BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24145_g1_i4 len=804 path=[1151:0-148 @1300@!:149-511 209:512-803]

Length=804
                                                                      Score     E

sp|Q84LF1.1|5EAS1_NICAT  RecName: Full=5-epi-aristolochene syntha...    141   9e-65   Nicotiana attenuata
pdb|1HX9|A  Chain A, Crystal Structure Of Teas W273s Form 1             145   9e-65   
pdb|5EAU|A  Chain A, 5-Epi-Aristolochene Synthase From Nicotiana ...    145   9e-65   
pdb|1HXG|A  Chain A, Crystal Structure Of Teas W273sC440W               145   1e-64   
pdb|1HXC|A  Chain A, Crystal Structure Of Teas C440w                    145   1e-64   
pdb|5EAS|A  Chain A, 5-Epi-Aristolochene Synthase From Nicotiana ...    144   2e-64   
pdb|5EAT|A  Chain A, 5-Epi-Aristolochene Synthase From Nicotiana ...    144   2e-64   
gb|AHM10157.1|  sesquiterpene synthase                                  143   3e-64   
pdb|3LZ9|A  Chain A, The Crystal Structure Of 5-Epi-Aristolochene...    142   5e-64   
pdb|3M01|A  Chain A, The Crystal Structure Of 5-Epi-Aristolochene...    142   5e-64   
sp|Q40577.3|5EAS_TOBAC  RecName: Full=5-epi-aristolochene synthas...    142   5e-64   Nicotiana tabacum [American tobacco]
ref|XP_009794139.1|  PREDICTED: vetispiradiene synthase 2-like          144   6e-64   
ref|XP_009764785.1|  PREDICTED: vetispiradiene synthase 3-like          145   9e-64   
ref|XP_004230359.1|  PREDICTED: vetispiradiene synthase 1               137   2e-63   
sp|Q39978.2|VTSS1_HYOMU  RecName: Full=Vetispiradiene synthase 1;...    144   2e-63   Hyoscyamus muticus
ref|XP_009784555.1|  PREDICTED: 5-epi-aristolochene synthase 3          145   4e-63   
dbj|BAA82108.1|  vetispiradiene synthase                                139   4e-63   Solanum tuberosum [potatoes]
sp|Q84LF0.1|5EAS2_NICAT  RecName: Full=5-epi-aristolochene syntha...    141   5e-63   Nicotiana attenuata
ref|XP_009757910.1|  PREDICTED: 5-epi-aristolochene synthase 1-like     145   7e-63   
dbj|BAN58139.1|  putative vetispiradiene synthase                       145   7e-63   
gb|AAA19216.1|  5-epi-aristolochene synthase                            138   7e-63   Nicotiana tabacum [American tobacco]
ref|XP_009762840.1|  PREDICTED: 5-epi-aristolochene synthase-like...    142   9e-63   
ref|XP_009762842.1|  PREDICTED: 5-epi-aristolochene synthase-like...    142   1e-62   
gb|AFJ04408.1|  5-epi-aristolochene synthase                            137   2e-62   
pdb|4DI5|A  Chain A, Co-Crystal Structure Of Wt 5-Epi-Aristoloche...    137   2e-62   
ref|XP_009595428.1|  PREDICTED: 5-epi-aristolochene synthase            136   2e-62   
sp|Q84LF2.1|5EAS3_NICAT  RecName: Full=5-epi-aristolochene syntha...    140   3e-62   Nicotiana attenuata
sp|Q84LG0.1|5EAS4_NICAT  RecName: Full=Probable 5-epi-aristoloche...    134   4e-62   Nicotiana attenuata
ref|XP_009771989.1|  PREDICTED: 5-epi-aristolochene synthase-like       140   5e-62   
ref|NP_001239040.1|  viridiflorene synthase                             139   6e-62   
ref|XP_009589983.1|  PREDICTED: 5-epi-aristolochene synthase-like       139   1e-61   
ref|XP_006367961.1|  PREDICTED: viridiflorene synthase-like             138   2e-61   
ref|XP_009773139.1|  PREDICTED: vetispiradiene synthase 3               137   3e-61   
ref|XP_009779916.1|  PREDICTED: 5-epi-aristolochene synthase            139   5e-61   
ref|XP_006358531.1|  PREDICTED: viridiflorene synthase-like             132   9e-61   
gb|AAF21053.1|AF212433_1  UV-induced sesquiterpene cyclase              126   1e-57   Capsicum annuum
gb|AAA86337.1|  vetispiradiene synthase                                 125   9e-56   Hyoscyamus muticus
sp|O65323.1|5EAS_CAPAN  RecName: Full=5-epiaristolochene synthase       130   3e-55   Capsicum annuum
ref|XP_009589984.1|  PREDICTED: 5-epi-aristolochene synthase-like       131   4e-55   
gb|AAP79448.1|  epi-arisotolchene synthase 110                          130   2e-54   Nicotiana tabacum [American tobacco]
emb|CAA06614.1|  5-epi-aristolochene synthase                           127   5e-54   Capsicum annuum var. annuum [chilli pepper]
ref|XP_009611774.1|  PREDICTED: vetispiradiene synthase 1-like          125   3e-53   
ref|XP_011082248.1|  PREDICTED: vetispiradiene synthase 3-like          117   5e-50   
gb|EYU21989.1|  hypothetical protein MIMGU_mgv1a023416mg                114   2e-49   
ref|XP_011073749.1|  PREDICTED: vetispiradiene synthase 3-like          116   2e-49   
ref|XP_011082247.1|  PREDICTED: vetispiradiene synthase 3-like          109   5e-48   
ref|XP_009617319.1|  PREDICTED: LOW QUALITY PROTEIN: vetispiradie...    120   9e-48   
emb|CAC83059.2|  putative terpenesynthase-1                             120   1e-47   Marrubium vulgare
ref|XP_006354694.1|  PREDICTED: viridiflorene synthase-like             111   4e-47   
gb|EYU21983.1|  hypothetical protein MIMGU_mgv1a023510mg                109   9e-46   
gb|EYU43546.1|  hypothetical protein MIMGU_mgv1a002915mg                105   4e-45   
emb|CDP07837.1|  unnamed protein product                                111   1e-44   
gb|EYU21979.1|  hypothetical protein MIMGU_mgv1a019334mg                112   2e-44   
ref|XP_011082260.1|  PREDICTED: vetispiradiene synthase 3-like          105   3e-44   
emb|CDP18842.1|  unnamed protein product                                107   5e-44   
gb|EYU32629.1|  hypothetical protein MIMGU_mgv1a023948mg                111   6e-44   
ref|XP_009771803.1|  PREDICTED: 5-epi-aristolochene synthase-like       145   3e-43   
sp|Q49SP5.1|TPGAS_POGCB  RecName: Full=Germacrene A synthase; Alt...    107   6e-43   Pogostemon cablin
gb|AAX16076.1|  putative sesquiterpene synthase                         112   8e-43   Perilla frutescens var. frutescens
ref|XP_007021121.1|  Delta-cadinene synthase isozyme A                  106   1e-42   
gb|AAX16077.1|  valencene synthase                                      110   2e-42   Perilla frutescens var. frutescens
ref|XP_009764783.1|  PREDICTED: viridiflorene synthase-like             106   3e-42   
gb|AGB14625.1|  germacrene-D synthase                                   104   7e-42   
ref|XP_011005621.1|  PREDICTED: (-)-germacrene D synthase-like          104   2e-41   
ref|XP_011080424.1|  PREDICTED: gamma-cadinene synthase-like            101   3e-41   
ref|XP_002274781.1|  PREDICTED: valencene synthase                    99.0    5e-41   Vitis vinifera
emb|CBI31294.3|  unnamed protein product                              99.0    5e-41   
ref|XP_002275408.3|  PREDICTED: valencene synthase                      102   6e-41   Vitis vinifera
ref|XP_009358866.1|  PREDICTED: (-)-germacrene D synthase-like          104   6e-41   
ref|XP_009338863.1|  PREDICTED: (-)-germacrene D synthase-like          104   7e-41   
gb|AII32471.1|  terpene synthase                                        102   1e-40   
gb|KHG04498.1|  (+)-delta-cadinene synthase isozyme A                   101   4e-40   
ref|XP_009344725.1|  PREDICTED: (-)-germacrene D synthase-like          100   4e-40   
ref|NP_001268213.1|  (-)-germacrene D synthase                          100   5e-40   
emb|CBI20483.3|  unnamed protein product                                101   6e-40   
ref|XP_006374233.1|  hypothetical protein POPTR_0015s05270g             100   6e-40   
emb|CAA77191.1|  (+)-delta-cadinene synthase                            101   9e-40   Gossypium arboreum [tree cotton]
sp|Q43714.1|DCS3_GOSAR  RecName: Full=(+)-delta-cadinene synthase...    101   9e-40   Gossypium arboreum [tree cotton]
emb|CAN83470.1|  hypothetical protein VITISV_030783                     100   1e-39   Vitis vinifera
emb|CAN68620.1|  hypothetical protein VITISV_013313                     100   1e-39   Vitis vinifera
ref|XP_011080333.1|  PREDICTED: gamma-cadinene synthase-like            105   2e-39   
ref|XP_009344731.1|  PREDICTED: (-)-germacrene D synthase-like          100   2e-39   
ref|XP_007021117.1|  Delta-cadinene synthase isozyme A                  100   2e-39   
ref|NP_001268204.1|  uncharacterized protein LOC100257265               101   2e-39   
ref|XP_011080427.1|  PREDICTED: gamma-cadinene synthase-like            103   3e-39   
ref|XP_008232170.1|  PREDICTED: (-)-germacrene D synthase-like          108   3e-39   
ref|XP_010241001.1|  PREDICTED: (-)-germacrene D synthase-like        98.2    3e-39   
emb|CBI20482.3|  unnamed protein product                                101   3e-39   
ref|XP_002513334.1|  Casbene synthase, chloroplast precursor, put...  95.1    3e-39   Ricinus communis
ref|XP_002321642.1|  hypothetical protein POPTR_0015s09710g             100   4e-39   Populus trichocarpa [western balsam poplar]
ref|NP_001268063.1|  uncharacterized protein LOC100267145               100   4e-39   
ref|XP_004308569.1|  PREDICTED: (-)-germacrene D synthase-like          112   4e-39   
gb|AGN72800.1|  germacrene A                                            107   5e-39   
emb|CBI31274.3|  unnamed protein product                              99.8    6e-39   
gb|KHG14851.1|  (+)-delta-cadinene synthase isozyme C2                94.7    6e-39   
sp|Q9FQ27.1|TPSGB_SOLHA  RecName: Full=(E,E)-germacrene B synthase      102   7e-39   Solanum habrochaites
gb|KHG18113.1|  (+)-delta-cadinene synthase isozyme C2                94.4    7e-39   
emb|CAN77700.1|  hypothetical protein VITISV_036209                     101   9e-39   Vitis vinifera
emb|CAD90835.1|  (+)-delta-cadinene synthase                          95.5    1e-38   Gossypium arboreum [tree cotton]
ref|XP_009338882.1|  PREDICTED: (-)-germacrene D synthase-like          104   1e-38   
ref|XP_007021120.1|  Delta-cadinene synthase isozyme A                  100   1e-38   
sp|O49853.1|DCS4_GOSAR  RecName: Full=(+)-delta-cadinene synthase...  94.4    1e-38   Gossypium arboreum [tree cotton]
ref|XP_011009444.1|  PREDICTED: probable terpene synthase 6 isofo...    100   1e-38   
gb|ADR74200.1|  beta-curcumene synthase                                 101   1e-38   
ref|XP_002277351.2|  PREDICTED: valencene synthase                      101   1e-38   Vitis vinifera
ref|XP_011035527.1|  PREDICTED: (-)-germacrene D synthase-like          100   2e-38   
gb|AFR42419.1|  driminol synthase                                     99.8    2e-38   
ref|XP_011005622.1|  PREDICTED: valencene synthase-like isoform X1    97.1    2e-38   
gb|KHG16315.1|  delta-cadinene synthase isozyme XC1                   94.7    2e-38   
ref|XP_004301355.1|  PREDICTED: (-)-germacrene D synthase-like        94.4    2e-38   
gb|AEP17005.1|  (E)-beta-caryophyllene synthase                       96.3    2e-38   
gb|ADB90273.1|  casbene synthase                                      94.7    2e-38   Euphorbia esula [wolf's milk]
gb|AAF74977.1|AF270425_1  (+)-delta-cadinene synthase                 95.5    2e-38   Gossypium hirsutum [American cotton]
ref|XP_011015484.1|  PREDICTED: valencene synthase-like               98.6    2e-38   
gb|AAX44033.1|  (+)-delta-cadinene synthase                           95.5    3e-38   Gossypium hirsutum [American cotton]
gb|KDP24704.1|  hypothetical protein JCGZ_25440                         100   3e-38   
ref|NP_001234766.1|  caryophyllene/alpha-humulene synthase              105   3e-38   
emb|CAN82172.1|  hypothetical protein VITISV_040547                   96.7    4e-38   Vitis vinifera
gb|AFE56211.1|  terpene synthase                                      99.8    5e-38   
ref|XP_002513343.1|  Casbene synthase, chloroplast precursor, put...    101   6e-38   Ricinus communis
gb|KDP46461.1|  hypothetical protein JCGZ_12944                         101   6e-38   
emb|CAN62114.1|  hypothetical protein VITISV_032023                   94.7    6e-38   Vitis vinifera
gb|KDP36233.1|  hypothetical protein JCGZ_09953                       95.9    6e-38   
sp|E3W207.1|SAUSS_SANAS  RecName: Full=Sesquiterpene synthase; Sh...    103   6e-38   
ref|XP_010247958.1|  PREDICTED: (-)-germacrene D synthase-like        97.1    7e-38   
dbj|BAJ53219.1|  JHL17M24.3                                           94.7    7e-38   
gb|AAD51718.1|  (+)-delta-cadinene sythase                            96.3    8e-38   Gossypium arboreum [tree cotton]
dbj|BAJ53216.1|  JHL22C18.7                                             101   9e-38   
ref|NP_001268028.1|  valencene synthase-like                          94.7    9e-38   
ref|XP_010105617.1|  (-)-germacrene D synthase                          107   9e-38   
ref|XP_010258444.1|  PREDICTED: (-)-germacrene D synthase-like        93.6    1e-37   
emb|CAN78342.1|  hypothetical protein VITISV_000109                   95.1    1e-37   Vitis vinifera
sp|Q39760.1|DCS2_GOSAR  RecName: Full=(+)-delta-cadinene synthase...  94.7    1e-37   Gossypium arboreum [tree cotton]
gb|KHG05331.1|  delta-cadinene synthase isozyme XC14                  95.1    1e-37   
gb|EYU31459.1|  hypothetical protein MIMGU_mgv1a026799mg                104   1e-37   
dbj|BAJ46125.1|  sesquiterpene synthase                                 102   1e-37   
sp|Q39761.1|DCS1_GOSAR  RecName: Full=(+)-delta-cadinene synthase...  94.0    1e-37   Gossypium arboreum [tree cotton]
ref|XP_006475306.1|  PREDICTED: (E)-beta-farnesene synthase-like      94.4    2e-37   
gb|KHG01612.1|  delta-cadinene synthase isozyme XC14                  92.4    2e-37   
gb|ADR66821.1|  germacrene A synthase                                 94.7    2e-37   
emb|CAN69834.1|  hypothetical protein VITISV_025998                     105   2e-37   Vitis vinifera
ref|XP_011009443.1|  PREDICTED: probable terpene synthase 6 isofo...  96.3    2e-37   
emb|CBI31262.3|  unnamed protein product                              94.7    2e-37   
ref|XP_006475262.1|  PREDICTED: (-)-germacrene D synthase-like        99.0    2e-37   
gb|KDO74408.1|  hypothetical protein CISIN_1g008427mg                 99.0    2e-37   
dbj|BAM24405.1|  sesquiterpene synthase                                 100   2e-37   
ref|XP_008388200.1|  PREDICTED: (-)-germacrene D synthase-like        94.7    3e-37   
ref|XP_008388210.1|  PREDICTED: (-)-germacrene D synthase-like          104   3e-37   
ref|XP_002513340.1|  Casbene synthase, chloroplast precursor            101   3e-37   Ricinus communis
gb|AIC76495.1|  terpene synthase                                        109   3e-37   
gb|ADR74194.1|  (E)-beta-caryophyllene synthase                       93.2    4e-37   
gb|AEM23825.1|  sesquiterpene synthase                                97.8    4e-37   
ref|XP_006476905.1|  PREDICTED: (-)-germacrene D synthase-like          100   4e-37   
gb|KDO69460.1|  hypothetical protein CISIN_1g044370mg                   100   5e-37   
ref|XP_008371257.1|  PREDICTED: (-)-germacrene D synthase-like is...    103   5e-37   
gb|KHG01539.1|  delta-cadinene synthase isozyme XC1                   95.1    5e-37   
ref|XP_009591578.1|  PREDICTED: (-)-germacrene D synthase-like        93.2    6e-37   
ref|XP_008371258.1|  PREDICTED: (-)-germacrene D synthase-like is...    103   6e-37   
ref|XP_006367945.1|  PREDICTED: germacrene C synthase-like              100   6e-37   
gb|ACJ46048.1|  sesquiterpene synthase                                99.0    8e-37   Warburgia ugandensis
emb|CAN69555.1|  hypothetical protein VITISV_013102                   94.7    8e-37   Vitis vinifera
gb|AAD02223.1|  vetispiradiene synthase                                 146   9e-37   Solanum tuberosum [potatoes]
ref|NP_001275171.1|  putative vetispiradiene synthase 5                 146   9e-37   
ref|XP_006475309.1|  PREDICTED: germacrene-D synthase-like            97.8    9e-37   
ref|XP_009346480.1|  PREDICTED: (-)-alpha-pinene synthase-like        97.4    1e-36   
ref|XP_010092286.1|  (-)-germacrene D synthase                          100   1e-36   
emb|CBI31266.3|  unnamed protein product                              94.7    1e-36   
ref|XP_010683547.1|  PREDICTED: probable terpene synthase 6 isofo...  99.4    1e-36   
ref|XP_009349849.1|  PREDICTED: (-)-germacrene D synthase-like          101   1e-36   
ref|XP_008347229.1|  PREDICTED: (-)-germacrene D synthase-like          100   1e-36   
ref|XP_007021123.1|  Delta-cadinene synthase isozyme A                94.7    1e-36   
ref|XP_010683546.1|  PREDICTED: (-)-germacrene D synthase-like is...  99.4    2e-36   
gb|KDP46456.1|  hypothetical protein JCGZ_12939                       92.8    2e-36   
gb|EYU31458.1|  hypothetical protein MIMGU_mgv1a004009mg                100   2e-36   
emb|CDP10867.1|  unnamed protein product                              93.6    2e-36   
ref|XP_010694308.1|  PREDICTED: (-)-germacrene D synthase-like          103   3e-36   
ref|XP_006475307.1|  PREDICTED: (E)-beta-farnesene synthase-like ...  94.7    3e-36   
ref|XP_010313902.1|  PREDICTED: vetispiradiene synthase 1 isoform X2    145   3e-36   
ref|XP_010248057.1|  PREDICTED: probable terpene synthase 2           90.1    4e-36   
ref|XP_004230358.1|  PREDICTED: vetispiradiene synthase 1 isoform X1    144   4e-36   
ref|XP_004288818.1|  PREDICTED: (-)-germacrene D synthase-like          104   4e-36   
gb|AAG41892.1|AF279456_1  sesquiterpene synthase 2                    96.7    5e-36   Solanum habrochaites
gb|AGB14624.1|  beta-caryophyllene synthase                             100   5e-36   
sp|Q6Q3H2.1|TPSVS_VITVI  RecName: Full=Valencene synthase; Short=...  89.7    5e-36   Vitis vinifera
gb|EYU32628.1|  hypothetical protein MIMGU_mgv1a005108mg                112   5e-36   
ref|NP_001268215.1|  valencene synthase                               89.7    5e-36   
ref|XP_006492721.1|  PREDICTED: casbene synthase, chloroplastic-like    100   6e-36   
ref|XP_010092292.1|  (-)-germacrene D synthase                        95.5    6e-36   
ref|XP_011080426.1|  PREDICTED: gamma-cadinene synthase-like          99.8    7e-36   
gb|AEM23826.1|  sesquiterpene synthase                                  100   9e-36   
emb|CBI31313.3|  unnamed protein product                              92.4    9e-36   
gb|KDP42347.1|  hypothetical protein JCGZ_02820                       92.4    9e-36   
ref|XP_009334624.1|  PREDICTED: (-)-germacrene D synthase-like          103   1e-35   
gb|AAX16121.1|  germacrene-D synthase                                 96.3    1e-35   Actinidia deliciosa [Chinese gooseberry]
gb|KDP46452.1|  hypothetical protein JCGZ_12935                       93.2    1e-35   
sp|P93665.1|DCS1_GOSHI  RecName: Full=(+)-delta-cadinene synthase...  95.1    1e-35   Gossypium hirsutum [American cotton]
gb|AGN72803.1|  germacrene A                                            107   1e-35   
ref|XP_011002270.1|  PREDICTED: probable terpene synthase 6           95.1    1e-35   
gb|KDP36230.1|  hypothetical protein JCGZ_09950                       90.1    1e-35   
ref|XP_004302393.1|  PREDICTED: (-)-alpha-pinene synthase-like          103   1e-35   
gb|ACJ46047.1|  sesquiterpene synthase                                99.4    2e-35   Warburgia ugandensis
gb|AIM47562.1|  casbene synthase 1                                    90.9    3e-35   
dbj|BAM34474.1|  casbene synthase                                     90.9    3e-35   
ref|XP_010645939.1|  PREDICTED: valencene synthase-like               89.7    3e-35   
gb|AHF22834.1|  drimenol synthase                                       108   3e-35   
ref|XP_011080334.1|  PREDICTED: gamma-cadinene synthase-like          99.8    3e-35   
emb|CBI31315.3|  unnamed protein product                              98.2    3e-35   
emb|CBI31312.3|  unnamed protein product                              89.7    3e-35   
ref|XP_004309077.1|  PREDICTED: (-)-germacrene D synthase-like        95.1    4e-35   
dbj|BAJ53221.1|  JHL17M24.6                                           90.5    4e-35   
ref|XP_006367763.1|  PREDICTED: germacrene C synthase-like              101   5e-35   
ref|XP_006494712.1|  PREDICTED: (-)-germacrene D synthase-like is...  96.7    6e-35   
gb|KDO38267.1|  hypothetical protein CISIN_1g008206mg                 96.3    6e-35   
ref|XP_006494713.1|  PREDICTED: (-)-germacrene D synthase-like is...  97.1    6e-35   
ref|XP_008366140.1|  PREDICTED: putative pinene synthase              94.0    7e-35   
gb|KDO38265.1|  hypothetical protein CISIN_1g008206mg                 96.7    7e-35   
gb|KDO38268.1|  hypothetical protein CISIN_1g008206mg                 95.9    7e-35   
gb|KDO38266.1|  hypothetical protein CISIN_1g008206mg                 96.3    7e-35   
emb|CBI31305.3|  unnamed protein product                              88.2    8e-35   
gb|KDO38264.1|  hypothetical protein CISIN_1g008206mg                 96.3    9e-35   
ref|NP_001268024.1|  valencene synthase-like                          87.8    9e-35   
gb|AAG09950.1|AF171218_1  vetispiradiene synthase                       126   9e-35   Solanum lycopersicum
gb|KDO38263.1|  hypothetical protein CISIN_1g008206mg                 96.3    9e-35   
emb|CBI31310.3|  unnamed protein product                              90.5    9e-35   
ref|XP_011080335.1|  PREDICTED: gamma-cadinene synthase-like          97.1    1e-34   
ref|XP_004294317.1|  PREDICTED: (-)-germacrene D synthase-like        92.4    1e-34   
gb|EYU31464.1|  hypothetical protein MIMGU_mgv1a003909mg              95.9    1e-34   
ref|XP_002523635.1|  (+)-delta-cadinene synthase isozyme A, putative  92.4    1e-34   Ricinus communis
ref|XP_006367561.1|  PREDICTED: germacrene C synthase-like              103   1e-34   
ref|XP_007099764.1|  Terpene synthase 21, putative                    92.0    1e-34   
gb|ADR74199.1|  gamma-cadinene synthase                               89.7    1e-34   
ref|XP_007022718.1|  Terpene synthase 21, putative                    91.7    2e-34   
gb|KDP31577.1|  hypothetical protein JCGZ_14802                       97.8    2e-34   
gb|AAG01339.1|  terpene synthase                                      88.2    2e-34   Citrus junos [kuzu]
gb|AGN72806.1|  germacrene A                                            107   2e-34   
emb|CAN71873.1|  hypothetical protein VITISV_002877                   89.7    2e-34   Vitis vinifera
ref|XP_002519897.1|  Casbene synthase, chloroplast precursor, put...  87.4    2e-34   Ricinus communis
ref|XP_008366777.1|  PREDICTED: LOW QUALITY PROTEIN: (-)-germacre...  90.9    2e-34   
ref|XP_010062945.1|  PREDICTED: (-)-germacrene D synthase-like        88.6    2e-34   
emb|CBI31280.3|  unnamed protein product                              88.6    2e-34   
ref|XP_008226805.1|  PREDICTED: (-)-alpha-pinene synthase-like        88.6    3e-34   
ref|XP_003541032.1|  PREDICTED: probable terpene synthase 2-like      91.3    3e-34   
ref|XP_010645872.1|  PREDICTED: LOW QUALITY PROTEIN: valencene sy...  89.0    3e-34   
sp|E2E2N7.1|BCGS_ORIVU  RecName: Full=Bicyclogermacrene synthase;...  93.6    3e-34   
gb|AAX44034.1|  (+)-delta-cadinene synthase                           93.6    3e-34   Gossypium hirsutum [American cotton]
ref|XP_007021065.1|  Delta-cadinene synthase isozyme A                94.7    4e-34   
dbj|BAJ53213.1|  JHL23C09.9                                           92.0    5e-34   
gb|AAG17667.1|AF272244_1  5-epi-aristolochene synthase                  127   6e-34   Nicotiana tabacum [American tobacco]
ref|XP_010066141.1|  PREDICTED: (-)-germacrene D synthase-like        89.4    7e-34   
gb|KDP39015.1|  hypothetical protein JCGZ_00772                       89.7    7e-34   
ref|XP_002513369.1|  Casbene synthase, chloroplast precursor, put...  89.7    7e-34   Ricinus communis
gb|ADR71055.1|  Tps2-1                                                86.7    7e-34   
gb|KDP31579.1|  hypothetical protein JCGZ_14804                       96.3    7e-34   
gb|KDO46373.1|  hypothetical protein CISIN_1g024780mg                 87.4    8e-34   
emb|CDP12282.1|  unnamed protein product                              90.9    9e-34   
ref|XP_009342460.1|  PREDICTED: (-)-alpha-pinene synthase-like        87.0    9e-34   
ref|XP_002310639.2|  hypothetical protein POPTR_0007s07360g           90.9    1e-33   Populus trichocarpa [western balsam poplar]
gb|AIK19228.1|  sesquiterpene synthase                                87.0    1e-33   
gb|EYU21954.1|  hypothetical protein MIMGU_mgv1a023164mg              89.7    1e-33   
ref|XP_006380499.1|  hypothetical protein POPTR_0007s07410g           90.9    1e-33   
gb|KCW70094.1|  hypothetical protein EUGRSUZ_F03400                   88.6    1e-33   
ref|XP_006477783.1|  PREDICTED: (-)-germacrene D synthase-like        86.3    1e-33   
gb|AGX84976.1|  terpene synthase                                        100   2e-33   
ref|XP_002275351.1|  PREDICTED: valencene synthase                    89.4    2e-33   Vitis vinifera
ref|XP_008226801.1|  PREDICTED: (-)-alpha-pinene synthase-like        85.5    2e-33   
ref|XP_002306399.2|  hypothetical protein POPTR_0005s09830g             100   2e-33   Populus trichocarpa [western balsam poplar]
ref|XP_011022083.1|  PREDICTED: probable terpene synthase 3           99.4    2e-33   
ref|XP_008366487.1|  PREDICTED: (-)-alpha-pinene synthase-like        85.9    3e-33   
ref|XP_006477789.1|  PREDICTED: (E)-beta-farnesene synthase-like      86.3    3e-33   
sp|B3TPQ6.1|BCUSY_MAGGA  RecName: Full=Beta-cubebene synthase; Sh...  86.3    3e-33   Magnolia grandiflora [southern magnolia]
gb|AII32472.1|  terpene synthase                                      89.4    3e-33   
gb|KHG04103.1|  (-)-germacrene D synthase                             93.2    3e-33   
gb|KCW44806.1|  hypothetical protein EUGRSUZ_L01631                   87.0    3e-33   
ref|XP_002282488.1|  PREDICTED: (-)-germacrene D synthase             89.4    4e-33   Vitis vinifera
ref|XP_010055485.1|  PREDICTED: (-)-germacrene D synthase-like        92.8    4e-33   
ref|NP_001274950.1|  putative vetispiradiene synthase 3                 136   4e-33   
gb|KCW76745.1|  hypothetical protein EUGRSUZ_D01100                   87.4    4e-33   
emb|CAN81129.1|  hypothetical protein VITISV_002911                   89.4    4e-33   Vitis vinifera
ref|NP_001267972.1|  valencene synthase-like                          84.7    4e-33   
emb|CAN66799.1|  hypothetical protein VITISV_037341                   90.1    5e-33   
gb|KCW71959.1|  hypothetical protein EUGRSUZ_E00414                   92.8    5e-33   
emb|CBI31291.3|  unnamed protein product                              84.7    5e-33   
ref|XP_004230360.1|  PREDICTED: vetispiradiene synthase 1               135   5e-33   
gb|AAG09949.1|AF171216_1  vetispiradiene synthase                       135   6e-33   
gb|AFQ23183.1|  sesquiterpene synthase                                93.2    6e-33   
ref|XP_009794478.1|  PREDICTED: germacrene C synthase-like            91.7    6e-33   
ref|XP_006371215.1|  hypothetical protein POPTR_0019s06170g           92.8    7e-33   
ref|XP_008371259.1|  PREDICTED: (-)-germacrene D synthase-like is...    103   8e-33   
ref|XP_010027310.1|  PREDICTED: (-)-germacrene D synthase-like        91.7    8e-33   
gb|AAK95517.1|AF401234_1  cyclase                                     95.5    9e-33   
ref|NP_001289541.1|  germacrene C synthase-like                       95.5    9e-33   
ref|NP_001289542.1|  germacrene C synthase-like                       95.5    1e-32   
gb|AII32469.1|  terpene synthase                                      98.2    1e-32   
gb|KHG21495.1|  (+)-delta-cadinene synthase isozyme A                 93.6    1e-32   
gb|AAS46038.1|  cyclase                                               95.1    1e-32   
ref|XP_010055474.1|  PREDICTED: (-)-germacrene D synthase-like        92.8    1e-32   
gb|KDO83772.1|  hypothetical protein CISIN_1g035568mg                 89.4    1e-32   
gb|AGW18160.1|  terpene synthase 3                                    84.3    1e-32   
ref|XP_009793508.1|  PREDICTED: germacrene C synthase-like isofor...  95.1    1e-32   
ref|XP_010055490.1|  PREDICTED: (-)-germacrene D synthase-like        92.8    1e-32   
ref|XP_006365934.1|  PREDICTED: germacrene C synthase-like            99.4    1e-32   
emb|CDP12281.1|  unnamed protein product                              88.2    1e-32   
gb|KCW71948.1|  hypothetical protein EUGRSUZ_E00404                   92.8    1e-32   
gb|AIK19227.1|  sesquiterpene synthase                                86.7    1e-32   
gb|KDO38269.1|  hypothetical protein CISIN_1g008206mg                 96.7    2e-32   
gb|KDO74415.1|  hypothetical protein CISIN_1g0436492mg                84.0    2e-32   
gb|KCW71947.1|  hypothetical protein EUGRSUZ_E00404                   92.4    2e-32   
gb|AEP82784.1|  terpene synthase                                      87.4    2e-32   
ref|XP_009793510.1|  PREDICTED: germacrene C synthase-like isofor...  94.7    2e-32   
ref|NP_001275785.1|  valencene synthase                               84.0    2e-32   
emb|CBI20287.3|  unnamed protein product                              93.6    2e-32   
ref|NP_001275083.1|  uncharacterized protein LOC102595695               134   2e-32   
ref|XP_006358528.1|  PREDICTED: vetispiradiene synthase 1-like          134   2e-32   
ref|XP_010644187.1|  PREDICTED: (-)-germacrene D synthase-like        93.6    2e-32   
gb|AIK19226.1|  sesquiterpene synthase                                90.1    2e-32   
ref|XP_008226803.1|  PREDICTED: (-)-alpha-pinene synthase-like        83.6    2e-32   
ref|XP_009623875.1|  PREDICTED: (-)-germacrene D synthase-like        84.7    2e-32   
ref|XP_009342276.1|  PREDICTED: probable terpene synthase 9           94.4    2e-32   
gb|KDO41091.1|  hypothetical protein CISIN_1g008817mg                 87.8    3e-32   
ref|XP_006475314.1|  PREDICTED: (E)-beta-farnesene synthase-like      88.2    3e-32   
gb|AGW18154.1|  terpene synthase 1                                    89.7    3e-32   
gb|AAQ04608.1|AF441124_1  valencene synthase                          84.0    3e-32   
gb|AAK15641.1|AF326117_1  sesquiterpene cyclase                         133   3e-32   
gb|ACI32639.1|  STS1                                                  84.7    4e-32   
emb|CDP12283.1|  unnamed protein product                              88.6    4e-32   
gb|AGN70884.1|  casbene synthase                                      84.0    4e-32   
ref|XP_009355684.1|  PREDICTED: (-)-alpha-pinene synthase-like        85.1    4e-32   
ref|XP_010557841.1|  PREDICTED: alpha-humulene/(-)-(E)-beta-caryo...  83.6    5e-32   
ref|XP_011003226.1|  PREDICTED: probable terpene synthase 9 isofo...  89.4    5e-32   
gb|KDO45658.1|  hypothetical protein CISIN_1g039366mg                 88.2    5e-32   
ref|XP_011003225.1|  PREDICTED: probable terpene synthase 9 isofo...  89.4    6e-32   
ref|XP_010045915.1|  PREDICTED: (-)-germacrene D synthase-like        90.5    7e-32   
ref|XP_008386098.1|  PREDICTED: (-)-alpha-pinene synthase-like        84.3    7e-32   
ref|NP_001281061.1|  (-)-alpha-pinene synthase-like                   85.5    7e-32   
emb|CBI20174.3|  unnamed protein product                              87.8    7e-32   
ref|NP_001268015.1|  (-)-germacrene D synthase-like                   87.8    7e-32   
sp|Q9XJ32.1|VTSS1_SOLTU  RecName: Full=Vetispiradiene synthase 1        132   7e-32   
gb|EYU24138.1|  hypothetical protein MIMGU_mgv1a007300mg              85.1    8e-32   
ref|XP_010678545.1|  PREDICTED: probable sesquiterpene synthase       87.4    8e-32   
gb|KCW62136.1|  hypothetical protein EUGRSUZ_H04797                   92.0    8e-32   
ref|XP_009349778.1|  PREDICTED: (-)-alpha-pinene synthase-like        84.3    9e-32   
ref|XP_002283344.1|  PREDICTED: (-)-germacrene D synthase             91.3    9e-32   
sp|Q94JS8.1|FARS_CITJU  RecName: Full=(E)-beta-farnesene synthase...  87.4    1e-31   
gb|KCW44753.1|  hypothetical protein EUGRSUZ_L01686                   88.6    1e-31   
ref|XP_006493820.1|  PREDICTED: (E)-beta-farnesene synthase-like      87.8    1e-31   
ref|XP_008374195.1|  PREDICTED: (-)-alpha-pinene synthase-like        84.7    1e-31   
ref|XP_010040951.1|  PREDICTED: (-)-germacrene D synthase-like        88.2    1e-31   
gb|AGW18156.1|  terpene synthase 3                                    84.0    1e-31   
ref|NP_001234481.1|  sesquiterpene synthase 1                         85.5    1e-31   
gb|AAD02268.1|  putative vetispiradiene synthase 3                      132   1e-31   
ref|XP_008353529.1|  PREDICTED: probable terpene synthase 9           89.7    1e-31   
emb|CAN62603.1|  hypothetical protein VITISV_009665                   87.0    1e-31   
ref|NP_001234060.1|  germacrene C synthase                            85.1    1e-31   
gb|AAG41890.1|AF279454_1  sesquiterpene synthase 2                    85.1    1e-31   
gb|AAM00426.1|AF411120_1  putative terpene synthase                   83.2    1e-31   
ref|XP_008226807.1|  PREDICTED: (-)-alpha-pinene synthase-like        84.0    1e-31   
gb|AGL98420.1|  germacrene-D synthase                                 86.7    1e-31   
ref|XP_008362251.1|  PREDICTED: probable terpene synthase 9           89.7    1e-31   
dbj|BAP74389.1|  delta-elemene synthase                               96.3    1e-31   
ref|XP_011030746.1|  PREDICTED: (-)-germacrene D synthase-like is...  86.3    1e-31   
gb|ADJ67476.1|  (E)-beta-farnesene synthase                           87.4    2e-31   
ref|XP_004298302.1|  PREDICTED: (-)-germacrene D synthase-like        94.7    2e-31   
emb|CDP12296.1|  unnamed protein product                              89.4    2e-31   
gb|AIC76497.1|  terpene synthase                                      82.8    2e-31   
gb|KDO52415.1|  hypothetical protein CISIN_1g008620mg                 92.4    2e-31   
ref|XP_010055487.1|  PREDICTED: (-)-germacrene D synthase-like        88.6    2e-31   
ref|XP_006478794.1|  PREDICTED: (-)-germacrene D synthase-like is...  92.4    2e-31   
gb|KDP25759.1|  hypothetical protein JCGZ_23929                       90.9    3e-31   
ref|XP_002274445.2|  PREDICTED: valencene synthase-like               88.2    3e-31   
gb|KCW71961.1|  hypothetical protein EUGRSUZ_E00415                   88.6    3e-31   
ref|XP_006478792.1|  PREDICTED: (-)-germacrene D synthase-like        91.3    3e-31   
gb|AEM23828.1|  sesquiterpene synthase                                86.3    3e-31   
ref|XP_008230161.1|  PREDICTED: probable terpene synthase 9           84.3    3e-31   
ref|XP_006475310.1|  PREDICTED: (-)-germacrene D synthase-like        85.5    3e-31   
ref|XP_010041348.1|  PREDICTED: (-)-germacrene D synthase-like        90.1    4e-31   
ref|XP_010040899.1|  PREDICTED: (-)-germacrene D synthase-like        87.4    4e-31   
ref|XP_007021122.1|  Delta-cadinene synthase isozyme A, putative      86.7    4e-31   
emb|CAR92134.1|  5-epi-aristolochene synthase                           126   4e-31   
ref|XP_010062946.1|  PREDICTED: (-)-germacrene D synthase-like        82.8    5e-31   
ref|XP_006371218.1|  hypothetical protein POPTR_0019s06210g           93.2    5e-31   
ref|XP_009762843.1|  PREDICTED: 5-epi-aristolochene synthase-like       123   5e-31   
ref|XP_009766331.1|  PREDICTED: 5-epi-aristolochene synthase 2-like     129   5e-31   
ref|NP_001289493.1|  germacrene C synthase-like                       92.4    5e-31   
ref|XP_011095786.1|  PREDICTED: germacrene-D synthase-like            92.8    5e-31   
emb|CBI31290.3|  unnamed protein product                              87.4    6e-31   
sp|J9R5V4.1|TPS2_VALOF  RecName: Full=Valerena-4,7(11)-diene synt...  86.7    6e-31   
ref|XP_009599829.1|  PREDICTED: 5-epi-aristolochene synthase 3-like     129   6e-31   
gb|KCW44424.1|  hypothetical protein EUGRSUZ_L02082                   89.7    7e-31   
ref|XP_010054518.1|  PREDICTED: (-)-germacrene D synthase-like        84.7    7e-31   
gb|KHN47556.1|  (-)-germacrene D synthase                             81.6    7e-31   
ref|XP_006475228.1|  PREDICTED: (E)-beta-farnesene synthase-like ...  84.7    8e-31   
ref|XP_010545918.1|  PREDICTED: alpha-humulene/(-)-(E)-beta-caryo...  82.0    8e-31   
gb|KCW76750.1|  hypothetical protein EUGRSUZ_D01105                   84.3    8e-31   
ref|XP_006851183.1|  hypothetical protein AMTR_s00043p00183580        87.0    8e-31   
ref|XP_006475226.1|  PREDICTED: (E)-beta-farnesene synthase-like ...  84.7    9e-31   
ref|XP_004289147.1|  PREDICTED: alpha-terpineol synthase, chlorop...  82.0    1e-30   
gb|AAC31570.2|  sesquiterpene synthase                                90.1    1e-30   
ref|XP_011030745.1|  PREDICTED: (-)-germacrene D synthase-like is...  86.3    1e-30   
gb|KDO81470.1|  hypothetical protein CISIN_1g041642mg                 88.6    1e-30   
gb|AAU05952.1|  beta-caryophyllene synthase                           85.5    1e-30   
gb|ADB90274.1|  putative casbene synthase                             88.2    1e-30   
ref|XP_008226800.1|  PREDICTED: (-)-alpha-pinene synthase-like        80.9    1e-30   
gb|ADC92564.1|  (E)-beta farnesene synthase                           87.8    1e-30   
gb|AGB05616.1|  sesquiterpene synthase 7                              84.7    1e-30   
ref|XP_006472987.1|  PREDICTED: (-)-germacrene D synthase-like        88.2    1e-30   
ref|XP_006356724.1|  PREDICTED: (E,E)-germacrene B synthase-like      94.0    1e-30   
gb|AAL25826.1|  cyclase                                               92.0    1e-30   
sp|J9RLZ7.1|TPS1_VALOF  RecName: Full=Germacrene C/D synthase; Al...  84.7    1e-30   
ref|XP_004287914.1|  PREDICTED: (-)-alpha-terpineol synthase-like     81.3    2e-30   
ref|XP_008245781.1|  PREDICTED: (-)-alpha-pinene synthase-like        84.7    2e-30   
ref|XP_007021067.1|  Delta-cadinene synthase isozyme A, putative      92.8    2e-30   
ref|XP_007021066.1|  Delta-cadinene synthase isozyme A, putative      92.8    2e-30   
ref|XP_008230162.1|  PREDICTED: probable terpene synthase 9           81.6    2e-30   
gb|AGB05610.1|  sesquiterpene synthase 1                              86.7    2e-30   
ref|XP_009609204.1|  PREDICTED: LOW QUALITY PROTEIN: germacrene C...  87.0    2e-30   
ref|XP_007217528.1|  hypothetical protein PRUPE_ppa023532mg           80.5    2e-30   
ref|XP_002309850.2|  hypothetical protein POPTR_0007s02810g           87.4    2e-30   
gb|ADX01382.1|  limonene synthase                                     84.7    2e-30   
ref|XP_006380496.1|  hypothetical protein POPTR_0007s07370g           80.5    3e-30   
gb|ACI32640.1|  STS2                                                  81.3    3e-30   
gb|AFN57631.1|  sesquiterpene synthase                                81.6    3e-30   
gb|KCW76749.1|  hypothetical protein EUGRSUZ_D01104                   88.2    3e-30   
gb|AEI52904.1|  terpene synthase 4                                    88.2    3e-30   
ref|XP_003596557.1|  (+)-delta-cadinene synthase isozyme C2           84.7    3e-30   
sp|Q8SA63.1|CARS_ARTAN  RecName: Full=Beta-caryophyllene synthase     84.0    4e-30   
ref|XP_009350682.1|  PREDICTED: probable terpene synthase 9           88.2    4e-30   
ref|XP_010908676.1|  PREDICTED: alpha-humulene synthase-like          90.1    4e-30   
gb|KEH17940.1|  terpene synthase family, metal-binding domain pro...  82.8    4e-30   
ref|NP_001239041.1|  sesquiterpene synthase                           84.3    4e-30   
gb|KCW70103.1|  hypothetical protein EUGRSUZ_F03413                   90.9    4e-30   
gb|KDP27294.1|  hypothetical protein JCGZ_20282                       87.0    5e-30   
ref|XP_002523475.1|  (+)-delta-cadinene synthase isozyme A, putative  89.4    5e-30   
gb|AIW00681.1|  a-bisabolol synthase                                  87.0    5e-30   
sp|Q49SP7.1|TPSCS_POGCB  RecName: Full=Gamma-curcumene synthase; ...  82.4    6e-30   
gb|AAK15642.1|AF326118_1  sesquiterpene cyclase                         100   6e-30   
gb|AAV36467.1|  wound-inducible putative cytosolic terpene syntha...  85.5    6e-30   
ref|XP_010910695.1|  PREDICTED: alpha-humulene synthase-like          83.6    6e-30   
gb|KEH26009.1|  sesquiterpene synthase                                85.1    6e-30   
ref|XP_010417166.1|  PREDICTED: tricyclene synthase, chloroplasti...  80.5    7e-30   
ref|XP_007028200.1|  Delta-cadinene synthase isozyme A, putative      81.6    7e-30   
ref|XP_010686114.1|  PREDICTED: probable terpene synthase 2           85.1    7e-30   
gb|KEH28961.1|  terpene synthase family, metal-binding domain pro...  85.5    7e-30   
ref|XP_010905142.1|  PREDICTED: alpha-humulene synthase-like isof...  88.6    7e-30   
ref|XP_007132996.1|  hypothetical protein PHAVU_011G142500g           81.3    8e-30   
ref|XP_010905141.1|  PREDICTED: alpha-humulene synthase-like isof...  88.6    8e-30   
gb|AIG92846.1|  sesquiterpene synthase 1                              86.3    8e-30   
ref|XP_006370591.1|  hypothetical protein POPTR_0001s44080g           79.3    9e-30   
gb|KGN56189.1|  hypothetical protein Csa_3G097040                     82.4    9e-30   
ref|XP_011090538.1|  PREDICTED: germacrene-D synthase-like            83.6    9e-30   
gb|AEI52901.1|  terpene synthase 1                                    79.3    9e-30   
ref|XP_006370590.1|  hypothetical protein POPTR_0001s44080g           79.3    9e-30   
ref|XP_006370594.1|  hypothetical protein POPTR_0001s44080g           79.3    1e-29   
gb|AGB05614.1|  sesquiterpene synthase 5                              83.2    1e-29   
dbj|BAP75561.1|  linalool synthase                                    79.7    1e-29   
gb|AGR40502.1|  caryophyllene synthase                                80.9    1e-29   
gb|EYU19193.1|  hypothetical protein MIMGU_mgv1a018094mg              79.7    1e-29   
gb|KDP37851.1|  hypothetical protein JCGZ_06358                       81.3    1e-29   
gb|AIC76493.1|  linalool/nerolidol synthase                           79.7    1e-29   
ref|XP_006351729.1|  PREDICTED: (-)-camphene/tricyclene synthase,...  79.0    1e-29   
ref|XP_006370593.1|  hypothetical protein POPTR_0001s44080g           79.3    1e-29   
gb|KHG27356.1|  delta-cadinene synthase isozyme XC14                  85.9    1e-29   
ref|XP_007133004.1|  hypothetical protein PHAVU_011G143100g           87.0    1e-29   
ref|XP_007133003.1|  hypothetical protein PHAVU_011G143100g           87.0    1e-29   
ref|XP_010927648.1|  PREDICTED: alpha-humulene synthase-like          82.4    2e-29   
ref|XP_007132999.1|  hypothetical protein PHAVU_011G142700g           79.0    2e-29   
gb|AAM11626.1|AF489964_1  germacrene A synthase LTC1                  82.0    2e-29   
ref|XP_006293874.1|  hypothetical protein CARUB_v10022869mg           85.5    2e-29   
gb|KCW63955.1|  hypothetical protein EUGRSUZ_G01636                   89.4    2e-29   
gb|AEQ27767.1|  sesquiterpene synthase                                84.7    2e-29   
ref|XP_006475284.1|  PREDICTED: (-)-germacrene D synthase-like        79.0    2e-29   
ref|XP_006475315.1|  PREDICTED: (E)-beta-farnesene synthase-like      87.8    2e-29   
ref|XP_008452330.1|  PREDICTED: (+)-gamma-cadinene synthase-like      84.3    2e-29   
ref|XP_004514757.1|  PREDICTED: (-)-germacrene D synthase-like        83.6    2e-29   
gb|AIC76500.1|  terpene synthase                                      82.8    2e-29   
sp|Q5SBP5.1|GCS1_OCIBA  RecName: Full=Gamma-cadinene synthase; Al...  89.0    2e-29   
ref|XP_006358783.1|  PREDICTED: germacrene C synthase-like            94.0    2e-29   
ref|XP_010064928.1|  PREDICTED: (-)-germacrene D synthase-like        88.6    2e-29   
gb|KDP35321.1|  hypothetical protein JCGZ_09480                       88.2    2e-29   
ref|XP_010546417.1|  PREDICTED: alpha-humulene/(-)-(E)-beta-caryo...  80.9    2e-29   
sp|B9SBU9.2|TPS5_RICCO  RecName: Full=Terpene synthase 5; Short=R...  84.7    2e-29   
ref|XP_010098604.1|  (-)-germacrene D synthase                        85.1    2e-29   
ref|XP_009803139.1|  PREDICTED: germacrene C synthase-like isofor...  95.5    2e-29   
ref|XP_010545503.1|  PREDICTED: (E)-beta-ocimene synthase, chloro...  80.1    2e-29   
ref|XP_004516888.1|  PREDICTED: (-)-germacrene D synthase-like        81.6    3e-29   
ref|XP_007022420.1|  Terpene synthase 21, putative                    85.9    3e-29   
ref|XP_004490338.1|  PREDICTED: (-)-germacrene D synthase-like        84.3    3e-29   
ref|XP_010545915.1|  PREDICTED: alpha-humulene/(-)-(E)-beta-caryo...  79.3    3e-29   
ref|XP_006365871.1|  PREDICTED: (-)-alpha-terpineol synthase-like     83.6    3e-29   
ref|XP_006475313.1|  PREDICTED: (E)-beta-farnesene synthase-like      81.3    4e-29   
ref|XP_004242295.1|  PREDICTED: germacrene C synthase-like            87.4    4e-29   
ref|XP_007133018.1|  hypothetical protein PHAVU_011G144200g           90.1    4e-29   
ref|XP_009759560.1|  PREDICTED: 5-epi-aristolochene synthase-like       122   4e-29   
ref|XP_008244326.1|  PREDICTED: (-)-germacrene D synthase-like        85.1    4e-29   
emb|CAC36896.1|  germacrene A synthase                                78.6    4e-29   
gb|AEP82781.1|  TPS16                                                 85.9    4e-29   
gb|AIW00680.1|  sesquiterpene cyclase                                 78.6    4e-29   
ref|XP_010061274.1|  PREDICTED: (-)-germacrene D synthase-like        78.2    4e-29   
gb|AJD19682.1|  sesquiterpene synthase Tps1                           83.6    5e-29   
ref|XP_007133009.1|  hypothetical protein PHAVU_011G143500g           89.7    5e-29   
ref|NP_001239042.1|  sesquiterpene synthase                           85.9    5e-29   



>sp|Q84LF1.1|5EAS1_NICAT RecName: Full=5-epi-aristolochene synthase 1; Short=NaEAS34 [Nicotiana 
attenuata]
 gb|AAP05761.1|AF484124_1 5-epi-aristolochene synthase 34 [Nicotiana attenuata]
Length=548

 Score =   141 bits (355),  Expect(2) = 9e-65, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 93/131 (71%), Gaps = 5/131 (4%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSD  239
            N+E  + RPV +F P+LW  + F +FSIDNQVAE YA+EIE LKEQTR ++L+ TG    
Sbjct  8    NYEEEIVRPVADFSPSLWGDH-FLSFSIDNQVAEKYAQEIEPLKEQTR-SMLLATGR---  62

Query  240  DVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNIS  419
             +A  L  ID +ERLGI+Y+FEKEID+ L HIY    + ND  T ALQFRL+RQHG+NIS
Sbjct  63   KLADTLNLIDTIERLGISYYFEKEIDEILDHIYNQNSNCNDFCTSALQFRLLRQHGFNIS  122

Query  420  THIFSNFVDGN  452
              IFS F D N
Sbjct  123  PQIFSKFQDEN  133


 Score =   134 bits (336),  Expect(2) = 9e-65, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 91/119 (76%), Gaps = 8/119 (7%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KFR+S  SDV GLL+LYEAS+VRT +DD +LE   AF+   L SAAP+LK  S L + VT
Sbjct  135  KFRESLASDVLGLLNLYEASHVRTHADD-ILEDALAFSTIHLESAAPHLK--SPLREQVT  191

Query  629  HALDQPFHTGLPRVEHRFFIS-VYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+Q  H G+PRVE RFFIS +Y  E E S+NN LLRFA LDFNLLQMLHKQEL+EVS
Sbjct  192  HALEQCLHKGVPRVETRFFISSIY--EKEQSKNNVLLRFAKLDFNLLQMLHKQELAEVS  248



>pdb|1HX9|A Chain A, Crystal Structure Of Teas W273s Form 1
 pdb|1HXA|A Chain A, Crystal Structure Of Teas W273s Form 2
Length=548

 Score =   145 bits (365),  Expect(2) = 9e-65, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 91/131 (69%), Gaps = 5/131 (4%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSD  239
            N+E  + RPV +F P+LW    F +FSIDNQVAE YAKEIE LKEQTR  +L+ TG    
Sbjct  8    NYEEEIVRPVADFSPSLWGDQ-FLSFSIDNQVAEKYAKEIEALKEQTR-NMLLATGM---  62

Query  240  DVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNIS  419
             +A  L  ID +ERLGI+YHFEKEIDD L  IY    + NDL T ALQFRL+RQHG+NIS
Sbjct  63   KLADTLNLIDTIERLGISYHFEKEIDDILDQIYNQNSNCNDLCTSALQFRLLRQHGFNIS  122

Query  420  THIFSNFVDGN  452
              IFS F D N
Sbjct  123  PEIFSKFQDEN  133


 Score =   130 bits (326),  Expect(2) = 9e-65, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 91/119 (76%), Gaps = 8/119 (7%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  SDV GLL+LYEAS+VRT +DD +LE   AF+   L SAAP+LK  S L + VT
Sbjct  135  KFKESLASDVLGLLNLYEASHVRTHADD-ILEDALAFSTIHLESAAPHLK--SPLREQVT  191

Query  629  HALDQPFHTGLPRVEHRFFIS-VYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+Q  H G+PRVE RFFIS +Y  + E S+NN LLRFA LDFNLLQMLHKQEL++VS
Sbjct  192  HALEQCLHKGVPRVETRFFISSIY--DKEQSKNNVLLRFAKLDFNLLQMLHKQELAQVS  248



>pdb|5EAU|A Chain A, 5-Epi-Aristolochene Synthase From Nicotiana Tabacum
Length=548

 Score =   145 bits (365),  Expect(2) = 9e-65, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 91/131 (69%), Gaps = 5/131 (4%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSD  239
            N+E  + RPV +F P+LW    F +FSIDNQVAE YAKEIE LKEQTR  +L+ TG    
Sbjct  8    NYEEEIVRPVADFSPSLWGDQ-FLSFSIDNQVAEKYAKEIEALKEQTR-NMLLATGM---  62

Query  240  DVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNIS  419
             +A  L  ID +ERLGI+YHFEKEIDD L  IY    + NDL T ALQFRL+RQHG+NIS
Sbjct  63   KLADTLNLIDTIERLGISYHFEKEIDDILDQIYNQNSNCNDLCTSALQFRLLRQHGFNIS  122

Query  420  THIFSNFVDGN  452
              IFS F D N
Sbjct  123  PEIFSKFQDEN  133


 Score =   130 bits (326),  Expect(2) = 9e-65, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 91/119 (76%), Gaps = 8/119 (7%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  SDV GLL+LYEAS+VRT +DD +LE   AF+   L SAAP+LK  S L + VT
Sbjct  135  KFKESLASDVLGLLNLYEASHVRTHADD-ILEDALAFSTIHLESAAPHLK--SPLREQVT  191

Query  629  HALDQPFHTGLPRVEHRFFIS-VYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+Q  H G+PRVE RFFIS +Y  + E S+NN LLRFA LDFNLLQMLHKQEL++VS
Sbjct  192  HALEQCLHKGVPRVETRFFISSIY--DKEQSKNNVLLRFAKLDFNLLQMLHKQELAQVS  248



>pdb|1HXG|A Chain A, Crystal Structure Of Teas W273sC440W
Length=548

 Score =   145 bits (365),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 91/131 (69%), Gaps = 5/131 (4%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSD  239
            N+E  + RPV +F P+LW    F +FSIDNQVAE YAKEIE LKEQTR  +L+ TG    
Sbjct  8    NYEEEIVRPVADFSPSLWGDQ-FLSFSIDNQVAEKYAKEIEALKEQTR-NMLLATGM---  62

Query  240  DVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNIS  419
             +A  L  ID +ERLGI+YHFEKEIDD L  IY    + NDL T ALQFRL+RQHG+NIS
Sbjct  63   KLADTLNLIDTIERLGISYHFEKEIDDILDQIYNQNSNCNDLCTSALQFRLLRQHGFNIS  122

Query  420  THIFSNFVDGN  452
              IFS F D N
Sbjct  123  PEIFSKFQDEN  133


 Score =   130 bits (326),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 91/119 (76%), Gaps = 8/119 (7%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  SDV GLL+LYEAS+VRT +DD +LE   AF+   L SAAP+LK  S L + VT
Sbjct  135  KFKESLASDVLGLLNLYEASHVRTHADD-ILEDALAFSTIHLESAAPHLK--SPLREQVT  191

Query  629  HALDQPFHTGLPRVEHRFFIS-VYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+Q  H G+PRVE RFFIS +Y  + E S+NN LLRFA LDFNLLQMLHKQEL++VS
Sbjct  192  HALEQCLHKGVPRVETRFFISSIY--DKEQSKNNVLLRFAKLDFNLLQMLHKQELAQVS  248



>pdb|1HXC|A Chain A, Crystal Structure Of Teas C440w
Length=548

 Score =   145 bits (365),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 91/131 (69%), Gaps = 5/131 (4%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSD  239
            N+E  + RPV +F P+LW    F +FSIDNQVAE YAKEIE LKEQTR  +L+ TG    
Sbjct  8    NYEEEIVRPVADFSPSLWGDQ-FLSFSIDNQVAEKYAKEIEALKEQTR-NMLLATGM---  62

Query  240  DVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNIS  419
             +A  L  ID +ERLGI+YHFEKEIDD L  IY    + NDL T ALQFRL+RQHG+NIS
Sbjct  63   KLADTLNLIDTIERLGISYHFEKEIDDILDQIYNQNSNCNDLCTSALQFRLLRQHGFNIS  122

Query  420  THIFSNFVDGN  452
              IFS F D N
Sbjct  123  PEIFSKFQDEN  133


 Score =   130 bits (326),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 91/119 (76%), Gaps = 8/119 (7%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  SDV GLL+LYEAS+VRT +DD +LE   AF+   L SAAP+LK  S L + VT
Sbjct  135  KFKESLASDVLGLLNLYEASHVRTHADD-ILEDALAFSTIHLESAAPHLK--SPLREQVT  191

Query  629  HALDQPFHTGLPRVEHRFFIS-VYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+Q  H G+PRVE RFFIS +Y  + E S+NN LLRFA LDFNLLQMLHKQEL++VS
Sbjct  192  HALEQCLHKGVPRVETRFFISSIY--DKEQSKNNVLLRFAKLDFNLLQMLHKQELAQVS  248



>pdb|5EAS|A Chain A, 5-Epi-Aristolochene Synthase From Nicotiana Tabacum
Length=548

 Score =   144 bits (362),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 93/131 (71%), Gaps = 5/131 (4%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSD  239
            N+E  + RPV +F P+LW    F +FSIDNQVAE YA+EIE LKEQTR ++L+ TG    
Sbjct  8    NYEEEIVRPVADFSPSLWGDQ-FLSFSIDNQVAEKYAQEIEALKEQTR-SMLLATGR---  62

Query  240  DVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNIS  419
             +A  L  ID++ERLGI+YHFEKEID+ L  IY    + NDL T ALQFRL+RQHG+NIS
Sbjct  63   KLADTLNLIDIIERLGISYHFEKEIDEILDQIYNQNSNCNDLCTSALQFRLLRQHGFNIS  122

Query  420  THIFSNFVDGN  452
              IFS F D N
Sbjct  123  PEIFSKFQDEN  133


 Score =   130 bits (326),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 91/119 (76%), Gaps = 8/119 (7%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  SDV GLL+LYEAS+VRT +DD +LE   AF+   L SAAP+LK  S L + VT
Sbjct  135  KFKESLASDVLGLLNLYEASHVRTHADD-ILEDALAFSTIHLESAAPHLK--SPLREQVT  191

Query  629  HALDQPFHTGLPRVEHRFFIS-VYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+Q  H G+PRVE RFFIS +Y  + E S+NN LLRFA LDFNLLQMLHKQEL++VS
Sbjct  192  HALEQCLHKGVPRVETRFFISSIY--DKEQSKNNVLLRFAKLDFNLLQMLHKQELAQVS  248



>pdb|5EAT|A Chain A, 5-Epi-Aristolochene Synthase From Nicotiana Tabacum 
With Substrate Analog Farnesyl Hydroxyphosphonate
Length=548

 Score =   144 bits (362),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 93/131 (71%), Gaps = 5/131 (4%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSD  239
            N+E  + RPV +F P+LW    F +FSIDNQVAE YA+EIE LKEQTR ++L+ TG    
Sbjct  8    NYEEEIVRPVADFSPSLWGDQ-FLSFSIDNQVAEKYAQEIEALKEQTR-SMLLATGR---  62

Query  240  DVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNIS  419
             +A  L  ID++ERLGI+YHFEKEID+ L  IY    + NDL T ALQFRL+RQHG+NIS
Sbjct  63   KLADTLNLIDIIERLGISYHFEKEIDEILDQIYNQNSNCNDLCTSALQFRLLRQHGFNIS  122

Query  420  THIFSNFVDGN  452
              IFS F D N
Sbjct  123  PEIFSKFQDEN  133


 Score =   130 bits (326),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 91/119 (76%), Gaps = 8/119 (7%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  SDV GLL+LYEAS+VRT +DD +LE   AF+   L SAAP+LK  S L + VT
Sbjct  135  KFKESLASDVLGLLNLYEASHVRTHADD-ILEDALAFSTIHLESAAPHLK--SPLREQVT  191

Query  629  HALDQPFHTGLPRVEHRFFIS-VYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+Q  H G+PRVE RFFIS +Y  + E S+NN LLRFA LDFNLLQMLHKQEL++VS
Sbjct  192  HALEQCLHKGVPRVETRFFISSIY--DKEQSKNNVLLRFAKLDFNLLQMLHKQELAQVS  248



>gb|AHM10157.1| sesquiterpene synthase [Nicotiana benthamiana]
Length=548

 Score =   143 bits (360),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 93/131 (71%), Gaps = 5/131 (4%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSD  239
            N+E  + RPV +F P+LW    F +FSIDNQVA+ YA+EIE LKEQTR ++L+ TG    
Sbjct  8    NYEEEIVRPVADFSPSLWGDQ-FLSFSIDNQVAQMYAQEIEALKEQTR-SMLLATGR---  62

Query  240  DVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNIS  419
             +A  L  ID++ERLGI+YHFEKEIDD L HI+    + +D  T ALQFRL+RQHG+NIS
Sbjct  63   KLADTLNLIDIIERLGISYHFEKEIDDLLDHIFNQNSNFDDFTTSALQFRLLRQHGFNIS  122

Query  420  THIFSNFVDGN  452
              IFS F D N
Sbjct  123  PEIFSKFQDEN  133


 Score =   130 bits (327),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 90/119 (76%), Gaps = 8/119 (7%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  SDV GLL+LYEAS+VRT +DD +LE   AF+   L SA P+L  NS L++ VT
Sbjct  135  KFKESLASDVLGLLNLYEASHVRTHADD-ILEDARAFSTIHLESATPHL--NSPLKEQVT  191

Query  629  HALDQPFHTGLPRVEHRFFIS-VYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+Q  H G+PRVE RFFIS +Y  E E S NN LLRFA LDFNLLQMLHKQEL+EVS
Sbjct  192  HALEQCLHKGVPRVETRFFISSIY--EKEKSMNNMLLRFAKLDFNLLQMLHKQELAEVS  248



>pdb|3LZ9|A Chain A, The Crystal Structure Of 5-Epi-Aristolochene Synthase 
M4 Mut Complexed With (2-Trans,6-Trans)-2-Fluorofarnesyl Diphospha
 pdb|3M00|A Chain A, Crystal Structure Of 5-Epi-Aristolochene Synthase M4 
Mutant Complexed With (2-Cis,6-Trans)-2-Fluorofarnesyl Diphosphate
Length=550

 Score =   142 bits (359),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 90/131 (69%), Gaps = 5/131 (4%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSD  239
            N+E  + RPV +F P+LW    F +FSI NQVAE YAKEIE LKEQTR  +L+ TG    
Sbjct  10   NYEEEIVRPVADFSPSLWGDQ-FLSFSIKNQVAEKYAKEIEALKEQTR-NMLLATGM---  64

Query  240  DVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNIS  419
             +A  L  ID +ERLGI+YHFEKEIDD L  IY    + NDL T ALQFRL+RQHG+NIS
Sbjct  65   KLADTLNLIDTIERLGISYHFEKEIDDILDQIYNQNSNCNDLCTSALQFRLLRQHGFNIS  124

Query  420  THIFSNFVDGN  452
              IFS F D N
Sbjct  125  PEIFSKFQDEN  135


 Score =   130 bits (326),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 91/119 (76%), Gaps = 8/119 (7%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  SDV GLL+LYEAS+VRT +DD +LE   AF+   L SAAP+LK  S L + VT
Sbjct  137  KFKESLASDVLGLLNLYEASHVRTHADD-ILEDALAFSTIHLESAAPHLK--SPLREQVT  193

Query  629  HALDQPFHTGLPRVEHRFFIS-VYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+Q  H G+PRVE RFFIS +Y  + E S+NN LLRFA LDFNLLQMLHKQEL++VS
Sbjct  194  HALEQCLHKGVPRVETRFFISSIY--DKEQSKNNVLLRFAKLDFNLLQMLHKQELAQVS  250



>pdb|3M01|A Chain A, The Crystal Structure Of 5-Epi-Aristolochene Synthase 
Complexed With (2-Trans,6-Trans)-2-Fluorofarnesyl Diphosphate
 pdb|3M02|A Chain A, The Crystal Structure Of 5-Epi-Aristolochene Synthase 
Complexed With (2-Cis,6-Trans)-2-Fluorofarnesyl Diphosphate
Length=550

 Score =   142 bits (359),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 90/131 (69%), Gaps = 5/131 (4%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSD  239
            N+E  + RPV +F P+LW    F +FSI NQVAE YAKEIE LKEQTR  +L+ TG    
Sbjct  10   NYEEEIVRPVADFSPSLWGDQ-FLSFSIKNQVAEKYAKEIEALKEQTR-NMLLATGM---  64

Query  240  DVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNIS  419
             +A  L  ID +ERLGI+YHFEKEIDD L  IY    + NDL T ALQFRL+RQHG+NIS
Sbjct  65   KLADTLNLIDTIERLGISYHFEKEIDDILDQIYNQNSNCNDLCTSALQFRLLRQHGFNIS  124

Query  420  THIFSNFVDGN  452
              IFS F D N
Sbjct  125  PEIFSKFQDEN  135


 Score =   130 bits (326),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 91/119 (76%), Gaps = 8/119 (7%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  SDV GLL+LYEAS+VRT +DD +LE   AF+   L SAAP+LK  S L + VT
Sbjct  137  KFKESLASDVLGLLNLYEASHVRTHADD-ILEDALAFSTIHLESAAPHLK--SPLREQVT  193

Query  629  HALDQPFHTGLPRVEHRFFIS-VYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+Q  H G+PRVE RFFIS +Y  + E S+NN LLRFA LDFNLLQMLHKQEL++VS
Sbjct  194  HALEQCLHKGVPRVETRFFISSIY--DKEQSKNNVLLRFAKLDFNLLQMLHKQELAQVS  250



>sp|Q40577.3|5EAS_TOBAC RecName: Full=5-epi-aristolochene synthase; Short=EAS [Nicotiana 
tabacum]
Length=548

 Score =   142 bits (358),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 90/131 (69%), Gaps = 5/131 (4%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSD  239
            N+E  + RPV +F P+LW    F +FSI NQVAE YAKEIE LKEQTR  +L+ TG    
Sbjct  8    NYEEEIVRPVADFSPSLWGDQ-FLSFSIKNQVAEKYAKEIEALKEQTR-NMLLATGM---  62

Query  240  DVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNIS  419
             +A  L  ID +ERLGI+YHFEKEIDD L  IY    + NDL T ALQFRL+RQHG+NIS
Sbjct  63   KLADTLNLIDTIERLGISYHFEKEIDDILDQIYNQNSNCNDLCTSALQFRLLRQHGFNIS  122

Query  420  THIFSNFVDGN  452
              IFS F D N
Sbjct  123  PEIFSKFQDEN  133


 Score =   130 bits (326),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 91/119 (76%), Gaps = 8/119 (7%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  SDV GLL+LYEAS+VRT +DD +LE   AF+   L SAAP+LK  S L + VT
Sbjct  135  KFKESLASDVLGLLNLYEASHVRTHADD-ILEDALAFSTIHLESAAPHLK--SPLREQVT  191

Query  629  HALDQPFHTGLPRVEHRFFIS-VYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+Q  H G+PRVE RFFIS +Y  + E S+NN LLRFA LDFNLLQMLHKQEL++VS
Sbjct  192  HALEQCLHKGVPRVETRFFISSIY--DKEQSKNNVLLRFAKLDFNLLQMLHKQELAQVS  248



>ref|XP_009794139.1| PREDICTED: vetispiradiene synthase 2-like [Nicotiana sylvestris]
Length=555

 Score =   144 bits (362),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 95/141 (67%), Gaps = 10/141 (7%)
 Frame = +3

Query  66   ENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDV  245
            E  + RPV NF P+LWA   FH+FS DNQVAE YA+EIE+LKEQTR ++L+ TG   D+ 
Sbjct  12   EEEIVRPVANFSPSLWADQ-FHSFSFDNQVAEKYAQEIEVLKEQTR-SMLLATGQKLDET  69

Query  246  AQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHL-----NDLETVALQFRLMRQHGY  410
               +  ID++ERLGI YHFEKEID+ L HIY    +      NDL T ALQFRL RQHGY
Sbjct  70   ---MNLIDVIERLGIGYHFEKEIDEILEHIYNENTNFEGDDYNDLCTSALQFRLFRQHGY  126

Query  411  NISTHIFSNFVDGNESSETAL  473
            NIS  IFS F D N   + +L
Sbjct  127  NISPEIFSKFQDENGKFKESL  147


 Score =   128 bits (321),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 89/118 (75%), Gaps = 6/118 (5%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  SDV GLLSLYEASYVRT +DD +L+   AF+   L S AP+ K  S L + VT
Sbjct  142  KFKESLASDVLGLLSLYEASYVRTHADD-ILKDALAFSTIHLESVAPHFK--SPLREQVT  198

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+Q  H G+PR+E RFFIS   E++ES +N+ LLRFA LDFNLLQMLHKQEL+EVS
Sbjct  199  HALEQCLHKGVPRLETRFFISSIYEKEES-KNDMLLRFAKLDFNLLQMLHKQELAEVS  255



>ref|XP_009764785.1| PREDICTED: vetispiradiene synthase 3-like [Nicotiana sylvestris]
Length=554

 Score =   145 bits (366),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 93/138 (67%), Gaps = 10/138 (7%)
 Frame = +3

Query  57   INFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCS  236
            IN +  + RPV NF P+LW    FH+FS+DNQVAE Y +EIEILKE+TR+ L     +C 
Sbjct  7    INNDEQIVRPVANFSPSLWGD-SFHSFSVDNQVAEKYGQEIEILKEETRSML---AAACE  62

Query  237  D-DVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHL-----NDLETVALQFRLMR  398
               +A+KL  ID +ERLG+AYHFEK+IDD L  IY    +      NDL T ALQFR++R
Sbjct  63   RYSLAEKLNLIDTVERLGLAYHFEKQIDDMLDQIYKEDPNFEGHEYNDLYTCALQFRMLR  122

Query  399  QHGYNISTHIFSNFVDGN  452
            QHGYNIS  IFS F D N
Sbjct  123  QHGYNISPKIFSRFQDAN  140


 Score =   126 bits (317),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 89/118 (75%), Gaps = 7/118 (6%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  +D KGLLSLYEAS+VRT  ++ +LE    F+   L SAAP+LK  S L K VT
Sbjct  142  KFKESLSNDAKGLLSLYEASHVRTH-EEGILEEALVFSTAHLESAAPHLK--SPLNKQVT  198

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+Q  H  +PRVE R+FIS+Y+EE+   +N+ LLRFA LD+NLLQMLHKQELSEVS
Sbjct  199  HALEQSLHKSIPRVETRYFISIYEEEE--LKNDVLLRFAKLDYNLLQMLHKQELSEVS  254



>ref|XP_004230359.1| PREDICTED: vetispiradiene synthase 1 [Solanum lycopersicum]
 gb|AEP82772.1| terpene synthase [Solanum lycopersicum]
Length=552

 Score =   137 bits (344),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 88/126 (70%), Gaps = 5/126 (4%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            RPV +F P+LW    FH FS+DNQVAE YA+EIE LKEQTR+  L+   +C   +A+KL 
Sbjct  16   RPVADFSPSLWGDR-FHYFSLDNQVAEEYAQEIETLKEQTRS--LLSDAACGTTLAEKLN  72

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLN--DLETVALQFRLMRQHGYNISTHIFS  434
             ID++ERLG+AYHFE +I+D L  IY    +    DL T++LQFR++RQHGYNIS  IF 
Sbjct  73   LIDIVERLGLAYHFETQIEDMLDQIYKSDPNFEAHDLNTLSLQFRILRQHGYNISPKIFC  132

Query  435  NFVDGN  452
             F D N
Sbjct  133  RFQDAN  138


 Score =   134 bits (336),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 92/118 (78%), Gaps = 7/118 (6%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  +D+KGLL+LYEAS+VRT  +D +LE   AF+   L SAAP+LK  S L K VT
Sbjct  140  KFKESLSNDIKGLLNLYEASHVRTHGED-ILEEALAFSTAHLESAAPHLK--SPLSKQVT  196

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+Q  H  +PRVE R+FIS+Y+EE++  +N+ LLRFA LDFNLLQMLHKQELSEVS
Sbjct  197  HALEQSLHKSIPRVETRYFISIYEEEEQ--KNDVLLRFAKLDFNLLQMLHKQELSEVS  252



>sp|Q39978.2|VTSS1_HYOMU RecName: Full=Vetispiradiene synthase 1; Short=HVS1 [Hyoscyamus 
muticus]
 gb|AAA86340.1| vetispiradiene synthase [synthetic construct]
Length=555

 Score =   144 bits (364),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 95/140 (68%), Gaps = 9/140 (6%)
 Frame = +3

Query  48   IMAINFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTG  227
            +M+   E  + RPV +F P+LW  + FH+FS+DNQVAE YA+EIE LKEQT   L   + 
Sbjct  6    VMSNYEEEEIVRPVADFSPSLWGDH-FHSFSVDNQVAEKYAQEIETLKEQTSTML---SA  61

Query  228  SCSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHI-----YIHPVHLNDLETVALQFRL  392
            +C   + +KL  ID++ERLGIAYHFEK+I+D L HI     Y      NDL T ++QFRL
Sbjct  62   ACGTTLTEKLNLIDIIERLGIAYHFEKQIEDMLDHIYRADPYFEAHEYNDLNTSSVQFRL  121

Query  393  MRQHGYNISTHIFSNFVDGN  452
            +RQHGYN+S +IFS F D N
Sbjct  122  LRQHGYNVSPNIFSRFQDAN  141


 Score =   125 bits (315),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 89/118 (75%), Gaps = 7/118 (6%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  SD++GLL+LYEAS+VRT  +D +LE    F+   L SAAP+LK  S L K VT
Sbjct  143  KFKESLRSDIRGLLNLYEASHVRTHKED-ILEEALVFSVGHLESAAPHLK--SPLSKQVT  199

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+Q  H  +PRVE R+FIS+Y+EE+   +N+ LLRFA LD+NLLQMLHK ELSEVS
Sbjct  200  HALEQSLHKSIPRVEIRYFISIYEEEE--FKNDLLLRFAKLDYNLLQMLHKHELSEVS  255



>ref|XP_009784555.1| PREDICTED: 5-epi-aristolochene synthase 3 [Nicotiana sylvestris]
Length=548

 Score =   145 bits (365),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 92/131 (70%), Gaps = 5/131 (4%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSD  239
            N+E  + RPV +F P+LW    F +FSIDNQVAE YA+EIE LKEQTR ++L+ TG    
Sbjct  8    NYEEEIVRPVADFSPSLWGDQ-FLSFSIDNQVAEKYAQEIEALKEQTR-SMLLATGR---  62

Query  240  DVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNIS  419
             +A  L  ID +ERLGI+YHFEKEIDD L  IY    + NDL T ALQFRL+RQHG+NIS
Sbjct  63   KLADTLNLIDTIERLGISYHFEKEIDDILDQIYNQNSNCNDLCTSALQFRLLRQHGFNIS  122

Query  420  THIFSNFVDGN  452
              IFS F D N
Sbjct  123  PEIFSKFQDEN  133


 Score =   124 bits (312),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 86/112 (77%), Gaps = 4/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            +SDV GLL+LYEAS+VRT +DD +LE   AF+   L SAAP+L  NS L + VT AL+Q 
Sbjct  141  ASDVLGLLNLYEASHVRTHADD-ILEDALAFSTIHLESAAPHL--NSPLREQVTRALEQC  197

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
             H G+PRVE RFFIS   E++ES +N+ LLRF+ LDFNLLQMLHKQEL+EVS
Sbjct  198  LHKGVPRVETRFFISSIYEKEES-KNDMLLRFSKLDFNLLQMLHKQELAEVS  248



>dbj|BAA82108.1| vetispiradiene synthase [Solanum tuberosum]
Length=549

 Score =   139 bits (349),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 93/134 (69%), Gaps = 9/134 (7%)
 Frame = +3

Query  66   ENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDV  245
            E  + RPV +F P+LW    FH FS+DNQVA+ YA+EIE LKEQTR+ LL  +G     +
Sbjct  6    EEEIVRPVADFSPSLWGDR-FHYFSLDNQVAKEYAQEIETLKEQTRSMLLTASGMT---L  61

Query  246  AQKLKFIDLLERLGIAYHFEKEIDDQLRHIY-IHPV----HLNDLETVALQFRLMRQHGY  410
            A+KL  ID++ERLG+AYHFEK+I+D L  IY  HP       +DL T++LQFRL+RQHGY
Sbjct  62   AEKLNLIDIVERLGLAYHFEKQIEDMLDQIYKAHPNFDSHEYSDLTTLSLQFRLLRQHGY  121

Query  411  NISTHIFSNFVDGN  452
            NIS  IFS + D  
Sbjct  122  NISPKIFSRYQDAK  135


 Score =   130 bits (328),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 87/112 (78%), Gaps = 5/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            S+D+KGLL+LYEAS+VRT  +D +LE   AF+   L SAAP+LK  S L K VTHAL+Q 
Sbjct  143  SNDIKGLLNLYEASHVRTHGED-ILEEALAFSTAHLESAAPHLK--SPLSKQVTHALEQS  199

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
             H  +PRVE R+FIS+Y+EE+   +N+ LLRFA LDFNLLQMLHKQELSEVS
Sbjct  200  LHKSIPRVETRYFISIYEEEE--FKNDVLLRFAKLDFNLLQMLHKQELSEVS  249



>sp|Q84LF0.1|5EAS2_NICAT RecName: Full=5-epi-aristolochene synthase 2; Short=NaEAS37 [Nicotiana 
attenuata]
 gb|AAP05762.1|AF484125_1 5-epi-aristolochene synthase 37 [Nicotiana attenuata]
Length=548

 Score =   141 bits (355),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 90/131 (69%), Gaps = 5/131 (4%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSD  239
            N+E  + RPV +F P+LW    F +FSIDNQ+AE YA+EIE LKEQTR+ LL    + + 
Sbjct  8    NYEEEIVRPVADFSPSLWGDQ-FLSFSIDNQIAEKYAQEIEALKEQTRSMLL----ATAR  62

Query  240  DVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNIS  419
             +A  L  ID +ERLGIAYHFEKEID+ L  IY      +DL T ALQFRL+RQHG+NIS
Sbjct  63   KLADTLNLIDTIERLGIAYHFEKEIDEILDQIYNQNSTFDDLCTSALQFRLLRQHGFNIS  122

Query  420  THIFSNFVDGN  452
              IFS F D N
Sbjct  123  PQIFSKFQDEN  133


 Score =   128 bits (321),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 90/118 (76%), Gaps = 6/118 (5%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  SDV GLL+LYEAS+VRT +D+ +LE   AF+   L SAAP +  NS L + VT
Sbjct  135  KFKESLASDVLGLLNLYEASHVRTHTDN-ILEDALAFSTVHLESAAPYM--NSPLREQVT  191

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+Q  H G+PRVE RFFIS   E++ES +N+ LLRFA LDFNLLQMLHKQEL+EVS
Sbjct  192  HALEQCLHKGVPRVETRFFISSIYEKEES-KNDMLLRFAKLDFNLLQMLHKQELAEVS  248



>ref|XP_009757910.1| PREDICTED: 5-epi-aristolochene synthase 1-like [Nicotiana sylvestris]
Length=452

 Score =   145 bits (365),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 100/146 (68%), Gaps = 5/146 (3%)
 Frame = +3

Query  15   YIYISISRIGHIMAINFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKE  194
            YIY S+    +   IN+E  + RPV +F P+LW    F +FSIDN+VAE YA+EIE LKE
Sbjct  16   YIYTSLFSSIYNKNINYEEEIVRPVADFSPSLWGDQ-FLSFSIDNEVAEKYAQEIEPLKE  74

Query  195  QTRATLLIPTGSCSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETV  374
            QTR ++L+ TG     +A  L  ID++ERLGI+YHFEKEID+ L  IY    + NDL T 
Sbjct  75   QTR-SMLLTTGR---KLADTLNLIDIIERLGISYHFEKEIDEILDQIYNQNSNCNDLCTS  130

Query  375  ALQFRLMRQHGYNISTHIFSNFVDGN  452
            ALQFRL+RQHG+NIS  IFS F D N
Sbjct  131  ALQFRLLRQHGFNISPEIFSKFQDEN  156


 Score =   124 bits (310),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 89/119 (75%), Gaps = 8/119 (7%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  SDV GLL+LYEAS+VRT +DD +LE   AF+   L SAAP+L   S L + VT
Sbjct  158  KFKESLASDVLGLLNLYEASHVRTHADD-ILEDALAFSTIHLESAAPHLI--SPLREQVT  214

Query  629  HALDQPFHTGLPRVEHRFFIS-VYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+Q  H G+PRVE RFFIS +Y  E E S+N  LLRF+ LD+N+LQMLHKQEL+EVS
Sbjct  215  HALEQCLHKGVPRVETRFFISSIY--EKEQSKNTVLLRFSKLDYNMLQMLHKQELAEVS  271



>dbj|BAN58139.1| putative vetispiradiene synthase [Hyoscyamus albus]
Length=553

 Score =   145 bits (365),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 97/145 (67%), Gaps = 9/145 (6%)
 Frame = +3

Query  57   INFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCS  236
            +N E  + RPV NF P+LW    FH+FS+DNQVAE YA+EIE LKEQTR+ L   + +C 
Sbjct  7    LNNEEEIVRPVANFSPSLWGD-SFHSFSLDNQVAEKYAQEIETLKEQTRSML---SAACG  62

Query  237  DDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIY-----IHPVHLNDLETVALQFRLMRQ  401
              +A+KL  ID++ERLGIAYHFEK+I+D L  I+           NDL T ++QFR++RQ
Sbjct  63   TTLAEKLNLIDIVERLGIAYHFEKQIEDMLDQIHKADPNFEAQDYNDLNTSSVQFRILRQ  122

Query  402  HGYNISTHIFSNFVDGNESSETALM  476
            HGYNIS   FS F D N   + +L+
Sbjct  123  HGYNISPKCFSRFQDANGKFKESLI  147


 Score =   124 bits (310),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 87/118 (74%), Gaps = 7/118 (6%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  +D K LL+LYEAS+VRT  +D +LE   AF+   L +AAP LK  S L K VT
Sbjct  141  KFKESLINDAKALLNLYEASHVRTHGED-ILEEALAFSTAHLEAAAPRLK--SPLNKQVT  197

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+Q  H  +PRVE R+FIS+Y+EE+   +N+ LLRFA LD+NLLQMLHK ELSEVS
Sbjct  198  HALEQSLHKSIPRVETRYFISIYEEEE--FKNDVLLRFAKLDYNLLQMLHKHELSEVS  253



>gb|AAA19216.1| 5-epi-aristolochene synthase [Nicotiana tabacum]
Length=550

 Score =   138 bits (348),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 93/133 (70%), Gaps = 7/133 (5%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAY--AKEIEILKEQTRATLLIPTGSC  233
            N+E  + RPV +F P+LW    F +FSIDNQVAE Y  A+EIE LKEQTR ++L+ TG  
Sbjct  8    NYEEEIVRPVADFSPSLWGDQ-FLSFSIDNQVAEKYIYAQEIEALKEQTR-SMLLATGR-  64

Query  234  SDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYN  413
               +A  L  ID++ERLGI+YHFEKEID+ L  IY    + NDL T ALQFRL+RQHG+N
Sbjct  65   --KLADTLNLIDIIERLGISYHFEKEIDEILDQIYNQNSNCNDLCTSALQFRLLRQHGFN  122

Query  414  ISTHIFSNFVDGN  452
            IS  IFS F D N
Sbjct  123  ISPEIFSKFQDEN  135


 Score =   130 bits (326),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 91/119 (76%), Gaps = 8/119 (7%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  SDV GLL+LYEAS+VRT +DD +LE   AF+   L SAAP+LK  S L + VT
Sbjct  137  KFKESLASDVLGLLNLYEASHVRTHADD-ILEDALAFSTIHLESAAPHLK--SPLREQVT  193

Query  629  HALDQPFHTGLPRVEHRFFIS-VYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+Q  H G+PRVE RFFIS +Y  + E S+NN LLRFA LDFNLLQMLHKQEL++VS
Sbjct  194  HALEQCLHKGVPRVETRFFISSIY--DKEQSKNNVLLRFAKLDFNLLQMLHKQELAQVS  250



>ref|XP_009762840.1| PREDICTED: 5-epi-aristolochene synthase-like isoform X1 [Nicotiana 
sylvestris]
Length=548

 Score =   142 bits (359),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 92/131 (70%), Gaps = 5/131 (4%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSD  239
            N+E  + RPV +F P+LW    F +FSI+NQ AE YAKEIE LKEQTR ++L+ TG    
Sbjct  8    NYEEEIVRPVADFSPSLWGDQ-FLSFSIENQAAEKYAKEIEALKEQTR-SMLLATGR---  62

Query  240  DVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNIS  419
             +A  L  ID++ERLGI+YHFEKEID+ L  IY    + +DL T ALQFRL+RQHG+NIS
Sbjct  63   KLADTLNLIDIIERLGISYHFEKEIDEILEQIYNQTSNCDDLSTSALQFRLLRQHGFNIS  122

Query  420  THIFSNFVDGN  452
              IFS F D N
Sbjct  123  PEIFSKFQDEN  133


 Score =   125 bits (315),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 89/119 (75%), Gaps = 8/119 (7%)
 Frame = +2

Query  455  KFRD--SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++  S+DV GLL+LYEAS+VRT +DD +LE   AF+   L   AP+LK  S L + VT
Sbjct  135  KFKECLSNDVLGLLNLYEASHVRTHADD-ILENALAFSTIHLEFVAPHLK--SPLREQVT  191

Query  629  HALDQPFHTGLPRVEHRFFIS-VYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+Q  H G+PRVE RFFIS +Y  E E S+N+ LLRFA LDFNLLQMLHKQEL+EVS
Sbjct  192  HALEQCLHKGVPRVETRFFISSIY--EKEQSKNDVLLRFAKLDFNLLQMLHKQELAEVS  248



>ref|XP_009762842.1| PREDICTED: 5-epi-aristolochene synthase-like isoform X2 [Nicotiana 
sylvestris]
Length=466

 Score =   142 bits (358),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 92/131 (70%), Gaps = 5/131 (4%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSD  239
            N+E  + RPV +F P+LW    F +FSI+NQ AE YAKEIE LKEQTR ++L+ TG    
Sbjct  8    NYEEEIVRPVADFSPSLWGDQ-FLSFSIENQAAEKYAKEIEALKEQTR-SMLLATGR---  62

Query  240  DVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNIS  419
             +A  L  ID++ERLGI+YHFEKEID+ L  IY    + +DL T ALQFRL+RQHG+NIS
Sbjct  63   KLADTLNLIDIIERLGISYHFEKEIDEILEQIYNQTSNCDDLSTSALQFRLLRQHGFNIS  122

Query  420  THIFSNFVDGN  452
              IFS F D N
Sbjct  123  PEIFSKFQDEN  133


 Score =   125 bits (314),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 89/119 (75%), Gaps = 8/119 (7%)
 Frame = +2

Query  455  KFRD--SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++  S+DV GLL+LYEAS+VRT +DD +LE   AF+   L   AP+LK  S L + VT
Sbjct  135  KFKECLSNDVLGLLNLYEASHVRTHADD-ILENALAFSTIHLEFVAPHLK--SPLREQVT  191

Query  629  HALDQPFHTGLPRVEHRFFIS-VYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+Q  H G+PRVE RFFIS +Y  E E S+N+ LLRFA LDFNLLQMLHKQEL+EVS
Sbjct  192  HALEQCLHKGVPRVETRFFISSIY--EKEQSKNDVLLRFAKLDFNLLQMLHKQELAEVS  248



>gb|AFJ04408.1| 5-epi-aristolochene synthase [Nicotiana tabacum]
Length=466

 Score =   137 bits (345),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 93/138 (67%), Gaps = 5/138 (4%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSD  239
            N+E  + RPV +F P+LW    F +FSI NQVAE YAKEIE LKEQTR  +L+ TG    
Sbjct  8    NYEEEIVRPVADFSPSLWGDQ-FLSFSIKNQVAEKYAKEIEALKEQTR-NMLLATGM---  62

Query  240  DVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNIS  419
             +A  L  ID++ERLGI+YHFEKEID+ L  IY    + +DL   ALQFRL+RQHG+NIS
Sbjct  63   KLADTLNLIDIIERLGISYHFEKEIDEILDQIYNQNSNCDDLCISALQFRLLRQHGFNIS  122

Query  420  THIFSNFVDGNESSETAL  473
              IFS F D N   + +L
Sbjct  123  PEIFSKFQDENGKFKESL  140


 Score =   130 bits (326),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 92/119 (77%), Gaps = 8/119 (7%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  SDV GLL+LYEAS+VRT +DD +LE   AF+   L SAAP+LK  S L++ VT
Sbjct  135  KFKESLASDVLGLLNLYEASHVRTHADD-ILEDALAFSTIHLESAAPHLK--SPLKEQVT  191

Query  629  HALDQPFHTGLPRVEHRFFIS-VYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+Q  H G+PRVE RFFIS +Y  + E S+NN LLRFA LDFNLLQMLHKQEL++VS
Sbjct  192  HALEQCLHKGVPRVETRFFISSIY--DKEQSKNNVLLRFAKLDFNLLQMLHKQELAQVS  248



>pdb|4DI5|A Chain A, Co-Crystal Structure Of Wt 5-Epi-Aristolochene Synthase 
From Nicotiana Tobaccum With Geraniline
Length=535

 Score =   137 bits (345),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 86/124 (69%), Gaps = 5/124 (4%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            RPV +F P+LW    F +FSI NQVAE YAKEIE LKEQTR  +L+ TG     +A  L 
Sbjct  2    RPVADFSPSLWGDQ-FLSFSIKNQVAEKYAKEIEALKEQTR-NMLLATGM---KLADTLN  56

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNISTHIFSNF  440
             ID +ERLGI+YHFEKEIDD L  IY    + NDL T ALQFRL+RQHG+NIS  IFS F
Sbjct  57   LIDTIERLGISYHFEKEIDDILDQIYNQNSNCNDLCTSALQFRLLRQHGFNISPEIFSKF  116

Query  441  VDGN  452
             D N
Sbjct  117  QDEN  120


 Score =   130 bits (326),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 91/119 (76%), Gaps = 8/119 (7%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  SDV GLL+LYEAS+VRT +DD +LE   AF+   L SAAP+LK  S L + VT
Sbjct  122  KFKESLASDVLGLLNLYEASHVRTHADD-ILEDALAFSTIHLESAAPHLK--SPLREQVT  178

Query  629  HALDQPFHTGLPRVEHRFFIS-VYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+Q  H G+PRVE RFFIS +Y  + E S+NN LLRFA LDFNLLQMLHKQEL++VS
Sbjct  179  HALEQCLHKGVPRVETRFFISSIY--DKEQSKNNVLLRFAKLDFNLLQMLHKQELAQVS  235



>ref|XP_009595428.1| PREDICTED: 5-epi-aristolochene synthase [Nicotiana tomentosiformis]
Length=548

 Score =   136 bits (342),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 89/131 (68%), Gaps = 5/131 (4%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSD  239
            N+E  + RPV +F P+LW    F +FSI NQVAE YAKEIE LKEQTR  +L  TG    
Sbjct  8    NYEEEIVRPVADFSPSLWGDQ-FLSFSIKNQVAEKYAKEIEALKEQTR-NMLSATGM---  62

Query  240  DVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNIS  419
             +A  L  ID++ERLGI+YHFEKEID+ L  IY    + +DL   ALQFRL+RQHG+NIS
Sbjct  63   KLADTLNLIDIIERLGISYHFEKEIDEILDQIYNQNSNCDDLCISALQFRLLRQHGFNIS  122

Query  420  THIFSNFVDGN  452
              IFS F D N
Sbjct  123  PEIFSKFQDEN  133


 Score =   131 bits (329),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 91/119 (76%), Gaps = 8/119 (7%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  SDV GLL+LYEAS+VRT +DD +LE   AF+   L SAAP+LK  S L + VT
Sbjct  135  KFKESLASDVLGLLNLYEASHVRTHADD-ILEDALAFSTIHLESAAPHLK--SPLREHVT  191

Query  629  HALDQPFHTGLPRVEHRFFIS-VYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+Q  H G+PRVE RFFIS +Y  E E S+NN LLRFA LDFNLLQMLHKQEL++VS
Sbjct  192  HALEQCLHKGVPRVETRFFISSIY--EKEQSKNNVLLRFAKLDFNLLQMLHKQELAQVS  248



>sp|Q84LF2.1|5EAS3_NICAT RecName: Full=5-epi-aristolochene synthase 3; Short=NaEAS12 [Nicotiana 
attenuata]
 gb|AAP05760.1|AF484123_1 5-epi-aristolochene synthase 12 [Nicotiana attenuata]
Length=548

 Score =   140 bits (354),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 90/131 (69%), Gaps = 5/131 (4%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSD  239
            N+E  + RPV +F P+LW    F +FSI+NQVAE YA+EIE LKEQTR+ LL        
Sbjct  8    NYEEEIVRPVADFSPSLWGDQ-FLSFSIENQVAEKYAQEIEALKEQTRSMLL----ENGR  62

Query  240  DVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNIS  419
             +A  L  ID++ERLGI+YHFEKEIDD L  IY    + NDL T ALQFRL+RQHG+NIS
Sbjct  63   KLADTLYLIDIIERLGISYHFEKEIDDILDQIYNQNSNCNDLCTSALQFRLLRQHGFNIS  122

Query  420  THIFSNFVDGN  452
              IFS F D N
Sbjct  123  PEIFSKFQDEN  133


 Score =   126 bits (316),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 90/119 (76%), Gaps = 8/119 (7%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  SD  GLL+LYEAS+VRT +DD +LE   AF+   L SAAP+LK  S L + VT
Sbjct  135  KFKESLASDFLGLLNLYEASHVRTHADD-ILEEALAFSTIHLESAAPHLK--SPLREQVT  191

Query  629  HALDQPFHTGLPRVEHRFFIS-VYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+Q  H G+PRVE RFFIS +Y  E E S+N+ LLRFA LDFNLLQ+LHKQEL+EVS
Sbjct  192  HALEQCLHKGVPRVETRFFISSIY--EKEQSKNDVLLRFAKLDFNLLQILHKQELAEVS  248



>sp|Q84LG0.1|5EAS4_NICAT RecName: Full=Probable 5-epi-aristolochene synthase 4 [Nicotiana 
attenuata]
 gb|AAO85555.1| 5-epi-aristolochene synthase [Nicotiana attenuata]
Length=548

 Score =   134 bits (337),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 91/119 (76%), Gaps = 8/119 (7%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  SDV GLL+LYEAS+VRT +DD +LE   AF+   L SAAP+LK  S L + V 
Sbjct  135  KFKESLASDVVGLLNLYEASHVRTHADD-ILEAALAFSTIHLESAAPHLK--SPLREQVA  191

Query  629  HALDQPFHTGLPRVEHRFFIS-VYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+Q  H G+PRVE RFFIS +Y  E E S+NN LLRFAILDFNLLQMLHKQEL+EVS
Sbjct  192  HALEQCLHKGVPRVETRFFISSIY--EKEQSKNNVLLRFAILDFNLLQMLHKQELAEVS  248


 Score =   131 bits (330),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 90/131 (69%), Gaps = 5/131 (4%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSD  239
            N+E  + RPV +F P+LW  + F +FSIDN VA+ YA+EIE LKEQTR ++L+ TG    
Sbjct  8    NYEEEIVRPVADFSPSLWGDH-FLSFSIDNHVAQKYAQEIEPLKEQTR-SMLVATGR---  62

Query  240  DVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNIS  419
             +   L  ID +ERLGI+YHFEKEID+ L  IY    + +DL T AL FRL+RQHG+NIS
Sbjct  63   KLVDTLNLIDTIERLGISYHFEKEIDEILDQIYNQNSNSSDLFTSALLFRLLRQHGFNIS  122

Query  420  THIFSNFVDGN  452
              IFS F D N
Sbjct  123  PEIFSKFQDEN  133



>ref|XP_009771989.1| PREDICTED: 5-epi-aristolochene synthase-like [Nicotiana sylvestris]
Length=548

 Score =   140 bits (353),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 91/131 (69%), Gaps = 5/131 (4%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSD  239
            N+E  + RPV +F P+LW    F +FSIDNQVAE YAKEIE  KEQTR  +L+ TG    
Sbjct  8    NYEEDIVRPVADFSPSLWGDQ-FLSFSIDNQVAEKYAKEIEAPKEQTR-NMLLATGM---  62

Query  240  DVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNIS  419
             +A  L  ID++ERLGI+YHFEKEID+ L  IY    + +DL T ALQFRL+RQHG+NIS
Sbjct  63   KLADTLNLIDIIERLGISYHFEKEIDEILDQIYNQNSNCDDLSTSALQFRLLRQHGFNIS  122

Query  420  THIFSNFVDGN  452
              IFS F D N
Sbjct  123  PEIFSKFQDEN  133


 Score =   125 bits (314),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 88/119 (74%), Gaps = 8/119 (7%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  SDV GLL+LYEAS+ RT +DD +L+   AF+   L   AP+LK  S L + VT
Sbjct  135  KFKESLASDVLGLLNLYEASHARTHADD-ILQDALAFSTIHLEFVAPHLK--SPLREQVT  191

Query  629  HALDQPFHTGLPRVEHRFFIS-VYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+Q  H G+PRVE RFFIS +Y  E E S+NN LLRFA LDFNLLQMLHKQEL+EVS
Sbjct  192  HALEQCLHKGVPRVETRFFISSIY--EKEQSKNNMLLRFAKLDFNLLQMLHKQELAEVS  248



>ref|NP_001239040.1| viridiflorene synthase [Solanum lycopersicum]
 sp|G5CV46.1|TPS31_SOLLC RecName: Full=Viridiflorene synthase; Short=SlTPS31 [Solanum 
lycopersicum]
 gb|AEM23833.1| sesquiterpene synthase [Solanum lycopersicum]
 gb|AEP82774.1| viridiflorene synthase [Solanum lycopersicum]
Length=555

 Score =   139 bits (349),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 92/134 (69%), Gaps = 11/134 (8%)
 Frame = +3

Query  66   ENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDV  245
            E  + RPV +F P+LW    FH+FS+DNQVAE Y +EIE LKEQTR+ L+         +
Sbjct  14   EEEIVRPVADFSPSLWGDR-FHSFSLDNQVAEKYVEEIETLKEQTRSMLM-----SGKTL  67

Query  246  AQKLKFIDLLERLGIAYHFEKEIDDQLRHIY-IHPV----HLNDLETVALQFRLMRQHGY  410
            A+KL  ID++ERLGIAYHFEK+IDD L HI+ I P       NDL T++LQFR++RQHGY
Sbjct  68   AEKLNLIDIVERLGIAYHFEKQIDDMLNHIFNIDPNFEAHEYNDLCTLSLQFRILRQHGY  127

Query  411  NISTHIFSNFVDGN  452
             IS  IFS F D N
Sbjct  128  YISPKIFSRFQDAN  141


 Score =   127 bits (318),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 88/118 (75%), Gaps = 7/118 (6%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S   D++G+L+LYEAS+VRT  +D  LE   AF+   L SAAP+LK  S L K VT
Sbjct  143  KFKESLCDDIRGILNLYEASHVRTHGED-TLEEALAFSTAHLESAAPHLK--SPLSKQVT  199

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+Q  H  +PRVE R+FIS+Y+EE+   +N+  LRFA LDFNLLQMLHKQELSEVS
Sbjct  200  HALEQSLHKSIPRVETRYFISIYEEEE--LKNDVFLRFAKLDFNLLQMLHKQELSEVS  255



>ref|XP_009589983.1| PREDICTED: 5-epi-aristolochene synthase-like [Nicotiana tomentosiformis]
Length=550

 Score =   139 bits (349),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 91/131 (69%), Gaps = 5/131 (4%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSD  239
            N+E  + RPV NF  +LW    F +FSIDNQVAE YA+EIE LKEQTR ++L+ TG    
Sbjct  9    NYEEEIVRPVANFSSSLWGDQ-FLSFSIDNQVAENYAQEIEPLKEQTR-SMLLATGR---  63

Query  240  DVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNIS  419
             +A  L  ID++ERLGI+YHFEKEIDD L  IY    + +DL T ALQFRL+RQ G+NIS
Sbjct  64   KLADTLNLIDIIERLGISYHFEKEIDDILDQIYNQNSNFDDLGTSALQFRLLRQRGFNIS  123

Query  420  THIFSNFVDGN  452
              IFS F D N
Sbjct  124  PEIFSKFQDEN  134


 Score =   125 bits (315),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 90/120 (75%), Gaps = 9/120 (8%)
 Frame = +2

Query  455  KFRDS---SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLV  625
            KF++S    DV GLL+LYEAS+VRT +DD +LE   AF+   L SAAP+LK  S L + V
Sbjct  136  KFKESLASDDVLGLLNLYEASHVRTHADD-ILEDALAFSTIHLESAAPHLK--SPLREQV  192

Query  626  THALDQPFHTGLPRVEHRFFI-SVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            THAL+QP H G+PR+E RFFI S+Y  E E S+ N LL+FA LDFNLLQMLHK+EL+E+S
Sbjct  193  THALEQPLHKGVPRIETRFFISSIY--EKEQSKINVLLQFAKLDFNLLQMLHKKELAEIS  250



>ref|XP_006367961.1| PREDICTED: viridiflorene synthase-like [Solanum tuberosum]
Length=560

 Score =   138 bits (347),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 89/129 (69%), Gaps = 9/129 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            RPV NF P+LW    F +FSIDN VA+ YA+EIE LKE+TR+ LL  TG     + +KL 
Sbjct  18   RPVANFSPSLWGDR-FLSFSIDNHVAQKYAQEIEALKEETRSMLLAITGR---KLVEKLN  73

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIHPVHL-----NDLETVALQFRLMRQHGYNISTH  425
             ID++ERLGIAYH+EKEIDD L  IY    +      +DL T ALQFRL+RQHGYNIS  
Sbjct  74   VIDVIERLGIAYHYEKEIDDILYGIYNENANFEGDDCSDLSTFALQFRLLRQHGYNISPE  133

Query  426  IFSNFVDGN  452
            IFS F DGN
Sbjct  134  IFSKFQDGN  142


 Score =   125 bits (314),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 83/110 (75%), Gaps = 4/110 (4%)
 Frame = +2

Query  473  DVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQPFH  652
            DV G LSLYEAS+VRT  +D +LE    F+ T L SAAP+L  NS L++ VTHAL+Q  H
Sbjct  154  DVLGFLSLYEASHVRTHGED-ILENALNFSTTHLESAAPHL--NSPLKEQVTHALEQSLH  210

Query  653  TGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
             G+PRVE RFFIS   E+DE  +N+ LLRFA LDFNLLQMLHKQEL+EVS
Sbjct  211  KGIPRVETRFFISSIYEKDEL-KNDALLRFAKLDFNLLQMLHKQELAEVS  259



>ref|XP_009773139.1| PREDICTED: vetispiradiene synthase 3 [Nicotiana sylvestris]
Length=560

 Score =   137 bits (346),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 92/135 (68%), Gaps = 7/135 (5%)
 Frame = +3

Query  66   ENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLL-IPTGSCSDD  242
            E  + RPV +F P+LW    FH+FS+DNQVA  YA+EIE LKEQTR+ L+   +G+ +  
Sbjct  13   EEEIVRPVADFSPSLWGDR-FHSFSLDNQVAGKYAQEIETLKEQTRSMLMSAASGTTTLT  71

Query  243  VAQKLKFIDLLERLGIAYHFEKEIDDQLRHIY-----IHPVHLNDLETVALQFRLMRQHG  407
            +A+KL  ID++ERLGIAYHFEK+IDD L  IY        +  NDL  ++LQFRL+RQHG
Sbjct  72   LAEKLNLIDIVERLGIAYHFEKQIDDMLDQIYNADPNFEGLEYNDLCILSLQFRLLRQHG  131

Query  408  YNISTHIFSNFVDGN  452
            YNIS  I S F   N
Sbjct  132  YNISPKILSRFQYAN  146


 Score =   125 bits (314),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 89/118 (75%), Gaps = 7/118 (6%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S   +V GLL+LYEAS+VRT  +D +LE   AF+   L SAAP+LK  S L K VT
Sbjct  148  KFKESLSDNVTGLLNLYEASHVRTHGED-ILEEALAFSTAHLESAAPHLK--SPLSKQVT  204

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+Q  H  +PRVE R+FIS+Y+EE+ +  N+ LLRFA LDFN+LQMLHKQELSEVS
Sbjct  205  HALEQSLHKSIPRVETRYFISIYEEEELN--NDILLRFAKLDFNVLQMLHKQELSEVS  260



>ref|XP_009779916.1| PREDICTED: 5-epi-aristolochene synthase, partial [Nicotiana sylvestris]
Length=540

 Score =   139 bits (349),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 92/130 (71%), Gaps = 5/130 (4%)
 Frame = +3

Query  63   FENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDD  242
            +E  + RPV +F P+LW    F +FSIDN+VAE YA+EIE LKEQTR ++L+ TG     
Sbjct  1    YEEEIVRPVADFSPSLWGDQ-FLSFSIDNEVAEKYAQEIEPLKEQTR-SMLLTTGR---K  55

Query  243  VAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNIST  422
            +A  L  ID++ERLGI+YHFEKEID+ L  IY    + NDL T ALQFRL+RQHG+NIS 
Sbjct  56   LADTLNLIDIIERLGISYHFEKEIDEILDQIYNQNSNCNDLCTSALQFRLLRQHGFNISP  115

Query  423  HIFSNFVDGN  452
             IFS F D N
Sbjct  116  EIFSKFQDEN  125


 Score =   124 bits (310),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 89/119 (75%), Gaps = 8/119 (7%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  SDV GLL+LYEAS+VRT +DD +LE   AF+   L SAAP+L   S L + VT
Sbjct  127  KFKESLASDVLGLLNLYEASHVRTHADD-ILEDALAFSTIHLESAAPHLI--SPLREQVT  183

Query  629  HALDQPFHTGLPRVEHRFFIS-VYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+Q  H G+PRVE RFFIS +Y  E E S+N  LLRF+ LD+N+LQMLHKQEL+EVS
Sbjct  184  HALEQCLHKGVPRVETRFFISSIY--EKEQSKNTVLLRFSKLDYNMLQMLHKQELAEVS  240



>ref|XP_006358531.1| PREDICTED: viridiflorene synthase-like [Solanum tuberosum]
Length=555

 Score =   132 bits (333),  Expect(2) = 9e-61, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 99/148 (67%), Gaps = 12/148 (8%)
 Frame = +3

Query  48   IMAINFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTG  227
            IM+   E  + RPV +F P+LW    FH+FS+DN+VAE Y +EIE LKEQTR+ L+    
Sbjct  7    IMSNYEEEEIVRPVADFSPSLWGDR-FHSFSLDNKVAEKYVEEIETLKEQTRSILM----  61

Query  228  SCSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLR-HIY-IHPV----HLNDLETVALQFR  389
                 +A+KL  ID++ERLGIAYHFEK+IDD L  HI+ I P       N+L T++LQFR
Sbjct  62   -SGKTLAEKLNLIDIVERLGIAYHFEKQIDDMLDLHIFNIDPNFEAHEYNNLCTLSLQFR  120

Query  390  LMRQHGYNISTHIFSNFVDGNESSETAL  473
            ++RQHGYNIS  IF+ F D N   + +L
Sbjct  121  ILRQHGYNISPKIFNRFQDANGKFKESL  148


 Score =   129 bits (324),  Expect(2) = 9e-61, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 90/118 (76%), Gaps = 7/118 (6%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  +D+KGLL+LYEAS+VRT  +D +LE   AF+   L SAAP+LK  S L   VT
Sbjct  143  KFKESLCNDIKGLLNLYEASHVRTHGED-ILEEALAFSTAHLESAAPHLK--SPLGMQVT  199

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+Q  H  +PRVE R+FIS+Y+EE+   +N+ LLRFA LDFNLLQMLHKQELSEVS
Sbjct  200  HALEQSLHKSIPRVETRYFISIYEEEE--FKNDVLLRFAKLDFNLLQMLHKQELSEVS  255



>gb|AAF21053.1|AF212433_1 UV-induced sesquiterpene cyclase [Capsicum annuum]
Length=560

 Score =   126 bits (317),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 85/112 (76%), Gaps = 4/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            +SDV GLLSLYEAS+VRT  DD +LE   AF+ T L SAAP+L  NS L++ VTHAL+  
Sbjct  153  ASDVLGLLSLYEASHVRTHGDD-ILEDALAFSTTHLESAAPHL--NSPLKEQVTHALELS  209

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
             H G+PR E RFFIS   E+ E+ +N+ LLRFA LDFNLLQMLHKQEL+EVS
Sbjct  210  LHKGIPRAETRFFISSIYEKQET-KNDVLLRFAKLDFNLLQMLHKQELAEVS  260


 Score =   124 bits (311),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 93/149 (62%), Gaps = 16/149 (11%)
 Frame = +3

Query  60   NFENHLP------RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIP  221
            NF NH+       RPV NF P+LW    F +FSI+N V   Y +EIE+LKEQTR ++L+ 
Sbjct  9    NFVNHIEEEEEIIRPVANFAPSLWGN-SFLSFSINNHVETKYVQEIEVLKEQTR-SMLLD  66

Query  222  TGSCSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHL-----NDLETVALQF  386
            TG     + + L  ID++ERLGIAYH+EKEIDD L+  ++   +      NDL T ALQF
Sbjct  67   TGR---KLVETLNLIDVIERLGIAYHYEKEIDDILKKNFLDNSNFDEDDFNDLCTCALQF  123

Query  387  RLMRQHGYNISTHIFSNFVDGNESSETAL  473
            RL+RQHGY IS  IFS   D N   + +L
Sbjct  124  RLLRQHGYKISLKIFSKLQDENGKLKESL  152



>gb|AAA86337.1| vetispiradiene synthase, partial [Hyoscyamus muticus]
Length=520

 Score =   125 bits (315),  Expect(2) = 9e-56, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 89/118 (75%), Gaps = 7/118 (6%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  SD++GLL+LYEAS+VRT  +D +LE    F+   L SAAP+LK  S L K VT
Sbjct  108  KFKESLRSDIRGLLNLYEASHVRTHKED-ILEEALVFSVGHLESAAPHLK--SPLSKQVT  164

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+Q  H  +PRVE R+FIS+Y+EE+   +N+ LLRFA LD+NLLQMLHK ELSEVS
Sbjct  165  HALEQSLHKSIPRVEIRYFISIYEEEE--FKNDLLLRFAKLDYNLLQMLHKHELSEVS  220


 Score =   119 bits (298),  Expect(2) = 9e-56, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 75/109 (69%), Gaps = 8/109 (7%)
 Frame = +3

Query  141  IDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLKFIDLLERLGIAYHFEKEIDD  320
            +DNQVAE YA+EIE LKEQT   L   + +C   + +KL  ID++ERLGIAYHFEK+I+D
Sbjct  1    VDNQVAEKYAQEIETLKEQTSTML---SAACGTTLTEKLNLIDIIERLGIAYHFEKQIED  57

Query  321  QLRHI-----YIHPVHLNDLETVALQFRLMRQHGYNISTHIFSNFVDGN  452
             L HI     Y      NDL T ++QFRL+RQHGYN+S +IFS F D N
Sbjct  58   MLDHIYRADPYFEAHEYNDLNTSSVQFRLLRQHGYNVSPNIFSRFQDAN  106



>sp|O65323.1|5EAS_CAPAN RecName: Full=5-epiaristolochene synthase [Capsicum annuum]
 gb|AAC61260.1| sesquiterpene cyclase [Capsicum annuum]
Length=559

 Score =   130 bits (327),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 91/141 (65%), Gaps = 15/141 (11%)
 Frame = +3

Query  60   NFENHLP----RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTG  227
            N  NH+     RPV +F P+LW    F +FSIDNQV   YA+EIE LKEQTR+ LL    
Sbjct  9    NVVNHIAEEIIRPVADFSPSLWGDR-FLSFSIDNQVETKYAQEIEPLKEQTRSMLL----  63

Query  228  SCSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIH------PVHLNDLETVALQFR  389
            +    +++ L  ID++ERLGIAYHFEKEID+ L  IY         V+  DL T  LQFR
Sbjct  64   ASGRKLSETLNLIDVIERLGIAYHFEKEIDEILDRIYNENSNFEGDVYNEDLCTCRLQFR  123

Query  390  LMRQHGYNISTHIFSNFVDGN  452
            L+RQHGYNIS  IFS F+DGN
Sbjct  124  LLRQHGYNISLKIFSKFLDGN  144


 Score =   112 bits (281),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 85/113 (75%), Gaps = 6/113 (5%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            +SDV GLLSLYEAS+VR+  +D +LE   AF+ T L SA P+L+    L++ V HAL+Q 
Sbjct  152  ASDVLGLLSLYEASHVRSHGED-ILEDALAFSTTHLESATPHLE--YPLKEQVRHALEQS  208

Query  647  FHTGLPRVEHRFFIS-VYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
             H G+PR+E +FFIS VY  + ++ +N+ LLRFA LD+N+LQMLHKQEL+EVS
Sbjct  209  LHKGIPRIEIQFFISSVY--DKQAIKNDVLLRFAKLDYNMLQMLHKQELAEVS  259



>ref|XP_009589984.1| PREDICTED: 5-epi-aristolochene synthase-like, partial [Nicotiana 
tomentosiformis]
Length=286

 Score =   131 bits (330),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 91/119 (76%), Gaps = 8/119 (7%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  SDV GLL+LYEAS+VRT +DD +LE   AF+   L SAAP+LK  S L + VT
Sbjct  104  KFKESLASDVLGLLNLYEASHVRTHADD-ILEDALAFSTIHLESAAPHLK--SPLREQVT  160

Query  629  HALDQPFHTGLPRVEHRFFIS-VYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+Q  H G+PRVE RFFIS +Y  E E S+NN LLRFA LDFNLLQMLHKQEL+EVS
Sbjct  161  HALEQCLHKGVPRVETRFFISSIY--EKEQSKNNVLLRFAKLDFNLLQMLHKQELAEVS  217


 Score =   111 bits (277),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 76/107 (71%), Gaps = 4/107 (4%)
 Frame = +3

Query  153  VAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRH  332
            VAE YA+EIE LKEQTR ++L+ TGS    +A  L  I ++ERLGI+YHFEKEIDD L  
Sbjct  7    VAENYAQEIEPLKEQTR-SMLLATGS---KLADTLNLIYIIERLGISYHFEKEIDDILDQ  62

Query  333  IYIHPVHLNDLETVALQFRLMRQHGYNISTHIFSNFVDGNESSETAL  473
            IY H  + +DL T ALQFRL+RQHG+NIS  IFS F D N   + +L
Sbjct  63   IYNHNSNFDDLGTSALQFRLLRQHGFNISPEIFSKFQDENGKFKESL  109



>gb|AAP79448.1| epi-arisotolchene synthase 110 [Nicotiana tabacum]
Length=548

 Score =   130 bits (327),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 88/113 (78%), Gaps = 6/113 (5%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            +SDV GLL+LYEAS+VRT +DD +LE   AF+   L SAAP+LK  S L++ VTHAL+Q 
Sbjct  141  ASDVLGLLNLYEASHVRTHADD-ILEDALAFSIIHLESAAPHLK--SPLKQQVTHALEQC  197

Query  647  FHTGLPRVEHRFFIS-VYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
             H G+PRVE RFFIS +Y  E E S+NN LLRFA LDFNLLQMLHKQEL++VS
Sbjct  198  LHKGVPRVETRFFISSIY--EKEQSKNNVLLRFAKLDFNLLQMLHKQELAQVS  248


 Score =   110 bits (275),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 79/116 (68%), Gaps = 5/116 (4%)
 Frame = +3

Query  126  FHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLKFIDLLERLGIAYHFE  305
            FH+  +  ++AE Y KEIE LKEQTR  +L+ TG     +A  L  ID++ERLGI+YHFE
Sbjct  30   FHSL-LKIRIAEKYTKEIEGLKEQTR-NMLLATGM---KLADTLNLIDIIERLGISYHFE  84

Query  306  KEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNISTHIFSNFVDGNESSETAL  473
            KEID+ L  IY    + +DL T ALQFRL+RQHG+NIS  IFS F D N  S+ +L
Sbjct  85   KEIDEILDQIYNQNSNCDDLCTSALQFRLLRQHGFNISPGIFSKFQDENGKSKESL  140



>emb|CAA06614.1| 5-epi-aristolochene synthase [Capsicum annuum var. annuum]
Length=559

 Score =   127 bits (318),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 89/141 (63%), Gaps = 15/141 (11%)
 Frame = +3

Query  60   NFENHLP----RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTG  227
            N  NH+     RPV ++ P++W    F +FSIDNQV + YA+EIE  KEQTR+ LL    
Sbjct  9    NVVNHIAEEIIRPVADYSPSIWGDR-FLSFSIDNQVEQKYAQEIEPPKEQTRSMLLASPR  67

Query  228  SCSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIH------PVHLNDLETVALQFR  389
              SD     L  ID++ERL IAYHFEKEID+ L  IY         V+  DL T ALQFR
Sbjct  68   KLSD----TLNLIDVIERLAIAYHFEKEIDEILDRIYNENSNFEGDVYNEDLCTCALQFR  123

Query  390  LMRQHGYNISTHIFSNFVDGN  452
            L+RQHGYNIS  IFS F+DGN
Sbjct  124  LLRQHGYNISLEIFSKFLDGN  144


 Score =   112 bits (280),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 85/113 (75%), Gaps = 6/113 (5%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            +SDV GLLSLYEAS+VR+  +D +LE   AF+ T L SA P+L+    L++ V HAL+Q 
Sbjct  152  ASDVLGLLSLYEASHVRSHGED-ILEDALAFSTTHLESATPHLE--YPLKEQVRHALEQS  208

Query  647  FHTGLPRVEHRFFIS-VYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
             H G+PR+E +FFIS +Y  + ++ +N+ LLRFA LD+N+LQMLHKQEL+EVS
Sbjct  209  LHKGIPRIEIQFFISSIY--DKQAIKNDVLLRFAKLDYNMLQMLHKQELAEVS  259



>ref|XP_009611774.1| PREDICTED: vetispiradiene synthase 1-like, partial [Nicotiana 
tomentosiformis]
Length=227

 Score =   125 bits (314),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 83/112 (74%), Gaps = 5/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            S D KGLLSLYEAS+VRT  +D +LE   AFA   L SA P+LK  S L K V HAL+Q 
Sbjct  113  SKDAKGLLSLYEASHVRTHGED-ILEEAFAFATAHLESATPHLK--SPLSKQVMHALEQS  169

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
             H  +PRVE R+FIS+Y+EE+   +N+ LLRFA LD+NLLQMLHKQELS+VS
Sbjct  170  LHKSIPRVETRYFISIYEEEE--LKNDVLLRFAKLDYNLLQMLHKQELSQVS  219


 Score =   111 bits (277),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 72/106 (68%), Gaps = 9/106 (8%)
 Frame = +3

Query  153  VAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRH  332
            VAE Y +EIE LKE+T++ L     +C   +A+KL  ID +ERLG+AYHFEK+IDD+L  
Sbjct  1    VAEKYGQEIETLKEETKSML---AAACERSLAEKLNLIDTVERLGLAYHFEKQIDDRLDQ  57

Query  333  IYIHP------VHLNDLETVALQFRLMRQHGYNISTHIFSNFVDGN  452
            IY          ++NDL T ALQFR++RQHGYNIS  IFS F D N
Sbjct  58   IYKEDPNFEGHEYINDLYTCALQFRMLRQHGYNISPKIFSRFQDAN  103



>ref|XP_011082248.1| PREDICTED: vetispiradiene synthase 3-like [Sesamum indicum]
Length=560

 Score =   117 bits (293),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 94/141 (67%), Gaps = 7/141 (5%)
 Frame = +3

Query  57   INFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCS  236
            +N++  + RP+ NF P+LW    F + SIDNQV E YA+EIE+L+E+ R  ++    + +
Sbjct  11   VNYQQEIVRPLANFSPSLWGD-LFTSVSIDNQVVEFYAQEIELLREKVRKMIV----AHN  65

Query  237  DDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIY--IHPVHLNDLETVALQFRLMRQHGY  410
             ++A+KL  ID +ERLGI+YHFE EI++Q+ + Y        +DL TVAL FRL+RQHG+
Sbjct  66   KNMAEKLNLIDSIERLGISYHFETEIEEQILNFYNARSSFESDDLHTVALYFRLLRQHGH  125

Query  411  NISTHIFSNFVDGNESSETAL  473
             IS+ IF  F++ +   + +L
Sbjct  126  PISSGIFEKFMENDGKFKNSL  146


 Score =   108 bits (270),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 85/118 (72%), Gaps = 7/118 (6%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  +D KGLLSLYEA++++TR +D +L+   AF    L S AP+L  +S  ++ V 
Sbjct  141  KFKNSLRADPKGLLSLYEAAHLQTREED-ILDKALAFTTAHLESIAPHL--SSPFKEQVA  197

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+Q    G+PRVE R +ISVY+E +  S+N+ LLR A LDFNLLQMLH++EL E+S
Sbjct  198  HALEQCLQRGIPRVEARHYISVYEEYE--SKNDSLLRLAKLDFNLLQMLHRRELCELS  253



>gb|EYU21989.1| hypothetical protein MIMGU_mgv1a023416mg [Erythranthe guttata]
Length=556

 Score =   114 bits (284),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 81/114 (71%), Gaps = 4/114 (4%)
 Frame = +2

Query  461  RDSSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALD  640
            RD  DVKGLLS+YEASY+R R+D+E+L+   +F+   L S APNL P S+L+K V+ AL 
Sbjct  148  RDIDDVKGLLSIYEASYLR-RTDEEILDKAFSFSKAHLESVAPNL-PESSLKKHVSRALY  205

Query  641  QPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            Q    G+PRVE   FIS+Y E +  S+N  LLR A LDFNLLQM HK ELSEV+
Sbjct  206  QSHVRGIPRVETHLFISLYGEFE--SKNESLLRLAKLDFNLLQMQHKMELSEVT  257


 Score =   110 bits (274),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 86/134 (64%), Gaps = 10/134 (7%)
 Frame = +3

Query  66   ENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDV  245
            +N + RPV NFPP+LW    F+++++D Q+++ Y +EI++LKE+ R  L+    S    +
Sbjct  10   KNEIVRPVANFPPSLWGD-VFNSYTMDIQLSDMYTEEIKVLKEEARNMLI----SRDSKL  64

Query  246  AQKLKFIDLLERLGIAYHFEKEIDDQLR-----HIYIHPVHLNDLETVALQFRLMRQHGY  410
            ++KL FID LERLG++YHFE EI +QL      H+ + P   +DL   +LQFRL+RQH  
Sbjct  65   SEKLAFIDTLERLGLSYHFENEIQEQLTLAFNGHLKLEPEENDDLFINSLQFRLLRQHAL  124

Query  411  NISTHIFSNFVDGN  452
            +  + +F   V+ N
Sbjct  125  DAPSSVFERLVENN  138



>ref|XP_011073749.1| PREDICTED: vetispiradiene synthase 3-like [Sesamum indicum]
Length=554

 Score =   116 bits (290),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 85/118 (72%), Gaps = 7/118 (6%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF+++  SD +GLLSLYEA+++R   +D + EG+ AFA   L+S APNL   S L + V 
Sbjct  142  KFQEALKSDARGLLSLYEAAHLRIHGEDILEEGL-AFATANLKSMAPNL--GSPLRQQVV  198

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL QP H+G PR+E R FIS Y+E +  S+N  LLRFA LD+NLLQMLHK+EL E+S
Sbjct  199  HALVQPLHSGNPRIEARNFISSYEEHE--SKNETLLRFAKLDYNLLQMLHKEELHEIS  254


 Score =   107 bits (268),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 85/143 (59%), Gaps = 9/143 (6%)
 Frame = +3

Query  57   INFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCS  236
            +N  + + RPV NF P+LW    F  ++ D QV E Y+K IE+LK + R ++L   GS  
Sbjct  10   VNCNDEIVRPVANFSPSLWGDQ-FIKYTSDTQVKEEYSKAIEVLKNEVR-SMLTAAGS--  65

Query  237  DDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLND----LETVALQFRLMRQH  404
             ++ + +  ID +ERLGI+YHFE EI+D+L   +    +  D    L TV+L FRL RQH
Sbjct  66   -EMVESMNLIDTIERLGISYHFESEIEDKLERFFSLNTNYEDEAYDLYTVSLHFRLFRQH  124

Query  405  GYNISTHIFSNFVDGNESSETAL  473
            G+ IS+ I S F D N   + AL
Sbjct  125  GHRISSEILSKFKDDNGKFQEAL  147



>ref|XP_011082247.1| PREDICTED: vetispiradiene synthase 3-like [Sesamum indicum]
Length=555

 Score =   109 bits (273),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 91/141 (65%), Gaps = 7/141 (5%)
 Frame = +3

Query  57   INFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCS  236
            ++++  + RP+ NF P+LW    F +  ID QV E+YA+EIE LK++ R  ++    + +
Sbjct  10   VHYQQEIVRPLANFSPSLWGD-LFTSVPIDTQVVESYAQEIESLKKEVRKMIV----ANN  64

Query  237  DDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHL--NDLETVALQFRLMRQHGY  410
             ++A KL  ID +ERLGI+YHFE+EI++Q+ + Y        +DL TVAL FRL+RQHG+
Sbjct  65   KNMAGKLNLIDSIERLGISYHFEREIEEQILNFYNACFSFVSDDLHTVALYFRLLRQHGH  124

Query  411  NISTHIFSNFVDGNESSETAL  473
             IS+ IF  F + +   + +L
Sbjct  125  PISSGIFHKFTESDGKFKNSL  145


 Score =   109 bits (273),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 85/118 (72%), Gaps = 7/118 (6%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S   D KGLLSLYEA+ +RTR +  + E +T FA   L S AP+L  +S L++ V 
Sbjct  140  KFKNSLRGDAKGLLSLYEAANLRTRGEGILDEAIT-FATAHLESIAPHL--SSPLKEQVA  196

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+Q    G+PRVE R +ISVY+E +  S+N+ LLR A +DFNLLQMLH++ELSE+S
Sbjct  197  HALEQCLQRGIPRVEARRYISVYEEYE--SKNDSLLRLAKMDFNLLQMLHREELSELS  252



>ref|XP_009617319.1| PREDICTED: LOW QUALITY PROTEIN: vetispiradiene synthase 3-like 
[Nicotiana tomentosiformis]
Length=551

 Score =   120 bits (300),  Expect(2) = 9e-48, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 89/129 (69%), Gaps = 10/129 (8%)
 Frame = +3

Query  60   NFE-NHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRA---TLLIPTG  227
            N+E + +  PV +F P+LW    F++FS+DNQ AE YA+EIE LKE TR+    +   +G
Sbjct  10   NYEKDEIVSPVSDFSPSLWGDR-FYSFSLDNQAAEKYAQEIETLKELTRSMXDVMSAASG  68

Query  228  SCSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIY-IHP----VHLNDLETVALQFRL  392
            + +  +A+KL  ID++ERLGIAYHFEK+IDD L  IY + P    +  NDL  ++LQFRL
Sbjct  69   TTTLTLAEKLNLIDIVERLGIAYHFEKQIDDMLDQIYNVDPNFEGLEYNDLCILSLQFRL  128

Query  393  MRQHGYNIS  419
            + QHGYNIS
Sbjct  129  LGQHGYNIS  137


 Score = 98.2 bits (243),  Expect(2) = 9e-48, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 68/94 (72%), Gaps = 5/94 (5%)
 Frame = +2

Query  524  SDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQPFHT-GLPRVEHRFFISVYQ  700
            S  ++LE   AF+   L S AP+LK  S L K VTHAL+Q  H   +PRVE R+FIS+Y+
Sbjct  162  SSXDILEEALAFSTAHLESTAPHLK--SPLSKQVTHALEQSLHIKSIPRVETRYFISIYE  219

Query  701  EEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            EE+   +N+ LLRFA LDFN+LQMLHKQELSEVS
Sbjct  220  EEE--LKNDILLRFAKLDFNVLQMLHKQELSEVS  251



>emb|CAC83059.2| putative terpenesynthase-1 [Marrubium vulgare]
Length=545

 Score =   120 bits (300),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 85/118 (72%), Gaps = 7/118 (6%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  SD KGLLSLYEASY+R   D ++ E +  FA T L+S APNL   S L K V 
Sbjct  134  KFQESLKSDAKGLLSLYEASYLRIHGDTQLDEAID-FATTNLKSMAPNL--GSPLRKQVE  190

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            +AL Q  H GLPRVE R FIS+Y+EE +  +N+ LLRFA LDFNLLQ+LHK+EL E+S
Sbjct  191  NALVQSLHFGLPRVEARHFISIYEEEQQ--KNHTLLRFAKLDFNLLQILHKEELCELS  246


 Score = 98.2 bits (243),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 81/141 (57%), Gaps = 19/141 (13%)
 Frame = +3

Query  81   RPVDNFPPT--LWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQK  254
            RP  NF P+  LW    F  ++ D QV E Y+K+IE+LK + ++ +    G   D +   
Sbjct  8    RPFANFSPSPSLWGDQ-FTKYNSDPQVKEKYSKQIEVLKNEVKSMVTAQGGKMVDTI---  63

Query  255  LKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLN--------DLETVALQFRLMRQHGY  410
              FID +ERLGIAYHF+ EI++ ++  +    +LN        DL TVAL FRL RQHG+
Sbjct  64   -NFIDTMERLGIAYHFKDEIEETIQQFF----NLNTNYEDEAYDLYTVALHFRLFRQHGH  118

Query  411  NISTHIFSNFVDGNESSETAL  473
             IS  IF  ++DGN   + +L
Sbjct  119  PISCDIFGKWIDGNGKFQESL  139



>ref|XP_006354694.1| PREDICTED: viridiflorene synthase-like [Solanum tuberosum]
Length=554

 Score =   111 bits (278),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 89/142 (63%), Gaps = 6/142 (4%)
 Frame = +3

Query  57   INFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCS  236
            +N EN + RP  NF P++W    F   + DNQ++E   +EIE LKE+ +  ++  T   S
Sbjct  8    VNHENGIFRPEANFSPSMWGN-VFRNSTKDNQISEKVVEEIEALKEEVKHMIISTT---S  63

Query  237  DDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIY-IHPVH-LNDLETVALQFRLMRQHGY  410
            +D+ QK+  ID LERLGI YHFEKEI+ QL  I+ ++ +H  +DL  V+L FRL RQHGY
Sbjct  64   NDIEQKVHLIDTLERLGIYYHFEKEIEHQLSKIFDLNFIHEEDDLYNVSLYFRLFRQHGY  123

Query  411  NISTHIFSNFVDGNESSETALM  476
             IS+  F+ F D N   +  L+
Sbjct  124  PISSDCFNQFKDTNGKFKKTLL  145


 Score =   104 bits (260),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 79/118 (67%), Gaps = 6/118 (5%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF+ +   DVKG+LSLYEA++VR +  D  LE    FA   L    PN   +STLEK VT
Sbjct  139  KFKKTLLRDVKGMLSLYEAAHVR-KHGDATLEEALIFATFHLERITPN-TLDSTLEKQVT  196

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL Q  H G+PR E  F IS+Y+E    SRN +LLR A LD+NL+Q+LHK+ELSE++
Sbjct  197  HALMQSHHRGIPRAEAHFNISIYEE--CGSRNEKLLRLAKLDYNLVQVLHKEELSELT  252



>gb|EYU21983.1| hypothetical protein MIMGU_mgv1a023510mg [Erythranthe guttata]
Length=559

 Score =   109 bits (273),  Expect(2) = 9e-46, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 75/112 (67%), Gaps = 6/112 (5%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            + D KG+LSLYEASY+R R  +E+L+    F    L S APNL P S L+K V HALDQ 
Sbjct  155  NDDTKGVLSLYEASYLR-RQGEEILDKAFTFCKANLESIAPNL-PESPLKKQVLHALDQS  212

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNE-LLRFAILDFNLLQMLHKQELSEV  799
                +PRVE  +FIS+Y   DES   NE LLR A LDFNLLQMLHK+EL EV
Sbjct  213  LFRSIPRVESHYFISLY---DESKPKNESLLRLAKLDFNLLQMLHKKELYEV  261


 Score =   102 bits (253),  Expect(2) = 9e-46, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 91/148 (61%), Gaps = 12/148 (8%)
 Frame = +3

Query  54   AINFENHLPRPVD-NFPPTLWARYCFHAFSIDN-QVAEAYAKEIEILKEQTRATLLIPTG  227
             +N EN + RPV  NFPP+LW    F +F++++ Q+++ Y +EI++LKE+TR  ++    
Sbjct  10   TVNSENDIVRPVTANFPPSLWDG-LFSSFNMEDFQLSDTYTEEIKVLKEETRNMIV----  64

Query  228  SCSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLR-----HIYIHPVHLNDLETVALQFRL  392
            S    +++KL  ID +ERLG++YHFE EI  QL      H  + P   +DL  +ALQFRL
Sbjct  65   SGDSKLSEKLVLIDTIERLGLSYHFENEIQQQLTLAFNGHFKLDPEEEDDLFIIALQFRL  124

Query  393  MRQHGYNISTHIFSNFVDGNESSETALM  476
            +RQ   +  + IF+ F + N   + +L+
Sbjct  125  LRQRALDAPSSIFNRFTENNGEFKKSLV  152



>gb|EYU43546.1| hypothetical protein MIMGU_mgv1a002915mg [Erythranthe guttata]
Length=626

 Score =   105 bits (262),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 80/131 (61%), Gaps = 12/131 (9%)
 Frame = +3

Query  81   RPV-DNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKL  257
            RPV  NFPP+LW    F +F++D Q+ + Y KEIE+LKE+ R  L+    S    +++KL
Sbjct  82   RPVVANFPPSLWGG-LFSSFNMDIQLLDMYTKEIEVLKEEARNMLI----SGDSKLSEKL  136

Query  258  KFIDLLERLGIAYHFEKEIDDQLR------HIYIHPVHLNDLETVALQFRLMRQHGYNIS  419
              ID +ERLG++YHFE EI  QL       H+ +     +DL  VALQFRL+RQHG +  
Sbjct  137  VLIDTIERLGLSYHFENEIQQQLSLAFNGGHLKLENEESDDLFIVALQFRLLRQHGMDAP  196

Query  420  THIFSNFVDGN  452
            + IF  F + N
Sbjct  197  SSIFKRFTENN  207


 Score =   103 bits (258),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 78/109 (72%), Gaps = 4/109 (4%)
 Frame = +2

Query  473  DVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQPFH  652
            +VKG+LSLYEA+Y+R R  +E+++   +F+   L   APNL   S L+K V HALDQ F 
Sbjct  220  EVKGVLSLYEATYLR-RQGEEIMDKAFSFSKAHLEFVAPNLT-ESPLKKQVLHALDQSFF  277

Query  653  TGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEV  799
             G+PRVE R FIS+Y E+DES+ +  LLR A LDFNLLQM HK+EL +V
Sbjct  278  RGIPRVESRNFISLY-EQDESN-SESLLRLAKLDFNLLQMHHKEELCQV  324



>emb|CDP07837.1| unnamed protein product [Coffea canephora]
Length=553

 Score =   111 bits (278),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 86/127 (68%), Gaps = 7/127 (6%)
 Frame = +2

Query  428  FQQLC*RK*KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKP  601
            F Q    K KF++S  +D +GLLSLYEAS+VRT  D ++LE   AF  T L S  P+L  
Sbjct  134  FDQFIDAKGKFKESLCNDTRGLLSLYEASHVRTHGD-KILEEALAFTTTHLTSGGPHL--  190

Query  602  NSTLEKLVTHALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHK  781
            +STL K V HAL+QP H G+PR E   +IS+Y EEDE S N  LLR A LD++LLQM +K
Sbjct  191  DSTLAKQVKHALEQPLHEGIPRYEAWRYISIY-EEDE-SHNKVLLRLAKLDYHLLQMSYK  248

Query  782  QELSEVS  802
            +EL E++
Sbjct  249  EELCEIT  255


 Score = 96.3 bits (238),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 81/136 (60%), Gaps = 10/136 (7%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSD  239
            N      RP+ +FP  +WA +    F++D Q  E   +EI+ILK +  A++++ TG    
Sbjct  11   NNRQETARPLADFPENIWADH-IAPFTLDKQEYEMCEREIQILKAEV-ASMVLATGKT--  66

Query  240  DVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLN-----DLETVALQFRLMRQH  404
             + ++  FID +ERLG+++HF+ EI++QL+  +    +L      DL + ALQFRL RQH
Sbjct  67   -MTERFDFIDKIERLGVSHHFDIEIENQLQEFFNVYTNLGEYSAYDLSSAALQFRLFRQH  125

Query  405  GYNISTHIFSNFVDGN  452
            G+NIS  IF  F+D  
Sbjct  126  GFNISCGIFDQFIDAK  141



>gb|EYU21979.1| hypothetical protein MIMGU_mgv1a019334mg [Erythranthe guttata]
Length=564

 Score =   112 bits (281),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 80/112 (71%), Gaps = 4/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
             ++++G+LSLYEA+Y+R R  +E+L+   +F+   L S APNL P   L+K V HALDQ 
Sbjct  157  CTEIEGVLSLYEATYLR-RQGEEILDKAFSFSKAYLESVAPNL-PELPLKKQVLHALDQS  214

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
             H G PRVE R FIS+Y+E +  S+N  LLR A LDFNLLQMLHK ELSE++
Sbjct  215  LHRGTPRVESRRFISLYEEVE--SKNESLLRLAKLDFNLLQMLHKNELSELT  264


 Score = 94.4 bits (233),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 77/130 (59%), Gaps = 11/130 (8%)
 Frame = +3

Query  81   RPV-DNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKL  257
            RPV  NFPP+LW    F +F +D Q++  YA+EI++LKE+ R  L     S    +++KL
Sbjct  24   RPVIANFPPSLWDDR-FTSFDMDIQLSSMYAEEIKVLKEEARNML----TSVDIKLSEKL  78

Query  258  KFIDLLERLGIAYHFEKEIDDQLR-----HIYIHPVHLNDLETVALQFRLMRQHGYNIST  422
              ID +ERLG++YHFE EI +QL      H+ +     NDL   +LQFRL+RQH  +  +
Sbjct  79   VLIDTIERLGLSYHFENEIQEQLTLAFNGHLKLELDENNDLFITSLQFRLLRQHALDAPS  138

Query  423  HIFSNFVDGN  452
             IF  F +  
Sbjct  139  SIFKRFTENK  148



>ref|XP_011082260.1| PREDICTED: vetispiradiene synthase 3-like [Sesamum indicum]
Length=554

 Score =   105 bits (263),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 86/135 (64%), Gaps = 6/135 (4%)
 Frame = +3

Query  66   ENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDV  245
            + ++ RPV NF P+LW    F +   D QV+E YAKE+E LKE+ R++++         +
Sbjct  15   QENIVRPVANFSPSLWGD-LFTSCCADTQVSEFYAKEVEELKEKARSSIVAD----GKKL  69

Query  246  AQKLKFIDLLERLGIAYHFEKEIDDQLRHIY-IHPVHLNDLETVALQFRLMRQHGYNIST  422
             +KL  I+ ++RLG++YHFEKEI DQL  I+ +     +DL   ALQFRL+RQHG+++S+
Sbjct  70   HEKLILIETVQRLGLSYHFEKEIQDQLELIFKLENEENDDLFITALQFRLLRQHGFDVSS  129

Query  423  HIFSNFVDGNESSET  467
             +F  F +  +  E+
Sbjct  130  CVFDKFTNNGKFKES  144


 Score =   100 bits (250),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 78/118 (66%), Gaps = 5/118 (4%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S   D+KGLLSLYEA+++R   +  VL+    F+   L S       NS + + V 
Sbjct  140  KFKESLRVDIKGLLSLYEAAHLRYHGET-VLDEALTFSTAHLESYGRQDSSNSMMGRKVR  198

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+Q    G+PR+E R FI+ Y EEDES ++  LLRFA LDFNLLQMLHK+EL EVS
Sbjct  199  HALEQFLQRGIPRIEARHFIAFY-EEDES-KDESLLRFAKLDFNLLQMLHKKELYEVS  254



>emb|CDP18842.1| unnamed protein product [Coffea canephora]
Length=552

 Score =   107 bits (267),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 82/117 (70%), Gaps = 7/117 (6%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  +D+KGLLSLYEA++VRT  D ++LE    F  T L    PN+   STL K V 
Sbjct  142  KFKESLCNDIKGLLSLYEAAHVRTHGD-KILEEALFFTTTHLTREIPNV--GSTLAKKVK  198

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEV  799
            HAL+QP H G+PR E   +IS+Y EEDESS N  LLR A LD++LL ML+K++LSE+
Sbjct  199  HALEQPLHKGIPRYEAYCYISMY-EEDESS-NKLLLRLAKLDYHLLHMLYKRDLSEI  253


 Score = 98.6 bits (244),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 79/137 (58%), Gaps = 11/137 (8%)
 Frame = +3

Query  57   INFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCS  236
            +N ++ + R + +FP  +WA +   +F++D Q  E  AKEIE+LKE+    L I      
Sbjct  10   LNNQHEIVRQLADFPENIWA-HRIASFTLDKQGYEMCAKEIEMLKEEVSRLLAIEK----  64

Query  237  DDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLN-----DLETVALQFRLMRQ  401
              + +K   ID +ERLGI+YHF  +I+DQL+  Y    +       DL   ALQFRL RQ
Sbjct  65   -PMMEKFNLIDNIERLGISYHFGDKIEDQLQEYYDACTNFEKHAECDLSIAALQFRLFRQ  123

Query  402  HGYNISTHIFSNFVDGN  452
            HG+NIS  IF  F+D N
Sbjct  124  HGFNISCGIFDGFLDAN  140



>gb|EYU32629.1| hypothetical protein MIMGU_mgv1a023948mg [Erythranthe guttata]
Length=549

 Score =   111 bits (278),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 83/118 (70%), Gaps = 7/118 (6%)
 Frame = +2

Query  455  KFRD--SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++   SD KGLLSLYEASY+R   +D +LE   AFA + L+S APNL  +S L + V 
Sbjct  137  KFKEVIKSDAKGLLSLYEASYLRVHEED-ILEDALAFATSNLKSIAPNL--SSPLREHVF  193

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL QP H G PR+E R FIS Y E+DE+ +N  LL FA LD+NLLQML+K EL EVS
Sbjct  194  HALVQPLHFGNPRIETRNFISFY-EQDEN-KNETLLIFAKLDYNLLQMLYKDELREVS  249


 Score = 94.0 bits (232),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 77/137 (56%), Gaps = 17/137 (12%)
 Frame = +3

Query  63   FENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDD  242
             EN + RPV NF P+LW    F  ++ D QV E Y++ I++LK +    L     +    
Sbjct  7    LENEIVRPVSNFSPSLWGD-QFINYTSDLQVREEYSERIQVLKNEVWTML----KANETK  61

Query  243  VAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLN--------DLETVALQFRLMR  398
            +   L  ID +ERLGI+YHFE EI+++L   +    +LN        DL TV+L FR+ R
Sbjct  62   IFDGLNLIDTIERLGISYHFENEIEEKLEQFF----NLNTNYEDETYDLYTVSLHFRVFR  117

Query  399  QHGYNISTHIFSNFVDG  449
            QHG+ IS+ IF  F DG
Sbjct  118  QHGHRISSDIFRKFKDG  134



>ref|XP_009771803.1| PREDICTED: 5-epi-aristolochene synthase-like, partial [Nicotiana 
sylvestris]
Length=196

 Score =   145 bits (365),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 92/131 (70%), Gaps = 5/131 (4%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSD  239
            N+E  + RPV +F P+LW    F +FSIDNQVAE YA+EIE LKEQTR ++L+ TG    
Sbjct  8    NYEEEIVRPVADFSPSLWGDQ-FLSFSIDNQVAEKYAQEIEALKEQTR-SMLLATGR---  62

Query  240  DVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNIS  419
             +A  L  ID +ERLGI+YHFEKEIDD L  IY    + NDL T ALQFRL+RQHG+NIS
Sbjct  63   KLADTLNLIDTIERLGISYHFEKEIDDILDQIYNQNSNCNDLCTSALQFRLLRQHGFNIS  122

Query  420  THIFSNFVDGN  452
              IFS F D N
Sbjct  123  PEIFSKFQDEN  133


 Score = 58.5 bits (140),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 46/65 (71%), Gaps = 5/65 (8%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  SDV GLL+LYEAS+VRT + D +LE   AF+   L SA P+LK  S L + VT
Sbjct  135  KFKESLASDVLGLLNLYEASHVRTHAGD-ILEDALAFSTIHLESAVPHLK--SPLREQVT  191

Query  629  HALDQ  643
            HAL+Q
Sbjct  192  HALEQ  196



>sp|Q49SP5.1|TPGAS_POGCB RecName: Full=Germacrene A synthase; AltName: Full=PatTpsCF2 
[Pogostemon cablin]
 gb|AAS86321.1| germacrene A synthase [Pogostemon cablin]
Length=554

 Score =   107 bits (268),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 78/118 (66%), Gaps = 7/118 (6%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  SD KGLLSLYEA  +RT  D  +L+    FA   L+S A NL   S L K V 
Sbjct  141  KFKESIKSDAKGLLSLYEACCLRTHGDT-LLDEALVFATASLKSMAANLA--SPLRKQVE  197

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL Q  H G+PRVE R FI+ Y+EE+   +N  LLRFA LDFN LQ LHK+ELSE+S
Sbjct  198  HALFQHLHFGIPRVEARHFITFYEEEEH--KNEMLLRFAKLDFNALQALHKEELSEIS  253


 Score = 94.7 bits (234),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 77/134 (57%), Gaps = 14/134 (10%)
 Frame = +3

Query  81   RPVDNFPP--TLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLL-IPTGSCSDDVAQ  251
            RP  NF P  +LW     +  S   Q++  Y +EIE LK + +  L   P G  +D V  
Sbjct  10   RPFANFSPNPSLWGDQFINHKSKTQQISRIYLEEIEGLKNEVKCMLTSTPEGKMADTV--  67

Query  252  KLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLN-------DLETVALQFRLMRQHGY  410
                ID LERLG++YHFEKEI+++++H++      N       DL T AL FRL RQHGY
Sbjct  68   --NLIDTLERLGVSYHFEKEIEEKMKHLFNLIKADNYKDHEGCDLYTDALHFRLFRQHGY  125

Query  411  NISTHIFSNFVDGN  452
             IS+ IF+ ++DGN
Sbjct  126  PISSGIFNKWMDGN  139



>gb|AAX16076.1| putative sesquiterpene synthase [Perilla frutescens var. frutescens]
Length=550

 Score =   112 bits (279),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 77/111 (69%), Gaps = 5/111 (5%)
 Frame = +2

Query  470  SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQPF  649
            SD KGLLSLYEASY+RTR +  +L+    FA   L+S AP L+  S L K V HAL QP 
Sbjct  144  SDGKGLLSLYEASYLRTRGE-TILDEALDFATASLKSIAPCLE--SPLGKQVVHALVQPL  200

Query  650  HTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            H G PR+E R FIS+Y+E +   RN  LL FA +D+NLLQMLHK+EL +VS
Sbjct  201  HFGTPRIEARNFISIYEEYE--GRNESLLMFAKIDYNLLQMLHKEELHQVS  249


 Score = 90.1 bits (222),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 79/143 (55%), Gaps = 14/143 (10%)
 Frame = +3

Query  66   ENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDV  245
            +NH  RPV +F P+LW        S   QV + Y+  +++LK++ +  +  P     D  
Sbjct  7    QNH--RPVADFSPSLWGDQFIKHDSC-PQVEKKYSNTVDVLKKEVKGMITAPGTKMVD--  61

Query  246  AQKLKFIDLLERLGIAYHFEKEIDDQLRHIY-IHPVHLND------LETVALQFRLMRQH  404
               ++ ID +ERLG++YHF+ EI+ +L+  + + P + ND      L TVAL FRL RQH
Sbjct  62   --TMELIDTIERLGVSYHFQDEIEHKLQQFFDLKPDYCNDDDDAYDLHTVALHFRLFRQH  119

Query  405  GYNISTHIFSNFVDGNESSETAL  473
            GY IS  IF  +V G+   E  L
Sbjct  120  GYRISCDIFGRWVHGDGKFEEIL  142



>ref|XP_007021121.1| Delta-cadinene synthase isozyme A [Theobroma cacao]
 gb|EOY12646.1| Delta-cadinene synthase isozyme A [Theobroma cacao]
Length=586

 Score =   106 bits (265),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 77/112 (69%), Gaps = 5/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            +SDV+GLL LYEASY+R   +D +L+   +FA T L   AP L  +  L + VTHAL Q 
Sbjct  148  TSDVRGLLELYEASYLRVHGED-LLDDAISFATTHLTLVAPTL--DYPLSEQVTHALKQS  204

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
               GLPRVE R +IS+YQ  D+ S N  LL+FA +DFNLLQ+LH++ELSE+ 
Sbjct  205  IRRGLPRVEARQYISLYQ--DDESHNKALLQFAKIDFNLLQLLHRKELSEIC  254


 Score = 94.7 bits (234),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 79/141 (56%), Gaps = 9/141 (6%)
 Frame = +3

Query  51   MAINFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGS  230
            ++ N EN   RP  +F P +W     +    D  +      + E LKE+ R TLL P   
Sbjct  16   ISSNTEN---RPKADFHPGIWGDVFLNC--PDKDIDATTELQYEELKEEVRRTLLAPM--  68

Query  231  CSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGY  410
              DD  QKL  ID ++RLG+ YHFEKEI+D L  IY      NDL T AL+FR++R+HG+
Sbjct  69   --DDSNQKLPLIDAVQRLGVNYHFEKEIEDALEQIYHDDNDANDLYTTALRFRILREHGF  126

Query  411  NISTHIFSNFVDGNESSETAL  473
            ++S   F+ F D   + +++L
Sbjct  127  DVSCDAFNKFKDDKGNFKSSL  147



>gb|AAX16077.1| valencene synthase [Perilla frutescens var. frutescens]
Length=550

 Score =   110 bits (274),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 81/118 (69%), Gaps = 7/118 (6%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++   SD K LLSLYEASY+RTR +  +L+    FAA  L+S AP+L+  S L K V 
Sbjct  137  KFKEGLKSDGKSLLSLYEASYLRTRGE-TILDEALDFAAASLKSIAPHLQ--SPLGKQVV  193

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL QP H G PR+E R FIS+Y+E +    N  LLR A LD+NLLQMLHK+EL +VS
Sbjct  194  HALVQPLHFGNPRIEARNFISIYEEYE--GMNEALLRLAKLDYNLLQMLHKEELHQVS  249


 Score = 90.5 bits (223),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 80/143 (56%), Gaps = 14/143 (10%)
 Frame = +3

Query  66   ENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDV  245
            +NH  RPV +F P+LW    F  +    QV + Y+  +++LK++ +  +  P     D  
Sbjct  7    QNH--RPVADFSPSLWGDQ-FVKYDSCPQVQKKYSNTVDVLKKEVKGMITAPGTKMVD--  61

Query  246  AQKLKFIDLLERLGIAYHFEKEIDDQLRHIY-IHPVHLND------LETVALQFRLMRQH  404
               ++ ID +ERLG+++HF+ EI+ +L+  + +   + ND      L TVAL FRL RQH
Sbjct  62   --TMELIDTIERLGVSFHFQDEIEQKLQQFFDLKTDYCNDGDDAYDLYTVALHFRLFRQH  119

Query  405  GYNISTHIFSNFVDGNESSETAL  473
            GY IS  IF  ++DGN   +  L
Sbjct  120  GYRISCDIFGRWIDGNGKFKEGL  142



>ref|XP_009764783.1| PREDICTED: viridiflorene synthase-like [Nicotiana sylvestris]
Length=488

 Score =   106 bits (264),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 78/112 (70%), Gaps = 5/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            S+DV G++ LYEAS+VRT  +  +L+   AF  T L+S   +LK  S L+K VTHAL+Q 
Sbjct  101  STDVLGMVCLYEASHVRTHGE-YILDEALAFTTTHLQSTVQHLK--SALKKQVTHALEQS  157

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
               G+PR E R++IS Y E +  S+N+ LLRFA LDFNLLQML+K EL E+S
Sbjct  158  LQKGIPRAEIRYYISNYDEGE--SKNDVLLRFAKLDFNLLQMLYKNELGEIS  207


 Score = 93.6 bits (231),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 69/113 (61%), Gaps = 13/113 (12%)
 Frame = +3

Query  177  IEILKEQTRATLLIPTGSCSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIY-----I  341
            +E +KE+TR+ LL    +C   V +KL  ID++ERLGIAYHFEK+ID+ L HI+      
Sbjct  1    METMKEKTRSMLL----ACGKTVYEKLNLIDIIERLGIAYHFEKQIDNMLYHIHNADPDF  56

Query  342  HPVHLNDLETVALQFRLMRQHGYNISTHIFSNFVDGN----ESSETALM*RVC  488
                 NDL   ALQFR++RQHGYNIS  +F  F  GN     S  T ++  VC
Sbjct  57   EGHEYNDLYICALQFRMLRQHGYNISPGVFRKFQYGNGQFKRSLSTDVLGMVC  109



>gb|AGB14625.1| germacrene-D synthase [Malus domestica]
Length=553

 Score =   104 bits (260),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 79/118 (67%), Gaps = 6/118 (5%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S   DV GLLSLYEA+++R   + E+L+    F  T L SA   L P   L K VT
Sbjct  140  KFKESLVDDVVGLLSLYEATHLRIHGE-EILDEALTFTTTNLESATFRLSP--PLAKAVT  196

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+QP   GLPRVE R+++SVYQE  ES  N  LL FA LDFN LQ +H++ELSE++
Sbjct  197  HALNQPLRKGLPRVEARYYLSVYQELRESP-NETLLTFAKLDFNRLQRVHQKELSEIT  253


 Score = 94.4 bits (233),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 82/133 (62%), Gaps = 6/133 (5%)
 Frame = +3

Query  78   PRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKL  257
            P+P   F P++W  +     S+  +V     + ++ LKE+ R+ L+    +  ++V+QKL
Sbjct  20   PKPSATFSPSIWGDHFLSYASL--EVDAELEQHVQELKEEVRSMLM----TSPENVSQKL  73

Query  258  KFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNISTHIFSN  437
              ID ++RLG++YHF  EI++ L+ I+     L+DL TVAL+FRL+RQ GYN+S  +F+ 
Sbjct  74   NLIDDIQRLGVSYHFGNEIEEILQKIHQSSYDLDDLYTVALRFRLLRQQGYNVSCDLFNK  133

Query  438  FVDGNESSETALM  476
              DG+   + +L+
Sbjct  134  LKDGDGKFKESLV  146



>ref|XP_011005621.1| PREDICTED: (-)-germacrene D synthase-like [Populus euphratica]
Length=554

 Score =   104 bits (259),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 79/115 (69%), Gaps = 5/115 (4%)
 Frame = +2

Query  458  FRDSSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHAL  637
            F+ S+DV+G+LSLYEA+++  R +D +L+   AF    L+S A +  P+  L   V+HAL
Sbjct  145  FKQSNDVRGILSLYEAAHLAVRGED-ILDEALAFTTIHLKSMATS--PDCPLAAKVSHAL  201

Query  638  DQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
             QP   G+PR+E R +IS+YQ  DE S N  LLR A L+FNL+Q LHK+E++E+S
Sbjct  202  KQPIRRGVPRLESRRYISIYQ--DEPSCNKNLLRLAKLNFNLVQELHKEEVAEIS  254


 Score = 92.8 bits (229),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 73/128 (57%), Gaps = 8/128 (6%)
 Frame = +3

Query  69   NHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVA  248
            N   R   NF P++W          D        +EIE L+EQ +  LL      + D +
Sbjct  19   NETIRRTANFRPSIWGDKFISHLPRDKVHETIELQEIEKLREQFKRELL------ASDSS  72

Query  249  QKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHL--NDLETVALQFRLMRQHGYNIST  422
            Q+L  ID ++RLG+AYHFE EI++ L+HIY + + +  +DL   AL FRL+RQHGYN+S 
Sbjct  73   QQLNLIDAIQRLGVAYHFETEIEEALQHIYNNRIGMEDDDLYNTALGFRLLRQHGYNVSC  132

Query  423  HIFSNFVD  446
             IF+ F D
Sbjct  133  DIFNKFKD  140



>ref|XP_011080424.1| PREDICTED: gamma-cadinene synthase-like [Sesamum indicum]
Length=558

 Score =   101 bits (251),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 86/134 (64%), Gaps = 12/134 (9%)
 Frame = +3

Query  84   PVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLKF  263
            P+ ++ P++W    F +FS+DN+V E +A+ I+ LKE+ R  +L+  GS +D    KL  
Sbjct  22   PITSYSPSIWGD-TFTSFSLDNKVQEKHAEAIKELKEEAR-NMLLAEGSKAD----KLVL  75

Query  264  IDLLERLGIAYHFEKEIDDQLRHIYIHPV-----HLNDLETVALQFRLMRQHGYNISTHI  428
            ID +ERLG+ YHF ++I++QLR I+         H  DL T ALQFRL+RQH Y++S  +
Sbjct  76   IDTIERLGVGYHFGQQIENQLREIFQSQFEDKDQHHYDLFTTALQFRLLRQHRYSVSCDV  135

Query  429  FSNFV-DGNESSET  467
            F+ F  +GN+  ET
Sbjct  136  FNKFKGEGNKFEET  149


 Score = 95.1 bits (235),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 72/112 (64%), Gaps = 5/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            SSD KGLLSLYEA+ VR   +D VLE   AF   +L+     L+P   L+  V  AL+QP
Sbjct  151  SSDAKGLLSLYEAANVRIHGED-VLEDAVAFTTHQLKHMVQQLEP--VLQCQVKRALEQP  207

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
             H G+PRVE R +IS Y  E + S+N  LL+ A LDFN LQ L+K+EL ++S
Sbjct  208  LHRGVPRVEARHYISFY--EMDKSKNKILLKLAKLDFNYLQNLYKKELHDLS  257



>ref|XP_002274781.1| PREDICTED: valencene synthase [Vitis vinifera]
 emb|CAN64791.1| hypothetical protein VITISV_001915 [Vitis vinifera]
 gb|ADR74227.1| alpha-humulene synthase [synthetic construct]
Length=555

 Score = 99.0 bits (245),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 75/111 (68%), Gaps = 5/111 (5%)
 Frame = +2

Query  470  SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQPF  649
            SDV+G+L LYEA+++R R +D +L+   AF  T LRS   +L+      + V HAL QP 
Sbjct  151  SDVRGMLGLYEAAHLRVRGED-ILDEALAFTTTHLRSMVEHLE--YPFAEQVVHALKQPI  207

Query  650  HTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
              GL R+E R++IS+YQ  DE+S +  LL+ A LDFNL+Q LHK+ELS +S
Sbjct  208  RRGLERLEARWYISIYQ--DETSHDRTLLKLAKLDFNLVQSLHKEELSNIS  256


 Score = 97.1 bits (240),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 87/137 (64%), Gaps = 10/137 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYA-KEIEILKEQTRATLLIPTGSCSDDVAQKL  257
            RPV  + P +W    F + + +++V  A   K++E LKE+ R  L+   G+ S    Q+L
Sbjct  19   RPVVKYHPNIWGDQ-FLSHTPEDEVTRACKEKQLEDLKEEIRRKLMNTAGNTS----QQL  73

Query  258  KFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLE----TVALQFRLMRQHGYNISTH  425
            KFID ++RLG+AYHFE+EI++ L+HIY    + +D+E     VALQFRL+RQ G+NIS  
Sbjct  74   KFIDAVQRLGLAYHFEREIEEVLQHIYDSYPNGDDMEGDIYNVALQFRLLRQAGFNISCG  133

Query  426  IFSNFVDGNESSETALM  476
            +F+ F D   + + AL+
Sbjct  134  LFNEFKDEKGNFKKALI  150



>emb|CBI31294.3| unnamed protein product [Vitis vinifera]
Length=584

 Score = 99.0 bits (245),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 75/111 (68%), Gaps = 5/111 (5%)
 Frame = +2

Query  470  SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQPF  649
            SDV+G+L LYEA+++R R +D +L+   AF  T LRS   +L+      + V HAL QP 
Sbjct  180  SDVRGMLGLYEAAHLRVRGED-ILDEALAFTTTHLRSMVEHLE--YPFAEQVVHALKQPI  236

Query  650  HTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
              GL R+E R++IS+YQ  DE+S +  LL+ A LDFNL+Q LHK+ELS +S
Sbjct  237  RRGLERLEARWYISIYQ--DETSHDRTLLKLAKLDFNLVQSLHKEELSNIS  285


 Score = 96.7 bits (239),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 87/137 (64%), Gaps = 10/137 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYA-KEIEILKEQTRATLLIPTGSCSDDVAQKL  257
            RPV  + P +W    F + + +++V  A   K++E LKE+ R  L+   G+ S    Q+L
Sbjct  48   RPVVKYHPNIWGDQ-FLSHTPEDEVTRACKEKQLEDLKEEIRRKLMNTAGNTS----QQL  102

Query  258  KFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLE----TVALQFRLMRQHGYNISTH  425
            KFID ++RLG+AYHFE+EI++ L+HIY    + +D+E     VALQFRL+RQ G+NIS  
Sbjct  103  KFIDAVQRLGLAYHFEREIEEVLQHIYDSYPNGDDMEGDIYNVALQFRLLRQAGFNISCG  162

Query  426  IFSNFVDGNESSETALM  476
            +F+ F D   + + AL+
Sbjct  163  LFNEFKDEKGNFKKALI  179



>ref|XP_002275408.3| PREDICTED: valencene synthase [Vitis vinifera]
 emb|CBI31300.3| unnamed protein product [Vitis vinifera]
 gb|ADR74222.1| (E)-beta-caryophyllene synthase [synthetic construct]
Length=555

 Score =   102 bits (253),  Expect(2) = 6e-41, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 89/137 (65%), Gaps = 10/137 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEA-YAKEIEILKEQTRATLLIPTGSCSDDVAQKL  257
            RPV  + P++W    F +++ +++V  A   K++E LKE+ R  L+   G+ S    QKL
Sbjct  19   RPVVKYHPSIWGD-QFMSYTPEDEVTRACKEKQLEDLKEEIRRKLMNTAGNTS----QKL  73

Query  258  KFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLE----TVALQFRLMRQHGYNISTH  425
            KFID ++RLG+AYHFE+EI++ L+HIY    + +D+E     VALQFRL+RQ G+NIS  
Sbjct  74   KFIDAVQRLGVAYHFEREIEEVLQHIYDSYPNGDDMEGGIYNVALQFRLLRQAGFNISCG  133

Query  426  IFSNFVDGNESSETALM  476
            +F+ F D   + + AL+
Sbjct  134  LFNEFKDEKGNFKKALV  150


 Score = 93.6 bits (231),  Expect(2) = 6e-41, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 73/111 (66%), Gaps = 5/111 (5%)
 Frame = +2

Query  470  SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQPF  649
            SDV+G+L LYEA+++R   +D +L+   A   T LRS   +L+      + V HAL QP 
Sbjct  151  SDVRGMLGLYEAAHLRVHGED-ILDEALALTTTHLRSMVEHLE--YPFAEQVAHALKQPI  207

Query  650  HTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
              GL R+E R++IS+YQ  DE+S +  LL+ A LDFNL+Q LHK+ELS ++
Sbjct  208  RKGLERLEARWYISIYQ--DETSHDRTLLKLAKLDFNLVQSLHKEELSNIT  256



>ref|XP_009358866.1| PREDICTED: (-)-germacrene D synthase-like [Pyrus x bretschneideri]
Length=556

 Score =   104 bits (259),  Expect(2) = 6e-41, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 79/118 (67%), Gaps = 6/118 (5%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S   DV GLLSLYEA+++R   + E+L+    F  T L SA   L P   L K VT
Sbjct  143  KFKESLVDDVAGLLSLYEATHLRIHGE-EILDEALTFTRTNLESATFRLSP--PLAKAVT  199

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+QP   GLPRVE R+++SVYQE  ES  N  LL FA LDFN LQ +H++ELSE++
Sbjct  200  HALNQPLRKGLPRVEARYYLSVYQELRESP-NETLLMFAKLDFNRLQRVHQKELSEIT  256


 Score = 91.3 bits (225),  Expect(2) = 6e-41, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 81/139 (58%), Gaps = 6/139 (4%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSD  239
             F+ H P+P   F P++W  +     S+  +V     + ++ LKE+ R  L     +  +
Sbjct  17   TFDVHRPKPSSTFSPSIWGDHFLSYASL--EVDAELEQHVQELKEEVRRML----TTSLE  70

Query  240  DVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNIS  419
            +V+QKL  ID ++ LG++YHF  EI++ L+ I+     L+DL T AL+FRL+RQ GYNIS
Sbjct  71   NVSQKLNLIDDIQHLGVSYHFGNEIEEILQKIHKSSYDLDDLYTAALRFRLLRQQGYNIS  130

Query  420  THIFSNFVDGNESSETALM  476
              +F+ F D +   + +L+
Sbjct  131  CDLFNKFKDSDGKFKESLV  149



>ref|XP_009338863.1| PREDICTED: (-)-germacrene D synthase-like [Pyrus x bretschneideri]
Length=556

 Score =   104 bits (259),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 79/118 (67%), Gaps = 6/118 (5%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S   DV GLLSLYEA+++R   + E+L+    F  T L SA   L P   L K VT
Sbjct  143  KFKESLVDDVAGLLSLYEATHLRIHGE-EILDEALTFTRTNLESATFRLSP--PLAKAVT  199

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+QP   GLPRVE R+++SVYQE  ES  N  LL FA LDFN LQ +H++ELSE++
Sbjct  200  HALNQPLRKGLPRVEARYYLSVYQELRESP-NETLLMFAKLDFNRLQRVHQKELSEIT  256


 Score = 90.9 bits (224),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 81/139 (58%), Gaps = 6/139 (4%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSD  239
             F+ H P+P   F P++W  +     S+  +V     + ++ LKE+ R  L     +  +
Sbjct  17   TFDVHRPKPSTTFSPSIWGDHFLSYASL--EVDAELEQHVQELKEEVRRML----TTSLE  70

Query  240  DVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNIS  419
            +V+QKL  ID ++ LG++YHF  EI++ L+ I+     L+DL T AL+FRL+RQ GYNIS
Sbjct  71   NVSQKLNLIDDIQHLGVSYHFGNEIEEILQKIHKSSYDLDDLYTAALRFRLLRQQGYNIS  130

Query  420  THIFSNFVDGNESSETALM  476
              +F+ F D +   + +L+
Sbjct  131  CDLFNKFKDSDGKFKESLV  149



>gb|AII32471.1| terpene synthase [Populus trichocarpa]
Length=553

 Score =   102 bits (255),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 77/115 (67%), Gaps = 5/115 (4%)
 Frame = +2

Query  458  FRDSSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHAL  637
            F+ S+DV+G+L LYEA+++    +D +L+   AF    L+S A +  PN  L   V+HAL
Sbjct  144  FKQSNDVRGILGLYEAAHLAVHGED-ILDEALAFTTIHLKSMASS--PNCPLTAKVSHAL  200

Query  638  DQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
             QP   G+PR+E R +IS+YQ  DE S N  LLR A L+FNL+Q LHK+EL+E++
Sbjct  201  KQPIQRGVPRLESRRYISIYQ--DEPSCNKTLLRLAKLNFNLVQELHKEELAEIT  253


 Score = 91.7 bits (226),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 75/128 (59%), Gaps = 6/128 (5%)
 Frame = +3

Query  69   NHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVA  248
            N + R   N+ P++W          D        +EIE L+EQ +  LL    + + + +
Sbjct  16   NEIIRRTANYHPSIWGDQFISHLPKDKVHEAIELQEIEKLREQFKRELL----AAASNSS  71

Query  249  QKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHL--NDLETVALQFRLMRQHGYNIST  422
            Q+L  ID ++RLG+AYHFE EI++ L+HIY + + +  +DL   AL FRL+RQHGYN+S 
Sbjct  72   QQLDLIDAIQRLGVAYHFETEIEEALQHIYNNRIDMEDDDLYNTALGFRLLRQHGYNVSC  131

Query  423  HIFSNFVD  446
             IF+ F D
Sbjct  132  DIFNKFKD  139



>gb|KHG04498.1| (+)-delta-cadinene synthase isozyme A [Gossypium arboreum]
 gb|KHG30537.1| (+)-delta-cadinene synthase isozyme A [Gossypium arboreum]
Length=555

 Score =   101 bits (252),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 74/112 (66%), Gaps = 5/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            +SDV+GLL LYEASY+R   +D +L+   +F   +L  A P L  +  L + V HAL Q 
Sbjct  149  TSDVQGLLELYEASYMRVHGED-ILDEAISFTTAQLTLALPTL--DHPLSEQVGHALKQS  205

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
               GLPRVE R FIS+YQ  D  S N  LL+FA +DFNLLQ+LH++ELSE+ 
Sbjct  206  IRRGLPRVEARNFISIYQ--DLESHNKSLLQFAKIDFNLLQLLHRKELSEIC  255


 Score = 91.3 bits (225),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 79/138 (57%), Gaps = 14/138 (10%)
 Frame = +3

Query  54   AINFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSC  233
            AI+ EN   RP  +F P +W     +    D  +  A   + E  K Q R  ++ P    
Sbjct  15   AISSEN---RPKADFHPGIWGDMFLNC--PDTDIDAATELQYEEFKAQVRKMIMEPV---  66

Query  234  SDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVH---LNDLETVALQFRLMRQH  404
             DD  QKL FID ++RLG++YHFEKEI+D+L +IY    +    NDL T AL+FRL+R+H
Sbjct  67   -DDSNQKLPFIDAVQRLGVSYHFEKEIEDELENIYRDTNNNDAENDLYTTALRFRLLREH  125

Query  405  GYNISTHIFSNFVD--GN  452
            G++IS   F+ F D  GN
Sbjct  126  GFDISCDAFNKFKDEAGN  143



>ref|XP_009344725.1| PREDICTED: (-)-germacrene D synthase-like [Pyrus x bretschneideri]
Length=555

 Score =   100 bits (249),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 77/117 (66%), Gaps = 6/117 (5%)
 Frame = +2

Query  458  FRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTH  631
            F++S   DV GLLSLYEA+++R   + E+L+    F  T L SA   L P   L K VTH
Sbjct  144  FKESLVDDVVGLLSLYEATHLRIHGE-EILDEALTFTMTNLESATFRLSP--PLAKAVTH  200

Query  632  ALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            AL+QP   GLPRVE R+ +SVYQE  ES  N  LL FA LDFN LQ +H++ELSE++
Sbjct  201  ALNQPLRKGLPRVEARYHLSVYQELRESP-NETLLTFAKLDFNRLQRVHQKELSEIT  256


 Score = 92.4 bits (228),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 82/139 (59%), Gaps = 6/139 (4%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSD  239
             F+ H P+P   F P++W  +     S+  +V     + ++ LKE+ R  L     +  +
Sbjct  17   TFDVHRPKPSATFSPSIWGDHFLSYASL--EVDAELEQHVQELKEEVRRML----TTSPE  70

Query  240  DVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNIS  419
            +V+QKL  ID ++ LG++YHF  EI++ L+ I+     L+DL T AL FRL+RQ GYN+S
Sbjct  71   NVSQKLNLIDDIQHLGVSYHFGNEIEEILQKIHKSSYDLDDLYTAALLFRLLRQQGYNVS  130

Query  420  THIFSNFVDGNESSETALM  476
              +F+ F DG+ + + +L+
Sbjct  131  CDLFNKFKDGDGNFKESLV  149



>ref|NP_001268213.1| (-)-germacrene D synthase [Vitis vinifera]
 sp|Q6Q3H3.1|TPSGD_VITVI RecName: Full=(-)-germacrene D synthase [Vitis vinifera]
 gb|AAS66357.1| (-)-germacrene D synthase [Vitis vinifera]
Length=557

 Score =   100 bits (250),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 76/112 (68%), Gaps = 5/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            SSDV+G+LSLYEA++ R   +D +L+   AF  T L+SA  +   ++ L + V HAL QP
Sbjct  151  SSDVRGMLSLYEATHFRVHGED-ILDEALAFTTTHLQSATKH--SSNPLAEQVVHALKQP  207

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
               GLPR+E R + SVYQ +D  S N  LL+ A LDFNLLQ LH++ELS++S
Sbjct  208  IRKGLPRLEARHYFSVYQADD--SHNKALLKLAKLDFNLLQKLHQKELSDIS  257


 Score = 91.3 bits (225),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 86/154 (56%), Gaps = 8/154 (5%)
 Frame = +3

Query  24   ISISRIGHIMA--INFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQ  197
            +S+   G ++A   N    + R   NF P++W  +     S      +   + ++ LKE+
Sbjct  1    MSVQSSGVLLAPSKNLSPEVGRRCANFHPSIWGDHFLSYASEFTNTDDHLKQHVQQLKEE  60

Query  198  TRATLLIPTGSCSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPV--HLNDLET  371
             R  L+    +  DD AQKL  ID ++RLG+AYHFE EID+ L+H++   V     D+ T
Sbjct  61   VRKMLM----AADDDSAQKLLLIDAIQRLGVAYHFESEIDEVLKHMFDGSVVSAEEDVYT  116

Query  372  VALQFRLMRQHGYNISTHIFSNFVDGNESSETAL  473
             +L+FRL+RQ GY++S  +F+NF D   + + +L
Sbjct  117  ASLRFRLLRQQGYHVSCDLFNNFKDNEGNFKESL  150



>emb|CBI20483.3| unnamed protein product [Vitis vinifera]
Length=557

 Score =   101 bits (251),  Expect(2) = 6e-40, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 76/112 (68%), Gaps = 5/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            SSDV+G+LSLYEA++ R   +D +L+   AF  T L+SA  +   ++ L + V HAL QP
Sbjct  151  SSDVRGMLSLYEATHFRVHGED-ILDEALAFTTTHLQSATKH--SSNPLAEQVVHALKQP  207

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
               GLPR+E R + SVYQ +D  S N  LL+ A LDFNLLQ LH++ELS++S
Sbjct  208  IRKGLPRLEARHYFSVYQADD--SHNKALLKLAKLDFNLLQKLHQKELSDIS  257


 Score = 90.9 bits (224),  Expect(2) = 6e-40, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 77/135 (57%), Gaps = 8/135 (6%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSD  239
            N    + R   NF P++W  +     S      +   + ++ LKE+ R  L+    +  D
Sbjct  15   NLSPEVGRRCANFHPSIWGDHFLSYASEFTNTDDHLKQHVQQLKEEVRKMLM----AADD  70

Query  240  DVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPV--HLNDLETVALQFRLMRQHGYN  413
            D AQKL  ID ++RLG+AYHFE EID+ L+H++   V     D+ T +L+FRL+RQ GY+
Sbjct  71   DSAQKLLLIDAIQRLGVAYHFESEIDEVLKHMFDGSVVSAEEDVYTASLRFRLLRQQGYH  130

Query  414  ISTHIFSNFVD--GN  452
            +S  +F+NF D  GN
Sbjct  131  VSCDLFNNFKDNEGN  145



>ref|XP_006374233.1| hypothetical protein POPTR_0015s05270g [Populus trichocarpa]
 gb|ERP52030.1| hypothetical protein POPTR_0015s05270g [Populus trichocarpa]
Length=554

 Score =   100 bits (248),  Expect(2) = 6e-40, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 76/115 (66%), Gaps = 5/115 (4%)
 Frame = +2

Query  458  FRDSSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHAL  637
            F+ S+DV+G+L LYEA+++    +D +L+   AF    L+S A +  PN  L   V+HAL
Sbjct  145  FKPSNDVRGILGLYEAAHLAVHGED-ILDEALAFTTIHLKSMATS--PNCPLTAKVSHAL  201

Query  638  DQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
             QP   G+PR+E R +IS YQ  DE S N  LLR A L+FN++Q LHK+ELSE++
Sbjct  202  KQPIRRGVPRLESRRYISFYQ--DEPSCNKTLLRLAKLNFNVVQELHKEELSEIT  254


 Score = 92.4 bits (228),  Expect(2) = 6e-40, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 73/129 (57%), Gaps = 8/129 (6%)
 Frame = +3

Query  66   ENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDV  245
            +N + R   N+ P++W          D        +EIE L+EQ +  LL    S     
Sbjct  18   DNEIIRRTANYHPSIWGDQFISHLPKDKVHEAIELQEIEKLREQFKRELLASNSS-----  72

Query  246  AQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHL--NDLETVALQFRLMRQHGYNIS  419
             QKL  ID ++RLG+AYHFE EI++ L+HIY + + +  +DL   AL FRL+RQHGYN+S
Sbjct  73   -QKLDLIDAIQRLGVAYHFETEIEEALQHIYNNRIDMEDDDLYNTALGFRLLRQHGYNVS  131

Query  420  THIFSNFVD  446
              IF+ F D
Sbjct  132  CDIFNKFKD  140



>emb|CAA77191.1| (+)-delta-cadinene synthase [Gossypium arboreum]
Length=555

 Score =   101 bits (251),  Expect(2) = 9e-40, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 74/112 (66%), Gaps = 5/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            +SDV+GLL LYEASY+R   +D +L+   +F   +L  A P L  +  L + V HAL Q 
Sbjct  149  TSDVQGLLELYEASYMRVHGED-ILDEAISFTTAQLTLALPTL--HHPLSEQVGHALKQS  205

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
               GLPRVE R FIS+YQ  D  S N  LL+FA +DFNLLQ+LH++ELSE+ 
Sbjct  206  IRRGLPRVEARNFISIYQ--DLESHNKSLLQFAKIDFNLLQLLHRKELSEIC  255


 Score = 90.5 bits (223),  Expect(2) = 9e-40, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 79/138 (57%), Gaps = 14/138 (10%)
 Frame = +3

Query  54   AINFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSC  233
            AI+ EN   RP  +F P +W          D  +  A   + E LK Q R  ++ P    
Sbjct  15   AISSEN---RPKADFHPGIWGD--MFIICPDTDIDAATELQYEELKAQVRKMIMEPV---  66

Query  234  SDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLN---DLETVALQFRLMRQH  404
             DD  QKL FID ++RLG++YHFEKEI+D+L +IY    + +   DL T AL+FRL+R+H
Sbjct  67   -DDSNQKLPFIDAVQRLGVSYHFEKEIEDELENIYRDTNNNDADTDLYTTALRFRLLREH  125

Query  405  GYNISTHIFSNFVD--GN  452
            G++IS   F+ F D  GN
Sbjct  126  GFDISCDAFNKFKDEAGN  143



>sp|Q43714.1|DCS3_GOSAR RecName: Full=(+)-delta-cadinene synthase isozyme A; Short=D-cadinene 
synthase A [Gossypium arboreum]
 gb|AAB41259.1| (+)-delta-cadinene synthase isozyme A [Gossypium arboreum]
 emb|CAA65289.1| (+)-delta-cadinene synthase [Gossypium arboreum]
Length=555

 Score =   101 bits (251),  Expect(2) = 9e-40, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 74/112 (66%), Gaps = 5/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            +SDV+GLL LYEASY+R   +D +L+   +F   +L  A P L  +  L + V HAL Q 
Sbjct  149  TSDVQGLLELYEASYMRVHGED-ILDEAISFTTAQLTLALPTL--HHPLSEQVGHALKQS  205

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
               GLPRVE R FIS+YQ  D  S N  LL+FA +DFNLLQ+LH++ELSE+ 
Sbjct  206  IRRGLPRVEARNFISIYQ--DLESHNKSLLQFAKIDFNLLQLLHRKELSEIC  255


 Score = 90.1 bits (222),  Expect(2) = 9e-40, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 79/138 (57%), Gaps = 14/138 (10%)
 Frame = +3

Query  54   AINFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSC  233
            AI+ EN   RP  +F P +W          D  +  A   + E LK Q R  ++ P    
Sbjct  15   AISSEN---RPKADFHPGIWGD--MFIICPDTDIDAATELQYEELKAQVRKMIMEPV---  66

Query  234  SDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLN---DLETVALQFRLMRQH  404
             DD  QKL FID ++RLG++YHFEKEI+D+L +IY    + +   DL T AL+FRL+R+H
Sbjct  67   -DDSNQKLPFIDAVQRLGVSYHFEKEIEDELENIYRDTNNNDADTDLYTTALRFRLLREH  125

Query  405  GYNISTHIFSNFVD--GN  452
            G++IS   F+ F D  GN
Sbjct  126  GFDISCDAFNKFKDEAGN  143



>emb|CAN83470.1| hypothetical protein VITISV_030783 [Vitis vinifera]
Length=557

 Score =   100 bits (249),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 75/112 (67%), Gaps = 5/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            SSDV+G+LSLYEA++ R   +D +L+   AF  T L+SA      ++ L + V HAL QP
Sbjct  151  SSDVRGMLSLYEATHFRVHGED-ILDEALAFTTTHLQSATKY--SSNPLAEQVVHALKQP  207

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
               GLPR+E R + SVYQ +D  S N  LL+ A LDFNLLQ LH++ELS++S
Sbjct  208  IRKGLPRLEARHYFSVYQADD--SHNKALLKLAKLDFNLLQKLHQKELSDIS  257


 Score = 90.9 bits (224),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 77/135 (57%), Gaps = 8/135 (6%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSD  239
            N    + R   NF P++W  +     S      +   + ++ LKE+ R  L+    +  D
Sbjct  15   NLSPEVGRRCANFHPSIWGDHFLSYASEFTNTDDHLKQHVQQLKEEVRKMLM----AADD  70

Query  240  DVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPV--HLNDLETVALQFRLMRQHGYN  413
            D AQKL  ID ++RLG+AYHFE EID+ L+H++   V     D+ T +L+FRL+RQ GY+
Sbjct  71   DSAQKLLLIDAIQRLGVAYHFESEIDEVLKHMFDGSVVSAEEDVYTASLRFRLLRQQGYH  130

Query  414  ISTHIFSNFVD--GN  452
            +S  +F+NF D  GN
Sbjct  131  VSCDLFNNFKDNEGN  145



>emb|CAN68620.1| hypothetical protein VITISV_013313 [Vitis vinifera]
Length=557

 Score =   100 bits (249),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 75/112 (67%), Gaps = 5/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            SSDV+G+LSLYEA++ R   +D +L+   AF  T L+SA      ++ L + V HAL QP
Sbjct  151  SSDVRGMLSLYEATHFRVHGED-ILDEALAFTTTHLQSATKY--SSNPLAEQVVHALKQP  207

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
               GLPR+E R + SVYQ +D  S N  LL+ A LDFNLLQ LH++ELS++S
Sbjct  208  IRKGLPRLEARHYFSVYQADD--SHNKALLKLAKLDFNLLQKLHQKELSDIS  257


 Score = 90.9 bits (224),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 77/135 (57%), Gaps = 8/135 (6%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSD  239
            N    + R   NF P++W  +     S      +   + ++ LKE+ R  L+    +  D
Sbjct  15   NLSPEVGRRCANFHPSIWGDHFLSYASEFTNTDDHLKQHVQQLKEEVRKMLM----AADD  70

Query  240  DVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPV--HLNDLETVALQFRLMRQHGYN  413
            D AQKL  ID ++RLG+AYHFE EID+ L+H++   V     D+ T +L+FRL+RQ GY+
Sbjct  71   DSAQKLLLIDAIQRLGVAYHFESEIDEVLKHMFDGSVVSAEEDVYTASLRFRLLRQQGYH  130

Query  414  ISTHIFSNFVD--GN  452
            +S  +F+NF D  GN
Sbjct  131  VSCDLFNNFKDNEGN  145



>ref|XP_011080333.1| PREDICTED: gamma-cadinene synthase-like, partial [Sesamum indicum]
Length=378

 Score =   105 bits (261),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 90/151 (60%), Gaps = 18/151 (12%)
 Frame = +3

Query  54   AINFENHLPR-------PVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATL  212
            A  F+  LP        P+ ++ P++W    F +FS+D++V + YA+ I+ LK+Q R ++
Sbjct  5    ATCFDESLPNLPKDGRPPITSYTPSMWGD-AFTSFSLDDKVQKKYAEAIQELKQQAR-SM  62

Query  213  LIPTGSCSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLN-----DLETVA  377
            L+  GS +    +KL  ID LERLG+ YHFE+EI+DQLR I+            DL   A
Sbjct  63   LMTKGSTT---IEKLILIDTLERLGVGYHFEQEIEDQLREIFFFQSQDKDQDNYDLFATA  119

Query  378  LQFRLMRQHGYNISTHIFSNFV-DGNESSET  467
            LQFRL+RQH Y++S  +F+ F  DG +  ET
Sbjct  120  LQFRLLRQHRYSVSCDVFNKFKDDGGKFEET  150


 Score = 85.9 bits (211),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 68/112 (61%), Gaps = 5/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            + D KGLLSLYEAS VR   +D +LE   AF    L      L+P   L+  V  AL+QP
Sbjct  152  TGDAKGLLSLYEASNVRVHGED-ILEDAVAFTTHHLNRMVQELEPQ--LQCQVKRALEQP  208

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
             + G+PR+E R +IS Y  E   S+N  LL+ A LDFN LQ ++K+EL ++S
Sbjct  209  VYRGVPRLEARHYISFY--ERNQSKNEILLKLAKLDFNYLQNIYKKELHDLS  258



>ref|XP_009344731.1| PREDICTED: (-)-germacrene D synthase-like [Pyrus x bretschneideri]
Length=506

 Score =   100 bits (248),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 77/117 (66%), Gaps = 6/117 (5%)
 Frame = +2

Query  458  FRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTH  631
            F++S   DV GLLSLYEA+++R   + E+L+    F  T L SA   L P   L K VTH
Sbjct  144  FKESLVDDVVGLLSLYEATHLRIHGE-EILDEALTFTMTNLESATFRLSP--PLAKAVTH  200

Query  632  ALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            AL+QP   GLPRVE R+ +SVYQE  ES  N  LL FA LDFN LQ +H++ELSE++
Sbjct  201  ALNQPLRKGLPRVEARYHLSVYQELRESP-NETLLTFAKLDFNRLQRVHQKELSEIT  256


 Score = 90.5 bits (223),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 82/139 (59%), Gaps = 6/139 (4%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSD  239
             F+ H P+P   F P++W  +     S+  +V     + ++ LKE+ R  L     +  +
Sbjct  17   TFDVHQPKPSATFSPSIWGDHFLSYASL--EVDAELEQHVQELKEEVRRML----TTSPE  70

Query  240  DVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNIS  419
            +V+QKL  ID ++ LG++YHF  +I++ L+ I+     L+DL T AL FRL+RQ GYN+S
Sbjct  71   NVSQKLNLIDDIQHLGVSYHFGNDIEEILQKIHKSSYDLDDLYTAALLFRLLRQQGYNVS  130

Query  420  THIFSNFVDGNESSETALM  476
              +F+ F DG+ + + +L+
Sbjct  131  CDLFNKFKDGDGNFKESLV  149



>ref|XP_007021117.1| Delta-cadinene synthase isozyme A [Theobroma cacao]
 gb|EOY12642.1| Delta-cadinene synthase isozyme A [Theobroma cacao]
Length=553

 Score =   100 bits (250),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 74/112 (66%), Gaps = 5/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            +SDV GLL LYEASY+R   +D +L+   +F  T L  AA  L  +  L + V HAL Q 
Sbjct  148  TSDVHGLLELYEASYLRVHGED-ILDEAISFTTTHLTLAAATL--DYPLSEQVAHALKQS  204

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
               GLPRVE R +IS+YQ  D+ S N  LL+FA +DFNLLQ+LH++ELSE+ 
Sbjct  205  IRRGLPRVEARQYISLYQ--DDESHNKALLQFAKIDFNLLQLLHRKELSEIC  254


 Score = 89.7 bits (221),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 78/143 (55%), Gaps = 9/143 (6%)
 Frame = +3

Query  45   HIMAINFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPT  224
            ++++ N EN   RP  +F P +W          D  +      + E  KE+ R  L+ P 
Sbjct  14   NVISSNMEN---RPKADFHPGIWGDVFLTC--PDKDIDSTAELQYEESKEEVRRMLVAPM  68

Query  225  GSCSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQH  404
             + +    QK   ID ++RLG+ YHFEKEI+D L  IY      NDL T AL+FR++R+H
Sbjct  69   ANSN----QKWSLIDAVQRLGVKYHFEKEIEDALEQIYPDNSDANDLYTAALRFRILREH  124

Query  405  GYNISTHIFSNFVDGNESSETAL  473
            G+++S  IF+ F D   + +++L
Sbjct  125  GFDVSCDIFNKFKDDKGNFKSSL  147



>ref|NP_001268204.1| uncharacterized protein LOC100257265 [Vitis vinifera]
 ref|XP_010644042.1| PREDICTED: uncharacterized protein LOC100257265 isoform X1 [Vitis 
vinifera]
 gb|ADR74193.1| (E)-beta-caryophyllene synthase [Vitis vinifera]
Length=557

 Score =   101 bits (251),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 78/113 (69%), Gaps = 7/113 (6%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAP-NLKPNSTLEKLVTHALDQ  643
            SSDV+G+LSLYEA+++R   +D +L+   AF  T L+SAA  +L P   L + V HAL Q
Sbjct  151  SSDVRGMLSLYEATHLRVHGED-ILDEALAFTTTHLQSAAKYSLNP---LAEQVVHALKQ  206

Query  644  PFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            P   GLPR+E R + S+YQ +D  S +  LL+ A LDFNLLQ LH++ELS++S
Sbjct  207  PIRKGLPRLEARHYFSIYQADD--SHHKALLKLAKLDFNLLQKLHQKELSDIS  257


 Score = 89.0 bits (219),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 76/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSD  239
            N    + R   N+ P++W  +     S      +   + ++ LKE+ R  L+    +  D
Sbjct  15   NLSPEVGRRCANYHPSIWGDHFLSYASEFTNTDDHLKQHVQQLKEEVRKMLM----AADD  70

Query  240  DVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHL--NDLETVALQFRLMRQHGYN  413
            D  QKL  ID ++RLG+AYHFE EID+ L+H++   V     D+ T +L+FRL+RQ GY+
Sbjct  71   DSVQKLLLIDAIQRLGVAYHFESEIDEALKHMFDGSVASAEEDVYTASLRFRLLRQQGYH  130

Query  414  ISTHIFSNFVD--GN  452
            +S  +F+NF D  GN
Sbjct  131  VSCDLFNNFKDNEGN  145



>ref|XP_011080427.1| PREDICTED: gamma-cadinene synthase-like [Sesamum indicum]
Length=561

 Score =   103 bits (258),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 88/141 (62%), Gaps = 15/141 (11%)
 Frame = +3

Query  75   LPR----PVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDD  242
            LP+    P+ ++ P++W    F +FS+D++V E Y + IE LK++ R ++L+  GS +  
Sbjct  15   LPKDVRPPITSYSPSMWGD-TFTSFSLDDKVQEKYVETIEELKQEAR-SMLMSKGSTT--  70

Query  243  VAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLN-----DLETVALQFRLMRQHG  407
              +KL  ID LERLG+ YHFE+EI+DQLR I+            DL T ALQFR+ RQH 
Sbjct  71   -IEKLVLIDTLERLGVGYHFEQEIEDQLREIFRFQSEDKDQGNYDLFTAALQFRVFRQHR  129

Query  408  YNISTHIFSNFV-DGNESSET  467
            Y++S  +F+ F+ +G E  ET
Sbjct  130  YSVSCDVFNKFMGEGGEFEET  150


 Score = 86.3 bits (212),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 68/112 (61%), Gaps = 5/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            +SD KGLLSLYEA+ VR   +D +LE    F    L+     L+P   L+  V  AL+QP
Sbjct  152  TSDTKGLLSLYEAANVRIHGED-ILENAVVFTTHHLKCMVQQLEPR--LQCQVKRALEQP  208

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
             H G+ +VE R +IS Y  E E SRN  LL+ A LDF+  Q L+K+EL ++S
Sbjct  209  LHRGVAKVEARHYISFY--EKEESRNEMLLKLAKLDFSYSQNLYKKELHDLS  258



>ref|XP_008232170.1| PREDICTED: (-)-germacrene D synthase-like [Prunus mume]
Length=559

 Score =   108 bits (270),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 81/118 (69%), Gaps = 7/118 (6%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  +DV GLLSLYEA+++R   +D +L+    F  T L SA   L P   L K VT
Sbjct  152  KFKESLVNDVLGLLSLYEATHLRNHGED-ILDEALIFTTTHLESATHRLSP--ILSKQVT  208

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HA+ QPF  GLPR+E R ++S+YQE D  S+N  LL FA LDFNLLQ +H++ELSE+S
Sbjct  209  HAMYQPFWKGLPRLETRHYMSLYQERD--SQNETLLNFAKLDFNLLQQVHQRELSEIS  264


 Score = 81.6 bits (200),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 52/146 (36%), Positives = 81/146 (55%), Gaps = 17/146 (12%)
 Frame = +3

Query  69   NHLPRPVDNFPPTLWARYCFHAFSIDNQV-AEAYAKEIEILKEQTRATLLIPTGSCSDDV  245
            N + R   NF P++W  +     S++  + A+  A+E   LKE+ +  L+ P    S   
Sbjct  20   NDINRRSANFSPSVWGSHFLSYASVETSIKAKQRAQE---LKEKVKMILMAPVKKPS---  73

Query  246  AQKLKFIDLLERLGIAYHFEKEIDDQLRHIY------IHPVHL---NDLETVALQFRLMR  398
             QKL  I  ++RLG+++HFE EI++ L+ I+        P      N+L T AL+FRL+R
Sbjct  74   -QKLDLIQDIQRLGVSHHFENEIEELLQKIHNSSHDSTEPGDQETDNELYTAALRFRLLR  132

Query  399  QHGYNISTHIFSNFVDGNESSETALM  476
            Q GYNIS  IF+NF D +   + +L+
Sbjct  133  QQGYNISCDIFNNFKDSDGKFKESLV  158



>ref|XP_010241001.1| PREDICTED: (-)-germacrene D synthase-like [Nelumbo nucifera]
Length=564

 Score = 98.2 bits (243),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 76/118 (64%), Gaps = 5/118 (4%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            K R+S   D++G+LSLYEA+Y+  R + EVL+   AF    L+S       + TL K V 
Sbjct  150  KLRESLARDIQGMLSLYEAAYLGKRGE-EVLDEALAFTTAHLKSTVATDTTSPTLVKQVK  208

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+QP H G+P++E R +IS Y+E  + SRN  LL+ A LDFN  Q+L+  ELS+VS
Sbjct  209  HALEQPLHRGIPKIEARHYISFYEE--DKSRNQVLLKLAKLDFNRTQLLYLNELSQVS  264


 Score = 92.0 bits (227),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 76/132 (58%), Gaps = 10/132 (8%)
 Frame = +3

Query  66   ENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDV  245
            +  L R   NF P++W    F  ++ DN   E+Y +++E LKE+ R+ L     + ++  
Sbjct  20   KTELIRHTTNFHPSIWGDR-FITYTCDNMKLESYNQQVEELKEEVRSIL----RNSANKP  74

Query  246  AQKLKFIDLLERLGIAYHFEKEIDDQLRHIY-IHPVHLND----LETVALQFRLMRQHGY  410
             + L  ID ++RLG+ YHFE+EI+  L  I+  H V+ ND    L  VAL FRL+RQHGY
Sbjct  75   LEMLSLIDAVQRLGLGYHFEREINKMLEQIFDAHIVYFNDMDDNLNAVALLFRLLRQHGY  134

Query  411  NISTHIFSNFVD  446
            NI   +F  F D
Sbjct  135  NIPCDVFKKFKD  146



>emb|CBI20482.3| unnamed protein product [Vitis vinifera]
Length=725

 Score =   101 bits (251),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 78/113 (69%), Gaps = 7/113 (6%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAP-NLKPNSTLEKLVTHALDQ  643
            SSDV+G+LSLYEA+++R   +D +L+   AF  T L+SAA  +L P   L + V HAL Q
Sbjct  151  SSDVRGMLSLYEATHLRVHGED-ILDEALAFTTTHLQSAAKYSLNP---LAEQVVHALKQ  206

Query  644  PFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            P   GLPR+E R + S+YQ +D  S +  LL+ A LDFNLLQ LH++ELS++S
Sbjct  207  PIRKGLPRLEARHYFSIYQADD--SHHKALLKLAKLDFNLLQKLHQKELSDIS  257


 Score = 89.0 bits (219),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 76/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSD  239
            N    + R   N+ P++W  +     S      +   + ++ LKE+ R  L+    +  D
Sbjct  15   NLSPEVGRRCANYHPSIWGDHFLSYASEFTNTDDHLKQHVQQLKEEVRKMLM----AADD  70

Query  240  DVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHL--NDLETVALQFRLMRQHGYN  413
            D  QKL  ID ++RLG+AYHFE EID+ L+H++   V     D+ T +L+FRL+RQ GY+
Sbjct  71   DSVQKLLLIDAIQRLGVAYHFESEIDEALKHMFDGSVASAEEDVYTASLRFRLLRQQGYH  130

Query  414  ISTHIFSNFVD--GN  452
            +S  +F+NF D  GN
Sbjct  131  VSCDLFNNFKDNEGN  145



>ref|XP_002513334.1| Casbene synthase, chloroplast precursor, putative [Ricinus communis]
 gb|EEF48737.1| Casbene synthase, chloroplast precursor, putative [Ricinus communis]
Length=614

 Score = 95.1 bits (235),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 81/120 (68%), Gaps = 9/120 (8%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPN--LKPNSTLEKL  622
            KF+ S  SD KG+LSL+EAS++    +D +L+   AF    L S+A +  L PN  L+K 
Sbjct  187  KFKASLLSDAKGMLSLFEASHLSMHGED-ILDEAFAFTKDYLESSAVDQYLCPN--LQKH  243

Query  623  VTHALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            +T+AL+QPFH G+PR+E R +I +Y  E +  RN  +L FA LD+N +Q+LH+QELS+ S
Sbjct  244  ITNALEQPFHKGIPRLEARKYIDLY--EGDECRNETVLEFAKLDYNRVQLLHQQELSQFS  301


 Score = 94.7 bits (234),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 84/137 (61%), Gaps = 10/137 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            RP+ NFPPT+W  + F + +        Y ++  +L+++ R  L   T S SD V +K+ 
Sbjct  62   RPLANFPPTVWGSH-FASPTFSESEFGTYDRQANVLQKKIRELL---TSSRSDSV-EKIA  116

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIY-IHPVHLN----DLETVALQFRLMRQHGYNISTH  425
            FIDLL RLG++YHFE +I++QL  I+   P  L+    DL TVAL FR+ RQHG+ +S++
Sbjct  117  FIDLLCRLGVSYHFENDIEEQLSQIFSCQPGLLDEKQYDLYTVALVFRVFRQHGFKMSSN  176

Query  426  IFSNFVDGNESSETALM  476
            +F  F D +   + +L+
Sbjct  177  VFHKFTDSHGKFKASLL  193



>ref|XP_002321642.1| hypothetical protein POPTR_0015s09710g [Populus trichocarpa]
 gb|EEF05769.1| hypothetical protein POPTR_0015s09710g [Populus trichocarpa]
Length=553

 Score =   100 bits (249),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 76/115 (66%), Gaps = 5/115 (4%)
 Frame = +2

Query  458  FRDSSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHAL  637
            F+ S+DV+G+L LYEA+++    +D +L+   AF    L+S   +  PN  L   V+HAL
Sbjct  144  FKQSNDVRGILGLYEAAHLAVHGED-ILDEALAFTTIHLKSMETS--PNCPLTAKVSHAL  200

Query  638  DQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
             QP   G+PR+E R +IS+YQ  DE S N  LLR A L+FNL+Q LHK+EL+E++
Sbjct  201  KQPIQRGVPRLESRRYISIYQ--DEPSCNKTLLRLAKLNFNLVQELHKEELAEIT  253


 Score = 89.0 bits (219),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 73/128 (57%), Gaps = 6/128 (5%)
 Frame = +3

Query  69   NHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVA  248
            N + R   N+ P++W          D        +EIE L+EQ +  LL    + + + +
Sbjct  16   NEIIRRTANYHPSIWGDQFISHLPKDKVHEATELQEIEKLREQFKRELL----AAASNSS  71

Query  249  QKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHL--NDLETVALQFRLMRQHGYNIST  422
            Q+L  ID ++RLG+AYHFE EI++ L+ IY + + +   DL   AL FRL+RQHGYN+S 
Sbjct  72   QQLDLIDAIQRLGVAYHFETEIEEALQKIYNNRIDMEDEDLYNTALGFRLLRQHGYNVSC  131

Query  423  HIFSNFVD  446
             IF+ F D
Sbjct  132  DIFNKFKD  139



>ref|NP_001268063.1| uncharacterized protein LOC100267145 [Vitis vinifera]
 gb|ADR74196.1| terpene synthase [Vitis vinifera]
Length=555

 Score =   100 bits (248),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 89/137 (65%), Gaps = 10/137 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYA-KEIEILKEQTRATLLIPTGSCSDDVAQKL  257
            RPV  + P++W    F +++ +++V  A   K++E LKE+ R  L+   G+ S    Q+L
Sbjct  19   RPVVQYHPSIWGDQ-FLSYTPEDEVTRACKEKQLEDLKEEIRRKLMNTAGNTS----QQL  73

Query  258  KFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLE----TVALQFRLMRQHGYNISTH  425
            KFID ++RLG+AYHFE+EI++ L+HIY    + +D+E     VALQFRL+RQ G+NIS  
Sbjct  74   KFIDAVQRLGVAYHFEREIEEVLQHIYDSYPNGDDMEGDIYNVALQFRLLRQAGFNISCG  133

Query  426  IFSNFVDGNESSETALM  476
            +F+ F D   + + AL+
Sbjct  134  LFNEFKDEKGNFKKALV  150


 Score = 89.4 bits (220),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 72/111 (65%), Gaps = 5/111 (5%)
 Frame = +2

Query  470  SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQPF  649
            SDV+G+L LYEA+++R   +D +L    AF  T L++   +L     L + V HAL++P 
Sbjct  151  SDVRGMLGLYEAAHLRVHGED-ILAKALAFTTTHLKAMVESL--GYHLAEQVAHALNRPI  207

Query  650  HTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
              GL R+E R++ISVYQ  DE+  +  LL  A LDFNL+Q LHK+ELS ++
Sbjct  208  RKGLERLEARWYISVYQ--DEAFHDKTLLELAKLDFNLVQSLHKEELSNLA  256



>ref|XP_004308569.1| PREDICTED: (-)-germacrene D synthase-like [Fragaria vesca subsp. 
vesca]
Length=566

 Score =   112 bits (280),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 83/118 (70%), Gaps = 5/118 (4%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  +DV GLLSLYEAS++    +D ++E +T F  T L SAA  L P+S L K VT
Sbjct  153  KFKESDINDVVGLLSLYEASHLLVPGEDALMEALT-FCTTHLESAAHRLIPSSQLSKQVT  211

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL QP   G+PR+E R ++SVYQE++  S N  LL FA LDFN +Q +H++ELSE++
Sbjct  212  HALYQPLWKGMPRIEARHYLSVYQEDE--SNNETLLNFAKLDFNFVQKVHQKELSEIT  267


 Score = 77.0 bits (188),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 73/127 (57%), Gaps = 6/127 (5%)
 Frame = +3

Query  75   LPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQK  254
            + R V NF P++W  + F ++S          K +  LKE+ +  +L P    ++  +QK
Sbjct  30   ITRRVANFSPSVWGDH-FLSYSSMEAADGKSKKHVHDLKEELKRMILAP----AERPSQK  84

Query  255  LKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLN-DLETVALQFRLMRQHGYNISTHIF  431
            L FI+ ++RLG++YHF+ EID  L  ++      + DL T AL+FRL+RQ GYN S ++F
Sbjct  85   LHFINNIQRLGVSYHFQNEIDKILEQVHREEDDDDADLCTTALKFRLLRQQGYNASCNMF  144

Query  432  SNFVDGN  452
            +   D +
Sbjct  145  NKLKDDD  151



>gb|AGN72800.1| germacrene A [Lavandula pedunculata subsp. lusitanica]
Length=547

 Score =   107 bits (266),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 77/110 (70%), Gaps = 5/110 (5%)
 Frame = +2

Query  473  DVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQPFH  652
            D KGLLSLYEASY+RTR +  +L+    F    L+S APNL+  S L + V HAL Q  H
Sbjct  143  DAKGLLSLYEASYLRTRGET-ILDEALDFTTASLKSIAPNLE--SPLRRQVEHALVQQLH  199

Query  653  TGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
             G PR+E R FIS+Y+E ++  ++  LLRFA LD+NLLQM+HK+EL EVS
Sbjct  200  WGNPRIEARNFISLYEEYED--KDESLLRFAKLDYNLLQMMHKEELHEVS  247


 Score = 82.0 bits (201),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 75/134 (56%), Gaps = 10/134 (7%)
 Frame = +3

Query  66   ENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDV  245
            E  + RP+ NF P+LW        S D +V +  +K IE+LKE+ + ++L  TG+   D 
Sbjct  5    EAEIIRPLANFSPSLWGDQFIKNDS-DAKVEDKISKTIEVLKEEVK-SMLTATGTKMVDT  62

Query  246  AQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLN----DLETVALQFRLMRQHGYN  413
               +  ID LERLG++YHFE EI++ L+  +      N    DL TVA  FRL RQHG+ 
Sbjct  63   ---MNLIDTLERLGVSYHFEHEIEEILQQFFNLNTDYNDEAYDLYTVATHFRLFRQHGHR  119

Query  414  IS-THIFSNFVDGN  452
            I+   IF  + D N
Sbjct  120  ITCADIFGRWRDEN  133



>emb|CBI31274.3| unnamed protein product [Vitis vinifera]
Length=750

 Score = 99.8 bits (247),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 89/137 (65%), Gaps = 10/137 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYA-KEIEILKEQTRATLLIPTGSCSDDVAQKL  257
            RPV  + P++W    F +++ +++V  A   K++E LKE+ R  L+   G+ S    Q+L
Sbjct  214  RPVVQYHPSIWGDQ-FLSYTPEDEVTRACKEKQLEDLKEEIRRKLMNTAGNTS----QQL  268

Query  258  KFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLE----TVALQFRLMRQHGYNISTH  425
            KFID ++RLG+AYHFE+EI++ L+HIY    + +D+E     VALQFRL+RQ G+NIS  
Sbjct  269  KFIDAVQRLGVAYHFEREIEEVLQHIYDSYPNGDDMEGDIYNVALQFRLLRQAGFNISCG  328

Query  426  IFSNFVDGNESSETALM  476
            +F+ F D   + + AL+
Sbjct  329  LFNEFKDEKGNFKKALV  345


 Score = 89.4 bits (220),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 72/111 (65%), Gaps = 5/111 (5%)
 Frame = +2

Query  470  SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQPF  649
            SDV+G+L LYEA+++R   +D +L    AF  T L++   +L     L + V HAL++P 
Sbjct  346  SDVRGMLGLYEAAHLRVHGED-ILAKALAFTTTHLKAMVESL--GYHLAEQVAHALNRPI  402

Query  650  HTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
              GL R+E R++ISVYQ  DE+  +  LL  A LDFNL+Q LHK+ELS ++
Sbjct  403  RKGLERLEARWYISVYQ--DEAFHDKTLLELAKLDFNLVQSLHKEELSNLA  451



>gb|KHG14851.1| (+)-delta-cadinene synthase isozyme C2 [Gossypium arboreum]
Length=564

 Score = 94.7 bits (234),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 72/112 (64%), Gaps = 5/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            +SDV+GLL LY+ASY+R   +D +L+   +F    L  A  +L  +  L + V+HAL Q 
Sbjct  148  TSDVRGLLELYQASYLRVHGED-ILDEAISFTTNHLSLAVASL--DHPLSEEVSHALKQS  204

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
               GLPRVE R ++SVYQ  D  S N  LL FA +DFN+LQ LH++ELSE+ 
Sbjct  205  IRRGLPRVEARHYLSVYQ--DIESHNKALLEFAKIDFNMLQFLHRKELSEIC  254


 Score = 94.4 bits (233),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 78/127 (61%), Gaps = 9/127 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            RP  +F P++W  +  +    D  +     K  + LKE+ R  ++ P  + +    QKL 
Sbjct  22   RPKADFQPSIWGDFFLNC--PDKNIDAGTEKRHQQLKEEVRKIIVAPMANST----QKLA  75

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIHPVHL-NDLETVALQFRLMRQHGYNISTHIFSN  437
            FID ++RLG++YHF KEI+D+L +IY +     NDL T++L+FRL+R+HGYN+S  +F+ 
Sbjct  76   FIDSVQRLGVSYHFTKEIEDELENIYHNNNDAENDLYTISLRFRLLREHGYNVSCDVFNK  135

Query  438  FVD--GN  452
            F D  GN
Sbjct  136  FKDEQGN  142



>sp|Q9FQ27.1|TPSGB_SOLHA RecName: Full=(E,E)-germacrene B synthase [Solanum habrochaites]
 gb|AAG41891.1|AF279455_1 sesquiterpene synthase 1 [Solanum habrochaites]
Length=544

 Score =   102 bits (255),  Expect(2) = 7e-39, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 88/128 (69%), Gaps = 6/128 (5%)
 Frame = +2

Query  428  FQQLC*RK*KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNL-K  598
            F+Q   +  KF+++  +DV+GLLSLYEASY+R R D+E+LE   AF  T L+S    +  
Sbjct  119  FKQFTNQDGKFKETLTNDVQGLLSLYEASYLRVR-DEEILEEALAFTTTHLKSIVSTMSN  177

Query  599  PNSTLEKLVTHALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLH  778
             N++L+  V+ AL QP    LPR+E R +IS+Y+  D  + N+ LL+FA LDFN+LQ LH
Sbjct  178  NNNSLKVEVSEALTQPIRMTLPRMEARRYISIYENND--AHNHLLLKFAKLDFNMLQKLH  235

Query  779  KQELSEVS  802
            ++ELS+++
Sbjct  236  QRELSDLT  243


 Score = 85.9 bits (211),  Expect(2) = 7e-39, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 72/123 (59%), Gaps = 9/123 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLL-IPTGSCSDDVAQKL  257
            RP+ NF PT+W    +H  S  +++      E++  KE  R  L+  P GS      QKL
Sbjct  10   RPLANFHPTVWG---YHFLSYTHEITNQEKVEVDEYKETIRKMLVEAPEGS-----EQKL  61

Query  258  KFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNISTHIFSN  437
              ID ++RLG+AYHF  EI+  +++I+  P   N+L  V+L+FRL+RQ G+ +S+ +F  
Sbjct  62   VLIDAMQRLGVAYHFHNEIETSIQNIFDAPKQNNNLHIVSLRFRLVRQQGHYMSSDVFKQ  121

Query  438  FVD  446
            F +
Sbjct  122  FTN  124



>gb|KHG18113.1| (+)-delta-cadinene synthase isozyme C2 [Gossypium arboreum]
Length=333

 Score = 94.4 bits (233),  Expect(2) = 7e-39, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 78/127 (61%), Gaps = 9/127 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            RP  +F P++W  +  +    D  +     K  + LKE+ R  ++ P  + +    QKL 
Sbjct  22   RPKADFQPSIWGDFFLNC--PDKNIDAGTEKRHQQLKEEVRKIIVAPMANST----QKLA  75

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIHPVHL-NDLETVALQFRLMRQHGYNISTHIFSN  437
            FID ++RLG++YHF KEI+D+L +IY +     NDL T++L+FRL+R+HGYN+S  +F+ 
Sbjct  76   FIDSVQRLGVSYHFTKEIEDELENIYHNNNDAENDLYTISLRFRLLREHGYNVSCDVFNK  135

Query  438  FVD--GN  452
            F D  GN
Sbjct  136  FKDEQGN  142


 Score = 94.4 bits (233),  Expect(2) = 7e-39, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 72/112 (64%), Gaps = 5/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            +SDV+GLL LY+ASY+R   +D +L+   +F    L  A  +L  +  L + V+HAL Q 
Sbjct  148  TSDVRGLLELYQASYLRVHGED-ILDEAISFTTNHLSLAVASL--DHPLSEEVSHALKQS  204

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
               GLPRVE R ++SVYQ  D  S N  LL FA +DFN+LQ LH++ELSE+ 
Sbjct  205  IRRGLPRVEARHYLSVYQ--DIESHNKALLEFAKIDFNMLQFLHRKELSEIC  254



>emb|CAN77700.1| hypothetical protein VITISV_036209 [Vitis vinifera]
Length=515

 Score =   101 bits (251),  Expect(2) = 9e-39, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 89/150 (59%), Gaps = 10/150 (7%)
 Frame = +3

Query  42   GHIMAINFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAY-AKEIEILKEQTRATLLI  218
             H +A N++  + RP+ NF P +     F  ++ D+++  AY  K++E LK++ R   L 
Sbjct  3    SHSLAQNYKPEVKRPMVNFHPGIRGN-PFINYTPDDEITRAYNQKQVEDLKDEVRREQLA  61

Query  219  PTGSCSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHI----YIHPVHLNDLETVALQF  386
              G  S    Q+L FID ++RLG+AYHFE+EI++ LRHI    +      +DL  V+L F
Sbjct  62   AAGKPS----QQLNFIDAIQRLGVAYHFEEEIEEALRHICDDHHYSDDKYDDLYNVSLXF  117

Query  387  RLMRQHGYNISTHIFSNFVDGNESSETALM  476
            RL+RQ GYNIS  +F+ F D N S   +L+
Sbjct  118  RLLRQQGYNISCBVFNKFKDKNGSFRESLI  147


 Score = 87.0 bits (214),  Expect(2) = 9e-39, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 76/117 (65%), Gaps = 7/117 (6%)
 Frame = +2

Query  458  FRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTH  631
            FR+S   DV+G+L LYEA+++R + +D +L+   AF  T L+S   +L  +  L   VT 
Sbjct  142  FRESLIGDVQGMLGLYEAAHLRVQEED-ILDEALAFTTTHLKSLVKHL--DHPLAVQVTQ  198

Query  632  ALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            AL +P   GL R+E R +I +YQ  DE+S +  LL+ A LDFNLLQ L+K+ELS ++
Sbjct  199  ALHRPIRKGLERLEARPYIXIYQ--DEASHSKALLKLAKLDFNLLQSLYKKELSHIT  253



>emb|CAD90835.1| (+)-delta-cadinene synthase [Gossypium arboreum]
Length=555

 Score = 95.5 bits (236),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 75/111 (68%), Gaps = 5/111 (5%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            +++V+GLL LYEASY+R   +D +L+   +F+A  L  A  +L  +  L + V+HAL Q 
Sbjct  150  TNNVRGLLELYEASYLRVHGED-ILDEAISFSANNLSLAVASL--DYPLSEQVSHALKQS  206

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEV  799
               GLPRVE R ++SVYQ  D  S N  LL FA +DFN+LQ+LH++ELSE+
Sbjct  207  IRRGLPRVEARHYLSVYQ--DIESHNKALLEFAKIDFNMLQLLHRKELSEI  255


 Score = 92.4 bits (228),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 78/123 (63%), Gaps = 10/123 (8%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            RP  ++PP++W  + FH     N  AE   K  + LKE+ R  ++ P  + +    QKL 
Sbjct  23   RPKADYPPSIWGDF-FHNCPDKNIDAET-EKRHQQLKEEVRKMIVAPMANST----QKLT  76

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIHPVHL---NDLETVALQFRLMRQHGYNISTHIF  431
            FID ++RLG++YHF KEI+D+L +IY H  ++   NDL T +L+FRL+R+HG+N+S   F
Sbjct  77   FIDSVQRLGVSYHFTKEIEDELENIY-HNNNIDAENDLYTTSLRFRLLREHGFNVSCDAF  135

Query  432  SNF  440
            + F
Sbjct  136  NKF  138



>ref|XP_009338882.1| PREDICTED: (-)-germacrene D synthase-like [Pyrus x bretschneideri]
Length=513

 Score =   104 bits (260),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 79/118 (67%), Gaps = 6/118 (5%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S   DV GLLSLYEA+++R   + E+L+    F  T L SA   L P   L K VT
Sbjct  101  KFKESLVDDVVGLLSLYEATHLRIHGE-EILDEALIFTTTNLESATFRLSP--PLAKAVT  157

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+QP   GLPRVE R+++SVYQE  ES  N  LL FA LDFN LQ +H++ELSE++
Sbjct  158  HALNQPLRKGLPRVEARYYLSVYQELRESP-NKTLLTFAKLDFNRLQRVHQKELSEIT  214


 Score = 83.6 bits (205),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 66/100 (66%), Gaps = 4/100 (4%)
 Frame = +3

Query  177  IEILKEQTRATLLIPTGSCSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHL  356
            ++ LKE+ R  L     +  ++V+QKL  ID ++RLG++YHF  EI++ L+ I+     L
Sbjct  12   VQELKEEVRRML----TTSPENVSQKLNLIDDIQRLGVSYHFGNEIEESLQKIHKSSYDL  67

Query  357  NDLETVALQFRLMRQHGYNISTHIFSNFVDGNESSETALM  476
            +DL T AL+FRL+RQ GYNIS  +F+ F DG+   + +L+
Sbjct  68   DDLYTAALRFRLLRQQGYNISCDLFNKFKDGDGKFKESLV  107



>ref|XP_007021120.1| Delta-cadinene synthase isozyme A [Theobroma cacao]
 gb|EOY12645.1| Delta-cadinene synthase isozyme A [Theobroma cacao]
Length=553

 Score =   100 bits (250),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 75/112 (67%), Gaps = 5/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            +SDV+GLL LYEA+Y+R   +D +L+   +F  T L  AA  L  +  L + V HAL Q 
Sbjct  148  TSDVRGLLELYEATYLRVHGED-ILDEAISFTTTHLTLAAATL--DYPLSEHVAHALKQS  204

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
               GLPRVE R +IS+YQ  D+ S N  LL+FA +DFNLLQ+LH++ELSE+ 
Sbjct  205  IRRGLPRVEARRYISLYQ--DDESHNKALLQFAKIDFNLLQLLHRKELSEIC  254


 Score = 87.0 bits (214),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 72/133 (54%), Gaps = 11/133 (8%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSD  239
            N EN   RP  +F P +W          D  +      + E LKE+    L+ P     D
Sbjct  19   NMEN---RPKADFHPGIWGDVFLTCPEKD--IDTTTELQYEELKEEVSRMLVAPM----D  69

Query  240  DVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNIS  419
            +  QKL  ID ++RLG+ YHFEKEI+D L  IY      NDL T AL+FR++R+HG+++S
Sbjct  70   NSNQKLPLIDAVQRLGVNYHFEKEIEDALEQIYHDNSDANDLYTTALRFRILREHGFDVS  129

Query  420  THIFSNFVD--GN  452
              IF+ F D  GN
Sbjct  130  CDIFNKFKDDKGN  142



>sp|O49853.1|DCS4_GOSAR RecName: Full=(+)-delta-cadinene synthase isozyme C2; Short=D-cadinene 
synthase C2 [Gossypium arboreum]
 emb|CAA76223.1| (+)-delta-cadinene synthase [Gossypium arboreum]
Length=554

 Score = 94.4 bits (233),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 72/112 (64%), Gaps = 5/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            +SDV+GLL LY+ASY+R   +D +L+   +F    L  A  +L  +  L + V+HAL Q 
Sbjct  148  TSDVQGLLELYQASYLRVHGED-ILDEAISFTTNHLSLAVSSL--DHPLSEEVSHALKQS  204

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
               GLPRVE R ++SVYQ  D  S N  LL FA +DFN+LQ LH++ELSE+ 
Sbjct  205  IRRGLPRVEARHYLSVYQ--DIESHNKALLEFAKIDFNMLQFLHRKELSEIC  254


 Score = 93.6 bits (231),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 77/127 (61%), Gaps = 9/127 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            RP  +F P++W  +  +    D  +     K  + LKE+ R  ++ P  + +    QKL 
Sbjct  22   RPKADFQPSIWGDFFLNC--PDKNIDAGTEKRHQQLKEEVRKMIVAPMANST----QKLA  75

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIHPVHL-NDLETVALQFRLMRQHGYNISTHIFSN  437
            FID ++RLG++YHF KEI+D+L +IY +     NDL T +L+FRL+R+HGYN+S  +F+ 
Sbjct  76   FIDSVQRLGVSYHFTKEIEDELENIYHNNNDAENDLYTTSLRFRLLREHGYNVSCDVFNK  135

Query  438  FVD--GN  452
            F D  GN
Sbjct  136  FKDEQGN  142



>ref|XP_011009444.1| PREDICTED: probable terpene synthase 6 isoform X2 [Populus euphratica]
Length=558

 Score =   100 bits (248),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 55/142 (39%), Positives = 83/142 (58%), Gaps = 10/142 (7%)
 Frame = +3

Query  42   GHIMAINFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIP  221
             H+ A N   +  RP  NFPP+LW    F +FS      E+Y +++E+LKE  +  L+  
Sbjct  5    AHLTASNNRQNNSRPEANFPPSLWG-CSFASFSFPQTEFESYNRKVEVLKENVKDMLMAS  63

Query  222  TGSCSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIY-----IHPVHLNDLETVALQF  386
            T     D A+ ++FI+LL RLG++YHF+ EI++ L+ I+     +   H  DL TV+L F
Sbjct  64   T----KDPAEHIEFINLLCRLGVSYHFDDEIENSLKQIFDDLPDLLEKHDFDLYTVSLLF  119

Query  387  RLMRQHGYNISTHIFSNFVDGN  452
            R++RQHG+ I   +F  F D N
Sbjct  120  RVLRQHGFKIPCVVFDKFKDTN  141


 Score = 87.8 bits (216),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 78/125 (62%), Gaps = 14/125 (11%)
 Frame = +2

Query  455  KFRDSS---------DVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNS  607
            KF+D++         DVK +L LYEAS++    + +VL+    +    L S+A    P  
Sbjct  136  KFKDTNGEFKKTIINDVKSILGLYEASFLGVHGE-QVLDEALVYTKANLESSAMQSSPR-  193

Query  608  TLEKLVTHALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQE  787
             L   + +AL +PFH G+PR+E R +IS Y+EE+  SRN+ LL+FA +DFN +Q+LH+QE
Sbjct  194  -LADHIRNALIRPFHKGVPRIEARKYISFYEEEE--SRNDTLLKFAKIDFNRVQLLHQQE  250

Query  788  LSEVS  802
            LS +S
Sbjct  251  LSILS  255



>gb|ADR74200.1| beta-curcumene synthase [Vitis vinifera]
Length=559

 Score =   101 bits (252),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 90/150 (60%), Gaps = 10/150 (7%)
 Frame = +3

Query  42   GHIMAINFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAY-AKEIEILKEQTRATLLI  218
             H +A N++  + RP+ NF P +     F  ++ D+++  AY  K++E LK++ R   L 
Sbjct  9    SHSLAQNYKPEVKRPMVNFHPGIRGN-PFINYTPDDEITRAYNQKQVEDLKDEVRREQLA  67

Query  219  PTGSCSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHI----YIHPVHLNDLETVALQF  386
              G  S    Q+L FID ++RLG+AYHFE+EI++ LRHI    +      +DL  V+L+F
Sbjct  68   AAGKPS----QQLNFIDAIQRLGVAYHFEEEIEEALRHICDDHHYSDDKYDDLYNVSLRF  123

Query  387  RLMRQHGYNISTHIFSNFVDGNESSETALM  476
            RL+RQ GYNIS  +F+ F D N S   +L+
Sbjct  124  RLLRQQGYNISCDVFNKFKDKNGSFRESLI  153


 Score = 85.9 bits (211),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 76/117 (65%), Gaps = 7/117 (6%)
 Frame = +2

Query  458  FRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTH  631
            FR+S   DV+G+L LYEA+++R + +D +L+   AF  T L+S   +L  +  L   VT 
Sbjct  148  FRESLIGDVQGMLGLYEAAHLRVQEED-ILDEALAFTTTHLKSLVKHL--DHPLAVQVTQ  204

Query  632  ALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            AL +P   GL R+E R +I +YQ  DE+S +  LL+ A LDFNLLQ L+K+ELS ++
Sbjct  205  ALHRPIRKGLERLEARPYIFIYQ--DEASHSKALLKLAKLDFNLLQSLYKKELSHIT  259



>ref|XP_002277351.2| PREDICTED: valencene synthase [Vitis vinifera]
Length=559

 Score =   101 bits (252),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 90/150 (60%), Gaps = 10/150 (7%)
 Frame = +3

Query  42   GHIMAINFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAY-AKEIEILKEQTRATLLI  218
             H +A N++  + RP+ NF P +     F  ++ D+++  AY  K++E LK++ R   L 
Sbjct  9    SHSLAQNYKPEVKRPMVNFHPGIRGN-PFINYTPDDEITRAYNQKQVEDLKDEVRREQLA  67

Query  219  PTGSCSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHI----YIHPVHLNDLETVALQF  386
              G  S    Q+L FID ++RLG+AYHFE+EI++ LRHI    +      +DL  V+L+F
Sbjct  68   AAGKPS----QQLNFIDAIQRLGVAYHFEEEIEEALRHICDDHHYSDDKYDDLYNVSLRF  123

Query  387  RLMRQHGYNISTHIFSNFVDGNESSETALM  476
            RL+RQ GYNIS  +F+ F D N S   +L+
Sbjct  124  RLLRQQGYNISCDVFNKFKDKNGSFRESLI  153


 Score = 85.9 bits (211),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 76/117 (65%), Gaps = 7/117 (6%)
 Frame = +2

Query  458  FRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTH  631
            FR+S   DV+G+L LYEA+++R + +D +L+   AF  T L+S   +L  +  L   VT 
Sbjct  148  FRESLIGDVQGMLGLYEAAHLRVQEED-ILDEALAFTTTHLKSLVKHL--DHPLAVQVTQ  204

Query  632  ALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            AL +P   GL R+E R +I +YQ  DE+S +  LL+ A LDFNLLQ L+K+ELS ++
Sbjct  205  ALHRPIRKGLERLEARPYIFIYQ--DEASHSKALLKLAKLDFNLLQSLYKKELSHIT  259



>ref|XP_011035527.1| PREDICTED: (-)-germacrene D synthase-like [Populus euphratica]
Length=554

 Score =   100 bits (250),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 77/115 (67%), Gaps = 5/115 (4%)
 Frame = +2

Query  458  FRDSSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHAL  637
            F+ ++DV+G+L LYEA+++    +D +L+   AF   +L+S A +  PN  L   V+HAL
Sbjct  145  FKQTNDVRGILGLYEAAHLAVHGED-ILDEALAFTTIQLKSIATS--PNCPLTAKVSHAL  201

Query  638  DQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
             QP   G+PR+E R + S+YQ  DE S N  LLR A L+FNL+Q LHK+ELSE++
Sbjct  202  KQPIRRGVPRLESRRYFSIYQ--DEPSCNKTLLRLAKLNFNLVQELHKEELSEIT  254


 Score = 86.7 bits (213),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 71/129 (55%), Gaps = 8/129 (6%)
 Frame = +3

Query  66   ENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDV  245
            +N + R   N+ P++W          D        +EIE L E+ +  +L    S     
Sbjct  18   DNEIIRRTANYHPSIWGDQFISHLPKDKVHEAIELQEIEKLMERFKREILASNSS-----  72

Query  246  AQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHL--NDLETVALQFRLMRQHGYNIS  419
             QKL  ID ++RLG+AYHFE EI++ L HIY + + +  +DL   AL FRL+RQHGYN+S
Sbjct  73   -QKLDLIDAIQRLGVAYHFETEIEEALLHIYNNRIDMEDDDLYNTALGFRLLRQHGYNVS  131

Query  420  THIFSNFVD  446
              IF+ F D
Sbjct  132  CDIFNKFKD  140



>gb|AFR42419.1| driminol synthase [Valeriana officinalis]
Length=556

 Score = 99.8 bits (247),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 74/110 (67%), Gaps = 3/110 (3%)
 Frame = +2

Query  473  DVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQPFH  652
            D  GLLSLYEA+ VR  ++ E+L+    F   +L S A     +  +EK +THAL Q  H
Sbjct  148  DAIGLLSLYEATQVRAHAE-EILDEALIFTKAQLESIAATSSLSPFVEKQITHALVQALH  206

Query  653  TGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
             G+PRVE R FISVY+E+ +  +N+ LLRF+ +D+N++QMLHKQEL  +S
Sbjct  207  KGIPRVESRHFISVYEEDPD--KNDLLLRFSKIDYNIVQMLHKQELCHIS  254


 Score = 87.8 bits (216),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 50/139 (36%), Positives = 79/139 (57%), Gaps = 10/139 (7%)
 Frame = +3

Query  54   AINFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSC  233
            A+N E+   RP+ +F P+ W    F ++S D+Q+ E Y KE E LK+Q +  LL  T   
Sbjct  4    ALNSEHETVRPLASFQPSTWGD-LFISYSEDSQLKEVYGKEHECLKQQVKTMLLDVTNY-  61

Query  234  SDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIY------IHPVHLNDLETVALQFRLM  395
               +++K+ FI+ LERLG+++ FE EI+  L  ++         +   DL T+ + FR++
Sbjct  62   --RISEKIAFINTLERLGVSHEFENEIEGLLHQMFDAHSKFQDGIQHFDLFTLGIYFRIL  119

Query  396  RQHGYNISTHIFSNFVDGN  452
            RQHGY I   +F+   D N
Sbjct  120  RQHGYRIYCDVFNKLKDSN  138



>ref|XP_011005622.1| PREDICTED: valencene synthase-like isoform X1 [Populus euphratica]
 ref|XP_011005623.1| PREDICTED: valencene synthase-like isoform X2 [Populus euphratica]
Length=554

 Score = 97.1 bits (240),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 75/115 (65%), Gaps = 5/115 (4%)
 Frame = +2

Query  458  FRDSSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHAL  637
            F+ S+DV+G+L LYEA+++    +D +L+   A     L+S A +  P+  L   V+HAL
Sbjct  145  FKQSNDVRGILGLYEAAHLAVHGED-ILDEALALTTIHLKSMATS--PDCPLAAKVSHAL  201

Query  638  DQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
             QP   G+PR+E R +IS+YQ  DE S N  LLR   L+FNL+Q LHK+EL+E++
Sbjct  202  KQPIRRGVPRLESRRYISIYQ--DEPSCNKTLLRLGKLNFNLVQELHKEELAEIT  254


 Score = 90.5 bits (223),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 71/128 (55%), Gaps = 8/128 (6%)
 Frame = +3

Query  69   NHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVA  248
            N + R   NF P++W          D        +EIE L+EQ    LL    S      
Sbjct  19   NEIIRRTANFHPSIWGDQFISHLPKDKVHEAIELQEIEKLREQFTRELLASNSS------  72

Query  249  QKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHL--NDLETVALQFRLMRQHGYNIST  422
            Q+L  ID ++RLG+AYHFE EI++ L+HIY + + +  +DL   AL FRL+RQHGYN+S 
Sbjct  73   QQLDLIDAIQRLGVAYHFETEIEEALQHIYNNRIGMEDDDLYNTALGFRLLRQHGYNVSC  132

Query  423  HIFSNFVD  446
             IF+ F D
Sbjct  133  DIFNKFKD  140



>gb|KHG16315.1| delta-cadinene synthase isozyme XC1 [Gossypium arboreum]
Length=564

 Score = 94.7 bits (234),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 72/112 (64%), Gaps = 5/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            +SDV+GLL LY+ASY+R   +D +L+   +F    L  A  +L  +  L + V+HAL Q 
Sbjct  148  TSDVRGLLELYQASYLRVHGED-ILDEAISFTTNHLSLAVASL--DHPLSEEVSHALKQS  204

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
               GLPRVE R ++SVYQ  D  S N  LL FA +DFN+LQ LH++ELSE+ 
Sbjct  205  IRRGLPRVEARHYLSVYQ--DIESHNKALLEFAKIDFNMLQFLHRKELSEIC  254


 Score = 92.4 bits (228),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 77/127 (61%), Gaps = 9/127 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            RP  +F P++W     +    D  +    AK  + LKE+ R  ++ P  + +    QKL 
Sbjct  22   RPKADFQPSIWGDLFLNC--PDKNIDAETAKRHQQLKEEVRKMIVAPMANST----QKLA  75

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIHPVHL-NDLETVALQFRLMRQHGYNISTHIFSN  437
            FID ++RLG++YHF KEI+D+L +IY +     NDL T +++FRL+R+HGYN+S  +F+ 
Sbjct  76   FIDSVQRLGVSYHFTKEIEDELENIYHNNNDAENDLYTTSIRFRLLREHGYNVSCDVFNK  135

Query  438  FVD--GN  452
            F D  GN
Sbjct  136  FKDEQGN  142



>ref|XP_004301355.1| PREDICTED: (-)-germacrene D synthase-like [Fragaria vesca subsp. 
vesca]
Length=554

 Score = 94.4 bits (233),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 73/111 (66%), Gaps = 5/111 (5%)
 Frame = +2

Query  470  SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQPF  649
            SDV GLLSLYEA+++R   +D +LE    F  T L S   +L  + +L K V+H+L+QP 
Sbjct  148  SDVSGLLSLYEATHLRIHGED-ILEEALDFTTTHLESIKHSL--SHSLSKQVSHSLNQPL  204

Query  650  HTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
              G+ RVE R+++S+Y E D  S N  LL FA LDFNLLQ +H+ EL E++
Sbjct  205  RKGIIRVEARYYLSIYHECD--SHNETLLTFAKLDFNLLQQVHQIELCEIT  253


 Score = 92.8 bits (229),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 85/145 (59%), Gaps = 13/145 (9%)
 Frame = +3

Query  45   HIMAINFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPT  224
             ++A   +    RP  N+ P++W  + F +++   +V  ++ ++ + LK Q +  L++P 
Sbjct  4    QVLASQSQTPNARPTANYTPSIWGDH-FLSYAT-AEVDFSHKQQFQELKRQVKMMLMVPV  61

Query  225  GSCSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLE------TVALQF  386
               S    +KL  +D ++RLG++YHFE EID+ L  IY    H ND+E      T AL+F
Sbjct  62   KEPS----EKLNLVDDIQRLGVSYHFENEIDEVLEQIY-QATHGNDMENDDDLYTTALRF  116

Query  387  RLMRQHGYNISTHIFSNFVDGNESS  461
            RL+RQ GYN+S  IF+ F +G++ +
Sbjct  117  RLLRQQGYNVSCDIFNKFKEGSDQT  141



>gb|AEP17005.1| (E)-beta-caryophyllene synthase [Vitis vinifera]
Length=557

 Score = 96.3 bits (238),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 73/112 (65%), Gaps = 5/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            SSDV+G+LS YEA++ R   +D +L+   AF  T L+SA      ++ L + V HAL QP
Sbjct  151  SSDVRGMLSSYEATHFRVHGED-ILDEALAFTTTHLQSATKY--SSNPLAEQVVHALKQP  207

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
               GLPR+E R + SVYQ  D  S N  LL+ A LDFNLLQ LH++ELS++S
Sbjct  208  IRKGLPRLEARHYFSVYQAYD--SHNKALLKLAKLDFNLLQKLHQKELSDIS  257


 Score = 90.9 bits (224),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 77/135 (57%), Gaps = 8/135 (6%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSD  239
            N    + R   NF P++W  +     S      +   + ++ LKE+ R  L+    +  D
Sbjct  15   NLSPEVGRRCANFHPSIWGDHFLSYASEFTNTDDHLKQHVQQLKEEVRKMLM----AADD  70

Query  240  DVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPV--HLNDLETVALQFRLMRQHGYN  413
            D AQKL  ID ++RLG+AYHFE EID+ L+H++   V     D+ T +L+FRL+RQ GY+
Sbjct  71   DSAQKLLLIDAIQRLGVAYHFESEIDEVLKHMFDGSVVSAEEDVYTASLRFRLLRQQGYH  130

Query  414  ISTHIFSNFVD--GN  452
            +S  +F+NF D  GN
Sbjct  131  VSCDLFNNFKDNEGN  145



>gb|ADB90273.1| casbene synthase [Euphorbia esula]
Length=598

 Score = 94.7 bits (234),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 85/137 (62%), Gaps = 10/137 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            RP+ NFP T+W    F + + +    E Y +++++L+E     LL    +C  D ++K+ 
Sbjct  62   RPLANFPATVWGDR-FSSLNFNESKFEWYERQVKLLRENIMVMLL--DSAC--DPSEKIV  116

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIHPVHL-----NDLETVALQFRLMRQHGYNISTH  425
             ID L RLG++YHFE  I++QL HI+   +H+      DL T++L FR++RQHG+ +ST 
Sbjct  117  LIDSLCRLGVSYHFEDVIEEQLDHIFKAQLHVFEHKDCDLYTISLAFRVLRQHGFKMSTD  176

Query  426  IFSNFVDGNESSETALM  476
            +F+NF D   + +++L+
Sbjct  177  VFNNFKDTEGNFKSSLL  193


 Score = 92.4 bits (228),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 78/111 (70%), Gaps = 5/111 (5%)
 Frame = +2

Query  470  SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQPF  649
            +D KGLLSLYEA+++    +D +L+    F+   L+S  P +K    L+K +++AL+QPF
Sbjct  194  TDAKGLLSLYEATHMSLPGED-ILDEAFDFSKAFLQS--PEIKSFPELKKHISNALEQPF  250

Query  650  HTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            H G+PR+E R FI +YQ  +++S+N+ LL FA LDFN +Q++H+QEL+  S
Sbjct  251  HNGIPRLEARKFIDLYQ--NDNSKNDILLEFAKLDFNRVQLIHQQELNHYS  299



>gb|AAF74977.1|AF270425_1 (+)-delta-cadinene synthase [Gossypium hirsutum]
Length=551

 Score = 95.5 bits (236),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 75/112 (67%), Gaps = 5/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            +SDV+GLL LY+ASY+R   +D +L+   +F +  L  A  +L  +  L + V+HAL Q 
Sbjct  145  TSDVRGLLELYQASYLRVHGED-ILDEAISFTSNHLSLAVASL--DHPLSEEVSHALKQS  201

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
               GLPRVE R ++SVYQ  D  S N  LL FA +DFN++Q+LH++ELSE+S
Sbjct  202  IRRGLPRVEARHYLSVYQ--DIESHNKVLLEFAKIDFNMVQLLHRKELSEIS  251


 Score = 91.7 bits (226),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 77/127 (61%), Gaps = 9/127 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            RP  +F P++W  +  +    D  +     K  + LKE+ R  ++ P  + +    QKL 
Sbjct  19   RPKADFQPSIWGDFFLNC--PDKNIDAETQKRHQQLKEEVRKMIVAPMANST----QKLA  72

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIHPVHL-NDLETVALQFRLMRQHGYNISTHIFSN  437
            FID ++RLG++YHF KEI+D+L +IY +     NDL T +L+FRL+R+HG+N+S  +F+ 
Sbjct  73   FIDSVQRLGVSYHFTKEIEDELENIYHNNNDAENDLYTTSLRFRLLREHGFNVSCDVFNK  132

Query  438  FVD--GN  452
            F D  GN
Sbjct  133  FKDEQGN  139



>ref|XP_011015484.1| PREDICTED: valencene synthase-like [Populus euphratica]
Length=554

 Score = 98.6 bits (244),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 76/115 (66%), Gaps = 5/115 (4%)
 Frame = +2

Query  458  FRDSSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHAL  637
            F+ S+DV+G+L LYEA+++    +D +L+   A     L+S A +  P+  L   V+HAL
Sbjct  145  FKQSNDVRGILGLYEAAHLAVHGED-ILDEALALTTIHLKSMATS--PDCPLAAKVSHAL  201

Query  638  DQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
             QP   G+PR+E R +IS+YQ  DE S N  LLR A L+FNL+Q LHK+EL+E++
Sbjct  202  KQPIQRGVPRLESRRYISIYQ--DEPSCNKTLLRLAKLNFNLVQELHKEELAEIT  254


 Score = 88.2 bits (217),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 71/128 (55%), Gaps = 8/128 (6%)
 Frame = +3

Query  69   NHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVA  248
            N + R   NF P++W          D        +EIE L+EQ    LL    S      
Sbjct  19   NEIIRRTANFHPSIWGDQFISHLPKDKVHEAIELQEIEKLREQFTRELLASNSS------  72

Query  249  QKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHL--NDLETVALQFRLMRQHGYNIST  422
            Q+L  ID ++RLG+AYHFE EI++ L++IY + + +  +DL   AL FRL+RQHGYN+S 
Sbjct  73   QQLDLIDAIQRLGVAYHFETEIEEALQYIYNNRIGMEDDDLYNTALGFRLLRQHGYNVSC  132

Query  423  HIFSNFVD  446
             IF+ F D
Sbjct  133  DIFNKFKD  140



>gb|AAX44033.1| (+)-delta-cadinene synthase [Gossypium hirsutum]
Length=554

 Score = 95.5 bits (236),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 75/112 (67%), Gaps = 5/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            +SDV+GLL LY+ASY+R   +D +L+   +F +  L  A  +L  +  L + V+HAL Q 
Sbjct  148  TSDVRGLLELYQASYLRVHGED-ILDEAISFTSNHLSLAVASL--DHPLSEEVSHALKQS  204

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
               GLPRVE R ++SVYQ  D  S N  LL FA +DFN++Q+LH++ELSE+S
Sbjct  205  IRRGLPRVEARHYLSVYQ--DIESHNKVLLEFAKIDFNMVQLLHRKELSEIS  254


 Score = 91.3 bits (225),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 77/127 (61%), Gaps = 9/127 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            RP  +F P++W  +  +    D  +     K  + LKE+ R  ++ P  + +    QKL 
Sbjct  22   RPKADFQPSIWGDFFLNC--PDKNIDAETQKRHQQLKEEVRKMIVAPMANST----QKLA  75

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIHPVHL-NDLETVALQFRLMRQHGYNISTHIFSN  437
            FID ++RLG++YHF KEI+D+L +IY +     NDL T +L+FRL+R+HG+N+S  +F+ 
Sbjct  76   FIDSVQRLGVSYHFTKEIEDELENIYHNNNDAENDLYTTSLRFRLLREHGFNVSCDVFNK  135

Query  438  FVD--GN  452
            F D  GN
Sbjct  136  FKDEQGN  142



>gb|KDP24704.1| hypothetical protein JCGZ_25440 [Jatropha curcas]
Length=724

 Score =   100 bits (248),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 87/141 (62%), Gaps = 9/141 (6%)
 Frame = +3

Query  66   ENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDV  245
            E ++ R V NFPPTLW    F +FS  +   E+Y K+ E LKE+ R  L+  T     ++
Sbjct  10   EQNVCRCVPNFPPTLWGYNSFASFSFSDSEYESYTKKGESLKEKVRDMLMAST----KNI  65

Query  246  AQKLKFIDLLERLGIAYHFEKEIDDQLRHI-YIHPVHLN----DLETVALQFRLMRQHGY  410
             Q ++ ID L RLG++YHFE EI++QL HI Y+    LN    DL ++AL FR++RQHGY
Sbjct  66   IQNIELIDTLRRLGVSYHFEMEIEEQLNHIFYVVSKFLNDNDCDLYSIALLFRVLRQHGY  125

Query  411  NISTHIFSNFVDGNESSETAL  473
             IS  +F+ F D + + + A+
Sbjct  126  KISCDVFNKFKDKDGNFQKAI  146


 Score = 86.7 bits (213),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 70/111 (63%), Gaps = 3/111 (3%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            S+DVKG+LSLYEAS V    +D +L+   AF    L S+         L + + +AL   
Sbjct  147  SNDVKGILSLYEASSVSVHGED-ILDEALAFTKPILESSLAMQSIPHHLAQHIRNALILS  205

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEV  799
            FH G+PRVE R +ISVY EEDES  N  LL FA LDFN +Q+LH+QEL E+
Sbjct  206  FHKGVPRVEARQYISVY-EEDESP-NQPLLEFAKLDFNRVQLLHRQELGEL  254



>ref|NP_001234766.1| caryophyllene/alpha-humulene synthase [Solanum lycopersicum]
 gb|ADD96698.1| caryophyllene/alpha-humulene synthase [Solanum lycopersicum]
 gb|AEP82783.1| beta caryophyllene/humulene synthase [Solanum lycopersicum]
Length=548

 Score =   105 bits (262),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 85/127 (67%), Gaps = 5/127 (4%)
 Frame = +2

Query  428  FQQLC*RK*KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKP  601
            F+Q   +  KF+++  +DV+GLLSLYEAS++R R D+E+LE    F  T L S   NL  
Sbjct  123  FKQFINQDGKFKETLTNDVQGLLSLYEASHLRVR-DEEILEEALTFTTTHLESTVSNLSN  181

Query  602  NSTLEKLVTHALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHK  781
            N++L+  VT A  QP    LPRV  R +IS+Y+  D  + N+ LL+FA LDFN+LQ LH+
Sbjct  182  NNSLKAEVTEAFSQPIRMTLPRVGARKYISIYENND--AHNHLLLKFAKLDFNMLQKLHQ  239

Query  782  QELSEVS  802
            +ELS+++
Sbjct  240  RELSDLT  246


 Score = 80.9 bits (198),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 73/127 (57%), Gaps = 13/127 (10%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLL-IPTGSCSDDVAQKL  257
            RP+ NF PT+W    +H  S  +++      E++  KE  R  L+  P GS      QKL
Sbjct  10   RPLANFHPTVWG---YHFLSYTHEITNQEKVEVDEYKETIRKMLVEAPEGS-----EQKL  61

Query  258  KFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLND----LETVALQFRLMRQHGYNISTH  425
              ID ++RLG+AYHF+ EI+  +++I+      ND    L  V+L+FRL+RQ G+ +S+ 
Sbjct  62   VLIDAMQRLGVAYHFDNEIETSIQNIFDASSKQNDNDNNLYVVSLRFRLVRQQGHYMSSD  121

Query  426  IFSNFVD  446
            +F  F++
Sbjct  122  VFKQFIN  128



>emb|CAN82172.1| hypothetical protein VITISV_040547 [Vitis vinifera]
 gb|ADR74221.1| (E)-beta-caryophyllene synthase [synthetic construct]
Length=555

 Score = 96.7 bits (239),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 85/137 (62%), Gaps = 10/137 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYA-KEIEILKEQTRATLLIPTGSCSDDVAQKL  257
            RP   F P++W    F A++ +++V+ A   K++E LKE+ R  L+   G+ S    Q L
Sbjct  19   RPRAEFHPSIWGDQ-FIAYTPEDEVSRACKEKQVEDLKEEVRRELMAAAGNPS----QLL  73

Query  258  KFIDLLERLGIAYHFEKEIDDQLRHIY--IHPVH--LNDLETVALQFRLMRQHGYNISTH  425
             FID ++RLG+AYHFE+EI++ L+HIY   H      +DL  +AL+FRL+RQ GYNIS  
Sbjct  74   NFIDAVQRLGVAYHFEREIEESLQHIYDRFHDADDTNDDLYNIALRFRLLRQQGYNISCG  133

Query  426  IFSNFVDGNESSETALM  476
            IF+ F D   S +  L+
Sbjct  134  IFNKFKDEKGSFKEDLI  150


 Score = 89.4 bits (220),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 74/111 (67%), Gaps = 5/111 (5%)
 Frame = +2

Query  470  SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQPF  649
            S+++G+L LYEA+++R   +D +LE   +F  T L++   +L     L + V+HAL  P 
Sbjct  151  SNIQGMLGLYEAAHLRVHGED-ILEEALSFTTTHLKATVESL--GYPLAEQVSHALKHPI  207

Query  650  HTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
              GL R+E R++IS+YQ  DE+S +  LL+ A LDFNL+Q LHK+ELS ++
Sbjct  208  RKGLERLEARWYISLYQ--DEASHDKTLLKLAKLDFNLVQSLHKEELSNLA  256



>gb|AFE56211.1| terpene synthase [Camellia sinensis]
Length=567

 Score = 99.8 bits (247),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 80/118 (68%), Gaps = 7/118 (6%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            K R+S   DV+G+LSLYEA+++R R +D +L+   +F  T L SA PNL  ++ +++ V 
Sbjct  150  KIRESLIGDVRGMLSLYEAAHLRVRGED-ILDEALSFTITHLESAVPNL--SNLVQEQVI  206

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+QP H GL R+E   +   Y+++D  S N  LL FA LDFNLLQ +H+ ELSE++
Sbjct  207  HALNQPIHMGLTRLEATRYFFFYEQDD--SHNEVLLNFAKLDFNLLQKMHQWELSEIT  262


 Score = 86.3 bits (212),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 80/149 (54%), Gaps = 18/149 (12%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWA----RYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTG  227
            N    + R   N+ P++W      Y  HA  +D ++ +   ++    KE+ R  L+    
Sbjct  16   NMVPEVTRRSANYHPSIWGDHFLTYASHAVEVDVKMGQQLQQQ----KEEVRKMLV----  67

Query  228  SCSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYI-----HPVHLN-DLETVALQFR  389
            + +D  +QKL F D ++RLG++YHFE E++  L+HIY      H    N DL TVAL FR
Sbjct  68   AANDQPSQKLNFTDAIQRLGVSYHFESEMETALQHIYETDYDHHDDKANDDLYTVALMFR  127

Query  390  LMRQHGYNISTHIFSNFVDGNESSETALM  476
            L+RQ GY IS  +F+ F D N     +L+
Sbjct  128  LLRQQGYPISCDVFNKFKDDNGKIRESLI  156



>ref|XP_002513343.1| Casbene synthase, chloroplast precursor, putative [Ricinus communis]
 gb|EEF48746.1| Casbene synthase, chloroplast precursor, putative [Ricinus communis]
Length=599

 Score =   101 bits (251),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 81/118 (69%), Gaps = 6/118 (5%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S   D KG+LSL+EAS++    +D +LE   AF    L+S+A  L PN  L++ +T
Sbjct  187  KFKESLRGDAKGMLSLFEASHLSVHGED-ILEEAFAFTKDYLQSSAVELFPN--LKRHIT  243

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            +AL+QPFH+G+PR+E R FI +Y E D   RN  LL FA LD+N +Q+LH+QEL + S
Sbjct  244  NALEQPFHSGVPRLEARKFIDLY-EADIECRNETLLEFAKLDYNRVQLLHQQELCQFS  300


 Score = 84.3 bits (207),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 77/136 (57%), Gaps = 10/136 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            RP+ +FPPT+W    F + + +    E+Y   + +LKE+ +  L+    S + D  + + 
Sbjct  62   RPLAHFPPTVWGNR-FASLTFNPSEFESYDGRVNVLKEKVKDLLV----SSATDSVETVV  116

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIHPVHL-----NDLETVALQFRLMRQHGYNISTH  425
             IDLL RLG++YHFE +I++ L  I+     L      DL T A+ FR+ RQHG+ +S+ 
Sbjct  117  LIDLLCRLGVSYHFENDIEELLSKIFNSQPDLVDEKECDLYTAAIVFRVFRQHGFKMSSD  176

Query  426  IFSNFVDGNESSETAL  473
            +FS F D +   + +L
Sbjct  177  VFSKFKDSDGKFKESL  192



>gb|KDP46461.1| hypothetical protein JCGZ_12944 [Jatropha curcas]
Length=538

 Score =   101 bits (252),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 81/129 (63%), Gaps = 10/129 (8%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            RP+ NFPP++W  Y F + S      E+Y +E+E LKE  +  L   TG    ++ + ++
Sbjct  16   RPLANFPPSVWG-YSFASSSPLEAEFESYTREVEALKENVKDMLKQSTG----ELIENIE  70

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYI---HPVHLN--DLETVALQFRLMRQHGYNISTH  425
            FI+LL RLGI+YHFE EI++QL HI+I   + +H N  DL T AL F+++RQHGY +   
Sbjct  71   FINLLYRLGISYHFEAEIEEQLNHIFIALPNIIHDNNYDLYTSALLFQVLRQHGYKMPCD  130

Query  426  IFSNFVDGN  452
            +F  F D N
Sbjct  131  VFKKFKDNN  139


 Score = 84.0 bits (206),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 73/125 (58%), Gaps = 14/125 (11%)
 Frame = +2

Query  455  KFRD---------SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNS  607
            KF+D         S DVKGLL LYEA+++    +D +L+    F    L   A    P+ 
Sbjct  134  KFKDNNGEFKKSISDDVKGLLGLYEATFLSVHGED-ILDEALVFTKRCLEILAAQSSPH-  191

Query  608  TLEKLVTHALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQE  787
             L   + +AL +PFH G+ R+E R +IS Y EE+  S N  LL+FA LDFN LQ+L+KQE
Sbjct  192  -LANRIRNALLRPFHQGIERIETRQYISFYAEEE--SPNQTLLKFAKLDFNRLQLLYKQE  248

Query  788  LSEVS  802
            L+ VS
Sbjct  249  LALVS  253



>emb|CAN62114.1| hypothetical protein VITISV_032023 [Vitis vinifera]
Length=532

 Score = 94.7 bits (234),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 83/137 (61%), Gaps = 10/137 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYA-KEIEILKEQTRATLLIPTGSCSDDVAQKL  257
            RP   F P +W    F  ++ +++V+ A   K++E LKE+ R  L+   G+ S    Q L
Sbjct  19   RPRAKFHPNIWGD-LFITYTPEDEVSRACKEKQVEDLKEEVRRELMAAAGNPS----QLL  73

Query  258  KFIDLLERLGIAYHFEKEIDDQLRHIY--IHPVH--LNDLETVALQFRLMRQHGYNISTH  425
             FID ++RLG+AYHFE+EI++ L+HIY   H      +DL  +AL+FRL+RQ GYNIS  
Sbjct  74   NFIDAVQRLGVAYHFEREIEESLQHIYDRFHDADDTNDDLYNIALRFRLLRQQGYNISCG  133

Query  426  IFSNFVDGNESSETALM  476
            IF+ F D   S +  L+
Sbjct  134  IFNKFKDEKGSFKEDLI  150


 Score = 90.9 bits (224),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 74/111 (67%), Gaps = 5/111 (5%)
 Frame = +2

Query  470  SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQPF  649
            S+++G+L LYEA+++R   +D +LE   AF  T L++   +L     L + V+HAL  P 
Sbjct  151  SNIQGMLGLYEAAHLRVHGED-ILEEALAFTTTHLKATVESL--GYPLAEQVSHALKHPI  207

Query  650  HTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
              GL R+E R++IS+YQ  DE+S +  LL+ A LDFNL+Q LHK+ELS ++
Sbjct  208  RKGLERLEARWYISLYQ--DEASHDKTLLKLAKLDFNLVQSLHKEELSNLA  256



>gb|KDP36233.1| hypothetical protein JCGZ_09953 [Jatropha curcas]
Length=510

 Score = 95.9 bits (237),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 78/125 (62%), Gaps = 13/125 (10%)
 Frame = +2

Query  455  KFRDSS---------DVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNS  607
            KFRDS+         D++G+LSLYEA+Y+R   +D +LE   AF+   L+S A N    S
Sbjct  135  KFRDSNGHLNETLKNDIQGILSLYEAAYLRVHGED-ILEEALAFSTVHLKSIA-NAHTRS  192

Query  608  TLEKLVTHALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQE  787
                 V+ AL QP   GL R+E + +IS+YQE+  +S N  LL FA LDFN+LQM+H++E
Sbjct  193  PFAAQVSRALKQPIRKGLQRLESKHYISMYQED--ASHNEVLLTFAKLDFNVLQMMHREE  250

Query  788  LSEVS  802
            L  +S
Sbjct  251  LRYIS  255


 Score = 89.7 bits (221),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 76/132 (58%), Gaps = 6/132 (5%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWA-RYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCS  236
            N  +++ R   NF P +W  R+  +A    N +     ++++ LKE+ R  ++  T   S
Sbjct  14   NTSSNITRRTANFSPDIWGDRFLSYASEFTN-INNDMEEQVQRLKEEVRRMIIASTHEPS  72

Query  237  DDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNI  416
             D    L  ID ++RLG+AYHFE EI++ L  I+    + NDL + AL+FRL+RQ G+N+
Sbjct  73   KD----LNLIDSIQRLGVAYHFENEIEEALLRIHCSTDNYNDLHSAALRFRLLRQQGFNV  128

Query  417  STHIFSNFVDGN  452
            S  +F+ F D N
Sbjct  129  SCDVFNKFRDSN  140



>sp|E3W207.1|SAUSS_SANAS RecName: Full=Sesquiterpene synthase; Short=SauSesquiTPS [Santalum 
austrocaledonicum]
 gb|ADO87005.1| sesquiterpene synthase [Santalum austrocaledonicum]
Length=559

 Score =   103 bits (258),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 83/144 (58%), Gaps = 13/144 (9%)
 Frame = +3

Query  69   NHLPRPVDNFPPTLWA-RYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDV  245
              L RP+ NFPP++W  R+  +    +N+ A+   +++E LKEQ R  L     +  D  
Sbjct  15   KELSRPIANFPPSIWGDRFINYTCEDENEQAQK-ERQVEELKEQVRREL----AATVDKP  69

Query  246  AQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLN-------DLETVALQFRLMRQH  404
             Q+L  ID  +RLGIAYHFE EI++ L HIY+H    N       DL +VAL FRL+RQ 
Sbjct  70   LQQLNIIDATQRLGIAYHFENEIEESLEHIYLHTYVKNNCFQGSHDLYSVALWFRLLRQD  129

Query  405  GYNISTHIFSNFVDGNESSETALM  476
            GY +S  +F NF D   + + +LM
Sbjct  130  GYKVSCDVFDNFRDYEGNFKNSLM  153


 Score = 81.6 bits (200),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 71/117 (61%), Gaps = 7/117 (6%)
 Frame = +2

Query  458  FRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTH  631
            F++S   D KGLL LYEA+++    + E+L+    FA TRL S   +L  N  L + V H
Sbjct  148  FKNSLMEDAKGLLELYEATHLSVHGE-EMLDDALEFAKTRLESIVNHL--NYPLAEQVRH  204

Query  632  ALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            AL +P   GLPR+E  +F  +Y  E   S N  LL+ A LDFNLLQ LH++EL +++
Sbjct  205  ALYRPLRKGLPRLEAVYFFRIY--EAYHSHNKALLKLAKLDFNLLQSLHRKELGDMA  259



>ref|XP_010247958.1| PREDICTED: (-)-germacrene D synthase-like [Nelumbo nucifera]
Length=564

 Score = 97.1 bits (240),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 76/118 (64%), Gaps = 5/118 (4%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KFR+S   D++G+LSLYEA+Y+  R + EVL+   AF    L+S       + TL K V 
Sbjct  150  KFRESLARDIQGMLSLYEAAYLGKRGE-EVLDEALAFTTAHLKSTVATDTTSPTLVKQVK  208

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+QP H G+P++E R +IS Y+E  + SR   LL+ A LDFN  Q+L+  ELS+VS
Sbjct  209  HALEQPLHRGIPKIEARHYISFYEE--DKSRIQVLLKLAKLDFNRTQLLYLNELSQVS  264


 Score = 88.2 bits (217),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 75/132 (57%), Gaps = 10/132 (8%)
 Frame = +3

Query  66   ENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDV  245
            +  L R    F P++W    F  ++ DN   E+Y +++E LKE+ R+ L     + ++  
Sbjct  20   KTELIRHTTTFHPSIWGDR-FITYTCDNMKLESYNQQVEELKEEVRSIL----RNSANKP  74

Query  246  AQKLKFIDLLERLGIAYHFEKEIDDQLRHIY-IHPVHLNDLE----TVALQFRLMRQHGY  410
             + L  ID ++RLG+ Y FE+EID  L  I+  H V+ ND++     VAL FRL+RQHGY
Sbjct  75   LEMLSLIDGVQRLGLGYQFEREIDKMLEQIFDAHIVYFNDMDDNLNAVALLFRLLRQHGY  134

Query  411  NISTHIFSNFVD  446
            NI   +F  F D
Sbjct  135  NIPCDVFKKFRD  146



>dbj|BAJ53219.1| JHL17M24.3 [Jatropha curcas]
Length=556

 Score = 94.7 bits (234),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 72/111 (65%), Gaps = 3/111 (3%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            S+DVKG+LSLYEAS+V    +D +L+   AF    L S+         L + + +AL  P
Sbjct  147  SNDVKGILSLYEASFVSVHGED-ILDEALAFTKPILESSLAMQSIPHHLAQYIRNALILP  205

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEV  799
            FH G+PRVE R +IS Y EEDES RN  LL FA LDFN +Q+LHKQEL E+
Sbjct  206  FHKGVPRVEARQYISFY-EEDES-RNETLLEFAKLDFNRVQLLHKQELGEL  254


 Score = 90.5 bits (223),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 75/128 (59%), Gaps = 9/128 (7%)
 Frame = +3

Query  66   ENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDV  245
            E ++ R V NFPPTLW    F +FS  N   E Y K++E LKE+    L+        ++
Sbjct  10   EQNVCRSVPNFPPTLWGYNSFASFSFPNSEYELYTKKVESLKEKIIRILM----DSVKNL  65

Query  246  AQKLKFIDLLERLGIAYHFEKEIDDQLRHIY-IHPVHLN----DLETVALQFRLMRQHGY  410
             Q ++ I  L RLG++YHFE EI++QL H + +    L+    DL  +AL FR++RQHGY
Sbjct  66   IQNIELISTLCRLGVSYHFEMEIEEQLSHAFNVVSNFLDDNDCDLYNIALIFRVLRQHGY  125

Query  411  NISTHIFS  434
             +S  +F+
Sbjct  126  KMSCDVFN  133



>gb|AAD51718.1| (+)-delta-cadinene sythase [Gossypium arboreum]
Length=508

 Score = 96.3 bits (238),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 79/134 (59%), Gaps = 9/134 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            RP  +F P++W  +  +    D  +     K  + LKE+ R  ++ P  + +    QKL 
Sbjct  22   RPKADFQPSIWGDFFLNC--PDKNIDAGTEKRHQQLKEEVRKMIVAPMANST----QKLA  75

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIHPVHL-NDLETVALQFRLMRQHGYNISTHIFSN  437
            FID L+RLG++YHF KEI+D+L +IY +     NDL T +L+FRL+R+HGYN+S  +F+ 
Sbjct  76   FIDSLQRLGVSYHFTKEIEDELENIYHNNNDAENDLYTTSLRFRLLREHGYNVSCDVFNK  135

Query  438  FVD--GNESSETAL  473
            F D  GN  S   L
Sbjct  136  FKDEQGNFKSSVTL  149


 Score = 89.0 bits (219),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 69/110 (63%), Gaps = 5/110 (5%)
 Frame = +2

Query  473  DVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQPFH  652
            DV+GLL LY+ASY+R   +D +L+   +F    L  A  +L  +  L + V+HAL Q   
Sbjct  150  DVRGLLELYQASYLRVHGED-ILDEAISFTTNHLSLAVASL--DHPLSEEVSHALKQSIR  206

Query  653  TGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
             GL RVE R ++SVYQ  D  S N  LL FA +DFN+LQ LH++ELSE+ 
Sbjct  207  RGLSRVEARHYLSVYQ--DIESHNKALLEFAKIDFNMLQFLHRKELSEIC  254



>dbj|BAJ53216.1| JHL22C18.7 [Jatropha curcas]
Length=551

 Score =   101 bits (252),  Expect(2) = 9e-38, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 81/129 (63%), Gaps = 10/129 (8%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            RP+ NFPP++W  Y F + S      E+Y +E+E LKE  +  L   TG    ++ + ++
Sbjct  16   RPLANFPPSVWG-YSFASSSPLEAEFESYTREVEALKENVKDMLKQSTG----ELIENIE  70

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYI---HPVHLN--DLETVALQFRLMRQHGYNISTH  425
            FI+LL RLGI+YHFE EI++QL HI+I   + +H N  DL T AL F+++RQHGY +   
Sbjct  71   FINLLYRLGISYHFEAEIEEQLNHIFIALPNIIHDNNYDLYTSALLFQVLRQHGYKMPCD  130

Query  426  IFSNFVDGN  452
            +F  F D N
Sbjct  131  VFKKFKDNN  139


 Score = 83.6 bits (205),  Expect(2) = 9e-38, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 72/125 (58%), Gaps = 14/125 (11%)
 Frame = +2

Query  455  KFRD---------SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNS  607
            KF+D         S DVKGLL LYEA+++    +D +L+    F    L   A    P+ 
Sbjct  134  KFKDNNGEFKKSISDDVKGLLGLYEATFLSVHGED-ILDEALVFTKRCLEILAAQSSPH-  191

Query  608  TLEKLVTHALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQE  787
             L   + +AL +PFH G+ R+E R +IS Y EE   S N  LL+FA LDFN LQ+L+KQE
Sbjct  192  -LANRIRNALLRPFHQGIERIETRQYISFYAEE--KSPNQTLLKFAKLDFNRLQLLYKQE  248

Query  788  LSEVS  802
            L+ VS
Sbjct  249  LALVS  253



>ref|NP_001268028.1| valencene synthase-like [Vitis vinifera]
 gb|ADR74192.1| (E)-beta-caryophyllene synthase [Vitis vinifera]
Length=555

 Score = 94.7 bits (234),  Expect(2) = 9e-38, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 76/136 (56%), Gaps = 8/136 (6%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            RP+  F P++W          D        K++E LK + R  L+   G+ S    Q L 
Sbjct  19   RPMAEFHPSIWGDQFIAYTPEDEDTRACKEKQVEDLKAEVRRELMAAAGNPS----QLLN  74

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIY--IHPVH--LNDLETVALQFRLMRQHGYNISTHI  428
            FID ++RLG+AYHFE+EI++ L+HIY   H      +DL  +ALQFRL+RQ GYNIS  I
Sbjct  75   FIDAVQRLGVAYHFEREIEESLQHIYDRFHDADDTEDDLYNIALQFRLLRQQGYNISCGI  134

Query  429  FSNFVDGNESSETALM  476
            F+ F D   S +  L+
Sbjct  135  FNKFKDEKGSFKEDLI  150


 Score = 90.5 bits (223),  Expect(2) = 9e-38, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 73/111 (66%), Gaps = 5/111 (5%)
 Frame = +2

Query  470  SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQPF  649
            S+++G+L LYEA+++R   +D +LE   AF  T L++   +L     L + V HAL  P 
Sbjct  151  SNIQGMLGLYEAAHLRVHGED-ILEEALAFTTTHLKATVESL--GYPLAEQVAHALKHPI  207

Query  650  HTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
              GL R+E R++IS+YQ  DE+S +  LL+ A LDFNL+Q LHK+ELS ++
Sbjct  208  RKGLERLEARWYISLYQ--DEASHDKTLLKLAKLDFNLVQSLHKEELSNLA  256



>ref|XP_010105617.1| (-)-germacrene D synthase [Morus notabilis]
 gb|EXC05286.1| (-)-germacrene D synthase [Morus notabilis]
Length=468

 Score =   107 bits (267),  Expect(2) = 9e-38, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 85/130 (65%), Gaps = 10/130 (8%)
 Frame = +2

Query  428  FQQLC*RK*KFRD--SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRS---AAPN  592
            FQ+   ++ KF D  + DVKG+LSLYEA+++R R  + +LE   AF  T L+    ++  
Sbjct  138  FQKFINKEGKFNDDLTDDVKGMLSLYEAAHLR-RLGEPILEEALAFTTTHLKPLTMSSSQ  196

Query  593  LKPNSTLEKLVTHALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQM  772
            L P   L   V HAL QP  TGLPR+E R FISVYQEE   S N+ LLRFA LDFN+LQ 
Sbjct  197  LSP--FLAAQVKHALTQPMWTGLPRLEVRRFISVYQEE--PSHNDVLLRFAKLDFNILQK  252

Query  773  LHKQELSEVS  802
            LH+QEL E+S
Sbjct  253  LHQQELGEMS  262


 Score = 77.4 bits (189),  Expect(2) = 9e-38, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 74/134 (55%), Gaps = 11/134 (8%)
 Frame = +3

Query  66   ENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDV  245
            +N + R   N+ P++W  Y  +  S   +V     +E E LKE+ +  L       S++ 
Sbjct  14   KNEIIRRSANYHPSIWRDYFLNYSSQSLEVGNNIKQEGEKLKEEVKRMLAAAATGPSENA  73

Query  246  AQKLKFIDLLERLGIAYHFEKEIDDQL----RHIYIHPVHLN---DLETVALQFRLMRQH  404
                + ID+++RLG +YHFE EI + L    ++I +   + N   DL T AL+FRL+RQ 
Sbjct  74   ----ELIDIIQRLGFSYHFESEISEILGLMKKNIVLDIGYFNNHDDLHTSALKFRLLRQQ  129

Query  405  GYNISTHIFSNFVD  446
            GYNI++ IF  F++
Sbjct  130  GYNIASDIFQKFIN  143



>ref|XP_010258444.1| PREDICTED: (-)-germacrene D synthase-like [Nelumbo nucifera]
Length=562

 Score = 93.6 bits (231),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 75/127 (59%), Gaps = 10/127 (8%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            R   NF P++W    F  ++ DN   +A  K+ E LKE+ R  L+  T   S    + L 
Sbjct  24   RRSANFHPSIWGDR-FTTYTCDNMTLDACNKQAEGLKEEVRCMLMNSTNGPS----EILS  78

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYI-HPVHLN----DLETVALQFRLMRQHGYNISTH  425
             ID ++RLG+AYHFE+EID+ L H+ + H  + N    DL T+AL FRL+RQ+GYNI   
Sbjct  79   LIDTIQRLGLAYHFEREIDEILEHMLVTHVGYFNGVDDDLHTIALWFRLLRQNGYNIPCD  138

Query  426  IFSNFVD  446
            IF+ F D
Sbjct  139  IFNKFKD  145


 Score = 91.3 bits (225),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 79/118 (67%), Gaps = 6/118 (5%)
 Frame = +2

Query  455  KFRD--SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KFRD  + D+KG+L LYEA+++  R + EVL+   AF   +L S+      +S L K V 
Sbjct  149  KFRDGLTRDLKGILGLYEAAHLGIRGE-EVLDEALAFTTAQLESSVVT-NTSSHLVKQVM  206

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+QPFH G+ ++E R +IS Y E+DE + N  LL+FA LDFN LQ LH +ELS++S
Sbjct  207  HALEQPFHRGMLKLEARHYISFY-EQDE-THNPVLLQFAKLDFNRLQPLHLKELSQIS  262



>emb|CAN78342.1| hypothetical protein VITISV_000109 [Vitis vinifera]
Length=555

 Score = 95.1 bits (235),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 87/137 (64%), Gaps = 10/137 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYA-KEIEILKEQTRATLLIPTGSCSDDVAQKL  257
            RPV  +   +W    F +++ +++V  A   K++E LKE+ R  L+   G+ S    Q+L
Sbjct  19   RPVVXYHXXIWGDQ-FLSYTPEDEVTRACKEKQLEDLKEEIRRKLMNTAGNTS----QQL  73

Query  258  KFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLE----TVALQFRLMRQHGYNISTH  425
            KFID ++RLG+AYHFE+EI++ L+HIY    + +D+E     VALQFRL+RQ G+NIS  
Sbjct  74   KFIDAVQRLGVAYHFEREIEEVLQHIYDSYPNGDDMEGDIYNVALQFRLLRQAGFNISCG  133

Query  426  IFSNFVDGNESSETALM  476
            +F+ F D   + + AL+
Sbjct  134  LFNEFKDEKGNFKKALV  150


 Score = 89.7 bits (221),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 73/111 (66%), Gaps = 5/111 (5%)
 Frame = +2

Query  470  SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQPF  649
            SDV+G+L LYEA+++R   +D +L    AF  T L++   +L  +  L + V HAL++P 
Sbjct  151  SDVRGMLGLYEAAHLRVHGED-ILAKALAFTTTHLKAMVESLGYH--LAEQVAHALNRPI  207

Query  650  HTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
              GL R+E R++ISVYQ  DE+  +  LL  A LDFNL+Q LHK+ELS ++
Sbjct  208  RKGLERLEARWYISVYQ--DEAFHDKTLLELAKLDFNLVQSLHKEELSNLA  256



>sp|Q39760.1|DCS2_GOSAR RecName: Full=(+)-delta-cadinene synthase isozyme XC14; Short=D-cadinene 
synthase XC14 [Gossypium arboreum]
 gb|AAA93065.1| (+)-delta-cadinene synthase isozyme XC14 [Gossypium arboreum]
Length=554

 Score = 94.7 bits (234),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 74/112 (66%), Gaps = 5/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            +SDV+GLL LY+ASY+R   +D +L+   +F    L  A  +L  +  L + V+HAL Q 
Sbjct  148  TSDVRGLLELYQASYLRVHGED-ILDEAISFTTNHLSLAVASL--DYPLSEEVSHALKQS  204

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
               GLPRVE R ++SVYQ  D  S N  LL FA +DFN++Q+LH++ELSE+S
Sbjct  205  IRRGLPRVEARHYLSVYQ--DIESHNKVLLEFAKIDFNMVQLLHRKELSEIS  254


 Score = 90.1 bits (222),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 76/127 (60%), Gaps = 9/127 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            RP  +F P++W     +    D  +     K  + LKE+ R  ++ P  + +    QKL 
Sbjct  22   RPKADFQPSIWGDLFLNC--PDKNIDAETEKRHQQLKEEVRKMIVAPMANST----QKLA  75

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIHPVHL-NDLETVALQFRLMRQHGYNISTHIFSN  437
            FID ++RLG++YHF KEI+D+L +IY +     NDL T +L+FRL+R+HG+N+S  +F+ 
Sbjct  76   FIDSVQRLGVSYHFTKEIEDELENIYHNNNDAENDLYTTSLRFRLLREHGFNVSCDVFNK  135

Query  438  FVD--GN  452
            F D  GN
Sbjct  136  FKDEQGN  142



>gb|KHG05331.1| delta-cadinene synthase isozyme XC14 [Gossypium arboreum]
Length=554

 Score = 95.1 bits (235),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 74/112 (66%), Gaps = 5/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            +SDV+GLL LY+ASY+R   +D +L+   +F    L  A  +L  +  L + V+HAL Q 
Sbjct  148  TSDVRGLLELYQASYLRVHGED-ILDEAISFTTNHLSLAVASL--DYPLSEEVSHALKQS  204

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
               GLPRVE R ++SVYQ  D  S N  LL FA +DFN++Q+LH++ELSE+S
Sbjct  205  IRRGLPRVEARHYLSVYQ--DIESHNKVLLEFAKIDFNMVQLLHRKELSEIS  254


 Score = 89.4 bits (220),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 81/134 (60%), Gaps = 10/134 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            RP  +F P++W     +    D  +     K  + LKE+ R  ++ P  + +    QKL 
Sbjct  22   RPKADFQPSIWGDLFLNC--PDKNIDAETEKRHQQLKEEVRKMIVAPMANST----QKLA  75

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIHPVHL-NDLETVALQFRLMRQHGYNISTHIFSN  437
            FID ++RLG++YHF KEI+D+L +IY +     NDL T +L+FRL+R+HG+N+S  +F+ 
Sbjct  76   FIDSVQRLGVSYHFTKEIEDELENIYHNNNDAENDLYTTSLRFRLLREHGFNVSYDVFNK  135

Query  438  FVD--GN-ESSETA  470
            F D  GN +SS T+
Sbjct  136  FKDEQGNFKSSMTS  149



>gb|EYU31459.1| hypothetical protein MIMGU_mgv1a026799mg [Erythranthe guttata]
Length=358

 Score =   104 bits (260),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 71/121 (59%), Gaps = 7/121 (6%)
 Frame = +3

Query  84   PVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLKF  263
            PV  F P++W    F  FS D QV E Y K IE LK++ R+ L+  T        + L  
Sbjct  15   PVTVFSPSMWGD-TFSTFSFDEQVQEKYEKAIETLKQEVRSKLVEATS------GKLLIS  67

Query  264  IDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNISTHIFSNFV  443
            +D LERLG+AYHFE EI+++L  IY      +DL T AL+FRL+RQH Y +S  +F  F 
Sbjct  68   VDTLERLGLAYHFETEIEEKLEQIYNEDQEFDDLFTTALRFRLLRQHQYQVSCSVFDKFT  127

Query  444  D  446
            D
Sbjct  128  D  128


 Score = 80.1 bits (196),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 71/111 (64%), Gaps = 4/111 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            SSDV+GLLSLYEA+++R R +D +LE    F    L +    L   S L+  V  AL   
Sbjct  138  SSDVEGLLSLYEAAHIRIRGED-ILEEAVPFTKHHL-TRRHMLSLESPLKDKVKRALVHS  195

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEV  799
             H G+P +E R +IS+Y+++D  SR+  +L+ A L+FN LQ ++K+ELSE+
Sbjct  196  LHRGVPIIEARVYISIYEKDD--SRDEIILKLAKLNFNYLQNMYKEELSEL  244



>dbj|BAJ46125.1| sesquiterpene synthase [Toona sinensis]
Length=556

 Score =   102 bits (253),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 76/112 (68%), Gaps = 3/112 (3%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            ++DV G+LSLYEA+++    +D +L+   AF  T L+S A +   N +L   V HAL QP
Sbjct  148  TTDVPGMLSLYEAAHLGAHGED-ILDEAIAFTTTHLKSLAIDHLRNPSLASQVIHALRQP  206

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
             H G+PR+E+R +IS+YQ  DE S N  L++   LDFNL+Q LHK+ELSE+S
Sbjct  207  LHRGVPRLENRRYISIYQ--DEVSHNKALVKLFKLDFNLVQSLHKKELSEIS  256


 Score = 82.4 bits (202),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 80/150 (53%), Gaps = 12/150 (8%)
 Frame = +3

Query  39   IGHIMAINFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLI  218
            +  I ++  +  + R   N+ P +W     +   +D      + + IE LK+  R  LL 
Sbjct  5    VSQIPSLKAKGVIMRRNANYHPNIWGDRFINYVPVDKMNHTCHLQAIEELKDAVRRELLT  64

Query  219  PTGSCSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLND-----LETVALQ  383
             TG        +L  ID ++RLG+ YHFE+E+++ L+H+Y H  H +D     L  ++L+
Sbjct  65   ATG------LSQLNLIDAIQRLGVGYHFERELEEALQHVY-HKNHYHDDTEDNLYIISLR  117

Query  384  FRLMRQHGYNISTHIFSNFVDGNESSETAL  473
            FRL+RQHGY +S  I + F D  ++ + +L
Sbjct  118  FRLLRQHGYYVSCDILNKFKDEKDNFKESL  147



>sp|Q39761.1|DCS1_GOSAR RecName: Full=(+)-delta-cadinene synthase isozyme XC1; Short=D-cadinene 
synthase XC1 [Gossypium arboreum]
 pdb|3G4D|A Chain A, Crystal Structure Of (+)-Delta-Cadinene Synthase From 
Gossypium Arboreum And Evolutionary Divergence Of Metal Binding 
Motifs For Catalysis
 pdb|3G4D|B Chain B, Crystal Structure Of (+)-Delta-Cadinene Synthase From 
Gossypium Arboreum And Evolutionary Divergence Of Metal Binding 
Motifs For Catalysis
 pdb|3G4F|A Chain A, Crystal Structure Of (+)- -Cadinene Synthase From Gossypium 
Arboreum In Complex With 2-Fluorofarnesyl Diphosphate
 pdb|3G4F|B Chain B, Crystal Structure Of (+)- -Cadinene Synthase From Gossypium 
Arboreum In Complex With 2-Fluorofarnesyl Diphosphate
 gb|AAA93064.1| (+)-delta-cadinene synthase isozyme XC1 [Gossypium arboreum]
Length=554

 Score = 94.0 bits (232),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 72/112 (64%), Gaps = 5/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            +SDV+GLL LY+ASY+R   +D +L+   +F    L  A  +L  +  L + V+HAL Q 
Sbjct  148  TSDVRGLLELYQASYLRVHGED-ILDEAISFTTHHLSLAVASL--DHPLSEEVSHALKQS  204

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
               GLPRVE R ++SVYQ  D  S N  LL FA +DFN+LQ LH++ELSE+ 
Sbjct  205  IRRGLPRVEARHYLSVYQ--DIESHNKALLEFAKIDFNMLQFLHRKELSEIC  254


 Score = 90.5 bits (223),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 76/127 (60%), Gaps = 9/127 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            RP  +F P++W     +    D  +     K  + LKE+ R  ++ P  + +    QKL 
Sbjct  22   RPKADFQPSIWGDLFLNC--PDKNIDAETEKRHQQLKEEVRKMIVAPMANST----QKLA  75

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIHPVHL-NDLETVALQFRLMRQHGYNISTHIFSN  437
            FID ++RLG++YHF KEI+D+L +IY +     NDL T +++FRL+R+HGYN+S  +F+ 
Sbjct  76   FIDSVQRLGVSYHFTKEIEDELENIYHNNNDAENDLYTTSIRFRLLREHGYNVSCDVFNK  135

Query  438  FVD--GN  452
            F D  GN
Sbjct  136  FKDEQGN  142



>ref|XP_006475306.1| PREDICTED: (E)-beta-farnesene synthase-like [Citrus sinensis]
Length=555

 Score = 94.4 bits (233),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 81/119 (68%), Gaps = 7/119 (6%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRS-AAPNLKPNSTLEKLV  625
            KF+ S   +V+G+LSLYEA ++  R +D +L+   AF  T L+S  + +++PN+  E+ +
Sbjct  142  KFKASLVKEVQGILSLYEAGHLAIRGED-ILDEAIAFTRTHLQSMVSHDVRPNNLAEQ-I  199

Query  626  THALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
             HALD P    LPRVE RFF+SVY  +D+  +   LL+FA LDFNL+Q +H++ELS ++
Sbjct  200  NHALDCPLRRALPRVETRFFLSVYPRDDKHDKT--LLKFAKLDFNLVQRIHQKELSAIT  256


 Score = 90.1 bits (222),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 80/136 (59%), Gaps = 9/136 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEA-YAKEIEILKEQTRATLLIPTGSCSDDVAQKL  257
            RP+  F P LW  Y F   + D +  +  + +E E LK++ R+ +     + +D  AQKL
Sbjct  18   RPIAGFHPNLWGDY-FLTLASDCKTNDTTHQEEYEALKQEVRSMIT----ATADTPAQKL  72

Query  258  KFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLN---DLETVALQFRLMRQHGYNISTHI  428
            + +D ++RLG+ YHFE+EI+D L +I+ +    N   DL TV+L+FRL+RQ G+ +S  +
Sbjct  73   QLVDAVQRLGVGYHFEQEIEDALENIFHNSFDNNDDVDLHTVSLRFRLLRQQGFKVSCDV  132

Query  429  FSNFVDGNESSETALM  476
            F  F D     + +L+
Sbjct  133  FEKFKDDEGKFKASLV  148



>gb|KHG01612.1| delta-cadinene synthase isozyme XC14 [Gossypium arboreum]
Length=249

 Score = 92.4 bits (228),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 78/127 (61%), Gaps = 9/127 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            RP  +FPP++W  + FH     N  AE   K  + LKE+ R  ++ P  + +    QKL 
Sbjct  2    RPKADFPPSIWGDF-FHNCPDKNIDAET-EKRHQQLKEEVRKMIVAPMANST----QKLA  55

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIHPVHL-NDLETVALQFRLMRQHGYNISTHIFSN  437
            FID ++RLG++ HF KEI+D+L +IY       NDL T +L+FRL+R+HG+N+S  +F+ 
Sbjct  56   FIDSVQRLGVSCHFTKEIEDELENIYHSDNDAENDLYTTSLRFRLLREHGFNVSCEVFNK  115

Query  438  FVD--GN  452
            F D  GN
Sbjct  116  FKDEQGN  122


 Score = 91.7 bits (226),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 72/112 (64%), Gaps = 5/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            +SDV+GLL LYEASY+R   +D +L+   +F    L  A  +L  +  L + V+HAL Q 
Sbjct  128  TSDVRGLLELYEASYLRVHGED-ILDETISFTTNHLSLAVASL--DYPLSEQVSHALKQS  184

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
               GLPRVE R ++SVYQ  D  S +  LL FA + FN+LQ+LH++ELSE+ 
Sbjct  185  IRRGLPRVEARHYLSVYQ--DIESHHKALLEFAKIGFNMLQLLHRKELSEIC  234



>gb|ADR66821.1| germacrene A synthase [Vitis vinifera]
Length=555

 Score = 94.7 bits (234),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 76/136 (56%), Gaps = 8/136 (6%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            RP+  F P++W          D        K++E LK + R  L+   G    + AQ L 
Sbjct  19   RPMAEFHPSIWGDQFIAYTPEDEDTRACKEKQVEDLKAEVRRELMAAAG----NPAQLLN  74

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIY--IHPVH--LNDLETVALQFRLMRQHGYNISTHI  428
            FID ++RLG+AYHFE+EI++ L+HIY   H      +DL  +ALQFRL+RQ GYNIS  I
Sbjct  75   FIDAVQRLGVAYHFEREIEESLQHIYDRFHDADDTEDDLYNIALQFRLLRQQGYNISCGI  134

Query  429  FSNFVDGNESSETALM  476
            F+ F D   S +  L+
Sbjct  135  FNKFKDEKGSFKEDLI  150


 Score = 89.7 bits (221),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 72/111 (65%), Gaps = 5/111 (5%)
 Frame = +2

Query  470  SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQPF  649
            S+V+G+L LYEA+++R   +D  LE   AF  T L++   +L     L + V HAL  P 
Sbjct  151  SNVQGMLGLYEAAHLRVHGED-TLEEALAFTTTHLKATVESL--GYPLAEQVAHALKHPI  207

Query  650  HTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
              GL R+E R++IS+YQ  DE+S +  LL+ A LDFNL+Q LHK+ELS ++
Sbjct  208  RKGLERLEARWYISLYQ--DEASHDKTLLKLAKLDFNLVQSLHKEELSNLA  256



>emb|CAN69834.1| hypothetical protein VITISV_025998 [Vitis vinifera]
Length=465

 Score =   105 bits (263),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 91/146 (62%), Gaps = 10/146 (7%)
 Frame = +3

Query  51   MAINFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKE-IEILKEQTRATLLIPTG  227
            M+ +    + RPV +F P++W    F  +++D+++  AY ++ +E LKE+ R  L++  G
Sbjct  1    MSSHLSAEVKRPVVSFRPSIWGNR-FINYTLDDEITRAYNQQRVEDLKEEVRRELMVAAG  59

Query  228  SCSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVH----LNDLETVALQFRLM  395
              S    Q+L FID ++RLG+AYHFE+EI++ + HIY +  H     +DL  V+L+FRL+
Sbjct  60   KPS----QQLNFIDAVQRLGMAYHFEEEIEEAIGHIYDNYHHSDDKYDDLCNVSLRFRLL  115

Query  396  RQHGYNISTHIFSNFVDGNESSETAL  473
            RQ GYNIS  IF  F D N S +  L
Sbjct  116  RQQGYNISCDIFERFKDENGSFKECL  141


 Score = 78.2 bits (191),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 70/112 (63%), Gaps = 5/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            ++DV+G+L LYEA+++R + +D +L+   AF    L S   +L  +  L    T AL +P
Sbjct  142  NNDVEGMLGLYEAAHLRVQEED-ILDEALAFTTAHLESLVEDL--DYPLAAQATQALYRP  198

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
               GL R+E R  IS+YQ  DE+S +  LL  A LDFNLLQ L+K+ELS ++
Sbjct  199  IRKGLERLEARPHISIYQ--DEASHSKALLELAKLDFNLLQSLYKKELSYIT  248



>ref|XP_011009443.1| PREDICTED: probable terpene synthase 6 isoform X1 [Populus euphratica]
Length=558

 Score = 96.3 bits (238),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 83/142 (58%), Gaps = 10/142 (7%)
 Frame = +3

Query  42   GHIMAINFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIP  221
             H+ AI  + +  R   NFPP+LW    F +FS      E+Y +++E+LKE  +  L+  
Sbjct  5    AHLTAITNQQNNYRRRANFPPSLWG-CSFASFSFPQTEFESYNRKVEVLKENVKDMLMAS  63

Query  222  TGSCSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIY-----IHPVHLNDLETVALQF  386
            T     D A+ ++FI+LL RLG++YHF+ EI++ L+ I+     +   H  DL TV+L F
Sbjct  64   T----KDPAEHIEFINLLCRLGVSYHFDDEIENSLKQIFDDLPDLLEKHDFDLYTVSLLF  119

Query  387  RLMRQHGYNISTHIFSNFVDGN  452
            R++RQHG+ I   +F  F D N
Sbjct  120  RVLRQHGFKIPCVVFDKFKDTN  141


 Score = 87.8 bits (216),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 78/125 (62%), Gaps = 14/125 (11%)
 Frame = +2

Query  455  KFRDSS---------DVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNS  607
            KF+D++         DVK +L LYEAS++    + +VL+    +    L S+A    P  
Sbjct  136  KFKDTNGEFKKTIINDVKSILGLYEASFLGVHGE-QVLDEALVYTKANLESSAMQSSPR-  193

Query  608  TLEKLVTHALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQE  787
             L   + +AL +PFH G+PR+E R +IS Y+EE+  SRN+ LL+FA +DFN +Q+LH+QE
Sbjct  194  -LADHIRNALIRPFHKGVPRIEARKYISFYEEEE--SRNDTLLKFAKIDFNRVQLLHQQE  250

Query  788  LSEVS  802
            LS +S
Sbjct  251  LSILS  255



>emb|CBI31262.3| unnamed protein product [Vitis vinifera]
Length=604

 Score = 94.7 bits (234),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 73/130 (56%), Gaps = 8/130 (6%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            RP+  F P++W          D        K++E LK + R  L+   G    + AQ L 
Sbjct  69   RPMAEFHPSIWGDQFIAYTPEDEDTRACKEKQVEDLKAEVRRELMAAAG----NPAQLLN  124

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIY--IHPVH--LNDLETVALQFRLMRQHGYNISTHI  428
            FID ++RLG+AYHFE+EI++ L+HIY   H      +DL  +ALQFRL+RQ GYNIS  I
Sbjct  125  FIDAVQRLGVAYHFEREIEESLQHIYDRFHDADDTEDDLYNIALQFRLLRQQGYNISCGI  184

Query  429  FSNFVDGNES  458
            F+ F D   S
Sbjct  185  FNKFKDEKGS  194


 Score = 89.4 bits (220),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 72/111 (65%), Gaps = 5/111 (5%)
 Frame = +2

Query  470  SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQPF  649
            S+V+G+L LYEA+++R   +D  LE   AF  T L++   +L     L + V HAL  P 
Sbjct  201  SNVQGMLGLYEAAHLRVHGED-TLEEALAFTTTHLKATVESL--GYPLAEQVAHALKHPI  257

Query  650  HTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
              GL R+E R++IS+YQ  DE+S +  LL+ A LDFNL+Q LHK+ELS ++
Sbjct  258  RKGLERLEARWYISLYQ--DEASHDKTLLKLAKLDFNLVQSLHKEELSNLA  306



>ref|XP_006475262.1| PREDICTED: (-)-germacrene D synthase-like [Citrus sinensis]
Length=573

 Score = 99.0 bits (245),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 82/125 (66%), Gaps = 13/125 (10%)
 Frame = +2

Query  455  KFRD---------SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNS  607
            KF+D         ++D +GLL LYEASY+R + ++ +LE    F+   L+S  P++  ++
Sbjct  145  KFKDEKGEFKAMLTNDARGLLCLYEASYLRVQGEN-ILEEACEFSRKHLKSLLPHI--ST  201

Query  608  TLEKLVTHALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQE  787
            +L   V H+L+ P H G+PR+E R +IS+Y E D S+RN  +L  A LDFNLLQ LH++E
Sbjct  202  SLANQVEHSLEIPLHRGMPRLEARQYISIY-EADNSTRNELILELAKLDFNLLQELHRRE  260

Query  788  LSEVS  802
            LSE+S
Sbjct  261  LSEIS  265


 Score = 85.1 bits (209),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 68/131 (52%), Gaps = 10/131 (8%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            R   N+ P++W  +  +  S D        K  E LK +    LL+   +    + + + 
Sbjct  19   RRSSNYHPSIWGDHFINVSSNDKYPNAEVEKRFETLKAEVE-KLLMSNNTAWKTIEEIVT  77

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIHPV---------HLNDLETVALQFRLMRQHGYN  413
             +D L+RLG+AYHFE EI + L+ IY   V         H NDL TVAL+FRL+RQHGY 
Sbjct  78   LVDQLQRLGVAYHFENEIKEDLQSIYNSHVNSNCDVNYDHNNDLYTVALRFRLLRQHGYK  137

Query  414  ISTHIFSNFVD  446
            +S  IF  F D
Sbjct  138  VSADIFKKFKD  148



>gb|KDO74408.1| hypothetical protein CISIN_1g008427mg [Citrus sinensis]
Length=566

 Score = 99.0 bits (245),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 82/125 (66%), Gaps = 13/125 (10%)
 Frame = +2

Query  455  KFRD---------SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNS  607
            KF+D         ++D +GLL LYEASY+R + ++ +LE    F+   L+S  P++  ++
Sbjct  145  KFKDEKGEFKAMLTNDARGLLCLYEASYLRVQGEN-ILEEACEFSRKHLKSLLPHI--ST  201

Query  608  TLEKLVTHALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQE  787
            +L   V H+L+ P H G+PR+E R +IS+Y E D S+RN  +L  A LDFNLLQ LH++E
Sbjct  202  SLANQVEHSLEIPLHRGMPRLEARQYISIY-EADNSTRNELILELAKLDFNLLQELHRRE  260

Query  788  LSEVS  802
            LSE+S
Sbjct  261  LSEIS  265


 Score = 85.1 bits (209),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 68/131 (52%), Gaps = 10/131 (8%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            R   N+ P++W  +  +  S D        K  E LK +    LL+   +    + + + 
Sbjct  19   RRSSNYHPSIWGDHFINVSSNDKYPNAEVEKRFETLKAEVE-KLLMSNNTAWKTIEEIVT  77

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIHPV---------HLNDLETVALQFRLMRQHGYN  413
             +D L+RLG+AYHFE EI + L+ IY   V         H NDL TVAL+FRL+RQHGY 
Sbjct  78   LVDQLQRLGVAYHFENEIKEDLQSIYNSHVNSNCDVNYDHNNDLYTVALRFRLLRQHGYK  137

Query  414  ISTHIFSNFVD  446
            +S  IF  F D
Sbjct  138  VSADIFKKFKD  148



>dbj|BAM24405.1| sesquiterpene synthase [Toona sinensis]
Length=556

 Score =   100 bits (249),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 75/112 (67%), Gaps = 3/112 (3%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            ++DV G+LSLYEA++     +D +L+   AF  T L+S A +   N +L   V HAL QP
Sbjct  148  TTDVPGMLSLYEAAHPGVHGED-ILDEAIAFTTTHLKSLAIDHLRNPSLASQVIHALRQP  206

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
             H G+PR+E+R +IS+YQ  DE S N  L++   LDFNL+Q LHK+ELSE+S
Sbjct  207  LHRGVPRLENRRYISIYQ--DEVSHNKALVKLFKLDFNLVQSLHKKELSEIS  256


 Score = 83.2 bits (204),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 81/150 (54%), Gaps = 12/150 (8%)
 Frame = +3

Query  39   IGHIMAINFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLI  218
            +  I ++  +  + R   N+ P +W     +   +D      + + IE LK+  R  LL 
Sbjct  5    VSQIPSLKAKGVIMRRNANYHPNIWGDRFINYVPVDKMNHTCHLQAIEELKDAVRRELLT  64

Query  219  PTGSCSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLND-----LETVALQ  383
             TG        +L  ID ++RLG+ YHFE+E+++ L+H+Y H  H +D     L +++L+
Sbjct  65   ATG------LSQLNLIDAIQRLGVGYHFERELEEALQHVY-HKNHYHDDTEDNLYSISLR  117

Query  384  FRLMRQHGYNISTHIFSNFVDGNESSETAL  473
            FRL+RQHGY +S  I + F D  ++ + +L
Sbjct  118  FRLLRQHGYYVSCDILNKFKDEKDNFKESL  147



>ref|XP_008388200.1| PREDICTED: (-)-germacrene D synthase-like [Malus domestica]
Length=553

 Score = 94.7 bits (234),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 82/133 (62%), Gaps = 6/133 (5%)
 Frame = +3

Query  78   PRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKL  257
            P+P   F P++W  +     S+  +V     + ++ LKE+ R  L+    +  ++V+QKL
Sbjct  20   PKPSATFSPSIWGDHFLSYASL--EVDXELEQHVQELKEEVRXXLM----TSXENVSQKL  73

Query  258  KFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNISTHIFSN  437
              ID ++RLG++YHF  EI++ L+ I+    +L+DL TVAL+FRL+RQ GYN+S  +F+ 
Sbjct  74   NLIDDIQRLGVSYHFGNEIEEILQKIHKSSYNLDDLYTVALRFRLLRQQGYNVSCDLFNK  133

Query  438  FVDGNESSETALM  476
              DG+   + +L+
Sbjct  134  LKDGDGKFKESLV  146


 Score = 88.6 bits (218),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 75/118 (64%), Gaps = 6/118 (5%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S   DV GLLSLYEA++ R   + E+L+    F  T L      L P   L K VT
Sbjct  140  KFKESLVDDVVGLLSLYEATHHRIHGE-EILDEALTFTTTXLEXXXXRLSP--PLAKXVT  196

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+Q    GLPRVE R+++SVY+E  ES  N  LL FA LDFN LQ +H++ELSE++
Sbjct  197  HALNQXLRKGLPRVEARYYLSVYEELRESP-NETLLTFAKLDFNRLQRVHQKELSEIT  253



>ref|XP_008388210.1| PREDICTED: (-)-germacrene D synthase-like [Malus domestica]
Length=393

 Score =   104 bits (259),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 79/118 (67%), Gaps = 6/118 (5%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S   DV GLLSLYEA+++R   + E+L+    F  T L SA   L P   L K VT
Sbjct  106  KFKESLVDDVVGLLSLYEATHLRIHGE-EILDEALTFTTTNLESATFRLSP--PLAKAVT  162

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+QP   GLPRVE R+++SVYQE  ES  N  LL FA LDFN LQ +H++ELSE++
Sbjct  163  HALNQPLRKGLPRVEARYYLSVYQELRESP-NETLLTFAKLDFNRLQRVHQKELSEIT  219


 Score = 79.0 bits (193),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 62/97 (64%), Gaps = 4/97 (4%)
 Frame = +3

Query  186  LKEQTRATLLIPTGSCSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDL  365
            LKE+ R  L     +  ++V+QKL  ID  +RLG++YHF  EI++ L+ I+      +DL
Sbjct  20   LKEEVRRMLT----TSLENVSQKLNLIDDFQRLGVSYHFGNEIEEVLQKIHKSSYDWDDL  75

Query  366  ETVALQFRLMRQHGYNISTHIFSNFVDGNESSETALM  476
             T AL+FRL+RQ GYN+S  +F+ F DG+   + +L+
Sbjct  76   YTAALRFRLLRQQGYNVSCDLFNKFKDGDGKFKESLV  112



>ref|XP_002513340.1| Casbene synthase, chloroplast precursor [Ricinus communis]
 sp|P59287.1|CASS_RICCO RecName: Full=Casbene synthase, chloroplastic; Flags: Precursor 
[Ricinus communis]
 gb|EEF48743.1| Casbene synthase, chloroplast precursor [Ricinus communis]
Length=601

 Score =   101 bits (251),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 81/118 (69%), Gaps = 6/118 (5%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S   D KG+LSL+EAS++    +D +LE   AF    L+S+A  L PN  L++ +T
Sbjct  189  KFKESLRGDAKGMLSLFEASHLSVHGED-ILEEAFAFTKDYLQSSAVELFPN--LKRHIT  245

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            +AL+QPFH+G+PR+E R FI +Y E D   RN  LL FA LD+N +Q+LH+QEL + S
Sbjct  246  NALEQPFHSGVPRLEARKFIDLY-EADIECRNETLLEFAKLDYNRVQLLHQQELCQFS  302


 Score = 81.6 bits (200),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 74/129 (57%), Gaps = 10/129 (8%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            RP+  FPPT+W    F + + +    E+Y + + +LK++ +  L+    S + D  + + 
Sbjct  64   RPLAYFPPTVWGNR-FASLTFNPSEFESYDERVIVLKKKVKDILI----SSTSDSVETVI  118

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIHPVHL-----NDLETVALQFRLMRQHGYNISTH  425
             IDLL RLG++YHFE +I++ L  I+     L      DL T A+ FR+ RQHG+ +S+ 
Sbjct  119  LIDLLCRLGVSYHFENDIEELLSKIFNSQPDLVDEKECDLYTAAIVFRVFRQHGFKMSSD  178

Query  426  IFSNFVDGN  452
            +FS F D +
Sbjct  179  VFSKFKDSD  187



>gb|AIC76495.1| terpene synthase [Prunus cerasoides var. campanulata]
Length=514

 Score =   109 bits (272),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 81/118 (69%), Gaps = 7/118 (6%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  +DV GLLSLYEA+++R   +D +L+    F  T L SA   L P   L K VT
Sbjct  102  KFKESLVNDVVGLLSLYEATHLRIHGED-ILDEALTFTTTHLESATHRLSP--ILLKQVT  158

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HA+ QPF  GLPR+E R ++S+YQE D  SRN  LL FA LDFNLLQ +H++ELSE+S
Sbjct  159  HAMYQPFWKGLPRLETRHYLSLYQERD--SRNETLLNFAKLDFNLLQQVHQRELSEIS  214


 Score = 73.6 bits (179),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 65/107 (61%), Gaps = 15/107 (14%)
 Frame = +3

Query  186  LKEQTRATLLIPTGSCSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLN--  359
            LKE+ +  ++ P    S    QKL  ID ++RLG+++HFE EI++ L+ I+ +  H N  
Sbjct  7    LKEKVKMIIMAPVKKPS----QKLDLIDDIQRLGVSHHFENEIEELLQQIH-NSSHDNTE  61

Query  360  --------DLETVALQFRLMRQHGYNISTHIFSNFVDGNESSETALM  476
                    +L T AL+FRL+RQ GYNIS  IF+NF DG+   + +L+
Sbjct  62   SGDQETDNELYTAALRFRLLRQQGYNISCDIFNNFKDGDGKFKESLV  108



>gb|ADR74194.1| (E)-beta-caryophyllene synthase [Vitis vinifera]
Length=555

 Score = 93.2 bits (230),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 83/137 (61%), Gaps = 10/137 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYA-KEIEILKEQTRATLLIPTGSCSDDVAQKL  257
            RP   F P +W    F  ++ +++V+ A   K++E LK++ R  L+   G+ S    Q L
Sbjct  19   RPRAKFHPNIWGD-LFITYTPEDEVSRACKEKQVEDLKDEVRRELMAAAGNPS----QLL  73

Query  258  KFIDLLERLGIAYHFEKEIDDQLRHIY--IHPVH--LNDLETVALQFRLMRQHGYNISTH  425
             FID ++RLG+AYHFE+EI++ L+HIY   H      +DL  +AL+FRL+RQ GYNIS  
Sbjct  74   NFIDAVQRLGVAYHFEREIEESLQHIYDRFHDADDTNDDLYNIALRFRLLRQQGYNISCG  133

Query  426  IFSNFVDGNESSETALM  476
            IF+ F D   S +  L+
Sbjct  134  IFNKFKDEEGSFKEDLI  150


 Score = 89.4 bits (220),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 73/111 (66%), Gaps = 5/111 (5%)
 Frame = +2

Query  470  SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQPF  649
            S+++G+L LYEA+++R   +D +LE   AF  T L++   +L     L + V HAL +P 
Sbjct  151  SNIQGMLGLYEAAHLRVHGED-ILEEALAFTTTHLKAKVESL--GCPLAEQVAHALKRPI  207

Query  650  HTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
              GL R+E R++IS+YQ  DE+  +  LL+ A LDFNL+Q LHK+ELS ++
Sbjct  208  RKGLERLEARWYISIYQ--DEAFHDKTLLKLAKLDFNLVQSLHKEELSNLA  256



>gb|AEM23825.1| sesquiterpene synthase [Solanum habrochaites]
Length=544

 Score = 97.8 bits (242),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 88/128 (69%), Gaps = 6/128 (5%)
 Frame = +2

Query  428  FQQLC*RK*KFRD--SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKP  601
            F+Q   +  KF++  ++DV+GLLSLYEASY+R R D+E+LE   AF  T L+S   N+  
Sbjct  119  FKQFTNQDGKFKERLTNDVQGLLSLYEASYLRVR-DEEILEEALAFTTTHLKSIVSNMSN  177

Query  602  NSTLEKL-VTHALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLH  778
            N+   K+ V+ AL QP    LPR+E R +IS+Y+  D  + N+ LL+FA LDFN+LQ LH
Sbjct  178  NNNSLKVEVSEALTQPIRMTLPRMEARRYISIYENND--AHNHLLLKFAKLDFNMLQKLH  235

Query  779  KQELSEVS  802
            ++ELS+++
Sbjct  236  QRELSDLT  243


 Score = 85.1 bits (209),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 71/123 (58%), Gaps = 9/123 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLL-IPTGSCSDDVAQKL  257
            RP+ NF PT+W    +H  S  +++      E++  KE  R  L+  P GS      QKL
Sbjct  10   RPLANFHPTVWG---YHFLSYTHEITNQEKVEVDEYKETIRKMLVEAPEGS-----EQKL  61

Query  258  KFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNISTHIFSN  437
              ID ++RLG+AYHF  EI+  +++I+  P   N+L  V+L FRL+RQ G+ +S+ +F  
Sbjct  62   VLIDAMQRLGVAYHFHNEIETSIQNIFDAPKQNNNLHIVSLHFRLVRQQGHYMSSDVFKQ  121

Query  438  FVD  446
            F +
Sbjct  122  FTN  124



>ref|XP_006476905.1| PREDICTED: (-)-germacrene D synthase-like [Citrus sinensis]
Length=554

 Score =   100 bits (249),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 76/112 (68%), Gaps = 5/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            +SD  G+LSLYEA+++    +D +L+   AF  T L+S A +L  ++ L+  V HAL QP
Sbjct  148  ASDALGMLSLYEAAHLGVHGED-ILDEAIAFTTTHLKSVATHL--SNPLKAQVRHALRQP  204

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
             H GLPR+EHR +IS+YQ  D++S    LL  A LDFNL+Q LHK+EL E+S
Sbjct  205  LHRGLPRLEHRRYISIYQ--DDASHYKALLTLAKLDFNLVQSLHKKELCEIS  254


 Score = 82.0 bits (201),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 49/146 (34%), Positives = 82/146 (56%), Gaps = 14/146 (10%)
 Frame = +3

Query  36   RIGHIMAINFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAY-AKEIEILKEQTRATL  212
            ++  I + N ++ + R   NF P++W    F  ++ ++++  A   KE++ LKE+    L
Sbjct  4    QVPQISSQNAKSQVMRRTANFHPSVWGDR-FANYTAEDKMNHARDLKELKALKEEVGRKL  62

Query  213  LIPTGSCSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLE----TVAL  380
            L   G        +L  ID ++RLG+ YHFE+E++  L+H+Y      +D E     ++L
Sbjct  63   LATAGPI------QLNLIDAIQRLGVGYHFERELEQALQHLYNEKYSDDDTEDDLYRISL  116

Query  381  QFRLMRQHGYNISTHIFSNFVD--GN  452
            +FRL+RQHGYN+S   F+ F D  GN
Sbjct  117  RFRLLRQHGYNVSCDKFNMFKDDKGN  142



>gb|KDO69460.1| hypothetical protein CISIN_1g044370mg [Citrus sinensis]
Length=554

 Score =   100 bits (249),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 76/112 (68%), Gaps = 5/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            +SD  G+LSLYEA+++    +D +L+   AF  T L+S A +L  ++ L+  V HAL QP
Sbjct  148  ASDALGMLSLYEAAHLGVHGED-ILDEAIAFTTTHLKSVATHL--SNPLKAQVRHALRQP  204

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
             H GLPR+EHR +IS+YQ  D++S    LL  A LDFNL+Q LHK+EL E+S
Sbjct  205  LHRGLPRLEHRRYISIYQ--DDASHYKALLTLAKLDFNLVQSLHKKELCEIS  254


 Score = 82.0 bits (201),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 49/146 (34%), Positives = 82/146 (56%), Gaps = 14/146 (10%)
 Frame = +3

Query  36   RIGHIMAINFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAY-AKEIEILKEQTRATL  212
            ++  I + N ++ + R   NF P++W    F  ++ ++++  A   KE++ LKE+    L
Sbjct  4    QVPQISSQNAKSQVMRRTANFHPSVWGDR-FANYTAEDKMNHARDLKELKALKEEVGRKL  62

Query  213  LIPTGSCSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLE----TVAL  380
            L   G        +L  ID ++RLG+ YHFE+E++  L+H+Y      +D E     ++L
Sbjct  63   LATAGPI------QLNLIDAIQRLGVGYHFERELEQALQHLYNEKYSDDDTEDDLYRISL  116

Query  381  QFRLMRQHGYNISTHIFSNFVD--GN  452
            +FRL+RQHGYN+S   F+ F D  GN
Sbjct  117  RFRLLRQHGYNVSCDKFNMFKDDKGN  142



>ref|XP_008371257.1| PREDICTED: (-)-germacrene D synthase-like isoform X1 [Malus domestica]
Length=562

 Score =   103 bits (258),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 80/118 (68%), Gaps = 7/118 (6%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  +DV GLLSLYEA+ +R   +D +LE    F  T L+S    L  +S L KLVT
Sbjct  150  KFKESLVNDVIGLLSLYEATQLRVHGED-ILEXALTFTTTHLKSVENRL--SSPLSKLVT  206

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL QPF  G PR+E R ++S+YQE+D  S N  LL  A LDFNLLQ +H++ELSE+S
Sbjct  207  HALYQPFWKGNPRLEARRYLSIYQEDD--SHNETLLTXAKLDFNLLQQVHQKELSEIS  262


 Score = 78.6 bits (192),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 69/132 (52%), Gaps = 14/132 (11%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            R   NFPP  W  Y     S+  +  EA  K ++ LKE  +  +L PT     D   KL 
Sbjct  19   RRSANFPPNFWGDYFLSYASVVEKNIEA-EKLVQELKENVKRMILAPTPCKHSD---KLD  74

Query  261  FIDLLERLGIAYHFEKEIDDQLRHI--------YIHPVHLND--LETVALQFRLMRQHGY  410
             +D ++RLG++YHFE EID+ L+ I        + H    +D  L   AL FRL+RQ GY
Sbjct  75   LVDTIQRLGVSYHFEDEIDEVLQQIRKDSYDGSHQHQGRDDDHNLHADALYFRLLRQQGY  134

Query  411  NISTHIFSNFVD  446
            +IS  +F+ F D
Sbjct  135  DISCEMFNKFKD  146



>gb|KHG01539.1| delta-cadinene synthase isozyme XC1 [Gossypium arboreum]
Length=583

 Score = 95.1 bits (235),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 72/112 (64%), Gaps = 5/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            +SDV+GLL LYEASY+R   +D +L+   +F    L     +L  +  L + V+HAL Q 
Sbjct  149  TSDVRGLLELYEASYMRVHGED-ILDEAISFTTNHLSLVVASL--DYPLSEQVSHALKQS  205

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
               GLPRVE R ++SVYQ  D  S N  LL FA +DFN+LQ+LH++E+SE+ 
Sbjct  206  IRRGLPRVEARHYLSVYQ--DIESHNKSLLEFAKIDFNMLQLLHRKEISEIC  255


 Score = 87.4 bits (215),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 77/128 (60%), Gaps = 10/128 (8%)
 Frame = +3

Query  81   RPVDNFPP-TLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKL  257
            RP  N PP ++W    F      N  AE   K  + LKE+ R  ++ P  + +    QKL
Sbjct  22   RPKSNIPPPSIWGD-VFLNCPYKNIDAET-EKHHQQLKEEVRKMIVAPMANST----QKL  75

Query  258  KFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHL-NDLETVALQFRLMRQHGYNISTHIFS  434
             FID ++RLG++YHF KEI+D+L +IY +     NDL T +L+FRL+R+HG+N+S  +F+
Sbjct  76   PFIDSVQRLGVSYHFTKEIEDELENIYHNDNDAENDLYTTSLRFRLLREHGFNVSCEVFN  135

Query  435  NFVD--GN  452
             F D  GN
Sbjct  136  KFKDEQGN  143



>ref|XP_009591578.1| PREDICTED: (-)-germacrene D synthase-like [Nicotiana tomentosiformis]
Length=552

 Score = 93.2 bits (230),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 87/144 (60%), Gaps = 20/144 (14%)
 Frame = +3

Query  51   MAINFENHLP--RPVDNFPPTLWARYCFHAFSIDNQVAEAY---AKEIEILKEQTRATLL  215
            M +N   H P  R VD + P++W  Y F A+  D+ + E Y    +E+E+LKE+ R  +L
Sbjct  1    MEVNNIVHKPTRRSVD-YHPSVWGDY-FLAY--DSSLTEIYPDEEQEVEVLKEEVR-KML  55

Query  216  IPTGSCSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLND-------LETV  374
            +   + S    QKL+ ID+++RLG++YHFE EI++ L+HIY      +D       LETV
Sbjct  56   VSDHAVS---TQKLELIDMIQRLGVSYHFENEIEESLKHIYNSCSEFDDNDEDHNMLETV  112

Query  375  ALQFRLMRQHGYNISTHIFSNFVD  446
            AL+FRL+RQ GYN+   +   F+D
Sbjct  113  ALRFRLLRQAGYNVPCDVLEEFMD  136


 Score = 89.4 bits (220),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 73/118 (62%), Gaps = 7/118 (6%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++   SDVKG+LSLYEA++V    ++ +LE   AF  TRL+S  PNL  +  L   V 
Sbjct  140  KFKEVLVSDVKGILSLYEAAHVGVEGEN-ILEEALAFTTTRLKSVVPNL--SGLLLAQVA  196

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL  P    L RV  R +I++Y+  D    N  LLRFA LDFN+LQ +H++EL  ++
Sbjct  197  HALKMPIQRTLERVAARQYINIYK--DSPKHNELLLRFARLDFNMLQKVHQKELCGIT  252



>ref|XP_008371258.1| PREDICTED: (-)-germacrene D synthase-like isoform X2 [Malus domestica]
Length=561

 Score =   103 bits (258),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 80/118 (68%), Gaps = 7/118 (6%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  +DV GLLSLYEA+ +R   +D +LE    F  T L+S    L  +S L KLVT
Sbjct  149  KFKESLVNDVIGLLSLYEATQLRVHGED-ILEXALTFTTTHLKSVENRL--SSPLSKLVT  205

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL QPF  G PR+E R ++S+YQE+D  S N  LL  A LDFNLLQ +H++ELSE+S
Sbjct  206  HALYQPFWKGNPRLEARRYLSIYQEDD--SHNETLLTXAKLDFNLLQQVHQKELSEIS  261


 Score = 78.2 bits (191),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 69/133 (52%), Gaps = 17/133 (13%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQV-AEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKL  257
            R   NFPP  W  Y     S++  + AE   +E   LKE  +  +L PT     D   KL
Sbjct  19   RRSANFPPNFWGDYFLSYASVEKNIEAEKLVQE---LKENVKRMILAPTPCKHSD---KL  72

Query  258  KFIDLLERLGIAYHFEKEIDDQLRHI--------YIHPVHLND--LETVALQFRLMRQHG  407
              +D ++RLG++YHFE EID+ L+ I        + H    +D  L   AL FRL+RQ G
Sbjct  73   DLVDTIQRLGVSYHFEDEIDEVLQQIRKDSYDGSHQHQGRDDDHNLHADALYFRLLRQQG  132

Query  408  YNISTHIFSNFVD  446
            Y+IS  +F+ F D
Sbjct  133  YDISCEMFNKFKD  145



>ref|XP_006367945.1| PREDICTED: germacrene C synthase-like [Solanum tuberosum]
Length=418

 Score =   100 bits (250),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 75/110 (68%), Gaps = 4/110 (4%)
 Frame = +2

Query  473  DVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQPFH  652
            DV+GLLSLYEAS++R   D+E+LE    F  TRL S  PNL  NS L+  VT AL QP H
Sbjct  191  DVQGLLSLYEASHMRMH-DEEILEEALIFTTTRLESLLPNLTNNS-LKIQVTEALSQPIH  248

Query  653  TGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
              +PRV  R +I +Y  E+  S N+ LL+FA LDFN+LQ +H+ EL+E+S
Sbjct  249  ETVPRVGARKYIHIY--ENIKSHNDLLLKFAKLDFNMLQKVHQDELNEIS  296


 Score = 81.3 bits (199),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 76/136 (56%), Gaps = 8/136 (6%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            R + +F PTLW  +         +++     E++ LKE  R TL+       D+  QKL 
Sbjct  57   RHLADFEPTLWGDHFLSYTPQQTEISTQEKVEVDELKEMIRKTLV----ETPDNSTQKLV  112

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIHPVHL----NDLETVALQFRLMRQHGYNISTHI  428
             ID ++RLG+AYHF  EI+  +++I+   +      ++L  VAL+FRL+RQ G+ IS+ +
Sbjct  113  LIDTIQRLGVAYHFHNEIEISIKNIFDSQLQSENNDDNLHVVALRFRLLRQQGHYISSDV  172

Query  429  FSNFVDGNESSETALM  476
            F  F+D N + +  L+
Sbjct  173  FKQFMDHNGNFKETLI  188



>gb|ACJ46048.1| sesquiterpene synthase [Warburgia ugandensis]
Length=459

 Score = 99.0 bits (245),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 77/111 (69%), Gaps = 5/111 (5%)
 Frame = +2

Query  470  SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQPF  649
            +DV+GLLSLYEA+Y+ TR +D VLE    F    L S+  +L P   L + V+HAL+ P 
Sbjct  155  TDVRGLLSLYEAAYLGTRGED-VLEEAITFTRQHLSSSVDHLDP--LLARKVSHALELPL  211

Query  650  HTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            H  + R+EH+++IS+YQEE++  RN  LL  A LDFNL+Q LH++EL E++
Sbjct  212  HKRVQRLEHKYYISIYQEEEK--RNETLLELAKLDFNLVQSLHQRELEELT  260


 Score = 82.8 bits (203),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 75/133 (56%), Gaps = 8/133 (6%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            R   ++ P++W  + F  F  +      +A  ++ LKE+    L     S + D  ++L 
Sbjct  27   RTPADYHPSVWGDH-FLTFPHEQTKLNTWAGRVQELKEEVMRML-----SNAGDSKEELD  80

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIH--PVHLNDLETVALQFRLMRQHGYNISTHIFS  434
             I++LE LG+AY FE+EI+  L  IY        NDL T AL+FRL+RQHGYNIS+ +F+
Sbjct  81   LINVLECLGVAYLFEQEIEKALHQIYGSHSTADANDLHTTALRFRLLRQHGYNISSDVFA  140

Query  435  NFVDGNESSETAL  473
             F D N + + AL
Sbjct  141  QFKDDNGNFKEAL  153



>emb|CAN69555.1| hypothetical protein VITISV_013102 [Vitis vinifera]
Length=533

 Score = 94.7 bits (234),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 83/137 (61%), Gaps = 10/137 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYA-KEIEILKEQTRATLLIPTGSCSDDVAQKL  257
            RP   F P +W    F  ++ +++V+ A   K++E LKE+ R  L+   G+ S    Q L
Sbjct  19   RPRAKFHPNIWGD-LFITYTPEDEVSRACKEKQVEDLKEEVRRELMAAAGNPS----QLL  73

Query  258  KFIDLLERLGIAYHFEKEIDDQLRHIY--IHPVH--LNDLETVALQFRLMRQHGYNISTH  425
             FID ++RLG+AYHFE+EI++ L+HIY   H      +DL  +AL+FRL+RQ GYNIS  
Sbjct  74   NFIDAVQRLGVAYHFEREIEESLQHIYDRFHDADDTNDDLYNIALRFRLLRQQGYNISCG  133

Query  426  IFSNFVDGNESSETALM  476
            IF+ F D   S +  L+
Sbjct  134  IFNKFKDEKGSFKEDLI  150


 Score = 87.0 bits (214),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 74/111 (67%), Gaps = 5/111 (5%)
 Frame = +2

Query  470  SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQPF  649
            S+++G+L LYEA+++R   ++ +LE   AF+ T L++   +L     L + V HAL +P 
Sbjct  151  SNIQGMLGLYEAAHLRIHGEN-ILEEALAFSTTHLKAMVESL--GYPLAEQVAHALKRPI  207

Query  650  HTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
              GL R+E R++IS+YQ  DE+  +  LL+ A LDFNL+Q LHK+ELS ++
Sbjct  208  RKGLERLEARWYISIYQ--DEAFHDKTLLKLAKLDFNLVQSLHKEELSNLA  256



>gb|AAD02223.1| vetispiradiene synthase [Solanum tuberosum]
Length=550

 Score =   146 bits (369),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 94/133 (71%), Gaps = 5/133 (4%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSD  239
            N E  + RPV NF P+LW    FH+FS+DNQVAE YA+EIE LKEQTR+  L+   +C  
Sbjct  8    NNEEEIVRPVANFSPSLWGDR-FHSFSLDNQVAEKYAQEIETLKEQTRS--LLSAAACGI  64

Query  240  DVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLN--DLETVALQFRLMRQHGYN  413
             +A+KL  ID++ERLG+AYHFEK+IDD L  IY    + +  DL T++LQFR++RQHGYN
Sbjct  65   TLAEKLNLIDIVERLGLAYHFEKQIDDMLDQIYKADPNFDGHDLNTLSLQFRILRQHGYN  124

Query  414  ISTHIFSNFVDGN  452
            IS   FS F D N
Sbjct  125  ISQKFFSRFQDAN  137


 Score =   124 bits (311),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 94/133 (71%), Gaps = 11/133 (8%)
 Frame = +2

Query  410  QHFYSYFQQLC*RK*KFRD--SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSA  583
            Q F+S FQ        F++  S+D++GLL+LYEAS+VRT  +D +LE    F+   L SA
Sbjct  127  QKFFSRFQDAN----GFKECLSNDIRGLLNLYEASHVRTHGED-ILEEALVFSTAHLESA  181

Query  584  APNLKPNSTLEKLVTHALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNL  763
            AP+L+  S L K VTHAL+Q  H  +PRVE R+FIS+Y+EE+   +N+ LLRFA LD+NL
Sbjct  182  APHLE--SPLSKQVTHALEQSLHKSIPRVETRYFISIYEEEE--FKNDVLLRFAKLDYNL  237

Query  764  LQMLHKQELSEVS  802
            LQMLHK ELSEVS
Sbjct  238  LQMLHKHELSEVS  250



>ref|NP_001275171.1| putative vetispiradiene synthase 5 [Solanum tuberosum]
 gb|AAD02270.1| putative vetispiradiene synthase 5 [Solanum tuberosum]
 dbj|BAA82109.1| vetispiradiene synthase [Solanum tuberosum]
Length=551

 Score =   146 bits (369),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 94/133 (71%), Gaps = 5/133 (4%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSD  239
            N E  + RPV NF P+LW    FH+FS+DNQVAE YA+EIE LKEQTR+  L+   +C  
Sbjct  8    NNEEEIVRPVANFSPSLWGDR-FHSFSLDNQVAEKYAQEIETLKEQTRS--LLSAAACGI  64

Query  240  DVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLN--DLETVALQFRLMRQHGYN  413
             +A+KL  ID++ERLG+AYHFEK+IDD L  IY    + +  DL T++LQFR++RQHGYN
Sbjct  65   TLAEKLNLIDIVERLGLAYHFEKQIDDMLDQIYKADPNFDAHDLNTLSLQFRILRQHGYN  124

Query  414  ISTHIFSNFVDGN  452
            IS   FS F D N
Sbjct  125  ISQKFFSRFQDAN  137


 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 95/133 (71%), Gaps = 10/133 (8%)
 Frame = +2

Query  410  QHFYSYFQQLC*RK*KFRD--SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSA  583
            Q F+S FQ       KF++  S+D++GLL+LYEAS+VRT  +D +LE    F+   L SA
Sbjct  127  QKFFSRFQD---ANGKFKECLSNDIRGLLNLYEASHVRTHGED-ILEEALVFSTAHLESA  182

Query  584  APNLKPNSTLEKLVTHALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNL  763
            AP+L+  S L K VTHAL+Q  H  +PRVE R+FIS+Y+EE+   +N+ LLRFA LD+NL
Sbjct  183  APHLE--SPLSKQVTHALEQSLHKSIPRVETRYFISIYEEEE--FKNDVLLRFAKLDYNL  238

Query  764  LQMLHKQELSEVS  802
            LQMLHK ELSEVS
Sbjct  239  LQMLHKHELSEVS  251



>ref|XP_006475309.1| PREDICTED: germacrene-D synthase-like [Citrus sinensis]
Length=487

 Score = 97.8 bits (242),  Expect(2) = 9e-37, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 76/135 (56%), Gaps = 7/135 (5%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVA---EAYAKEIEILKEQTRATLLIPTGSCSDDVAQ  251
            RP  ++ PTLW        S+D+ VA        E E LK++ +  L+ PT    D   Q
Sbjct  20   RPTASYHPTLWGEKFLDYSSVDDSVAMDPTIDQDEFEALKQKIKNMLISPT----DKSFQ  75

Query  252  KLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNISTHIF  431
            KL  ID ++RLG+AYHFE+EI+D+L  +       ND+ +VAL+FRL+RQ GY IS  IF
Sbjct  76   KLSLIDAVQRLGVAYHFEREIEDELEKLSPDEYDGNDVHSVALRFRLLRQQGYRISCDIF  135

Query  432  SNFVDGNESSETALM  476
              F D     + +L+
Sbjct  136  GGFKDDRGKFKVSLI  150


 Score = 84.0 bits (206),  Expect(2) = 9e-37, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 76/118 (64%), Gaps = 6/118 (5%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF+ S  +DV G+L+LYEA+++R R +D +L+   AF  + L S    + P  + E  + 
Sbjct  144  KFKVSLINDVTGMLNLYEAAHLRIRGED-ILDEALAFTTSHLESMVTQVSPQLSDE--IL  200

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL++P   GLPR+E  ++I +Y   D+S     LL+FA LDF +LQ++H++ELS ++
Sbjct  201  HALNRPIRRGLPRLEAVYYIDLYS-RDDSKDKAILLKFAKLDFCMLQVIHRKELSIIT  257



>ref|XP_009346480.1| PREDICTED: (-)-alpha-pinene synthase-like [Pyrus x bretschneideri]
Length=560

 Score = 97.4 bits (241),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 81/147 (55%), Gaps = 7/147 (5%)
 Frame = +3

Query  24   ISISRIGHIMAINFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTR  203
            +SI     +++ N +  + RP  NFPP++W     +  S D        +EI+ LKE  R
Sbjct  1    MSIPICAGVLSTNAKPEIVRPTANFPPSIWGDRFINYDSQDITTHARNKQEIDELKEVVR  60

Query  204  ATLLIPTGSCSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYI----HPVHLNDLET  371
            + +     S   D + +LK ID ++RLG+AYHF  EI++ L+ ++     H     DL  
Sbjct  61   SEVFKTMAS---DFSHQLKLIDAIQRLGVAYHFASEIEETLKRMHGTFNDHEDVGGDLHI  117

Query  372  VALQFRLMRQHGYNISTHIFSNFVDGN  452
            VAL FRL+RQHGYN+S  IF+ F D N
Sbjct  118  VALGFRLLRQHGYNVSCDIFNKFKDAN  144


 Score = 84.3 bits (207),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 75/118 (64%), Gaps = 6/118 (5%)
 Frame = +2

Query  455  KFRD--SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF+   ++D+ G+LSLYEA+++  R +D +L+    F  T L SA+     +  L +  T
Sbjct  146  KFKGCLTADIPGMLSLYEAAHLGVRGED-ILDEALVFTTTHLESASTT-NVSYQLTEQTT  203

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
             AL++P    L RV  R ++S+YQ  DE++ N  LL+ A LDFNL+Q LHK+ELSE++
Sbjct  204  QALERPLQKDLERVCARCYMSIYQ--DEAAHNEALLKLAKLDFNLVQSLHKKELSEIT  259



>ref|XP_010092286.1| (-)-germacrene D synthase [Morus notabilis]
 gb|EXB50920.1| (-)-germacrene D synthase [Morus notabilis]
Length=562

 Score =   100 bits (248),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 83/120 (69%), Gaps = 8/120 (7%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAP--NLKPNSTLEKL  622
            KF+++  SD++G+LSLYEA+Y+R   +D +L+    F  T L+SAA   +L P+  +E+ 
Sbjct  146  KFKETLASDIRGMLSLYEATYLRVHGED-ILDEALVFTTTCLKSAASSRHLSPSFLVEQ-  203

Query  623  VTHALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            VTHAL QP   GL R+E R ++SVYQ+  + S N  LL FA LDFNLLQ +H++ELS ++
Sbjct  204  VTHALKQPIRKGLTRLEARHYMSVYQQ--DPSHNKVLLNFAKLDFNLLQKVHQEELSHIA  261


 Score = 81.3 bits (199),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 72/133 (54%), Gaps = 17/133 (13%)
 Frame = +3

Query  69   NHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVA  248
            +H+ R   N+ P++W        S + ++     K    LKE+ +  +  P     +D +
Sbjct  16   DHVNRRSGNYHPSIWGDRFLSEKSAEGEITNKILK----LKEEVKKMVAAPV----EDPS  67

Query  249  QKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHL---------NDLETVALQFRLMRQ  401
            +KL  +D ++RLG++YHFEKEI+  L  IY + ++          +DL TVAL FRL+RQ
Sbjct  68   KKLNLVDAIQRLGVSYHFEKEIETVLHQIYDNTLYNCPQNAETYDDDLHTVALCFRLLRQ  127

Query  402  HGYNISTHIFSNF  440
             GY +S  IF NF
Sbjct  128  QGYPVSCDIFKNF  140



>emb|CBI31266.3| unnamed protein product [Vitis vinifera]
Length=734

 Score = 94.7 bits (234),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 83/137 (61%), Gaps = 10/137 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYA-KEIEILKEQTRATLLIPTGSCSDDVAQKL  257
            RP   F P +W    F  ++ +++V+ A   K++E LKE+ R  L+   G+ S    Q L
Sbjct  19   RPRAKFHPNIWGD-LFITYTPEDEVSRACKEKQVEDLKEEVRRELMAAAGNPS----QLL  73

Query  258  KFIDLLERLGIAYHFEKEIDDQLRHIY--IHPVH--LNDLETVALQFRLMRQHGYNISTH  425
             FID ++RLG+AYHFE+EI++ L+HIY   H      +DL  +AL+FRL+RQ GYNIS  
Sbjct  74   NFIDAVQRLGVAYHFEREIEESLQHIYDRFHDADDTNDDLYNIALRFRLLRQQGYNISCG  133

Query  426  IFSNFVDGNESSETALM  476
            IF+ F D   S +  L+
Sbjct  134  IFNKFKDEKGSFKEDLI  150


 Score = 86.7 bits (213),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 74/111 (67%), Gaps = 5/111 (5%)
 Frame = +2

Query  470  SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQPF  649
            S+++G+L LYEA+++R   ++ +LE   AF+ T L++   +L     L + V HAL +P 
Sbjct  151  SNIQGMLGLYEAAHLRIHGEN-ILEEALAFSTTHLKAMVESL--GYPLAEQVAHALKRPI  207

Query  650  HTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
              GL R+E R++IS+YQ  DE+  +  LL+ A LDFNL+Q LHK+ELS ++
Sbjct  208  RKGLERLEARWYISIYQ--DEAFHDKTLLKLAKLDFNLVQSLHKEELSNLA  256


 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 67/117 (57%), Gaps = 8/117 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            RP+  F P++W          D        K++E LKE+ R  L+   G+ S    Q L 
Sbjct  605  RPMAEFHPSIWGDQFIAYTPEDEDTRACKEKQVEDLKEEVRRELMAAAGNPS----QLLN  660

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIY----IHPVHLNDLETVALQFRLMRQHGYNIS  419
            FID ++RLG+AYHFE+EI++ L+HIY          +DL  +ALQFRL+RQ GYNIS
Sbjct  661  FIDAVQRLGVAYHFEREIEESLQHIYDRFHDADDTDDDLYNIALQFRLLRQQGYNIS  717



>ref|XP_010683547.1| PREDICTED: probable terpene synthase 6 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=479

 Score = 99.4 bits (246),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 79/137 (58%), Gaps = 10/137 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSI-DNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKL  257
            RP+ +FPP +W    F  FS  D+ + E YAKEIE LKE+ +  L+I     S D A+K+
Sbjct  12   RPLAHFPPDIWGDR-FVTFSTEDSLMMEKYAKEIEPLKEEVKTMLMIEN---SADFAKKM  67

Query  258  KFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLN-----DLETVALQFRLMRQHGYNIST  422
              ID +ERLG++Y+FE EI++QL HI+      N     DL   A QFR+ RQHGY I  
Sbjct  68   SLIDAVERLGVSYYFENEIEEQLSHIFKELAAKNFDMEYDLYNTASQFRIFRQHGYKIPC  127

Query  423  HIFSNFVDGNESSETAL  473
             +F  F + +   +  L
Sbjct  128  DVFIKFTNEDGKMKETL  144


 Score = 81.6 bits (200),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 72/111 (65%), Gaps = 10/111 (9%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            S++++ ++SLYEAS++R   +  +L+  +AFA   L+S+A          +   HAL Q 
Sbjct  145  STNIRAIVSLYEASHLRIHGE-PILDEASAFATDVLKSSA-------NFSEQARHALKQV  196

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEV  799
             H G+ RVE+R FIS Y E+DE  RN  LLR A +DFN +Q+LH+QELS++
Sbjct  197  LHFGIQRVENRHFISFY-EQDEF-RNETLLRLAKIDFNRVQLLHRQELSQI  245



>ref|XP_009349849.1| PREDICTED: (-)-germacrene D synthase-like [Pyrus x bretschneideri]
Length=561

 Score =   101 bits (251),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 79/118 (67%), Gaps = 7/118 (6%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF+DS  ++V GLLSLYEA+ +    +D +L+    F  T L+S    L  +S L KLVT
Sbjct  149  KFKDSLVNNVIGLLSLYEATQLSVHGED-ILDEALTFTTTHLKSVENRL--SSPLSKLVT  205

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL QPF  G PR+E R ++S+YQE+D  S N  LL FA LDFNLLQ +H +ELSE+S
Sbjct  206  HALYQPFWKGNPRLEARRYLSIYQEDD--SHNETLLTFAKLDFNLLQQVHLKELSEIS  261


 Score = 80.1 bits (196),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 75/143 (52%), Gaps = 17/143 (12%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQV-AEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKL  257
            R   NFPP  W  Y     S++  + AE   +E   LKE  +  +L PT S   D   KL
Sbjct  19   RRSANFPPNFWGDYFLSYASVEKNIEAERLVQE---LKENVKRMILAPTPSKHSD---KL  72

Query  258  KFIDLLERLGIAYHFEKEIDDQLRHI--------YIHPVHLND--LETVALQFRLMRQHG  407
              +D ++RLG++YH+E EID+ L+ I        + H    +D  L   AL FRL+RQ G
Sbjct  73   DLVDTIQRLGVSYHYEDEIDEVLQQIRKDSYDGSHQHQGSDDDHNLHAAALYFRLLRQQG  132

Query  408  YNISTHIFSNFVDGNESSETALM  476
            Y+IS  +F+ F D +   + +L+
Sbjct  133  YDISCEMFNKFKDDDGKFKDSLV  155



>ref|XP_008347229.1| PREDICTED: (-)-germacrene D synthase-like [Malus domestica]
Length=554

 Score =   100 bits (249),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 78/118 (66%), Gaps = 6/118 (5%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S   DV GLLSLYEA+++R   + E+L+    F  T L SA   L P   L K VT
Sbjct  141  KFKESLVDDVVGLLSLYEATHLRIHGE-EILDEALTFTTTHLESATNRLSP--PLAKTVT  197

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+Q    GLPRVE R+++SVYQE  ES  N  LL FA LDFN LQ +H++ELSE++
Sbjct  198  HALNQQLRKGLPRVEARYYLSVYQELRESP-NETLLTFAKLDFNRLQRVHQKELSELT  254


 Score = 80.5 bits (197),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 79/132 (60%), Gaps = 6/132 (5%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            RP   F  ++W  + F ++    +V     + ++ LKE+ R  L     +  ++V+QKL 
Sbjct  22   RPSATFYTSIWGDH-FLSYGF-MEVDAELEQHVQELKEEVRRML----TTSVENVSQKLN  75

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNISTHIFSNF  440
             ID ++RLG++Y+F  EI++ L+ I+ +   L+DL T AL FRL+RQ GYNI+  +F+ F
Sbjct  76   LIDDVQRLGVSYYFGNEIEEILQKIHENSYDLDDLYTAALCFRLLRQQGYNITCDLFNKF  135

Query  441  VDGNESSETALM  476
             DG+   + +L+
Sbjct  136  KDGDGKFKESLV  147



>ref|XP_007021123.1| Delta-cadinene synthase isozyme A [Theobroma cacao]
 gb|EOY12648.1| Delta-cadinene synthase isozyme A [Theobroma cacao]
Length=557

 Score = 94.7 bits (234),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 74/111 (67%), Gaps = 4/111 (4%)
 Frame = +2

Query  470  SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQPF  649
            SDVKGLL LYEA+++RT  +  +LE   AF  T L SA  +L     +  LV+HA  +P 
Sbjct  150  SDVKGLLELYEAAHIRTHGE-HILEEALAFTTTHLESAKTSL-CEYPISVLVSHARKRPI  207

Query  650  HTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
              GL R+E R FIS+YQE+   S +  LL+FA LDF+L+Q LHK+ELS++S
Sbjct  208  RKGLQRLEARRFISIYQED--GSHDKTLLKFAKLDFSLVQNLHKEELSKIS  256


 Score = 86.3 bits (212),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 76/131 (58%), Gaps = 4/131 (3%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            R    F P++W    F +F     V        E LK++ R  L +PT    + ++QKL+
Sbjct  22   RRSTKFHPSIWGD-LFLSFPSKVNVDTTTQLHYEELKQEVRRMLRVPT---DNQLSQKLR  77

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNISTHIFSNF  440
             I+ ++RLG++YHFE+EI+D L++IY      ++LE  +L+FRL+R+HG+N+    F+ F
Sbjct  78   LIETIKRLGVSYHFEREIEDVLQNIYDQDYKDDNLEVTSLRFRLLREHGFNVQCETFNKF  137

Query  441  VDGNESSETAL  473
             D   + + +L
Sbjct  138  KDDKGNFKVSL  148



>ref|XP_010683546.1| PREDICTED: (-)-germacrene D synthase-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=552

 Score = 99.4 bits (246),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 79/137 (58%), Gaps = 10/137 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSI-DNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKL  257
            RP+ +FPP +W    F  FS  D+ + E YAKEIE LKE+ +  L+I     S D A+K+
Sbjct  12   RPLAHFPPDIWGDR-FVTFSTEDSLMMEKYAKEIEPLKEEVKTMLMIEN---SADFAKKM  67

Query  258  KFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLN-----DLETVALQFRLMRQHGYNIST  422
              ID +ERLG++Y+FE EI++QL HI+      N     DL   A QFR+ RQHGY I  
Sbjct  68   SLIDAVERLGVSYYFENEIEEQLSHIFKELAAKNFDMEYDLYNTASQFRIFRQHGYKIPC  127

Query  423  HIFSNFVDGNESSETAL  473
             +F  F + +   +  L
Sbjct  128  DVFIKFTNEDGKMKETL  144


 Score = 81.6 bits (200),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 72/111 (65%), Gaps = 10/111 (9%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            S++++ ++SLYEAS++R   +  +L+  +AFA   L+S+A          +   HAL Q 
Sbjct  145  STNIRAIVSLYEASHLRIHGE-PILDEASAFATDVLKSSA-------NFSEQARHALKQV  196

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEV  799
             H G+ RVE+R FIS Y E+DE  RN  LLR A +DFN +Q+LH+QELS++
Sbjct  197  LHFGIQRVENRHFISFY-EQDEF-RNETLLRLAKIDFNRVQLLHRQELSQI  245



>gb|KDP46456.1| hypothetical protein JCGZ_12939 [Jatropha curcas]
Length=533

 Score = 92.8 bits (229),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 76/129 (59%), Gaps = 10/129 (8%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            RP+ NFPP  W  Y F + S      E+Y +E+  LKE  +  L    G    ++ + ++
Sbjct  16   RPLGNFPPRAWG-YSFASSSPLEAEFESYTREVVALKENVKDMLKQSLG----ELIENIE  70

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIH-PVHLN----DLETVALQFRLMRQHGYNISTH  425
            FI+LL RLG++YHFE EI++QL HI+I  P  +N    DL T AL F+++RQHGY +   
Sbjct  71   FINLLYRLGVSYHFEAEIEEQLSHIFIALPNIINDNNHDLYTSALIFQVLRQHGYKMPCD  130

Query  426  IFSNFVDGN  452
            +F  F D N
Sbjct  131  VFKKFKDNN  139


 Score = 87.4 bits (215),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 75/125 (60%), Gaps = 14/125 (11%)
 Frame = +2

Query  455  KFRD---------SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNS  607
            KF+D         S DVKGLL LYEA+++    +D + EG+  F   RL   A    P+ 
Sbjct  134  KFKDNNGEFKKSISDDVKGLLGLYEATFLSVHGEDILDEGLV-FTKRRLEILAAQSSPH-  191

Query  608  TLEKLVTHALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQE  787
             L   + +AL +PFH G+ R+E R +IS Y EE+  S N  LL+FA LDFN LQ+L+KQE
Sbjct  192  -LANRIRNALLRPFHQGIERIETRQYISFYAEEE--SPNQTLLKFAKLDFNRLQLLYKQE  248

Query  788  LSEVS  802
            L+ VS
Sbjct  249  LALVS  253



>gb|EYU31458.1| hypothetical protein MIMGU_mgv1a004009mg [Erythranthe guttata]
Length=549

 Score =   100 bits (249),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 71/121 (59%), Gaps = 7/121 (6%)
 Frame = +3

Query  84   PVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLKF  263
            P+  F P++W    F  FS D QV E Y K +E LK++ R+ L+  T        + L  
Sbjct  15   PMTVFSPSMWGD-TFSTFSFDEQVQEKYEKAMETLKQEVRSKLVEATS------GKLLVL  67

Query  264  IDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNISTHIFSNFV  443
            +D +ERLG++YHFE EI+++L  IY      +DL T AL+FRL+RQH Y +S  +F  F 
Sbjct  68   VDTIERLGLSYHFETEIEEKLEQIYNEDQEYDDLFTTALRFRLLRQHQYQVSCSVFDKFT  127

Query  444  D  446
            D
Sbjct  128  D  128


 Score = 79.7 bits (195),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 72/112 (64%), Gaps = 4/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRL-RSAAPNLKPNSTLEKLVTHALDQ  643
            +SDV+GLLSLYEA++VR R  +E+LE    F    + R    +    S L+  V  AL  
Sbjct  138  TSDVEGLLSLYEAAHVRIRG-EEILEEAVPFTKHHMTRHMLSSQSLESPLKDKVKRALVH  196

Query  644  PFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEV  799
              H G+P +E R +IS+Y+++D  SR++ +L+ A L+FN LQ ++K+ELSE+
Sbjct  197  SLHRGVPIIEARVYISIYEKDD--SRDDIILKLAKLNFNYLQNMYKEELSEL  246



>emb|CDP10867.1| unnamed protein product [Coffea canephora]
Length=569

 Score = 93.6 bits (231),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 89/150 (59%), Gaps = 18/150 (12%)
 Frame = +3

Query  66   ENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKE-------QTRATLLIPT  224
            ++ + R V +FP  +W    F ++++D Q+ + YAKEIEI+KE       + + ++L  T
Sbjct  13   QSEIIRLVSDFPEDIWGD-SFSSYTLDKQMYDMYAKEIEIMKEDGWHPYLKKKKSMLTAT  71

Query  225  GSCSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYI-------HPVHLNDLETVALQ  383
              CS  + +KLK ID LERLGI+YHFE+EI+ QL  I+          +H  DL T AL 
Sbjct  72   -HCS--ITEKLKLIDKLERLGISYHFEEEIEHQLEEIFKLSTNYEEEYLHSYDLFTAALH  128

Query  384  FRLMRQHGYNISTHIFSNFVDGNESSETAL  473
            FRL+RQH +NIS  IF  FVD N   +  L
Sbjct  129  FRLLRQHHFNISCGIFDKFVDANSKFKETL  158


 Score = 86.7 bits (213),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 74/119 (62%), Gaps = 9/119 (8%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF+++  SD+ GLLSLYEA+ VRTR D  +LE    F    L+     L+ +STL K V 
Sbjct  153  KFKETLCSDINGLLSLYEAAQVRTRKDS-ILEEALTFTLVHLKREP--LQASSTLAKQVK  209

Query  629  H--ALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEV  799
               +L    H G  RVE R +IS Y+EE+    N  LLRFA LD+N+LQMLHK+EL E+
Sbjct  210  FLDSLYNAVHKGSLRVEARRYISAYEEEE--CHNELLLRFAKLDYNMLQMLHKEELFEI  266



>ref|XP_010694308.1| PREDICTED: (-)-germacrene D synthase-like [Beta vulgaris subsp. 
vulgaris]
Length=325

 Score =   103 bits (256),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 71/111 (64%), Gaps = 5/111 (5%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            + DV GLLSLYEAS+VR   DD++L+   AF  T L      L P   L   V HAL QP
Sbjct  144  TKDVPGLLSLYEASHVRIH-DDKILDEALAFCTTHLNGMVDQLSP--PLADQVAHALHQP  200

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEV  799
             H G+PRVE R +IS+Y  E + S N  LL+FA LDFNLLQ LH++EL ++
Sbjct  201  MHKGMPRVEARHYISIY--EKDPSCNKTLLKFAKLDFNLLQTLHQKELKDL  249


 Score = 77.0 bits (188),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 74/136 (54%), Gaps = 9/136 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEI--LKEQTRATLLIPTGSCSDDVAQK  254
            RPV NF P  W  +  +     +  A    KE E+  LKE     LL   G    +  ++
Sbjct  12   RPVANFQPCHWGDHFLNITHPHHHEAVQVQKEQEVKQLKEAVEKRLLETKG----NPLEQ  67

Query  255  LKFIDLLERLGIAYHFEKEIDDQLRHIYIH---PVHLNDLETVALQFRLMRQHGYNISTH  425
            L FID +ERLG+AYHFE++I++ L+ +Y +       +DL  V+ +FR++RQHG+ +   
Sbjct  68   LTFIDAIERLGVAYHFEEQIEEALKQVYDNFHDQCAEDDLYHVSTRFRILRQHGFLVPCD  127

Query  426  IFSNFVDGNESSETAL  473
            +F+ F D   S E +L
Sbjct  128  VFNKFKDEKGSFEESL  143



>ref|XP_006475307.1| PREDICTED: (E)-beta-farnesene synthase-like isoform X1 [Citrus 
sinensis]
 ref|XP_006475308.1| PREDICTED: (E)-beta-farnesene synthase-like isoform X2 [Citrus 
sinensis]
Length=555

 Score = 94.7 bits (234),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 79/119 (66%), Gaps = 7/119 (6%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRS-AAPNLKPNSTLEKLV  625
            KF+ S   DV+G+LSLYEA ++  R +D +L+   AF  T L+S A+ ++ PN+  E+ +
Sbjct  142  KFKASLVKDVQGILSLYEAGHLAIRGED-ILDEAIAFTRTHLKSMASDDVCPNNLAEQ-I  199

Query  626  THALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
             HALD P     PRVE RFF+SVY   D+  +   LL+FA LDFNL+Q +H++ELS ++
Sbjct  200  NHALDCPLRRAFPRVETRFFLSVYPRVDKHDKT--LLKFAKLDFNLVQRIHQKELSAIT  256


 Score = 85.5 bits (210),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 78/136 (57%), Gaps = 9/136 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEA-YAKEIEILKEQTRATLLIPTGSCSDDVAQKL  257
            RP+  F P LW  Y F   + D +  +  + +E E LK++ R+ +     + +D  AQKL
Sbjct  18   RPIAGFHPNLWGDY-FLTLASDCKTNDTTHQEEYEALKQEVRSMIT----ATADTPAQKL  72

Query  258  KFIDLLERLGIAYHFEKEIDDQLRHIY---IHPVHLNDLETVALQFRLMRQHGYNISTHI  428
            + +D ++RLG+AYHFE+EI+D +  IY      +   DL TV+L+FRL+RQ G+ +   +
Sbjct  73   QLVDAVQRLGVAYHFEQEIEDAMEKIYHDDFDNIDDVDLYTVSLRFRLLRQQGFKVPCDV  132

Query  429  FSNFVDGNESSETALM  476
            F  F D     + +L+
Sbjct  133  FEKFKDDEGKFKASLV  148



>ref|XP_010313902.1| PREDICTED: vetispiradiene synthase 1 isoform X2 [Solanum lycopersicum]
Length=533

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 96/134 (72%), Gaps = 5/134 (4%)
 Frame = +3

Query  57   INFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCS  236
            +N ++ + RPV NF P+LW    FH+FS+DNQVA+ YA++IE LKEQTR+  L+   +C 
Sbjct  4    LNNQDEIVRPVANFSPSLWGDR-FHSFSLDNQVADKYAQQIETLKEQTRS--LLSDAACG  60

Query  237  DDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLN--DLETVALQFRLMRQHGY  410
              +A+KL  ID++ERLG+AYHFEK+I+D L  IY    +    DL T++LQFR++RQHGY
Sbjct  61   TTLAEKLNLIDIVERLGLAYHFEKQIEDMLDQIYKADPNFEAHDLNTLSLQFRILRQHGY  120

Query  411  NISTHIFSNFVDGN  452
            NIS  IFS F D N
Sbjct  121  NISQKIFSRFQDAN  134


 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 99/137 (72%), Gaps = 11/137 (8%)
 Frame = +2

Query  410  QHFYSYFQQLC*R----K*KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATR  571
            QH Y+  Q++  R      KF++S  +D+KGLL+LYEAS+VRT  +D +LE   AF+   
Sbjct  117  QHGYNISQKIFSRFQDANGKFKESLSNDIKGLLNLYEASHVRTHGED-ILEEALAFSTAH  175

Query  572  LRSAAPNLKPNSTLEKLVTHALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAIL  751
            L SAAP+LK  S L K VTHAL+Q  H  +PRVE R+FIS+Y+EE+   +N+ LLRFA L
Sbjct  176  LESAAPHLK--SPLSKQVTHALEQSLHKSIPRVETRYFISIYEEEE--FKNDVLLRFAKL  231

Query  752  DFNLLQMLHKQELSEVS  802
            D+NLLQMLHKQELSEVS
Sbjct  232  DYNLLQMLHKQELSEVS  248



>ref|XP_010248057.1| PREDICTED: probable terpene synthase 2 [Nelumbo nucifera]
Length=635

 Score = 90.1 bits (222),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 77/112 (69%), Gaps = 5/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            + D++G+LSLYEA+++  R +D +L+ V +F  T L +   N   +S+L K + HAL+QP
Sbjct  229  TRDIRGMLSLYEAAHLGIRGED-ILDDVLSFTTTHLNTFVSN--ASSSLVKQMMHALEQP  285

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
             H G  ++E R FIS Y EEDE +R   +L+ A LDFN +Q+LH++ELSE+S
Sbjct  286  LHKGTVKLEARRFISFY-EEDE-TRKEVILKLAKLDFNQVQLLHRKELSELS  335


 Score = 89.4 bits (220),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 77/131 (59%), Gaps = 12/131 (9%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            R   NF P++W  Y F A++ DN+  + Y K++E LKE+ +  L   T S +  + + L 
Sbjct  98   RHTANFSPSIWGDY-FLAYTCDNKEPDTYDKQVEELKEEVKRLL---TNSANRPL-EILN  152

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIY-IHPVHLND----LETVALQFRLMRQHGYNISTH  425
             ID L+RLG++YHFE E +  L  I+  H  + ND    L  VAL FRL+RQHGYNI   
Sbjct  153  LIDTLQRLGLSYHFEGERNQMLEQIFEAHISYFNDMGDDLHAVALLFRLLRQHGYNIPCD  212

Query  426  IFSNFVD--GN  452
            +F+ F D  GN
Sbjct  213  VFNKFKDERGN  223



>ref|XP_004230358.1| PREDICTED: vetispiradiene synthase 1 isoform X1 [Solanum lycopersicum]
 gb|AEP82773.1| viridiflorene synthase [Solanum lycopersicum]
Length=548

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 96/134 (72%), Gaps = 5/134 (4%)
 Frame = +3

Query  57   INFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCS  236
            +N ++ + RPV NF P+LW    FH+FS+DNQVA+ YA++IE LKEQTR+  L+   +C 
Sbjct  4    LNNQDEIVRPVANFSPSLWGDR-FHSFSLDNQVADKYAQQIETLKEQTRS--LLSDAACG  60

Query  237  DDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLN--DLETVALQFRLMRQHGY  410
              +A+KL  ID++ERLG+AYHFEK+I+D L  IY    +    DL T++LQFR++RQHGY
Sbjct  61   TTLAEKLNLIDIVERLGLAYHFEKQIEDMLDQIYKADPNFEAHDLNTLSLQFRILRQHGY  120

Query  411  NISTHIFSNFVDGN  452
            NIS  IFS F D N
Sbjct  121  NISQKIFSRFQDAN  134


 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 99/137 (72%), Gaps = 11/137 (8%)
 Frame = +2

Query  410  QHFYSYFQQLC*R----K*KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATR  571
            QH Y+  Q++  R      KF++S  +D+KGLL+LYEAS+VRT  +D +LE   AF+   
Sbjct  117  QHGYNISQKIFSRFQDANGKFKESLSNDIKGLLNLYEASHVRTHGED-ILEEALAFSTAH  175

Query  572  LRSAAPNLKPNSTLEKLVTHALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAIL  751
            L SAAP+LK  S L K VTHAL+Q  H  +PRVE R+FIS+Y+EE+   +N+ LLRFA L
Sbjct  176  LESAAPHLK--SPLSKQVTHALEQSLHKSIPRVETRYFISIYEEEE--FKNDVLLRFAKL  231

Query  752  DFNLLQMLHKQELSEVS  802
            D+NLLQMLHKQELSEVS
Sbjct  232  DYNLLQMLHKQELSEVS  248



>ref|XP_004288818.1| PREDICTED: (-)-germacrene D synthase-like [Fragaria vesca subsp. 
vesca]
Length=560

 Score =   104 bits (260),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 81/118 (69%), Gaps = 6/118 (5%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF +S   DV GL SLYEA+++R R +D  LE   AF  T L+SAA  L P   L K V 
Sbjct  147  KFDESLHHDVAGLQSLYEATHLRVRGED-FLEEALAFTTTHLQSAANRLSP--PLSKQVR  203

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+QP   GLPR+E R ++S++QE    SRN+ LLRFA LDFNLLQ +H++ELS+++
Sbjct  204  HALNQPLRKGLPRLEARHYMSLHQEL-HGSRNHVLLRFAKLDFNLLQQVHQKELSDIA  260


 Score = 74.7 bits (182),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 45/142 (32%), Positives = 78/142 (55%), Gaps = 8/142 (6%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWA-RYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCS  236
               N   R    + P++W  R+  +  +++  + +   + I+ LKE+ +  L+ P     
Sbjct  15   TLNNADTRRSAKYHPSIWGDRFLSYNNTMETNM-QGKQQVIQQLKEEVKRMLMAPPVETG  73

Query  237  DDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIH---PVHLNDLETVALQFRLMRQHG  407
                 KL+ ID ++RLG++YHFE EID  ++ I+ +       +DL T AL+FRL+RQHG
Sbjct  74   ---LGKLELIDDIQRLGVSYHFEYEIDQTMQQIHENLNGTYDDDDLHTCALRFRLLRQHG  130

Query  408  YNISTHIFSNFVDGNESSETAL  473
            YN+S  +F+ F D +   + +L
Sbjct  131  YNVSCDMFNKFKDCDGKFDESL  152



>gb|AAG41892.1|AF279456_1 sesquiterpene synthase 2 [Solanum habrochaites]
Length=546

 Score = 96.7 bits (239),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 85/128 (66%), Gaps = 6/128 (5%)
 Frame = +2

Query  428  FQQLC*RK*KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNL-K  598
            F+Q   +  KF+++  +DV+GLLSLYEAS++R R ++E+LE    F  T L S   NL  
Sbjct  121  FKQFTNQDGKFKETLTNDVQGLLSLYEASHLRVR-NEEILEEALTFTTTHLESIVSNLSN  179

Query  599  PNSTLEKLVTHALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLH  778
             N++L+  V+ AL QP    LPR+  R +IS+Y+  D  + N+ LL+FA LDFN+LQ  H
Sbjct  180  KNNSLKVEVSEALSQPIRMTLPRIGARKYISIYENND--AHNHLLLKFAKLDFNMLQKFH  237

Query  779  KQELSEVS  802
            ++ELS+++
Sbjct  238  QRELSDLT  245


 Score = 82.8 bits (203),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 76/135 (56%), Gaps = 12/135 (9%)
 Frame = +3

Query  51   MAINFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLL-IPTG  227
            MA +F N   RP+ NF PT+W    +H    + ++      E++  KE  R  L+  P G
Sbjct  1    MAASFANKC-RPLANFHPTVWG---YHFLYYNPEITNQEKIEVDEYKETIRKMLVEAPEG  56

Query  228  SCSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLND--LETVALQFRLMRQ  401
            S      QKL  ID ++RLG+AYHF  EI+  +++I+  P   ND  L  V+L+FRL+RQ
Sbjct  57   S-----EQKLVLIDAMQRLGVAYHFHNEIETSIQNIFDAPKQNNDDNLHIVSLRFRLVRQ  111

Query  402  HGYNISTHIFSNFVD  446
             G+ +S+ +F  F +
Sbjct  112  QGHYMSSDVFKQFTN  126



>gb|AGB14624.1| beta-caryophyllene synthase [Malus domestica]
Length=554

 Score =   100 bits (250),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 78/118 (66%), Gaps = 6/118 (5%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S   DV GLLSLYEA+++R   + E+L+    F  T L SA   L P   L K VT
Sbjct  141  KFKESLVDDVVGLLSLYEATHLRIHGE-EILDEALTFTTTHLESATNRLSP--PLAKTVT  197

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+Q    GLPRVE R+++SVYQE  ES  N  LL FA LDFN LQ +H++ELSE++
Sbjct  198  HALNQQLRKGLPRVEARYYLSVYQELRESP-NETLLTFAKLDFNRLQRVHQKELSELT  254


 Score = 78.6 bits (192),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 78/132 (59%), Gaps = 6/132 (5%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            RP   F  ++W  + F ++    +V     + ++ LKE+ R  L     +  ++V+QKL 
Sbjct  22   RPSATFYTSIWGDH-FLSYGF-MEVDAELEQHVQELKEEVRRML----TTSVENVSQKLN  75

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNISTHIFSNF  440
             ID ++RLG++Y+F  EI++ L+ I+ +   L+DL T  L FRL+RQ GYN++  +F+ F
Sbjct  76   LIDDIQRLGVSYYFGNEIEEILQKIHENSYDLDDLYTATLCFRLLRQQGYNVTCDLFNKF  135

Query  441  VDGNESSETALM  476
             DG+   + +L+
Sbjct  136  KDGDGKFKESLV  147



>sp|Q6Q3H2.1|TPSVS_VITVI RecName: Full=Valencene synthase; Short=VvVal; AltName: Full=7-epi-alpha-selinene 
synthase [Vitis vinifera]
 gb|AAS66358.1| (+)-valencene synthase [Vitis vinifera]
Length=556

 Score = 89.7 bits (221),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 78/118 (66%), Gaps = 7/118 (6%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            +F+++  SDV+G+L LYEA+++R   +D +L    AF  T L++   +L  +  L + V 
Sbjct  145  RFKEALISDVRGMLGLYEAAHLRVHGED-ILAKALAFTTTHLKAMVESLGYH--LAEQVA  201

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL++P   GL R+E R++ISVYQ  DE+  +  LL  A LDFNL+Q LHK+ELS ++
Sbjct  202  HALNRPIRKGLERLEARWYISVYQ--DEAFHDKTLLELAKLDFNLVQSLHKEELSNLA  257


 Score = 89.4 bits (220),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 81/137 (59%), Gaps = 9/137 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKE-IEILKEQTRATLLIPTGSCSDDVAQKL  257
            RPV NF P +W    F  ++ +++V  A  +E IE LK++ +  L   T +   + +Q L
Sbjct  19   RPVANFHPNIWGDQ-FITYTPEDKVTRACKEEQIEDLKKEVKRKL---TAAAVANPSQLL  74

Query  258  KFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLE----TVALQFRLMRQHGYNISTH  425
             FID ++RLG+AYHFE+EI++ L+HI       ND++     +AL FRL+RQ GY IS  
Sbjct  75   NFIDAVQRLGVAYHFEQEIEEALQHICNSFHDCNDMDGDLYNIALGFRLLRQQGYTISCD  134

Query  426  IFSNFVDGNESSETALM  476
            IF+ F D     + AL+
Sbjct  135  IFNKFTDERGRFKEALI  151



>gb|EYU32628.1| hypothetical protein MIMGU_mgv1a005108mg [Erythranthe guttata]
Length=496

 Score =   112 bits (281),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 82/118 (69%), Gaps = 7/118 (6%)
 Frame = +2

Query  455  KFRD--SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++   SD KGLLSLYEASY+R   +D +LE   AFA + L+  APNL  +S L + V 
Sbjct  84   KFKEVIKSDAKGLLSLYEASYLRVHEED-ILEDALAFATSNLKFIAPNL--SSPLREYVF  140

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL QP H G PR+E R FIS Y E+DE+ +N  LLRFA LD+NLLQ LHK EL EVS
Sbjct  141  HALVQPLHFGNPRIEARNFISFY-EQDEN-KNETLLRFAKLDYNLLQTLHKDELREVS  196


 Score = 66.2 bits (160),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 46/69 (67%), Gaps = 4/69 (6%)
 Frame = +3

Query  255  LKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLND----LETVALQFRLMRQHGYNIST  422
            L  ID +ERLGI+YHFE EI+++L+  +    +  D    L TV+L FR+ RQHG+ IS+
Sbjct  13   LNLIDTIERLGISYHFEDEIEEKLQQYFNMDTNYEDKTYDLYTVSLHFRVFRQHGHRISS  72

Query  423  HIFSNFVDG  449
             IF  F+DG
Sbjct  73   DIFRKFMDG  81



>ref|NP_001268215.1| valencene synthase [Vitis vinifera]
 gb|ACO36239.1| (+)-valencene synthase [Vitis vinifera]
Length=556

 Score = 89.7 bits (221),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 78/118 (66%), Gaps = 7/118 (6%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            +F+++  SDV+G+L LYEA+++R   +D +L    AF  T L++   +L  +  L + V 
Sbjct  145  RFKEALISDVRGMLGLYEAAHLRVHGED-ILAKALAFTTTHLKAMVESLGYH--LAEQVA  201

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL++P   GL R+E R++ISVYQ  DE+  +  LL  A LDFNL+Q LHK+ELS ++
Sbjct  202  HALNRPIRKGLERLEARWYISVYQ--DEAFHDKTLLELAKLDFNLVQSLHKEELSNLA  257


 Score = 89.4 bits (220),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 81/137 (59%), Gaps = 9/137 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKE-IEILKEQTRATLLIPTGSCSDDVAQKL  257
            RPV NF P +W    F  ++ +++V  A  +E IE LK++ +  L   T +   + +Q L
Sbjct  19   RPVANFHPNIWGDQ-FITYTPEDKVTRACKEEQIEDLKKEVKRKL---TAAAVANPSQLL  74

Query  258  KFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLE----TVALQFRLMRQHGYNISTH  425
             FID ++RLG+AYHFE+EI++ L+HI       ND++     +AL FRL+RQ GY IS  
Sbjct  75   NFIDAVQRLGVAYHFEQEIEEALQHICNSFHDCNDMDGDLYNIALGFRLLRQQGYTISCD  134

Query  426  IFSNFVDGNESSETALM  476
            IF+ F D     + AL+
Sbjct  135  IFNKFTDERGRFKEALI  151



>ref|XP_006492721.1| PREDICTED: casbene synthase, chloroplastic-like [Citrus sinensis]
 gb|KDO56473.1| hypothetical protein CISIN_1g047877mg [Citrus sinensis]
Length=590

 Score =   100 bits (250),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 78/113 (69%), Gaps = 6/113 (5%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRS-AAPNLKPNSTLEKLVTHALDQ  643
            +SD +G+LSLYEA+++R   +D +LE    F    L+S AAPNL  N  L K +  AL+Q
Sbjct  184  TSDARGMLSLYEATHLRVHGED-ILEEALTFTTAHLKSMAAPNLDQN--LAKHINDALEQ  240

Query  644  PFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            P H G+PR+E   FIS Y+ +D  S+N+ LL+FA LDFN +Q+LH+QEL+ ++
Sbjct  241  PLHMGVPRIEAHKFISFYEHDD--SKNDTLLKFAKLDFNRVQLLHQQELAYIT  291


 Score = 78.2 bits (191),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 72/127 (57%), Gaps = 12/127 (9%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            RP+ NF PT+W      +  ++    E Y K  E +K+  +  L+    +  +D  +++ 
Sbjct  55   RPLGNFRPTIWKDGSISSPVLE---VETYDKLNEEMKDHVKEMLV----ASRNDPVEEVV  107

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLN-----DLETVALQFRLMRQHGYNISTH  425
             I+LL RLG++YHFE EI+++L HI+     L      DL   A+ FR+ RQHG+N+S+ 
Sbjct  108  LINLLCRLGVSYHFENEIEERLNHIFEMQPDLAAEKDCDLYATAILFRVFRQHGFNVSSG  167

Query  426  IFSNFVD  446
            +F+ F D
Sbjct  168  VFNKFKD  174



>ref|XP_010092292.1| (-)-germacrene D synthase [Morus notabilis]
 gb|EXB50926.1| (-)-germacrene D synthase [Morus notabilis]
Length=568

 Score = 95.5 bits (236),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 82/120 (68%), Gaps = 8/120 (7%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAP--NLKPNSTLEKL  622
            KF+++  SD++G+LSLYEA+++R   +D +L+    F    L+SAA   +L P+  +E+ 
Sbjct  152  KFKEALASDIRGILSLYEATHLRVHGED-ILDEALVFTTPCLKSAASSRHLSPSFLIEQ-  209

Query  623  VTHALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            VTHAL QP   GL R+E R ++SVYQ+  + S N  LL FA LDFNLLQ +H++ELS ++
Sbjct  210  VTHALKQPIRKGLTRLEARHYMSVYQQ--DPSHNKVLLNFAKLDFNLLQKVHQEELSHIA  267


 Score = 83.2 bits (204),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 84/146 (58%), Gaps = 15/146 (10%)
 Frame = +3

Query  69   NHLPRPVDNFPPTLWA-RYCFHAFSIDNQVAEA-YAKEIEILKEQTRATLLIPTGSCSDD  242
            +H+ R   NF P++W  R+  +A +   + AEA    +I  LKE+ +  ++ P     +D
Sbjct  16   DHVNRRSANFHPSIWGDRFLSYAPNSMEKSAEAEITNKILELKEEVKKMVVGPV----ED  71

Query  243  VAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHL---------NDLETVALQFRLM  395
             ++KL  ID ++RLG++YHFEKEI+  L  I+ + ++          +DL TVAL+FRL+
Sbjct  72   PSKKLNLIDTIQRLGVSYHFEKEIETVLHQIHDNTLYNCPQNAETYDDDLHTVALRFRLL  131

Query  396  RQHGYNISTHIFSNFVDGNESSETAL  473
            RQ GY +S  IF NF +     + AL
Sbjct  132  RQQGYPVSCDIFKNFKNTEGKFKEAL  157



>ref|XP_011080426.1| PREDICTED: gamma-cadinene synthase-like [Sesamum indicum]
Length=559

 Score = 99.8 bits (247),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 84/143 (59%), Gaps = 10/143 (7%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSD  239
            N    +  P+ ++ P++     F +FS+D+++   YA+ I+ LK+Q R ++L+  GS + 
Sbjct  14   NLTKDVRPPITSYTPSMLGD-AFTSFSLDDKLQRKYAEAIQELKQQAR-SMLMTKGSTT-  70

Query  240  DVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLN-----DLETVALQFRLMRQH  404
               +KL  ID LERLG+ YHFE+EI+DQLR I+            DL   ALQFRL+RQH
Sbjct  71   --IEKLILIDTLERLGVGYHFEQEIEDQLREIFFFQSQDKDQDNYDLFATALQFRLLRQH  128

Query  405  GYNISTHIFSNFVDGNESSETAL  473
             Y+IS ++F  F D +   E  L
Sbjct  129  RYSISCNVFDKFKDDDSKFEETL  151


 Score = 79.0 bits (193),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 66/112 (59%), Gaps = 5/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            +SD KGLLSLYEAS VR   +  +LE   AF    L      L+P   L+  V  AL Q 
Sbjct  152  TSDAKGLLSLYEASNVRIHGE-HILEDAVAFTTHHLNHMVQELEPQ--LQCQVKRALVQS  208

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
             + G+PR+E R +IS Y  E   S+N  LL+ A LDFN LQ ++K+EL ++S
Sbjct  209  VYRGVPRLEARHYISFY--ERNESKNEILLKLAKLDFNYLQNIYKKELHDLS  258



>gb|AEM23826.1| sesquiterpene synthase [Solanum habrochaites]
Length=545

 Score =   100 bits (248),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 85/127 (67%), Gaps = 7/127 (6%)
 Frame = +2

Query  428  FQQLC*RK*KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKP  601
            F+Q   +  KF+++  +DV+GLLSLYEAS++R R D+E+LE    F  T L S   NL  
Sbjct  122  FKQFTNQDGKFKETLTNDVQGLLSLYEASHLRVR-DEEILEEALTFTTTHLESIVSNLSN  180

Query  602  NSTLEKLVTHALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHK  781
            N+ +E  V+ AL QP    LPR+  R +IS+Y+  D  + N+ LL+FA LDFN+LQ LH+
Sbjct  181  NNKVE--VSEALTQPIRMTLPRMGARKYISIYENND--AHNHLLLKFAKLDFNMLQKLHQ  236

Query  782  QELSEVS  802
            +ELS+++
Sbjct  237  RELSDLT  243


 Score = 78.2 bits (191),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 75/125 (60%), Gaps = 10/125 (8%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            RP+ NF PT+W    +H  S   +++     E++ LKE  R  L+    +C D+  QKL 
Sbjct  10   RPLANFSPTVWG---YHFLSYTPEISSQEKHEVDELKEIFRKMLV---ETC-DNSTQKLV  62

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIY-IHPVHLND--LETVALQFRLMRQHGYNISTHIF  431
             ID ++RLG+AYHF+ EI+  +++I+     + ND  L  V+L+FRL+RQ G+ +S+ +F
Sbjct  63   LIDTIQRLGVAYHFDNEIETSIQNIFDASKQNDNDDNLHIVSLRFRLVRQQGHYMSSDVF  122

Query  432  SNFVD  446
              F +
Sbjct  123  KQFTN  127



>emb|CBI31313.3| unnamed protein product [Vitis vinifera]
Length=606

 Score = 92.4 bits (228),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 84/145 (58%), Gaps = 9/145 (6%)
 Frame = +3

Query  57   INFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAY-AKEIEILKEQTRATLLIPTGSC  233
            +N++      + +F P++W     +   +  ++  AY  K++E LK++ R   L   G  
Sbjct  60   LNYKPEKKGAIVSFHPSVWGNRFINYTLLMMKITRAYNQKQVEDLKDEVRREQLAAAGKP  119

Query  234  SDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHI----YIHPVHLNDLETVALQFRLMRQ  401
            S    Q+L FID ++RLG+AYHFE+EI++ LRHI    +      +DL  V+L+FRL+RQ
Sbjct  120  S----QQLNFIDAIQRLGVAYHFEEEIEEALRHICDDHHYSDDKYDDLYNVSLRFRLLRQ  175

Query  402  HGYNISTHIFSNFVDGNESSETALM  476
             GYNIS  +F+ F D N S   +L+
Sbjct  176  QGYNISCDVFNKFKDKNGSFRESLI  200


 Score = 85.9 bits (211),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 76/117 (65%), Gaps = 7/117 (6%)
 Frame = +2

Query  458  FRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTH  631
            FR+S   DV+G+L LYEA+++R + +D +L+   AF  T L+S   +L  +  L   VT 
Sbjct  195  FRESLIGDVQGMLGLYEAAHLRVQEED-ILDEALAFTTTHLKSLVKHL--DHPLAVQVTQ  251

Query  632  ALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            AL +P   GL R+E R +I +YQ  DE+S +  LL+ A LDFNLLQ L+K+ELS ++
Sbjct  252  ALHRPIRKGLERLEARPYIFIYQ--DEASHSKALLKLAKLDFNLLQSLYKKELSHIT  306



>gb|KDP42347.1| hypothetical protein JCGZ_02820 [Jatropha curcas]
 gb|AIM47564.1| casbene synthase 3 [Jatropha curcas]
Length=601

 Score = 92.4 bits (228),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 80/137 (58%), Gaps = 9/137 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            RP+  FPPT+W      + + +    E+  K++E+LKE  +  + I + S   D AQK+ 
Sbjct  62   RPLAYFPPTVWGDR-LGSLTFEQPELESLNKQVELLKENVKKDVFIASTS---DPAQKII  117

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIY-IHPVHLN----DLETVALQFRLMRQHGYNISTH  425
             ID L RLG++YHF+ EI + L  I+   P  LN    DL TVA+ FR+ RQHG+ IS+ 
Sbjct  118  LIDSLCRLGVSYHFQDEIKENLNKIFNTQPNFLNENDYDLYTVAMVFRVYRQHGFKISSD  177

Query  426  IFSNFVDGNESSETALM  476
            +F+ F D +   + +L+
Sbjct  178  VFNKFKDSDGKFKESLL  194


 Score = 85.9 bits (211),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 78/118 (66%), Gaps = 7/118 (6%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  +D+KG+LSL+EA++V +  ++ +L+   AF    L S+A    PN    K ++
Sbjct  188  KFKESLLNDIKGILSLFEATHV-SMPNEPILDEALAFTKAFLESSAVKSFPN--FAKHIS  244

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
             AL+QP H G+PR+E R +I +Y  E + SRN  +L  A LDFN +Q+LH++ELS+ S
Sbjct  245  SALEQPVHKGIPRLEARKYIDLY--EVDESRNETVLELAKLDFNRVQLLHQEELSQFS  300



>ref|XP_009334624.1| PREDICTED: (-)-germacrene D synthase-like [Pyrus x bretschneideri]
Length=557

 Score =   103 bits (258),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 81/118 (69%), Gaps = 6/118 (5%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF+ S  +D+ GLLSLYEA+++R   +D +LE   +F  T L SAA +L P   L++ V 
Sbjct  145  KFKGSLTNDIVGLLSLYEATHLRVHGED-ILEEALSFTTTHLESAAHSLSPGPLLQQ-VK  202

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL QPF  G PR+E R ++S+Y+E +  S N  LL FA LDFNLLQ +H++ELSE+S
Sbjct  203  HALYQPFWKGNPRLEARHYLSIYRENN--SHNETLLTFAKLDFNLLQKVHQKELSEIS  258


 Score = 74.3 bits (181),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 49/138 (36%), Positives = 70/138 (51%), Gaps = 14/138 (10%)
 Frame = +3

Query  69   NHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVA  248
            N + R   NF PT+W  Y     SI+  + E   + ++ LK +      IP+        
Sbjct  15   NDVNRRSANFSPTIWGDYFLSYASIEINIEEE--QHVQELKVKRMIMAPIPSKPL-----  67

Query  249  QKLKFIDLLERLGIAYHFEKEIDDQLRHIY--IHPVHLN-----DLETVALQFRLMRQHG  407
            +KL+ ID ++R G++ HFE EID  L  I+   H  H       DL   AL FRL+RQ G
Sbjct  68   KKLELIDAIQRFGVSRHFENEIDQVLLQIHNSYHRYHQGSDDDEDLHAAALYFRLLRQQG  127

Query  408  YNISTHIFSNFVDGNESS  461
            YNIS  +F+ F D N++ 
Sbjct  128  YNISCDMFNKFKDVNDAK  145



>gb|AAX16121.1| germacrene-D synthase [Actinidia deliciosa]
Length=565

 Score = 96.3 bits (238),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 82/120 (68%), Gaps = 7/120 (6%)
 Frame = +2

Query  449  K*KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKL  622
            K +F++S  SDV+G+LSLYEA+ +R   +D +L+   AF  T+LRSA PNL  ++  ++ 
Sbjct  150  KGEFQESIISDVQGMLSLYEATCLRIHGED-ILDEALAFTITQLRSALPNL--STPFKEQ  206

Query  623  VTHALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            + HAL+QP H GL R+  R  I  +++ D  S++  LL FA LDFNLLQ LH++EL E++
Sbjct  207  IIHALNQPIHKGLTRLNARSHILFFEQNDCHSKD--LLNFAKLDFNLLQKLHQRELCEIT  264


 Score = 82.0 bits (201),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 71/128 (55%), Gaps = 10/128 (8%)
 Frame = +3

Query  72   HLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEI----LKEQTRATLLIPTGSCSD  239
            H+ R   N+ P++W  + F A+S D    E    E +     LK++ R  L     + ++
Sbjct  24   HVTRRSANYHPSIWGDH-FLAYSSDAMEEEVINMEQQQRLHHLKQKVRKML----EAAAE  78

Query  240  DVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIY-IHPVHLNDLETVALQFRLMRQHGYNI  416
              +Q L  +D ++RLG++YHFE EI+  LRHIY     H +DL T AL FRL+RQ GY +
Sbjct  79   QSSQMLNLVDKIQRLGVSYHFETEIETALRHIYKTCDYHFDDLHTAALSFRLLRQQGYPV  138

Query  417  STHIFSNF  440
            S  +F  F
Sbjct  139  SCDMFDKF  146



>gb|KDP46452.1| hypothetical protein JCGZ_12935 [Jatropha curcas]
Length=500

 Score = 93.2 bits (230),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 75/129 (58%), Gaps = 10/129 (8%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            RP+ NFPP  W  Y F + S      E+Y +E+E LKE  +  L   TG   +++    +
Sbjct  16   RPLGNFPPRGWG-YSFASSSPLEAEFESYTREVEALKENVKDMLKQSTGKLIENI----E  70

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIH-PVHLN----DLETVALQFRLMRQHGYNISTH  425
             I+LL RLG++Y F  EI++QL HI+I  P  +N    DL T AL F+++RQHGY +S  
Sbjct  71   LINLLYRLGVSYQFRAEIEEQLSHIFIALPNIINDNNYDLYTSALLFQVLRQHGYKMSCD  130

Query  426  IFSNFVDGN  452
            +F  F D N
Sbjct  131  VFKKFKDNN  139


 Score = 85.1 bits (209),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 73/125 (58%), Gaps = 14/125 (11%)
 Frame = +2

Query  455  KFRD---------SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNS  607
            KF+D         S DVKGLL LYEA+++    +D +L+    F   RL   A    P+ 
Sbjct  134  KFKDNNGEFKKSISDDVKGLLGLYEATFLSVHGED-ILDEALVFTKQRLEILAAQSSPH-  191

Query  608  TLEKLVTHALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQE  787
             L   + +AL +PFH G+ R E R +IS Y EE+  S N  LL+FA LDFN LQ+L+KQE
Sbjct  192  -LANRIRNALLRPFHQGIERKETRQYISFYGEEE--SPNQTLLKFAKLDFNRLQLLYKQE  248

Query  788  LSEVS  802
            L+ VS
Sbjct  249  LALVS  253



>sp|P93665.1|DCS1_GOSHI RecName: Full=(+)-delta-cadinene synthase; Short=D-cadinene synthase 
[Gossypium hirsutum]
 gb|AAC12784.1| (+)-delta-cadinene synthase [Gossypium hirsutum]
Length=554

 Score = 95.1 bits (235),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 75/112 (67%), Gaps = 5/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            +SDV+GLL LY+ASY+R   +D +L+   +F +  L  A  +L  +  L + V+HAL Q 
Sbjct  148  TSDVRGLLELYQASYLRVHGED-ILDEAISFTSNHLSLAVASL--DHPLSEEVSHALKQS  204

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
               GLPRVE R ++SVYQ  D  S N  LL FA +DFN++Q+LH++ELSE+S
Sbjct  205  IRRGLPRVEARHYLSVYQ--DIESHNKVLLEFAKIDFNMVQLLHRKELSEIS  254


 Score = 82.8 bits (203),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 75/127 (59%), Gaps = 9/127 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            RP  +F P++W  +  +    D  +     K  + LKE+ R  ++ P  + +     KL 
Sbjct  22   RPKADFQPSIWGDFFLNC--PDKNIDAETQKRHQQLKEEVRKMIVAPMANST----LKLA  75

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIHPVHL-NDLETVALQFRLMRQHGYNISTHIFSN  437
            FID ++ LG++YHF KEI+D+L +IY +     NDL T +L+FRL+R+HG+++S  +F+ 
Sbjct  76   FIDSVQGLGVSYHFTKEIEDELENIYHNNNDAENDLYTTSLRFRLLREHGFHVSCDVFNK  135

Query  438  FVD--GN  452
            F D  GN
Sbjct  136  FKDEQGN  142



>gb|AGN72803.1| germacrene A [Lavandula stoechas]
Length=542

 Score =   107 bits (266),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 77/110 (70%), Gaps = 5/110 (5%)
 Frame = +2

Query  473  DVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQPFH  652
            D KGLLSLYEASY+RTR +  +L+    F    L+S APNL+  S L + V HAL Q  H
Sbjct  138  DAKGLLSLYEASYLRTRGET-ILDEALDFTTASLKSIAPNLE--SPLRRQVEHALVQQLH  194

Query  653  TGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
             G PR+E R FIS+Y+E ++  ++  LLRFA LD+NLLQM+HK+EL EVS
Sbjct  195  WGNPRIEARNFISLYEEYED--KDESLLRFAKLDYNLLQMMHKEELHEVS  242


 Score = 71.2 bits (173),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 69/133 (52%), Gaps = 13/133 (10%)
 Frame = +3

Query  66   ENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDV  245
            E  + RP+ NF P+LW         I N  ++A  + I    + T  ++L  TG+   D 
Sbjct  5    EAEILRPLANFSPSLWGDQF-----IKND-SDAKVRYIFHYVDYTNLSMLTATGTKMVDT  58

Query  246  AQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLN----DLETVALQFRLMRQHGYN  413
               +  ID LERLG++YHFE EI++ L+  +      N    DL TVA  FRL RQHG+ 
Sbjct  59   ---MNLIDTLERLGVSYHFEHEIEEILQQFFNLNTDYNDEAYDLYTVATHFRLFRQHGHR  115

Query  414  ISTHIFSNFVDGN  452
            I+  IF  + D N
Sbjct  116  ITCDIFGRWRDEN  128



>ref|XP_011002270.1| PREDICTED: probable terpene synthase 6 [Populus euphratica]
Length=552

 Score = 95.1 bits (235),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 81/144 (56%), Gaps = 21/144 (15%)
 Frame = +3

Query  63   FENHLP-------RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIP  221
             + HLP       RP+ +FPPT W  + F +FS      E+Y +++E LK      L+  
Sbjct  3    LQAHLPENSKQNSRPLADFPPTEWG-FSFVSFSFPEMEFESYNRQVEDLKSTVMGMLM--  59

Query  222  TGSCSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLN-------DLETVAL  380
              +   D  + ++FI+LL RLG++YHFE EI+DQ+   Y+H    N       DL TVAL
Sbjct  60   --ASKKDPVENVEFINLLCRLGVSYHFETEIEDQVD--YVHDALPNLLENNDHDLHTVAL  115

Query  381  QFRLMRQHGYNISTHIFSNFVDGN  452
             FR++RQ+GY +S+ +F  F D N
Sbjct  116  LFRVLRQYGYKVSSDVFKKFKDTN  139


 Score = 82.8 bits (203),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 76/125 (61%), Gaps = 14/125 (11%)
 Frame = +2

Query  455  KFRDS---------SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNS  607
            KF+D+         SDVKG LSL+EA+Y+    + ++L+    F+ T L S A    P  
Sbjct  134  KFKDTNGEFKKTITSDVKGNLSLHEAAYLSVNGE-QILDEALEFSRTNLESLATQSGPR-  191

Query  608  TLEKLVTHALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQE  787
             L + + +AL +P H  + R+E R +IS Y+EED   RN  LL+FA LDFN +Q+LH+QE
Sbjct  192  -LGRHIKYALIRPIHKTVQRLEAREYISFYEEED--FRNETLLKFAKLDFNRVQLLHQQE  248

Query  788  LSEVS  802
            LS +S
Sbjct  249  LSTLS  253



>gb|KDP36230.1| hypothetical protein JCGZ_09950 [Jatropha curcas]
Length=555

 Score = 90.1 bits (222),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 76/125 (61%), Gaps = 13/125 (10%)
 Frame = +2

Query  455  KFRDSS---------DVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNS  607
            KFRDS+         D++G+LSLYEA+Y+R   +D +LE   AF+   L+S A N     
Sbjct  135  KFRDSNGHFNETLKNDIQGILSLYEAAYLRVHGED-ILEEALAFSTVHLKSIA-NSNTRF  192

Query  608  TLEKLVTHALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQE  787
                 V+ AL QP   GL R+E + +IS+YQE+  +S N  LL FA LDFN+LQ +H++E
Sbjct  193  PFAAQVSRALKQPIRKGLQRLESKHYISMYQED--ASHNEVLLTFAKLDFNVLQKMHREE  250

Query  788  LSEVS  802
            L  +S
Sbjct  251  LRYIS  255


 Score = 87.4 bits (215),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 76/135 (56%), Gaps = 12/135 (9%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWA----RYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTG  227
            N  ++  R   NF P +W      Y     +I+N + E    +++ LKE+ +  ++  T 
Sbjct  14   NTSSNTTRHTANFSPDIWGDRFLSYDSEFTNINNDMEE----QVQRLKEEVKRMIIASTH  69

Query  228  SCSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHG  407
              S+D    L  ID ++RLG+AYHFE EI++ L  I+    + NDL + AL+FRL+RQ G
Sbjct  70   ESSED----LNLIDSIQRLGVAYHFENEIEEALLRIHCSTDNYNDLHSAALRFRLLRQQG  125

Query  408  YNISTHIFSNFVDGN  452
            +N+S  +F+ F D N
Sbjct  126  FNVSCDVFNKFRDSN  140



>ref|XP_004302393.1| PREDICTED: (-)-alpha-pinene synthase-like [Fragaria vesca subsp. 
vesca]
Length=570

 Score =   103 bits (258),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 83/142 (58%), Gaps = 10/142 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            RP+ NF P++W     +  S D +    + +++E LK   ++ +   T  C  D A +LK
Sbjct  23   RPIANFQPSIWGDQFLNYDSQDIKTGAFWQQQVEELKVNVKSKVF--TNEC--DFALRLK  78

Query  261  FIDLLERLGIAYHFEKEIDDQLRHI---YIHPVHLN---DLETVALQFRLMRQHGYNIST  422
             ID ++RLG+AYHFE+EI D LRHI   Y    H N   DL TVAL FRL+RQHGY IS+
Sbjct  79   LIDAIQRLGVAYHFEEEIADALRHIHATYRDQDHFNDDSDLSTVALCFRLLRQHGYEISS  138

Query  423  HIFSNFVDGNESSETALM*RVC  488
             +F+ F D N S +  L+   C
Sbjct  139  DMFNKFKDENGSFKEGLVADGC  160


 Score = 73.6 bits (179),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 69/114 (61%), Gaps = 4/114 (4%)
 Frame = +2

Query  470  SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQPF  649
            +D   +LSLYEA++++   ++ +LE    F    L SA  +   ++ + + +T AL +P 
Sbjct  157  ADGCAMLSLYEAAHLKVHGEN-ILEEALVFTTAHLESAKSSACYSTQMTEQITQALVRPL  215

Query  650  HTGLPRVEHRFFISVYQEEDESS---RNNELLRFAILDFNLLQMLHKQELSEVS  802
             T L R+  +  +SVYQ ED+++    N  LL+ A +DFNL+Q LHK+EL E++
Sbjct  216  RTSLERICAKRHMSVYQLEDDAALIKHNETLLKLAKMDFNLVQFLHKKELCEIT  269



>gb|ACJ46047.1| sesquiterpene synthase [Warburgia ugandensis]
Length=353

 Score = 99.4 bits (246),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 77/111 (69%), Gaps = 5/111 (5%)
 Frame = +2

Query  470  SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQPF  649
            +DV+GLLSLYEA+Y+ TR +D VLE    F    L S+  +L P   L + V+HAL+ P 
Sbjct  119  TDVRGLLSLYEAAYLGTRGED-VLEEAITFTRQHLSSSVDHLDP--LLARKVSHALELPL  175

Query  650  HTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            H  + R+EH+++IS+YQEE++  RN  LL  A LDFNL+Q LH++EL E++
Sbjct  176  HKRVQRLEHKYYISIYQEEEK--RNETLLELAKLDFNLVQSLHQRELEELT  224


 Score = 77.8 bits (190),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 67/118 (57%), Gaps = 7/118 (6%)
 Frame = +3

Query  126  FHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLKFIDLLERLGIAYHFE  305
            F  F  +      +A  ++ LKE+    L     S + D  ++L  I++LE LG+AY FE
Sbjct  5    FLTFPHEQTKLNTWAGRVQELKEEVMRML-----SNAGDSKEELDLINVLECLGVAYLFE  59

Query  306  KEIDDQLRHIYIH--PVHLNDLETVALQFRLMRQHGYNISTHIFSNFVDGNESSETAL  473
            +EI+  L  IY        NDL T AL+FRL+RQHGYNIS+ +F+ F D N + + AL
Sbjct  60   QEIEKALHQIYGSHSTADANDLHTTALRFRLLRQHGYNISSDVFAQFKDDNGNFKEAL  117



>gb|AIM47562.1| casbene synthase 1 [Jatropha curcas]
Length=601

 Score = 90.9 bits (224),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 81/137 (59%), Gaps = 9/137 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            RP+  FPPT+W      + + +    E  +K++E+L E+ +  +L      + D+A+K+ 
Sbjct  62   RPLAYFPPTVWGDR-LASLTFNQPAFELLSKQVELLNEKIKKEML---NVSTSDLAEKII  117

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIY-IHPVHLN----DLETVALQFRLMRQHGYNISTH  425
             ID L RLG++YHFE+EI + L  I+   P  LN    DL TVA+ FR+ RQHG+ IS+ 
Sbjct  118  LIDSLCRLGVSYHFEEEIQENLTRIFNTQPNFLNEKDYDLFTVAVIFRVFRQHGFKISSD  177

Query  426  IFSNFVDGNESSETALM  476
            +F+ F D +   + +L+
Sbjct  178  VFNKFKDSDGKFKESLL  194


 Score = 85.9 bits (211),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 78/118 (66%), Gaps = 7/118 (6%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  +D+KG+LSL+EA++V +  ++ +L+   AF    L S+A    PN    K ++
Sbjct  188  KFKESLLNDIKGILSLFEATHV-SMPNEPILDEALAFTKAFLESSAVKSFPN--FAKHIS  244

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
             AL+QP H G+PR+E R +I +Y  E + SRN  +L  A LDFN +Q+LH++ELS+ S
Sbjct  245  SALEQPVHKGIPRLEARKYIDLY--EVDESRNETVLELAKLDFNRVQLLHQEELSQFS  300



>dbj|BAM34474.1| casbene synthase [Jatropha curcas]
 gb|KDP42349.1| hypothetical protein JCGZ_02822 [Jatropha curcas]
Length=601

 Score = 90.9 bits (224),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 81/137 (59%), Gaps = 9/137 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            RP+  FPPT+W      + + +    E  +K++E+L E+ +  +L      + D+A+K+ 
Sbjct  62   RPLAYFPPTVWGDR-LASLTFNQPAFELLSKQVELLNEKIKKEML---NVSTSDLAEKII  117

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIY-IHPVHLN----DLETVALQFRLMRQHGYNISTH  425
             ID L RLG++YHFE+EI + L  I+   P  LN    DL TVA+ FR+ RQHG+ IS+ 
Sbjct  118  LIDSLCRLGVSYHFEEEIQENLTRIFNTQPNFLNEKDYDLFTVAVIFRVFRQHGFKISSD  177

Query  426  IFSNFVDGNESSETALM  476
            +F+ F D +   + +L+
Sbjct  178  VFNKFKDSDGKFKESLL  194


 Score = 85.9 bits (211),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 78/118 (66%), Gaps = 7/118 (6%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  +D+KG+LSL+EA++V +  ++ +L+   AF    L S+A    PN    K ++
Sbjct  188  KFKESLLNDIKGILSLFEATHV-SMPNEPILDEALAFTKAFLESSAVKSFPN--FAKHIS  244

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
             AL+QP H G+PR+E R +I +Y  E + SRN  +L  A LDFN +Q+LH++ELS+ S
Sbjct  245  SALEQPVHKGIPRLEARKYIDLY--EVDESRNETVLELAKLDFNRVQLLHQEELSQFS  300



>ref|XP_010645939.1| PREDICTED: valencene synthase-like [Vitis vinifera]
Length=363

 Score = 89.7 bits (221),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 77/127 (61%), Gaps = 10/127 (8%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEA-YAKEIEILKEQTRATLLIPTGSCSDDVAQKL  257
            RPV NF P +W    F  ++ +++V  A   ++IE LK++ +  L   T + S      L
Sbjct  19   RPVTNFHPNIWGDQ-FITYTPEDKVTRACKVEQIEDLKKEVKRKLTAATANHS----LLL  73

Query  258  KFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLE----TVALQFRLMRQHGYNISTH  425
             FID ++RLG+AYHFE+EI++ L+HIY     LND++     VAL FRL+RQ GY+IS  
Sbjct  74   NFIDAVQRLGVAYHFEQEIEEALQHIYESFHDLNDIDGDLYNVALGFRLLRQQGYSISCG  133

Query  426  IFSNFVD  446
            IF  F D
Sbjct  134  IFKKFTD  140


 Score = 86.7 bits (213),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 73/111 (66%), Gaps = 5/111 (5%)
 Frame = +2

Query  470  SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQPF  649
            ++V+GLL LYEA+++R   +D + E +T F  T L++   +L     L + V HAL++P 
Sbjct  151  TNVRGLLGLYEAAHLRVHGEDILAEALT-FTTTHLKAMVESL--GYPLAEQVVHALNRPI  207

Query  650  HTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
              GL R+E R++ISVYQ  DE+  +  LL  A LDFNL+Q LH++ELS ++
Sbjct  208  RKGLERIEARWYISVYQ--DEAFHDKTLLELAKLDFNLVQSLHREELSNLA  256



>gb|AHF22834.1| drimenol synthase [Persicaria hydropiper]
Length=559

 Score =   108 bits (269),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 80/121 (66%), Gaps = 6/121 (5%)
 Frame = +2

Query  446  RK*KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEK  619
            R  +F+DS  SDVKG+L LYEAS+VRT  DD + E +  F  T L++   N +PN  L  
Sbjct  141  RNGRFKDSLASDVKGILGLYEASHVRTHGDDTLDEALV-FTTTHLKAVVTN-QPNHPLVP  198

Query  620  LVTHALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEV  799
             VTHAL QP+H G+PR+E R FI+ Y  E +   +  LL+F  LDFNL+Q LHK+EL ++
Sbjct  199  QVTHALMQPYHKGMPRLESRHFIAFY--EKDPYHDKTLLKFGKLDFNLVQALHKKELKDL  256

Query  800  S  802
            S
Sbjct  257  S  257


 Score = 68.2 bits (165),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 65/127 (51%), Gaps = 4/127 (3%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            RP+ +F P+ W  Y       D         E++ ++E  +  L     +    + + L 
Sbjct  17   RPIASFHPSPWGDYFLKYVPCDQVTQAKMEDEVKKVEEDVKKELRKLAKAVGKPL-ELLN  75

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIH---PVHLNDLETVALQFRLMRQHGYNISTHIF  431
            FID++ERLG+ Y  E+EI+D ++ I+ +    V   DL   +L FRL+RQHG+++S  +F
Sbjct  76   FIDVVERLGVGYRLEQEIEDLVQAIFDNDKFGVDEFDLYHTSLWFRLLRQHGFHVSCDVF  135

Query  432  SNFVDGN  452
              F   N
Sbjct  136  GKFKGRN  142



>ref|XP_011080334.1| PREDICTED: gamma-cadinene synthase-like [Sesamum indicum]
Length=539

 Score = 99.8 bits (247),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 87/134 (65%), Gaps = 10/134 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSID-NQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKL  257
            + + +  PT+W    F + S+D NQ+ E YA++IE L E+ R ++LI  GS +   A+ L
Sbjct  5    QTISSSAPTMWDN-TFTSSSVDVNQLQEKYAQDIEELTEEAR-SMLIAKGSTA---AETL  59

Query  258  KFIDLLERLGIAYHFEKEIDDQLRHIY-IHPVHLN--DLETVALQFRLMRQHGYNISTHI  428
              ID LERLG+AYHFE+EI+DQL+ I+  H  + N  DL T ALQFRL+RQH Y +S+ +
Sbjct  60   ILIDTLERLGVAYHFEQEIEDQLQEIFQFHSKNENHYDLFTTALQFRLLRQHRYFVSSSV  119

Query  429  FSNFV-DGNESSET  467
            F  F  + NE  ET
Sbjct  120  FDKFKNEDNEFKET  133


 Score = 76.6 bits (187),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 65/111 (59%), Gaps = 5/111 (5%)
 Frame = +2

Query  470  SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQPF  649
            SDVKGLLSLYEA+ +R   +  +LE   AF    L+     L+    L+  V  AL    
Sbjct  136  SDVKGLLSLYEAAQLRIHGE-TILEEAVAFTTHHLKLMLQQLE--CPLQDQVKRALQHSL  192

Query  650  HTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            H G+PR++ R FIS Y+ +D  S N  LL+ A LDFN LQ L+K+E  +++
Sbjct  193  HRGVPRIQTRHFISFYETDD--SNNQLLLKLARLDFNYLQNLYKKEFHDLT  241



>emb|CBI31315.3| unnamed protein product [Vitis vinifera]
Length=897

 Score = 98.2 bits (243),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 88/146 (60%), Gaps = 10/146 (7%)
 Frame = +3

Query  51   MAINFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKE-IEILKEQTRATLLIPTG  227
            M+ +    + RPV +F  ++W    F  ++ D+++  AY ++ +E LKE+ +  L++  G
Sbjct  1    MSSHLSAEVKRPVVSFRSSIWGNR-FINYTPDDEITRAYNQQRVEDLKEEVKRELMVAAG  59

Query  228  SCSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVH----LNDLETVALQFRLM  395
              S    Q L FID ++RLG+AYHFE+EI++ + HIY +  H     +DL  V+L+FRL+
Sbjct  60   KPS----QHLNFIDAVQRLGMAYHFEEEIEEAIGHIYDNYHHSDDKYDDLCNVSLRFRLL  115

Query  396  RQHGYNISTHIFSNFVDGNESSETAL  473
            RQ GYNIS  IF  F D N S +  L
Sbjct  116  RQQGYNISCDIFERFKDENGSFKECL  141


 Score = 78.2 bits (191),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 70/112 (63%), Gaps = 5/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            ++DV+G+L LYEA+++R + +D +L+   AF    L S   +L  +  L    T AL +P
Sbjct  142  NNDVEGMLGLYEAAHLRVQEED-ILDEALAFTTAHLESLVEDL--DYPLAAQATQALYRP  198

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
               GL R+E R  IS+YQ  DE+S +  LL  A LDFNLLQ L+K+ELS ++
Sbjct  199  IRKGLERLEARPHISIYQ--DEASHSKALLELAKLDFNLLQSLYKKELSYIT  248


 Score = 78.2 bits (191),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 70/110 (64%), Gaps = 5/110 (5%)
 Frame = +2

Query  473  DVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQPFH  652
            DV+G+L LYEA+++R + +D +L+   AF  T LRS   +L  +  L   V  AL +P  
Sbjct  708  DVEGMLGLYEAAHLRVQEED-ILDEAIAFTTTHLRSLVEHL--DCPLAAPVNRALYRPIR  764

Query  653  TGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
              L R+E R +I++YQ  DE+S + +LL  A LDFN LQ L+K+ELS ++
Sbjct  765  KCLERLEARPYITMYQ--DEASHSKDLLELAKLDFNQLQSLYKKELSHIT  812


 Score = 52.0 bits (123),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 52/110 (47%), Gaps = 30/110 (27%)
 Frame = +3

Query  150  QVAEAYAKE-IEILKEQTRATLLIPTGSCSDDVAQKLKFIDLLERLGIAYHFEKEIDDQL  326
            Q+  AY ++ IE LKE+ R  L+   G  S    Q+L FID ++RLG+AYHFE+EI++ L
Sbjct  626  QITLAYNQQRIEDLKEEVRRELMAAAGKPS----QQLNFIDAVQRLGVAYHFEEEIEEAL  681

Query  327  RHIYIHPVHLNDLETVALQFRLMRQHGYNISTHIFSNFVDGNESSETALM  476
                                       +NIS   F  F D N S +  L+
Sbjct  682  GR-------------------------FNISCDTFKRFTDENGSFKECLI  706



>emb|CBI31312.3| unnamed protein product [Vitis vinifera]
Length=310

 Score = 89.7 bits (221),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 77/127 (61%), Gaps = 10/127 (8%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEA-YAKEIEILKEQTRATLLIPTGSCSDDVAQKL  257
            RPV NF P +W    F  ++ +++V  A   ++IE LK++ +  L   T + S      L
Sbjct  19   RPVTNFHPNIWGDQ-FITYTPEDKVTRACKVEQIEDLKKEVKRKLTAATANHS----LLL  73

Query  258  KFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLE----TVALQFRLMRQHGYNISTH  425
             FID ++RLG+AYHFE+EI++ L+HIY     LND++     VAL FRL+RQ GY+IS  
Sbjct  74   NFIDAVQRLGVAYHFEQEIEEALQHIYESFHDLNDIDGDLYNVALGFRLLRQQGYSISCG  133

Query  426  IFSNFVD  446
            IF  F D
Sbjct  134  IFKKFTD  140


 Score = 86.7 bits (213),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 73/111 (66%), Gaps = 5/111 (5%)
 Frame = +2

Query  470  SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQPF  649
            ++V+GLL LYEA+++R   +D + E +T F  T L++   +L     L + V HAL++P 
Sbjct  151  TNVRGLLGLYEAAHLRVHGEDILAEALT-FTTTHLKAMVESL--GYPLAEQVVHALNRPI  207

Query  650  HTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
              GL R+E R++ISVYQ  DE+  +  LL  A LDFNL+Q LH++ELS ++
Sbjct  208  RKGLERIEARWYISVYQ--DEAFHDKTLLELAKLDFNLVQSLHREELSNLA  256



>ref|XP_004309077.1| PREDICTED: (-)-germacrene D synthase-like [Fragaria vesca subsp. 
vesca]
Length=384

 Score = 95.1 bits (235),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 72/111 (65%), Gaps = 5/111 (5%)
 Frame = +2

Query  470  SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQPF  649
            SDV GLLSLYEA+++R   + E+ E   AF  T L S   +L P   L  LV+H+L+QP 
Sbjct  204  SDVSGLLSLYEATHLRVHGE-EIFEEALAFTTTHLESIKHSLSP--PLSNLVSHSLNQPL  260

Query  650  HTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
             TG+ RVE R ++S+YQ+ D  S N  LL  A LDFN +Q LH++EL E++
Sbjct  261  RTGVARVEARHYLSIYQDCD--SHNETLLTLAKLDFNSVQQLHQKELCEIT  309


 Score = 80.9 bits (198),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 76/129 (59%), Gaps = 8/129 (6%)
 Frame = +3

Query  75   LPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQK  254
            LP     + P +W  + F ++S   +V     + +  LKE+ +  +L+   + S   +Q+
Sbjct  71   LPPAYYEYAPCIWNDH-FLSYST-TEVDIKLEQHVRELKEKVKR-ILMDLANVSG--SQQ  125

Query  255  LKFIDLLERLGIAYHFEKEIDD---QLRHIYIHPVHLNDLETVALQFRLMRQHGYNISTH  425
            +  ++ L+RLG+AYHFE EID+   Q+ H Y      +DL T AL+FRL+RQHGYNIS  
Sbjct  126  IDLVNDLQRLGVAYHFENEIDEILKQIHHNYSCGTDDDDLYTTALRFRLLRQHGYNISCD  185

Query  426  IFSNFVDGN  452
            IF+ F DGN
Sbjct  186  IFNKFKDGN  194



>dbj|BAJ53221.1| JHL17M24.6 [Jatropha curcas]
Length=555

 Score = 90.5 bits (223),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 70/110 (64%), Gaps = 3/110 (3%)
 Frame = +2

Query  470  SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQPF  649
            +DVKG+LSLYEAS+V    +D +L+   AF    L S          L + + +AL  PF
Sbjct  147  NDVKGILSLYEASFVSVHGED-ILDEALAFTKPILESLLAMQSIPHHLAQNIRNALIFPF  205

Query  650  HTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEV  799
            H G+PRVE R +IS Y EEDES RN  LL FA LDFN +Q+LHKQEL E+
Sbjct  206  HKGVPRVEARQYISFY-EEDES-RNETLLEFAKLDFNRVQLLHKQELGEL  253


 Score = 85.5 bits (210),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 69/121 (57%), Gaps = 9/121 (7%)
 Frame = +3

Query  87   VDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLKFI  266
            V NFPP LW    F +FS  N   E Y K++E LK++ R  L+        ++ Q ++ I
Sbjct  16   VPNFPPALWGYNSFASFSFPNSEYELYTKKVESLKKKVRCILM----DSVKNLVQNIELI  71

Query  267  DLLERLGIAYHFEKEIDDQLRHIY-IHPVHLN----DLETVALQFRLMRQHGYNISTHIF  431
              L RL ++YHFE EI +QL H + +    L+    DL  +AL FR++RQHGY +S  +F
Sbjct  72   STLCRLAVSYHFEMEIQEQLSHAFNVVSNFLDDNDCDLYDIALLFRVLRQHGYKMSCDVF  131

Query  432  S  434
            +
Sbjct  132  N  132



>ref|XP_006367763.1| PREDICTED: germacrene C synthase-like, partial [Solanum tuberosum]
Length=596

 Score =   101 bits (251),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 75/110 (68%), Gaps = 4/110 (4%)
 Frame = +2

Query  473  DVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQPFH  652
            DV+GLLSLYEAS++R   D+E+LE    F  TRL S  PNL  NS L+  VT AL QP H
Sbjct  189  DVQGLLSLYEASHMRMH-DEEILEEALIFTTTRLESLLPNLTNNS-LKIQVTEALSQPIH  246

Query  653  TGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
              +PRV  R +I +Y  E+  S N+ LL+FA LDFN+LQ +H+ EL+E+S
Sbjct  247  ETVPRVGARKYIHIY--ENIKSHNDLLLKFAKLDFNMLQKVHQDELNEIS  294


 Score = 74.7 bits (182),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 74/136 (54%), Gaps = 8/136 (6%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            R + +F PTLW  +         +++     E++ LK   R TL+       D+  QKL 
Sbjct  55   RHLADFEPTLWGDHFLSYTPQQTEISSQEKVEVDELKVMIRKTLV----ETPDNSTQKLV  110

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIHPVHL----NDLETVALQFRLMRQHGYNISTHI  428
             ID ++RLG+AYHF  EI+  +++I+   +      ++L  VAL+FRL+RQ  + IS+ +
Sbjct  111  LIDRIQRLGVAYHFHNEIEISIKNIFDSQLQSETNDDNLHVVALRFRLLRQQRHYISSDV  170

Query  429  FSNFVDGNESSETALM  476
            F  F+D N + +  L+
Sbjct  171  FKQFMDHNGNFKETLI  186



>ref|XP_006494712.1| PREDICTED: (-)-germacrene D synthase-like isoform X1 [Citrus 
sinensis]
Length=574

 Score = 96.7 bits (239),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 79/125 (63%), Gaps = 13/125 (10%)
 Frame = +2

Query  455  KFRD---------SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNS  607
            KFRD         ++D KGLL LYEASY+R + ++ +LE    F+   L+S   +L  ++
Sbjct  146  KFRDEKGEFKAMLTNDAKGLLCLYEASYLRVQGEN-ILEEACEFSRKHLKSLLSHL--ST  202

Query  608  TLEKLVTHALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQE  787
             L   V H+L+ P H G+PR+E R +IS+Y E D S+RN  +L  A LDFNLLQ LH+ E
Sbjct  203  PLADQVEHSLEIPLHRGMPRLEARQYISIY-EADNSTRNELILELAKLDFNLLQALHRIE  261

Query  788  LSEVS  802
            LSE+S
Sbjct  262  LSEIS  266


 Score = 79.0 bits (193),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 67/131 (51%), Gaps = 10/131 (8%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            R   N+ P++W  +  +  S +        K  E LK +    LL+   +    + + + 
Sbjct  20   RRSSNYHPSIWGDHFINVSSNEKYTNTEVEKRFETLKAEIE-KLLVSNNTAWKTLEEIVA  78

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIHPV---------HLNDLETVALQFRLMRQHGYN  413
             ++ L+RLG+AYHFE EI + L+ IY   V         H NDL  VAL+FRL+RQHGY 
Sbjct  79   IVNQLQRLGVAYHFENEIKEALQTIYDSHVNGNCDVNYDHNNDLYIVALRFRLLRQHGYK  138

Query  414  ISTHIFSNFVD  446
            +S  IF  F D
Sbjct  139  VSADIFKKFRD  149



>gb|KDO38267.1| hypothetical protein CISIN_1g008206mg [Citrus sinensis]
Length=361

 Score = 96.3 bits (238),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 79/125 (63%), Gaps = 13/125 (10%)
 Frame = +2

Query  455  KFRD---------SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNS  607
            KFRD         ++D KGLL LYEASY+R + ++ +LE    F+   L+S   +L  ++
Sbjct  146  KFRDEKGEFKAMLTNDAKGLLCLYEASYLRVQGEN-ILEEACEFSRKHLKSLLSHL--ST  202

Query  608  TLEKLVTHALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQE  787
             L   V H+L+ P H G+PR+E R +IS+Y E D S+RN  +L  A LDFNLLQ LH+ E
Sbjct  203  PLVDQVEHSLEIPLHRGMPRLEARQYISIY-EADNSTRNELILELAKLDFNLLQALHRIE  261

Query  788  LSEVS  802
            LSE+S
Sbjct  262  LSEIS  266


 Score = 79.3 bits (194),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 67/131 (51%), Gaps = 10/131 (8%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            R   N+ P++W  +  +  S +        K  E LK +    LL+   +    + + + 
Sbjct  20   RRSSNYHPSIWGDHFINVSSNEKYTNTEVEKRFETLKAEIEK-LLVSNNTAWKTLEEIVA  78

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIHPV---------HLNDLETVALQFRLMRQHGYN  413
             ++ L+RLG+AYHFE EI + L+ IY   V         H NDL  VAL+FRL+RQHGY 
Sbjct  79   IVNQLQRLGVAYHFENEIKEALQTIYDSHVNGNCDVNYDHNNDLYIVALRFRLLRQHGYK  138

Query  414  ISTHIFSNFVD  446
            +S  IF  F D
Sbjct  139  VSADIFKKFRD  149



>ref|XP_006494713.1| PREDICTED: (-)-germacrene D synthase-like isoform X2 [Citrus 
sinensis]
Length=567

 Score = 97.1 bits (240),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 79/125 (63%), Gaps = 13/125 (10%)
 Frame = +2

Query  455  KFRD---------SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNS  607
            KFRD         ++D KGLL LYEASY+R + ++ +LE    F+   L+S   +L  ++
Sbjct  146  KFRDEKGEFKAMLTNDAKGLLCLYEASYLRVQGEN-ILEEACEFSRKHLKSLLSHL--ST  202

Query  608  TLEKLVTHALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQE  787
             L   V H+L+ P H G+PR+E R +IS+Y E D S+RN  +L  A LDFNLLQ LH+ E
Sbjct  203  PLADQVEHSLEIPLHRGMPRLEARQYISIY-EADNSTRNELILELAKLDFNLLQALHRIE  261

Query  788  LSEVS  802
            LSE+S
Sbjct  262  LSEIS  266


 Score = 78.6 bits (192),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 67/131 (51%), Gaps = 10/131 (8%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            R   N+ P++W  +  +  S +        K  E LK +    LL+   +    + + + 
Sbjct  20   RRSSNYHPSIWGDHFINVSSNEKYTNTEVEKRFETLKAEIE-KLLVSNNTAWKTLEEIVA  78

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIHPV---------HLNDLETVALQFRLMRQHGYN  413
             ++ L+RLG+AYHFE EI + L+ IY   V         H NDL  VAL+FRL+RQHGY 
Sbjct  79   IVNQLQRLGVAYHFENEIKEALQTIYDSHVNGNCDVNYDHNNDLYIVALRFRLLRQHGYK  138

Query  414  ISTHIFSNFVD  446
            +S  IF  F D
Sbjct  139  VSADIFKKFRD  149



>ref|XP_008366140.1| PREDICTED: putative pinene synthase [Malus domestica]
Length=454

 Score = 94.0 bits (232),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 77/139 (55%), Gaps = 7/139 (5%)
 Frame = +3

Query  48   IMAINFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTG  227
            +++ N +  + RP  NFPP++W     +  S D        +EI+ LKE  R+ +     
Sbjct  9    VLSTNAKPEIVRPTANFPPSIWGDRFINYDSQDITTHARKKQEIDELKEVVRSEVFKIMA  68

Query  228  SCSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYI----HPVHLNDLETVALQFRLM  395
            S   D + +LK ID ++RLG+AYHF  EI++ L  ++     H     DL  VAL FRL+
Sbjct  69   S---DFSHQLKLIDAIQRLGVAYHFASEIEETLERMHGTFNDHEDVGGDLHIVALGFRLL  125

Query  396  RQHGYNISTHIFSNFVDGN  452
            RQHGYN+S  IF+ F D N
Sbjct  126  RQHGYNVSCDIFNKFKDAN  144


 Score = 81.3 bits (199),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 71/112 (63%), Gaps = 4/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            ++D+ G+LSLYEA+++  R +D +L+    F  T L SA+     +  L +  T AL++P
Sbjct  152  TADIPGMLSLYEAAHLGVRGED-ILDEALVFTTTHLESASTT-NVSYQLAEQTTQALERP  209

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
                L RV  R  +S+YQ  DE++ N  LL+ A LDFNL+Q LHK+ELSE++
Sbjct  210  LQKDLERVCARRHMSIYQ--DEAAHNEALLKLAKLDFNLVQSLHKKELSEIT  259



>gb|KDO38265.1| hypothetical protein CISIN_1g008206mg [Citrus sinensis]
Length=511

 Score = 96.7 bits (239),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 79/125 (63%), Gaps = 13/125 (10%)
 Frame = +2

Query  455  KFRD---------SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNS  607
            KFRD         ++D KGLL LYEASY+R + ++ +LE    F+   L+S   +L  ++
Sbjct  146  KFRDEKGEFKAMLTNDAKGLLCLYEASYLRVQGEN-ILEEACEFSRKHLKSLLSHL--ST  202

Query  608  TLEKLVTHALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQE  787
             L   V H+L+ P H G+PR+E R +IS+Y E D S+RN  +L  A LDFNLLQ LH+ E
Sbjct  203  PLVDQVEHSLEIPLHRGMPRLEARQYISIY-EADNSTRNELILELAKLDFNLLQALHRIE  261

Query  788  LSEVS  802
            LSE+S
Sbjct  262  LSEIS  266


 Score = 79.0 bits (193),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 67/131 (51%), Gaps = 10/131 (8%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            R   N+ P++W  +  +  S +        K  E LK +    LL+   +    + + + 
Sbjct  20   RRSSNYHPSIWGDHFINVSSNEKYTNTEVEKRFETLKAEIE-KLLVSNNTAWKTLEEIVA  78

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIHPV---------HLNDLETVALQFRLMRQHGYN  413
             ++ L+RLG+AYHFE EI + L+ IY   V         H NDL  VAL+FRL+RQHGY 
Sbjct  79   IVNQLQRLGVAYHFENEIKEALQTIYDSHVNGNCDVNYDHNNDLYIVALRFRLLRQHGYK  138

Query  414  ISTHIFSNFVD  446
            +S  IF  F D
Sbjct  139  VSADIFKKFRD  149



>gb|KDO38268.1| hypothetical protein CISIN_1g008206mg [Citrus sinensis]
Length=347

 Score = 95.9 bits (237),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 79/125 (63%), Gaps = 13/125 (10%)
 Frame = +2

Query  455  KFRD---------SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNS  607
            KFRD         ++D KGLL LYEASY+R + ++ +LE    F+   L+S   +L  ++
Sbjct  146  KFRDEKGEFKAMLTNDAKGLLCLYEASYLRVQGEN-ILEEACEFSRKHLKSLLSHL--ST  202

Query  608  TLEKLVTHALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQE  787
             L   V H+L+ P H G+PR+E R +IS+Y E D S+RN  +L  A LDFNLLQ LH+ E
Sbjct  203  PLVDQVEHSLEIPLHRGMPRLEARQYISIY-EADNSTRNELILELAKLDFNLLQALHRIE  261

Query  788  LSEVS  802
            LSE+S
Sbjct  262  LSEIS  266


 Score = 79.3 bits (194),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 67/131 (51%), Gaps = 10/131 (8%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            R   N+ P++W  +  +  S +        K  E LK +    LL+   +    + + + 
Sbjct  20   RRSSNYHPSIWGDHFINVSSNEKYTNTEVEKRFETLKAEIEK-LLVSNNTAWKTLEEIVA  78

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIHPV---------HLNDLETVALQFRLMRQHGYN  413
             ++ L+RLG+AYHFE EI + L+ IY   V         H NDL  VAL+FRL+RQHGY 
Sbjct  79   IVNQLQRLGVAYHFENEIKEALQTIYDSHVNGNCDVNYDHNNDLYIVALRFRLLRQHGYK  138

Query  414  ISTHIFSNFVD  446
            +S  IF  F D
Sbjct  139  VSADIFKKFRD  149



>gb|KDO38266.1| hypothetical protein CISIN_1g008206mg [Citrus sinensis]
Length=471

 Score = 96.3 bits (238),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 79/125 (63%), Gaps = 13/125 (10%)
 Frame = +2

Query  455  KFRD---------SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNS  607
            KFRD         ++D KGLL LYEASY+R + ++ +LE    F+   L+S   +L  ++
Sbjct  146  KFRDEKGEFKAMLTNDAKGLLCLYEASYLRVQGEN-ILEEACEFSRKHLKSLLSHL--ST  202

Query  608  TLEKLVTHALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQE  787
             L   V H+L+ P H G+PR+E R +IS+Y E D S+RN  +L  A LDFNLLQ LH+ E
Sbjct  203  PLVDQVEHSLEIPLHRGMPRLEARQYISIY-EADNSTRNELILELAKLDFNLLQALHRIE  261

Query  788  LSEVS  802
            LSE+S
Sbjct  262  LSEIS  266


 Score = 79.0 bits (193),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 67/131 (51%), Gaps = 10/131 (8%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            R   N+ P++W  +  +  S +        K  E LK +    LL+   +    + + + 
Sbjct  20   RRSSNYHPSIWGDHFINVSSNEKYTNTEVEKRFETLKAEIE-KLLVSNNTAWKTLEEIVA  78

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIHPV---------HLNDLETVALQFRLMRQHGYN  413
             ++ L+RLG+AYHFE EI + L+ IY   V         H NDL  VAL+FRL+RQHGY 
Sbjct  79   IVNQLQRLGVAYHFENEIKEALQTIYDSHVNGNCDVNYDHNNDLYIVALRFRLLRQHGYK  138

Query  414  ISTHIFSNFVD  446
            +S  IF  F D
Sbjct  139  VSADIFKKFRD  149



>emb|CBI31305.3| unnamed protein product [Vitis vinifera]
Length=645

 Score = 88.2 bits (217),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 76/127 (60%), Gaps = 10/127 (8%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEA-YAKEIEILKEQTRATLLIPTGSCSDDVAQKL  257
            RPV NF P +W    F  ++ +++V  A   ++IE LK++ +  L   T + S      L
Sbjct  109  RPVTNFHPNIWGDQ-FITYTPEDKVTRACKVEQIEDLKKEVKRKLTAATANHS----LLL  163

Query  258  KFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLE----TVALQFRLMRQHGYNISTH  425
             FID ++RLG+AYHFE+EI++ L+HIY     LND++     VAL FRL+RQ GY+IS  
Sbjct  164  NFIDAVQRLGVAYHFEQEIEEALQHIYESFHDLNDIDGDLYNVALGFRLLRQQGYSISCG  223

Query  426  IFSNFVD  446
            I   F D
Sbjct  224  ILKKFTD  230


 Score = 87.0 bits (214),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 73/111 (66%), Gaps = 5/111 (5%)
 Frame = +2

Query  470  SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQPF  649
            ++V+GLL LYEA+++R   +D + E +T F  T L++   +L     L + V HAL++P 
Sbjct  241  TNVRGLLGLYEAAHLRVHGEDILAEALT-FTTTHLKAMVESL--GYPLAEQVVHALNRPI  297

Query  650  HTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
              GL R+E R++ISVYQ  DE+  +  LL  A LDFNL+Q LH++ELS ++
Sbjct  298  RKGLERIEARWYISVYQ--DEAFHDKTLLELAKLDFNLVQSLHREELSNLA  346



>gb|KDO38264.1| hypothetical protein CISIN_1g008206mg [Citrus sinensis]
Length=567

 Score = 96.3 bits (238),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 79/125 (63%), Gaps = 13/125 (10%)
 Frame = +2

Query  455  KFRD---------SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNS  607
            KFRD         ++D KGLL LYEASY+R + ++ +LE    F+   L+S   +L  ++
Sbjct  146  KFRDEKGEFKAMLTNDAKGLLCLYEASYLRVQGEN-ILEEACEFSRKHLKSLLSHL--ST  202

Query  608  TLEKLVTHALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQE  787
             L   V H+L+ P H G+PR+E R +IS+Y E D S+RN  +L  A LDFNLLQ LH+ E
Sbjct  203  PLVDQVEHSLEIPLHRGMPRLEARQYISIY-EADNSTRNELILELAKLDFNLLQALHRIE  261

Query  788  LSEVS  802
            LSE+S
Sbjct  262  LSEIS  266


 Score = 78.6 bits (192),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 67/131 (51%), Gaps = 10/131 (8%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            R   N+ P++W  +  +  S +        K  E LK +    LL+   +    + + + 
Sbjct  20   RRSSNYHPSIWGDHFINVSSNEKYTNTEVEKRFETLKAEIE-KLLVSNNTAWKTLEEIVA  78

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIHPV---------HLNDLETVALQFRLMRQHGYN  413
             ++ L+RLG+AYHFE EI + L+ IY   V         H NDL  VAL+FRL+RQHGY 
Sbjct  79   IVNQLQRLGVAYHFENEIKEALQTIYDSHVNGNCDVNYDHNNDLYIVALRFRLLRQHGYK  138

Query  414  ISTHIFSNFVD  446
            +S  IF  F D
Sbjct  139  VSADIFKKFRD  149



>ref|NP_001268024.1| valencene synthase-like [Vitis vinifera]
 gb|ADR74197.1| germacrene D synthase [Vitis vinifera]
Length=584

 Score = 87.8 bits (216),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 76/127 (60%), Gaps = 10/127 (8%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEA-YAKEIEILKEQTRATLLIPTGSCSDDVAQKL  257
            RPV NF P +W    F  ++ +++V  A   ++IE LK++ +  L   T + S      L
Sbjct  48   RPVTNFHPNIWGDQ-FITYTPEDKVTRACKVEQIEDLKKEVKRKLTAATANHS----LLL  102

Query  258  KFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLE----TVALQFRLMRQHGYNISTH  425
             FID ++RLG+AYHFE+EI++ L+HIY     LND++     VAL FRL+RQ GY+IS  
Sbjct  103  NFIDAVQRLGVAYHFEQEIEEALQHIYESFHDLNDIDGDLYNVALGFRLLRQQGYSISCG  162

Query  426  IFSNFVD  446
            I   F D
Sbjct  163  ILKKFTD  169


 Score = 87.0 bits (214),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 73/111 (66%), Gaps = 5/111 (5%)
 Frame = +2

Query  470  SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQPF  649
            ++V+GLL LYEA+++R   +D + E +T F  T L++   +L     L + V HAL++P 
Sbjct  180  TNVRGLLGLYEAAHLRVHGEDILAEALT-FTTTHLKAMVESL--GYPLAEQVVHALNRPI  236

Query  650  HTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
              GL R+E R++ISVYQ  DE+  +  LL  A LDFNL+Q LH++ELS ++
Sbjct  237  RKGLERIEARWYISVYQ--DEAFHDKTLLELAKLDFNLVQSLHREELSNLA  285



>gb|AAG09950.1|AF171218_1 vetispiradiene synthase [Solanum lycopersicum]
Length=453

 Score =   126 bits (317),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 88/118 (75%), Gaps = 7/118 (6%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S   D++G+L+LYEAS+VRT  +D  LE   AF+   L SAAP+LK  S L K VT
Sbjct  41   KFKESLCDDIRGILNLYEASHVRTHGED-TLEEALAFSTAHLESAAPHLK--SPLSKQVT  97

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+Q  H  +PRVE R+FIS+Y+EE+   +N+  LRFA LDFNLLQMLHKQELSEVS
Sbjct  98   HALEQSLHKSIPRVETRYFISIYEEEE--LKNDVFLRFAKLDFNLLQMLHKQELSEVS  153


 Score = 48.1 bits (113),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +3

Query  357  NDLETVALQFRLMRQHGYNISTHIFSNFVDGNESSETAL  473
            NDL T++LQFR++RQHGY IS  IFS F D N   + +L
Sbjct  8    NDLCTLSLQFRILRQHGYYISPKIFSRFQDANGKFKESL  46



>gb|KDO38263.1| hypothetical protein CISIN_1g008206mg [Citrus sinensis]
Length=574

 Score = 96.3 bits (238),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 79/125 (63%), Gaps = 13/125 (10%)
 Frame = +2

Query  455  KFRD---------SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNS  607
            KFRD         ++D KGLL LYEASY+R + ++ +LE    F+   L+S   +L  ++
Sbjct  146  KFRDEKGEFKAMLTNDAKGLLCLYEASYLRVQGEN-ILEEACEFSRKHLKSLLSHL--ST  202

Query  608  TLEKLVTHALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQE  787
             L   V H+L+ P H G+PR+E R +IS+Y E D S+RN  +L  A LDFNLLQ LH+ E
Sbjct  203  PLVDQVEHSLEIPLHRGMPRLEARQYISIY-EADNSTRNELILELAKLDFNLLQALHRIE  261

Query  788  LSEVS  802
            LSE+S
Sbjct  262  LSEIS  266


 Score = 78.6 bits (192),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 67/131 (51%), Gaps = 10/131 (8%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            R   N+ P++W  +  +  S +        K  E LK +    LL+   +    + + + 
Sbjct  20   RRSSNYHPSIWGDHFINVSSNEKYTNTEVEKRFETLKAEIE-KLLVSNNTAWKTLEEIVA  78

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIHPV---------HLNDLETVALQFRLMRQHGYN  413
             ++ L+RLG+AYHFE EI + L+ IY   V         H NDL  VAL+FRL+RQHGY 
Sbjct  79   IVNQLQRLGVAYHFENEIKEALQTIYDSHVNGNCDVNYDHNNDLYIVALRFRLLRQHGYK  138

Query  414  ISTHIFSNFVD  446
            +S  IF  F D
Sbjct  139  VSADIFKKFRD  149



>emb|CBI31310.3| unnamed protein product [Vitis vinifera]
Length=337

 Score = 90.5 bits (223),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 78/127 (61%), Gaps = 10/127 (8%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEA-YAKEIEILKEQTRATLLIPTGSCSDDVAQKL  257
            RPV NF P +W    F  ++ +++V  A   ++IE LK++ +  L   T + S    Q L
Sbjct  75   RPVANFHPNIWGDQ-FITYTPEDKVTRACKVEQIEDLKKEVKRKLTAATANRS----QLL  129

Query  258  KFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLE----TVALQFRLMRQHGYNISTH  425
             FID ++RLG+AY+FE+EI++ L+HIY     LND++     VAL FRL+RQ GY+IS  
Sbjct  130  NFIDAVQRLGVAYNFEQEIEEALQHIYNSFHDLNDIDGDLYNVALGFRLLRQQGYSISCD  189

Query  426  IFSNFVD  446
            IF  F D
Sbjct  190  IFKKFTD  196


 Score = 84.3 bits (207),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 72/111 (65%), Gaps = 5/111 (5%)
 Frame = +2

Query  470  SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQPF  649
            ++V+G+L LYEA+++R   +D +L    AF  T L++   +L     L + V HAL++P 
Sbjct  207  TNVRGMLGLYEAAHLRVHGED-ILAEALAFTTTHLKAMVESL--GYPLAEQVAHALNRPI  263

Query  650  HTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
              GL R+E R++IS+YQ  DE+  +  LL  A LDFNL+Q LH++ELS ++
Sbjct  264  RKGLERLEARWYISIYQ--DEAFHDKTLLELAKLDFNLVQSLHREELSNLA  312



>ref|XP_011080335.1| PREDICTED: gamma-cadinene synthase-like [Sesamum indicum]
Length=544

 Score = 97.1 bits (240),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 86/135 (64%), Gaps = 11/135 (8%)
 Frame = +3

Query  81   RP-VDNFPPTLWARYCFHAFSID-NQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQK  254
            RP + +  PT+WA   F + S D N+V E YA++IE  KE+ R ++L   GS + D   +
Sbjct  4    RPTIGSSAPTMWAD-TFTSLSADMNKVQEKYAQDIEAPKEEAR-SMLTAKGSRTAD---R  58

Query  255  LKFIDLLERLGIAYHFEKEIDDQLRHIY-IHPVHLN--DLETVALQFRLMRQHGYNISTH  425
            L  ID LERLG+AYHFE+EI+DQL+ I+  HP   N  DL T ALQFRL+RQH + +S  
Sbjct  59   LILIDTLERLGVAYHFEQEIEDQLQEIFQFHPKDENHYDLFTTALQFRLLRQHRHFVSCS  118

Query  426  IFSNF-VDGNESSET  467
            +F  F  + N+  ET
Sbjct  119  VFDKFKSEDNKFKET  133


 Score = 77.4 bits (189),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 71/118 (60%), Gaps = 7/118 (6%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF+++  +D KGLLSLYEA+ +R   +  +LE   AF    L+     L+    L+  V 
Sbjct  129  KFKETLKNDGKGLLSLYEAAQLRIHGE-AILEEAVAFTTHHLKRMLQQLE--CPLQDQVK  185

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
             AL    H G+PR+E R FIS Y+ +D  S+N  LL+ A LDFN LQ ++K+EL +++
Sbjct  186  RALQHSLHRGVPRIETRHFISFYERDD--SKNQLLLKLAKLDFNYLQNVYKKELHDLT  241



>ref|XP_004294317.1| PREDICTED: (-)-germacrene D synthase-like [Fragaria vesca subsp. 
vesca]
Length=552

 Score = 92.4 bits (228),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 77/118 (65%), Gaps = 7/118 (6%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  +DV GLLSLYEA+++    +D +LE    FA T L SA  +L  +S L K V 
Sbjct  140  KFKESLVNDVVGLLSLYEATHLMMHGED-ILEEALTFATTHLESAMHSL--SSLLLKQVK  196

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL QP+  GLPR+E   ++S+Y E D  S N  LL  A LDFNL+Q +H+ ELS+++
Sbjct  197  HALYQPYWKGLPRIEAVHYLSIYGEMD--SHNKALLSLAKLDFNLVQNVHQNELSDIA  252


 Score = 82.0 bits (201),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 74/137 (54%), Gaps = 11/137 (8%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            R   NF   +W        S++N       ++++ LKE+ R  L+ P       ++QKL+
Sbjct  16   RGSANFSDGVWGDLFLSHASLENDTKTE--QQVQELKEEVRTMLMSPVKK----ISQKLE  69

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLET-----VALQFRLMRQHGYNISTH  425
             ID + RLG++ HFE+E D+ L+ +Y +  H NDL        +L FRL+RQ GYNIS  
Sbjct  70   LIDDITRLGVSRHFEEETDEILQKVYDNVYHANDLYDKELYFTSLVFRLVRQQGYNISCE  129

Query  426  IFSNFVDGNESSETALM  476
            IFS F +G    + +L+
Sbjct  130  IFSKFKNGEGKFKESLV  146



>gb|EYU31464.1| hypothetical protein MIMGU_mgv1a003909mg [Erythranthe guttata]
Length=555

 Score = 95.9 bits (237),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 77/131 (59%), Gaps = 7/131 (5%)
 Frame = +3

Query  84   PVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLKF  263
            PV  F P++W  + F +FS+D+QV E Y K IE +K++ R+ L+  T          L  
Sbjct  23   PVTIFKPSMWG-HTFASFSLDHQVQETYEKTIEAIKKKVRSILMAKTSG-----KPILIL  76

Query  264  IDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNISTHIFSNFV  443
            +D L RLG+AYHFE EI+++L  IY       DL T AL+FRL+RQH + +S  +F  F 
Sbjct  77   VDTLVRLGLAYHFETEIEEKLEQIYKEDEEF-DLFTTALRFRLLRQHRHQVSCSVFDKFT  135

Query  444  DGNESSETALM  476
            + +   E +L+
Sbjct  136  NKDNKLEESLI  146


 Score = 79.0 bits (193),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 71/111 (64%), Gaps = 5/111 (5%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
             +DV+GLLSLYEA++VR R +D +LE    F    L     +L+  S L+  V  AL   
Sbjct  147  GNDVEGLLSLYEAAHVRIRGED-ILEEAVPFTKHHLTRHMLSLE--SPLKDKVKRALVHS  203

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEV  799
             H G+P +E R +IS+Y+++D  SR+  +L+ A L+FN LQ ++K+ELSE+
Sbjct  204  LHRGVPIIEARVYISIYEKDD--SRDEIILKLAKLNFNYLQNMYKEELSEL  252



>ref|XP_002523635.1| (+)-delta-cadinene synthase isozyme A, putative [Ricinus communis]
 sp|B9SCB6.1|TPS2_RICCO RecName: Full=Probable terpene synthase 2; Short=RcSeTPS2 [Ricinus 
communis]
 gb|EEF38721.1| (+)-delta-cadinene synthase isozyme A, putative [Ricinus communis]
Length=550

 Score = 92.4 bits (228),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 73/125 (58%), Gaps = 14/125 (11%)
 Frame = +2

Query  455  KFRD---------SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNS  607
            KFRD          +D++G+LSLYEA++ R   +  +L+   AF  T L S  PNL P  
Sbjct  133  KFRDRNGHFIQTLKTDLQGMLSLYEAAHFRVHGEG-ILDDALAFTTTYLESIVPNLSP--  189

Query  608  TLEKLVTHALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQE  787
             L   ++  L QP    L RVE R FIS+YQE+  +S N  LL FA LDFNLLQ LH++E
Sbjct  190  PLAAQISRTLRQPLRKSLARVEARHFISIYQED--TSHNEVLLTFAKLDFNLLQKLHQKE  247

Query  788  LSEVS  802
            L  +S
Sbjct  248  LKYIS  252


 Score = 82.4 bits (202),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 44/138 (32%), Positives = 79/138 (57%), Gaps = 16/138 (12%)
 Frame = +3

Query  60   NFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSD  239
            N + +  R + +F P +W        +    + +   +++E LKE+ +  +     + +D
Sbjct  10   NLKPNTTRHLASFHPNIWGDRFLSCAAESTDIEDDMEQQVERLKEEVKKMI-----ASAD  64

Query  240  DVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLN-------DLETVALQFRLMR  398
            + +Q L  IDLL+RLG++YHFEKEI++ L+ +    +++N       DL +VAL+FRL+R
Sbjct  65   EPSQILNLIDLLQRLGVSYHFEKEIEEALQQV----LNMNSDSDKDDDLHSVALRFRLLR  120

Query  399  QHGYNISTHIFSNFVDGN  452
            + G N+S  +F+ F D N
Sbjct  121  EQGLNVSCDVFNKFRDRN  138



>ref|XP_006367561.1| PREDICTED: germacrene C synthase-like [Solanum tuberosum]
Length=549

 Score =   103 bits (256),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 85/127 (67%), Gaps = 5/127 (4%)
 Frame = +2

Query  428  FQQLC*RK*KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKP  601
            F++   +  KF+++  +DV+GLLSLYEAS++R R D+E+LE    F  T L S   NL  
Sbjct  124  FKKFTEQDGKFKETLTNDVQGLLSLYEASHLRVR-DEEILEEALTFTTTHLESIVSNLSN  182

Query  602  NSTLEKLVTHALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHK  781
            N++L+  VT AL QP    LPRV  + +IS+Y+  D  + N+ LL+FA LDFN+LQ  H+
Sbjct  183  NNSLKVEVTEALSQPIRMTLPRVGAKKYISIYENND--AHNHLLLKFAKLDFNMLQKFHQ  240

Query  782  QELSEVS  802
            +ELSE++
Sbjct  241  RELSELT  247


 Score = 71.6 bits (174),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 72/129 (56%), Gaps = 16/129 (12%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKE---IEILKEQTRATLL-IPTGSCSDDVA  248
            RP+ NF  T+W    +H  S   Q+ E   +E   ++  KE+ R  L+  P GS      
Sbjct  10   RPLANFHSTIWG---YHFLSYTPQLTETTNQEKVEVDEYKERIRKMLVEAPEGSL-----  61

Query  249  QKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLND---LETVALQFRLMRQHGYNIS  419
            QKL  ID ++RLG+AYHF+ +I+  +++I+      ND   L  V+L FRL+RQ G+ +S
Sbjct  62   QKLVLIDAMQRLGVAYHFDNQIETSIQNIF-DAFKQNDDDNLHVVSLYFRLVRQQGHYMS  120

Query  420  THIFSNFVD  446
            + +F  F +
Sbjct  121  SDVFKKFTE  129



>ref|XP_007099764.1| Terpene synthase 21, putative [Theobroma cacao]
 gb|EOY20530.1| Terpene synthase 21, putative [Theobroma cacao]
Length=586

 Score = 92.0 bits (227),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 78/118 (66%), Gaps = 7/118 (6%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S   D++G+LSLYEA+Y+R   +  +LE   AF   +L+  A    P+  L K + 
Sbjct  137  KFKESLVDDIRGMLSLYEAAYLRVHGE-LILEEAIAFTKAKLKPLAAKSSPH--LAKQIM  193

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            +ALD P +   PR+E R +IS Y+EE+  SRN  LL FA LDFN +Q+LH+QE+S+++
Sbjct  194  NALDNPLNKRPPRLEARNYISFYEEEE--SRNETLLTFAKLDFNRVQVLHRQEISQIA  249


 Score = 82.4 bits (202),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 50/139 (36%), Positives = 75/139 (54%), Gaps = 10/139 (7%)
 Frame = +3

Query  51   MAINFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGS  230
            M+   E H+ RPV NF   +W R  F +    + V ++  KEI  LKE+ +  L   T  
Sbjct  1    MSSKGECHVLRPVANFSKNIW-RDQFPSLPSSDSVFDSLTKEIIPLKEKVKEMLKASTA-  58

Query  231  CSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHL-----NDLETVALQFRLM  395
               D  + +KFID L RLG++YHFE +I+ QL  I+    +L      DL + ++ FR+ 
Sbjct  59   ---DPMENVKFIDTLLRLGVSYHFENDIEMQLERIFNSQENLFHKNDYDLNSTSIAFRVS  115

Query  396  RQHGYNISTHIFSNFVDGN  452
            R HG+ +S  +F  F DG+
Sbjct  116  RLHGFKMSCGVFEKFKDGS  134



>gb|ADR74199.1| gamma-cadinene synthase [Vitis vinifera]
Length=585

 Score = 89.7 bits (221),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 77/118 (65%), Gaps = 7/118 (6%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            +F+++  SDV+G+L LYEA+++R   +D +L    AF  T L++    L  +  L + V 
Sbjct  174  RFKEALISDVRGMLCLYEAAHLRVHGED-ILAKALAFTTTHLKAMVEGLGYH--LAEQVA  230

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL++P   GL R+E R++ISVYQ  DE+  +  LL  A LDFNL+Q LHK+ELS ++
Sbjct  231  HALNRPIRKGLERLEXRWYISVYQ--DEAFHDRTLLELAKLDFNLVQSLHKEELSNLA  286


 Score = 84.7 bits (208),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 82/137 (60%), Gaps = 9/137 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKE-IEILKEQTRATLLIPTGSCSDDVAQKL  257
            RPV N+ P +W    F ++  +++V  A  +E I  LK++ +  L   T +   + +Q L
Sbjct  48   RPVANYHPNIWGDQ-FISYIPEDKVTRACKEEQIVDLKKEVKRKL---TAAAVANPSQLL  103

Query  258  KFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLE----TVALQFRLMRQHGYNISTH  425
             FID ++RLG+AYHFE+EI++ L+HI       ND++     +AL FRL+RQ GY+IS  
Sbjct  104  NFIDAVQRLGVAYHFEQEIEEALQHICNSFHDCNDMDGDLYNIALGFRLLRQQGYSISCG  163

Query  426  IFSNFVDGNESSETALM  476
            IF+ F+D     + AL+
Sbjct  164  IFNKFMDERGRFKEALI  180



>ref|XP_007022718.1| Terpene synthase 21, putative [Theobroma cacao]
 gb|EOY14243.1| Terpene synthase 21, putative [Theobroma cacao]
Length=549

 Score = 91.7 bits (226),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 77/118 (65%), Gaps = 7/118 (6%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S   D++G+LSLYEA+Y+R   +  +LE   AF    L+  A    P+  L K + 
Sbjct  137  KFKESLVDDIRGMLSLYEAAYLRVHGE-LILEEAIAFTKANLKPLAAKSSPH--LAKQIM  193

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            +ALD P +   PR+E R +IS Y+EE+  SRN  LL FA LDFN +Q+LH+QE+S+++
Sbjct  194  NALDNPLNKCPPRLEARNYISFYEEEE--SRNETLLTFAKLDFNRVQVLHRQEISQIA  249


 Score = 82.4 bits (202),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 50/139 (36%), Positives = 75/139 (54%), Gaps = 10/139 (7%)
 Frame = +3

Query  51   MAINFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGS  230
            M+   E H+ RPV NF   +W R  F +    + V ++  KEI  LKE+ +  L   T  
Sbjct  1    MSSKGECHVLRPVANFSKNIW-RDQFPSLPSSDSVFDSLTKEIIPLKEKVKEMLKASTA-  58

Query  231  CSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHL-----NDLETVALQFRLM  395
               D  + +KFID L RLG++YHFE +I+ QL  I+    +L      DL + ++ FR+ 
Sbjct  59   ---DPMENVKFIDTLLRLGVSYHFENDIEMQLERIFNSQENLFHKDDYDLNSTSIAFRVS  115

Query  396  RQHGYNISTHIFSNFVDGN  452
            R HG+ +S  +F  F DG+
Sbjct  116  RLHGFKMSCGVFEKFKDGS  134



>gb|KDP31577.1| hypothetical protein JCGZ_14802 [Jatropha curcas]
Length=523

 Score = 97.8 bits (242),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 81/129 (63%), Gaps = 10/129 (8%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            R    F P++W  Y     S D+++   +++E E+LK++ R  L     S +D  +++LK
Sbjct  13   RRTAEFHPSVWGDYFIKHVS-DSEIVSFWSEEAEVLKKEVREML----SSAADKPSEQLK  67

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIHPVHL---NDLETVALQFRLMRQHGYNISTHIF  431
             ID ++RLGIAYHFE+EI+  L+ IY    +L   ++L TV L+FRL+RQ GYN+ST +F
Sbjct  68   LIDAIQRLGIAYHFEEEIETALKQIYTTYRNLKEDDNLYTVGLRFRLLRQEGYNVSTDVF  127

Query  432  SNFVD--GN  452
            + F D  GN
Sbjct  128  NKFKDSEGN  136


 Score = 76.3 bits (186),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 73/125 (58%), Gaps = 16/125 (13%)
 Frame = +2

Query  455  KFRDS---------SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNS  607
            KF+DS          DV+GLLSLYEASY+  + +  +L+    F  T L +     + +S
Sbjct  129  KFKDSEGNFKEYLIKDVQGLLSLYEASYLSIQGET-ILDEACEFTKTHLMAT----QLSS  183

Query  608  TLEKLVTHALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQE  787
             L   V+HAL  P   GLPR+E   + S+Y++ +E S    LL+ A LD+N++Q LH+++
Sbjct  184  PLAHQVSHALRWPVRRGLPRIEAWHYFSIYKQSEEHSET--LLKRAKLDYNIVQKLHQKD  241

Query  788  LSEVS  802
            +S ++
Sbjct  242  MSRIT  246



>gb|AAG01339.1| terpene synthase [Citrus junos]
Length=555

 Score = 88.2 bits (217),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 77/119 (65%), Gaps = 7/119 (6%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRS-AAPNLKPNSTLEKLV  625
            KF+ S   DV G+LSLYEA ++  R +  +L+   AF  T L+S  + ++ PN+  E+ +
Sbjct  142  KFKASLVRDVHGILSLYEAGHLAIRGEG-ILDEAIAFTRTHLQSMVSQDVCPNNLAEQ-I  199

Query  626  THALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
             H LD P    LPRVE RFF+SVY  +D+  +   LL+F+ LDFNL+Q +H++ELS ++
Sbjct  200  NHTLDCPLRRALPRVETRFFLSVYPRDDKHDKT--LLKFSKLDFNLVQRIHQKELSAIT  256


 Score = 85.5 bits (210),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 78/136 (57%), Gaps = 9/136 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEA-YAKEIEILKEQTRATLLIPTGSCSDDVAQKL  257
            RP+  F P LW  Y F   + D +  +  + +E E LK++ R+ +     + +D  AQKL
Sbjct  18   RPIAGFHPNLWGDY-FLTLASDCKTDDTTHQEEYEALKQEVRSMIT----ATADTPAQKL  72

Query  258  KFIDLLERLGIAYHFEKEIDDQLRHIY---IHPVHLNDLETVALQFRLMRQHGYNISTHI  428
            + +D ++RLG+AYHFE+EI+D +  IY          DL TV+L+FRL+RQ G+ +   +
Sbjct  73   QLVDAVQRLGVAYHFEQEIEDAMEKIYHDDFDNNDDVDLYTVSLRFRLLRQQGFKVPCDV  132

Query  429  FSNFVDGNESSETALM  476
            F+ F D     + +L+
Sbjct  133  FAKFKDDEGKFKASLV  148



>gb|AGN72806.1| germacrene A [Lavandula viridis]
Length=543

 Score =   107 bits (266),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 77/110 (70%), Gaps = 5/110 (5%)
 Frame = +2

Query  473  DVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQPFH  652
            D KGLLSLYEASY+RTR +  +L+    F    L+S APNL+  S L + V HAL Q  H
Sbjct  139  DAKGLLSLYEASYLRTRGET-ILDEALDFTTASLKSIAPNLE--SPLRRQVEHALVQQLH  195

Query  653  TGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
             G PR+E R FIS+Y+E ++  ++  LLRFA LD+NLLQM+HK+EL EVS
Sbjct  196  WGNPRIEARNFISLYEEYED--KDESLLRFAKLDYNLLQMMHKEELHEVS  243


 Score = 67.0 bits (162),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 49/146 (34%), Positives = 65/146 (45%), Gaps = 38/146 (26%)
 Frame = +3

Query  66   ENHLPRPVDNFPPTLWA------------RYCFHAFSIDNQVAEAYAKEIEILKEQTRAT  209
            E  + RP+ NF P+LW             RY FH     N                   +
Sbjct  5    EAEILRPLANFSPSLWGDQFIKNDSDAKVRYIFHYVDYTN------------------LS  46

Query  210  LLIPTGSCSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLN----DLETVA  377
            +L  TG+   D    +  ID LERLG++YHFE EI++ L+  +      N    DL TVA
Sbjct  47   MLTATGTKMVDT---MNLIDTLERLGVSYHFEHEIEEILQQFFNLNTDYNDEAYDLYTVA  103

Query  378  LQFRLMRQHGYNIS-THIFSNFVDGN  452
              FRL RQHG+ I+   IF  + D N
Sbjct  104  THFRLFRQHGHRITCADIFGRWRDEN  129



>emb|CAN71873.1| hypothetical protein VITISV_002877 [Vitis vinifera]
Length=538

 Score = 89.7 bits (221),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 77/116 (66%), Gaps = 7/116 (6%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            +F+++  SDV+G+L LYEA+++R   +D +L    AF  T L++   +L  +  L + V 
Sbjct  145  RFKEALISDVRGMLCLYEAAHLRVHGED-ILAKALAFTTTHLKAMVESLGYH--LAEQVA  201

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSE  796
            HAL++P   GL R+E R++ISVYQ  DE+  +  LL  A LDFNL+Q LHK+ELS+
Sbjct  202  HALNRPIRKGLERLEARWYISVYQ--DEAFHDKTLLELAKLDFNLVQSLHKEELSK  255


 Score = 84.0 bits (206),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 81/138 (59%), Gaps = 11/138 (8%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKE--IEILKEQTRATLLIPTGSCSDDVAQK  254
            RPV N+ P +W    F ++  +++V  A  +E  +++ KE  R      T +   + +Q 
Sbjct  19   RPVANYHPNIWGDQ-FISYIPEDKVTRACKEEQFVDLKKEVKRKL----TAAAVANPSQL  73

Query  255  LKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLE----TVALQFRLMRQHGYNIST  422
            L FID ++RLG+AYHFE+EI++ L+HI       ND++     +AL FRL+RQ GY+IS 
Sbjct  74   LNFIDAVQRLGVAYHFEQEIEEALQHICNSFHDCNDMDGDLYNIALGFRLLRQQGYSISC  133

Query  423  HIFSNFVDGNESSETALM  476
             IF+ F+D     + AL+
Sbjct  134  GIFNKFMDERGRFKEALI  151



>ref|XP_002519897.1| Casbene synthase, chloroplast precursor, putative [Ricinus communis]
 sp|B9S1N2.1|TPS8_RICCO RecName: Full=Probable terpene synthase 8; Short=RcSeTPS8 [Ricinus 
communis]
 gb|EEF42501.1| Casbene synthase, chloroplast precursor, putative [Ricinus communis]
Length=551

 Score = 87.4 bits (215),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 78/135 (58%), Gaps = 11/135 (8%)
 Frame = +3

Query  66   ENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDV  245
            +  + R +  FP T+W    F +FS+ +   E+Y +++E LK + +  L+  T     ++
Sbjct  10   QQDIARRLAKFPSTIWG-CSFASFSLKDSEIESYTQQVEELKGKVKDMLMQST----KEI  64

Query  246  AQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIH-PVHLN-----DLETVALQFRLMRQHG  407
             Q ++ I+LL RLG++YHFE EI+ QL  I+   P  LN     DL TVAL FR++RQHG
Sbjct  65   TQNIEVINLLCRLGVSYHFESEIEQQLNLIFASLPSFLNDNGHLDLYTVALLFRVLRQHG  124

Query  408  YNISTHIFSNFVDGN  452
              +   +F+ + D N
Sbjct  125  RKVPCDVFNKYKDDN  139


 Score = 86.3 bits (212),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 73/112 (65%), Gaps = 5/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            +SDVKGLLSLYEAS V    + E+L+    F    L + A  + P+   E+ + +AL  P
Sbjct  147  TSDVKGLLSLYEASVVSVHGE-EILDEALVFTKQHLETLAAQVSPH--FEQHIRNALLCP  203

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
             H G+ R++ R +IS Y EEDES RN  LL+FA LDFN LQ+L+++EL+ VS
Sbjct  204  VHYGMERLQARLYISFY-EEDES-RNEILLKFAKLDFNRLQLLYREELAIVS  253



>ref|XP_008366777.1| PREDICTED: LOW QUALITY PROTEIN: (-)-germacrene D synthase-like 
[Malus domestica]
Length=514

 Score = 90.9 bits (224),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 73/118 (62%), Gaps = 6/118 (5%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S   DV GLLS YEA+ +R   + E+L+    F  T L SA   L P   L K VT
Sbjct  98   KFKESLVDDVVGLLSQYEATQLRIHGE-EILDEALTFTTTHLESATYRLSP--PLSKTVT  154

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+Q      PRVE R+++SVYQE  ES  N  LL FA  DFN LQ +H++ELSE++
Sbjct  155  HALNQQLRKAXPRVEARYYLSVYQELRESP-NESLLTFAKSDFNRLQRVHQKELSEIT  211


 Score = 82.8 bits (203),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 67/100 (67%), Gaps = 4/100 (4%)
 Frame = +3

Query  177  IEILKEQTRATLLIPTGSCSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHL  356
            ++ LKE+ R  L     +  ++V+QKL FID ++RLG++YHF  EI+  L+ I+ +   L
Sbjct  9    VQELKEEVRRML----TTSLENVSQKLNFIDDIQRLGVSYHFRNEIEQILQKIHANFDDL  64

Query  357  NDLETVALQFRLMRQHGYNISTHIFSNFVDGNESSETALM  476
            +DL T AL+FRL+RQ GYNIS  IF+ F DG+   + +L+
Sbjct  65   DDLYTAALRFRLLRQQGYNISCDIFNMFKDGDGKFKESLV  104



>ref|XP_010062945.1| PREDICTED: (-)-germacrene D synthase-like [Eucalyptus grandis]
 gb|KCW70096.1| hypothetical protein EUGRSUZ_F03400 [Eucalyptus grandis]
Length=567

 Score = 88.6 bits (218),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 74/117 (63%), Gaps = 6/117 (5%)
 Frame = +2

Query  458  FRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTH  631
            FR+S  S+V GLLSLYEA ++R   D  +L+    FA T L S   + K ++ L K V+H
Sbjct  155  FRESLISNVLGLLSLYEACHLRCHGDS-ILDEALLFATTHLESINES-KVSTNLAKQVSH  212

Query  632  ALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            AL QP   GLPR+E R +I +YQE  E S +  LL  A LDFNLLQ  H++EL +++
Sbjct  213  ALKQPLRKGLPRLEARHYIPLYQE--EPSHDEVLLTLAKLDFNLLQEQHQKELGKIT  267


 Score = 84.7 bits (208),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 71/141 (50%), Gaps = 7/141 (5%)
 Frame = +3

Query  75   LPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQK  254
            + R    + P++W  Y     S  N V   +   +E   E+ +  +        D   QK
Sbjct  20   IERRSAGYHPSVWGDYFLKYDSPSNSVKFKFLGRVEGQIEELKGEVKKMLTDIMDKPLQK  79

Query  255  LKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHL-------NDLETVALQFRLMRQHGYN  413
            L  ID ++RLGI YHFE+EID+QL  I+     L       +DL  VAL FRL+RQHGYN
Sbjct  80   LHLIDQIQRLGIEYHFEREIDEQLEQIHKSYSRLDHEDFKVDDLHIVALIFRLLRQHGYN  139

Query  414  ISTHIFSNFVDGNESSETALM  476
            IS+ +F  F D   +   +L+
Sbjct  140  ISSEVFDKFKDSGGNFRESLI  160



>emb|CBI31280.3| unnamed protein product [Vitis vinifera]
Length=379

 Score = 88.6 bits (218),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 76/116 (66%), Gaps = 7/116 (6%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            +F+++  SDV+G+L LYEA+++R   +D ++    AF  T L++   +L     L + V 
Sbjct  247  RFKEALISDVRGMLCLYEAAHLRVHGED-IIAKALAFTTTHLKAMVESL--GYHLAEQVA  303

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSE  796
            HAL++P   GL R+E R++ISVYQ  DE+  +  LL  A LDFNL+Q LHK+ELS+
Sbjct  304  HALNRPIRKGLERLEARWYISVYQ--DEAFHDKTLLELAKLDFNLVQSLHKEELSK  357


 Score = 84.7 bits (208),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 81/138 (59%), Gaps = 11/138 (8%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKE--IEILKEQTRATLLIPTGSCSDDVAQK  254
            RPV N+ P +W    F ++  +++V  A  +E  +++ KE  R      T +   + +Q 
Sbjct  121  RPVANYHPNIWGDQ-FISYIPEDKVTRACKEEQFVDLKKEVKRKL----TAAAVANPSQL  175

Query  255  LKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLE----TVALQFRLMRQHGYNIST  422
            L FID ++RLG+AYHFE+EI++ L+HI       ND++     +AL FRL+RQ GY+IS 
Sbjct  176  LNFIDAVQRLGVAYHFEQEIEEALQHICNSFHDCNDMDGDLYNIALGFRLLRQQGYSISC  235

Query  423  HIFSNFVDGNESSETALM  476
             IF+ F+D     + AL+
Sbjct  236  GIFNKFMDERGRFKEALI  253



>ref|XP_008226805.1| PREDICTED: (-)-alpha-pinene synthase-like [Prunus mume]
Length=561

 Score = 88.6 bits (218),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 82/156 (53%), Gaps = 8/156 (5%)
 Frame = +3

Query  24   ISISRIGHIMAINFENHLPRPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTR  203
            +SI       + N +  + R   NFPP++W     +  S D         E++ LKE  R
Sbjct  1    MSIQVCAAAQSPNAKPEIIRRTANFPPSIWGDRFLNYDSQDIITNARNQPEVDNLKEVVR  60

Query  204  ATLLIPTGSCSDDVAQKLKFIDLLERLGIAYHFEKEIDDQLRHIYI----HPVHLN-DLE  368
              +   + S   D + +LKFID ++RLG+AYHFE EI++ L  ++     H    + DL 
Sbjct  61   REVFTTSAS---DFSHQLKFIDAIQRLGVAYHFESEIEEALERMHAAFRDHDFSDDGDLY  117

Query  369  TVALQFRLMRQHGYNISTHIFSNFVDGNESSETALM  476
             VAL FRL+RQHGY +S  +F+ F D N S +  L+
Sbjct  118  NVALGFRLLRQHGYKVSCDVFNKFKDENGSFKECLI  153


 Score = 84.7 bits (208),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 75/113 (66%), Gaps = 8/113 (7%)
 Frame = +2

Query  470  SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLE--KLVTHALDQ  643
            +DV G+LSLYEA ++  R ++E+L+   AF  T L SAA   K + + E  + +T AL++
Sbjct  154  ADVPGMLSLYEAGHLGVR-EEEILDEALAFTTTHLDSAA---KAHVSYEHAEQITEALER  209

Query  644  PFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            P    L RV  R ++S+YQ  DE+S N  LL+ A LDFNL+Q LHK+ELSE++
Sbjct  210  PLRKDLERVCARRYMSIYQ--DEASHNEALLKLAKLDFNLVQSLHKKELSEIN  260



>ref|XP_003541032.1| PREDICTED: probable terpene synthase 2-like [Glycine max]
Length=560

 Score = 91.3 bits (225),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 81/133 (61%), Gaps = 13/133 (10%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            R   NF PT+W  Y F ++   +   ++  K+++ILKE  R  L+ P    +++++ KL 
Sbjct  16   RCTANFHPTIWGHY-FLSYVPSSTEDDSRIKQVQILKEHVRKILVSPI---NNNLSFKLN  71

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIHPV-------HLNDLETVALQFRLMRQHGYNIS  419
            FID ++RLG++YHFE+EID+ L  IY           H +DL+ +AL FRL+RQ GY IS
Sbjct  72   FIDTIQRLGVSYHFEQEIDELLLQIYDISTKDNNIIGHDDDLQQLALLFRLLRQRGYRIS  131

Query  420  THIFSNFVD--GN  452
            +++F  F D  GN
Sbjct  132  SNVFYKFKDQTGN  144


 Score = 81.6 bits (200),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 72/115 (63%), Gaps = 6/115 (5%)
 Frame = +2

Query  461  RDSSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRL-RSAAPNLKPNSTLEKLVTHAL  637
            R ++D++G++SLYEAS +R   + E+LE    F   +L +S    L P   LE  V H L
Sbjct  148  RLANDIQGMMSLYEASQLRFHGE-EILEEAHNFTHIQLSKSLTTQLSP--YLEAQVQHIL  204

Query  638  DQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
             Q FH G+PR+E  + IS YQE  + S +  LL FA +DF++LQ LHK+E+S V+
Sbjct  205  VQSFHKGMPRLEATYNISFYQE--DPSHDKYLLSFAKVDFDILQKLHKKEVSSVT  257



>ref|XP_010645872.1| PREDICTED: LOW QUALITY PROTEIN: valencene synthase [Vitis vinifera]
Length=556

 Score = 89.0 bits (219),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 77/118 (65%), Gaps = 7/118 (6%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            +F+++  SDV+G+L LYEA+++R   +D ++    AF  T L++   +L     L + V 
Sbjct  145  RFKEALISDVRGMLCLYEAAHLRVHGED-IIAKALAFTTTHLKAMVESL--GYHLAEQVA  201

Query  629  HALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL++P   GL R+E R++ISVYQ  DE+  +  LL  A LDFNL+Q LHK+ELS ++
Sbjct  202  HALNRPIRKGLERLEARWYISVYQ--DEAFHDKTLLELAKLDFNLVQSLHKEELSNLA  257


 Score = 84.0 bits (206),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 81/138 (59%), Gaps = 11/138 (8%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKE--IEILKEQTRATLLIPTGSCSDDVAQK  254
            RPV N+ P +W    F ++  +++V  A  +E  +++ KE  R      T +   + +Q 
Sbjct  19   RPVANYHPNIWGDQ-FISYIPEDKVTRACKEEQFVDLKKEVKRKL----TAAAVANPSQL  73

Query  255  LKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLE----TVALQFRLMRQHGYNIST  422
            L FID ++RLG+AYHFE+EI++ L+HI       ND++     +AL FRL+RQ GY+IS 
Sbjct  74   LNFIDAVQRLGVAYHFEQEIEEALQHICNSFHDCNDMDGDLYNIALGFRLLRQQGYSISC  133

Query  423  HIFSNFVDGNESSETALM  476
             IF+ F+D     + AL+
Sbjct  134  GIFNKFMDERGRFKEALI  151



>sp|E2E2N7.1|BCGS_ORIVU RecName: Full=Bicyclogermacrene synthase; Short=Ovtps4 [Origanum 
vulgare]
 gb|ADK73618.1| terpene synthase 4 [Origanum vulgare]
Length=555

 Score = 93.6 bits (231),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 80/134 (60%), Gaps = 9/134 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDN-QVAEAYAKEIEILKEQTRATLL-IPTGSCSDDVAQK  254
            R    F P++W  + F +++ DN Q++EA  +E+   KE  R  L  +P GS       K
Sbjct  21   RKSAKFHPSIWGDF-FLSYNSDNTQISEAEEEEVAKQKEAVRELLAQVPEGS-----TYK  74

Query  255  LKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLND-LETVALQFRLMRQHGYNISTHIF  431
            ++ IDL++RLG+ YHFEKEI D L +I+ +  H +D + T AL+FRL+RQ GY +   +F
Sbjct  75   MELIDLIQRLGVNYHFEKEIHDSLNYIHENSQHNDDEVRTTALRFRLLRQQGYRVPCDVF  134

Query  432  SNFVDGNESSETAL  473
              F DG  +  TAL
Sbjct  135  RKFTDGEGNFATAL  148


 Score = 79.3 bits (194),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 75/113 (66%), Gaps = 4/113 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSA-APNLKPNSTLEKLVTHALDQ  643
            ++DV+GLL LYEAS++ TR + E+L+    F+++ L++    +L  + +L K V  AL  
Sbjct  149  TNDVEGLLELYEASHLATRGE-EILDRAMEFSSSHLQALLNQHLVGSVSLSKRVDEALKM  207

Query  644  PFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            P    L R+  R FIS+YQE++  SRN  LL FA LDFN++Q +H++ELS+ +
Sbjct  208  PIRKTLTRLGARKFISLYQEDE--SRNELLLNFAKLDFNMVQKMHQRELSDAT  258



>gb|AAX44034.1| (+)-delta-cadinene synthase [Gossypium hirsutum]
Length=554

 Score = 93.6 bits (231),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 72/112 (64%), Gaps = 5/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            +SDV+GLL LYEASY+R   +D +L+   +F    L  A   L+    L + V+HAL + 
Sbjct  148  TSDVRGLLELYEASYLRVHGED-ILDEAISFTTDHLTLAVATLE--YPLSEHVSHALKKS  204

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
               GLPR+E R ++SVYQ  D  S N  LL FA +DFN+LQ+LH++ELSE+ 
Sbjct  205  IRRGLPRIEARHYLSVYQ--DIESHNTALLEFAKIDFNMLQLLHRKELSEIC  254


 Score = 79.7 bits (195),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 74/128 (58%), Gaps = 7/128 (5%)
 Frame = +3

Query  93   NFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLKFIDL  272
            +F P++W         +DN +     +  + L+   R  ++ P  + +    QKL FID 
Sbjct  26   DFQPSIWGDLFLTC--LDNDIDAETEQRHQQLEGGVRKMIVAPMANST----QKLTFIDS  79

Query  273  LERLGIAYHFEKEIDDQLRHIYIHPVHL-NDLETVALQFRLMRQHGYNISTHIFSNFVDG  449
            ++RLG++Y F KEI+D+L +IY +     NDL T +L+FRL+R+HG+N+S  +F+ F D 
Sbjct  80   VQRLGVSYRFTKEIEDELENIYHNNNDAENDLYTTSLRFRLLREHGFNVSCEVFNKFKDE  139

Query  450  NESSETAL  473
                +++L
Sbjct  140  QGDFKSSL  147



>ref|XP_007021065.1| Delta-cadinene synthase isozyme A [Theobroma cacao]
 gb|EOY12590.1| Delta-cadinene synthase isozyme A [Theobroma cacao]
Length=522

 Score = 94.7 bits (234),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 72/112 (64%), Gaps = 5/112 (4%)
 Frame = +2

Query  467  SSDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALDQP  646
            +SDV+GLL LYEASY+    +D +L+   +FA T L  AAP L  +  L + V HAL Q 
Sbjct  148  TSDVRGLLELYEASYLPVHGED-ILDEAISFATTYLILAAPTL--DHPLSEQVAHALKQS  204

Query  647  FHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
               GLPRVE R +IS+YQ  +  S N  LL FA +D  LLQ+LH++ELSE+ 
Sbjct  205  IRRGLPRVEARRYISLYQ--NYESHNKALLEFAKIDLKLLQLLHRKELSEIC  254


 Score = 78.2 bits (191),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 72/133 (54%), Gaps = 10/133 (8%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHA--FSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQK  254
            RP  +F P +W     +     ID      Y    E LKE+ R  ++ P     D++  K
Sbjct  23   RPKVDFHPNIWGDVFLNCPLKDIDTTTELRY----EELKEEVRRMVVAPM----DNLNLK  74

Query  255  LKFIDLLERLGIAYHFEKEIDDQLRHIYIHPVHLNDLETVALQFRLMRQHGYNISTHIFS  434
            L  +D ++RLG  YHFEKE ++ L  IY      NDL T AL+FR++R+HG+++S  +F+
Sbjct  75   LLLVDAVQRLGFNYHFEKETENILEQIYHDSNDANDLYTTALRFRILREHGFDVSCDVFN  134

Query  435  NFVDGNESSETAL  473
             F D   + +++L
Sbjct  135  KFKDDKGNFKSSL  147



>dbj|BAJ53213.1| JHL23C09.9 [Jatropha curcas]
Length=602

 Score = 92.0 bits (227),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 80/129 (62%), Gaps = 9/129 (7%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVAQKLK  260
            RP+ NFP T+W      +   D    E+ +K++++LKE+ +  +L  T S SD V +K+ 
Sbjct  62   RPLANFPSTVWGER-LGSLPFDQSGFESLSKQVQLLKEKVKNDML--TASTSDSV-EKII  117

Query  261  FIDLLERLGIAYHFEKEIDDQLRHIYIH-PVHLN----DLETVALQFRLMRQHGYNISTH  425
             ID L RLG++YHFE EI++ L  I+ + P  LN    DL TVA+ FR+ RQHG+ IS+ 
Sbjct  118  SIDSLCRLGVSYHFEDEIEENLNKIFNNQPNFLNENDYDLYTVAVIFRVFRQHGFKISSD  177

Query  426  IFSNFVDGN  452
            +F+ F D +
Sbjct  178  VFNKFKDSD  186


 Score = 80.5 bits (197),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 77/125 (62%), Gaps = 14/125 (11%)
 Frame = +2

Query  455  KFRDS---------SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNS  607
            KF+DS         SDVKG+LSL+EA+++ +  ++ +L+   AF    L  +A    P+ 
Sbjct  181  KFKDSDGKFKEFLLSDVKGILSLFEATHL-SMPNESILDEALAFTKAFLEVSAVESFPD-  238

Query  608  TLEKLVTHALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQE  787
               K +T+AL+QP H G+PR+E R +I +Y  E + ++N  LL  A LDFN +Q+LH++E
Sbjct  239  -FAKHITNALEQPVHKGIPRLEARKYIDLY--EVDENQNEALLELAKLDFNRVQLLHQEE  295

Query  788  LSEVS  802
            LS  S
Sbjct  296  LSRFS  300



>gb|AAG17667.1|AF272244_1 5-epi-aristolochene synthase, partial [Nicotiana tabacum]
Length=441

 Score =   127 bits (320),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 90/119 (76%), Gaps = 8/119 (7%)
 Frame = +2

Query  455  KFRDS--SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVT  628
            KF++S  SDV GLL+LYEAS+VRT +DD +LE   AF+   L SA P+LK  S L + VT
Sbjct  29   KFKESLASDVLGLLNLYEASHVRTHADD-ILEDALAFSTIHLESAVPHLK--SPLREQVT  85

Query  629  HALDQPFHTGLPRVEHRFFIS-VYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEVS  802
            HAL+Q  H G+PRVE RFFIS +Y  E E S+N+ LLRFA LD+NLLQMLHKQEL+EVS
Sbjct  86   HALEQCLHKGVPRVETRFFISSIY--EKEQSKNDVLLRFAKLDYNLLQMLHKQELAEVS  142


 Score = 44.3 bits (103),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = +3

Query  375  ALQFRLMRQHGYNISTHIFSNFVDGN  452
            ALQFRL+RQHG+NIS  IFS F D N
Sbjct  2    ALQFRLLRQHGFNISPEIFSKFQDEN  27



>ref|XP_010066141.1| PREDICTED: (-)-germacrene D synthase-like [Eucalyptus grandis]
Length=567

 Score = 89.4 bits (220),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 73/125 (58%), Gaps = 13/125 (10%)
 Frame = +2

Query  455  KFRDS---------SDVKGLLSLYEASYVRTRSDDEVLEGVTAFAATRLRSAAPNLKPNS  607
            KF+D+         +DV+GLLSL+EA +V   SDD +L    AF  T L S     K + 
Sbjct  145  KFKDNEGHFSKSLIADVRGLLSLFEACHVGFHSDD-ILNDALAFTVTHLESIDKE-KVSR  202

Query  608  TLEKLVTHALDQPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQE  787
             LEK V+HAL QP H GL R+E R +I +YQE  E   N  LL  A LDFNLLQ  H++E
Sbjct  203  NLEKEVSHALSQPIHKGLSRLEARHYIQLYQE--EPLHNEVLLSLARLDFNLLQKQHQKE  260

Query  788  LSEVS  802
            L  ++
Sbjct  261  LGNIT  265


 Score = 82.8 bits (203),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 69/130 (53%), Gaps = 12/130 (9%)
 Frame = +3

Query  81   RPVDNFPPTLWARYCFHAFSIDNQVA--EAYAKEIEILKEQTRATLLIPTGSCSDDVAQK  254
            R   NF P++W  Y     S  N  +  +   + IE LK + +  L     S  D ++QK
Sbjct  23   RRSGNFHPSIWGDYFLKYASDSNSKSSQDIAGERIERLKGEVKKMLT----SAMDKLSQK  78

Query  255  LKFIDLLERLGIAYHFEKEIDDQLRHI------YIHPVHLNDLETVALQFRLMRQHGYNI  416
            L  ID ++RLG+AYHFE EID +L  I      Y    +  DL T AL FRL+RQ GY++
Sbjct  79   LNLIDQIQRLGLAYHFEIEIDKELEQIHRSYFEYHRGDNDEDLHTTALLFRLLRQQGYDV  138

Query  417  STHIFSNFVD  446
            S  IF+ F D
Sbjct  139  SCEIFNKFKD  148



>gb|KDP39015.1| hypothetical protein JCGZ_00772 [Jatropha curcas]
Length=558

 Score = 89.7 bits (221),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 84/141 (60%), Gaps = 16/141 (11%)
 Frame = +3

Query  81   RPVDNFPPTLWA----RYCFHAFSIDNQVAEAYAKEIEILKEQTRATLLIPTGSCSDDVA  248
            R   N+ P +W      Y  +  +IDN    A   ++E LKE+ R TL++ T    ++  
Sbjct  22   RRSANYHPNIWGDRFLSYDSNFMTIDN----ATHHQLEELKEEVRRTLVVTT----NNSL  73

Query  249  QKLKFIDLLERLGIAYHFEKEIDDQLRHIY-IHPVHLNDLETVALQFRLMRQHGYNISTH  425
            QKL+ ID ++RLG+ YHFEKEI+D+L  +Y  +  + NDL T+AL+FRL+RQ G+N S  
Sbjct  74   QKLQLIDAIQRLGVDYHFEKEIEDELEKLYHENDDNENDLYTIALRFRLLRQQGFNASCE  133

Query  426  IFSNFVDGNESSETALM*RVC  488
            +F+ F D   + + +L   VC
Sbjct  134  VFNQFKDDEGNFKKSL---VC  151


 Score = 82.0 bits (201),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 66/113 (58%), Gaps = 11/113 (10%)
 Frame = +2

Query  470  SDVKGLLSLYEASYVRTRSD---DEVLEGVTAFAATRLRSAAPNLKPNSTLEKLVTHALD  640
             D KG+L LYEA++VR   +   DE LE    F    L  AA NL  +  L   ++ AL 
Sbjct  151  CDAKGMLELYEATHVRVHGENTLDEALE----FTTINLEWAATNL--DYPLSYQISEALK  204

Query  641  QPFHTGLPRVEHRFFISVYQEEDESSRNNELLRFAILDFNLLQMLHKQELSEV  799
            Q     LPR+E R ++S YQE+   S N  LL+ A LDFNLLQ LHK+ELSE+
Sbjct  205  QSIRKRLPRLEARRYVSFYQED--CSHNKALLKMAKLDFNLLQSLHKKELSEI  255



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1499838010448