NGLPRRCYFLAFVVGFLVLFSFFSLILWGASRPMKPKITIRSITFDHVRVQAGSDATGVA  160

Query  761   TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVN  940
             T ++++N +L+ +  N  TF+G+HV+STP+ L +SDI +A G LKK+YQSR+S+R + V+
Sbjct  161   TDMITLNSTLKFTYRNTGTFFGVHVTSTPVELSYSDIVIAAGNLKKFYQSRRSQRLLSVS  220

Query  941   IQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCEL  1120
             + G K+PLYG+G+SL +T    G   + VPL L+F ++S+  V+GKLV+  Y + I C +
Sbjct  221   VMGNKIPLYGSGASLSST---TGVPTLPVPLNLNFVLRSRAYVLGKLVKPKYYKTIKCSI  277

Query  1121  IIDSAG-NKPIKFKKDSCAY  1177
              +D    N  I  KK SC Y
Sbjct  278   TLDPKKLNAAISLKK-SCTY  296



>ref|XP_006587484.1| PREDICTED: uncharacterized protein LOC100817451 [Glycine max]
Length=297

 Score =   200 bits (508),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 131/320 (41%), Positives = 193/320 (60%), Gaps = 30/320 (9%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH-----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             +H K++S+VTSLAASSP+       +YYVQSPSRDSHD   GEK+ +   T   ++PV S
Sbjct  1     MHAKTDSEVTSLAASSPTRSPPRRPLYYVQSPSRDSHD---GEKTAT---TSFHSTPVLS  54

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDS  580
             PS                    R SS  +   K    + K W + +VI EEG     +  
Sbjct  55    PS--------------ASPPHSRHSSSTRFSKKDHSHSLKPWKQIDVIEEEGLLQGDDRR  100

Query  581   WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
               L RR + L  + GFL+LF+ F LI+WGA+RP K ++T++S++  ++ +  GSD TGV 
Sbjct  101   NGLPRRCYFLAFVVGFLVLFSFFSLILWGASRPMKPKITIRSITFDHVRVQAGSDATGVA  160

Query  761   TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVN  940
             T ++++N +L+ +  N  TF+G+HV+STP+ L +SDI +A G LKK+YQSR+S+R + V+
Sbjct  161   TDMITLNSTLKFTYRNTGTFFGVHVTSTPVELSYSDIVIAAGNLKKFYQSRRSQRLLSVS  220

Query  941   IQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCEL  1120
             + G K+PLYG+G+SL +T    G   + VPL L F ++S+  V+GKLV+  Y + I C +
Sbjct  221   VMGNKIPLYGSGASLSST---TGVPTLPVPLNLSFVLRSRAYVLGKLVKPKYYKTIKCSI  277

Query  1121  IIDSAG-NKPIKFKKDSCAY  1177
              +D    N  I  KK SC Y
Sbjct  278   TLDPKKLNAAISLKK-SCTY  296



>ref|XP_004238140.1| PREDICTED: uncharacterized protein LOC101250111 isoform X1 [Solanum 
lycopersicum]
Length=320

 Score =   200 bits (509),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 141/329 (43%), Positives = 203/329 (62%), Gaps = 23/329 (7%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH---VYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPVESP  403
             +HTK++S+ TSLA SSP       YYVQSPSRDSHD   GEK+T S   TP   SP+ SP
Sbjct  1     MHTKTDSEDTSLAPSSPDNRGPTAYYVQSPSRDSHD---GEKTTTSFHSTPVI-SPMGSP  56

Query  404   --SHPSLGRHSRTssgtrfsgifrsssgrkgrgkr-------mmsNDKGWPECNVIMEEG  556
               SH S+GRHSR SS +RFSG  +  S +                  K W EC+VI EEG
Sbjct  57    PHSHSSVGRHSRDSSSSRFSGSLKPGSQKILPDAAGGVGGRHHRKGQKPWKECDVIEEEG  116

Query  557   KYDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGE  736
               ++   S  L RR + L  + GF +LF+ F LI+WGA+RP K ++T++++   +  I  
Sbjct  117   LLEDDRSSKSLPRRCYVLAFVVGFFVLFSFFALILWGASRPQKPKITMRTIKFDHFGIQA  176

Query  737   GSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRK  916
             GSD TGV T ++S+N +++    N A+F+G+HV+STP++L FS++T+ +G +KK+YQSRK
Sbjct  177   GSDATGVATDMISMNATVKFLYRNTASFFGVHVTSTPLDLSFSELTIGSGAMKKFYQSRK  236

Query  917   SRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDY  1096
             S+R V V++ G K+PLYG G+SL       G   + VPL L+F+++S+  V+GK+V+  +
Sbjct  237   SQRVVAVSVIGNKIPLYGGGASL---STPAGATPLPVPLKLNFKLRSRAYVLGKMVKPKF  293

Query  1097  RRKIWCELII-DSAGNKPIKFKKDSCAYS  1180
              + I C L +     N  I  K  +C YS
Sbjct  294   YKTIDCLLTLRPQKMNAAISLK--NCTYS  320



>ref|XP_009405343.1| PREDICTED: uncharacterized protein LOC103988523 [Musa acuminata 
subsp. malaccensis]
Length=322

 Score =   200 bits (508),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 138/326 (42%), Positives = 191/326 (59%), Gaps = 17/326 (5%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSP----SGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESP  403
             +H K++S+VTSLAASSP       VYYVQSPSRDSHD      +TS   TP   SP+ SP
Sbjct  1     MHAKTDSEVTSLAASSPPRSPRRQVYYVQSPSRDSHDGEKTTATTSFHSTPVL-SPMASP  59

Query  404   --SHPSLGRHSRTssgtrfsgifr------sssgrkgrgkrmmsNDKGWPECNVIMEEGK  559
               SH S+G  SR SS +RFSG  +        S    R      +DK W EC  I EEG 
Sbjct  60    RHSHSSVGPQSRDSSSSRFSGGIKPGGGPRKMSSHDDRKGGRNKSDKAWKECATIEEEGL  119

Query  560   YDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEG  739
              ++  +   L RR + L  L GF++LF+ F LI+WGA+R  K ++T+KS+   N  I  G
Sbjct  120   LEDEREEKGLPRRCYYLAFLLGFVILFSFFALILWGASRSQKPEITMKSIRFENFIIQAG  179

Query  740   SDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKS  919
             +D + VPT + ++N ++R S  N  TF+G+HVS+TP  L +  +T+A G +  +YQSRKS
Sbjct  180   TDASLVPTDMATLNSTVRFSFRNTGTFFGVHVSATPFVLSYDQLTLAGGDMNNFYQSRKS  239

Query  920   RRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYR  1099
             +R V V + G KVPLYG G SL ++     T    VPL+L F VKS+  V+GKLV+  + 
Sbjct  240   QRNVEVVVLGKKVPLYGGGPSLASSPGSVAT----VPLSLSFMVKSRAYVLGKLVKPKFE  295

Query  1100  RKIWCELIIDSAGNKPIKFKKDSCAY  1177
               + C++++  A        K+SC Y
Sbjct  296   IGVQCKVVMKPAKLNTRVSLKNSCQY  321



>ref|XP_002510197.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52384.1| conserved hypothetical protein [Ricinus communis]
Length=319

 Score =   199 bits (505),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 135/330 (41%), Positives = 201/330 (61%), Gaps = 28/330 (8%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPVES  400
             +H K++S+VTSLA SSP+      VY+VQSPSRDSHD   GEK+T S   TP   SP+ S
Sbjct  1     MHAKTDSEVTSLAPSSPTRSPRRPVYFVQSPSRDSHD---GEKTTTSFHSTPVL-SPMGS  56

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsND----------KGWPECNVIME  550
             P H     HS     +R S   R S   K   +++  ND          K W +C VI E
Sbjct  57    PPH----SHSSVGRHSRESSSSRFSGSLKPGSRKISPNDASKSSHRKGQKQWKDCAVIEE  112

Query  551   EGKYDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYI  730
             EG  ++      L RR + L  L GF +LF+ F L++WGA++P K ++T+K++   +  I
Sbjct  113   EGLLEDEAREKGLPRRCYFLAFLLGFFVLFSFFSLVLWGASKPQKPKITMKNIKFEHFSI  172

Query  731   GEGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQS  910
               GSD TGV T ++S+N ++++   N  TF+G+HV+STP++L +S+IT+A+G +KK+YQS
Sbjct  173   QAGSDSTGVATDMISINSTVKMIYRNTGTFFGVHVTSTPVDLFYSEITIASGAVKKFYQS  232

Query  911   RKSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRT  1090
             RKS+R+V +++   K+PLYG+G+   ++    GT  + VPL L F ++S+  V+GKLV+ 
Sbjct  233   RKSQRSVAISVMSNKIPLYGSGAGFSSS---TGTTALPVPLKLSFVLRSRAYVLGKLVKP  289

Query  1091  DYRRKIWCELIIDSAG-NKPIKFKKDSCAY  1177
              + ++I C+   D    N PI  KK SC Y
Sbjct  290   KFYKRIECDFTFDPKKLNVPISLKK-SCTY  318



>ref|XP_009604889.1| PREDICTED: uncharacterized protein LOC104099562 [Nicotiana tomentosiformis]
Length=322

 Score =   198 bits (504),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 135/335 (40%), Positives = 201/335 (60%), Gaps = 33/335 (10%)
 Frame = +2

Query  236   LHTKSESDVTS-LAASSPSGH---VYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPVES  400
             +H K++SDVTS LA SSP  +   VYYVQSPSRDSHD   GEK+T S   TP   SP+ S
Sbjct  1     MHAKTDSDVTSSLAPSSPDHNRRPVYYVQSPSRDSHD---GEKTTTSFHSTPVI-SPMGS  56

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsND--------------KGWPECN  538
             P H     HS     +R S   R S   K   +++  ND              K W EC+
Sbjct  57    PPH----SHSSVGRHSRESSSSRFSGSLKPGSRKISPNDAAAAAGGRNHRKGQKPWKECD  112

Query  539   VIMEEGKYDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVS  718
             VI EEG  ++ + S  L RR + L  +  F +LF+ F L++WGA+RP K ++T++S+   
Sbjct  113   VIEEEGLLEDDQYSKPLPRRCYFLAFVVAFFILFSFFALVLWGASRPQKPKITMRSIKFE  172

Query  719   NIYIGEGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKK  898
                I  GSD +GV T ++S+N +++    N ATF+G+HV+S+P++L FS++ + +G +KK
Sbjct  173   RFGIQAGSDNSGVATDMISMNATVKFVYRNTATFFGVHVTSSPVDLSFSELILGSGAMKK  232

Query  899   YYQSRKSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGK  1078
             ++QSRKS+R V V++ G K+PLYG+G+SL   K   G     VPL L+F+V+S+  V+G+
Sbjct  233   FHQSRKSQRVVAVSVIGNKIPLYGSGASLSTPK---GATAQPVPLKLNFKVRSRAYVLGQ  289

Query  1079  LVRTDYRRKIWCELIIDSAG-NKPIKFKKDSCAYS  1180
             LV+  + + I C + +++   N  I  K  +C YS
Sbjct  290   LVKPKFYKTIDCLITLNTQKLNVAIPLK--NCTYS  322



>ref|XP_009611037.1| PREDICTED: uncharacterized protein LOC104104606 [Nicotiana tomentosiformis]
Length=320

 Score =   198 bits (503),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 138/327 (42%), Positives = 197/327 (60%), Gaps = 27/327 (8%)
 Frame = +2

Query  239   HTKSESDVTSLAASSPSGHVYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPVESPSHPS  415
             H K++S+VTSLA SSP+  VYYVQSPSRDSHD   GEK+T S   TP   SP+ SP    
Sbjct  6     HAKTDSEVTSLAPSSPNRPVYYVQSPSRDSHD---GEKTTNSFHSTPIL-SPMGSP----  57

Query  416   LGRHSRTssgtrfsgifrsssgrkgrg------------krmmsNDKGWPECNVIMEEGK  559
              GR SR SS TR+SG  + S+ +                +      + W E + I EEG 
Sbjct  58    -GRQSRDSSSTRYSGSLKPSTHKSSTNGSRSSSSRHHQHRHRKGEKQQWNEFDAIEEEGL  116

Query  560   YDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEG  739
              D+      L RR + L  + GF +LFT F LI+WGA+R  K  VT++S+S +   I  G
Sbjct  117   LDDDGYRKGLPRRCYFLAFVVGFFVLFTFFSLILWGASRNQKPVVTMRSISFNEFGIQAG  176

Query  740   SDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKS  919
              D +GV T ++S+N ++++   N  TF+G+HV+STP+ L FS +TVATG +KK+YQ RKS
Sbjct  177   MDSSGVATEMVSMNSTVKMRFRNTGTFFGVHVTSTPLVLSFSQLTVATGSVKKFYQRRKS  236

Query  920   RRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYR  1099
             +RTV V + G+K+PLYG G+ L +   K+G     V L LDF+V+++  V+G++V+  + 
Sbjct  237   QRTVTVTLIGSKIPLYGGGADLIS---KEGKPVAAVSLVLDFKVRARAYVLGRVVKPKFY  293

Query  1100  RKIWCELIID-SAGNKPIKFKKDSCAY  1177
               + C +++D    N PI  +K SC Y
Sbjct  294   NTVQCSVVMDPKKMNVPISLQK-SCTY  319



>ref|XP_003528962.1| PREDICTED: uncharacterized protein LOC100811519 [Glycine max]
Length=297

 Score =   197 bits (501),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 131/320 (41%), Positives = 191/320 (60%), Gaps = 30/320 (9%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH-----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             +H K++S+VTSLAASSP+       +YYVQSPSRDSHD   GEK+ +   T   ++PV S
Sbjct  1     MHAKTDSEVTSLAASSPTRSPPRRPLYYVQSPSRDSHD---GEKTAT---TSFHSTPVLS  54

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDS  580
             PS                    R SS  +   K    + K W + +VI EEG     +  
Sbjct  55    PS--------------ASPPHSRHSSSTRFSKKDHSHSLKPWKQIDVIEEEGLLQGDDHH  100

Query  581   WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
               L RR + L  + GFL+LF+ F LI+WGA+RP K ++ +KS+   ++ +  GSD TGV 
Sbjct  101   NGLPRRCYFLAFVVGFLVLFSFFSLILWGASRPMKPKINIKSIKFDHVRVQAGSDATGVA  160

Query  761   TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVN  940
             T ++++N +L+ +  N  TF+G+HV+STP+ L +SDI +A+G +KK+YQSR+S+R V V 
Sbjct  161   TDMITLNSTLKFAYRNTGTFFGVHVTSTPVELSYSDIVIASGNMKKFYQSRRSQRLVSVA  220

Query  941   IQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCEL  1120
             + G K+PLYG+G+SL +T    G   V V L L+F ++S+  V+GKLV+  Y + I C +
Sbjct  221   VMGNKIPLYGSGASLSST---TGVPTVPVLLNLNFVLRSRAYVLGKLVKPKYYKTIQCSI  277

Query  1121  IIDSAG-NKPIKFKKDSCAY  1177
              +D    N  I  KK SC Y
Sbjct  278   TLDPKKLNAAISLKK-SCTY  296



>ref|XP_004512880.1| PREDICTED: uncharacterized protein LOC101513762 [Cicer arietinum]
Length=303

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 124/320 (39%), Positives = 191/320 (60%), Gaps = 24/320 (8%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH-----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             +H K++S+ TSLA SSP+       +YYVQSPSRDSHD+     + S   TP   SPV S
Sbjct  1     MHRKTDSEGTSLATSSPTRSPPRRPIYYVQSPSRDSHDEKT--VTNSFHSTPVL-SPVAS  57

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDS  580
             P H            +  +     +  +         + K W + +VI EEG  +  + S
Sbjct  58    PPH-----------SSSSTNFSSQTRKKHHHQHHHNHSHKPWKQIDVIEEEGLLEREDRS  106

Query  581   WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
                 RR +    + GFLLLF++F +I+WGA+R  K ++ +KS+   ++ +  GSD TGV 
Sbjct  107   GSFPRRCYFPAFVVGFLLLFSLFSVILWGASRHMKPKIVVKSIKFDHVRVQAGSDSTGVA  166

Query  761   TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVN  940
             T ++++N +L+ +  N  TF+G+HVS+TP+ L +SDIT+A+G +K+++QSRKS+R V V 
Sbjct  167   TDMITMNSTLKFTYRNTGTFFGVHVSATPLELSYSDITIASGNMKEFHQSRKSQRLVSVT  226

Query  941   IQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCEL  1120
             + G K+PLYG+G+SL +T    GT  + VPL L+F ++S+ +V+GKLV+  Y ++I C +
Sbjct  227   VTGNKIPLYGSGASLSST---TGTPTLPVPLNLNFVLRSRANVLGKLVKPKYYKRIQCSI  283

Query  1121  IIDSAG-NKPIKFKKDSCAY  1177
              +D      PI  KK SC Y
Sbjct  284   TLDPKKLGAPISLKK-SCKY  302



>gb|KHN44600.1| hypothetical protein glysoja_027211 [Glycine soja]
Length=297

 Score =   197 bits (501),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 131/320 (41%), Positives = 191/320 (60%), Gaps = 30/320 (9%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH-----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             +H K++S+VTSLAASSP+       +YYVQSPSRDSHD   GEK+ +   T   ++PV S
Sbjct  1     MHAKTDSEVTSLAASSPTRSPPRRPLYYVQSPSRDSHD---GEKTAT---TSFHSTPVLS  54

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDS  580
             PS                    R SS  +   K    + K W + +VI EEG     +  
Sbjct  55    PS--------------ASPPHSRHSSSTRFSKKDHSHSLKPWKQIDVIEEEGLLQGDDHH  100

Query  581   WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
               L RR + L  + GFL+LF+ F LI+WGA+RP K ++ +KS+   ++ +  GSD TGV 
Sbjct  101   NGLPRRCYFLAFVVGFLVLFSFFSLILWGASRPMKPKINIKSIKFDHVRVQAGSDATGVA  160

Query  761   TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVN  940
             T ++++N +L+ +  N  TF+G+HV+STP+ L +SDI +A+G +KK+YQSR+S+R V V 
Sbjct  161   TDMITLNSTLKFTYRNTGTFFGVHVTSTPVELSYSDIVIASGNMKKFYQSRRSQRLVSVA  220

Query  941   IQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCEL  1120
             + G K+PLYG+G+SL +T    G   V V L L+F ++S+  V+GKLV+  Y + I C +
Sbjct  221   VMGNKIPLYGSGASLSST---TGVPTVPVLLNLNFVLRSRAYVLGKLVKPKYYKTIQCSI  277

Query  1121  IIDSAG-NKPIKFKKDSCAY  1177
              +D    N  I  KK SC Y
Sbjct  278   TLDPKKLNAAISLKK-SCTY  296



>ref|XP_006354866.1| PREDICTED: uncharacterized protein LOC102592145 [Solanum tuberosum]
Length=320

 Score =   198 bits (503),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 139/329 (42%), Positives = 203/329 (62%), Gaps = 23/329 (7%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH---VYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPVESP  403
             +HTK++S+ TSLA SSP       YYVQSPSRDSHD   GEK+T S   TP   SP+ SP
Sbjct  1     MHTKTDSEGTSLAPSSPDNSRPTAYYVQSPSRDSHD---GEKTTTSFHSTPVI-SPMGSP  56

Query  404   --SHPSLGRHSRTssgtrfsgifrsssgrkgrgkrm-------msNDKGWPECNVIMEEG  556
               SH S+GRHSR SS +RFSG  +  S +                  K W EC+VI EEG
Sbjct  57    PHSHSSVGRHSRDSSSSRFSGSLKPGSRKILPDAAAGVGGRHHRKGQKPWKECDVIEEEG  116

Query  557   KYDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGE  736
               ++   S  L RR + L  + GF +LF+ F LI+WGA+RP K ++T++++   +  I  
Sbjct  117   LLEDDRSSKSLPRRCYVLAFVVGFFILFSFFALILWGASRPQKPKITMRTIKFDHFGIQA  176

Query  737   GSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRK  916
             GSD TGV T ++S+N +++    N A+F+G+HV+S+P++L FS++T+ +G +KK+YQSRK
Sbjct  177   GSDATGVATDMISMNATVKFLYRNTASFFGVHVTSSPLDLSFSELTIGSGAMKKFYQSRK  236

Query  917   SRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDY  1096
             S+R V V++ G K+PLYG G+SL       G   + VPL L+F+++S+  V+GK+V+  +
Sbjct  237   SQRVVAVSVIGNKIPLYGGGASL---STPSGATPLPVPLKLNFKLRSRAYVLGKVVKPKF  293

Query  1097  RRKIWCELIID-SAGNKPIKFKKDSCAYS  1180
              + I C L +     N  I  K  +C Y+
Sbjct  294   YKTIDCLLTLHPQKMNAAISLK--NCTYT  320



>ref|XP_009772483.1| PREDICTED: uncharacterized protein LOC104222860 [Nicotiana sylvestris]
Length=320

 Score =   197 bits (502),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 138/327 (42%), Positives = 196/327 (60%), Gaps = 27/327 (8%)
 Frame = +2

Query  239   HTKSESDVTSLAASSPSGHVYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPVESPSHPS  415
             H K++S+VTSLA SSP+  VYYVQSPSRDSHD   GEK+T S   TP   SP+ SP    
Sbjct  6     HAKTDSEVTSLAPSSPNRPVYYVQSPSRDSHD---GEKTTNSFHSTPIL-SPMGSP----  57

Query  416   LGRHSRTssgtrfsgifrsssgrkgrg------------krmmsNDKGWPECNVIMEEGK  559
              GR SR SS TR+SG  + S+ +                +      + W E + I EEG 
Sbjct  58    -GRQSRDSSSTRYSGSLKPSTQKSSTNGSRSSSSRHHQHRHRKGEKQQWKEFDAIEEEGL  116

Query  560   YDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEG  739
              D+      L RR + L  + GF +LFT F LI+WGA+R  K  VT++S+S +   I  G
Sbjct  117   LDDDGYRKGLPRRCYFLAFVVGFFVLFTFFSLILWGASRNQKPVVTMRSISFNEFGIQAG  176

Query  740   SDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKS  919
              D +GV T ++S+N ++++   N  TF+G+HV+STP+ L FS +TVATG +KK+YQ RKS
Sbjct  177   MDSSGVATEMVSMNSTVKMRFRNTGTFFGVHVTSTPLVLSFSQLTVATGSVKKFYQRRKS  236

Query  920   RRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYR  1099
             +RTV V + G+K+PLYG G+ L +   K+G     V L LD +V+++  V+G++V+  + 
Sbjct  237   QRTVAVTLIGSKIPLYGGGADLIS---KEGKPVAAVSLVLDLKVRARAYVLGRVVKPKFY  293

Query  1100  RKIWCELIID-SAGNKPIKFKKDSCAY  1177
               + C +++D    N PI  KK SC Y
Sbjct  294   NTVQCSVVMDPKKMNVPISLKK-SCTY  319



>gb|KHG23014.1| hypothetical protein F383_29948 [Gossypium arboreum]
Length=326

 Score =   197 bits (502),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 144/331 (44%), Positives = 204/331 (62%), Gaps = 23/331 (7%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESP  403
             +H K++S+VTSLA SSP+      VYYVQSPSRDSHD G+   +TS   TP   SP  SP
Sbjct  1     MHAKTDSEVTSLAPSSPTRSPRRPVYYVQSPSRDSHD-GEKTTTTSFHSTPIL-SPTGSP  58

Query  404   --SHPSLGRHSRTssg----------trfsgifrsssgrkgrgkrmmsNDKGWPECNVIM  547
               SH S+GRHSR SS           +R       SS    R     S+ K W +C+VI 
Sbjct  59    PHSHSSVGRHSRESSSSRFSGSLKPGSRKVSPKEGSSKSGYRKGSSSSHHKQWKDCDVIE  118

Query  548   EEGKYDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIY  727
             EEG  +  E    L RR + L  + GF +LF++F LI+WGA+RP K ++T+KS+      
Sbjct  119   EEGLLESEEREKSLPRRCYLLAFVVGFFVLFSMFSLILWGASRPQKPKITMKSIKFEQFK  178

Query  728   IGEGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQ  907
             I  GSDFTGV T ++++N ++++   N  TF+G+HV+S+P++L +S I +A+G +KK+YQ
Sbjct  179   IQAGSDFTGVSTDMITMNSTVKMIYRNTGTFFGVHVTSSPLDLSYSQINIASGTMKKFYQ  238

Query  908   SRKSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVR  1087
             SRKS+R+V + + G KVPLYG+G+   +  +  GT  V + L L+F V+S+  V+GKLV+
Sbjct  239   SRKSQRSVSITVTGNKVPLYGSGA---SLSSSTGTTSVPISLKLNFIVRSRAYVLGKLVK  295

Query  1088  TDYRRKIWCELIIDSAG-NKPIKFKKDSCAY  1177
               + +KI C+L  D    N PI  KK SC Y
Sbjct  296   PKFYKKIQCDLTFDPKKLNLPISLKK-SCTY  325



>ref|XP_009771087.1| PREDICTED: uncharacterized protein LOC104221676 [Nicotiana sylvestris]
Length=321

 Score =   197 bits (501),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 135/334 (40%), Positives = 201/334 (60%), Gaps = 32/334 (10%)
 Frame = +2

Query  236   LHTKSESDVTS-LAASSPSGH---VYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPVES  400
             +H K++SDVTS LA SSP  +   VYYVQSPSRDSHD   GEK+T S   TP   SP+ S
Sbjct  1     MHAKTDSDVTSSLAPSSPDHNRRPVYYVQSPSRDSHD---GEKTTTSFHSTPVI-SPMGS  56

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsND-------------KGWPECNV  541
             P H     HS     +R S   R S   K   +++  ND             K W EC+V
Sbjct  57    PPH----SHSSVGRHSRESSSSRFSGSLKPGSRKISPNDAAAAGGRNHRKGQKPWKECDV  112

Query  542   IMEEGKYDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSN  721
             I EEG  ++ + S  L RR + L  +  F +LF+ F L++WGA+RP K ++T++S+    
Sbjct  113   IEEEGLLEDDQYSKPLPRRCYFLAFIVAFFILFSFFALVLWGASRPQKPKITMRSIKFER  172

Query  722   IYIGEGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKY  901
               I  GSD +GV T ++S+N +++    N ATF+G+HV+S+P++L FS++ + +G +KK+
Sbjct  173   FGIQAGSDNSGVATDMISMNATVKFVYRNTATFFGVHVTSSPVDLSFSELILGSGAMKKF  232

Query  902   YQSRKSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKL  1081
             +QSRKS+R V V++ G K+PLYG+G+SL   K   G     VPL L+F+V+S+  V+G+L
Sbjct  233   HQSRKSQRVVAVSVIGNKIPLYGSGASLSTPK---GATTQPVPLKLNFKVRSRAYVLGQL  289

Query  1082  VRTDYRRKIWCELIIDSAG-NKPIKFKKDSCAYS  1180
             V+  + + I C + +++   N  I  K  +C YS
Sbjct  290   VKPKFYKTIDCLITLNTQKLNVAIPLK--NCTYS  321



>gb|KHG23694.1| hypothetical protein F383_01880 [Gossypium arboreum]
Length=320

 Score =   197 bits (500),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 146/327 (45%), Positives = 205/327 (63%), Gaps = 21/327 (6%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPVES  400
             +H K++S+VTSLA SSP+      VYYVQSPSRDSHD   GEK+T S   TP   SP+ S
Sbjct  1     MHAKTDSEVTSLAPSSPTRSPRRPVYYVQSPSRDSHD---GEKTTTSFHSTPVL-SPMGS  56

Query  401   P--SHPSLGRHSRTssgtrfsgifrsssgr-----kgrgkrmmsNDKGWPECNVIMEEGK  559
             P  SH S+  HSR SS +RFSG  +  S +                K W EC+VI EEG 
Sbjct  57    PPHSHASVDHHSRESSSSRFSGSLKPGSRKVLPNDASSRGAHRKGHKQWKECDVIEEEGL  116

Query  560   YDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEG  739
              ++ E    L RR + L  + GF +LF++F LI+WGA+RP K ++T+KS+      I  G
Sbjct  117   LEDGERGKGLPRRCYFLAFVLGFFILFSMFSLILWGASRPQKPKITMKSIKFEQFKIQAG  176

Query  740   SDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKS  919
             SDFTGV T ++++N ++++   N  TF+G+HV+STP++L +S I +A+G +KK+YQSRKS
Sbjct  177   SDFTGVATDMITMNSTVKMIYRNTGTFFGVHVASTPLDLSYSQINIASGTMKKFYQSRKS  236

Query  920   RRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYR  1099
             +R+V V + G KVPLYG+G+   +  +  GT  + V L L F V+S+  V+GKLV+  + 
Sbjct  237   QRSVTVLVMGNKVPLYGSGA---SLSSSTGTTSLPVSLKLSFVVRSRAYVLGKLVKPKFY  293

Query  1100  RKIWCELIIDSAG-NKPIKFKKDSCAY  1177
             +KI C++  D    N PI  KK SC Y
Sbjct  294   KKIECDITFDPKKLNVPIWLKK-SCTY  319



>ref|XP_009123524.1| PREDICTED: uncharacterized protein LOC103848363 [Brassica rapa]
Length=341

 Score =   196 bits (499),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 140/339 (41%), Positives = 205/339 (60%), Gaps = 33/339 (10%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEK-STSMQPTPTFTSPVES  400
             +H K++S+VTS+AASSP+      VYYVQSPSRDSHD   GEK +TS   TP   SP+ S
Sbjct  1     MHAKTDSEVTSIAASSPARSPRRPVYYVQSPSRDSHD---GEKTATSFHSTPVL-SPMGS  56

Query  401   PSHP--SLGRHSRTssgtrfsgifrsssgrkgrgkrmmsN--DKGWPECNVIMEEGKYDE  568
             P H   S+GRHSR SS TRFSG  +  S +   G +   +  +K W EC +I EEG  D+
Sbjct  57    PPHSQSSMGRHSRESSSTRFSGSLKPGSRKVNDGSKRKGHGGEKQWKECAMIEEEGLLDD  116

Query  569   LEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDF  748
              E    + RR + L  + GF +LF +F LI++GAA+P K ++T+KS++   + I  G D 
Sbjct  117   GERDRGVPRRCYVLAFIVGFFILFGLFSLILYGAAKPQKPKITVKSITFETLKIQAGQDA  176

Query  749   TGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRT  928
              GV T ++++N +LR+   N  TF+G+HV+STP++L FS + + +G +KK+YQSRKS+RT
Sbjct  177   GGVGTDMITMNATLRMLYRNTGTFFGVHVTSTPVDLSFSQMKIGSGSIKKFYQSRKSQRT  236

Query  929   VLVNIQGTKVPLYGAGSSL-------------------PATKNKDGTGGVQVPLALDFEV  1051
             VLV++ G K+PLYG+G++L                   P            VP+ L F V
Sbjct  237   VLVHVIGEKIPLYGSGATLIPPAPPAPLPKPKKKKKGAPVVIPDPPAPPAPVPMKLSFVV  296

Query  1052  KSQGDVVGKLVRTDYRRKIWCELIIDSAG-NKPIKFKKD  1165
             +S+  V+G+LV+  + +KI C++  +    NK I   K+
Sbjct  297   RSRAYVLGRLVKHKFLKKIECDINFEHKNLNKHIPITKN  335



>ref|XP_008393793.1| PREDICTED: uncharacterized protein LOC103455958 [Malus domestica]
Length=318

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 140/326 (43%), Positives = 201/326 (62%), Gaps = 19/326 (6%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH-----VYYVQSPSRDSHDDGDGEK-STSMQPTPTFTSPVE  397
             +H K++S+VTSLA SSP+       VYYVQSPSRDSHD   GEK +TS Q TP  +    
Sbjct  1     MHAKTDSEVTSLAPSSPTRSPGRRPVYYVQSPSRDSHD---GEKTATSFQSTPVISPSGS  57

Query  398   SPSHPS-LGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKG---WPECNVIMEEGKYD  565
              P   S +GRHSR SS TRFSG  +  S +         + KG   W E  VI EEG  +
Sbjct  58    PPHSHSSVGRHSRESSSTRFSGSLKPGSRKINPNDGSRHHRKGQKPWKEQAVIEEEGLLE  117

Query  566   ELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSD  745
               E S    RR +    + GF LLFT+F LI+WGA++P K ++T+KS++     I  GSD
Sbjct  118   GEERSKGFPRRCYFPAFVLGFFLLFTMFALILWGASKPMKPKITMKSVTFEQFKIQAGSD  177

Query  746   FTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRR  925
              TGV T ++SVN +++ +  N  TF+G+HV S  ++L +  IT+A+G +KK+YQSRKS+R
Sbjct  178   STGVSTDMISVNSTVKFTFRNTGTFFGMHVMSKTLDLSYFQITIASGTIKKFYQSRKSQR  237

Query  926   TVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRK  1105
             ++ V + G K+PLYG+G+S+    +  GT  + VPL L+F ++S+  V+GKLV+  + R+
Sbjct  238   SISVQLFGEKIPLYGSGASI---NSATGTTALPVPLQLNFVIRSKAYVLGKLVKPKFNRR  294

Query  1106  IWCELIIDSAG-NKPIKFKKDSCAYS  1180
             ++C +  D    N PIK   ++C  S
Sbjct  295   VYCSVTFDPKKLNVPIKL--NNCTTS  318



>emb|CDY06769.1| BnaA10g05480D [Brassica napus]
Length=319

 Score =   196 bits (497),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 136/320 (43%), Positives = 199/320 (62%), Gaps = 17/320 (5%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEK-STSMQPTPTFTSPVES  400
             +H K++S+VTS+AASSP+      VYYVQSPSRDSHD   GEK +TS   TP   SP+ S
Sbjct  1     MHAKTDSEVTSIAASSPARSPRRPVYYVQSPSRDSHD---GEKTATSFHSTPVL-SPMGS  56

Query  401   PSHP--SLGRHSRTssgtrfsgifrsssgrkgrgkrmmsN--DKGWPECNVIMEEGKYDE  568
             P H   S+GRHSR SS TRFSG  +  S +   G +   +  +K W EC +I EEG  D+
Sbjct  57    PPHSQSSMGRHSRESSSTRFSGSLKPGSRKVNDGSKRKGHGGEKQWKECAMIEEEGLLDD  116

Query  569   LEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDF  748
              E    + RR + L  + GF +LF +F LI++GAA+P K ++T+KS++   + I  G D 
Sbjct  117   GERDRGVPRRCYVLAFIVGFFILFGLFSLILYGAAKPQKPKITVKSITFETLKIQAGQDA  176

Query  749   TGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRT  928
              GV T ++++N +LR+   N  TF+G+HV+STP++L FS + + +G + K+YQSRKS+RT
Sbjct  177   GGVGTDMITMNATLRMLYRNTGTFFGVHVTSTPVDLSFSQMKIGSGSIMKFYQSRKSQRT  236

Query  929   VLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKI  1108
             VLV++ G K+PLYG    +             VP+ L F V+S+  V+G+LV+  + +KI
Sbjct  237   VLVHVIGEKIPLYGRAPVVIPDPPAPPA---PVPMKLSFVVRSRAYVLGRLVKPKFLKKI  293

Query  1109  WCELIIDSAG-NKPIKFKKD  1165
              C++  +    NK I   K+
Sbjct  294   ECDINFEHKNLNKHIPITKN  313



>gb|KDP41715.1| hypothetical protein JCGZ_16122 [Jatropha curcas]
Length=319

 Score =   195 bits (496),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 139/330 (42%), Positives = 206/330 (62%), Gaps = 28/330 (8%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPVES  400
             +H K++S+V+S+  SSP+      VYYVQSPSRDSHD   GEK+T S   TP   SPV S
Sbjct  1     MHAKTDSEVSSITPSSPTRSPRRPVYYVQSPSRDSHD---GEKTTTSFHSTPVL-SPVGS  56

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsND----------KGWPECNVIME  550
             P H     HS     +R S   R S   K   +++  ND          K W EC VI E
Sbjct  57    PPH----SHSSVGRHSRESSSSRFSGSLKPGSRKISPNDGSRGDQRKGQKQWKECAVIEE  112

Query  551   EGKYDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYI  730
             EG  ++ E    + RR + L+ + GF +LF+ F LI+WGA++P K ++T+KS++  +  I
Sbjct  113   EGLLEDEEREKGIPRRCYFLIFVLGFFVLFSFFSLILWGASKPQKPKITMKSITFEHFGI  172

Query  731   GEGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQS  910
               GSD TGV T ++SVN ++++   N  TF+G+HV+STP++L +S+IT+A+G LKK+YQS
Sbjct  173   QAGSDATGVATDMISVNSTIKMIYRNTGTFFGVHVTSTPVDLSYSEITIASGILKKFYQS  232

Query  911   RKSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRT  1090
             RKS R+V ++++  K+PLYG+G+ L ++    G   + VPL L+F ++S+  V+GKLV+ 
Sbjct  233   RKSHRSVAISVKSNKIPLYGSGAGLSSS---TGMPTLPVPLKLNFIIRSRAYVLGKLVKP  289

Query  1091  DYRRKIWCELIIDSAG-NKPIKFKKDSCAY  1177
              + ++I C++  DS   N PI  KK SC Y
Sbjct  290   KFYKRIECDITFDSKKLNVPISLKK-SCTY  318



>ref|XP_011017528.1| PREDICTED: uncharacterized protein LOC105120843 [Populus euphratica]
Length=305

 Score =   194 bits (494),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 133/325 (41%), Positives = 195/325 (60%), Gaps = 32/325 (10%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPVES  400
             +H K++S+VTSLA SSP+      VYYVQSPSRDSHD   GEK+T S   TP   SP+ S
Sbjct  1     MHAKTDSEVTSLAPSSPTRSPRRPVYYVQSPSRDSHD---GEKTTTSFHSTPVL-SPMGS  56

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDS  580
             P H     HS     +R S   R S   K   +++  ND            G   + +  
Sbjct  57    PPH----SHSSVGRHSRESSSSRFSGSLKPGSRKISPND---------ASRGGQGKGQKQ  103

Query  581   WL-----LSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSD  745
             W      L RR + L  + GF +LF++F LI+WGA++P K ++T+KS+      I  GSD
Sbjct  104   WKERRKGLPRRCYFLAFVLGFFILFSLFSLILWGASKPQKPKITMKSIKFEQFRIQAGSD  163

Query  746   FTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRR  925
              TGV T ++SVN +++++  N  TF+G+ V+STP++L +S+IT+A+G +KK+YQSRKS+R
Sbjct  164   STGVATDMISVNSTVKMTYRNEGTFFGVRVTSTPLDLSYSEITIASGNIKKFYQSRKSQR  223

Query  926   TVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRK  1105
              V +++   K+PLYG+G+ L ++    GT  + VPL ++F V+S+  V+GKLV+  + RK
Sbjct  224   PVAISVISNKIPLYGSGAGLSSS---TGTTTLPVPLKMNFVVRSRAYVLGKLVKPKFNRK  280

Query  1106  IWCELIIDSAG-NKPIKFKKDSCAY  1177
             I C+   D    N PI  KK +C Y
Sbjct  281   IKCDFTFDPKKLNVPISLKK-ACTY  304



>ref|XP_009359769.1| PREDICTED: uncharacterized protein LOC103950301 [Pyrus x bretschneideri]
Length=318

 Score =   194 bits (494),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 140/326 (43%), Positives = 200/326 (61%), Gaps = 19/326 (6%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH-----VYYVQSPSRDSHDDGDGEK-STSMQPTPTFTSPVE  397
             +H K++S+VTSLA SSP+       VYYVQSPSRDSHD   GEK +TS Q TP  +    
Sbjct  1     MHAKTDSEVTSLAPSSPTRSPGRRPVYYVQSPSRDSHD---GEKTATSFQSTPVISPSGS  57

Query  398   SPSHPS-LGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKG---WPECNVIMEEGKYD  565
              P   S +GRHSR SS TRFSG  +  S +         + KG   W E  VI EEG  +
Sbjct  58    PPHSHSSVGRHSRESSSTRFSGSLKPGSRKINPNDGSRHHRKGQKPWKEQAVIEEEGLLE  117

Query  566   ELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSD  745
               E S    RR +    + GF LLFT+F LI+WGA++P K ++T+KS++     I  GSD
Sbjct  118   GEERSKGFPRRCYFPAFVLGFFLLFTMFALILWGASKPMKPKITMKSVTFEQFKIQAGSD  177

Query  746   FTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRR  925
              TGV T ++SVN +++ +  N  TF+G+HV S  ++L +S IT+A+G + K+YQSRKS+R
Sbjct  178   STGVSTDMISVNSTVKFTFRNTGTFFGMHVMSKTLDLSYSQITIASGTINKFYQSRKSQR  237

Query  926   TVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRK  1105
             ++ V + G K+PLYG+G+S+    +  GT  + VPL L+F ++S   V+GKLV+  + R+
Sbjct  238   SISVQLFGDKIPLYGSGASI---NSATGTTALPVPLQLNFVIRSTAYVLGKLVKPKFNRR  294

Query  1106  IWCELIIDSAG-NKPIKFKKDSCAYS  1180
             ++C +  D    N PIK   ++C  S
Sbjct  295   VYCSVTFDPKKLNVPIKL--NNCTTS  318



>gb|ADE76287.1| unknown [Picea sitchensis]
Length=174

 Score =   189 bits (481),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 136/178 (76%), Gaps = 5/178 (3%)
 Frame = +2

Query  644   VFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPTRLLSVNGSLRISVYNPATFY  823
             +F LI+WGA+RPYK ++T++S+   + Y+  GSD TGVPT+++S+N +L++S YNPATF+
Sbjct  1     MFSLILWGASRPYKPEITVQSIIFHDFYVSAGSDATGVPTKMISLNATLKMSFYNPATFF  60

Query  824   GIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNIQGTKVPLYGAGSSLPATKNK  1003
             G+HV+STP++L++  + VA+GQ+K++YQSRK+ RT+ V +QG KVPLYG G+SL ++   
Sbjct  61    GVHVTSTPMDLMYYQLVVASGQVKRFYQSRKTHRTISVVLQGKKVPLYGGGASLTSS---  117

Query  1004  DGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELIIDSAGNKPIKFKKDSCAY  1177
             D  GG  VPL L F++K++  V+GKLV+T + ++++C++ +DSA     +  K++C Y
Sbjct  118   DAVGG--VPLDLTFDIKAKAYVLGKLVKTKFSKRVYCKIDMDSAKLMKSRSLKNACEY  173



>ref|XP_007017196.1| CAA30379.1 protein, putative [Theobroma cacao]
 gb|EOY14421.1| CAA30379.1 protein, putative [Theobroma cacao]
Length=320

 Score =   193 bits (490),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 139/331 (42%), Positives = 201/331 (61%), Gaps = 29/331 (9%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPVES  400
             +H K++S+VTSLA SSP+      VYYVQSPSRDSHD   GEK+T S   TP   SP+ S
Sbjct  1     MHAKTDSEVTSLAPSSPTRSPRRPVYYVQSPSRDSHD---GEKTTTSFHSTPV-VSPMGS  56

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsND-----------KGWPECNVIM  547
             P H     HS     +R S   R S   K   +++  ND           K W EC+VI 
Sbjct  57    PPH----SHSSVGRHSRESSSSRFSGSLKPGSRKISPNDASSGRAHSKGHKQWKECDVIE  112

Query  548   EEGKYDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIY  727
             EEG  +  E    L RR + L  + GF +LF++F LI+WGA+RP K ++ ++S+      
Sbjct  113   EEGLLENEEREKGLPRRCYVLAFVLGFFILFSMFSLILWGASRPQKPKIRMQSIKFEQFK  172

Query  728   IGEGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQ  907
             I  GSDFTGV T ++++N ++++   N  TF+G+HV+STP++L +S I +A+G +KK+YQ
Sbjct  173   IQAGSDFTGVATDMITMNSTVKMIYRNTGTFFGVHVTSTPLDLSYSQINIASGTMKKFYQ  232

Query  908   SRKSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVR  1087
             SRKS+R+V V + G KVPLYG+G+   +  +  GT  + V L L+F V+S+  V+GKLV+
Sbjct  233   SRKSQRSVQVMVMGNKVPLYGSGA---SLSSSTGTTSLPVSLNLNFVVRSRAYVLGKLVK  289

Query  1088  TDYRRKIWCELIIDSAG-NKPIKFKKDSCAY  1177
               + ++I C++  D    N PI  K+ SC Y
Sbjct  290   PKFSKRIDCDITFDPKKLNVPISLKQ-SCTY  319



>ref|XP_003631048.1| hypothetical protein MTR_8g106580 [Medicago truncatula]
 gb|AET05524.1| late embryogenesis abundant protein [Medicago truncatula]
Length=296

 Score =   192 bits (487),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 132/319 (41%), Positives = 189/319 (59%), Gaps = 29/319 (9%)
 Frame = +2

Query  236   LHTKSESDVTSLAASS----PSGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESP  403
             +HTK++S+VTSL ASS    P    YYVQSPS D      GEK+T    T   ++PV SP
Sbjct  1     MHTKTDSEVTSLDASSTTRSPRRPAYYVQSPSHD------GEKTT----TSFHSTPVISP  50

Query  404   SHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDSW  583
                         S           SG +       SN K W E +VI EEG  +  +   
Sbjct  51    ----------MGSPPHSHSSSSRFSGSRKLNNNHRSNTKPWKEIDVIEEEGLLNNQDHHH  100

Query  584   LLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPT  763
              LSRR++ L  + GF LLFT+F LI+WGA+RP K  V +KS+   ++ +  GSD TGV T
Sbjct  101   SLSRRWYFLAFILGFFLLFTLFSLILWGASRPMKPHVMIKSIKFEHVRVQAGSDATGVAT  160

Query  764   RLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNI  943
              +++VN +++ +  N  TF+G+HVSSTP++L +S+I + TG +KK+YQSR+S+R V V +
Sbjct  161   DMITVNATVKFTYRNKGTFFGVHVSSTPLDLSYSEIVIGTGNMKKFYQSRRSQRLVSVAV  220

Query  944   QGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELI  1123
              G+K+PLYG+G+SL +T    G   + VPL L FE++S+  V+GKLV+  Y +K+ C ++
Sbjct  221   MGSKIPLYGSGASLSST---TGMPTLPVPLKLSFEIRSRAYVLGKLVKPKYYKKVHCSVV  277

Query  1124  IDSAG-NKPIKFKKDSCAY  1177
              D    N  +  KK SC Y
Sbjct  278   FDPKKINVSVSLKK-SCTY  295



>ref|XP_010912464.1| PREDICTED: uncharacterized protein LOC105038371 [Elaeis guineensis]
Length=320

 Score =   192 bits (489),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 133/330 (40%), Positives = 200/330 (61%), Gaps = 25/330 (8%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH-----VYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPVE  397
             +H K++S+VTS+A SSP+       VYYVQSPSRDSHD   GEK+T S+  TP   SP+ 
Sbjct  1     MHAKTDSEVTSIAPSSPTRSPGRRPVYYVQSPSRDSHD---GEKTTTSLHSTPVL-SPMG  56

Query  398   SPSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsND--------KGWPECNVIMEE  553
             SP H     HS     +R S   R S   K   +++  ND        K W EC VI EE
Sbjct  57    SPPH----SHSSVGRHSRESSSSRFSGSLKPGSRKVSPNDGSRRGGRHKTWKECAVIEEE  112

Query  554   GKYDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIG  733
             G  ++ ED+  L RR + L  +  F +LF+ F LI+WGA+R  K ++T+KS++  N +I 
Sbjct  113   GLLEDDEDAKGLPRRCYVLFFILAFFVLFSFFALILWGASRNQKPEITMKSITFENFFIQ  172

Query  734   EGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSR  913
              G+D + VPT + ++N +++++  N  TF+G+HVSSTP++L +  +T+A+G +  +YQ R
Sbjct  173   AGTDASFVPTDMSTLNATVQMTFRNTGTFFGVHVSSTPLDLSYYQLTLASGNINNFYQRR  232

Query  914   KSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTD  1093
             KS+R + V + G++VPLYG G+SL  T     T    VPL L F V+S+  V+GKLV+  
Sbjct  233   KSQRNLHVVVMGSQVPLYGGGASLSGTP-AGKTNNQPVPLTLGFRVRSRAYVLGKLVKPK  291

Query  1094  YRRKIWCELIID-SAGNKPIKFKKDSCAYS  1180
             +   + C +++D +   KP+  KK +C Y+
Sbjct  292   FYTNVQCSVVMDVTKLGKPVSLKK-ACQYN  320



>emb|CDY17052.1| BnaA08g04160D [Brassica napus]
Length=290

 Score =   191 bits (486),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 123/259 (47%), Positives = 174/259 (67%), Gaps = 13/259 (5%)
 Frame = +2

Query  236  LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEK-STSMQPTPTFTSPVES  400
            +H K++S+VTS+AASSP+      VYYVQSPSRDSHD   GEK +TS   TP   SP+ S
Sbjct  1    MHAKTDSEVTSIAASSPARSPRRPVYYVQSPSRDSHD---GEKTATSFHSTPVL-SPMGS  56

Query  401  PSHP--SLGRHSRTssgtrfsgifrsssgrkgrgkrmmsN--DKGWPECNVIMEEGKYDE  568
            P H   S+GRHSR SS TRFSG  +  S +   G +   +  +K W EC +I EEG  D+
Sbjct  57   PPHSQSSMGRHSRESSSTRFSGSLKPGSRKVNDGSKRKGHGGEKQWKECAMIEEEGLLDD  116

Query  569  LEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDF  748
             E    L RR + L  + GF +L  +F LI++GAA+P K ++T+KS++   + +  G D 
Sbjct  117  GERDRGLPRRCYVLAFIVGFFILLGLFSLILYGAAKPQKPKITVKSITFETLKVQAGQDA  176

Query  749  TGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRT  928
             GV T ++++N +LR+   N  TF+G+HV+STPI+L FS + + +G +KK+YQSRKS+RT
Sbjct  177  GGVGTDMITMNATLRMLYRNTGTFFGVHVTSTPIDLSFSQMKIGSGSIKKFYQSRKSQRT  236

Query  929  VLVNIQGTKVPLYGAGSSL  985
            VLV+I G K+PLYG+G++L
Sbjct  237  VLVHITGEKIPLYGSGATL  255



>ref|XP_002310135.2| hypothetical protein POPTR_0007s10910g [Populus trichocarpa]
 gb|EEE90585.2| hypothetical protein POPTR_0007s10910g [Populus trichocarpa]
Length=321

 Score =   192 bits (488),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 132/324 (41%), Positives = 197/324 (61%), Gaps = 21/324 (6%)
 Frame = +2

Query  242   TKSESDVTSLAASSPSGH------VYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPV--  394
             +K++S+V+SL  SSP+        VYYVQSPSRDSHD   GEK+T S   TP   SP+  
Sbjct  6     SKTDSEVSSLTPSSPARSSPPRRPVYYVQSPSRDSHD---GEKTTNSFHSTPVL-SPMGS  61

Query  395   --ESPSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDE  568
                S S+ SLG HSR  S +           +           K W E + I EEG  D 
Sbjct  62    PPHSHSNSSLGPHSR-ESSSTRYSASLKPHKQHKTDGSGPKGRKPWKEFDAIEEEGLLDG  120

Query  569   LEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDF  748
                   +SRR + L  + GF +LF++F LI+WGA+RP K  +T+K++      +  G DF
Sbjct  121   DNGPHGMSRRCYFLAFIVGFWILFSLFSLILWGASRPQKPTITMKNIIFDQFIVHAGMDF  180

Query  749   TGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRT  928
             +GV T ++S+N +++++  N ATF+G+HV+STP++L +S++TVATG + K+YQSRKS+RT
Sbjct  181   SGVATEMVSMNCTVKLTFRNTATFFGVHVTSTPLDLSYSELTVATGTISKFYQSRKSQRT  240

Query  929   VLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKI  1108
             + V ++G+K+PLYG G+SL +    +G     VPL L+F V+S+  V+GKLV+  + ++I
Sbjct  241   LTVMVKGSKIPLYGGGASLSSL---NGAPTQPVPLILNFMVRSRAYVLGKLVKPKFYKRI  297

Query  1109  WCELIID-SAGNKPIKFKKDSCAY  1177
              C +++D    N PI   K+ C Y
Sbjct  298   ECSVVMDPKKMNVPISL-KNKCTY  320



>gb|AFK40819.1| unknown [Lotus japonicus]
Length=302

 Score =   191 bits (486),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 132/320 (41%), Positives = 193/320 (60%), Gaps = 25/320 (8%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH-----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             +H K++S+VTS++ASSP+       +Y+VQSPSRDSHD G+   +TS   TP   SP  S
Sbjct  1     MHAKTDSEVTSISASSPARSPPRRPLYFVQSPSRDSHD-GEKTVTTSFHSTPVL-SPNAS  58

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDS  580
             P H S             S    S+  RK        + K W + +VI EEG     +  
Sbjct  59    PPHSS-------------SSTRFSAPHRKKDNHHHHHSLKPWKQIDVIEEEGLLQGEDRD  105

Query  581   WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
               LSRR + L+ L GFLLLFT+F LI+WGA+RP K ++ +KS+   ++ +  GSD TGV 
Sbjct  106   RTLSRRCYFLIFLLGFLLLFTLFSLILWGASRPMKPKIFIKSIKFDHVQVQAGSDSTGVA  165

Query  761   TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVN  940
             T ++S+N +L+ +  N  TF+G+HV+STP+ L +S+I +A G +K++YQ R+S R V V 
Sbjct  166   TDMISMNSTLKFTYRNTGTFFGVHVASTPLELSYSEIVIAAGNMKEFYQHRRSHRLVSVA  225

Query  941   IQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCEL  1120
             + G K+PLYG+G+SL +T    G   V VPL L+F ++S+  V+GKLV+  Y ++I C +
Sbjct  226   VMGNKIPLYGSGASLSST---TGMPTVPVPLNLNFVLRSRAYVLGKLVKPKYYKRIQCSI  282

Query  1121  IIDSAG-NKPIKFKKDSCAY  1177
              +D    + PI   K SC Y
Sbjct  283   TLDPKKLSAPIPL-KHSCTY  301



>ref|XP_011075336.1| PREDICTED: uncharacterized protein LOC105159829 [Sesamum indicum]
Length=310

 Score =   191 bits (485),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 126/319 (39%), Positives = 193/319 (61%), Gaps = 17/319 (5%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGHVYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPVESPSHP  412
             +H K++S+VTSLA SSP+  VYYVQSPSRDSHD   GEK+T S   TP   SP+ SP   
Sbjct  3     MHAKTDSEVTSLAPSSPNRAVYYVQSPSRDSHD---GEKTTNSFHSTPIL-SPMGSP---  55

Query  413   SLGRHSR----TssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDS  580
               GR SR    T          + SS    R  +    +K W E + I EEG  DE    
Sbjct  56    --GRQSRDSSSTRYSGSLKPGSQKSSNGSRRHHQHRKAEKQWKEFDAIEEEGLLDEEGGR  113

Query  581   WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
               + RR + L  + GF +LF+ F LI+WGA+R  K  V +KS+      I  GSD +GV 
Sbjct  114   RGVPRRCYFLAFVVGFFVLFSFFALILWGASRNQKPVVVMKSILFDRFIIQAGSDASGVG  173

Query  761   TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVN  940
             T ++++N +++    N  TF+G+HV+STP++L FS++T+A+G +K++YQSR+S++TV V 
Sbjct  174   TEMVTMNSTVKFVFRNRGTFFGVHVTSTPLDLSFSELTLASGMVKRFYQSRRSQKTVTVM  233

Query  941   IQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCEL  1120
             ++G+ +PLYG G++L    +++G     VPL L+F V+++  V+G+LV+  + +++ C +
Sbjct  234   LRGSNIPLYGGGANL---SSQEGKPVAPVPLNLNFTVRARAYVLGRLVKPKFNKRVQCSV  290

Query  1121  IIDSAGNKPIKFKKDSCAY  1177
             ++D          K+SC Y
Sbjct  291   VLDPKKMNVAIPLKNSCTY  309



>ref|XP_002284845.1| PREDICTED: uncharacterized protein LOC100254049 [Vitis vinifera]
Length=319

 Score =   191 bits (486),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 137/330 (42%), Positives = 201/330 (61%), Gaps = 28/330 (8%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPVES  400
             +H K++S+VTSLAASSP+      VYYVQSPSRDSHD   GEK+T S   TP   SP+ S
Sbjct  1     MHAKTDSEVTSLAASSPTRSPRRPVYYVQSPSRDSHD---GEKTTTSFHSTPVL-SPMGS  56

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsND----------KGWPECNVIME  550
             P H     HS     +R S   R S   K   +++  ND          K W EC VI E
Sbjct  57    PPH----SHSSVGRHSRESSSSRFSGSLKPGSRKISPNDASRGGHRKGEKPWKECAVIEE  112

Query  551   EGKYDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYI  730
             EG  ++ E    L RR + L  + GF +LF++F LI+WGA++P K ++T+KS++     +
Sbjct  113   EGLLEDEERQKGLPRRCYFLAFVVGFFVLFSLFSLILWGASKPQKPKITMKSITFERFVV  172

Query  731   GEGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQS  910
               GSD TGV T ++S+N +++++  N ATF+G+HV+STP++L +S + VA+G +KK+YQS
Sbjct  173   QAGSDSTGVATDMVSMNSTVKLTFRNTATFFGVHVTSTPLDLSYSRLRVASGTIKKFYQS  232

Query  911   RKSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRT  1090
             RKS R++ + + G K+PLYG G+SL  +          +PL L F ++S+  V+GKLV+ 
Sbjct  233   RKSHRSLTIVLMGDKIPLYGGGASLSTSTGTTTE---PLPLKLSFMLRSRAYVLGKLVKP  289

Query  1091  DYRRKIWCELIIDSAG-NKPIKFKKDSCAY  1177
              + ++I C + +D    N P+  KK SC Y
Sbjct  290   KFYKRIECSVNLDPKKLNVPLSLKK-SCTY  318



>ref|XP_004232022.1| PREDICTED: uncharacterized protein LOC101266178 [Solanum lycopersicum]
Length=319

 Score =   191 bits (486),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 143/326 (44%), Positives = 201/326 (62%), Gaps = 26/326 (8%)
 Frame = +2

Query  239   HTKSESDVTSLAASSPSGHVYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPVESPSHPS  415
             H K++S+VTSLA SSP+  VYYVQSPSRDSHD   GEK+T S   TP   SP+ SP    
Sbjct  6     HAKTDSEVTSLAPSSPNRPVYYVQSPSRDSHD---GEKTTNSFHSTPIL-SPMGSP----  57

Query  416   LGRHSRTssgt-----------rfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKY  562
              GR SR SS T           + S   RS+SGR    +    + + W E + I EEG  
Sbjct  58    -GRQSRDSSSTRYSGSLKPGSQKSSNGSRSNSGRHHNHRHRKGDKQQWKEFDAIEEEGLL  116

Query  563   DELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGS  742
             D+   S  + RR + L  + GF LLFT F LI+WGA+R  K  VT+KS+S +   +  G 
Sbjct  117   DDDAYSKGVPRRCYFLAFVVGFFLLFTFFSLILWGASRNQKPVVTMKSISYNEFGVQSGM  176

Query  743   DFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSR  922
             DF+GV T ++S+N ++++ V N  TF+G+HV+STP+ L FS +T+ATG +KK+YQ RKS+
Sbjct  177   DFSGVATVMVSMNCTVKLIVRNTGTFFGVHVTSTPLVLSFSQLTLATGTIKKFYQRRKSQ  236

Query  923   RTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRR  1102
             RTV V++ G K+PLYG G  L    +K+G     V L LDF+V+++  V+G+LV+  + +
Sbjct  237   RTVTVSLIGNKIPLYGGGVDL---MSKEGKPVAPVSLTLDFKVRARAYVLGRLVQPKFYK  293

Query  1103  KIWCELIID-SAGNKPIKFKKDSCAY  1177
             ++ C +++D    N PI  KK  C Y
Sbjct  294   RVQCNVVMDPKKMNVPISLKK-FCTY  318



>ref|XP_002523601.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38796.1| conserved hypothetical protein [Ricinus communis]
Length=326

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 128/304 (42%), Positives = 191/304 (63%), Gaps = 21/304 (7%)
 Frame = +2

Query  296   VYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPV----ESPSHPSLGRHSRTssgtrfsg  460
             VYYVQSPSRDSH   DGEK+T S   TP   SP+     S S+ SLG HSR    +  + 
Sbjct  33    VYYVQSPSRDSH---DGEKTTNSFHSTPVL-SPMGSPPHSHSNSSLGPHSR---ESSSTR  85

Query  461   ifrsssgrkgrgkrmmsNDKG----WPECNVIMEEGKYDELEDSWLLSRRFHallalcgf  628
                S   +    K   SN KG    W E + I EE   D      +L+RR++ L  + GF
Sbjct  86    FSGSLKPQHHHRKTDGSNRKGARKPWKEFDAIEEECLLDGDVPPHVLTRRYYFLAFVGGF  145

Query  629   lllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPTRLLSVNGSLRISVYN  808
             ++LFT+F LI+WGA+RP K  +T+KS++     +  G+DF+GV T ++S+N +++++  N
Sbjct  146   IVLFTMFSLILWGASRPQKPIITVKSIAFDQFVVQAGADFSGVATEMVSMNCTVKLTFRN  205

Query  809   PATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNIQGTKVPLYGAGSSLP  988
              ATF+G+HV++TP++L +S +TVATG ++K+YQSRKS+R++ V ++G   PLYG GSSL 
Sbjct  206   TATFFGVHVTATPVHLSYSQLTVATGTVQKFYQSRKSQRSLTVMVKGNSTPLYGGGSSLG  265

Query  989   ATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELIIDSAG-NKPIKFKKD  1165
             +    +G     VPLAL+F V+S+  V+GKLV+  + +++ C +++DS   N PI   K+
Sbjct  266   SL---NGAPTQPVPLALNFTVRSRAYVLGKLVKPKFYKRVECWVVMDSHKMNVPISL-KN  321

Query  1166  SCAY  1177
              C Y
Sbjct  322   KCTY  325



>ref|XP_006374914.1| hypothetical protein POPTR_0014s02660g [Populus trichocarpa]
 gb|ERP52711.1| hypothetical protein POPTR_0014s02660g [Populus trichocarpa]
Length=318

 Score =   191 bits (485),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 144/325 (44%), Positives = 211/325 (65%), Gaps = 19/325 (6%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPVES  400
             +H K++S+VTSLA SSP+      VYYVQSPSRDSHD   GEK+T S   TP   SP+ S
Sbjct  1     MHAKTDSEVTSLAPSSPTRSPRRPVYYVQSPSRDSHD---GEKTTTSFHSTPVL-SPMGS  56

Query  401   P--SHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKG---WPECNVIMEEGKYD  565
             P  SH S+GRHSR SS +RFSG  +  S +           KG   W EC+VI EEG  D
Sbjct  57    PPHSHSSVGRHSRESSSSRFSGSLKPGSRKISPNDASRGGRKGQKQWKECDVIEEEGLLD  116

Query  566   ELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSD  745
             + E    L R+ + L  + GF +LF+ F LI+WGA++  K ++T+KS++     I  GSD
Sbjct  117   DEERRKGLPRKCYFLAFVLGFFILFSFFSLILWGASKQQKPKITMKSVTFEQFRIQAGSD  176

Query  746   FTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRR  925
              TGV T ++SVN ++R++  N  TF+G+HV+STP++L +S+IT+A+G +KK+YQSRKS+R
Sbjct  177   STGVATDMISVNSTVRMTYRNKGTFFGVHVTSTPLDLSYSEITLASGSIKKFYQSRKSQR  236

Query  926   TVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRK  1105
             +V +++   K+PLYG+G++  ++    GT  + VPL ++F V+S+  V+GKLV+  + ++
Sbjct  237   SVAISLISDKIPLYGSGAAFSSS---TGTATLPVPLKVNFVVRSKAYVLGKLVKPKFNKR  293

Query  1106  IWCELIIDSAG-NKPIKFKKDSCAY  1177
             I C+   D    N PI  +K +C Y
Sbjct  294   IECDFTFDPKKLNVPISLQK-ACTY  317



>ref|XP_010112178.1| hypothetical protein L484_009544 [Morus notabilis]
 gb|EXC32844.1| hypothetical protein L484_009544 [Morus notabilis]
Length=319

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 143/332 (43%), Positives = 201/332 (61%), Gaps = 32/332 (10%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSP----SGHVYYVQSPSRDSHDDGDGEK-STSMQPTPTFTSPVES  400
             +H K++S+VTSLAASSP       VYYVQSPSRDSHD   GEK +TS   TP   SP+ S
Sbjct  1     MHAKTDSEVTSLAASSPPRSPRRQVYYVQSPSRDSHD---GEKTATSFHSTPVL-SPMGS  56

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsND----------KGWPECNVIME  550
             P H     HS     +R S   R S   K   +++  ND          K W EC VI E
Sbjct  57    PPH----SHSSVGRHSRESSSSRFSGSLKPGSRKISPNDASRGGPRKGEKPWKECAVIEE  112

Query  551   EGKYDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYI  730
             EG  +  E    L RR + L  + GF LLF++F LI+WGA++P K ++T+KS+      I
Sbjct  113   EGLLEAEERRKGLPRRCYFLAFVLGFFLLFSLFSLILWGASKPMKPKITVKSIKFEEFKI  172

Query  731   GEGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQS  910
               GSDFTGV T ++S+N +L+++  N  TF+G+HV  TPI+L++S+I VA+G +K++YQS
Sbjct  173   QAGSDFTGVATDMISLNATLKLTFRNTGTFFGVHVKPTPIDLIYSEIAVASGNMKRFYQS  232

Query  911   RKSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRT  1090
             RKS+R++ + + G K+PLYG+G+      +  GT  + VPL L+F V+S+  V+GKLV+ 
Sbjct  233   RKSQRSLSIPVTGNKIPLYGSGA---GLSSSTGTSSLPVPLKLNFAVRSRAYVLGKLVKP  289

Query  1091  DYRRKIWCELIIDSAGNKP---IKFKKDSCAY  1177
              + +++ C L  D    KP   I  KK SC Y
Sbjct  290   KFNKRVQCSLTYDP--KKPHVAINLKK-SCTY  318



>gb|EEC78302.1| hypothetical protein OsI_18024 [Oryza sativa Indica Group]
Length=315

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 135/326 (41%), Positives = 196/326 (60%), Gaps = 24/326 (7%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH--------VYYVQSPSRDSHDDGDGEK-STSMQPTPTFTS  388
             +H K++S+VTSLA SSP           VYYVQSPSRDSHD   GEK +TS+  TP   S
Sbjct  1     MHAKTDSEVTSLAPSSPPRSPTSRGGRPVYYVQSPSRDSHD---GEKTATSVHSTPAL-S  56

Query  389   PVESPSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDE  568
             P+ SP H S+GR S +S  +         S    +G       KGW E  VI EEG  D+
Sbjct  57    PMGSPRH-SVGRDSSSSRFSGHPKRKGDKSSSGRKGAPA---GKGWQEIGVIEEEGLLDD  112

Query  569   LEDSWLLSRRF-HallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSD  745
              ++   + +R  + L+ + GF++LF+ F L++WGA+R  K Q+ +KS++  N  I  G+D
Sbjct  113   EDERRGIPKRCKYFLIFVLGFVVLFSFFALVLWGASRSQKPQIVIKSITFENFIIQAGTD  172

Query  746   FTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRR  925
              + VPT + + N +++++  N  TF+GIHV++ P  L +S +T+A+G L K+YQ+R SRR
Sbjct  173   ASLVPTDMATTNSTVKLTYRNTGTFFGIHVTADPFTLSYSQLTLASGDLNKFYQARSSRR  232

Query  926   TVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQ-VPLALDFEVKSQGDVVGKLVRTDYRR  1102
             TV V + G KVPLYG G +L A K   G+G +  VP+ L   V S+  V+G LV+  + R
Sbjct  233   TVSVGVMGNKVPLYGGGPTLTAGK---GSGSMAPVPMILRTTVHSRAYVLGALVKPKFTR  289

Query  1103  KIWCELIIDSAG-NKPIKFKKDSCAY  1177
              I C+++++ A  NKPI   K SC Y
Sbjct  290   AIECKVLMNPAKLNKPISLDK-SCIY  314



>dbj|BAK05954.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=351

 Score =   192 bits (487),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 118/269 (44%), Positives = 171/269 (64%), Gaps = 8/269 (3%)
 Frame = +2

Query  380   FTSPVESPSHPS-LGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEG  556
             + SP++SPSH S +G HSR SS +RFSG            KR   + KGW E +VI EE 
Sbjct  89    YNSPLDSPSHQSSIGPHSRASSASRFSGNLTGGVRAAATRKRPHGHGKGWHEVDVIDEED  148

Query  557   KYDE-LEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIG  733
               D  ++    LSR   A      F+L FT+ CL++WGAAR  K  V +KSL+V N Y G
Sbjct  149   AEDAGVDQERELSRSCVAAFWFSVFVLAFTLVCLVVWGAARRDKPSVLVKSLTVENFYAG  208

Query  734   EGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSR  913
             EG+D TGVPT+ +++N SL + V NP+T +GIHVSST I L +S I +A+GQL+K+YQ +
Sbjct  209   EGTDATGVPTKFVTMNCSLEMDVDNPSTMFGIHVSSTSIQLYYSQIPIASGQLEKFYQPK  268

Query  914   KSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTD  1093
             KSR  + VN+ G K PLYGAG++   T + DG     VPL +D  V+++G V+G+LVR  
Sbjct  269   KSRHVLSVNLHGEKTPLYGAGATFVLT-DTDG-----VPLTVDLAVRTRGYVIGRLVRVT  322

Query  1094  YRRKIWCELIIDSAGNKPIKFKKDSCAYS  1180
             + +++ C +++ S  ++PI   + +C+Y+
Sbjct  323   HAKRVRCPVLVSSLTDRPIMIAQTACSYT  351



>ref|XP_007152713.1| hypothetical protein PHAVU_004G153000g [Phaseolus vulgaris]
 gb|ESW24707.1| hypothetical protein PHAVU_004G153000g [Phaseolus vulgaris]
Length=297

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 129/320 (40%), Positives = 193/320 (60%), Gaps = 30/320 (9%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH-----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             +H K++S+VTSLAASSP+       +YYVQSPSRDSHD G+   +TS   TP   SPV S
Sbjct  1     MHAKTDSEVTSLAASSPTRSPPRRPLYYVQSPSRDSHD-GEKTATTSFHSTPVL-SPVAS  58

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDS  580
             P H      +R                     K    N K W + ++I EEG     +  
Sbjct  59    PPHSRHSSSTR------------------FSKKDHSHNLKPWKQIDIIEEEGLLQGDDRR  100

Query  581   WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
               L RR + L  + GFLLLF++F LI+WGA+RP K ++++KS+   ++ +  GSD TGV 
Sbjct  101   NGLPRRCYFLAFVVGFLLLFSLFSLILWGASRPMKPKISVKSIKFDDVRVQAGSDPTGVA  160

Query  761   TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVN  940
             T ++++N +L+ +  N  TF+G+HV++TP+ L +SDI +A+G +KK+YQSR+S+R V V 
Sbjct  161   TDMITMNSTLKFTYRNTGTFFGVHVTATPVELSYSDIVIASGNMKKFYQSRRSQRLVSVA  220

Query  941   IQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCEL  1120
             + G ++PLYG+G+SL +T    G   V VPL L+F ++S+  V+GKLV+  Y + I C +
Sbjct  221   VMGNRIPLYGSGASLSST---TGMPTVPVPLNLNFVLRSRAYVLGKLVKPKYYKTIQCSI  277

Query  1121  IIDSAG-NKPIKFKKDSCAY  1177
              +D    + P+  KK SC +
Sbjct  278   TLDPKKLSSPVSLKK-SCRH  296



>ref|XP_011029651.1| PREDICTED: uncharacterized protein LOC105129340 [Populus euphratica]
Length=318

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 140/308 (45%), Positives = 203/308 (66%), Gaps = 17/308 (6%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPVES  400
             +H K++S+VTSLA SSP+      VYYVQSPSRDSHD   GEK+T S   TP   SP+ S
Sbjct  1     MHAKTDSEVTSLAPSSPTRSPRRPVYYVQSPSRDSHD---GEKTTTSFHSTPVL-SPMGS  56

Query  401   P--SHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKG---WPECNVIMEEGKYD  565
             P  SH S+GRHSR SS +RFSG  +  S +           KG   W EC+VI EEG  D
Sbjct  57    PPHSHSSVGRHSRESSSSRFSGSLKPGSRKISPNDASRGGRKGQKQWKECDVIEEEGLLD  116

Query  566   ELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSD  745
             + E    L R+ + L  + GF +LF+ F LI+WGA+R  K ++T+KS++     I  GSD
Sbjct  117   DEERRKGLPRKCYFLAFVVGFFILFSFFSLILWGASRQQKPKITMKSVTFEQFRIQAGSD  176

Query  746   FTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRR  925
              TGV T ++SVN ++R++  N  TF+G+HV+STP++L +S+IT+A+G +KK+YQSRKS+R
Sbjct  177   STGVATDMISVNSTVRMTYRNKGTFFGVHVTSTPVDLSYSEITLASGSIKKFYQSRKSQR  236

Query  926   TVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRK  1105
             +V +++   K+PLYG+G++  ++    GT  + VPL L+F V+S+  V+GKLV+  + ++
Sbjct  237   SVAISLISDKIPLYGSGAAFSSS---TGTATLPVPLKLNFVVRSKAYVLGKLVKPKFNKR  293

Query  1106  IWCELIID  1129
             I C+   D
Sbjct  294   IECDFTFD  301



>emb|CAE01801.2| OSJNBa0039K24.20 [Oryza sativa Japonica Group]
 dbj|BAG87656.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG90829.1| unnamed protein product [Oryza sativa Japonica Group]
Length=315

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 135/326 (41%), Positives = 196/326 (60%), Gaps = 24/326 (7%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH--------VYYVQSPSRDSHDDGDGEK-STSMQPTPTFTS  388
             +H K++S+VTSLA SSP           VYYVQSPSRDSHD   GEK +TS+  TP   S
Sbjct  1     MHAKTDSEVTSLAPSSPPRSPTSRGGRPVYYVQSPSRDSHD---GEKTATSVHSTPAL-S  56

Query  389   PVESPSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDE  568
             P+ SP H S+GR S +S  +         S    +G       KGW E  VI EEG  D+
Sbjct  57    PMGSPRH-SVGRDSSSSRFSGHPKRKGDKSSSGRKGAPA---GKGWQEIGVIEEEGLLDD  112

Query  569   LEDSWLLSRRF-HallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSD  745
              ++   + +R  + L+ + GF++LF+ F L++WGA+R  K Q+ +KS++  N  I  G+D
Sbjct  113   EDERRGIPKRCKYFLIFVLGFVVLFSFFALVLWGASRSQKPQIVIKSITFDNFIIQAGTD  172

Query  746   FTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRR  925
              + VPT + + N +++++  N  TF+GIHV++ P  L +S +T+A+G L K+YQ+R SRR
Sbjct  173   ASLVPTDMATTNSTVKLTYRNTGTFFGIHVTADPFTLSYSQLTLASGDLNKFYQARSSRR  232

Query  926   TVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQ-VPLALDFEVKSQGDVVGKLVRTDYRR  1102
             TV V + G KVPLYG G +L A K   G+G +  VP+ L   V S+  V+G LV+  + R
Sbjct  233   TVSVGVMGNKVPLYGGGPTLTAGK---GSGSMAPVPMILRTTVHSRAYVLGALVKPKFTR  289

Query  1103  KIWCELIIDSAG-NKPIKFKKDSCAY  1177
              I C+++++ A  NKPI   K SC Y
Sbjct  290   AIECKVLMNPAKLNKPISLDK-SCIY  314



>ref|XP_011043531.1| PREDICTED: uncharacterized protein LOC105138964 [Populus euphratica]
Length=321

 Score =   190 bits (483),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 133/324 (41%), Positives = 196/324 (60%), Gaps = 21/324 (6%)
 Frame = +2

Query  242   TKSESDVTSLAASSPSGH------VYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPV--  394
             +K++S+V+SL  SSP+        VYYVQSPSRDSHD   GEK+T S   TP   SP+  
Sbjct  6     SKTDSEVSSLTPSSPARSSPPRRPVYYVQSPSRDSHD---GEKTTNSFHSTPVL-SPMGS  61

Query  395   --ESPSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDE  568
                S S+ SLG HSR  S +           +           K W E + I EEG  D 
Sbjct  62    PPHSHSNSSLGPHSR-DSSSTRYSASLKPHKQHKTDGSGRKGRKPWKEFDAIEEEGLLDG  120

Query  569   LEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDF  748
                S  L RR + L  + GF +LF++F LI+WGA+RP K  +T+K++      +  G DF
Sbjct  121   DIGSHGLPRRCYFLAFVVGFWILFSLFSLILWGASRPQKPTITMKNIIFDQFIVHAGMDF  180

Query  749   TGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRT  928
             +GV T ++S+N +++++  N ATF+G+HV+STP++L +S++TVATG + K+YQSRKS+RT
Sbjct  181   SGVATEMVSMNCTVKLTFRNTATFFGVHVTSTPLDLSYSELTVATGTISKFYQSRKSQRT  240

Query  929   VLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKI  1108
             + V ++G+K+PLYG G+SL +    +G     VPL L+F V+S+  V+GKLV+  + ++I
Sbjct  241   LKVMVKGSKIPLYGGGASLSSL---NGAPTQPVPLILNFMVRSRAYVLGKLVKPKFYKRI  297

Query  1109  WCELIID-SAGNKPIKFKKDSCAY  1177
              C  ++D    N PI   K+ C Y
Sbjct  298   ECSAVMDPKKMNVPISL-KNKCTY  320



>ref|NP_001054346.1| Os04g0689500 [Oryza sativa Japonica Group]
 dbj|BAF16260.1| Os04g0689500, partial [Oryza sativa Japonica Group]
Length=348

 Score =   190 bits (483),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 135/326 (41%), Positives = 196/326 (60%), Gaps = 24/326 (7%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH--------VYYVQSPSRDSHDDGDGEK-STSMQPTPTFTS  388
             +H K++S+VTSLA SSP           VYYVQSPSRDSHD   GEK +TS+  TP   S
Sbjct  34    MHAKTDSEVTSLAPSSPPRSPTSRGGRPVYYVQSPSRDSHD---GEKTATSVHSTPAL-S  89

Query  389   PVESPSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDE  568
             P+ SP H S+GR S +S  +         S    +G       KGW E  VI EEG  D+
Sbjct  90    PMGSPRH-SVGRDSSSSRFSGHPKRKGDKSSSGRKGAPA---GKGWQEIGVIEEEGLLDD  145

Query  569   LEDSWLLSRRF-HallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSD  745
              ++   + +R  + L+ + GF++LF+ F L++WGA+R  K Q+ +KS++  N  I  G+D
Sbjct  146   EDERRGIPKRCKYFLIFVLGFVVLFSFFALVLWGASRSQKPQIVIKSITFDNFIIQAGTD  205

Query  746   FTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRR  925
              + VPT + + N +++++  N  TF+GIHV++ P  L +S +T+A+G L K+YQ+R SRR
Sbjct  206   ASLVPTDMATTNSTVKLTYRNTGTFFGIHVTADPFTLSYSQLTLASGDLNKFYQARSSRR  265

Query  926   TVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQ-VPLALDFEVKSQGDVVGKLVRTDYRR  1102
             TV V + G KVPLYG G +L A K   G+G +  VP+ L   V S+  V+G LV+  + R
Sbjct  266   TVSVGVMGNKVPLYGGGPTLTAGK---GSGSMAPVPMILRTTVHSRAYVLGALVKPKFTR  322

Query  1103  KIWCELIIDSAG-NKPIKFKKDSCAY  1177
              I C+++++ A  NKPI   K SC Y
Sbjct  323   AIECKVLMNPAKLNKPISLDK-SCIY  347



>ref|XP_007047284.1| CAA30379.1 protein, putative [Theobroma cacao]
 gb|EOX91441.1| CAA30379.1 protein, putative [Theobroma cacao]
Length=318

 Score =   189 bits (480),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 126/307 (41%), Positives = 184/307 (60%), Gaps = 15/307 (5%)
 Frame = +2

Query  275   ASSPSGHVYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPV----ESPSHPSLGRHSRTs  439
             A SP   VYYVQSPSRDSHD   GEK+T S   TP   SP+     S S+ SLG HS   
Sbjct  21    ARSPRRQVYYVQSPSRDSHD---GEKTTNSFHSTPVI-SPMGSPPHSHSNSSLGPHS---  73

Query  440   sgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDSWLLSRRFHallal  619
             S    S     S     + +      K W E + I EEG  D       L RR + L  +
Sbjct  74    SRESSSTRLSGSLKPHRKHEGSRKGRKPWKEFDAIEEEGLLDGDGVPHGLPRRCYFLAFV  133

Query  620   cgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPTRLLSVNGSLRIS  799
              GF +LFT F LI+WGA+RP K ++T+KS+S +   +  G+DF+G+ T ++S+N +++++
Sbjct  134   VGFFVLFTTFSLILWGASRPQKPKITMKSISFNEFVVQAGADFSGLATEMVSMNCTVKLT  193

Query  800   VYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNIQGTKVPLYGAGS  979
               N ATF+G+HV+STP++L +S +TVATG ++K+YQSRKS+R + V ++G+ +PLYG G+
Sbjct  194   YRNTATFFGVHVTSTPLDLSYSQLTVATGSIRKFYQSRKSQRALTVMMKGSHIPLYGGGA  253

Query  980   SLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELIIDSAGNKPIKFK  1159
             SL +    +G     VPL L+F V+S+  V+GKLV+  + ++I C + +D          
Sbjct  254   SLGSL---NGAPTQPVPLTLNFMVRSRAYVLGKLVKPKFYKRIECSVTMDPKKMNVAISL  310

Query  1160  KDSCAYS  1180
             K+ C YS
Sbjct  311   KNKCIYS  317



>ref|XP_006339887.1| PREDICTED: uncharacterized protein LOC102589271 [Solanum tuberosum]
Length=393

 Score =   191 bits (485),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 144/339 (42%), Positives = 207/339 (61%), Gaps = 26/339 (8%)
 Frame = +2

Query  200   LQLQISNSTTAMLHTKSESDVTSLAASSPSGHVYYVQSPSRDSHDDGDGEKST-SMQPTP  376
             L L   ++ ++  H K++S+VTSLA SSP+  VYYVQSPSRDSHD   GEK+T S   TP
Sbjct  67    LNLLDQSTMSSTHHAKTDSEVTSLAPSSPNRPVYYVQSPSRDSHD---GEKTTNSFHSTP  123

Query  377   TFTSPVESPSHPSLGRHSRTssgt-----------rfsgifrsssgrkgrgkrmmsNDKG  523
                SP+ SP     GR SR SS T           + S   RS+SGR    +    + + 
Sbjct  124   IL-SPMGSP-----GRQSRDSSSTRYSGSLKPGSQKSSNGSRSNSGRHHNHRHRKGDKQQ  177

Query  524   WPECNVIMEEGKYDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLK  703
             W E + I EEG  D+   S  + RR + L  + GF LLFT F LI+WGA+R  K  VT+K
Sbjct  178   WKEFDAIEEEGLLDDDAYSKSVPRRCYFLAFIVGFFLLFTFFSLILWGASRNQKPVVTMK  237

Query  704   SLSVSNIYIGEGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVAT  883
             S+S +   +  G DF+GV T ++S+N ++++   N  TF+G+HV+STP+ L FS +TVAT
Sbjct  238   SISYNEFGVQSGMDFSGVATVMVSMNSTVKLIFGNTGTFFGVHVTSTPLVLSFSQLTVAT  297

Query  884   GQLKKYYQSRKSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQG  1063
             G +KK+YQ RKS+RTV V++ G K+PLYG G  L    +K+G     V L+LDF+V+++ 
Sbjct  298   GTIKKFYQGRKSQRTVTVSLIGNKIPLYGGGVDL---MSKEGKPLAPVSLSLDFKVRARA  354

Query  1064  DVVGKLVRTDYRRKIWCELIID-SAGNKPIKFKKDSCAY  1177
              V+G+LV+  + +++ C ++++    N PI  KK  C Y
Sbjct  355   YVLGRLVKPKFYKRVQCNVVMEPKKMNVPISLKK-FCTY  392



>gb|KDP31944.1| hypothetical protein JCGZ_12405 [Jatropha curcas]
Length=319

 Score =   189 bits (479),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 129/328 (39%), Positives = 197/328 (60%), Gaps = 31/328 (9%)
 Frame = +2

Query  242   TKSESDVTSLAASSPSGH-------VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             +K++S+V+SL  SSP+         VYYVQSPSRDSHD   GEK+T+       ++PV S
Sbjct  6     SKTDSEVSSLTHSSPTRSSSTPRRPVYYVQSPSRDSHD---GEKTTN----SFHSTPVLS  58

Query  401   PS--------HPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEG  556
             P+        + SLG HSR       S  F  S     +      + K W   + I EEG
Sbjct  59    PAGSPPHSHSNSSLGPHSR----ESSSTRFSGSLKPHRKTSERKVSRKPWKAFDAIEEEG  114

Query  557   KYDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGE  736
               D       + RR + L  + GF +LF++F LIIWGA+RP K  VT+K++      +  
Sbjct  115   LLDGDIGPHGMRRRCYFLAFVLGFFILFSLFSLIIWGASRPQKPTVTMKTIVFDQFIVQA  174

Query  737   GSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRK  916
             G+DF+GV T ++S+N S++++  N ATF+G+HV++TP++L +S +T+ATG ++K+YQSRK
Sbjct  175   GADFSGVATEMVSMNCSVKLTFRNTATFFGVHVTATPLDLSYSQLTLATGTMRKFYQSRK  234

Query  917   SRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDY  1096
             S+R+V V ++G K+PLYG G++L +    +G     VPL L+F V+S+  V+GKLV+  +
Sbjct  235   SQRSVTVMVKGNKIPLYGGGANLGSL---NGAPTQPVPLTLNFTVRSRAYVLGKLVKPKF  291

Query  1097  RRKIWCELIID-SAGNKPIKFKKDSCAY  1177
              +++ C ++ID    N PI   K+ C Y
Sbjct  292   HKRVECLVVIDPKKMNVPISL-KNKCNY  318



>gb|KHG05483.1| hypothetical protein F383_30625 [Gossypium arboreum]
Length=320

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 147/327 (45%), Positives = 207/327 (63%), Gaps = 21/327 (6%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPVES  400
             +H K++S+VTSLA SSP+      VYYVQSPSRDSHD   GEK+T S   TP   SP+ S
Sbjct  1     MHAKTDSEVTSLAPSSPTRSPRRPVYYVQSPSRDSHD---GEKTTTSFHSTPVI-SPMGS  56

Query  401   P--SHPSLGRHSRTssgtrfsg-----ifrsssgrkgrgkrmmsNDKGWPECNVIMEEGK  559
             P  SH S+GRHSR SS +RFSG       + S             +K W EC+VI EEG 
Sbjct  57    PPHSHSSMGRHSRESSSSRFSGSLKPGSRKISPNDAPLRGAHRKGNKQWKECDVIEEEGL  116

Query  560   YDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEG  739
              ++ E    L RR + L    GF LLF++F LI+WGA+RP K ++T+KS+      I  G
Sbjct  117   LEDEEREQGLPRRCYVLAFFVGFFLLFSLFSLILWGASRPQKPKITMKSIRFEQFKIQAG  176

Query  740   SDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKS  919
             SDFTGV T ++++N ++++   N  TF+G+HV+STP++L F+ IT+A+G +KK++QSRKS
Sbjct  177   SDFTGVATDMITMNSTVKMIYRNTGTFFGVHVTSTPLDLSFAQITIASGTMKKFHQSRKS  236

Query  920   RRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYR  1099
             +R++ V + G KVPLYG+G+   +  +  GT  + V L L F V+S+  V+GKLV+  + 
Sbjct  237   QRSLTVIVMGNKVPLYGSGA---SLSSSTGTTSLPVSLKLSFVVRSRAYVLGKLVKQKFY  293

Query  1100  RKIWCELIIDSAG-NKPIKFKKDSCAY  1177
             +KI C++  D    N PI  KK +C Y
Sbjct  294   KKIECDVTFDPKKLNVPISLKK-ACTY  319



>emb|CAB53482.1| CAA30379.1 protein [Oryza sativa]
Length=835

 Score =   196 bits (497),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 141/352 (40%), Positives = 206/352 (59%), Gaps = 24/352 (7%)
 Frame = +2

Query  158   FCSFTIS*TKKLIFLQLQISNSTTAMLHTKSESDVTSLAASSPSGH--------VYYVQS  313
             +CS ++     +  L  QI    T  +H K++S+VTSLA SSP           VYYVQS
Sbjct  495   YCSRSMLLEASVSELHCQIKKKKTRKMHAKTDSEVTSLAPSSPPRSPTSRGGRPVYYVQS  554

Query  314   PSRDSHDDGDGEK-STSMQPTPTFTSPVESPSHPSLGRHSRTssgtrfsgifrsssgrkg  490
             PSRDSHD   GEK +TS+  TP   SP+ SP H S+GR S +S  +         S    
Sbjct  555   PSRDSHD---GEKTATSVHSTPAL-SPMGSPRH-SVGRDSSSSRFSGHPKRKGDKSSSGR  609

Query  491   rgkrmmsNDKGWPECNVIMEEGKYDELEDSWLLSRRF-HallalcgflllfTVFCLIIWG  667
             +G       KGW E  VI EEG  D+ ++   + +R  + L+ + GF++LF+ F L++WG
Sbjct  610   KGAPA---GKGWQEIGVIEEEGLLDDEDERRGIPKRCKYFLIFVLGFVVLFSFFALVLWG  666

Query  668   AARPYKAQVTLKSLSVSNIYIGEGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTP  847
             A+R  K Q+ +KS++  N  I  G+D + VPT + + N +++++  N  TF+GIHV++ P
Sbjct  667   ASRSQKPQIVIKSITFENFIIQAGTDASLVPTDMATTNSTVKLTYRNTGTFFGIHVTADP  726

Query  848   INLVFSDITVATGQLKKYYQSRKSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQ-  1024
               L +S +T+A+G L K+YQ+R SRRTV V + G KVPLYG G +L A K   G+G +  
Sbjct  727   FTLSYSQLTLASGDLNKFYQARSSRRTVSVGVMGNKVPLYGGGPTLTAGK---GSGSMAP  783

Query  1025  VPLALDFEVKSQGDVVGKLVRTDYRRKIWCELIIDSAG-NKPIKFKKDSCAY  1177
             VP+ L   V S+  V+G LV+  + R I C+++++ A  NKPI   K SC Y
Sbjct  784   VPMILRTTVHSRAYVLGALVKPKFTRAIECKVLMNPAKLNKPISLDK-SCIY  834



>ref|XP_004503314.1| PREDICTED: uncharacterized protein LOC101508885 [Cicer arietinum]
Length=299

 Score =   186 bits (471),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 126/318 (40%), Positives = 186/318 (58%), Gaps = 24/318 (8%)
 Frame = +2

Query  236   LHTKSESDVTSLAASS----PSGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESP  403
             +HTK++S+VTSL ASS    P    YYVQSPS D      GEK+T    T   ++PV SP
Sbjct  1     MHTKTDSEVTSLDASSTTRSPRRPAYYVQSPSHD------GEKTT----TSFHSTPVISP  50

Query  404   SHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDSW  583
                              S  F  S           +N+K W + +VI EEG     +   
Sbjct  51    M-------GSPPHSHSSSSRFSGSRKINNHRNNNNNNNKHWKDIDVIEEEGLLQSQDHHH  103

Query  584   LLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPT  763
              L+RR++ L  + GF LLFT+F LI+WGA+RP K  +T+KS+   ++ +  GSD TGV T
Sbjct  104   SLTRRYYFLAFVLGFFLLFTLFSLILWGASRPMKPHITIKSIKFDHVRVQAGSDATGVAT  163

Query  764   RLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNI  943
              +++VN +++ +  N  TF+G+HV+STP++L +SDI + TG +KK+YQSRKS R V V +
Sbjct  164   DMITVNSTVKFTYRNKGTFFGVHVTSTPLDLSYSDIIIGTGNMKKFYQSRKSERLVNVAV  223

Query  944   QGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELI  1123
              G+K+PLYG+G+ L +T    G   + VPL L+FE++S+  V+G+LV+  Y ++I C ++
Sbjct  224   MGSKIPLYGSGAGLSST---TGMPTLPVPLKLNFEIRSRAYVLGRLVKPKYYKRIHCSVV  280

Query  1124  IDSAGNKPIKFKKDSCAY  1177
              D          K+SC Y
Sbjct  281   FDPKKINVSVSLKNSCTY  298



>emb|CAJ86345.1| H0814G11.12 [Oryza sativa Indica Group]
Length=975

 Score =   196 bits (498),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 144/358 (40%), Positives = 208/358 (58%), Gaps = 29/358 (8%)
 Frame = +2

Query  140   LIPYNGFCSFTIS*TKKLIFLQLQISNSTTAMLHTKSESDVTSLAASSPSGH--------  295
             LIP++G  S        +  L  QI    T  +H K++S+VTSLA SSP           
Sbjct  634   LIPHSGDMSLA-----SVSELHCQIKKKKTRKMHAKTDSEVTSLAPSSPPRSPTSRGGRP  688

Query  296   VYYVQSPSRDSHDDGDGEK-STSMQPTPTFTSPVESPSHPSLGRHSRTssgtrfsgifrs  472
             VYYVQSPSRDSHD   GEK +TS+  TP   SP+ SP H S+GR S +S  +        
Sbjct  689   VYYVQSPSRDSHD---GEKTATSVHSTPAL-SPMGSPRH-SVGRDSSSSRFSGHPKRKGD  743

Query  473   ssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDSWLLSRRF-HallalcgflllfTVF  649
              S    +G       KGW E  VI EEG  D+ ++   + +R  + L+ + GF++LF+ F
Sbjct  744   KSSSGRKGAPA---GKGWQEIGVIEEEGLLDDEDERRGIPKRCKYFLIFVLGFVVLFSFF  800

Query  650   CLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPTRLLSVNGSLRISVYNPATFYGI  829
              L++WGA+R  K Q+ +KS++  N  I  G+D + VPT + + N +++++  N  TF+GI
Sbjct  801   ALVLWGASRSQKPQIVIKSITFENFIIQAGTDASLVPTDMATTNSTVKLTYRNTGTFFGI  860

Query  830   HVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNIQGTKVPLYGAGSSLPATKNKDG  1009
             HV++ P  L +S +T+A+G L K+YQ+R SRRTV V + G KVPLYG G +L A K   G
Sbjct  861   HVTADPFTLSYSQLTLASGDLNKFYQARSSRRTVSVGVMGNKVPLYGGGPTLTAGK---G  917

Query  1010  TGGVQ-VPLALDFEVKSQGDVVGKLVRTDYRRKIWCELIIDSAG-NKPIKFKKDSCAY  1177
             +G +  VP+ L   V S+  V+G LV+  + R I C+++++ A  NKPI   K SC Y
Sbjct  918   SGSMAPVPMILRTTVHSRAYVLGALVKPKFTRAIECKVLMNPAKLNKPISLDK-SCIY  974



>emb|CBI19503.3| unnamed protein product [Vitis vinifera]
Length=296

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 128/319 (40%), Positives = 194/319 (61%), Gaps = 29/319 (9%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESP  403
             +H K++S+VTSLAASSP+      VYYVQSPSRDSHD   GEK+T    T   ++PV SP
Sbjct  1     MHAKTDSEVTSLAASSPTRSPRRPVYYVQSPSRDSHD---GEKTT----TSFHSTPVLSP  53

Query  404   SHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDSW  583
                 +G    + S    +   R    +          +K W EC VI EEG  ++ E   
Sbjct  54    ----MGSPPHSHSSISPNDASRGGHRK---------GEKPWKECAVIEEEGLLEDEERQK  100

Query  584   LLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPT  763
              L RR + L  + GF +LF++F LI+WGA++P K ++T+KS++     +  GSD TGV T
Sbjct  101   GLPRRCYFLAFVVGFFVLFSLFSLILWGASKPQKPKITMKSITFERFVVQAGSDSTGVAT  160

Query  764   RLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNI  943
              ++S+N +++++  N ATF+G+HV+STP++L +S + VA+G +KK+YQSRKS R++ + +
Sbjct  161   DMVSMNSTVKLTFRNTATFFGVHVTSTPLDLSYSRLRVASGTIKKFYQSRKSHRSLTIVL  220

Query  944   QGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELI  1123
              G K+PLYG G+SL  +          +PL L F ++S+  V+GKLV+  + ++I C + 
Sbjct  221   MGDKIPLYGGGASLSTSTGTTTE---PLPLKLSFMLRSRAYVLGKLVKPKFYKRIECSVN  277

Query  1124  IDSAG-NKPIKFKKDSCAY  1177
             +D    N P+  KK SC Y
Sbjct  278   LDPKKLNVPLSLKK-SCTY  295



>ref|XP_006466733.1| PREDICTED: uncharacterized protein LOC102607882 [Citrus sinensis]
 gb|KDO79192.1| hypothetical protein CISIN_1g047795mg [Citrus sinensis]
Length=314

 Score =   185 bits (470),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 122/304 (40%), Positives = 188/304 (62%), Gaps = 18/304 (6%)
 Frame = +2

Query  281   SPSGHVYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPV----ESPSHPSLGRHSRTssg  445
             SP   VYYVQSPSRDSHD   GEK+T S   TP   SP+     S S+ SLG HS   S 
Sbjct  23    SPRRPVYYVQSPSRDSHD---GEKTTNSFHSTPVL-SPMGSPPHSHSNSSLGPHSSRESS  78

Query  446   trfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDSWLLSRRFHallalcg  625
             +  S   +     + +      + K W E + I EEG  D       LSRR + L  + G
Sbjct  79    SSASLKPQHHRKNERK------SRKPWKEFDAIEEEGLLDGETIHRALSRRCYLLTFVVG  132

Query  626   flllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPTRLLSVNGSLRISVY  805
             F++LF++F LI+WGA++P K  + +KS+S +   +  G+DF+GV T++++VN +++ +  
Sbjct  133   FIVLFSMFSLILWGASKPQKPTIRMKSISFNQFVVQAGADFSGVATQMVTVNCTVKFTFR  192

Query  806   NPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNIQGTKVPLYGAGSSL  985
             N ATF+G+HV+STP++L +S +TVATG ++K+YQSRKS+R+V V ++G+ +PLYG G+SL
Sbjct  193   NTATFFGVHVTSTPLDLYYSQLTVATGTIRKFYQSRKSQRSVTVMMKGSHIPLYGGGASL  252

Query  986   PATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELIIDSAGNKPIKFKKD  1165
              +    +G     VPL L+F V+++  V+G+LV+  + ++I C +I+D          K+
Sbjct  253   SSL---NGALVEPVPLTLNFMVRARAYVLGRLVKPKFYKRIECSVIMDPKKMNVGISLKN  309

Query  1166  SCAY  1177
             +C Y
Sbjct  310   NCTY  313



>ref|XP_010912033.1| PREDICTED: uncharacterized protein LOC105038045 [Elaeis guineensis]
Length=318

 Score =   185 bits (470),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 126/324 (39%), Positives = 189/324 (58%), Gaps = 15/324 (5%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSG----HVYYVQSPSRDSHDDGDGEK-STSMQPTPTFTSPVES  400
             +H K++S+VTSLAASSP+     HVYYVQSPSRDSHD   GEK +TS   TP   SP+ S
Sbjct  1     MHAKTDSEVTSLAASSPARSPRRHVYYVQSPSRDSHD---GEKTATSFHSTPVL-SPMAS  56

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkr--mmsNDKGWPECNVIMEEGKYDELE  574
             P H        +   +               G +     ++K W E  VI EEG   E E
Sbjct  57    PRHSHSSVGHHSRDSSSSRFSGALKKVANNDGGKGGRRKSEKTWKEFTVIEEEGGLLEDE  116

Query  575   DSWL-LSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFT  751
             +      RR + L  +  F++LF+ F LI+WGA+R  + Q+T+KS++  +  I  G+D +
Sbjct  117   EEGKGFRRRLYFLGFILAFVVLFSFFALILWGASRSQRPQITMKSITFESFIIQAGTDAS  176

Query  752   GVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTV  931
              VPT + ++N +++++  N  TF+G+H +STP +L ++ +T+A+G +  +YQSRKS+RT+
Sbjct  177   LVPTDMATLNSTVKLTFRNTGTFFGVHSTSTPFDLTYNQLTLASGNMNNFYQSRKSQRTL  236

Query  932   LVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIW  1111
              V + G K+PLYG G SL  +  K  T  V VPL L F ++S+  V+G+LV+  +   + 
Sbjct  237   NVVVSGNKIPLYGGGPSLTNSPGKTNT-SVPVPLNLSFMMRSRAYVLGQLVKPKFYTTVQ  295

Query  1112  CELIIDSAG-NKPIKFKKDSCAYS  1180
             C + +D    N P+  KK SC YS
Sbjct  296   CSVAMDQTKLNTPVSLKK-SCQYS  318



>ref|XP_008784188.1| PREDICTED: uncharacterized protein LOC103703193 [Phoenix dactylifera]
Length=318

 Score =   185 bits (469),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 136/328 (41%), Positives = 197/328 (60%), Gaps = 25/328 (8%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPVES  400
             +H K++S+VTS+A SSP+      VYYVQSPSRDSHD   GEK+T S+  TP   SP+ S
Sbjct  1     MHAKTDSEVTSIALSSPTRSPRRPVYYVQSPSRDSHD---GEKTTTSLHSTPVL-SPMGS  56

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsND--------KGWPECNVIMEEG  556
             P H     HS     +R S   R S   K   +++  ND        K W EC VI EEG
Sbjct  57    PPH----SHSSVGRHSRESSSSRFSGSLKPGSRKVTPNDGTRRGGRHKSWKECAVIEEEG  112

Query  557   KYDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGE  736
               ++ ED+  L RR + L  +  F  LF+ F LI+WGA+R  K ++ +KS++  N +I  
Sbjct  113   LIEDEEDAKGLPRRCYVLAFILAFFALFSFFALILWGASRNQKPEIAMKSITFENFFIQA  172

Query  737   GSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRK  916
             GSD + VPT + ++N ++R++  N  +F+G+HVSST ++L +  +T+A+G +  +YQ RK
Sbjct  173   GSDASFVPTDMSTLNSTVRMTYRNTGSFFGVHVSSTSLDLSYYQLTLASGTINSFYQRRK  232

Query  917   SRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDY  1096
             S+R + V + G+KVPLYG G+SL AT  K  T    VPL L F V+S+  V+GKLV+  +
Sbjct  233   SQRNLHVVVTGSKVPLYGGGASLSATPAK--TNSQPVPLTLSFRVRSKAYVLGKLVKPKF  290

Query  1097  RRKIWCELIIDSAG-NKPIKFKKDSCAY  1177
                I C +++D     KP+  KK +C Y
Sbjct  291   YTNIQCSVVMDRTKLGKPVSLKK-ACQY  317



>ref|XP_006653072.1| PREDICTED: uncharacterized protein LOC102708149 [Oryza brachyantha]
Length=317

 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 131/326 (40%), Positives = 191/326 (59%), Gaps = 22/326 (7%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSG--------HVYYVQSPSRDSHDDGDGEK-STSMQPTPTFTS  388
             +H K++S+VTSLA SSP            YYVQSPSRDSHD   GEK +TS+  TP   S
Sbjct  1     MHAKTDSEVTSLAPSSPPRSPTSRGGRQAYYVQSPSRDSHD---GEKTATSVHSTPAL-S  56

Query  389   PVESPSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDE  568
             P+ SP H S+GR S +S  +         S  +          KGW E  VI EEG  D+
Sbjct  57    PMGSPRH-SVGRDSSSSRFSGHPKRKADKSSGRKGAPP----GKGWQEIGVIEEEGFLDD  111

Query  569   LEDSWLLSRRF-HallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSD  745
              ++   + +R  + L+ + GF++LF+ F L++WGA+R  K Q+ +KS++  N  I  G+D
Sbjct  112   DDERRGIPKRCKYFLIFVLGFVVLFSFFALVLWGASRSQKPQIVMKSITFENFIIQAGTD  171

Query  746   FTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRR  925
              + VPT + + N +++ +  N  TF+GIHV++ P  L +S +T+A+G L K+YQ+R SRR
Sbjct  172   ASLVPTDMATTNSTVKFTYRNTGTFFGIHVTADPFQLSYSQLTLASGDLNKFYQARSSRR  231

Query  926   TVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQ-VPLALDFEVKSQGDVVGKLVRTDYRR  1102
             TV V + G KVPLYG G +L A     G+  V  VP+ L   V S+  V+G LV+  + R
Sbjct  232   TVSVGVTGNKVPLYGGGPTLTAGGGSKGSSSVAPVPMILRTTVHSRAYVLGALVKPKFTR  291

Query  1103  KIWCELIIDSAG-NKPIKFKKDSCAY  1177
              I C+++++ A  NKPI   K +C Y
Sbjct  292   GIECKVLMNPAKLNKPISLDK-ACVY  316



>ref|XP_009368173.1| PREDICTED: uncharacterized protein LOC103957702 [Pyrus x bretschneideri]
Length=307

 Score =   184 bits (467),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 125/315 (40%), Positives = 186/315 (59%), Gaps = 42/315 (13%)
 Frame = +2

Query  275   ASSPSGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTF-TSPVESP--------SHPSLGRH  427
             A SP   VYYVQSPSRDSHD   GEK+T+     +F +SPV SP        S+ SLG H
Sbjct  20    ARSPRRAVYYVQSPSRDSHD---GEKTTN-----SFNSSPVLSPMGSPPHSHSNSSLGPH  71

Query  428   SRTssgtrfsgifrsssgrkgrgkrmmsNDKGW----PECNVIMEEGKYDELEDSWLLSR  595
             SR                     +   S  KGW     +   I EEG  DE  +   L+R
Sbjct  72    SR----------------ESASTRFSGSRRKGWRPWKDQFGSIEEEGLLDEDGNPHGLTR  115

Query  596   RFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPTRLLS  775
             R + L  + GFL+LF++F LI+WGA+R  K  +T+KS+      +  G DF+GV T ++S
Sbjct  116   RCYFLAFIGGFLVLFSLFSLILWGASRSQKPIITMKSILFDQFVVQAGEDFSGVATSMVS  175

Query  776   VNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNIQGTK  955
             +N +++++  N ATF+G+HV STP++L +S ++VATG +  +YQ+RKS+RT+ + + G +
Sbjct  176   MNSTVKLTFRNSATFFGVHVKSTPLDLSYSLLSVATGTINNFYQARKSQRTITITLIGNR  235

Query  956   VPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELIIDSA  1135
             +PLYG G++L +    +G     VP AL F V+S+  V+GKLV+  + +K+ C +++DS 
Sbjct  236   IPLYGGGANLGSL---NGAPTQPVPFALRFTVRSRAYVLGKLVKPKFYKKVECSVVMDSK  292

Query  1136  G-NKPIKFKKDSCAY  1177
               N PI   K+SC+Y
Sbjct  293   KMNVPIAL-KNSCSY  306



>ref|NP_564495.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAG50630.1|AC083835_15 unknown protein [Arabidopsis thaliana]
 gb|AAM20677.1| unknown protein [Arabidopsis thaliana]
 gb|AAM66126.1| unknown [Arabidopsis thaliana]
 gb|AAN15642.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD95386.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE32122.1| uncharacterized protein AT1G45688 [Arabidopsis thaliana]
Length=342

 Score =   185 bits (470),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 138/324 (43%), Positives = 195/324 (60%), Gaps = 33/324 (10%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEK-STSMQPTPTFTSPVES  400
             +H K++S+VTSLAASSP+      VYYVQSPSRDSHD   GEK +TS   TP   SP+ S
Sbjct  1     MHAKTDSEVTSLAASSPARSPRRPVYYVQSPSRDSHD---GEKTATSFHSTPVL-SPMGS  56

Query  401   P--SHPSLGRHSRTssgtrfsgifrsssgrkg----rgkrmmsNDKGWPECNVIMEEGKY  562
             P  SH S+GRHSR SS +RFSG  +  S +        ++    +K W EC VI EEG  
Sbjct  57    PPHSHSSMGRHSRESSSSRFSGSLKPGSRKVNPNDGSKRKGHGGEKQWKECAVIEEEGLL  116

Query  563   DELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGS  742
             D+ +    + RR + L  + GF +LF  F LI++GAA+P K ++T+KS++   + I  G 
Sbjct  117   DDGDRDGGVPRRCYVLAFIVGFFILFGFFSLILYGAAKPMKPKITVKSITFETLKIQAGQ  176

Query  743   DFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSR  922
             D  GV T ++++N +LR+   N  TF+G+HV+STPI+L FS I + +G +KK+YQ RKS 
Sbjct  177   DAGGVGTDMITMNATLRMLYRNTGTFFGVHVTSTPIDLSFSQIKIGSGSVKKFYQGRKSE  236

Query  923   RTVLVNIQGTKVPLYGAGSS------------------LPATKNKDGTGGVQVPLALDFE  1048
             RTVLV++ G K+PLYG+GS+                   P            VP+ L F 
Sbjct  237   RTVLVHVIGEKIPLYGSGSTLLPPAPPAPLPKPKKKKGAPVPIPDPPAPPAPVPMTLSFV  296

Query  1049  VKSQGDVVGKLVRTDYRRKIWCEL  1120
             V+S+  V+GKLV+  + +KI C++
Sbjct  297   VRSRAYVLGKLVQPKFYKKIECDI  320



>ref|XP_006425910.1| hypothetical protein CICLE_v10027302mg [Citrus clementina]
 gb|ESR39150.1| hypothetical protein CICLE_v10027302mg [Citrus clementina]
Length=317

 Score =   184 bits (467),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 123/304 (40%), Positives = 186/304 (61%), Gaps = 15/304 (5%)
 Frame = +2

Query  281   SPSGHVYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPV----ESPSHPSLGRHSRTssg  445
             SP   VYYVQSPSRDSHD   GEK+T S   TP   SP+     S S+ SLG HS   S 
Sbjct  23    SPRRPVYYVQSPSRDSHD---GEKTTNSFHSTPVL-SPMGSPPHSHSNSSLGPHS---SR  75

Query  446   trfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDSWLLSRRFHallalcg  625
                S    +S   + + K    + K W E + I EEG  D       LSRR + L  + G
Sbjct  76    ESSSTRLSASLKPQHQRKNERKSRKPWKEFDAIEEEGLLDGETIHRALSRRCYLLTFVVG  135

Query  626   flllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPTRLLSVNGSLRISVY  805
             F++LF++F LI+WGA++P K  + +KS+S +   +  G+DF+GV T++++VN +++ +  
Sbjct  136   FIVLFSMFSLILWGASKPQKPTIRMKSISFNQFVVQAGADFSGVATQMVTVNCTVKFTFR  195

Query  806   NPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNIQGTKVPLYGAGSSL  985
             N ATF+G+HV+STP++L +S +TVATG + K+YQSRKS+R+V V ++G+ +PLYG G+SL
Sbjct  196   NTATFFGVHVTSTPLDLYYSQLTVATGTIPKFYQSRKSQRSVTVMMKGSHIPLYGGGASL  255

Query  986   PATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELIIDSAGNKPIKFKKD  1165
              +    +G     V L L+F V+++  V+G+LV+  + ++I C +I+D          K+
Sbjct  256   SSL---NGALVEPVALTLNFMVRARAYVLGRLVKPKFYKRIECSVIMDPKKMNVGISLKN  312

Query  1166  SCAY  1177
              C Y
Sbjct  313   KCTY  316



>ref|XP_006434739.1| hypothetical protein CICLE_v10001851mg [Citrus clementina]
 ref|XP_006473304.1| PREDICTED: uncharacterized protein LOC102631034 [Citrus sinensis]
 gb|ESR47979.1| hypothetical protein CICLE_v10001851mg [Citrus clementina]
 gb|KDO84131.1| hypothetical protein CISIN_1g020687mg [Citrus sinensis]
Length=322

 Score =   183 bits (465),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 138/331 (42%), Positives = 203/331 (61%), Gaps = 27/331 (8%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPVES  400
             +H K++S+VTSLA SSP+      VYYVQSPSRDSHD   GEK+T S   TP   SP  S
Sbjct  1     MHAKTDSEVTSLAPSSPTRSPRRPVYYVQSPSRDSHD---GEKTTTSFHSTPVL-SPAGS  56

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsND----------KGW-PECNVIM  547
             P H     HS     +R S   R S   K   +++  ND          K W  EC+VI 
Sbjct  57    PPH----SHSSIGRHSRESSSSRFSGSLKPGSRKISPNDASRGGQRKGQKRWNKECDVIE  112

Query  548   EEGKYDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIY  727
             EEG  ++ E    L RR + L  + GF LLF++F LI+WGA++  K ++T+KS++  +  
Sbjct  113   EEGLLEDEERRSGLPRRCYFLAFVLGFFLLFSLFSLILWGASKSQKPKITMKSINFEHFK  172

Query  728   IGEGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQ  907
             I  GSDF+GV T +++VN ++++   N  TF+G+HV+S P++L +S+IT+A+G ++K+YQ
Sbjct  173   IQAGSDFSGVATDMITVNSTVKMIYRNTGTFFGVHVTSNPLDLSYSEITIASGAIRKFYQ  232

Query  908   SRKSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVR  1087
             SRKS++TV V + G K+PLYG+G+ L +  +  G+    VPL L+F V+S+  V+GKLV+
Sbjct  233   SRKSQKTVSVAVMGNKIPLYGSGAGL-SINSTTGSTSHPVPLNLNFVVRSRAYVLGKLVK  291

Query  1088  TDYRRKIWCELIIDSAG-NKPIKFKKDSCAY  1177
               + + I C +  D    N P+   K+SC Y
Sbjct  292   PKFYKNIACSITFDPKKLNVPVSL-KNSCTY  321



>ref|XP_010526725.1| PREDICTED: uncharacterized protein LOC104804214 [Tarenaya hassleriana]
Length=297

 Score =   182 bits (463),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 119/311 (38%), Positives = 177/311 (57%), Gaps = 51/311 (16%)
 Frame = +2

Query  242   TKSESDVTSLAASSPS---GHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESPSHP  412
             +K++S+V+SL  SSP+     VYYVQSPSRDSHD      S     TP   SP+ SP H 
Sbjct  6     SKTDSEVSSLPNSSPARGANVVYYVQSPSRDSHDGEKTTNSFHSSSTPPVLSPMGSPPHS  65

Query  413   SLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDSWLL-  589
             S G  S                                P      +  ++D +E+  LL 
Sbjct  66    SRGSSS---------------------------TRLSRPH-----KAKRFDSIEEERLLG  93

Query  590   ----------SRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEG  739
                       SRRF+ L  + GF +LFTVF LI+W A+RP K  VT++S+      +  G
Sbjct  94    SGPDHALTVRSRRFYFLAFVSGFFVLFTVFSLILWAASRPQKPSVTMRSILFDQFVVQAG  153

Query  740   SDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKS  919
             SD +GV T ++S+N S+R++  N A+F+G+HV+STP++L +S +TVATG + K+YQSRKS
Sbjct  154   SDGSGVATSMVSMNCSVRLTFLNRASFFGVHVTSTPLDLSYSQLTVATGSINKFYQSRKS  213

Query  920   RRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQ-VPLALDFEVKSQGDVVGKLVRTDY  1096
              ++++V ++G K+P+YG G  L A++N+     VQ VPL L F V+S+  V+GKLV+  +
Sbjct  214   EKSMVVQVRGQKIPIYGGGVEL-ASENR---APVQPVPLTLSFMVRSRAYVLGKLVKPMF  269

Query  1097  RRKIWCELIID  1129
              +KI C + ++
Sbjct  270   YKKIVCYVTME  280



>ref|XP_008347617.1| PREDICTED: uncharacterized protein LOC103410720 isoform X2 [Malus 
domestica]
Length=318

 Score =   182 bits (463),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 125/318 (39%), Positives = 182/318 (57%), Gaps = 17/318 (5%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH-----VYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPVE  397
             +H K++S+VTSLA SSP+       VYYVQSPSRDSHD   GEK+T S Q TP  +    
Sbjct  1     MHAKTDSEVTSLAPSSPTRSPGRRPVYYVQSPSRDSHD---GEKTTTSFQSTPVISPSGS  57

Query  398   SPSHPSLG----RHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYD  565
              P   S      R S ++  +                +      K W E  VI EEG  +
Sbjct  58    PPHSHSSTGHHSRESSSTRFSGSLKPGSRKINPNDGSRHNRKGHKLWKEQAVIEEEGLLE  117

Query  566   ELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSD  745
               E S    RR +    + GF LLF++F LI+WGA+RP K ++T+KS++     I  GSD
Sbjct  118   GEEGSKGFPRRCYFPAFVLGFFLLFSMFALILWGASRPMKPKITMKSVTFEQFKIQAGSD  177

Query  746   FTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRR  925
              TGV T ++S+N +++ +  N  TF+G+HV   P++L +  IT+A+G +KK+YQSRKS+R
Sbjct  178   STGVSTDMISINSTVKFTFRNTGTFFGMHVMPKPLDLSYFQITIASGTIKKFYQSRKSQR  237

Query  926   TVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRK  1105
             T+ V + G K+PLYG+G+S+ +     GT  + VP  L F ++S+  V+GKLV+  + R+
Sbjct  238   TISVRVFGDKIPLYGSGASMNSV---TGTTALPVPXQLSFVIRSRAYVLGKLVKPKFNRR  294

Query  1106  IWCELIIDSAG-NKPIKF  1156
             + C +  D    N PIK 
Sbjct  295   VDCSVTFDPKKLNVPIKL  312



>ref|XP_010538128.1| PREDICTED: uncharacterized protein LOC104812578 [Tarenaya hassleriana]
Length=340

 Score =   183 bits (465),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 131/328 (40%), Positives = 186/328 (57%), Gaps = 41/328 (13%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH-----VYYVQSPSRDSHDDGDGEK-STSMQPTPTFTSPVE  397
             +H K++S+VTSLAASSP+       VYYVQSPSRDSHD   GEK +TS   TP   SP+ 
Sbjct  1     MHAKTDSEVTSLAASSPTRSPGRRPVYYVQSPSRDSHD---GEKTATSFHSTPVL-SPMG  56

Query  398   SPSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKG------------WPECNV  541
             SP H      S     +R S   R S   K   +++  ND G            W +C V
Sbjct  57    SPPH----SQSSMGRHSRESSSSRFSGSLKPGSRKISPNDGGKRKGHGGGGDKQWRDCEV  112

Query  542   IMEEGKYDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSN  721
             I EE   D  E    L RR + L  L GF +LFT F LI++GAA+P K ++++KS+    
Sbjct  113   IEEECLLDNEEQEKGLPRRCYVLAFLVGFFVLFTFFSLILYGAAKPQKPKISVKSIRFEQ  172

Query  722   IYIGEGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKY  901
             + +  GSD +GV T ++++N +LR+   N  TF+G+HV+S+PI++ FS IT+ +G +KK+
Sbjct  173   LKVQAGSDSSGVGTDMITMNATLRMMYRNTGTFFGVHVTSSPIDIAFSQITIGSGAIKKF  232

Query  902   YQSRKSRRTVLVNIQGTKVPLYGAGSSL---------------PATKNKDGTGGVQVPLA  1036
             YQSRKS R V+VN+ G K+PLYG+GSS                             VP+ 
Sbjct  233   YQSRKSERMVVVNVIGDKIPLYGSGSSFIPPPPPAPLPKKKKGAPPAVVIPVVPPPVPMK  292

Query  1037  LDFEVKSQGDVVGKLVRTDYRRKIWCEL  1120
             L F V+S+  V+GKLV+  + ++I C++
Sbjct  293   LTFTVRSRAYVLGKLVQPKFYKRIECDI  320



>ref|XP_009343297.1| PREDICTED: uncharacterized protein LOC103935257 [Pyrus x bretschneideri]
Length=307

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 124/315 (39%), Positives = 184/315 (58%), Gaps = 42/315 (13%)
 Frame = +2

Query  275   ASSPSGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTF-TSPVESP--------SHPSLGRH  427
             A SP   VYYVQSPSRDSHD   GEK+T+     +F +SPV SP        S+ SLG H
Sbjct  20    ARSPRRAVYYVQSPSRDSHD---GEKTTN-----SFNSSPVLSPMGSPPHSHSNSSLGPH  71

Query  428   SRTssgtrfsgifrsssgrkgrgkrmmsNDKGW----PECNVIMEEGKYDELEDSWLLSR  595
             SR                     +   S  KGW     +   I EEG  DE  +   L+R
Sbjct  72    SR----------------ESASTRFSGSRRKGWRPWKDQFGSIEEEGLLDEDGNPHGLTR  115

Query  596   RFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPTRLLS  775
             R + L  + GFL+LF++F LI+WGA+R  K  +T+KS+      +  G DF+GV T ++S
Sbjct  116   RCYFLAFIGGFLVLFSLFSLILWGASRSQKPIITMKSILFDEFVVQAGEDFSGVATSMVS  175

Query  776   VNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNIQGTK  955
             +N ++++   N ATF+G+HV STP++L +S +TVATG +  +YQ+RKS+R + + + G +
Sbjct  176   MNSTVKLIFRNSATFFGVHVKSTPLDLSYSQLTVATGTINNFYQARKSQRIITITLVGNR  235

Query  956   VPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELIIDSA  1135
             +PLYG G++L +    +G     VP AL F V+S+  V+GKLV+  + +K+ C +++DS 
Sbjct  236   IPLYGGGANLGSL---NGAPTQPVPFALRFTVRSRAYVLGKLVKPRFYKKVECSVVMDSK  292

Query  1136  G-NKPIKFKKDSCAY  1177
               N PI   K++C+Y
Sbjct  293   KMNVPIAL-KNACSY  306



>ref|XP_002891325.1| hypothetical protein ARALYDRAFT_473858 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67584.1| hypothetical protein ARALYDRAFT_473858 [Arabidopsis lyrata subsp. 
lyrata]
Length=342

 Score =   182 bits (463),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 140/340 (41%), Positives = 201/340 (59%), Gaps = 34/340 (10%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEK-STSMQPTPTFTSPVES  400
             +H K++S+VTSLAASSP+      VYYVQSPSRDSHD   GEK +TS   TP   SP+ S
Sbjct  1     MHAKTDSEVTSLAASSPARSPRRPVYYVQSPSRDSHD---GEKTATSFHSTPVL-SPMGS  56

Query  401   P--SHPSLGRHSRTssgtrfsgifrsssgrkg----rgkrmmsNDKGWPECNVIMEEGKY  562
             P  SH S+GRHSR SS +RFSG  +  S +        ++    +K W EC VI EEG  
Sbjct  57    PPHSHSSMGRHSRESSSSRFSGSLKPGSRKVNPNDGSKRKGHGGEKQWKECAVIEEEGLL  116

Query  563   DELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGS  742
             D+ +    + RR + L  + GF +LF  F LI++GAA+P K ++T+KS++   + +  G 
Sbjct  117   DDGDRDGGVPRRCYVLAFIVGFFILFGFFSLILYGAAKPQKPKITVKSITFETLKVQAGQ  176

Query  743   DFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSR  922
             D  GV T ++++N +LR+   N  TF+G+HV+STPI+L FS I + +G + K+YQSRKS 
Sbjct  177   DAGGVGTDMITMNATLRMLYRNTGTFFGVHVTSTPIDLSFSQIKIGSGSVTKFYQSRKSE  236

Query  923   RTVLVNIQGTKVPLYGAGSS------------------LPATKNKDGTGGVQVPLALDFE  1048
             RTV+V++ G K+PLYG+GS+                   P            VP+ L F 
Sbjct  237   RTVVVHVIGEKIPLYGSGSTLLPPAPPAPLPKPKKKKGAPVVIPDPPAPPAPVPMTLSFV  296

Query  1049  VKSQGDVVGKLVRTDYRRKIWCELIIDSAG-NKPIKFKKD  1165
             V+S+  V+GKLV+  + +KI C++  +    NK I   K+
Sbjct  297   VRSRAYVLGKLVQPKFYKKIECDINFEHKNLNKHIAITKN  336



>ref|XP_006393635.1| hypothetical protein EUTSA_v10011627mg [Eutrema salsugineum]
 gb|ESQ30921.1| hypothetical protein EUTSA_v10011627mg [Eutrema salsugineum]
Length=343

 Score =   182 bits (463),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 141/325 (43%), Positives = 197/325 (61%), Gaps = 34/325 (10%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEK-STSMQPTPTFTSPVES  400
             +H K++S+VTSLAASSP+      VYYVQSPSRDSHD   GEK +TS   TP   SP+ S
Sbjct  1     MHAKTDSEVTSLAASSPARSPRRPVYYVQSPSRDSHD---GEKTATSFHSTPVL-SPMGS  56

Query  401   PSHP--SLGRHSRTssgtrfsgifrsssgrkg----rgkrmmsNDKGWPECNVIMEEGKY  562
             P H   S+GRHSR SS +RFSG  +  S +        ++    +K W EC VI EEG  
Sbjct  57    PPHSQSSMGRHSRESSSSRFSGSLKPGSRKVNPNDGSKRKGHGGEKQWKECAVIEEEGLL  116

Query  563   DELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGS  742
             D+ E    + RR + L  + GF +LF  F LI++GAA+P K ++T+KS++   + +  G 
Sbjct  117   DDGERDGGVPRRCYVLAFIVGFFVLFGFFSLILYGAAKPQKPKITVKSITFETLKVQAGQ  176

Query  743   DFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSR  922
             D  GV T ++++N +LR+   N  TF+G+HV+STPI+L FS I + +G +KK+YQSRKS+
Sbjct  177   DAGGVGTDMITMNATLRMLYRNTGTFFGVHVTSTPIDLSFSQIKIGSGSIKKFYQSRKSQ  236

Query  923   RTVLVNIQGTKVPLYGAGSSL-------------------PATKNKDGTGGVQVPLALDF  1045
             RTVLV++ G K+PLYG+GSSL                   P            VPL L F
Sbjct  237   RTVLVHVIGEKIPLYGSGSSLIPPPPPAPLPKPKKKKRGAPVVIPLPPAPPAPVPLRLSF  296

Query  1046  EVKSQGDVVGKLVRTDYRRKIWCEL  1120
              V+S+  V+GKLV+  + +KI C++
Sbjct  297   VVRSRAYVLGKLVQPKFLKKIECDI  321



>ref|XP_003579535.1| PREDICTED: uncharacterized protein LOC100833843 [Brachypodium 
distachyon]
Length=340

 Score =   182 bits (462),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 127/346 (37%), Positives = 190/346 (55%), Gaps = 39/346 (11%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSP--------------------------SGHVYYVQSPSRDSHDD  337
             +H K++S+VTSLA SSP                           G VYYVQSPSRDSHD 
Sbjct  1     MHAKTDSEVTSLAPSSPPRSPGRANGTTTNNNGSGNNTGGGVMRGAVYYVQSPSRDSHD-  59

Query  338   GDGEKSTSMQPTPTFTSPVESPSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsND  517
             G+ + +TS+  TP   SP+ SP H     HS     +  S   R     K  G++     
Sbjct  60    GETKTATSVHSTPAL-SPMASPRH----SHSSVGRDSSSSRFSRGHHKDKSAGRKGAPAG  114

Query  518   KGWPECNVIMEEGKYDELEDSWLLSRRF-HallalcgflllfTVFCLIIWGAARPYKAQV  694
             KGW E  VI EEG  D+ ++   + +R  + L+ + GF++LF+ F L++WGA+R  K Q+
Sbjct  115   KGWQEIGVIEEEGLLDDEDERRPMPKRCKYCLIFVGGFVVLFSFFALVLWGASRSQKPQI  174

Query  695   TLKSLSVSNIYIGEGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDIT  874
              +KS++  N  I  G+D + VPT + + N +++ +  N  TF+GIHV++ P  L +S + 
Sbjct  175   AMKSITFENFIIQAGTDASLVPTDMATTNATVKFTYKNTGTFFGIHVAADPFTLSYSQLN  234

Query  875   VATGQLKKYYQSRKSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGG----VQVPLALD  1042
             +A+G LKK+YQ R  RRTV V++ G KVPLYG+G +L A               VP+ L 
Sbjct  235   LASGDLKKFYQGRSGRRTVSVSVTGNKVPLYGSGPTLMAAPAGAKGAAPGKVAAVPMILR  294

Query  1043  FEVKSQGDVVGKLVRTDYRRKIWCELIIDSAG-NKPIKFKKDSCAY  1177
               V+S+  V+G LV+  + ++I C ++++ A  NKPI   K +C Y
Sbjct  295   TTVRSRAYVLGALVKPRFTKEIECRVVMNPAKLNKPISLAK-ACQY  339



>ref|XP_007202978.1| hypothetical protein PRUPE_ppa018646mg [Prunus persica]
 gb|EMJ04177.1| hypothetical protein PRUPE_ppa018646mg [Prunus persica]
Length=317

 Score =   181 bits (460),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 125/314 (40%), Positives = 182/314 (58%), Gaps = 30/314 (10%)
 Frame = +2

Query  275   ASSPSGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTF-TSPVESP--------SHPSLGRH  427
             A SP    YYVQSPSRDSHD   GEK+T+     +F +SPV SP        S+ SLG H
Sbjct  20    ARSPRRAAYYVQSPSRDSHD---GEKTTN-----SFNSSPVLSPMGSPPHSHSNSSLGPH  71

Query  428   SRTssgtrfsgifrsssgrkgrgkrmmsNDKGW----PECNVIMEEGKYDELEDSWLLSR  595
             SR       S   R S  R        S+ KGW     +   I EEG  D+      L+R
Sbjct  72    SR------ESASTRFSGSRSKNHHGGGSHRKGWRPWKDQFGSIEEEGLLDDDGTKHGLTR  125

Query  596   RFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPTRLLS  775
             R + +  + GFL LF++F LI+WGA+RP K  VT+KS++     +  G DF+GV T +LS
Sbjct  126   RCYFVAFIVGFLGLFSLFSLILWGASRPQKPIVTMKSIAFDQFVVQAGEDFSGVATNMLS  185

Query  776   VNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNIQGTK  955
             +N +L+ +  N ATF+G+HV  TP++L +S +TVATG +K +YQSRKS+R++ + + G +
Sbjct  186   MNSTLKFTFRNTATFFGVHVKPTPLDLSYSQLTVATGTMKGFYQSRKSQRSITITLIGNR  245

Query  956   VPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELIIDSA  1135
             +P+YG G++L ++   +G     VPL L F V+S+  V+G+LV+  + R++ C +I+D  
Sbjct  246   IPVYGGGANLGSS---NGAPTQAVPLTLRFLVRSRAYVLGQLVKPKFHRRVDCSVIMDPK  302

Query  1136  GNKPIKFKKDSCAY  1177
                     K  C Y
Sbjct  303   KMNVAIALKSKCNY  316



>ref|XP_008241489.1| PREDICTED: uncharacterized protein LOC103339911 [Prunus mume]
Length=317

 Score =   181 bits (459),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 123/311 (40%), Positives = 181/311 (58%), Gaps = 30/311 (10%)
 Frame = +2

Query  284   PSGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTF-TSPVESP--------SHPSLGRHSRT  436
             P    YYVQSPSRDSHD   GEK+T+     +F +SPV SP        S+ SLG HSR 
Sbjct  23    PRRAAYYVQSPSRDSHD---GEKTTN-----SFNSSPVLSPMGSPPHSHSNSSLGPHSR-  73

Query  437   ssgtrfsgifrsssgrkgrgkrmmsNDKGW----PECNVIMEEGKYDELEDSWLLSRRFH  604
                   S   R S  R        S+ KGW     +   I EEG  ++      L+RR +
Sbjct  74    -----ESASTRFSGSRSKNHHGGGSHRKGWRPWKDQFGSIEEEGLLNDDGTKHGLTRRCY  128

Query  605   allalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPTRLLSVNG  784
                 + GFL LF++F LI+WGA+RP K  VT+KS++     +  G DF+GV T +LS+N 
Sbjct  129   FFAFIVGFLGLFSLFSLILWGASRPQKPIVTMKSIAFDQFVVQAGEDFSGVATNMLSMNS  188

Query  785   SLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNIQGTKVPL  964
             +L+ +  N ATF+G+HV  TP++L +S +TVATG +K +YQSRKS+R++ + + G ++P+
Sbjct  189   TLKFTFRNTATFFGVHVKPTPLDLSYSQLTVATGTMKGFYQSRKSQRSITITLIGNRIPV  248

Query  965   YGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELIIDSAGNK  1144
             YG G++L ++   +G     VPL L F V+S+  V+GKLV+  + RK+ C +++D     
Sbjct  249   YGGGANLGSS---NGAPTQAVPLTLRFLVRSRAHVLGKLVKPKFHRKVDCSVVMDPKKMN  305

Query  1145  PIKFKKDSCAY  1177
                  K+ C+Y
Sbjct  306   VAIALKNKCSY  316



>ref|XP_003525209.1| PREDICTED: uncharacterized protein LOC100787767 [Glycine max]
 gb|KHN21646.1| hypothetical protein glysoja_023498 [Glycine soja]
Length=294

 Score =   180 bits (457),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 128/320 (40%), Positives = 189/320 (59%), Gaps = 33/320 (10%)
 Frame = +2

Query  236   LHTKSESDVTSLAASS----PSGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESP  403
             +H K++S+VTSL ASS    P   VYYVQSPS D      GEK+T    T   ++PV SP
Sbjct  1     MHAKTDSEVTSLDASSSTRSPRRAVYYVQSPSHD------GEKTT----TSLHSTPVLSP  50

Query  404   SHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYD-ELEDS  580
                 +G    + S +      R  +           N+K W   +VI EEG    EL+  
Sbjct  51    ----MGSPPHSHSSSSRFSASRHRNNH---------NNKSWKGIDVIEEEGLLQSELDRQ  97

Query  581   WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
               LSRR++ L  L GF LLF++F LI+W A+RP K ++ +KS+   ++ +  GSD +GV 
Sbjct  98    HSLSRRYYFLAFLLGFFLLFSLFSLILWCASRPMKPKILIKSIKFDHLRVQAGSDSSGVA  157

Query  761   TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVN  940
             T ++++N +++ +  N  TF+G+HV+STP +L +SDI +ATG LKK+YQSRKS+R V V 
Sbjct  158   TDMITMNSTVKFTYRNTGTFFGVHVTSTPFDLSYSDIVIATGNLKKFYQSRKSQRLVSVA  217

Query  941   IQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCEL  1120
             + G K+PLYG G+SL ++    G   + VPL L F ++S+  V+G+LV+  Y +++ C +
Sbjct  218   VMGNKIPLYGGGASLSSS---TGVPTLPVPLNLTFVIRSRAYVLGRLVKPKYYKRVQCSI  274

Query  1121  IIDSAG-NKPIKFKKDSCAY  1177
              +D    N PI  K  SC Y
Sbjct  275   NLDPKKINVPISLKH-SCTY  293



>ref|XP_008363142.1| PREDICTED: uncharacterized protein LOC103426839 [Malus domestica]
Length=317

 Score =   181 bits (458),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 129/312 (41%), Positives = 196/312 (63%), Gaps = 26/312 (8%)
 Frame = +2

Query  275   ASSPSGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTF-TSPVESP--------SHPSLGRH  427
             A SP   VYYVQSPSRDSHD   GEK+T+     +F +SPV SP        S+ SLG H
Sbjct  20    ARSPRRAVYYVQSPSRDSHD---GEKTTN-----SFNSSPVRSPMGSPPHSHSNSSLGPH  71

Query  428   SRTssgtrfsgifrsssgrkgrgkrmmsNDKGWP-ECNVIMEEGKYDELEDSWLLSRRFH  604
             SR S+ TRFSG    SS   G  ++     + W  +   I EEG  DE  +   L+RR +
Sbjct  72    SRESASTRFSGSRSKSSRSSGSRRKGW---RPWKDQFGSIEEEGLLDEDGNPHGLTRRCY  128

Query  605   allalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPTRLLSVNG  784
              L  + GFL+LF++F LI+WGA+R  K  +T+KS+      +  G DF+GV T ++S+N 
Sbjct  129   FLAFIGGFLVLFSLFSLILWGASRSQKPIITMKSILFDQFVVQAGEDFSGVATSMVSMNS  188

Query  785   SLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNIQGTKVPL  964
             ++++++ N ATF+G+HV STP++L +S ++VATG +  +YQ+RKS+R++ + + G ++PL
Sbjct  189   TVKLTLRNSATFFGVHVKSTPLDLSYSQLSVATGTINNFYQARKSQRSITITLVGNRIPL  248

Query  965   YGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELIIDSAG-N  1141
             YG G++L +    +G     VP AL F V+S+  V+GKLV+  + +K+ C +++DS   N
Sbjct  249   YGGGANLGSL---NGAPTQPVPFALRFTVRSRAYVLGKLVKPKFYKKVECSVVMDSKKMN  305

Query  1142  KPIKFKKDSCAY  1177
              PI   K++C+Y
Sbjct  306   VPIAL-KNTCSY  316



>ref|XP_008347616.1| PREDICTED: uncharacterized protein LOC103410720 isoform X1 [Malus 
domestica]
Length=319

 Score =   181 bits (458),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 126/319 (39%), Positives = 183/319 (57%), Gaps = 18/319 (6%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH-----VYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPVE  397
             +H K++S+VTSLA SSP+       VYYVQSPSRDSHD   GEK+T S Q TP  +    
Sbjct  1     MHAKTDSEVTSLAPSSPTRSPGRRPVYYVQSPSRDSHD---GEKTTTSFQSTPVISPSGS  57

Query  398   SPSHPSLG----RHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYD  565
              P   S      R S ++  +                +      K W E  VI EEG  +
Sbjct  58    PPHSHSSTGHHSRESSSTRFSGSLKPGSRKINPNDGSRHNRKGHKLWKEQAVIEEEGLLE  117

Query  566   ELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSD  745
               E S    RR +    + GF LLF++F LI+WGA+RP K ++T+KS++     I  GSD
Sbjct  118   GEEGSKGFPRRCYFPAFVLGFFLLFSMFALILWGASRPMKPKITMKSVTFEQFKIQAGSD  177

Query  746   FTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATG-QLKKYYQSRKSR  922
              TGV T ++S+N +++ +  N  TF+G+HV   P++L +  IT+A+G Q+KK+YQSRKS+
Sbjct  178   STGVSTDMISINSTVKFTFRNTGTFFGMHVMPKPLDLSYFQITIASGTQIKKFYQSRKSQ  237

Query  923   RTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRR  1102
             RT+ V + G K+PLYG+G+S+ +     GT  + VP  L F ++S+  V+GKLV+  + R
Sbjct  238   RTISVRVFGDKIPLYGSGASMNSV---TGTTALPVPXQLSFVIRSRAYVLGKLVKPKFNR  294

Query  1103  KIWCELIIDSAG-NKPIKF  1156
             ++ C +  D    N PIK 
Sbjct  295   RVDCSVTFDPKKLNVPIKL  313



>ref|XP_008378032.1| PREDICTED: uncharacterized protein LOC103441111 [Malus domestica]
Length=318

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 125/318 (39%), Positives = 181/318 (57%), Gaps = 17/318 (5%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH-----VYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPVE  397
             +H K++S+VTSLA SSP+       VYYVQSPSRDSHD   GEK+T S Q TP  +    
Sbjct  1     MHAKTDSEVTSLAPSSPTRSPGRRPVYYVQSPSRDSHD---GEKTTTSFQSTPVISPSGS  57

Query  398   SPSHPSLG----RHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYD  565
              P   S      R S ++  +                +      K W E  VI EEG  +
Sbjct  58    PPHSHSSTGHHSRESSSTRFSGSLKPGSRKINPNDGSRHNRKGHKLWKEQAVIEEEGLLE  117

Query  566   ELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSD  745
               E S    RR +    + GF LLF++F LI+WGA+RP K ++T+KS++     I  GSD
Sbjct  118   GEEGSKGFPRRCYFPAFVLGFFLLFSMFALILWGASRPMKPKITMKSVTFEQFKIQAGSD  177

Query  746   FTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRR  925
              TGV T ++S+N +++ +  N  TF+G+HV   P++L +  IT+A+G +KK YQSRKS+R
Sbjct  178   STGVSTDMISINSTVKFTFRNTGTFFGMHVMPKPLDLSYFQITIASGTIKKXYQSRKSQR  237

Query  926   TVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRK  1105
             T+ V + G K+PLYG+G+S+ +     GT  + VP  L F ++S+  V+GKLV+  + R+
Sbjct  238   TISVRVFGDKIPLYGSGASMNSV---TGTTALPVPXQLSFVIRSRAYVLGKLVKPKFNRR  294

Query  1106  IWCELIIDSAG-NKPIKF  1156
             + C +  D    N PIK 
Sbjct  295   VDCSVTFDPKKLNVPIKL  312



>ref|XP_010479103.1| PREDICTED: uncharacterized protein LOC104758001 [Camelina sativa]
Length=342

 Score =   181 bits (460),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 138/340 (41%), Positives = 200/340 (59%), Gaps = 34/340 (10%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEK-STSMQPTPTFTSPVES  400
             +H K++S+VTS+AASSP+      VYYVQSPSRDSHD   GEK +TS   TP   SP+ S
Sbjct  1     MHAKTDSEVTSIAASSPARSPRRPVYYVQSPSRDSHD---GEKTATSFHSTPVL-SPMGS  56

Query  401   PSHP--SLGRHSRTssgtrfsgifrsssgrkg----rgkrmmsNDKGWPECNVIMEEGKY  562
             P H   S+GRHSR SS +RFSG  +  S +        ++    +K W EC VI EEG  
Sbjct  57    PPHSQSSMGRHSRESSSSRFSGSLKPGSRKVNPNDGSKRKGHGGEKQWKECAVIEEEGLL  116

Query  563   DELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGS  742
             DE +    + RR + L  + GF +LF +F LI++GAA+P K ++T+KS++   + +  G 
Sbjct  117   DEGDRDRGVPRRCYVLAFIVGFFILFGLFSLILYGAAKPQKPKITVKSITFETLKVQAGQ  176

Query  743   DFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSR  922
             D  GV T ++++N +LR+   N  TF+G+HV+STPI+L FS I + +G +KK+YQSR S 
Sbjct  177   DAGGVGTDMITMNATLRMLYKNTGTFFGVHVTSTPIDLSFSQIKIGSGSIKKFYQSRNSH  236

Query  923   RTVLVNIQGTKVPLYGAGSS------------------LPATKNKDGTGGVQVPLALDFE  1048
              TV+V++ G K+PLYG+GS+                   P            VP+ L F 
Sbjct  237   STVVVHVTGEKIPLYGSGSTLLPPAPPAPLPKPKKKKGAPVVIPDPPAPPAPVPMTLSFI  296

Query  1049  VKSQGDVVGKLVRTDYRRKIWCELIIDSAG-NKPIKFKKD  1165
             V+S+  V+GKLV+  + +KI C++  +    NK I   K+
Sbjct  297   VRSRAYVLGKLVQPKFYKKIMCDINFEHKNLNKHIAITKN  336



>dbj|BAB02013.1| unnamed protein product [Arabidopsis thaliana]
Length=298

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 120/315 (38%), Positives = 187/315 (59%), Gaps = 24/315 (8%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESPSHPS  415
             ++ KS+SDVTSL  SSP    YYVQSPSRDS      +KS+S+  T   T+P ESPSHPS
Sbjct  3     MYPKSDSDVTSLDLSSPKRPTYYVQSPSRDS------DKSSSVALTTHQTTPTESPSHPS  56

Query  416   LGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDEL-EDSWLLS  592
             +   SR S+G      ++                  WP       +G+Y++L ED+  +S
Sbjct  57    IA--SRVSNGGGGGFRWKGRRKYH--------GGIWWPADKEEGGDGRYEDLYEDNRGVS  106

Query  593   -RRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPTRL  769
                   +L +   L +F + C +++GA++     V +K ++V + Y GEGSD TGVPT++
Sbjct  107   IVTCRLILGVVATLSIFFLLCSVLFGASQSSPPIVYIKGVNVRSFYYGEGSDNTGVPTKI  166

Query  770   LSVNGSLRISVYNPATFYGIHVSSTPINLVFS-DITVATGQLKKYYQSRKSRRTVLVNIQ  946
             ++V  S+ I+ +NP+T +GIHVSST ++L++S   T+A  +LK Y+Q ++S  T  +N+ 
Sbjct  167   MNVKCSVVITTHNPSTLFGIHVSSTAVSLIYSRQFTLANARLKSYHQPKQSNHTSRINLI  226

Query  947   GTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELII  1126
             G+KVPLYGAG+ L A+ N  G     VP+ L+FE++S+ ++VG LV++ +R+ + C   I
Sbjct  227   GSKVPLYGAGAELVASDNSGG-----VPVKLEFEIRSRANIVGNLVKSRHRKHLSCFFFI  281

Query  1127  DSAGNKPIKFKKDSC  1171
              S     +KF   +C
Sbjct  282   SSYNTTFVKFTHKTC  296



>gb|EAZ32502.1| hypothetical protein OsJ_16721 [Oryza sativa Japonica Group]
Length=988

 Score =   189 bits (481),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 135/326 (41%), Positives = 196/326 (60%), Gaps = 24/326 (7%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH--------VYYVQSPSRDSHDDGDGEK-STSMQPTPTFTS  388
             +H K++S+VTSLA SSP           VYYVQSPSRDSHD   GEK +TS+  TP   S
Sbjct  674   MHAKTDSEVTSLAPSSPPRSPTSRGGRPVYYVQSPSRDSHD---GEKTATSVHSTPAL-S  729

Query  389   PVESPSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDE  568
             P+ SP H S+GR S +S  +         S    +G       KGW E  VI EEG  D+
Sbjct  730   PMGSPRH-SVGRDSSSSRFSGHPKRKGDKSSSGRKGAPA---GKGWQEIGVIEEEGLLDD  785

Query  569   LEDSWLLSRRF-HallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSD  745
              ++   + +R  + L+ + GF++LF+ F L++WGA+R  K Q+ +KS++  N  I  G+D
Sbjct  786   EDERRGIPKRCKYFLIFVLGFVVLFSFFALVLWGASRSQKPQIVIKSITFDNFIIQAGTD  845

Query  746   FTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRR  925
              + VPT + + N +++++  N  TF+GIHV++ P  L +S +T+A+G L K+YQ+R SRR
Sbjct  846   ASLVPTDMATTNSTVKLTYRNTGTFFGIHVTADPFTLSYSQLTLASGDLNKFYQARSSRR  905

Query  926   TVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQ-VPLALDFEVKSQGDVVGKLVRTDYRR  1102
             TV V + G KVPLYG G +L A K   G+G +  VP+ L   V S+  V+G LV+  + R
Sbjct  906   TVSVGVMGNKVPLYGGGPTLTAGK---GSGSMAPVPMILRTTVHSRAYVLGALVKPKFTR  962

Query  1103  KIWCELIIDSAG-NKPIKFKKDSCAY  1177
              I C+++++ A  NKPI   K SC Y
Sbjct  963   AIECKVLMNPAKLNKPISLDK-SCIY  987



>ref|XP_008363141.1| PREDICTED: uncharacterized protein LOC103426838 [Malus domestica]
Length=317

 Score =   180 bits (457),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 129/312 (41%), Positives = 196/312 (63%), Gaps = 26/312 (8%)
 Frame = +2

Query  275   ASSPSGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTF-TSPVESP--------SHPSLGRH  427
             A SP   VYYVQSPSRDSHD   GEK+T+     +F +SPV SP        S+ SLG H
Sbjct  20    ARSPRRAVYYVQSPSRDSHD---GEKTTN-----SFNSSPVRSPMGSPPHSHSNSSLGPH  71

Query  428   SRTssgtrfsgifrsssgrkgrgkrmmsNDKGWP-ECNVIMEEGKYDELEDSWLLSRRFH  604
             SR S+ TRFSG    SS   G  ++     + W  +   I EEG  DE  +   L+RR +
Sbjct  72    SRESASTRFSGSRSKSSRSSGSRRKGW---RPWKDQFGSIEEEGLLDEDGNPHGLTRRCY  128

Query  605   allalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPTRLLSVNG  784
              L  + GFL+LF++F LI+WGA+R  K  +T+KS+      +  G DF+GV T ++S+N 
Sbjct  129   FLXFIGGFLVLFSLFSLILWGASRSQKPIITMKSILFDQFVVQAGEDFSGVATSMVSMNS  188

Query  785   SLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNIQGTKVPL  964
             ++++++ N ATF+G+HV STP++L +S ++VATG +  +YQ+RKS+R++ + + G ++PL
Sbjct  189   TVKLTLRNSATFFGVHVKSTPLDLSYSQLSVATGTINNFYQARKSQRSITITLVGNRIPL  248

Query  965   YGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELIIDSAG-N  1141
             YG G++L +    +G     VP AL F V+S+  V+GKLV+  + +K+ C +++DS   N
Sbjct  249   YGGGANLGSL---NGAPTQPVPFALRFTVRSRAYVLGKLVKPKFYKKVECSVVMDSKKMN  305

Query  1142  KPIKFKKDSCAY  1177
              PI   K++C+Y
Sbjct  306   VPIAL-KNTCSY  316



>ref|XP_004509134.1| PREDICTED: uncharacterized protein LOC101501112 [Cicer arietinum]
Length=329

 Score =   180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 125/319 (39%), Positives = 191/319 (60%), Gaps = 38/319 (12%)
 Frame = +2

Query  230   AMLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTF-TSPV  394
             AML  K++S+V+S   SSP+      VYYVQSPSRDS +DG  EK+T+     +F +SP+
Sbjct  12    AML-AKTDSEVSSQTQSSPTRSPRRAVYYVQSPSRDSSNDG--EKTTN-----SFNSSPL  63

Query  395   ESP--------SHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKG----WP-EC  535
             +SP        S+ SLG HSR            +      +     +N KG    W  + 
Sbjct  64    QSPLGSPPHSHSNSSLGPHSR--------ESASTRFSASRKSSNASNNRKGHWRPWKDQF  115

Query  536   NVIMEEGKYDELEDSWL-LSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLS  712
             + I EEG  D  +D+     RR +    + GF +LF+VF LI+WGA+RP K  + LKS++
Sbjct  116   HAIEEEGLLDVHDDTNRGFPRRCYFPAFVVGFTVLFSVFSLILWGASRPQKPTILLKSIT  175

Query  713   VSNIYIGEGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQL  892
                  I  G+D +GV T ++S+N S++++  N ATF+G+HVSSTP+N+ +  +++ATG +
Sbjct  176   FDRFIIQAGADLSGVATSMVSMNSSVKMTFRNTATFFGVHVSSTPLNINYYQLSLATGNM  235

Query  893   KKYYQSRKSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVV  1072
              ++YQSRKS R++ V ++G+ +PLYG G+SL +    +G     VPL L+  V+S+  V+
Sbjct  236   PRFYQSRKSERSIRVMVKGSHIPLYGGGASLSSM---NGLPVEPVPLTLNVMVRSKAYVL  292

Query  1073  GKLVRTDYRRKIWCELIID  1129
             GKLV+  + +KI C LI+D
Sbjct  293   GKLVKPKFYKKIECGLIMD  311



>ref|XP_003525811.2| PREDICTED: uncharacterized protein LOC100798888 [Glycine max]
Length=324

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 126/323 (39%), Positives = 192/323 (59%), Gaps = 38/323 (12%)
 Frame = +2

Query  218   NSTTAMLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTF-  382
             N    ML  K++S+V+SL  SSP+      VYYVQSPSRDS  DG  EK+T+     +F 
Sbjct  4     NDNMTML-AKTDSEVSSLTQSSPARSPRRDVYYVQSPSRDSSHDG--EKTTN-----SFH  55

Query  383   TSPVESP--------SHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKG----W  526
             +SP++SP        S+ SLGRHSR            +      +     +N KG    W
Sbjct  56    SSPLQSPLGSPPHSHSNSSLGRHSR--------ESASTRFSGSRKSSSSGNNRKGPWRPW  107

Query  527   P-ECNVIMEEGKYDELEDSWL-LSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTL  700
               + + I EEG  D  +++     RR +    + GF++LF+ F LI+WGA+RP K  ++L
Sbjct  108   KDQFHAIEEEGLLDPNDNAHHGFPRRCYFPAFVVGFVVLFSAFSLILWGASRPQKPAISL  167

Query  701   KSLSVSNIYIGEGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVA  880
             KS++     I  G+D +GV T L+S+N S++++  N ATF+G+HV+STP++L +  +TVA
Sbjct  168   KSITFDQFVIQAGADMSGVATSLVSMNSSVKMTFRNTATFFGVHVTSTPVDLNYYQLTVA  227

Query  881   TGQLKKYYQSRKSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQ  1060
             TG + K+YQSRKS+R+V V + G+ +PLYG G++L +    +G     VPL L   V+S+
Sbjct  228   TGTMPKFYQSRKSQRSVRVMVIGSHIPLYGGGANLNSV---NGKPVEPVPLTLSVMVRSR  284

Query  1061  GDVVGKLVRTDYRRKIWCELIID  1129
               V+GKLV+  + +KI C +++D
Sbjct  285   AYVLGKLVKPKFYKKIECSIVMD  307



>dbj|BAJ96526.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=347

 Score =   180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 129/348 (37%), Positives = 190/348 (55%), Gaps = 31/348 (9%)
 Frame = +2

Query  215   SNSTTAMLHTKSESDVTSLAASSPS--------------------GHVYYVQSPSRDSHD  334
             S    A +H K++S+VTSLA SSP+                    G VYYVQSPSRDSHD
Sbjct  5     SQEKAARMHAKTDSEVTSLAPSSPARSPPRAAANNNAGSGGGVMRGAVYYVQSPSRDSHD  64

Query  335   DGDGEK-STSMQPTPTFTSPVESPSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmms  511
                  K +TS+  TP   SP+ SP H      S     +            K  G++   
Sbjct  65    GETTTKGATSVHSTPAL-SPMASPRH---SHSSVGRDSSSSRFSRGHHHKDKSAGRKGAP  120

Query  512   NDKGWPECNVIMEEGKYDELEDSWLLSRRF-HallalcgflllfTVFCLIIWGAARPYKA  688
               KGW E  VI EEG  DE +    + +R  + L+ + GF +LFT F L++WGA+R  K 
Sbjct  121   AGKGWQEIGVIEEEGLLDEEDQRRPMPKRCKYCLIFVGGFAVLFTFFALVLWGASRSKKP  180

Query  689   QVTLKSLSVSNIYIGEGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSD  868
             Q+ +KS++  N  I  G+D + VPT + + N +++ +  N  TF+GIHV++ P  L +S 
Sbjct  181   QIAMKSITFENFIIQAGTDASLVPTDMATTNATVKFTYKNTGTFFGIHVTADPFTLSYSQ  240

Query  869   ITVATGQLKKYYQSRKSRRTVLVNIQGTKVPLYGAGSSL---PATKNKDGTGGVQVPLAL  1039
             + +A G LKK+YQ R  RRT  VN++G KVPLYG+G +L   PA         + VP+ L
Sbjct  241   LNLAAGDLKKFYQGRSGRRTASVNVKGNKVPLYGSGPTLMAQPAGGKGGAGKVIPVPMVL  300

Query  1040  DFEVKSQGDVVGKLVRTDYRRKIWCELIIDSAG-NKPIKFKKDSCAYS  1180
                V+SQ  V+G LV+  + +++ C+++++ A  NKP+  +K +C YS
Sbjct  301   RTTVRSQAYVLGALVKPRFTKEVECKVVMNPAKLNKPVSLEK-ACKYS  347



>gb|AFK41834.1| unknown [Lotus japonicus]
Length=125

 Score =   172 bits (437),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 104/128 (81%), Gaps = 4/128 (3%)
 Frame = +2

Query  794   ISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNIQGTKVPLYGA  973
             +S+YNPATF+GIHV STPINLVFSDI+VATG+LKKYYQ RKS R V VN+ G KVPLYGA
Sbjct  1     MSIYNPATFFGIHVHSTPINLVFSDISVATGELKKYYQPRKSHRMVSVNLVGKKVPLYGA  60

Query  974   GSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELIIDSAGNKPIK  1153
             GS++  ++    TG V V L L FE+ S+G+VVGKLVRT + ++I C L+IDS+G+KPIK
Sbjct  61    GSTITESQ----TGVVVVSLKLKFEIVSRGNVVGKLVRTKHHKEITCPLVIDSSGSKPIK  116

Query  1154  FKKDSCAY  1177
             FKK+SC Y
Sbjct  117   FKKNSCTY  124



>ref|XP_003550061.2| PREDICTED: uncharacterized protein LOC100798077 [Glycine max]
Length=323

 Score =   179 bits (453),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 125/322 (39%), Positives = 191/322 (59%), Gaps = 37/322 (11%)
 Frame = +2

Query  218   NSTTAMLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTF-  382
             N   AML  K++S+V+SL  SSP+      VYYVQSPSRDS  DG  EK+T+     +F 
Sbjct  4     NDNMAML-AKTDSEVSSLTQSSPTRSPRRAVYYVQSPSRDSSHDG--EKTTN-----SFH  55

Query  383   TSPVESP--------SHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKG----W  526
             +SP++SP        S+ SLG HSR            +      +     +N KG    W
Sbjct  56    SSPLQSPLGSPPHSHSNSSLGHHSR--------ESASTRFSGSRKSSSSGNNRKGPWRPW  107

Query  527   P-ECNVIMEEGKYDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLK  703
               + + I EEG  D  +++    R  +    + GF+LLF+ F LI+WGA+RP K  ++LK
Sbjct  108   KDQFHAIEEEGLIDAHDNARGFPRCCYFPAFVIGFVLLFSAFSLILWGASRPQKPAISLK  167

Query  704   SLSVSNIYIGEGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVAT  883
             S++     I  G+D +GV T L+S+N S++++  N ATF+G+HV+STP++L +  +T+AT
Sbjct  168   SITFDQFVIQAGADMSGVATSLVSMNSSVKMTFRNTATFFGVHVTSTPVDLNYYQLTLAT  227

Query  884   GQLKKYYQSRKSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQG  1063
             G + K+YQSRKS+R+V V + G+ +PLYG G++L +    +G     VPL L   V+S+ 
Sbjct  228   GTMPKFYQSRKSQRSVRVMVIGSHIPLYGGGANLNSV---NGKPVEPVPLTLSVMVRSRA  284

Query  1064  DVVGKLVRTDYRRKIWCELIID  1129
              V+GKLV+  + +KI C +++D
Sbjct  285   YVLGKLVKPKFYKKIECSIVMD  306



>ref|XP_010500209.1| PREDICTED: uncharacterized protein LOC104777627 [Camelina sativa]
 ref|XP_010461502.1| PREDICTED: uncharacterized protein LOC104742224 [Camelina sativa]
Length=342

 Score =   179 bits (453),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 137/340 (40%), Positives = 200/340 (59%), Gaps = 34/340 (10%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEK-STSMQPTPTFTSPVES  400
             +H K++S+VTS+AASSP+      VYYVQSPSRDSHD   GEK +TS   TP   SP+ S
Sbjct  1     MHAKTDSEVTSIAASSPARSPRRPVYYVQSPSRDSHD---GEKTATSFHSTPVL-SPMGS  56

Query  401   PSHP--SLGRHSRTssgtrfsgifrsssgrkg----rgkrmmsNDKGWPECNVIMEEGKY  562
             P H   S+GRHSR SS +RFSG  +  S +        ++    +K W EC VI EEG  
Sbjct  57    PPHSQSSMGRHSRESSSSRFSGSLKPGSRKVNPNDGSKRKGHGGEKQWKECAVIEEEGLL  116

Query  563   DELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGS  742
             D+ +    + RR + L  + GF +LF +F LI++GAA+P K ++T+KS++   + +  G 
Sbjct  117   DDGDRDGGVPRRCYVLAFIVGFFILFGLFSLILYGAAKPQKPKITVKSITFETLKVQAGQ  176

Query  743   DFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSR  922
             D  GV T ++++N +LR+   N  TF+G+HV+STPI+L FS I + +G +KK+YQSR S 
Sbjct  177   DAGGVGTDMITMNATLRMLYKNTGTFFGVHVTSTPIDLSFSQIKIGSGSIKKFYQSRNSH  236

Query  923   RTVLVNIQGTKVPLYGAGSS------------------LPATKNKDGTGGVQVPLALDFE  1048
              TV+V++ G K+PLYG+GS+                   P            VP+ L F 
Sbjct  237   STVVVHVTGEKIPLYGSGSTLLPPAPPAPLPKPKKKKGAPVVIPDPPAPPAPVPMTLSFI  296

Query  1049  VKSQGDVVGKLVRTDYRRKIWCELIIDSAG-NKPIKFKKD  1165
             V+S+  V+GKLV+  + +KI C++  +    NK I   K+
Sbjct  297   VRSRAYVLGKLVQPKFYKKIECDINFEHKNLNKHIAITKN  336



>ref|XP_006296796.1| hypothetical protein CARUB_v10016215mg [Capsella rubella]
 gb|EOA29694.1| hypothetical protein CARUB_v10016215mg [Capsella rubella]
Length=302

 Score =   177 bits (450),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 125/322 (39%), Positives = 187/322 (58%), Gaps = 33/322 (10%)
 Frame = +2

Query  236   LHTKSESDVTSLA-ASSPSGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESPSHP  412
             ++ KS+SD+TSL   SSP   VYYVQSPSRDS      EKS+S   T   T+P ESPSHP
Sbjct  3     MYPKSDSDITSLVDLSSPKRPVYYVQSPSRDS------EKSSSAALTTHQTTPTESPSHP  56

Query  413   SLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEG------KYDEL-  571
             S    SR S+G    G       +           + WP      EEG      +YD+L 
Sbjct  57    SFA--SRVSNGGTGGGFRWKGRRKYH-------GGRWWPADK---EEGGDDGRYEYDDLY  104

Query  572   EDSWLLS-RRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDF  748
             ED+  +S      +L +   L +F + C +++GA++ +   V +K ++V + Y GEGSD 
Sbjct  105   EDNRGVSVGTCRLILGVVATLSIFLLLCSVLFGASQSFPPIVYIKGVNVHSFYYGEGSDS  164

Query  749   TGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFS-DITVATGQLKKYYQSRKSRR  925
             TGVPT++++ N S+ I+ +NP+T +GIHVSS+ INL++S   T+A  QLK YYQ ++S  
Sbjct  165   TGVPTKIMNFNCSVEITTHNPSTLFGIHVSSSDINLIYSRQFTLAIAQLKSYYQPKQSNH  224

Query  926   TVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRK  1105
             T  +N+ G+KVPLYGA + L A+ +  G     VP+ L+FE++S+ ++VG LV++ ++  
Sbjct  225   TSRINLVGSKVPLYGASADLVASDHNGG-----VPVKLEFEIRSRANIVGHLVKSRHQEH  279

Query  1106  IWCELIIDSAGNKPIKFKKDSC  1171
             + C   I S     +KF   +C
Sbjct  280   LSCFFSISSNNTTFVKFTHKTC  301



>ref|XP_010540370.1| PREDICTED: uncharacterized protein LOC104814169 [Tarenaya hassleriana]
Length=342

 Score =   178 bits (451),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 136/351 (39%), Positives = 199/351 (57%), Gaps = 45/351 (13%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSG----HVYYVQSPSRDSHDDGDGEK-STSMQPTPTFTSPVES  400
             +H K++S+VTSL ASSP+       YYVQSPSRDS D   GEK ++S   TP   SP+ S
Sbjct  1     MHAKTDSEVTSLPASSPTRSPRRQEYYVQSPSRDSRD---GEKMASSFHSTPVI-SPMGS  56

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKG-------------WPECNV  541
             P H      S     +R S   R S   K   +++  ND G             W +C V
Sbjct  57    PPH----SQSSMGHHSRESSSSRFSGSLKPGSRKISPNDAGKRKGHGGGGGDKQWKDCAV  112

Query  542   IMEEGKYDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSN  721
             I EEG  D+ +    L RR + L  L GF  LFT F LI++GAA+P K ++++KS++   
Sbjct  113   IEEEGLLDDEDRDKGLPRRCYILAFLVGFFALFTFFSLILYGAAKPQKPKISVKSITFEQ  172

Query  722   IYIGEGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKY  901
             + +  GSD +GV T ++++N +LR+   N  TF+G+HVSS+PI++ FS IT+ +G +KK+
Sbjct  173   VKVQAGSDSSGVGTDMITMNATLRMLYRNTGTFFGVHVSSSPIDITFSQITIGSGSIKKF  232

Query  902   YQSRKSRRTVLVNIQGTKVPLYGAGSSL---------PATKNKDGT--------GGVQVP  1030
             YQSRKS+  V VN+ G K+PLYG+GSS            TK K G+            VP
Sbjct  233   YQSRKSQGLVTVNVIGDKIPLYGSGSSFIPPPPAPVPTTTKRKKGSPAVVYVPVVPPPVP  292

Query  1031  LALDFEVKSQGDVVGKLVRTDYRRKIWCELIIDSAGNKPIKFK-KDSCAYS  1180
             + L F V+S+  V+GKLV+  + ++I C++  +      +KF  K++C Y+
Sbjct  293   MKLKFTVRSRAYVLGKLVQPKFYKRIECDINYE-LEKLNVKFSLKNNCTYT  342



>emb|CDY17105.1| BnaC06g00380D [Brassica napus]
Length=285

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 121/316 (38%), Positives = 181/316 (57%), Gaps = 43/316 (14%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEK-STSMQPTPTFTSPVES  400
             +H K++S+VTS+AASSP+      VYYVQSPSRDSHD   GEK +TS   TP   S    
Sbjct  1     MHAKTDSEVTSIAASSPARSPRRPVYYVQSPSRDSHD---GEKTATSFHSTPVLKSSSTR  57

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDS  580
              S  SL   SR                  G  ++    +K W EC +I EEG   + E  
Sbjct  58    FSG-SLKPGSR--------------KVNDGSKRKGHGGEKQWKECAMIEEEGLLGDGERD  102

Query  581   WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
               + RR + L  + GF +LF +F LI++GAA+P K ++T+KS++   + I  G D  GV 
Sbjct  103   RGVPRRCYVLAFIVGFFMLFGLFSLILYGAAKPQKPKITVKSITFETLKIQAGQDAGGVG  162

Query  761   TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVN  940
             T ++++N +LR+   N  TF+G+HV+STP++L FS + + +G +KK+YQSRKS+RTVLV+
Sbjct  163   TDMITMNATLRMLYRNTGTFFGVHVTSTPVDLSFSQMKIGSGSIKKFYQSRKSQRTVLVH  222

Query  941   IQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCEL  1120
             + G ++PLYG                 + PL+  F V+S+  V+G+LV+  + +KI C++
Sbjct  223   VIGERIPLYG-----------------RAPLS--FVVRSRAYVLGRLVKPKFLKKIECDI  263

Query  1121  IIDSAG-NKPIKFKKD  1165
               +    NK I   K+
Sbjct  264   NFEHKNLNKHIPITKN  279



>gb|EYU25436.1| hypothetical protein MIMGU_mgv1a010185mg [Erythranthe guttata]
Length=319

 Score =   177 bits (448),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 132/329 (40%), Positives = 187/329 (57%), Gaps = 27/329 (8%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH---VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESPS  406
             +H K++SD+TS +  SP      VYYVQSPSRDSHD   GEKST     P   SP+ SP 
Sbjct  1     MHAKTDSDLTSFSPPSPDHSRRPVYYVQSPSRDSHD---GEKST-----PVLGSPMGSPP  52

Query  407   HP--SLGRHSRTssgt---------rfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEE  553
             H   S+GRHSR SS +                      GRG R     K W E +VI EE
Sbjct  53    HSQSSVGRHSRESSTSRFSGSLKPGSRKISPNDLGSGGGRGHRKGGGQKNWNEFDVIEEE  112

Query  554   GKYDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIG  733
                 + E    L RR + L+ + GF +LF++F LI+  A++P K  + ++S+      I 
Sbjct  113   RLLGDDESRKRLPRRCYFLIFVGGFFVLFSLFALILLAASKPQKPAILMRSIKFERFAIQ  172

Query  734   EGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSR  913
              GSD TGV T +LS N ++  +  N ATF+G+HVSSTP+ L +S +T+A+G +K +Y+SR
Sbjct  173   AGSDHTGVSTDMLSTNATVNFTFTNTATFFGLHVSSTPLALFYSQLTIASGDVKNFYESR  232

Query  914   KSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTD  1093
             K    V V + G K+P+YG+G++L       G   + VPL L+F V+S+  V+GKLV+  
Sbjct  233   KHSTNVSVVVVGDKIPMYGSGATL---STHLGLTTLPVPLKLEFTVRSRAYVLGKLVKPK  289

Query  1094  YRRKIWCELIIDSAG-NKPIKFKKDSCAY  1177
             + +K+ C ++ +S   N PI  KK SC Y
Sbjct  290   FYKKVNCSIVFESKKLNIPISLKK-SCTY  317



>ref|XP_010093627.1| hypothetical protein L484_011050 [Morus notabilis]
 gb|EXB54388.1| hypothetical protein L484_011050 [Morus notabilis]
Length=324

 Score =   177 bits (448),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 123/293 (42%), Positives = 182/293 (62%), Gaps = 32/293 (11%)
 Frame = +2

Query  296   VYYVQSPSRDSHDDGDGEKSTSMQPTPTF-TSPVESP--------SHPSLGRHSRTssgt  448
             VYYVQSPSRDSHD   GEK+T+     +F +SPV SP        S+ SLG HSR     
Sbjct  30    VYYVQSPSRDSHD---GEKTTN-----SFNSSPVLSPMGSPPHSHSNSSLGPHSR-----  76

Query  449   rfsgifrsssgrkgrgkrmmsNDKG-----WPE-CNVIMEEGKYDELEDSWLLSRRFHal  610
               S   R S  RK       SN KG     W +  + I EEG  D+   +   +RR + L
Sbjct  77    -DSSSTRFSGSRKHTNNGSGSNQKGSGWRPWKDRFDAIEEEGLLDDDGIARGNTRRGYFL  135

Query  611   lalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPTRLLSVNGSL  790
               + GF +LF+VF LI+WGA+R  K  +T+KS+      I  G+DF+GV T ++S+N ++
Sbjct  136   AFVVGFFVLFSVFSLILWGASRSQKPAITMKSIVFDQFVIQAGADFSGVATEMVSMNSTV  195

Query  791   RISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNIQGTKVPLYG  970
             +++  N ATF+G+HV+STP++L +S +TVATG + K+YQ+R S+R+V+V ++G  +PLYG
Sbjct  196   KLTFRNTATFFGLHVTSTPLDLSYSQLTVATGTMGKFYQARMSQRSVIVTLRGRNIPLYG  255

Query  971   AGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELIID  1129
              G+SL ++   +G     VPL L+F V+S+  V+GKLV+  + R+I C +++D
Sbjct  256   GGASLGSS---NGAPIQPVPLTLNFMVRSRAYVLGKLVKPKFYRRIQCSVVMD  305



>ref|XP_009761920.1| PREDICTED: uncharacterized protein LOC104214021 [Nicotiana sylvestris]
Length=161

 Score =   171 bits (434),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 133/161 (83%), Gaps = 10/161 (6%)
 Frame = +2

Query  233  MLHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
            MLHTKSESD+TSLA SSPS      VYYVQSPSRDSHD   G+KSTSMQPTP+F SP+ES
Sbjct  1    MLHTKSESDITSLAPSSPSRSPKRPVYYVQSPSRDSHD---GDKSTSMQPTPSFNSPMES  57

Query  401  PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDS  580
            PSHPS GRHSR SS +RFSGIFRSSSGRK   KR   NDKGWPECNVIMEEGKYDE ++ 
Sbjct  58   PSHPSFGRHSRNSSASRFSGIFRSSSGRKNGRKR---NDKGWPECNVIMEEGKYDEYDED  114

Query  581  WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLK  703
              ++RR  ALLAL GF++LF++FCLIIWGA RPYKA++T++
Sbjct  115  KGVTRRCQALLALLGFIVLFSIFCLIIWGAGRPYKAEITVR  155



>gb|EPS58954.1| hypothetical protein M569_15857, partial [Genlisea aurea]
Length=315

 Score =   175 bits (444),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 131/324 (40%), Positives = 189/324 (58%), Gaps = 28/324 (9%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH--VYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPVESPS  406
             +H K++S+VTSLA SSP     VY+VQSPS D      GEK+T S   TP   SP  SP 
Sbjct  1     MHAKTDSEVTSLAPSSPDNRRPVYFVQSPSHD------GEKTTISFHSTPAQGSPSGSPP  54

Query  407   HP--SLGRHSR---TssgtrfsgifrsssgrkgrgkrmmsNDKG-----WPECNVIMEEG  556
             H   S+  HSR   TS  +               G    +N KG     + E +VI EEG
Sbjct  55    HSQSSVCHHSRESSTSRFSGSLKPGSRKISPNEAGSGGKANRKGGGRKNFDEFDVIEEEG  114

Query  557   KY-DELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIG  733
                D    + LL RR + L  + GF LLF++F LI+WGA++P   ++ +KS+   +  + 
Sbjct  115   LLLDHESRNGLLPRRCYFLAFIVGFFLLFSLFALILWGASKPQTPKIAMKSIRFESFVVQ  174

Query  734   EGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSR  913
              GSD TGV T ++SVN +L+ S  N  TF+G+HVSSTP++L++SD+ +A+G + ++ QSR
Sbjct  175   AGSDSTGVSTGMISVNATLKFSFRNTGTFFGVHVSSTPLDLLYSDLRIASGHMNEFSQSR  234

Query  914   KSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTD  1093
             +S + V V + G ++PLYG G+SL +T+       V VPL L+F V+S+ DV+GKLV+T 
Sbjct  235   RSSKNVTVIVVGDQIPLYGIGASL-STQTP-----VPVPLDLNFTVESRADVLGKLVKTR  288

Query  1094  YRRKIWCELIIDSAG--NKPIKFK  1159
             +  +I C +  D+    N PI  K
Sbjct  289   FHDQIGCSIEFDTTSKLNVPILLK  312



>gb|KHG00396.1| 45 kDa immediate-early 2 [Gossypium arboreum]
Length=318

 Score =   175 bits (444),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 124/313 (40%), Positives = 185/313 (59%), Gaps = 26/313 (8%)
 Frame = +2

Query  275   ASSPSGHVYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPV----ESPSHPSLGRHSRTs  439
             A S    VYYVQSPSRDSHD   GEK+T S   TP   SP+     S S+ SLG HS   
Sbjct  21    ARSDRRQVYYVQSPSRDSHD---GEKTTNSFHSTPVL-SPMGSPPHSHSNSSLGPHS---  73

Query  440   sgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYD-ELEDSWLLSRRFHalla  616
             S    S     S   + +        K W E + I EEG  D +        RR + L  
Sbjct  74    SRESSSTRLSGSMKPQRKHDGSRKGRKPWKEFDAIEEEGLLDGDGAHQDFHRRRCYFLAF  133

Query  617   lcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPTRLLSVNGSLRI  796
             + GF +LFT F LI+WGA+RP K ++T+KS+S +   +  G+D +GV T ++++N ++++
Sbjct  134   VVGFFVLFTTFSLILWGASRPQKPKITMKSISFNEFRVHAGTDSSGVSTEMVTMNCTVKL  193

Query  797   SVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNIQGTKVPLYGAG  976
             +  N ATF+G+HV+STP++L +S +TVATG ++K+YQSRKS+R + V + G+++PLYG G
Sbjct  194   TYRNTATFFGVHVTSTPLDLSYSQLTVATGTMRKFYQSRKSQRALTVVMLGSQIPLYGGG  253

Query  977   SSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELIIDSAGNKPIKF  1156
             +SL +    +G     VPL L+F V+S+  V+GKLV+  + ++I C + ++     P+K 
Sbjct  254   ASLGSL---NGEPTQPVPLTLNFIVRSRAYVLGKLVKPKFYKRIECSVTMN-----PMKM  305

Query  1157  K-----KDSCAYS  1180
                   K+ C YS
Sbjct  306   SWAISLKNKCIYS  318



>ref|XP_007160489.1| hypothetical protein PHAVU_002G326000g [Phaseolus vulgaris]
 gb|ESW32483.1| hypothetical protein PHAVU_002G326000g [Phaseolus vulgaris]
Length=298

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 126/320 (39%), Positives = 183/320 (57%), Gaps = 28/320 (9%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASS----PSGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
             M H K++S+VTSL ASS    P   VYYVQSPS D      GEK+T    T   ++PV S
Sbjct  1     MHHAKTDSEVTSLDASSTTRSPRRPVYYVQSPSHD------GEKTT----TSLHSTPVLS  50

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGW-PECNVIMEEGKYDELED  577
             P            S           SG +       S+   W  + +VI EEG     + 
Sbjct  51    P----------MGSPPHSHSSSSRFSGSRKINNHPRSHKLPWNKDIDVIEEEGLLQNEDR  100

Query  578   SWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGV  757
                LSRR++ L  + GF LLF++F LI+WGA+RP K  V +KS+   ++ +  GSD TGV
Sbjct  101   HRALSRRYYFLAFVLGFFLLFSLFSLILWGASRPMKPNVLIKSIKFDHLRVQAGSDSTGV  160

Query  758   PTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLV  937
              T ++++N +++ +  N  TF+G+HV+STP++L +S+I +ATG LKK+YQSRKS+R V V
Sbjct  161   ATDMITMNSTVKFTYRNTGTFFGVHVTSTPLDLSYSEIVIATGNLKKFYQSRKSQRLVSV  220

Query  938   NIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCE  1117
              + G K+PLYG+G+SL ++    G   V VPL L F ++S+  V+G+LV+  Y R++ C 
Sbjct  221   AVMGNKIPLYGSGASLSSS---TGVPTVAVPLRLGFVIRSRAYVLGRLVKPKYYRRVECS  277

Query  1118  LIIDSAGNKPIKFKKDSCAY  1177
             + +D          K SC Y
Sbjct  278   INLDPKKINVSLSLKHSCVY  297



>gb|KFK44646.1| hypothetical protein AALP_AA1G285700 [Arabis alpina]
Length=343

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 135/341 (40%), Positives = 201/341 (59%), Gaps = 35/341 (10%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH-----VYYVQSPSRDSHDDGDGEK-STSMQPTPTFTSPVE  397
             +H K++S+VTSLAASSP+       VYYVQSPSRDSHD   GEK +TS   TP   SP+ 
Sbjct  1     MHAKTDSEVTSLAASSPTRSPPRRPVYYVQSPSRDSHD---GEKTATSFHSTPVL-SPMG  56

Query  398   SPSHP--SLGRHSRTssgtrfsgifrsssgrkg----rgkrmmsNDKGWPECNVIMEEGK  559
             SP H   S+GRHSR SS +RFSG  +  S +        ++    +K W EC +I EEG 
Sbjct  57    SPPHSQSSMGRHSRESSSSRFSGSLKPGSRKVNPNDGAKRKGHGGEKQWKECAIIEEEGL  116

Query  560   YDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEG  739
              D+ E    + RR + L  + GF +LF  F LI++GAA+P K ++T+K+++   + +  G
Sbjct  117   LDDGERDRGVPRRCYVLAFIVGFFILFGFFSLILYGAAKPQKPKITVKTITFETLKVQAG  176

Query  740   SDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKS  919
              D  GV T ++++N +LR+   N  TF+G+HV+STPI+L FS + + +G ++K+YQ RKS
Sbjct  177   QDAGGVGTDMITMNATLRMLYRNTGTFFGVHVTSTPIDLSFSQLKIGSGSIEKFYQRRKS  236

Query  920   RRTVLVNIQGTKVPLYGAGSSL------------------PATKNKDGTGGVQVPLALDF  1045
             ++ V+V++ G K+PLYG+GS+L                  P    +     V VP+ L F
Sbjct  237   QKMVVVHVTGEKIPLYGSGSTLIPPPPPAPLPKPKKKKGKPVPIPEPPPPPVPVPMKLSF  296

Query  1046  EVKSQGDVVGKLVRTDYRRKIWCELIIDSAG-NKPIKFKKD  1165
              V+S+  V+GKLV   + ++I C +  +    NK I   K+
Sbjct  297   VVRSRAYVLGKLVSPKFYKRIECNINFEHKNLNKHIIITKN  337



>ref|XP_006304997.1| hypothetical protein CARUB_v10009363mg, partial [Capsella rubella]
 gb|EOA37895.1| hypothetical protein CARUB_v10009363mg, partial [Capsella rubella]
Length=396

 Score =   176 bits (447),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 131/325 (40%), Positives = 197/325 (61%), Gaps = 34/325 (10%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEK-STSMQPTPTFTSPVES  400
             +H K++S+VTS+AASSP+      VYYVQSPSRDSH   DGEK +TS   TP   SP+ S
Sbjct  54    MHAKTDSEVTSIAASSPTRSPRRPVYYVQSPSRDSH---DGEKTATSFHSTPVL-SPMGS  109

Query  401   PSH--PSLGRHSRTssgtrfsgifrsssgrkg----rgkrmmsNDKGWPECNVIMEEGKY  562
             P H   S+GRHSR SS +RFSG  +  S +        ++    +K W EC VI EEG  
Sbjct  110   PPHSQSSMGRHSRESSSSRFSGSLKPGSRKVNPNDGSKRKGHGGEKQWKECAVIEEEGLL  169

Query  563   DELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGS  742
             D+ +    + RR + L  + GF +LF +F LI++GAA+P K ++T+K+++   + +  G 
Sbjct  170   DDGDRDGGVPRRCYVLAFIVGFFILFGLFSLILYGAAKPQKPKITVKTITFETLKVQAGQ  229

Query  743   DFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSR  922
             D  GV T ++++N ++R+   N  TF+G+HV+S+PI+L FS I + +G +KK+YQSRKS 
Sbjct  230   DAGGVGTDMITMNATIRMLYKNTGTFFGVHVTSSPIDLSFSQIKIGSGSIKKFYQSRKSH  289

Query  923   RTVLVNIQGTKVPLYGAGSSL-------------------PATKNKDGTGGVQVPLALDF  1045
              TV+V++ G K+PLYG+GS+L                   P    +       VP+ L F
Sbjct  290   STVVVHVTGEKIPLYGSGSTLLPPAPPAPLPKPKKKKKGSPPETPEPPAPPAPVPMTLSF  349

Query  1046  EVKSQGDVVGKLVRTDYRRKIWCEL  1120
              V+S+  V+GKLV+  + +K+ C++
Sbjct  350   IVRSRAYVLGKLVQPKFNKKVECDI  374



>gb|KFK39781.1| hypothetical protein AALP_AA3G286700 [Arabis alpina]
Length=291

 Score =   173 bits (439),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 120/316 (38%), Positives = 187/316 (59%), Gaps = 32/316 (10%)
 Frame = +2

Query  236   LHTKSESDVTSL-AASSPSGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESPSHP  412
             ++ KS+SD+TS   +SSP    YYVQSPSRDS      +KS+S   T   T+P ESPSHP
Sbjct  3     MYPKSDSDMTSFDQSSSPKRPTYYVQSPSRDS------DKSSSAALTHQ-TTPTESPSHP  55

Query  413   SLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDEL--EDSWL  586
             S    SR SSG  + G  +              +   W   +   E+G+Y++L  ++  +
Sbjct  56    SFA--SRISSGGGWKGRRKY-------------HGGRWSPGDK-EEDGRYEDLYGDNRGI  99

Query  587   LSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPTR  766
                    +L +   L LF + C I++ A++ +   V +K ++V + Y GEGSD +GVPT+
Sbjct  100   SIATCRLILGVVATLTLFFLLCSILFAASQSFSPIVYVKGVNVHSFYYGEGSDHSGVPTK  159

Query  767   LLSVNGSLRISVYNPATFYGIHVSSTPINLVFS-DITVATGQLKKYYQSRKSRRTVLVNI  943
             +L+   S+ I+ +NP+TF+GIHVSS+   +++S   T+A  QLK YYQ ++S RT  +N+
Sbjct  160   ILNFKCSVEITTHNPSTFFGIHVSSSAFKVIYSRQFTLAIAQLKSYYQPKQSNRTSRINL  219

Query  944   QGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELI  1123
               ++VPLYGAGS L A+   D  GG  VP+ L+FE++S+ ++VG LV++ +++ + C   
Sbjct  220   VASRVPLYGAGSDLAAS---DHNGG--VPVTLEFEIRSRANIVGNLVKSRHQKHLSCFFF  274

Query  1124  IDSAGNKPIKFKKDSC  1171
             I S  NK +KF   +C
Sbjct  275   ISSRNNKFVKFTHKTC  290



>ref|XP_008785866.1| PREDICTED: uncharacterized protein LOC103704383 [Phoenix dactylifera]
Length=322

 Score =   173 bits (439),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 117/327 (36%), Positives = 187/327 (57%), Gaps = 17/327 (5%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPVES  400
             +H K++S+VTSLA SSP+       YYVQSPSRDSHD   GEK+T S+  TP   SP+ S
Sbjct  1     MHAKTDSEVTSLAPSSPTRSPRRPAYYVQSPSRDSHD---GEKTTTSLHSTPVL-SPMAS  56

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrm-------msNDKGWPECNVIMEEGK  559
             P H        +   +          G  G+             ++K W E  VI EEG 
Sbjct  57    PRHSHSSAGHHSRDSSSSRFSGALKPGGSGKILSNDGGKGGRRKSEKTWKEFTVIEEEGL  116

Query  560   YDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEG  739
              ++ E+     R+ + L  +  F+++F+ F LI+W A+R  + ++T+KS++  +  I  G
Sbjct  117   LEDEEEGKRFRRQLYFLGFIMAFIVIFSFFALILWAASRSQRPKITMKSITFESFIIQAG  176

Query  740   SDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKS  919
             +D + VPT + ++N ++++S  N  TF+G+HV+STP +L ++ + +A+G + K+YQSRKS
Sbjct  177   TDASMVPTDMATLNSTVKLSFRNTGTFFGVHVTSTPFDLTYTQLILASGNMNKFYQSRKS  236

Query  920   RRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYR  1099
              RT+ V + G+K+PLYG G SL  +  K     V V L+L+F V+S+  V+G+LV+  + 
Sbjct  237   HRTLSVVVLGSKIPLYGGGPSLMYSPGKTN-NSVPVHLSLNFMVRSRAYVLGRLVKPKFY  295

Query  1100  RKIWCELIIDSAGNKPIKFKKDSCAYS  1180
               + C +++D      +   K SC YS
Sbjct  296   TGVHCSVVMDQTKLNTLVSLKKSCQYS  322



>ref|XP_002277867.1| PREDICTED: uncharacterized protein LOC100249074 [Vitis vinifera]
Length=309

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 125/317 (39%), Positives = 184/317 (58%), Gaps = 21/317 (7%)
 Frame = +2

Query  245   KSESDVTSLAASSPSGHVYYVQSPSRDSHDDGDGEK-STSMQPTPTFTSPVESPSHP--S  415
             K++SD TS AASSP   +Y+VQSPS DSHD   GEK S S+  TP   SP+ SP H   S
Sbjct  6     KTDSDDTSFAASSPRRPLYFVQSPSGDSHD---GEKTSMSLHSTPAL-SPMGSPPHSNSS  61

Query  416   LGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDSWLLSR  595
             LGRHS ++  +       +    +         +K W E + I EEG  +        S 
Sbjct  62    LGRHSSSTRFSGSGKTSTNGGHHRK-------GEKPWKEFDKIEEEGLLEFDGARRRPSP  114

Query  596   RFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPTRLLS  775
             R + +  + GF LLF++F LI+   ++ +K  +T++S+      I  G D +GVPT ++S
Sbjct  115   RCYIIAFVVGFFLLFSLFSLILLCVSKSHKPTITMQSIRFQQFSIQAGVDSSGVPTDMVS  174

Query  776   VNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNIQGTK  955
             VN  ++    N ATF+G+HV+STP++L FS + VATG ++K+YQ R S +T+ V ++G+ 
Sbjct  175   VNTIVKFKFRNTATFFGLHVTSTPLHLSFSQLNVATGMMQKFYQPRNSHKTIKVIVRGSN  234

Query  956   VPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELIIDSA  1135
             +PLYG G+SL  +   +GT    VPL L F V+S+G V+G+LVR  +  ++ C + +D  
Sbjct  235   IPLYGGGASLNIS---NGTVSGAVPLTLSFTVRSRGYVLGRLVRPKFYLRMKCPVAMD-F  290

Query  1136  GNKPIKFK---KDSCAY  1177
             GN   K     KDSC Y
Sbjct  291   GNPKKKVSIPLKDSCTY  307



>gb|EMS68593.1| Glyoxylate reductase [Triticum urartu]
Length=570

 Score =   177 bits (448),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 123/180 (68%), Gaps = 6/180 (3%)
 Frame = +2

Query  641   TVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPTRLLSVNGSLRISVYNPATF  820
             T+ CL++WGAAR  K  V +KSL V N Y GEG+D TGVPT+ +++N SL I V+NP+T 
Sbjct  397   TLVCLVVWGAARRDKPSVLVKSLRVENFYAGEGTDGTGVPTKFVTMNCSLEIDVHNPSTM  456

Query  821   YGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNIQGTKVPLYGAGSSLPATKN  1000
             +GIHVSST I L +S I +A+GQL K+YQ +KSR    V + G K PLYGAG++   T +
Sbjct  457   FGIHVSSTSIQLYYSQIPIASGQLDKFYQPKKSRHVASVTLHGEKTPLYGAGATFVLT-D  515

Query  1001  KDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELIIDSAGNKPIKFKKDSCAYS  1180
              DG     VPL +D  V+++G V+G+LVR  + +++ C +++ S  +KPI   + +C+YS
Sbjct  516   TDG-----VPLTVDLAVRTRGYVIGRLVRVTHAKRVRCPVLVSSLTDKPIMIAQTACSYS  570



>gb|EYU39327.1| hypothetical protein MIMGU_mgv1a011308mg [Erythranthe guttata]
Length=286

 Score =   169 bits (428),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 107/301 (36%), Positives = 166/301 (55%), Gaps = 34/301 (11%)
 Frame = +2

Query  230   AMLHTKSESDVTSLAASSPSGHVYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPVESPS  406
             A  H+K++S+VTSLA SSP+  VYYVQSPSRDSHD   GEK+T S   TP          
Sbjct  2     ATHHSKTDSEVTSLAPSSPNRAVYYVQSPSRDSHD---GEKTTNSFHSTP----------  48

Query  407   HPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDSWL  586
                                   S             +K W E + I EEG  D+      
Sbjct  49    -----------------KSSNGSRRHHHHHHNNRKAEKQWKEFDAIEEEGLLDDGGARRG  91

Query  587   LSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPTR  766
               RR +    + GF +LF+ F LI+WGA++  K  VT+KS+      I  G+D +GV T 
Sbjct  92    FPRRCYFPAFVVGFFVLFSFFALILWGASKNQKPVVTMKSILFDRFVIQAGTDSSGVATV  151

Query  767   LLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNIQ  946
             ++++N ++++S  N  TF+G+HV+S+P +L F+D+T+ATG ++K+Y SRKS++TV V + 
Sbjct  152   MVTMNSTVKMSFRNKGTFFGVHVTSSPFDLSFTDLTLATGSVEKFYTSRKSQKTVTVVLI  211

Query  947   GTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELII  1126
             G  +PLYG G+ L +   + G     V L L   V+++  ++G+LV+  ++  + C +++
Sbjct  212   GDNIPLYGGGADLSS---QGGKPVKPVALNLTLTVRARAYIMGRLVKPKFQNGVQCSVVL  268

Query  1127  D  1129
             D
Sbjct  269   D  269



>ref|XP_003620361.1| hypothetical protein MTR_6g081930 [Medicago truncatula]
 gb|AES76579.1| late embryogenesis abundant protein [Medicago truncatula]
Length=294

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 110/322 (34%), Positives = 180/322 (56%), Gaps = 37/322 (11%)
 Frame = +2

Query  236   LHTKSESDVTSLAA--------SSPSGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSP  391
             +HTK++S+VT+ +         S P   +YYVQSPS D    G+   +TS   TP     
Sbjct  1     MHTKTDSEVTTTSVATSTSPTRSPPRRPLYYVQSPSHD----GEKTVTTSFHSTPV----  52

Query  392   VESPSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDEL  571
                               +       +      + ++   +   W   +VI EEG + E 
Sbjct  53    -----------------ASPHHSSSSTHFSASKKDQQHQHSVNPWKHIDVIEEEG-FLEK  94

Query  572   EDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFT  751
             E +   SRR + L  + GF +LF++F LI+WGA+RP K ++ +KS+   ++ +  GSD T
Sbjct  95    ERNGGYSRRCYFLAFVVGFFVLFSLFSLILWGASRPMKPKIVIKSIKFDHVTVQAGSDST  154

Query  752   GVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTV  931
             GV T ++++N +L+ +  N  TF+G+HVS+TP+ L +SDI +A+G +K+++QSR+S R V
Sbjct  155   GVATDMITMNSTLKFTYRNTGTFFGVHVSATPLELSYSDIVIASGNMKEFHQSRRSHRLV  214

Query  932   LVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIW  1111
              V + G+KVPLYG+G+SL +T    G   + VPL L+F ++S+ +V+G LV+  Y ++I 
Sbjct  215   SVAVMGSKVPLYGSGASLSST---TGMPTLPVPLNLNFVMRSRANVLGNLVKHKYYKRIQ  271

Query  1112  CELIIDSAGNKPIKFKKDSCAY  1177
             C + +D      +   K+SC Y
Sbjct  272   CSITLDPKKLGALVSLKNSCTY  293



>ref|NP_199100.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB09187.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAE99552.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED94876.1| uncharacterized protein AT5G42860 [Arabidopsis thaliana]
Length=320

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 119/318 (37%), Positives = 180/318 (57%), Gaps = 47/318 (15%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEK-STSMQPTPTFTSPV--  394
             +H K++S+VTSL+ASSP+       Y+VQSPSRDSHD   GEK +TS   TP  TSP+  
Sbjct  1     MHAKTDSEVTSLSASSPTRSPRRPAYFVQSPSRDSHD---GEKTATSFHSTPVLTSPMGS  57

Query  395   ESPSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELE  574
                SH S  R S+ +   R                       G  +  +I EEG  D+ +
Sbjct  58    PPHSHSSSSRFSKINGSKRK-------------------GHAGEKQFAMIEEEGLLDDGD  98

Query  575   -DSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFT  751
              +   L RR + L  + GF LLF  F LI++ AA+P K ++++KS++   + +  G D  
Sbjct  99    REQEALPRRCYVLAFIVGFSLLFAFFSLILYAAAKPQKPKISVKSITFEQLKVQAGQDAG  158

Query  752   GVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTV  931
             G+ T ++++N +LR+   N  TF+G+HV+S+PI+L FS IT+ +G +KK+YQSRKS+RTV
Sbjct  159   GIGTDMITMNATLRMLYRNTGTFFGVHVTSSPIDLSFSQITIGSGSIKKFYQSRKSQRTV  218

Query  932   LVNIQGTKVPLYGAGSSLPATKN-----------------KDGTGGVQVPLALDFEVKSQ  1060
             +VN+ G K+PLYG+GS+L                      +       VP+ L+F V+S+
Sbjct  219   VVNVLGDKIPLYGSGSTLVPPPPPAPIPKPKKKKGPIVIVEPPAPPAPVPMRLNFTVRSR  278

Query  1061  GDVVGKLVRTDYRRKIWC  1114
               V+GKLV+  + ++I C
Sbjct  279   AYVLGKLVQPKFYKRIVC  296



>ref|XP_007155918.1| hypothetical protein PHAVU_003G243200g [Phaseolus vulgaris]
 gb|ESW27912.1| hypothetical protein PHAVU_003G243200g [Phaseolus vulgaris]
Length=316

 Score =   169 bits (428),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 119/288 (41%), Positives = 175/288 (61%), Gaps = 25/288 (9%)
 Frame = +2

Query  296   VYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESP----SHPSLGRHSRTssgtrfsgi  463
             VYYVQSPSRDS    DGEK+T+   +    SP+ SP    S+ SLGRHSR          
Sbjct  27    VYYVQSPSRDS--SHDGEKTTNSFHSSPIQSPLGSPPRSHSNSSLGRHSR----------  74

Query  464   frsssgrkgrgkrmmsNDKG----WPE-CNVIMEEGKYDELEDSWL-LSRRFHallalcg  625
               +S+   G  K   +N KG    W +  + I EEG  D  +++     RR + L  +  
Sbjct  75    ESASTRFSGSRKSSSTNRKGPWRPWKDHFHAIEEEGLLDAHDNAEHGFPRRCYFLAFILA  134

Query  626   flllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPTRLLSVNGSLRISVY  805
             FLLLF+ F LI+W A+RP K  ++LKS++     I  G+D +GV T L+S+N S++++  
Sbjct  135   FLLLFSSFSLILWAASRPQKPAISLKSITFDQFLIQAGADVSGVATSLVSMNSSVKLTFR  194

Query  806   NPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNIQGTKVPLYGAGSSL  985
             N ATF+G+HV+STP++L F  +T+ATG + K+YQSRKS+R+V V ++G+ +PLYG G++L
Sbjct  195   NTATFFGVHVTSTPLDLNFYQLTLATGTMPKFYQSRKSQRSVRVMVKGSHIPLYGGGATL  254

Query  986   PATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELIID  1129
                    GT    VPL L   V+S+  V+GKLV+  + +KI C +++D
Sbjct  255   ---DTLHGTPVEAVPLTLSVMVRSRAYVLGKLVKPKFLKKIECSVVLD  299



>ref|NP_001143549.1| LOC100276241 [Zea mays]
 gb|ACG32990.1| hypothetical protein [Zea mays]
 gb|ACR37693.1| unknown [Zea mays]
 tpg|DAA36775.1| TPA: putative receptor-like kinase family protein [Zea mays]
Length=334

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 123/336 (37%), Positives = 181/336 (54%), Gaps = 22/336 (7%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPS-------GHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSP  391
             M H K++S+VTSLA SSP        G VYYVQSPSRDSHD    + +TS+  TP   SP
Sbjct  1     MPHAKTDSEVTSLAPSSPPRSPPRTRGAVYYVQSPSRDSHDGETIKAATSVHSTPAL-SP  59

Query  392   VESPSHPSLGRHSRTssgtrfsgifrsssgrkgr----gkrmmsNDKGWPECNVIMEEGK  559
             + SP H     HS     +  S        ++        +     KGW E  VI EEG 
Sbjct  60    MASPRHSHSHSHSSMGRDSSSSRFSGHGHNKRKADKGGSNKGAPGGKGWQEIGVIEEEGL  119

Query  560   YDELEDSWLLSRR-FHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGE  736
              DE + + ++ R+ +  L  L GF+ LF+ F L++WGA+R  K ++ + ++   N  I  
Sbjct  120   MDEEDHTRIVPRKCYCFLAFLLGFVALFSFFALVLWGASRSQKPRIVMGTIRFDNFIIQA  179

Query  737   GSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRK  916
             G+D + VPT + + N ++R +  N  TF+GIHV++ P  L +S +T+A+G L  +YQ R 
Sbjct  180   GTDASLVPTDMATTNSTVRFTYRNRGTFFGIHVTADPFQLSYSQLTLASGDLHNFYQPRS  239

Query  917   SRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQ-------VPLALDFEVKSQGDVVG  1075
             S RTV V + G KVPLYG G +L A     G G  Q       VP+ L   + S+  V+G
Sbjct  240   SSRTVSVAVVGNKVPLYGGGPTLTAAPAAGGKGQQQASAKVASVPMVLRTTLHSRAYVLG  299

Query  1076  KLVRTDYRRKIWCELIID-SAGNKPIKFKKDSCAYS  1180
              LV+  +   + C ++++ +  NKPI    ++C YS
Sbjct  300   ALVKPKFTLAVECRVLMNPNKQNKPISL-GNACHYS  334



>ref|XP_002863727.1| hypothetical protein ARALYDRAFT_494732 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39986.1| hypothetical protein ARALYDRAFT_494732 [Arabidopsis lyrata subsp. 
lyrata]
Length=320

 Score =   168 bits (426),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 119/318 (37%), Positives = 180/318 (57%), Gaps = 47/318 (15%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEK-STSMQPTPTFTSPV--  394
             +H K++S+VTSL+ASSP+       Y+VQSPSRDSHD   GEK +TS   TP  TSP+  
Sbjct  1     MHAKTDSEVTSLSASSPTRSPRRPAYFVQSPSRDSHD---GEKTATSFHSTPVLTSPMGS  57

Query  395   ESPSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELE  574
                SH S  R S+ +   R                       G  +  +I EEG  D+ +
Sbjct  58    PPHSHSSSSRFSKINGSKRK-------------------GHAGEKQFAMIEEEGLLDDGD  98

Query  575   -DSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFT  751
              +   L RR + L  + GF LLF  F LI++ AA+P K ++++KS++   + +  G D  
Sbjct  99    REQEPLPRRCYVLAFIVGFSLLFAFFSLILYAAAKPQKPKISVKSITFEQLKVQAGQDAG  158

Query  752   GVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTV  931
             G+ T ++++N +LR+   N  TF+G+HV+S+PI+L FS IT+ +G +KK+YQSRKS+RTV
Sbjct  159   GIGTDMITMNATLRMLYRNTGTFFGVHVTSSPIDLSFSQITIGSGSIKKFYQSRKSQRTV  218

Query  932   LVNIQGTKVPLYGAGSSLPATKN-----------------KDGTGGVQVPLALDFEVKSQ  1060
             +VN+ G K+PLYG+GS+L                      +       VP+ L+F V+S+
Sbjct  219   VVNVLGDKIPLYGSGSTLVPPPPPAPIPKPKKKKGPIVIVEPPAPPAPVPMRLNFTVRSR  278

Query  1061  GDVVGKLVRTDYRRKIWC  1114
               V+GKLV+  + ++I C
Sbjct  279   AYVLGKLVQPKFYKRIVC  296



>ref|XP_010481937.1| PREDICTED: uncharacterized protein LOC104760674 [Camelina sativa]
Length=321

 Score =   168 bits (425),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 122/319 (38%), Positives = 179/319 (56%), Gaps = 48/319 (15%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEK-STSMQPTPTFTSPV--  394
             +H K++S+VTSL+ASSP+       Y+VQSPSRDSHD   GEK +TS   TP  TSP+  
Sbjct  1     MHAKTDSEVTSLSASSPTRSPRRPAYFVQSPSRDSHD---GEKTATSFHSTPVLTSPMGS  57

Query  395   ESPSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELE  574
                SH S  R S+ +   R                       G  +   I EEG  D+ +
Sbjct  58    PPHSHSSSSRFSKINGSKRK-------------------GHAGEKQFARIEEEGLLDDGD  98

Query  575   -DSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFT  751
                  L RR + L  + GF LLF  F LI++ AA+P K ++++KS++   + +  G D  
Sbjct  99    RQQEALPRRCYVLAFIVGFSLLFAFFSLILYAAAKPQKPKISVKSITFEQLKVQAGQDAG  158

Query  752   GVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTV  931
             G+ T ++++N +LR+   N  TF+G+HV+S+PI+L FS IT+ +G +KK+YQSRKS+RTV
Sbjct  159   GIGTDMITMNATLRMLYRNTGTFFGVHVTSSPIDLSFSQITIGSGTIKKFYQSRKSQRTV  218

Query  932   LVNIQGTKVPLYGAGSSL----------PATKNKDG--------TGGVQVPLALDFEVKS  1057
             +VN+ G K PLYG+GS+L             K K G             VP+ L+F V+S
Sbjct  219   VVNVLGDKTPLYGSGSTLVPPPPPAPIPTKPKRKKGPIVIIEPPAPPAPVPMRLNFTVRS  278

Query  1058  QGDVVGKLVRTDYRRKIWC  1114
             +  V+GKLV+  + ++I C
Sbjct  279   RAYVLGKLVQPKFYKRIVC  297



>ref|XP_009624500.1| PREDICTED: uncharacterized protein LOC104115537 isoform X2 [Nicotiana 
tomentosiformis]
Length=217

 Score =   165 bits (417),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 108/228 (47%), Positives = 146/228 (64%), Gaps = 17/228 (7%)
 Frame = +2

Query  233  MLHTKSESD----VTSLAASSPSGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVES  400
            M++++ ESD     TS + +SP   VYYVQSPSRDSHDD D + S+SMQ TP + SP++S
Sbjct  2    MMNSRDESDNASTATSSSLTSPKLPVYYVQSPSRDSHDDAD-KSSSSMQNTPAYHSPIDS  60

Query  401  PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDS  580
                       + S    S    S + R  RG     + KGW EC VI E+  YD +  +
Sbjct  61   ----------PSHSSRDSSSSRLSGNWRWARGYNRRRSGKGWQECAVIEEDLDYDHMNQA  110

Query  581  WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
            +  SRR    +AL GF   F  FCLI+WGA+RPY+  +++K+  V N Y G+GSD TGVP
Sbjct  111  Y--SRRCLFFIALMGFGAFFAFFCLILWGASRPYQPHISMKACRVHNFYFGQGSDRTGVP  168

Query  761  TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYY  904
            T+LL+VN S+ + +YNPATF+G+HVSS P+NL FS+ITVATGQ+  +Y
Sbjct  169  TKLLTVNCSVTMVIYNPATFFGVHVSSNPVNLFFSEITVATGQINLHY  216



>gb|AAO42869.1| At5g42860 [Arabidopsis thaliana]
Length=320

 Score =   167 bits (424),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 119/318 (37%), Positives = 179/318 (56%), Gaps = 47/318 (15%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEK-STSMQPTPTFTSPV--  394
             +H K++S+VTSL+ASSP+       Y+VQSPSRDSHD   GEK +TS   TP  TSP+  
Sbjct  1     MHAKTDSEVTSLSASSPTRSPRRPAYFVQSPSRDSHD---GEKTATSFHSTPVLTSPMGS  57

Query  395   ESPSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELE  574
                SH S  R S+ +   R                       G  +  +I EEG  D+ +
Sbjct  58    PPHSHSSSSRFSKINGSKRK-------------------GHAGEKQFAMIEEEGLLDDGD  98

Query  575   -DSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFT  751
              +   L RR + L  + GF LLF  F LI++ AA+P K ++++KS++   + +  G D  
Sbjct  99    REQEALPRRCYVLAFIVGFSLLFAFFSLILYAAAKPQKPKISVKSITFEQLKVQAGQDAG  158

Query  752   GVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTV  931
             G+ T ++++N +LR+   N  TF+G HV+S+PI+L FS IT+ +G +KK+YQSRKS+RTV
Sbjct  159   GIGTDMITMNATLRMLYRNTGTFFGXHVTSSPIDLSFSQITIGSGSIKKFYQSRKSQRTV  218

Query  932   LVNIQGTKVPLYGAGSSLPATKN-----------------KDGTGGVQVPLALDFEVKSQ  1060
             +VN+ G K+PLYG+GS+L                      +       VP+ L+F V+S+
Sbjct  219   VVNVLGDKIPLYGSGSTLVPPPPPAPIPKPKKKKGPIVIVEPPAPPAPVPMRLNFTVRSR  278

Query  1061  GDVVGKLVRTDYRRKIWC  1114
               V+GKLV+  + ++I C
Sbjct  279   AYVLGKLVQPKFYKRIVC  296



>ref|XP_010266959.1| PREDICTED: uncharacterized protein LOC104604355 [Nelumbo nucifera]
Length=303

 Score =   166 bits (421),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 123/328 (38%), Positives = 189/328 (58%), Gaps = 40/328 (12%)
 Frame = +2

Query  236   LHTKSESDVTSLAAS----SPSGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESP  403
             +H KS+S+VTS+ AS    SP   +YYVQSPS+  HD         ++     +SP+ SP
Sbjct  1     MHAKSDSEVTSIDASTPPRSPRRPLYYVQSPSQ--HD---------LEKMSYGSSPLGSP  49

Query  404   SHP---SLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELE  574
              H    S   HSR SS +RFS   +              N   W + N  +++   DE +
Sbjct  50    QHHYHCSPIHHSRESSTSRFSASLKQPR-----------NPAAWKKINQHLDDDDDDEND  98

Query  575   DSWLLS-----RRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEG  739
             D           RF+ +  +  F +LFTVF LI+WGA++PYK ++++K+++     I  G
Sbjct  99    DGIGDRGSGNLARFYVVCFVFSFAVLFTVFSLILWGASKPYKPKISIKNIAFERFNIQAG  158

Query  740   SDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKS  919
              D +GVPT +LS+N +++I   NPATF+G+HVSSTP++L +  + +A+G + K+YQSRKS
Sbjct  159   MDDSGVPTDMLSLNSTVKIWFRNPATFFGVHVSSTPLDLYYYQLKIASGHMNKFYQSRKS  218

Query  920   RRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYR  1099
             +RT++V + G +VPLYG  S+L  +   +    V VPL L F ++S+  V+G+LV+  + 
Sbjct  219   QRTIVVTVGGKQVPLYGGVSAL--SGGMENYERVTVPLNLTFMMRSRAYVLGRLVKPKFY  276

Query  1100  RKIWCELIIDSAGNKPIKFKK--DSCAY  1177
             R I C +I+   GNK  K +   +SC Y
Sbjct  277   RTIRCSVILK--GNKLGKPQNLDNSCVY  302



>emb|CDX77406.1| BnaA07g05440D [Brassica napus]
Length=297

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 117/318 (37%), Positives = 183/318 (58%), Gaps = 34/318 (11%)
 Frame = +2

Query  245   KSESDVTSL-AASSPSGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESPSHPSLG  421
             KS SD+TS   +SSP    Y+VQSPSRDS      +KS+S   T   T+P ESPSHPS  
Sbjct  6     KSYSDMTSFDLSSSPKRPTYFVQSPSRDS------DKSSSAALTHQ-TTPTESPSHPSFA  58

Query  422   RHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIME--EGKYDEL-EDSWLLS  592
               SR S G      ++              +   WP  +   E  +G+Y++L ED   +S
Sbjct  59    --SRISGGGGGGFRWKGRRKY---------HGGRWPPGDKEEESGDGRYEDLYEDHRGIS  107

Query  593   RRFHallalcgflllfTVF---CLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPT  763
                     + G +   T+F   C +++ A++ +   V +K ++V N Y  EG D TGVPT
Sbjct  108   --IATCRLILGVVATLTLFFLICSVLFAASQSFTPIVYVKGVNVHNFYYWEGLDNTGVPT  165

Query  764   RLLSVNGSLRISVYNPATFYGIHVSSTPINLVFS-DITVATGQLKKYYQSRKSRRTVLVN  940
             +++++  S++I+ +NP+TF GIHVSS+PI L++S   T AT QL  YYQ ++S  T  ++
Sbjct  166   KIMNIKCSMQITTHNPSTFLGIHVSSSPIKLIYSRRFTFATAQLNSYYQPKQSNHTSRID  225

Query  941   IQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCEL  1120
             + G+ VPLYGAG+ + A+ N  G     VP+ L+FE++S+ ++VG LV++ +R+ + C  
Sbjct  226   LVGSMVPLYGAGADIAASGNNGG-----VPVKLEFEIRSRANIVGSLVKSRHRKHLSCFF  280

Query  1121  IIDSAGNKPIKFKKDSCA  1174
             +I S+  K +KF   +C+
Sbjct  281   LI-SSNTKFVKFTHKTCS  297



>gb|KFK31809.1| hypothetical protein AALP_AA6G161400 [Arabis alpina]
Length=312

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 116/316 (37%), Positives = 173/316 (55%), Gaps = 51/316 (16%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEK-STSMQPTPTFTSPVES  400
             +HTK++S+VTSLAASSP+       YYVQSPSRDSHD   GEK +TS   +P  + P   
Sbjct  1     MHTKTDSEVTSLAASSPTRSPRRPAYYVQSPSRDSHD---GEKTATSFHSSPMGSPPHSH  57

Query  401   PSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELEDS  580
              S     +                            S  K   +  +I EEG  D+ +  
Sbjct  58    SSSSRFSK-------------------------INGSKRKENKQFAMIEEEGLLDDGDRQ  92

Query  581   WLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVP  760
               L RR + L  + GF LLF  F LI++GAA+P K ++++KS++   + +  G D  G+ 
Sbjct  93    QGLPRRCYVLAFIVGFALLFAFFSLILYGAAKPQKPKISVKSITFEQLKVQAGQDAGGIG  152

Query  761   TRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVN  940
             T ++++N +LR+   N  TF+G+HV+S+PI+L FS IT+ +G +KK+YQSRKS+RTV+VN
Sbjct  153   TDMITMNATLRMMYRNTGTFFGVHVTSSPIDLSFSQITIGSGTIKKFYQSRKSQRTVIVN  212

Query  941   IQGTKVPLYGAGSSLPATKN------------------KDGTGGVQVPLALDFEVKSQGD  1066
             + G K PLYG+GS+L                       +       VP+ L+F V+S+  
Sbjct  213   VIGDKTPLYGSGSTLVPPPPPAPIPTKPKKKKGPIVIIEPPAPPAPVPMRLNFTVRSRAY  272

Query  1067  VVGKLVRTDYRRKIWC  1114
             V+GKLV+  + ++I C
Sbjct  273   VLGKLVQPKFYKRIVC  288



>ref|XP_009413040.1| PREDICTED: uncharacterized protein LOC103994436 [Musa acuminata 
subsp. malaccensis]
Length=321

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 124/180 (69%), Gaps = 3/180 (2%)
 Frame = +2

Query  641   TVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPTRLLSVNGSLRISVYNPATF  820
             T+F LI+WGA++ YK  + +K +   +  I  G+D TGVPT++LS+N ++RI+  NPATF
Sbjct  142   TLFSLILWGASKSYKPDIFVKGVVFRSYDIHAGTDLTGVPTKMLSINSTVRIAFRNPATF  201

Query  821   YGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNIQGTKVPLYGAGSSLPATKN  1000
             +G+HVSSTP+ + FSD+ +ATG +K++YQSRKS RTV V + G++VPLYG G+ L  ++ 
Sbjct  202   FGVHVSSTPLEIYFSDLKIATGYMKEFYQSRKSGRTVAVAVGGSQVPLYGGGTGL-RSRT  260

Query  1001  KDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELII-DSAGNKPIKFKKDSCAY  1177
             +DG     VPL L F ++++  V+G LVR+ + R + C L + +   +KP++    +C Y
Sbjct  261   EDGGAPAVVPLELSFTIRARAYVLGHLVRSKFYRHVRCSLSLREDRLDKPLRLAH-ACDY  319



>ref|XP_004959968.1| PREDICTED: uncharacterized protein LOC101762121 isoform X2 [Setaria 
italica]
Length=329

 Score =   166 bits (421),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 131/334 (39%), Positives = 193/334 (58%), Gaps = 23/334 (7%)
 Frame = +2

Query  233   MLHTKSESDVTSLAASSPSGH------VYYVQSPSRDSHDDGDGEK-STSMQPTPTFTSP  391
             M H K++S+VTSLA SSP         VYYVQSPSRDSHD   GEK +TS+  TP   SP
Sbjct  1     MPHAKTDSEVTSLAPSSPPRSPPRTRPVYYVQSPSRDSHD---GEKTATSVHSTPAL-SP  56

Query  392   VESP--SHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYD  565
             + SP  SH S+GR S +S  +           +   G++     KGW E  VI EEG  D
Sbjct  57    MASPRHSHSSVGRDSSSSRFSGHPKRGHHKGDKSSAGRKGAPPGKGWQEIGVIEEEGLLD  116

Query  566   ELEDSWLLSRR-FHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGS  742
             + E + ++ ++ ++ L+ + GF+ LF+ F L++WGA+R  K Q+ +KS+   N  I  G+
Sbjct  117   DEEHTRIVPKKCYYFLVFVLGFVALFSFFALVLWGASRSQKPQIVMKSIKFENFIIQAGT  176

Query  743   DFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSR  922
             D + VPT + + N +++ +  N  TF+GIHV++ P  L +S +T+A G LKK+YQ+R SR
Sbjct  177   DASLVPTDMATTNATVKFTYRNKGTFFGIHVTADPFQLAYSQLTLANGDLKKFYQARSSR  236

Query  923   RTVLVNIQGTKVPLYGAGSSLPATKNKDG-------TGGVQVPLALDFEVKSQGDVVGKL  1081
             RTV V + G KVPLYG G +L A     G       +    VP+ L   + S+  V+G L
Sbjct  237   RTVSVAVLGNKVPLYGGGPTLMAAPAAGGGKQAASSSSVAPVPMVLRTTLHSRAYVLGAL  296

Query  1082  VRTDYRRKIWCELIID-SAGNKPIKFKKDSCAYS  1180
             V+  +   + C ++++ S  NK I  +K +C YS
Sbjct  297   VKPKFTMAVECRVVMNPSKLNKIISLEK-ACHYS  329



>ref|XP_010494244.1| PREDICTED: uncharacterized protein LOC104771425 [Camelina sativa]
Length=322

 Score =   166 bits (420),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 120/320 (38%), Positives = 177/320 (55%), Gaps = 49/320 (15%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEK-STSMQPTPTFTSPV--  394
             +H K++S+VTSL+ASSP+       Y+VQSPSRDSHD   GEK +TS   TP  TSP+  
Sbjct  1     MHAKTDSEVTSLSASSPTRSPRRPAYFVQSPSRDSHD---GEKTATSFHSTPVLTSPMGS  57

Query  395   ESPSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELE  574
                SH S  R S+ +   R                       G  +   I EEG  D+  
Sbjct  58    PPHSHSSSSRFSKINGSKRK-------------------GHAGEKQFARIEEEGLLDDGG  98

Query  575   DSW--LLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDF  748
             D     L RR + L  + GF LLF  F LI++ AA+P K ++++KS++   + +  G D 
Sbjct  99    DRQQEALPRRCYVLAFIVGFSLLFAFFSLILYAAAKPQKPKISVKSITFEQLKVQAGQDA  158

Query  749   TGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRT  928
              G+ T ++++N +LR+   N  TF+G+HV+S+PI+L FS IT+ +G +KK+YQSRKS+RT
Sbjct  159   RGIGTDMITMNATLRMLYRNTGTFFGVHVTSSPIDLSFSQITIGSGTIKKFYQSRKSQRT  218

Query  929   VLVNIQGTKVPLYGAGSSLPATKN------------------KDGTGGVQVPLALDFEVK  1054
             V+VN+ G K PLYG+GS+L                       +       VP+ L+F V+
Sbjct  219   VVVNVLGDKTPLYGSGSTLVPPPPPAPIPTKPKKKKGPIVIVEPPAPPAPVPMRLNFTVR  278

Query  1055  SQGDVVGKLVRTDYRRKIWC  1114
             S+  V+GKLV+  + ++I C
Sbjct  279   SRAYVLGKLVQPKFYKRIVC  298



>ref|XP_006280823.1| hypothetical protein CARUB_v10026791mg [Capsella rubella]
 gb|EOA13721.1| hypothetical protein CARUB_v10026791mg [Capsella rubella]
Length=321

 Score =   166 bits (420),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 120/319 (38%), Positives = 177/319 (55%), Gaps = 48/319 (15%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEK-STSMQPTPTFTSPV--  394
             +H K++S+VTSL+ASSP+       Y+VQSPSRDSHD   GEK +TS   TP  TSP+  
Sbjct  1     MHAKTDSEVTSLSASSPTRSPRRPAYFVQSPSRDSHD---GEKTATSFHSTPVLTSPMGS  57

Query  395   ESPSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELE  574
                SH S  R S+ +   R                       G  +  +I EEG  D+ +
Sbjct  58    PPHSHSSSSRFSKINGSKRK-------------------GHAGEKQFAMIEEEGLLDDGD  98

Query  575   DSW-LLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFT  751
                  L RR + L  L GF LLF  F LI++ AA+P K ++ +KS++   + +  G D  
Sbjct  99    RRQEALPRRCYVLAFLVGFSLLFAFFSLILYAAAKPQKPKIFVKSITFEQLKVQAGQDAG  158

Query  752   GVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTV  931
             G+ T ++++N +LR+   N  TF+G+HV+S+PI+L FS IT+ +G +KK+YQSRKS+RTV
Sbjct  159   GIGTDMITMNATLRMLYRNTGTFFGVHVTSSPIDLSFSQITIGSGTIKKFYQSRKSQRTV  218

Query  932   LVNIQGTKVPLYGAGSSLPATKN------------------KDGTGGVQVPLALDFEVKS  1057
             +VN+ G K PLYG+GS+L                       +       VP+ L+F V+S
Sbjct  219   MVNVLGDKTPLYGSGSTLVPPPPPAPIPTKPKKKKGPIVIVEPPAPPAPVPMRLNFTVRS  278

Query  1058  QGDVVGKLVRTDYRRKIWC  1114
             +  V+GKLV+  + ++I C
Sbjct  279   RAYVLGKLVQPKFYKRIVC  297



>emb|CDY39534.1| BnaC07g07020D [Brassica napus]
Length=297

 Score =   165 bits (418),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 116/316 (37%), Positives = 182/316 (58%), Gaps = 30/316 (9%)
 Frame = +2

Query  245   KSESDVTSL-AASSPSGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESPSHPSLG  421
             KS+SD+TS   +SSP    Y+VQSPSRDS      +KS+S   T   T+P ESPSHPS  
Sbjct  6     KSDSDMTSFDLSSSPKRPTYFVQSPSRDS------DKSSSAALTHQ-TTPTESPSHPSFA  58

Query  422   RHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIME--EGKYDEL--EDSWLL  589
               SR S G      ++              +   WP  +   E  +G+Y++L  +   + 
Sbjct  59    --SRISGGGGGGFRWKGRRKY---------HGGRWPRGDKEEESGDGRYEDLYGDHRGIS  107

Query  590   SRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPTRL  769
                   +L +   L LF + C +++ A++ +   V +K +SV N Y  EG D TGVPT++
Sbjct  108   IATCRLILGVVATLTLFFLICSVLFAASQSFTPVVYVKGVSVHNFYYWEGLDNTGVPTKI  167

Query  770   LSVNGSLRISVYNPATFYGIHVSSTPINLVFS-DITVATGQLKKYYQSRKSRRTVLVNIQ  946
             +++  S++I+ +NP+TF GIHVSS+PI L++S   T AT QL  YYQ ++S  T  +++ 
Sbjct  168   MNIKCSVQITTHNPSTFLGIHVSSSPIKLIYSRRFTFATAQLNSYYQPKQSNHTSRIDLV  227

Query  947   GTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELII  1126
             G+ VPLYGAG+ + A+ N  G     VP+ L+FE++S+ ++VG LV++ +R+ + C  +I
Sbjct  228   GSMVPLYGAGADIAASGNNGG-----VPVKLEFEIRSRANIVGSLVKSRHRKHLSCFFLI  282

Query  1127  DSAGNKPIKFKKDSCA  1174
              S   K +KF   +C+
Sbjct  283   YS-NTKFVKFTHKTCS  297



>gb|EYU38006.1| hypothetical protein MIMGU_mgv1a010019mg [Erythranthe guttata]
Length=324

 Score =   166 bits (420),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 125/328 (38%), Positives = 184/328 (56%), Gaps = 23/328 (7%)
 Frame = +2

Query  236   LHTKSESDVTSLAAS----SPSGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESP  403
             +H KS+S+VTS+ AS    SP   +YYVQSPS   H   D EK +        +SP  SP
Sbjct  5     MHVKSDSEVTSIEASTPPRSPRRPLYYVQSPS---HSQQDLEKMSYG------SSPFGSP  55

Query  404   SHP-----SLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKY-D  565
             +H      S   HSR SS +RFS   ++     G G       + + E    +EE +  D
Sbjct  56    THHFQYHCSPIHHSRESSTSRFSASLKNPRNSGGIGGGWRRMQRKYDEVGDEVEENEEGD  115

Query  566   ELEDSWLL--SRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEG  739
             ++ED        +F+ +  L  F+LLFTVF LI+W ++  YK ++ +KS+S     +  G
Sbjct  116   DVEDERDNGGQVKFYVVCFLFSFVLLFTVFSLILWASSLAYKPKIIVKSISFETFNVQAG  175

Query  740   SDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKS  919
              D TGVPT +L++N ++ I   NPATF+G+HV+STP++L F D+ VA+G + K+YQSRKS
Sbjct  176   MDATGVPTDMLTLNSTVFIFYRNPATFFGVHVTSTPLHLHFFDLQVASGHMNKFYQSRKS  235

Query  920   RRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYR  1099
              R V+  IQG +VPLYG    L     K     + VPL L F ++S+  ++G+LV+  + 
Sbjct  236   ERKVIAVIQGHQVPLYGGIPMLSGGVAKAHLQTMAVPLNLTFVIRSRAYILGRLVKPKFY  295

Query  1100  RKIWCELII--DSAGNKPIKFKKDSCAY  1177
             + + C+L +  +  GN     K  SCAY
Sbjct  296   QSVLCQLTLTGNHLGNPLNLTKTHSCAY  323



>ref|XP_006299053.1| hypothetical protein CARUB_v10015193mg, partial [Capsella rubella]
 gb|EOA31951.1| hypothetical protein CARUB_v10015193mg, partial [Capsella rubella]
Length=271

 Score =   164 bits (415),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 119/174 (68%), Gaps = 6/174 (3%)
 Frame = +2

Query  659   IWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVS  838
             +WGA+ P+   V++KS S+ + Y GEG D TGV T++LS N S+++++++PA ++GIHVS
Sbjct  100   LWGASHPFSPIVSVKSFSLHSFYYGEGIDRTGVATKILSFNSSVKVTIHSPAPYFGIHVS  159

Query  839   STPINLVFSDITVATGQLKKYYQSRKSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGG  1018
             S+   L FS  T+ATGQLK YYQ RKS+   +V + G +VPLYGAG  L A+  K     
Sbjct  160   SSTFKLTFSTFTLATGQLKSYYQPRKSKHMAIVKLTGAEVPLYGAGPHLAASDKKG----  215

Query  1019  VQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELIIDSAG-NKPIKFKKDSCAY  1177
              +VP+ L+F+++SQG+++GKLV++ +   I C   I S+  +KPI+F   +C +
Sbjct  216   -KVPVKLEFDIRSQGNLLGKLVKSKHVNHITCSFFISSSKTSKPIEFSHRTCKH  268



>ref|XP_004173619.1| PREDICTED: uncharacterized protein LOC101226858, partial [Cucumis 
sativus]
Length=202

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 133/192 (69%), Gaps = 4/192 (2%)
 Frame = +2

Query  587   LSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPTR  766
             L RR + L  + GF++LF++F LI+WGA+RP K ++T+KS++     I  GSDFTGV T 
Sbjct  9     LPRRCYVLAFILGFVVLFSMFALILWGASRPMKPKITMKSITFEQFKIQAGSDFTGVATD  68

Query  767   LLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTVLVNIQ  946
             + SVN ++++   N  +F+G+HVS TP++L +S+ITVA+G +KK+YQSRKS R++ +N+ 
Sbjct  69    MASVNSTVKLIFRNTGSFFGVHVSPTPVDLSYSEITVASGTVKKFYQSRKSHRSMTINVI  128

Query  947   GTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELII  1126
             GT+VPLYG+G+SL  +    GT    +PL L F ++S+  V+G+LV+  + R I C +I 
Sbjct  129   GTRVPLYGSGASLSGS---TGTPETPLPLKLRFVIRSRAYVLGQLVKPKFYRHIDCPIIF  185

Query  1127  DSAG-NKPIKFK  1159
             DS   N P+  K
Sbjct  186   DSKKLNVPMSLK  197



>ref|XP_010442112.1| PREDICTED: uncharacterized protein LOC104725191 [Camelina sativa]
Length=321

 Score =   165 bits (418),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 119/319 (37%), Positives = 177/319 (55%), Gaps = 48/319 (15%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH----VYYVQSPSRDSHDDGDGEK-STSMQPTPTFTSPV--  394
             +H K++S+VTSL+ASSP+       Y+VQSPSRDSHD   GEK +TS   TP  TSP+  
Sbjct  1     MHAKTDSEVTSLSASSPTRSPRRPAYFVQSPSRDSHD---GEKTATSFHSTPVLTSPMGS  57

Query  395   ESPSHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVIMEEGKYDELE  574
                SH S  R S+ +   R                       G  +   I EEG  D+ +
Sbjct  58    PPHSHSSSSRFSKINGSKRK-------------------GHAGEKQFARIEEEGLLDDGD  98

Query  575   -DSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFT  751
                  L RR + L  + GF LLF  F LI++ AA+P K ++++KS++   + +  G D  
Sbjct  99    RQQEALPRRCYVLAFIVGFSLLFAFFSLILYAAAKPQKPKISVKSITFEQLKVQAGQDAG  158

Query  752   GVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRKSRRTV  931
             G+ T ++++N +LR+   N  TF+G+HV+S+PI+L FS IT+ +G +KK+YQSRKS+RTV
Sbjct  159   GIGTDMITMNATLRMLYRNTGTFFGVHVTSSPIDLSFSQITIGSGTIKKFYQSRKSQRTV  218

Query  932   LVNIQGTKVPLYGAGSSLPATKN------------------KDGTGGVQVPLALDFEVKS  1057
             +VN+ G K PLYG+GS+L                       +       VP+ L+F V+S
Sbjct  219   VVNVLGDKTPLYGSGSTLVPPPPPAPIPTKPKKKKGPIVIVEPPAPPAPVPMRLNFTVRS  278

Query  1058  QGDVVGKLVRTDYRRKIWC  1114
             +  V+GKLV+  + ++I C
Sbjct  279   RAYVLGKLVQPKFYKRIVC  297



>emb|CDY39535.1| BnaC07g07030D [Brassica napus]
Length=307

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 124/175 (71%), Gaps = 7/175 (4%)
 Frame = +2

Query  659   IWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVS  838
             +WGA+ P+   V++KS S+ + Y GEG D TGV T++LS N S+++++ +PA ++GIHVS
Sbjct  135   LWGASHPFSPIVSVKSFSLHSFYYGEGIDRTGVATKILSFNSSVKVTIDSPAPYFGIHVS  194

Query  839   STP-INLVFSDITVATGQLKKYYQSRKSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTG  1015
             S+   NL FS +T+ATGQLK YYQ RKS+ T +V + G++VPLYGAG +L A+  K    
Sbjct  195   SSSTFNLTFSALTLATGQLKSYYQPRKSKHTAIVKLIGSEVPLYGAGPNLAASDKKG---  251

Query  1016  GVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELIIDSAG-NKPIKFKKDSCAY  1177
               +VP+ L+FE++SQG+++GKLV++++   I C   I S+  +KPI+F   +C +
Sbjct  252   --RVPVKLEFEIRSQGNLLGKLVKSNHLNHISCSFYISSSKTSKPIEFTHKTCKH  304



>emb|CDX77407.1| BnaA07g05450D [Brassica napus]
Length=307

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 124/175 (71%), Gaps = 7/175 (4%)
 Frame = +2

Query  659   IWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVS  838
             +WGA+ P+   V++KS S+ + Y GEG D TGV T++LS N S+++++ +PA ++GIHVS
Sbjct  135   LWGASHPFSPIVSVKSFSLHSFYYGEGIDRTGVATKILSFNSSVKVTIDSPAPYFGIHVS  194

Query  839   STP-INLVFSDITVATGQLKKYYQSRKSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTG  1015
             S+   NL FS +T+ATGQLK YYQ RKS+ T +V + G++VPLYGAG +L A+  K    
Sbjct  195   SSSTFNLTFSALTLATGQLKSYYQPRKSKHTAIVKLIGSEVPLYGAGPNLAASDKKG---  251

Query  1016  GVQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELIIDSAG-NKPIKFKKDSCAY  1177
               +VP+ L+FE++SQG+++GKLV++++   I C   I S+  +KPI+F   +C +
Sbjct  252   --RVPVKLEFEIRSQGNLLGKLVKSNHLNHISCSFYISSSKTSKPIEFTHKTCKH  304



>gb|AAR95998.1| hypothetical protein kinase [Musa acuminata]
Length=267

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 91/222 (41%), Positives = 138/222 (62%), Gaps = 4/222 (2%)
 Frame = +2

Query  512   NDKGWPECNVIMEEGKYDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQ  691
             +DK W EC  I EEG  ++  +   L RR ++L+ L GF++LF+ F LI+WGA+R  K +
Sbjct  49    SDKAWKECATIEEEGLLEDEREEKGLPRRCYSLVFLLGFVILFSFFALILWGASRSQKPE  108

Query  692   VTLKSLSVSNIYIGEGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDI  871
             +T+KS+   N  I  G+D + VPT + ++N ++R S  N  TF+G+HVS+TP  L +  +
Sbjct  109   ITMKSVRFENFIIQAGTDASLVPTDMATLNSTVRFSFRNTGTFFGVHVSATPFVLSYDQL  168

Query  872   TVATGQLKKYYQSRKSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEV  1051
             T+A G++  +YQSRKS+R V V + G KVPLYG G SL ++     T    VPL+L F V
Sbjct  169   TLAGGEMNNFYQSRKSQRNVEVVVLGKKVPLYGGGPSLASSPGSVAT----VPLSLSFMV  224

Query  1052  KSQGDVVGKLVRTDYRRKIWCELIIDSAGNKPIKFKKDSCAY  1177
             KS+  V+GKLV+  +   + C++++  A        K+SC Y
Sbjct  225   KSRAYVLGKLVKPKFEIGVQCKVVMKPAQLNTRVSLKNSCQY  266



>ref|XP_004238141.1| PREDICTED: uncharacterized protein LOC101250111 isoform X2 [Solanum 
lycopersicum]
Length=299

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 131/329 (40%), Positives = 185/329 (56%), Gaps = 44/329 (13%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGH---VYYVQSPSRDSHDDGDGEKST-SMQPTPTFTSPVESP  403
             +HTK++S+ TSLA SSP       YYVQSPSRDSHD   GEK+T S   TP   SP+ SP
Sbjct  1     MHTKTDSEDTSLAPSSPDNRGPTAYYVQSPSRDSHD---GEKTTTSFHSTPVI-SPMGSP  56

Query  404   --SHPSLGRHSRTssgtrfsgifrsssgrkgrgkr-------mmsNDKGWPECNVIMEEG  556
               SH S+GRHSR SS +RFSG  +  S +                  K W EC+VI EEG
Sbjct  57    PHSHSSVGRHSRDSSSSRFSGSLKPGSQKILPDAAGGVGGRHHRKGQKPWKECDVIEEEG  116

Query  557   KYDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGE  736
               ++   S  L RR + L  + GF +LF+ F LI+WGA+RP K ++T++++   +  I  
Sbjct  117   LLEDDRSSKSLPRRCYVLAFVVGFFVLFSFFALILWGASRPQKPKITMRTIKFDHFGIQA  176

Query  737   GSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYYQSRK  916
             GSD TGV T ++S+N +++    N A+F+G                     +KK+YQSRK
Sbjct  177   GSDATGVATDMISMNATVKFLYRNTASFFG---------------------MKKFYQSRK  215

Query  917   SRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLVRTDY  1096
             S+R V V++ G K+PLYG G+SL       G   + VPL L+F+++S+  V+GK+V+  +
Sbjct  216   SQRVVAVSVIGNKIPLYGGGASL---STPAGATPLPVPLKLNFKLRSRAYVLGKMVKPKF  272

Query  1097  RRKIWCELII-DSAGNKPIKFKKDSCAYS  1180
              + I C L +     N  I  K  +C YS
Sbjct  273   YKTIDCLLTLRPQKMNAAISLK--NCTYS  299



>ref|XP_004172052.1| PREDICTED: uncharacterized protein LOC101232653 [Cucumis sativus]
 gb|KGN48532.1| hypothetical protein Csa_6G490960 [Cucumis sativus]
Length=321

 Score =   163 bits (413),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 130/332 (39%), Positives = 200/332 (60%), Gaps = 32/332 (10%)
 Frame = +2

Query  230   AMLHTKSESDVTSLAASSPSGH------VYYVQSPSRDSHDDGDGEKSTSMQPTPTF-TS  388
             +++  K++S+V+SL  SSP+        VYYVQSPSRDSHD   GEK+T+     +F +S
Sbjct  2     SVVLAKTDSEVSSLTPSSPTRSPSSRRPVYYVQSPSRDSHD---GEKTTN-----SFHSS  53

Query  389   PVESP--------SHPSLGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGWPECNVI  544
             PV SP        S+ SLG HSR SS TRFS   +  S +    K      K W   + I
Sbjct  54    PVLSPMGSPPHSHSNSSLGPHSRDSSSTRFSASVKPGSRKPPNHKI----PKPWKRFDAI  109

Query  545   MEEGKYDELEDSWLLSRRFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNI  724
              EE   D+   S   +RR + L  +  F+LLF++F LI+WGA+RP K  + +KS+     
Sbjct  110   EEERLLDDDGASDRFTRRCYFLAFVISFVLLFSLFSLILWGASRPQKPTILMKSILFDKF  169

Query  725   YIGEGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVSSTPINLVFSDITVATGQLKKYY  904
              I  G+DF+GV T L+++N +++    N ATF+G+ V+STP+ L +S +T+A+G ++K++
Sbjct  170   VIQAGADFSGVATGLVTMNATVKFIFRNTATFFGVQVTSTPLQLSYSQLTLASGTMQKFH  229

Query  905   QSRKSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGGVQVPLALDFEVKSQGDVVGKLV  1084
             Q RKS+R + V ++G+ +PLYG G+SL +    +G     VP+ L F V+S+ +V+GKLV
Sbjct  230   QRRKSQRPITVTVKGSGIPLYGGGASLGSV---NGKPVEPVPMNLQFTVRSRANVLGKLV  286

Query  1085  RTDYRRKIWCELIIDSAG-NKPIKFKKDSCAY  1177
             +  + + + C +++D    NKPI   K+ C Y
Sbjct  287   KPKFYKSVDCSVVMDPINMNKPISL-KNKCTY  317



>ref|XP_010513616.1| PREDICTED: uncharacterized protein LOC104789645 [Camelina sativa]
Length=506

 Score =   167 bits (423),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 118/172 (69%), Gaps = 6/172 (3%)
 Frame = +2

Query  659   IWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPTRLLSVNGSLRISVYNPATFYGIHVS  838
             +WGA+ P+   V++KS S+ + Y GEG D TGV TR+LS N S+++++++PA ++GIHVS
Sbjct  335   LWGASHPFSTVVSVKSFSLHSFYYGEGIDRTGVATRILSFNSSVKVTIHSPAPYFGIHVS  394

Query  839   STPINLVFSDITVATGQLKKYYQSRKSRRTVLVNIQGTKVPLYGAGSSLPATKNKDGTGG  1018
             S+   L FS  T+ATGQLK YYQ RKS+   +V + G +VPLYGAG  L A+  K     
Sbjct  395   SSTFKLTFSSFTLATGQLKSYYQPRKSKHIAIVKLTGAEVPLYGAGPHLAASDKKG----  450

Query  1019  VQVPLALDFEVKSQGDVVGKLVRTDYRRKIWCELIIDSAG-NKPIKFKKDSC  1171
              +VP+ L+F+++SQG+++GKLV++ +   I C   I S+  +KPIKF   +C
Sbjct  451   -KVPVKLEFDIRSQGNLLGKLVKSKHVNHITCSFFISSSKTSKPIKFSHKTC  501


 Score =   154 bits (388),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 109/268 (41%), Positives = 161/268 (60%), Gaps = 24/268 (9%)
 Frame = +2

Query  236   LHTKSESDVTSLAASSPSGHVYYVQSPSRDSHDDGDGEKSTSMQPTPTFTSPVESPSHPS  415
             ++ KS+SD+TSL  SSP    YYVQSPSRDS      EKS+S+  T   T+P ESPSHPS
Sbjct  3     IYLKSDSDITSLDESSPKQPTYYVQSPSRDS------EKSSSVALTTHQTTPTESPSHPS  56

Query  416   LGRHSRTssgtrfsgifrsssgrkgrgkrmmsNDKGW-PECNVIMEEGKYDEL-EDSWLL  589
                 SR S+G      ++              +   W P       +G+YD+L ED+  +
Sbjct  57    FA--SRVSNGGGGGFRWKGRRKY---------HGGRWSPADKEESGDGRYDDLYEDNRGV  105

Query  590   SR-RFHallalcgflllfTVFCLIIWGAARPYKAQVTLKSLSVSNIYIGEGSDFTGVPTR  766
             S      +L +   L +F + C +++GA++ +   V +K ++V + Y GEGSD TGVPT+
Sbjct  106   SVVTCRLILGVVATLSIFVLLCSVLFGASQSFPPIVYIKGVNVHSFYYGEGSDSTGVPTK  165

Query  767   LLSVNGSLRISVYNPATFYGIHVSSTPINLVFS-DITVATGQLKKYYQSRKSRRTVLVNI  943
             +L+   S+ I+++NP+TF+GIHVSS+ I+L++S   T+A   LK YYQ ++S  T ++N+
Sbjct  166   ILNFKCSMEITIHNPSTFFGIHVSSSAISLIYSRQFTLAIAHLKSYYQPKQSNHTSMINL  225

Query  944   QGTKVPLYGAGSSLPATKNKDGTGGVQV  1027
              G+KVPLYGAG+ L A+   D  GGV V
Sbjct  226   VGSKVPLYGAGAELVAS---DHNGGVPV  250



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3780637393212