BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24137_g5_i1 len=3614 path=[3660:0-2953 6614:2954-2977
24354:2978-3356 24733:3357-3359 29054:3360-3380 24756:3381-3415
28148:3416-3613]

Length=3614
                                                                      Score     E

ref|XP_009602213.1|  PREDICTED: auxin response factor 6-like isof...   1315   0.0      
ref|XP_009757615.1|  PREDICTED: auxin response factor 6-like isof...   1311   0.0      
ref|XP_009602214.1|  PREDICTED: auxin response factor 6-like isof...   1308   0.0      
ref|XP_009757616.1|  PREDICTED: auxin response factor 6-like isof...   1307   0.0      
ref|XP_006357892.1|  PREDICTED: auxin response factor 6-like isof...   1298   0.0      
gb|ADH04265.1|  ARF1                                                   1297   0.0      
ref|XP_006357893.1|  PREDICTED: auxin response factor 6-like isof...   1293   0.0      
gb|ACM66271.1|  ARF8                                                   1273   0.0      Solanum melongena [aubergine]
ref|NP_001234663.1|  auxin response factor 6                           1201   0.0      
gb|ADK91822.1|  auxin response factor 6                                1186   0.0      
gb|KDO63433.1|  hypothetical protein CISIN_1g002390mg                  1157   0.0      
ref|XP_006468969.1|  PREDICTED: auxin response factor 6-like           1157   0.0      
ref|XP_006446840.1|  hypothetical protein CICLE_v10014200mg            1156   0.0      
gb|KDO63436.1|  hypothetical protein CISIN_1g002390mg                  1149   0.0      
gb|KHN12007.1|  Auxin response factor 6                                1130   0.0      
gb|AHY24213.1|  auxin response factor                                  1129   0.0      
ref|XP_003519519.1|  PREDICTED: auxin response factor 6-like           1129   0.0      
gb|KDO63434.1|  hypothetical protein CISIN_1g002390mg                  1128   0.0      
ref|XP_006595764.1|  PREDICTED: auxin response factor 6-like           1126   0.0      
ref|XP_011032738.1|  PREDICTED: auxin response factor 6-like isof...   1124   0.0      
ref|XP_007141460.1|  hypothetical protein PHAVU_008G197600g            1123   0.0      
ref|XP_002307574.2|  hypothetical protein POPTR_0005s22930g            1122   0.0      Populus trichocarpa [western balsam poplar]
gb|ABK95163.1|  unknown                                                1121   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011032737.1|  PREDICTED: auxin response factor 6-like isof...   1120   0.0      
gb|KDP38016.1|  hypothetical protein JCGZ_04659                        1115   0.0      
ref|XP_010054260.1|  PREDICTED: auxin response factor 6-like           1113   0.0      
gb|KDO63435.1|  hypothetical protein CISIN_1g002390mg                  1113   0.0      
emb|CBI22060.3|  unnamed protein product                               1112   0.0      
ref|XP_009602215.1|  PREDICTED: auxin response factor 6-like isof...   1108   0.0      
ref|XP_006448968.1|  hypothetical protein CICLE_v10014198mg            1083   0.0      
ref|XP_006468258.1|  PREDICTED: auxin response factor 6-like isof...   1079   0.0      
ref|XP_006468259.1|  PREDICTED: auxin response factor 6-like isof...   1072   0.0      
ref|XP_004150775.1|  PREDICTED: auxin response factor 6-like           1055   0.0      
ref|XP_011047524.1|  PREDICTED: auxin response factor 6-like isof...   1046   0.0      
ref|XP_011047523.1|  PREDICTED: auxin response factor 6-like isof...   1042   0.0      
ref|XP_011007615.1|  PREDICTED: auxin response factor 6-like           1040   0.0      
ref|XP_004164684.1|  PREDICTED: LOW QUALITY PROTEIN: auxin respon...   1039   0.0      
gb|KDO75361.1|  hypothetical protein CISIN_1g002624mg                  1026   0.0      
gb|KDO63437.1|  hypothetical protein CISIN_1g002390mg                  1015   0.0      
dbj|BAD19064.1|  auxin response factor 4                                876   0.0      Cucumis sativus [cucumbers]
ref|NP_001234540.1|  auxin response factor 6-1                          830   0.0      
emb|CDP16075.1|  unnamed protein product                                835   0.0      
ref|XP_006351989.1|  PREDICTED: auxin response factor 6-like isof...    823   0.0      
ref|XP_006351990.1|  PREDICTED: auxin response factor 6-like isof...    823   0.0      
ref|XP_011085439.1|  PREDICTED: auxin response factor 6-like            823   0.0      
ref|XP_010106165.1|  Auxin response factor 6                            822   0.0      
ref|XP_010657096.1|  PREDICTED: auxin response factor 17-like           817   0.0      
ref|XP_008229616.1|  PREDICTED: auxin response factor 6-like isof...    812   0.0      
gb|ABN10955.2|  auxin response factor 8                                 809   0.0      Ipomoea nil [qian niu]
ref|XP_002532983.1|  Auxin response factor, putative                    794   0.0      Ricinus communis
ref|XP_010275911.1|  PREDICTED: auxin response factor 6-like isof...    810   0.0      
ref|XP_010275910.1|  PREDICTED: auxin response factor 6-like isof...    810   0.0      
emb|CBI30950.3|  unnamed protein product                                795   0.0      
ref|XP_007217690.1|  hypothetical protein PRUPE_ppa001069mg             810   0.0      
ref|XP_010688802.1|  PREDICTED: auxin response factor 6 isoform X2      810   0.0      
ref|XP_009376828.1|  PREDICTED: auxin response factor 6-like            808   0.0      
ref|XP_004304523.1|  PREDICTED: auxin response factor 17-like           805   0.0      
ref|XP_010688801.1|  PREDICTED: auxin response factor 6 isoform X1      804   0.0      
gb|KHG01675.1|  Auxin response factor 6 -like protein                   796   0.0      
gb|EYU42851.1|  hypothetical protein MIMGU_mgv1a001422mg                796   0.0      
ref|XP_007048898.1|  Auxin response factor 6 isoform 2                  798   0.0      
ref|XP_002279808.1|  PREDICTED: auxin response factor 6                 797   0.0      Vitis vinifera
ref|XP_010090447.1|  Auxin response factor 6                            796   0.0      
ref|XP_008229615.1|  PREDICTED: auxin response factor 6-like isof...    796   0.0      
ref|XP_007024963.1|  Auxin response factor 6 isoform 2                  791   0.0      
ref|XP_007024962.1|  Auxin response factor 6 isoform 1                  791   0.0      
ref|XP_011096635.1|  PREDICTED: auxin response factor 6 isoform X1      788   0.0      
ref|XP_011096636.1|  PREDICTED: auxin response factor 6 isoform X2      787   0.0      
gb|KCW75879.1|  hypothetical protein EUGRSUZ_D00264                     781   0.0      
ref|XP_008439586.1|  PREDICTED: LOW QUALITY PROTEIN: auxin respon...    784   0.0      
emb|CDP05666.1|  unnamed protein product                                783   0.0      
ref|XP_004166469.1|  PREDICTED: auxin response factor 6-like            783   0.0      
dbj|BAD19063.1|  auxin response factor 3                                782   0.0      Cucumis sativus [cucumbers]
ref|XP_010275037.1|  PREDICTED: auxin response factor 6                 784   0.0      
ref|XP_010052021.1|  PREDICTED: auxin response factor 6                 781   0.0      
ref|XP_010908739.1|  PREDICTED: auxin response factor 17-like iso...    778   0.0      
ref|XP_011026193.1|  PREDICTED: auxin response factor 6-like isof...    780   0.0      
ref|XP_007048897.1|  Auxin response factor 6 isoform 1                  783   0.0      
ref|XP_011096637.1|  PREDICTED: auxin response factor 6 isoform X3      778   0.0      
ref|XP_004134558.1|  PREDICTED: auxin response factor 6-like            778   0.0      
ref|XP_010908738.1|  PREDICTED: auxin response factor 17-like iso...    777   0.0      
ref|XP_010908734.1|  PREDICTED: auxin response factor 17-like iso...    777   0.0      
ref|XP_002300854.2|  hypothetical protein POPTR_0002s05590g             778   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010538262.1|  PREDICTED: auxin response factor 6                 775   0.0      
ref|XP_008371645.1|  PREDICTED: auxin response factor 6                 775   0.0      
ref|XP_011026192.1|  PREDICTED: auxin response factor 6-like isof...    776   0.0      
ref|XP_009399037.1|  PREDICTED: auxin response factor 17                776   0.0      
ref|XP_010499563.1|  PREDICTED: auxin response factor 6-like isof...    775   0.0      
ref|XP_008777704.1|  PREDICTED: auxin response factor 17-like           775   0.0      
ref|NP_001280959.1|  auxin response factor 6-like                       774   0.0      
ref|XP_002893612.1|  hypothetical protein ARALYDRAFT_473256             773   0.0      
ref|XP_008784820.1|  PREDICTED: LOW QUALITY PROTEIN: auxin respon...    777   0.0      
ref|XP_009360948.1|  PREDICTED: auxin response factor 6                 773   0.0      
ref|XP_010478419.1|  PREDICTED: auxin response factor 6 isoform X3      774   0.0      
ref|NP_001031115.1|  auxin response factor 6                            774   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009377485.1|  PREDICTED: auxin response factor 6-like            773   0.0      
ref|XP_008371797.1|  PREDICTED: auxin response factor 6-like            773   0.0      
ref|XP_008444734.1|  PREDICTED: auxin response factor 6-like            773   0.0      
ref|XP_010941526.1|  PREDICTED: auxin response factor 17-like iso...    773   0.0      
ref|XP_009115164.1|  PREDICTED: auxin response factor 6 isoform X1      772   0.0      
ref|XP_006415485.1|  hypothetical protein EUTSA_v10006747mg             771   0.0      
ref|XP_007212802.1|  hypothetical protein PRUPE_ppa001179mg             770   0.0      
emb|CDY02285.1|  BnaA09g26170D                                          768   0.0      
gb|KFK27496.1|  hypothetical protein AALP_AA8G390400                    771   0.0      
ref|XP_010462991.1|  PREDICTED: auxin response factor 6-like            765   0.0      
ref|XP_010499564.1|  PREDICTED: auxin response factor 6-like isof...    769   0.0      
ref|XP_010923658.1|  PREDICTED: auxin response factor 17 isoform X2     769   0.0      
ref|XP_010478420.1|  PREDICTED: auxin response factor 6 isoform X4      768   0.0      
ref|NP_174323.1|  auxin response factor 6                               768   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010499561.1|  PREDICTED: auxin response factor 6-like isof...    768   0.0      
ref|XP_006306714.1|  hypothetical protein CARUB_v10008239mg             768   0.0      
ref|XP_010478417.1|  PREDICTED: auxin response factor 6 isoform X1      767   0.0      
gb|KHG10285.1|  Auxin response factor 6 -like protein                   764   0.0      
ref|XP_009115165.1|  PREDICTED: auxin response factor 6 isoform X2      766   0.0      
ref|XP_008225531.1|  PREDICTED: auxin response factor 6                 764   0.0      
ref|XP_011012265.1|  PREDICTED: auxin response factor 6-like            764   0.0      
ref|XP_010923656.1|  PREDICTED: auxin response factor 17 isoform X1     766   0.0      
ref|XP_003593869.1|  Auxin response factor                              764   0.0      
ref|XP_004293501.1|  PREDICTED: auxin response factor 17-like           762   0.0      
ref|XP_008794474.1|  PREDICTED: auxin response factor 17                764   0.0      
ref|XP_010499562.1|  PREDICTED: auxin response factor 6-like isof...    762   0.0      
ref|XP_010940157.1|  PREDICTED: LOW QUALITY PROTEIN: auxin respon...    763   0.0      
ref|XP_009399230.1|  PREDICTED: auxin response factor 17-like           761   0.0      
ref|XP_010478418.1|  PREDICTED: auxin response factor 6 isoform X2      762   0.0      
ref|XP_004485979.1|  PREDICTED: auxin response factor 6-like            760   0.0      
ref|XP_009797609.1|  PREDICTED: auxin response factor 6-like isof...    759   0.0      
ref|XP_003542951.1|  PREDICTED: auxin response factor 6-like isof...    759   0.0      
emb|CBA11994.1|  putative auxin response factor 6                       759   0.0      
ref|XP_009627654.1|  PREDICTED: auxin response factor 6-like isof...    759   0.0      
ref|XP_006415484.1|  hypothetical protein EUTSA_v10006747mg             759   0.0      
emb|CDY09598.1|  BnaC05g23210D                                          758   0.0      
ref|XP_011085226.1|  PREDICTED: auxin response factor 6-like isof...    759   0.0      
ref|XP_011085227.1|  PREDICTED: auxin response factor 6-like isof...    758   0.0      
ref|XP_002298839.1|  auxin response factor 6 family protein             757   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006656378.1|  PREDICTED: auxin response factor 17-like           757   0.0      
ref|XP_003546066.1|  PREDICTED: auxin response factor 6-like isof...    755   0.0      
ref|XP_006594517.1|  PREDICTED: auxin response factor 6-like isof...    755   0.0      
ref|XP_006836327.1|  hypothetical protein AMTR_s00092p00072950          758   0.0      
ref|XP_007159383.1|  hypothetical protein PHAVU_002G233600g             754   0.0      
ref|XP_009393314.1|  PREDICTED: auxin response factor 17-like           754   0.0      
ref|XP_009385053.1|  PREDICTED: auxin response factor 6-like            754   0.0      
gb|KHN47353.1|  Auxin response factor 6                                 753   0.0      
ref|XP_002438851.1|  hypothetical protein SORBIDRAFT_10g027220          753   0.0      Sorghum bicolor [broomcorn]
ref|XP_004966207.1|  PREDICTED: auxin response factor 17-like           753   0.0      
ref|NP_001045993.1|  Os02g0164900                                       752   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_009797608.1|  PREDICTED: auxin response factor 6-like isof...    752   0.0      
gb|KHN12428.1|  Auxin response factor 6                                 752   0.0      
ref|XP_003531170.1|  PREDICTED: auxin response factor 6-like isof...    752   0.0      
gb|EAZ38013.1|  hypothetical protein OsJ_22358                          751   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006597509.1|  PREDICTED: auxin response factor 6-like isof...    751   0.0      
ref|XP_006646917.1|  PREDICTED: auxin response factor 6-like            752   0.0      
sp|A2YG67.1|ARFQ_ORYSI  RecName: Full=Auxin response factor 17          751   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_009627653.1|  PREDICTED: auxin response factor 6-like isof...    751   0.0      
gb|ADG43152.1|  auxin response factor 18                                751   0.0      
ref|NP_001058360.1|  Os06g0677800                                       751   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_008644237.1|  PREDICTED: uncharacterized protein LOC100502...    751   0.0      
ref|XP_002316773.1|  auxin response factor 6 family protein             751   0.0      Populus trichocarpa [western balsam poplar]
gb|KHN06947.1|  Auxin response factor 6                                 749   0.0      
ref|XP_009627655.1|  PREDICTED: auxin response factor 6-like isof...    747   0.0      
ref|XP_009402570.1|  PREDICTED: auxin response factor 6-like isof...    749   0.0      
ref|XP_009627652.1|  PREDICTED: auxin response factor 6-like isof...    749   0.0      
ref|XP_007158734.1|  hypothetical protein PHAVU_002G177600g             749   0.0      
ref|XP_006585093.1|  PREDICTED: auxin response factor 6-like isof...    748   0.0      
ref|XP_002451599.1|  hypothetical protein SORBIDRAFT_04g004430          746   0.0      Sorghum bicolor [broomcorn]
gb|KHN46047.1|  Auxin response factor 6                                 744   0.0      
ref|XP_004504543.1|  PREDICTED: auxin response factor 6-like isof...    743   0.0      
ref|XP_009402572.1|  PREDICTED: auxin response factor 6-like isof...    743   0.0      
ref|XP_008679928.1|  PREDICTED: auxin response factor 6 isoform X1      743   0.0      
ref|XP_009109594.1|  PREDICTED: auxin response factor 6-like            740   0.0      
emb|CDX90245.1|  BnaA08g17390D                                          740   0.0      
ref|XP_003563403.1|  PREDICTED: auxin response factor 17                741   0.0      
gb|ADG43150.1|  auxin response factor 16                                741   0.0      
ref|XP_008679929.1|  PREDICTED: auxin response factor 6 isoform X2      741   0.0      
ref|XP_004963222.1|  PREDICTED: auxin response factor 25-like           740   0.0      
gb|AFD01302.1|  auxin response factor 6                                 737   0.0      
ref|XP_009384193.1|  PREDICTED: auxin response factor 17-like iso...    739   0.0      
gb|KEH20525.1|  auxin response factor 2                                 739   0.0      
ref|XP_004504542.1|  PREDICTED: auxin response factor 6-like isof...    739   0.0      
ref|NP_001067266.1|  Os12g0613700                                       737   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_008648945.1|  PREDICTED: auxin response factor 17-like iso...    736   0.0      
gb|EAY83881.1|  hypothetical protein OsI_39101                          737   0.0      Oryza sativa Indica Group [Indian rice]
gb|ADG43156.1|  auxin response factor 22                                737   0.0      
ref|XP_004951871.1|  PREDICTED: auxin response factor 6-like isof...    737   0.0      
ref|XP_003575362.1|  PREDICTED: auxin response factor 6-like isof...    736   0.0      
dbj|BAB85915.1|  auxin response factor 6b                               734   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|KEH20526.1|  auxin response factor 2                                 735   0.0      
ref|XP_002443554.1|  hypothetical protein SORBIDRAFT_08g021460          734   0.0      Sorghum bicolor [broomcorn]
ref|XP_007141982.1|  hypothetical protein PHAVU_008G242400g             732   0.0      
ref|XP_010233862.1|  PREDICTED: auxin response factor 6-like isof...    734   0.0      
emb|CBI27334.3|  unnamed protein product                                717   0.0      
ref|XP_008662061.1|  PREDICTED: auxin response factor 25-like           733   0.0      
emb|CDY12048.1|  BnaC03g59640D                                          731   0.0      
gb|AIB05454.1|  ARF transcription factor                                733   0.0      
dbj|BAK00026.1|  predicted protein                                      732   0.0      
ref|XP_006596491.1|  PREDICTED: auxin response factor 8-like            730   0.0      
gb|ABF69979.1|  transcriptional factor B3 family protein                731   0.0      Musa acuminata [banana]
ref|XP_010250595.1|  PREDICTED: auxin response factor 8 isoform X1      729   0.0      
ref|XP_010237021.1|  PREDICTED: auxin response factor 25-like           729   0.0      
ref|XP_006664743.1|  PREDICTED: auxin response factor 25-like           729   0.0      
ref|XP_003616115.1|  Auxin response factor                              728   0.0      
ref|XP_010233861.1|  PREDICTED: auxin response factor 6-like isof...    729   0.0      
ref|XP_006575466.1|  PREDICTED: auxin response factor 8-like isof...    727   0.0      
gb|KGN50892.1|  hypothetical protein Csa_5G315370                       724   0.0      
ref|XP_008813056.1|  PREDICTED: auxin response factor 12-like iso...    716   0.0      
ref|XP_008776642.1|  PREDICTED: auxin response factor 17-like           728   0.0      
ref|XP_006591281.1|  PREDICTED: auxin response factor 8-like            724   0.0      
ref|XP_004148912.1|  PREDICTED: auxin response factor 8-like            724   0.0      
ref|XP_008463127.1|  PREDICTED: auxin response factor 8                 724   0.0      
ref|XP_002266678.2|  PREDICTED: auxin response factor 8                 723   0.0      Vitis vinifera
ref|XP_007146950.1|  hypothetical protein PHAVU_006G084200g             723   0.0      
ref|XP_002526195.1|  Auxin response factor, putative                    722   0.0      Ricinus communis
ref|XP_010540603.1|  PREDICTED: auxin response factor 6-like isof...    721   0.0      
ref|XP_007146949.1|  hypothetical protein PHAVU_006G084200g             723   0.0      
ref|XP_003553137.1|  PREDICTED: auxin response factor 8-like            723   0.0      
tpg|DAA55140.1|  TPA: hypothetical protein ZEAMMB73_057592              720   0.0      
gb|KDP36369.1|  hypothetical protein JCGZ_09784                         721   0.0      
ref|XP_010540601.1|  PREDICTED: auxin response factor 6-like isof...    721   0.0      
gb|EMT04282.1|  Auxin response factor 25                                728   0.0      
emb|CBA12001.1|  putative auxin response factor 8                       719   0.0      
gb|KHG28199.1|  Auxin response factor 6                                 723   0.0      
ref|XP_004288582.1|  PREDICTED: auxin response factor 8-like isof...    720   0.0      
ref|XP_010675200.1|  PREDICTED: auxin response factor 8 isoform X2      717   0.0      
ref|XP_004490754.1|  PREDICTED: auxin response factor 8-like            719   0.0      
ref|XP_004162834.1|  PREDICTED: auxin response factor 8-like            719   0.0      
ref|XP_008813049.1|  PREDICTED: auxin response factor 12-like iso...    717   0.0      
ref|XP_010675199.1|  PREDICTED: auxin response factor 8 isoform X1      717   0.0      
gb|AFQ94050.1|  auxin response factor 1                                 717   0.0      
emb|CDP01733.1|  unnamed protein product                                718   0.0      
ref|XP_007032138.1|  Auxin response factor 8-1                          717   0.0      
ref|XP_004288583.1|  PREDICTED: auxin response factor 8-like isof...    715   0.0      
gb|ADG43143.1|  auxin response factor 9                                 719   0.0      
ref|NP_001146279.1|  uncharacterized protein LOC100279854               719   0.0      Zea mays [maize]
ref|XP_011048868.1|  PREDICTED: auxin response factor 8-like            716   0.0      
ref|XP_002305917.2|  hypothetical protein POPTR_0004s07640g             715   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010935427.1|  PREDICTED: auxin response factor 12-like iso...    714   0.0      
ref|XP_009341867.1|  PREDICTED: auxin response factor 8-like isof...    715   0.0      
ref|XP_006847975.1|  hypothetical protein AMTR_s00029p00157690          715   0.0      
gb|KHN41019.1|  Auxin response factor 8                                 714   0.0      
ref|XP_008227867.1|  PREDICTED: LOW QUALITY PROTEIN: auxin respon...    713   0.0      
dbj|BAB85914.1|  auxin response factor 6a                               696   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_008348621.1|  PREDICTED: auxin response factor 8-like            713   0.0      
gb|EPS62844.1|  auxin response factor 8-1                               698   0.0      
ref|XP_008804149.1|  PREDICTED: auxin response factor 12-like           711   0.0      
ref|XP_004231633.1|  PREDICTED: auxin response factor 8                 712   0.0      
ref|XP_011038345.1|  PREDICTED: auxin response factor 8-like            710   0.0      
ref|XP_009631564.1|  PREDICTED: auxin response factor 8-like isof...    711   0.0      
ref|XP_008343154.1|  PREDICTED: auxin response factor 8 isoform X2      709   0.0      
ref|XP_009370590.1|  PREDICTED: auxin response factor 8-like isof...    708   0.0      
ref|XP_008343153.1|  PREDICTED: auxin response factor 8 isoform X1      710   0.0      
ref|XP_009612885.1|  PREDICTED: auxin response factor 8-like            709   0.0      
ref|XP_008672720.1|  PREDICTED: uncharacterized protein LOC100279...    711   0.0      
ref|XP_010940284.1|  PREDICTED: LOW QUALITY PROTEIN: auxin respon...    709   0.0      
ref|XP_003600594.1|  Auxin response factor                              709   0.0      
ref|XP_010528612.1|  PREDICTED: auxin response factor 8-like            708   0.0      
ref|XP_009341866.1|  PREDICTED: auxin response factor 8-like isof...    709   0.0      
ref|XP_006430417.1|  hypothetical protein CICLE_v10011065mg             702   0.0      
ref|XP_006372462.1|  hypothetical protein POPTR_0017s01870g             707   0.0      
ref|XP_009789648.1|  PREDICTED: auxin response factor 8-like            708   0.0      
ref|XP_006350451.1|  PREDICTED: auxin response factor 8-like isof...    708   0.0      
gb|EMS45696.1|  Auxin response factor 25                                716   0.0      
ref|XP_006350452.1|  PREDICTED: auxin response factor 8-like isof...    708   0.0      
ref|XP_009370588.1|  PREDICTED: auxin response factor 8-like isof...    708   0.0      
gb|KHG06791.1|  Auxin response factor 6 -like protein                   706   0.0      
ref|XP_004500428.1|  PREDICTED: auxin response factor 8-like            708   0.0      
ref|XP_011097995.1|  PREDICTED: auxin response factor 8-like isof...    707   0.0      
ref|XP_009769535.1|  PREDICTED: auxin response factor 8-like isof...    707   0.0      
ref|XP_006430415.1|  hypothetical protein CICLE_v10011065mg             702   0.0      
ref|XP_009631563.1|  PREDICTED: auxin response factor 8-like isof...    706   0.0      
gb|KDO57334.1|  hypothetical protein CISIN_1g003544mg                   703   0.0      
ref|XP_010551611.1|  PREDICTED: auxin response factor 8-like isof...    705   0.0      
ref|XP_010551627.1|  PREDICTED: auxin response factor 8-like isof...    704   0.0      
gb|KDO57335.1|  hypothetical protein CISIN_1g003544mg                   704   0.0      
ref|XP_006481966.1|  PREDICTED: auxin response factor 8-like isof...    703   0.0      
gb|KDO57333.1|  hypothetical protein CISIN_1g003544mg                   702   0.0      
ref|XP_011097997.1|  PREDICTED: auxin response factor 8-like isof...    704   0.0      
ref|XP_010908226.1|  PREDICTED: auxin response factor 12-like           703   0.0      
gb|KDO57330.1|  hypothetical protein CISIN_1g003544mg                   703   0.0      
ref|XP_006430416.1|  hypothetical protein CICLE_v10011065mg             704   0.0      
gb|AFF60411.1|  auxin response factor 8                                 703   0.0      
ref|XP_006481965.1|  PREDICTED: auxin response factor 8-like isof...    702   0.0      
ref|NP_001234783.1|  auxin response factor 8                            703   0.0      
ref|XP_006481964.1|  PREDICTED: auxin response factor 8-like isof...    702   0.0      
ref|XP_006343312.1|  PREDICTED: auxin response factor 8-like isof...    702   0.0      
ref|XP_009769534.1|  PREDICTED: auxin response factor 8-like isof...    702   0.0      
gb|KDO57331.1|  hypothetical protein CISIN_1g003544mg                   697   0.0      
ref|XP_006580853.1|  PREDICTED: auxin response factor 6-like            699   0.0      
ref|NP_001234552.1|  auxin response factor 8-1                          697   0.0      
ref|XP_010549536.1|  PREDICTED: auxin response factor 6-like            696   0.0      
ref|XP_011097999.1|  PREDICTED: auxin response factor 8-like isof...    694   0.0      
ref|XP_008648947.1|  PREDICTED: auxin response factor 17-like iso...    676   0.0      
ref|XP_006350449.1|  PREDICTED: auxin response factor 8-like isof...    689   0.0      
ref|XP_009382091.1|  PREDICTED: auxin response factor 12-like           688   0.0      
gb|EYU19157.1|  hypothetical protein MIMGU_mgv1a001449mg                688   0.0      
ref|XP_006653864.1|  PREDICTED: auxin response factor 12-like           687   0.0      
ref|XP_006350450.1|  PREDICTED: auxin response factor 8-like isof...    689   0.0      
gb|AEV41129.1|  putative auxin response factor                          687   0.0      
gb|AEV41081.1|  putative auxin response factor                          687   0.0      
dbj|BAB85918.1|  auxin response factor 8                                686   0.0      
gb|AEV40985.1|  putative auxin response factor                          687   0.0      
gb|KHN39511.1|  Auxin response factor 8                                 687   0.0      
gb|AEV41036.1|  putative auxin response factor                          686   0.0      
sp|Q258Y5.1|ARFL_ORYSI  RecName: Full=Auxin response factor 12; A...    685   0.0      
ref|NP_001054222.1|  Os04g0671900                                       685   0.0      
ref|XP_008813064.1|  PREDICTED: auxin response factor 12-like iso...    672   0.0      
ref|XP_011098000.1|  PREDICTED: auxin response factor 8-like isof...    683   0.0      
ref|XP_009105160.1|  PREDICTED: auxin response factor 8-like            679   0.0      
emb|CDY07460.1|  BnaA07g25390D                                          679   0.0      
tpg|DAA35416.1|  TPA: hypothetical protein ZEAMMB73_535909              680   0.0      
tpg|DAA35415.1|  TPA: hypothetical protein ZEAMMB73_535909              679   0.0      
ref|XP_004960119.1|  PREDICTED: auxin response factor 12-like iso...    679   0.0      
ref|XP_008662153.1|  PREDICTED: uncharacterized protein LOC100382...    678   0.0      
ref|XP_006282446.1|  hypothetical protein CARUB_v10004139mg             677   0.0      
gb|ADG43164.1|  auxin response factor 30                                676   0.0      
ref|XP_010440819.1|  PREDICTED: auxin response factor 8-like isof...    676   0.0      
emb|CDY39274.1|  BnaC06g27170D                                          674   0.0      
ref|XP_010450468.1|  PREDICTED: auxin response factor 8 isoform X2      676   0.0      
ref|XP_010435545.1|  PREDICTED: auxin response factor 8-like            675   0.0      
ref|XP_006391521.1|  hypothetical protein EUTSA_v10018139mg             674   0.0      
ref|NP_001078672.1|  auxin response factor 8                            672   0.0      
gb|EEC78229.1|  hypothetical protein OsI_17874                          675   0.0      
gb|ADG43137.1|  auxin response factor 3                                 673   0.0      
ref|XP_009397956.1|  PREDICTED: auxin response factor 12-like iso...    672   0.0      
dbj|BAB08972.1|  auxin responsive transcription factor                  672   0.0      
ref|NP_198518.1|  auxin response factor 8                               672   0.0      
ref|XP_002870511.1|  hypothetical protein ARALYDRAFT_493698             671   0.0      
emb|CDX74594.1|  BnaA04g07950D                                          671   0.0      
ref|XP_009139709.1|  PREDICTED: auxin response factor 8 isoform X2      671   0.0      
emb|CBA11997.1|  putative auxin response factor 6                       671   0.0      
ref|XP_003580798.1|  PREDICTED: auxin response factor 12                670   0.0      
emb|CBA11998.1|  putative auxin response factor 8                       666   0.0      
ref|XP_009139708.1|  PREDICTED: auxin response factor 8 isoform X1      665   0.0      
emb|CDY53537.1|  BnaCnng25410D                                          664   0.0      
ref|XP_004951872.1|  PREDICTED: auxin response factor 6-like isof...    662   0.0      
emb|CBA12003.1|  putative auxin response factor 6/8                     660   0.0      
gb|EMT32630.1|  Auxin response factor 6                                 657   0.0      
ref|XP_008679931.1|  PREDICTED: auxin response factor 6 isoform X3      655   0.0      
gb|EMS45463.1|  Auxin response factor 6                                 656   0.0      
emb|CBA12002.1|  putative auxin response factor 6/8                     655   0.0      
ref|XP_008662154.1|  PREDICTED: uncharacterized protein LOC100382...    650   0.0      
gb|EPS61990.1|  auxin response factor 6-1                               634   0.0      
ref|XP_009139710.1|  PREDICTED: auxin response factor 8 isoform X3      644   0.0      
gb|KDO57329.1|  hypothetical protein CISIN_1g003544mg                   641   0.0      
gb|EMS51666.1|  Auxin response factor 17                                632   0.0      
ref|XP_008381532.1|  PREDICTED: auxin response factor 8-like            612   0.0      
ref|XP_009769536.1|  PREDICTED: auxin response factor 8-like isof...    629   0.0      
gb|KDO57328.1|  hypothetical protein CISIN_1g003544mg                   627   0.0      
ref|XP_006594518.1|  PREDICTED: auxin response factor 6-like isof...    628   0.0      
gb|KEH20527.1|  auxin response factor 2                                 626   0.0      
ref|XP_006597510.1|  PREDICTED: auxin response factor 6-like isof...    625   0.0      
ref|XP_008813080.1|  PREDICTED: auxin response factor 12-like iso...    603   0.0      
ref|XP_008813071.1|  PREDICTED: auxin response factor 12-like iso...    604   0.0      
ref|XP_002447305.1|  hypothetical protein SORBIDRAFT_06g032500          617   0.0      
gb|EMT27817.1|  Auxin response factor 12                                593   0.0      
gb|KCW89824.1|  hypothetical protein EUGRSUZ_A020651                    571   0.0      
ref|XP_009384197.1|  PREDICTED: auxin response factor 17-like iso...    590   0.0      
ref|XP_007024964.1|  Auxin response factor 6 isoform 3                  585   0.0      
gb|KCW89825.1|  hypothetical protein EUGRSUZ_A020651                    562   0.0      
gb|KCW89823.1|  hypothetical protein EUGRSUZ_A020651                    561   0.0      
emb|CAE03604.2|  OSJNBb0004A17.6                                        580   0.0      
gb|EYU25686.1|  hypothetical protein MIMGU_mgv1a002020mg                573   0.0      
gb|KDO57332.1|  hypothetical protein CISIN_1g003544mg                   571   0.0      
ref|XP_001771109.1|  predicted protein                                  555   0.0      
ref|XP_006575467.1|  PREDICTED: auxin response factor 8-like isof...    568   0.0      
ref|XP_009395459.1|  PREDICTED: auxin response factor 6-like            562   0.0      
ref|XP_001764067.1|  predicted protein                                  571   0.0      
ref|XP_001769883.1|  predicted protein                                  553   0.0      
ref|XP_001766666.1|  predicted protein                                  550   0.0      
gb|EMT11111.1|  Auxin response factor 17                                564   3e-180   
ref|XP_001773496.1|  predicted protein                                  566   9e-178   
gb|KHG29290.1|  Auxin response factor 12                                556   3e-176   
ref|XP_011097996.1|  PREDICTED: auxin response factor 8-like isof...    547   4e-175   
ref|XP_006282445.1|  hypothetical protein CARUB_v10004139mg             546   6e-175   
ref|XP_002990954.1|  hypothetical protein SELMODRAFT_451392             548   2e-174   
ref|XP_002982854.1|  hypothetical protein SELMODRAFT_179736             548   2e-174   
ref|XP_010450467.1|  PREDICTED: auxin response factor 8 isoform X1      545   3e-174   
ref|XP_002436642.1|  hypothetical protein SORBIDRAFT_10g006440          550   2e-173   
ref|XP_006343313.1|  PREDICTED: auxin response factor 8-like isof...    542   4e-173   
ref|XP_010317649.1|  PREDICTED: auxin response factor 8-1 isoform X1    540   3e-172   
ref|XP_001752898.1|  predicted protein                                  532   3e-169   
gb|KHG01922.1|  Auxin response factor 19                                519   6e-169   
emb|CBI27770.3|  unnamed protein product                                535   8e-169   
ref|XP_010273878.1|  PREDICTED: auxin response factor 7-like            541   8e-169   
ref|XP_002984982.1|  hypothetical protein SELMODRAFT_451395             533   2e-168   
ref|XP_002986171.1|  hypothetical protein SELMODRAFT_451397             531   6e-168   
sp|A3B9A0.1|ARFP_ORYSJ  RecName: Full=Auxin response factor 16          538   1e-167   
ref|XP_010263344.1|  PREDICTED: auxin response factor 19-like iso...    541   1e-167   
ref|XP_003564148.1|  PREDICTED: auxin response factor 16 isoform X1     537   2e-167   
sp|A2YAA5.1|ARFP_ORYSI  RecName: Full=Auxin response factor 16          536   6e-167   
ref|XP_010656094.1|  PREDICTED: auxin response factor 7-like isof...    537   2e-166   
dbj|BAK05459.1|  predicted protein                                      531   3e-166   
ref|XP_008337825.1|  PREDICTED: auxin response factor 19-like iso...    536   4e-166   
ref|XP_006381580.1|  hypothetical protein POPTR_0006s14070g             534   4e-166   
ref|XP_008659167.1|  PREDICTED: auxin response factor 16 isoform X1     532   1e-165   
ref|XP_008337824.1|  PREDICTED: auxin response factor 19-like iso...    535   1e-165   
ref|XP_004964586.1|  PREDICTED: auxin response factor 16-like           532   1e-165   
gb|KHG17185.1|  Auxin response factor 19                                510   1e-165   
ref|XP_006381583.1|  hypothetical protein POPTR_0006s14070g             535   2e-165   
ref|XP_011039940.1|  PREDICTED: auxin response factor 19-like iso...    533   2e-165   
ref|XP_006381581.1|  auxin response factor 1 family protein             534   2e-165   
ref|XP_011093873.1|  PREDICTED: auxin response factor 19                532   2e-165   
ref|XP_011039938.1|  PREDICTED: auxin response factor 19-like iso...    533   3e-165   
ref|XP_006656735.1|  PREDICTED: auxin response factor 16-like           530   5e-165   
ref|XP_009594540.1|  PREDICTED: auxin response factor 19-like           531   6e-165   
ref|XP_002984990.1|  hypothetical protein SELMODRAFT_181404             525   4e-164   
ref|XP_002986179.1|  hypothetical protein SELMODRAFT_182255             525   6e-164   
ref|XP_010687537.1|  PREDICTED: auxin response factor 7 isoform X2      530   7e-164   
ref|XP_010687536.1|  PREDICTED: auxin response factor 7 isoform X1      530   7e-164   
ref|XP_009762809.1|  PREDICTED: auxin response factor 19-like iso...    528   8e-164   
emb|CBI24055.3|  unnamed protein product                                526   9e-164   
gb|KEH32422.1|  auxin response factor 2                                 528   9e-164   
ref|XP_003609970.1|  Auxin response factor                              529   1e-163   
ref|XP_002516230.1|  Auxin response factor, putative                    528   1e-163   
gb|EYU28308.1|  hypothetical protein MIMGU_mgv1a001526mg                519   1e-163   
ref|XP_006381584.1|  hypothetical protein POPTR_0006s14070g             529   2e-163   
ref|XP_011039939.1|  PREDICTED: auxin response factor 19-like iso...    528   2e-163   
ref|XP_010917437.1|  PREDICTED: auxin response factor 16-like iso...    526   3e-163   
ref|XP_010656700.1|  PREDICTED: auxin response factor 19-like           527   6e-163   
ref|XP_007012579.1|  Transcriptional factor B3 family protein / a...    527   1e-162   
ref|XP_007012578.1|  Transcriptional factor B3 family protein / a...    527   1e-162   
ref|XP_010089663.1|  Auxin response factor 19                           526   2e-162   
ref|XP_010271412.1|  PREDICTED: auxin response factor 5-like            520   2e-162   
gb|KDP27747.1|  hypothetical protein JCGZ_19776                         525   3e-162   
ref|XP_009390465.1|  PREDICTED: auxin response factor 19-like iso...    525   4e-162   
ref|XP_003542373.1|  PREDICTED: auxin response factor 19-like           525   6e-162   
ref|XP_010259931.1|  PREDICTED: auxin response factor 19-like           524   7e-162   
gb|KHN07880.1|  Auxin response factor 19                                524   8e-162   
ref|XP_007014532.1|  Transcriptional factor B3 family protein / a...    523   1e-161   
ref|XP_008460049.1|  PREDICTED: auxin response factor 19 isoform X3     520   1e-161   
ref|XP_003533798.1|  PREDICTED: auxin response factor 19-like           523   2e-161   
gb|KHN12303.1|  Auxin response factor 19                                523   2e-161   
ref|XP_004243692.1|  PREDICTED: auxin response factor 7                 523   2e-161   
ref|XP_007014531.1|  Transcriptional factor B3 family protein / a...    523   2e-161   
ref|XP_004508018.1|  PREDICTED: auxin response factor 19-like iso...    523   3e-161   
ref|XP_002307706.2|  hypothetical protein POPTR_0005s25800g             516   3e-161   
dbj|BAD19061.1|  auxin response factor 1                                521   4e-161   
ref|XP_010541969.1|  PREDICTED: auxin response factor 19-like           521   4e-161   
ref|XP_004157943.1|  PREDICTED: auxin response factor 19-like           521   4e-161   
ref|XP_007203220.1|  hypothetical protein PRUPE_ppa000708mg             519   5e-161   
gb|AGH32870.1|  auxin response factor 5                                 521   5e-161   
ref|XP_006365636.1|  PREDICTED: auxin response factor 19-like           521   6e-161   
ref|NP_001234740.1|  auxin response factor 19                           521   6e-161   
gb|KDP33949.1|  hypothetical protein JCGZ_07520                         522   6e-161   
gb|KDO73824.1|  hypothetical protein CISIN_1g001728mg                   519   6e-161   
ref|XP_009620963.1|  PREDICTED: auxin response factor 19-like           520   7e-161   
gb|KDO73826.1|  hypothetical protein CISIN_1g001728mg                   518   7e-161   
ref|XP_003551063.1|  PREDICTED: auxin response factor 19-like           522   8e-161   
ref|XP_006381166.1|  hypothetical protein POPTR_0006s07740g             521   8e-161   
ref|XP_011094057.1|  PREDICTED: auxin response factor 19-like           521   1e-160   
gb|KDO73825.1|  hypothetical protein CISIN_1g001728mg                   518   1e-160   
gb|ABO33637.1|  auxin response factor                                   521   1e-160   
emb|CDP03049.1|  unnamed protein product                                520   1e-160   
gb|KHN17743.1|  Auxin response factor 7                                 523   1e-160   
ref|XP_009418004.1|  PREDICTED: auxin response factor 16 isoform X2     518   1e-160   
ref|XP_009418003.1|  PREDICTED: auxin response factor 16 isoform X1     518   2e-160   
ref|XP_006473629.1|  PREDICTED: auxin response factor 5-like isof...    515   2e-160   
ref|XP_010927183.1|  PREDICTED: auxin response factor 19-like iso...    520   2e-160   
ref|XP_006473628.1|  PREDICTED: auxin response factor 5-like isof...    515   2e-160   
ref|XP_010929405.1|  PREDICTED: auxin response factor 19-like iso...    520   3e-160   
ref|XP_008792838.1|  PREDICTED: auxin response factor 16-like           520   3e-160   
ref|XP_006452860.1|  hypothetical protein CICLE_v10007286mg             520   3e-160   
ref|XP_011083507.1|  PREDICTED: auxin response factor 5                 514   4e-160   
ref|XP_008460042.1|  PREDICTED: auxin response factor 19 isoform X2     519   4e-160   
ref|XP_009359710.1|  PREDICTED: auxin response factor 19                519   4e-160   
ref|XP_004508019.1|  PREDICTED: auxin response factor 19-like iso...    519   5e-160   
ref|XP_006435146.1|  hypothetical protein CICLE_v10000183mg             514   5e-160   
gb|KDP36947.1|  hypothetical protein JCGZ_08238                         514   5e-160   
ref|XP_011019970.1|  PREDICTED: auxin response factor 19-like           518   6e-160   
gb|EYU38831.1|  hypothetical protein MIMGU_mgv1a002956mg                503   7e-160   
ref|XP_008460034.1|  PREDICTED: auxin response factor 19 isoform X1     518   7e-160   
ref|XP_003634382.2|  PREDICTED: auxin response factor 5                 513   9e-160   
ref|XP_003546519.1|  PREDICTED: auxin response factor 19-like           518   1e-159   
ref|XP_006353789.1|  PREDICTED: auxin response factor 7-like            519   1e-159   
ref|XP_010106948.1|  Auxin response factor 5                            518   1e-159   
ref|XP_009778804.1|  PREDICTED: auxin response factor 5                 512   1e-159   
ref|XP_009791842.1|  PREDICTED: auxin response factor 19-like           517   1e-159   
ref|XP_006416527.1|  hypothetical protein EUTSA_v10006635mg             517   1e-159   
gb|KHN42790.1|  Auxin response factor 19                                518   1e-159   
gb|KCW81920.1|  hypothetical protein EUGRSUZ_C03293                     518   1e-159   
ref|XP_009417514.1|  PREDICTED: auxin response factor 19-like           518   1e-159   
ref|XP_010049373.1|  PREDICTED: auxin response factor 19-like iso...    518   1e-159   
ref|XP_011045124.1|  PREDICTED: auxin response factor 5-like            513   2e-159   
ref|XP_006474691.1|  PREDICTED: auxin response factor 7-like isof...    518   2e-159   
ref|XP_007138629.1|  hypothetical protein PHAVU_009G224800g             517   2e-159   
gb|AHC30881.1|  auxin response factor                                   512   2e-159   
ref|XP_006474692.1|  PREDICTED: auxin response factor 7-like isof...    517   3e-159   
ref|XP_010246955.1|  PREDICTED: auxin response factor 5-like isof...    512   3e-159   
ref|XP_006850956.1|  hypothetical protein AMTR_s00025p00198750          519   3e-159   
gb|EYU36774.1|  hypothetical protein MIMGU_mgv1a001550mg                507   3e-159   
ref|XP_008242274.1|  PREDICTED: auxin response factor 7-like isof...    518   3e-159   
ref|XP_008242275.1|  PREDICTED: auxin response factor 7-like isof...    518   3e-159   
ref|XP_010261758.1|  PREDICTED: auxin response factor 19-like iso...    515   3e-159   
ref|XP_010246954.1|  PREDICTED: auxin response factor 5-like isof...    512   3e-159   
ref|XP_011006174.1|  PREDICTED: auxin response factor 19-like iso...    513   4e-159   
ref|NP_001234545.1|  auxin response factor 5                            511   4e-159   
ref|XP_004508020.1|  PREDICTED: auxin response factor 19-like iso...    516   4e-159   
ref|XP_007154558.1|  hypothetical protein PHAVU_003G128800g             518   4e-159   
ref|XP_006342026.1|  PREDICTED: auxin response factor 5-like            511   5e-159   
ref|XP_010061492.1|  PREDICTED: auxin response factor 5 isoform X2      511   5e-159   
ref|XP_004499235.1|  PREDICTED: auxin response factor 5-like            510   6e-159   
ref|XP_010535799.1|  PREDICTED: auxin response factor 7-like            516   7e-159   



>ref|XP_009602213.1| PREDICTED: auxin response factor 6-like isoform X1 [Nicotiana 
tomentosiformis]
Length=893

 Score =  1315 bits (3403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 705/898 (79%), Positives = 769/898 (86%), Gaps = 15/898 (2%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MRVS AG NPQ EE TGEKKCLNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRVSSAGFNPQPEEATGEKKCLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  60

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YPGLP QLICQLHN+TMHAD ETDEVYAQMTLQPLSAQEQKDVCLLPAELG
Sbjct  61    KEVDAHIPNYPGLPPQLICQLHNLTMHADVETDEVYAQMTLQPLSAQEQKDVCLLPAELG  120

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPP QELIAKDLHGNEW
Sbjct  121   IPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPCQELIAKDLHGNEW  180

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS
Sbjct  181   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  240

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKYAKAVYHTR+SVGMR
Sbjct  241   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYAKAVYHTRISVGMR  300

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  301   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  360

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPFSLRLKRPWPSGLPS PG  NG+M ++SPLSWLRG++GDQGIQSLNFQG
Sbjct  361   PLTTFPMYPSPFSLRLKRPWPSGLPSLPGFPNGNMTMNSPLSWLRGDIGDQGIQSLNFQG  420

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMATldssklasqqsllqfqqsipsssssliqsqml  2007
             YG+TPFMQPR+DASMLGLQPDI QTMA LD SKLA+Q  +   Q     S+S      + 
Sbjct  421   YGVTPFMQPRIDASMLGLQPDILQTMAALDPSKLANQSFMQFQQSIPGGSASLSHSQILQ  480

Query  2008  qRPHPQQNLLQSFQENQVISqaqilqqqlqrqqsyneqqqqqlhpppiqqfqeqqqM---  2178
                  QQNLL  F ENQ+ISQAQ+LQQQLQR+Q+YN+QQQ         Q     Q    
Sbjct  481   PS-LSQQNLLHGFSENQLISQAQMLQQQLQRRQNYNDQQQLLQPQLQQHQEVNSSQFQHQ  539

Query  2179  --SKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSH  2352
               +K ++SL +M S  Q QLSH Q LSST   Q+FSD++GNHV  S+NS+ QSL  SFS 
Sbjct  540   QQTKAMSSLSQMTSAAQPQLSHLQVLSSTGSPQTFSDILGNHVNASSNSTMQSLLSSFSR  599

Query  2353  DEASQLLNMHETNPLA--TLPSKRIALESQVSSRATPYVVSQ-ADMISPNSKVSDLPTFL  2523
             D AS +LNMHE +PL   +  SKRIALESQ+ SR TP+ V Q  D+IS N+KVSDL + L
Sbjct  600   DGASAVLNMHEAHPLVSSSSSSKRIALESQLPSRVTPFAVPQPEDVISHNTKVSDLSSLL  659

Query  2524  PPFPGKE-FPEYQGVAYSQGNNALLGVNTDSSILLQNGISNLKNSGGENGFLNMPFSTCN  2700
             PPFPG+E F +Y+GV  SQ N+AL G NTDS  +LQNG+SN+K+S G+NG L++P++T  
Sbjct  660   PPFPGRESFSDYRGVEDSQ-NSALYGFNTDSLNILQNGMSNMKDSSGDNGSLSIPYATST  718

Query  2701  FTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISK  2880
             FT+ VG +YP+N DM TSSCVDESGFLQSSEN DQANP NRTFVKVHKSGSFGRSLDISK
Sbjct  719   FTNTVGNEYPINSDMTTSSCVDESGFLQSSENGDQANPTNRTFVKVHKSGSFGRSLDISK  778

Query  2881  FSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKI  3060
             FSSYHELRSELA MFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKI
Sbjct  779   FSSYHELRSELAHMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKI  838

Query  3061  LSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRN-MNGIPLGSLDY  3231
             LSP EV QMGK  G+DLPN   A  QRLP+ G  C+ +++QK +RN MNGIPLGSLDY
Sbjct  839   LSPLEVQQMGK-AGLDLPNAGQA--QRLPSNGVGCDDYMNQKGSRNTMNGIPLGSLDY  893



>ref|XP_009757615.1| PREDICTED: auxin response factor 6-like isoform X1 [Nicotiana 
sylvestris]
Length=893

 Score =  1311 bits (3394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 702/898 (78%), Positives = 767/898 (85%), Gaps = 15/898 (2%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MRVS AG NPQ EE  GEKKCLNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRVSSAGFNPQPEEAAGEKKCLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  60

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YPGLP QLICQLHN+TMHAD ETDEVYAQMTLQPLSAQEQKDVCLLPAELG
Sbjct  61    KEVDAHIPNYPGLPPQLICQLHNLTMHADVETDEVYAQMTLQPLSAQEQKDVCLLPAELG  120

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPP QELIAKDLHGNEW
Sbjct  121   IPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPCQELIAKDLHGNEW  180

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS
Sbjct  181   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  240

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKYAKAVYHTR+SVGMR
Sbjct  241   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYAKAVYHTRISVGMR  300

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  301   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  360

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPFSLRLKRPWPSGLPS PG  NGDM ++SPLSWLRG++GDQGIQSLNFQG
Sbjct  361   PLTTFPMYPSPFSLRLKRPWPSGLPSLPGFPNGDMTMNSPLSWLRGDIGDQGIQSLNFQG  420

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMATldssklasqqsllqfqqsipsssssliqsqml  2007
             YG+TPFMQPR+DASMLGLQPDI QTMA LD SKLA+Q  +   Q     S+S      + 
Sbjct  421   YGVTPFMQPRIDASMLGLQPDILQTMAALDPSKLANQSFMQFQQSIPGGSASLSHSQILQ  480

Query  2008  qRPHPQQNLLQSFQENQVISqaqilqqqlqrqqsyneqqqqqlhpppiqqfqeqqqM---  2178
                H QQNLL  F ENQ+ISQAQ+LQQQLQR+Q+YN+QQQ         Q     Q    
Sbjct  481   PS-HSQQNLLHGFSENQLISQAQMLQQQLQRRQNYNDQQQLLQPQLQQHQEVNSSQFQHQ  539

Query  2179  --SKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSH  2352
               +K ++SL +M S  Q QLSH + LSST   Q+FSD++GNHV  S+NS+ QSL  SFS 
Sbjct  540   QQTKAMSSLSQMTSAAQPQLSHLRVLSSTGSPQTFSDILGNHVNASSNSTMQSLLSSFSR  599

Query  2353  DEASQLLNMHETNPLA--TLPSKRIALESQVSSRATPYVVSQ-ADMISPNSKVSDLPTFL  2523
             D AS +LNMHE +PL   +  SKRIALESQ+ SR TP+ V Q  D+IS N+KVSDL + L
Sbjct  600   DGASAVLNMHEAHPLVSSSSSSKRIALESQLPSRVTPFAVPQPEDVISHNTKVSDLSSLL  659

Query  2524  PPFPGKE-FPEYQGVAYSQGNNALLGVNTDSSILLQNGISNLKNSGGENGFLNMPFSTCN  2700
             PPFPG+E F +Y+GV  SQ NNAL G NTDS  +L NG+SN+K+S G+NG L++P++T  
Sbjct  660   PPFPGRESFSDYRGVEDSQ-NNALYGFNTDSLNILPNGMSNMKDSSGDNGSLSIPYATST  718

Query  2701  FTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISK  2880
             FT+ VG +YP+N DM TSSCVDESGFLQSSEN DQ NP NRTFVKVHKSGSFGRSLDISK
Sbjct  719   FTNTVGNEYPINSDMTTSSCVDESGFLQSSENGDQGNPTNRTFVKVHKSGSFGRSLDISK  778

Query  2881  FSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKI  3060
             FSSYHELRSELA MFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKI
Sbjct  779   FSSYHELRSELAHMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKI  838

Query  3061  LSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRN-MNGIPLGSLDY  3231
             LSP EV QMGK +G+DLPN      QRLP+ G  C+ +++QK ++N MNGIPLGSLDY
Sbjct  839   LSPLEVQQMGK-DGLDLPN--AGLVQRLPSNGVGCDDYMNQKGSQNAMNGIPLGSLDY  893



>ref|XP_009602214.1| PREDICTED: auxin response factor 6-like isoform X2 [Nicotiana 
tomentosiformis]
Length=892

 Score =  1308 bits (3386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 704/898 (78%), Positives = 768/898 (86%), Gaps = 16/898 (2%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MRVS AG NPQ EE  GEKKCLNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRVSSAGFNPQPEEA-GEKKCLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  59

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YPGLP QLICQLHN+TMHAD ETDEVYAQMTLQPLSAQEQKDVCLLPAELG
Sbjct  60    KEVDAHIPNYPGLPPQLICQLHNLTMHADVETDEVYAQMTLQPLSAQEQKDVCLLPAELG  119

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPP QELIAKDLHGNEW
Sbjct  120   IPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPCQELIAKDLHGNEW  179

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS
Sbjct  180   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  239

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKYAKAVYHTR+SVGMR
Sbjct  240   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYAKAVYHTRISVGMR  299

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  300   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  359

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPFSLRLKRPWPSGLPS PG  NG+M ++SPLSWLRG++GDQGIQSLNFQG
Sbjct  360   PLTTFPMYPSPFSLRLKRPWPSGLPSLPGFPNGNMTMNSPLSWLRGDIGDQGIQSLNFQG  419

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMATldssklasqqsllqfqqsipsssssliqsqml  2007
             YG+TPFMQPR+DASMLGLQPDI QTMA LD SKLA+Q  +   Q     S+S      + 
Sbjct  420   YGVTPFMQPRIDASMLGLQPDILQTMAALDPSKLANQSFMQFQQSIPGGSASLSHSQILQ  479

Query  2008  qRPHPQQNLLQSFQENQVISqaqilqqqlqrqqsyneqqqqqlhpppiqqfqeqqqM---  2178
                  QQNLL  F ENQ+ISQAQ+LQQQLQR+Q+YN+QQQ         Q     Q    
Sbjct  480   PS-LSQQNLLHGFSENQLISQAQMLQQQLQRRQNYNDQQQLLQPQLQQHQEVNSSQFQHQ  538

Query  2179  --SKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSH  2352
               +K ++SL +M S  Q QLSH Q LSST   Q+FSD++GNHV  S+NS+ QSL  SFS 
Sbjct  539   QQTKAMSSLSQMTSAAQPQLSHLQVLSSTGSPQTFSDILGNHVNASSNSTMQSLLSSFSR  598

Query  2353  DEASQLLNMHETNPLA--TLPSKRIALESQVSSRATPYVVSQ-ADMISPNSKVSDLPTFL  2523
             D AS +LNMHE +PL   +  SKRIALESQ+ SR TP+ V Q  D+IS N+KVSDL + L
Sbjct  599   DGASAVLNMHEAHPLVSSSSSSKRIALESQLPSRVTPFAVPQPEDVISHNTKVSDLSSLL  658

Query  2524  PPFPGKE-FPEYQGVAYSQGNNALLGVNTDSSILLQNGISNLKNSGGENGFLNMPFSTCN  2700
             PPFPG+E F +Y+GV  SQ N+AL G NTDS  +LQNG+SN+K+S G+NG L++P++T  
Sbjct  659   PPFPGRESFSDYRGVEDSQ-NSALYGFNTDSLNILQNGMSNMKDSSGDNGSLSIPYATST  717

Query  2701  FTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISK  2880
             FT+ VG +YP+N DM TSSCVDESGFLQSSEN DQANP NRTFVKVHKSGSFGRSLDISK
Sbjct  718   FTNTVGNEYPINSDMTTSSCVDESGFLQSSENGDQANPTNRTFVKVHKSGSFGRSLDISK  777

Query  2881  FSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKI  3060
             FSSYHELRSELA MFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKI
Sbjct  778   FSSYHELRSELAHMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKI  837

Query  3061  LSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRN-MNGIPLGSLDY  3231
             LSP EV QMGK  G+DLPN   A  QRLP+ G  C+ +++QK +RN MNGIPLGSLDY
Sbjct  838   LSPLEVQQMGK-AGLDLPNAGQA--QRLPSNGVGCDDYMNQKGSRNTMNGIPLGSLDY  892



>ref|XP_009757616.1| PREDICTED: auxin response factor 6-like isoform X2 [Nicotiana 
sylvestris]
Length=892

 Score =  1307 bits (3382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 702/898 (78%), Positives = 767/898 (85%), Gaps = 16/898 (2%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MRVS AG NPQ EE  GEKKCLNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRVSSAGFNPQPEEA-GEKKCLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  59

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YPGLP QLICQLHN+TMHAD ETDEVYAQMTLQPLSAQEQKDVCLLPAELG
Sbjct  60    KEVDAHIPNYPGLPPQLICQLHNLTMHADVETDEVYAQMTLQPLSAQEQKDVCLLPAELG  119

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPP QELIAKDLHGNEW
Sbjct  120   IPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPCQELIAKDLHGNEW  179

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS
Sbjct  180   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  239

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKYAKAVYHTR+SVGMR
Sbjct  240   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYAKAVYHTRISVGMR  299

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  300   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  359

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPFSLRLKRPWPSGLPS PG  NGDM ++SPLSWLRG++GDQGIQSLNFQG
Sbjct  360   PLTTFPMYPSPFSLRLKRPWPSGLPSLPGFPNGDMTMNSPLSWLRGDIGDQGIQSLNFQG  419

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMATldssklasqqsllqfqqsipsssssliqsqml  2007
             YG+TPFMQPR+DASMLGLQPDI QTMA LD SKLA+Q  +   Q     S+S      + 
Sbjct  420   YGVTPFMQPRIDASMLGLQPDILQTMAALDPSKLANQSFMQFQQSIPGGSASLSHSQILQ  479

Query  2008  qRPHPQQNLLQSFQENQVISqaqilqqqlqrqqsyneqqqqqlhpppiqqfqeqqqM---  2178
                H QQNLL  F ENQ+ISQAQ+LQQQLQR+Q+YN+QQQ         Q     Q    
Sbjct  480   PS-HSQQNLLHGFSENQLISQAQMLQQQLQRRQNYNDQQQLLQPQLQQHQEVNSSQFQHQ  538

Query  2179  --SKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSH  2352
               +K ++SL +M S  Q QLSH + LSST   Q+FSD++GNHV  S+NS+ QSL  SFS 
Sbjct  539   QQTKAMSSLSQMTSAAQPQLSHLRVLSSTGSPQTFSDILGNHVNASSNSTMQSLLSSFSR  598

Query  2353  DEASQLLNMHETNPLA--TLPSKRIALESQVSSRATPYVVSQ-ADMISPNSKVSDLPTFL  2523
             D AS +LNMHE +PL   +  SKRIALESQ+ SR TP+ V Q  D+IS N+KVSDL + L
Sbjct  599   DGASAVLNMHEAHPLVSSSSSSKRIALESQLPSRVTPFAVPQPEDVISHNTKVSDLSSLL  658

Query  2524  PPFPGKE-FPEYQGVAYSQGNNALLGVNTDSSILLQNGISNLKNSGGENGFLNMPFSTCN  2700
             PPFPG+E F +Y+GV  SQ NNAL G NTDS  +L NG+SN+K+S G+NG L++P++T  
Sbjct  659   PPFPGRESFSDYRGVEDSQ-NNALYGFNTDSLNILPNGMSNMKDSSGDNGSLSIPYATST  717

Query  2701  FTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISK  2880
             FT+ VG +YP+N DM TSSCVDESGFLQSSEN DQ NP NRTFVKVHKSGSFGRSLDISK
Sbjct  718   FTNTVGNEYPINSDMTTSSCVDESGFLQSSENGDQGNPTNRTFVKVHKSGSFGRSLDISK  777

Query  2881  FSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKI  3060
             FSSYHELRSELA MFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKI
Sbjct  778   FSSYHELRSELAHMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKI  837

Query  3061  LSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRN-MNGIPLGSLDY  3231
             LSP EV QMGK +G+DLPN      QRLP+ G  C+ +++QK ++N MNGIPLGSLDY
Sbjct  838   LSPLEVQQMGK-DGLDLPN--AGLVQRLPSNGVGCDDYMNQKGSQNAMNGIPLGSLDY  892



>ref|XP_006357892.1| PREDICTED: auxin response factor 6-like isoform X1 [Solanum tuberosum]
Length=893

 Score =  1298 bits (3358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 692/897 (77%), Positives = 756/897 (84%), Gaps = 13/897 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MRVS +G NPQ EE  GEKKCLNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRVSSSGFNPQQEEAAGEKKCLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  60

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YPGLP QLICQLHN+TMHAD ETDEVYAQMTLQPLS QEQKDVCLLPAELG
Sbjct  61    KEVDAHIPNYPGLPPQLICQLHNLTMHADVETDEVYAQMTLQPLSPQEQKDVCLLPAELG  120

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPP QELIAKDLHGNEW
Sbjct  121   IPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPCQELIAKDLHGNEW  180

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS
Sbjct  181   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  240

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKYAKAVYHTR+SVGMR
Sbjct  241   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYAKAVYHTRISVGMR  300

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  301   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  360

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPFSLRLKRPWPSGLPS PG  NGDM ++SPLSWLRG+MGDQG+QSLNFQG
Sbjct  361   PLTTFPMYPSPFSLRLKRPWPSGLPSLPGFPNGDMTMNSPLSWLRGDMGDQGMQSLNFQG  420

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMATldssklasqqsllqfqqsipsssssliqsqml  2007
             +G+TPFMQPR+DASMLGLQPDI QTMA LD SKLA+Q  +        SS+       + 
Sbjct  421   FGVTPFMQPRMDASMLGLQPDILQTMAALDPSKLANQSLMQFQHSIPNSSAPLSQSQMLQ  480

Query  2008  qRPHPQQNLLQSFQENQVISqaqilqqqlqr----qqsyneqqqqqlhpppiqqfqeqqq  2175
                H QQNL+Q F EN +ISQAQ+LQQQLQR           Q Q      +    + QQ
Sbjct  481   PS-HSQQNLIQGFSENHLISQAQMLQQQLQRRQNFNDQQQLLQPQLQRHQEVNSQFQHQQ  539

Query  2176  MSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHD  2355
              +K I+ L +M S T   LSH Q LSST   Q+FSD++GNHV  S+NS+ QSL  SFS D
Sbjct  540   QTKTISGLSQMASATHPHLSHLQVLSSTGSPQTFSDILGNHVNASSNSNMQSLLSSFSCD  599

Query  2356  EASQLLNMHETNPLA--TLPSKRIALESQVSSRATPYVVSQ-ADMISPNSKVSDLPTFLP  2526
              AS +LN+HET+PL   +  SKRIALESQ+ SR TP+VVSQ  D+I+ N+KVSDL + LP
Sbjct  600   GASTVLNVHETHPLVSSSSSSKRIALESQLPSRVTPFVVSQPEDVIAHNTKVSDLSSLLP  659

Query  2527  PFPGKE-FPEYQGVAYSQGNNALLGVNTDSSILLQNGISNLKNSGGENGFLNMPFSTCNF  2703
             PFP +E F +Y+GV  SQ +NAL G  TDS  +LQ G+SN+K S G+NG L++P++T  F
Sbjct  660   PFPSRESFSDYRGVEDSQ-SNALYGF-TDSLNILQTGMSNMKGSSGDNGSLSIPYATSTF  717

Query  2704  TSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKF  2883
             TS VG +YPLN DM  SSCVDESGFLQSSEN DQANP NR FVKV KSGSFGRSLDISKF
Sbjct  718   TSTVGNEYPLNSDMTASSCVDESGFLQSSENGDQANPTNRIFVKVQKSGSFGRSLDISKF  777

Query  2884  SSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKIL  3063
             SSYHELRSELARMFGLEGLLEDPERSGWQLV VDRENDVLLLGDDPWQEFVNNVWYIKIL
Sbjct  778   SSYHELRSELARMFGLEGLLEDPERSGWQLVIVDRENDVLLLGDDPWQEFVNNVWYIKIL  837

Query  3064  SPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRN-MNGIPLGSLDY  3231
             SP EV QMGK EG+DLPN + A  Q LP   + C+ +++QK +RN MNGIPLGSLDY
Sbjct  838   SPHEVQQMGK-EGLDLPNGVQAQTQTLPGNVNGCDDYMNQKGSRNTMNGIPLGSLDY  893



>gb|ADH04265.1| ARF1 [Nicotiana benthamiana]
Length=889

 Score =  1297 bits (3356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 697/898 (78%), Positives = 762/898 (85%), Gaps = 19/898 (2%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MRVS AG NPQ EE  GEKKCLNSELWHACAGPLVSLPP+GS VVYFPQGHSEQV ASTN
Sbjct  1     MRVSSAGFNPQPEEAAGEKKCLNSELWHACAGPLVSLPPVGSGVVYFPQGHSEQVAASTN  60

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YPGLP QLICQLHN+TMHAD ETDEVYAQMTLQPLSAQEQKDVCLLPAELG
Sbjct  61    KEVDAHIPNYPGLPPQLICQLHNLTMHADVETDEVYAQMTLQPLSAQEQKDVCLLPAELG  120

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPP QELIAKDLHGNEW
Sbjct  121   IPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPCQELIAKDLHGNEW  180

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS
Sbjct  181   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  240

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKYAKAVYHTR+SVGMR
Sbjct  241   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYAKAVYHTRISVGMR  300

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  301   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  360

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPFSLRLKRPWPS LP FP   NGDM ++SPLSWLRG++GDQGIQSLNFQG
Sbjct  361   PLTTFPMYPSPFSLRLKRPWPS-LPGFP---NGDMTMNSPLSWLRGDIGDQGIQSLNFQG  416

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMATldssklasqqsllqfqqsipsssssliqsqml  2007
             YG+TPFMQPR+DASMLGLQPDI QTMA LD SK A+Q  +   Q     S+S      + 
Sbjct  417   YGVTPFMQPRIDASMLGLQPDILQTMAALDPSKFANQSFMQFQQSIPGVSASLSHSQILQ  476

Query  2008  qRPHPQQNLLQSFQENQVISqaqilqqqlqrqqsyneqqqqqlhpppiqqfqeqqqM---  2178
                H QQNLL  F ENQ+ISQAQ+LQQQLQR+Q+YN+QQQ         Q     Q    
Sbjct  477   PS-HSQQNLLHGFSENQLISQAQMLQQQLQRRQNYNDQQQLLQPQLQQHQEVNSSQFQHQ  535

Query  2179  --SKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSH  2352
               +K ++SL +M S  Q QLSH Q LSST   Q+FSD++GNHV  S+NS+ QSL  SFS 
Sbjct  536   QQTKAMSSLSQMTSAAQPQLSHLQVLSSTGSPQTFSDILGNHVNASSNSTMQSLLSSFSR  595

Query  2353  DEASQLLNMHETNPLA--TLPSKRIALESQVSSRATPYVVSQ-ADMISPNSKVSDLPTFL  2523
             D AS +LNMHE +PL   +  SKRIALESQ+ SR TP+ V Q  D+IS N+KVSDL + L
Sbjct  596   DGASAVLNMHEAHPLVSSSSSSKRIALESQLPSRVTPFAVPQPEDVISHNTKVSDLSSLL  655

Query  2524  PPFPGKE-FPEYQGVAYSQGNNALLGVNTDSSILLQNGISNLKNSGGENGFLNMPFSTCN  2700
             PP PG+E F +Y+GV  SQ NNA+ G NTD   +LQNG+SN+K+S G+NG L++P++T  
Sbjct  656   PPLPGRESFSDYRGVEDSQ-NNAMYGFNTDCLNILQNGMSNMKDSTGDNGSLSIPYATST  714

Query  2701  FTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISK  2880
             FT+ VG +YP+N DM TSSCVDESGFLQSSEN DQ NP NRTFVKVHKSGSFGRSLDISK
Sbjct  715   FTNTVGNEYPINSDMTTSSCVDESGFLQSSENGDQRNPTNRTFVKVHKSGSFGRSLDISK  774

Query  2881  FSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKI  3060
             FS+YHELRSELA MFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKI
Sbjct  775   FSNYHELRSELAHMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKI  834

Query  3061  LSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRN-MNGIPLGSLDY  3231
             LSP EV QMGK +G+DLPN      QRLP+ G  C+ +++QK +RN MNGIPLGSLDY
Sbjct  835   LSPLEVQQMGK-DGLDLPN--AGLAQRLPSNGVGCDDYMNQKGSRNTMNGIPLGSLDY  889



>ref|XP_006357893.1| PREDICTED: auxin response factor 6-like isoform X2 [Solanum tuberosum]
Length=892

 Score =  1293 bits (3346),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 692/897 (77%), Positives = 756/897 (84%), Gaps = 14/897 (2%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MRVS +G NPQ EE  GEKKCLNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRVSSSGFNPQQEEA-GEKKCLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  59

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YPGLP QLICQLHN+TMHAD ETDEVYAQMTLQPLS QEQKDVCLLPAELG
Sbjct  60    KEVDAHIPNYPGLPPQLICQLHNLTMHADVETDEVYAQMTLQPLSPQEQKDVCLLPAELG  119

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPP QELIAKDLHGNEW
Sbjct  120   IPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPCQELIAKDLHGNEW  179

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS
Sbjct  180   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  239

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKYAKAVYHTR+SVGMR
Sbjct  240   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYAKAVYHTRISVGMR  299

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  300   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  359

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPFSLRLKRPWPSGLPS PG  NGDM ++SPLSWLRG+MGDQG+QSLNFQG
Sbjct  360   PLTTFPMYPSPFSLRLKRPWPSGLPSLPGFPNGDMTMNSPLSWLRGDMGDQGMQSLNFQG  419

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMATldssklasqqsllqfqqsipsssssliqsqml  2007
             +G+TPFMQPR+DASMLGLQPDI QTMA LD SKLA+Q  +        SS+       + 
Sbjct  420   FGVTPFMQPRMDASMLGLQPDILQTMAALDPSKLANQSLMQFQHSIPNSSAPLSQSQMLQ  479

Query  2008  qRPHPQQNLLQSFQENQVISqaqilqqqlqr----qqsyneqqqqqlhpppiqqfqeqqq  2175
                H QQNL+Q F EN +ISQAQ+LQQQLQR           Q Q      +    + QQ
Sbjct  480   PS-HSQQNLIQGFSENHLISQAQMLQQQLQRRQNFNDQQQLLQPQLQRHQEVNSQFQHQQ  538

Query  2176  MSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHD  2355
              +K I+ L +M S T   LSH Q LSST   Q+FSD++GNHV  S+NS+ QSL  SFS D
Sbjct  539   QTKTISGLSQMASATHPHLSHLQVLSSTGSPQTFSDILGNHVNASSNSNMQSLLSSFSCD  598

Query  2356  EASQLLNMHETNPLA--TLPSKRIALESQVSSRATPYVVSQ-ADMISPNSKVSDLPTFLP  2526
              AS +LN+HET+PL   +  SKRIALESQ+ SR TP+VVSQ  D+I+ N+KVSDL + LP
Sbjct  599   GASTVLNVHETHPLVSSSSSSKRIALESQLPSRVTPFVVSQPEDVIAHNTKVSDLSSLLP  658

Query  2527  PFPGKE-FPEYQGVAYSQGNNALLGVNTDSSILLQNGISNLKNSGGENGFLNMPFSTCNF  2703
             PFP +E F +Y+GV  SQ +NAL G  TDS  +LQ G+SN+K S G+NG L++P++T  F
Sbjct  659   PFPSRESFSDYRGVEDSQ-SNALYGF-TDSLNILQTGMSNMKGSSGDNGSLSIPYATSTF  716

Query  2704  TSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKF  2883
             TS VG +YPLN DM  SSCVDESGFLQSSEN DQANP NR FVKV KSGSFGRSLDISKF
Sbjct  717   TSTVGNEYPLNSDMTASSCVDESGFLQSSENGDQANPTNRIFVKVQKSGSFGRSLDISKF  776

Query  2884  SSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKIL  3063
             SSYHELRSELARMFGLEGLLEDPERSGWQLV VDRENDVLLLGDDPWQEFVNNVWYIKIL
Sbjct  777   SSYHELRSELARMFGLEGLLEDPERSGWQLVIVDRENDVLLLGDDPWQEFVNNVWYIKIL  836

Query  3064  SPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRN-MNGIPLGSLDY  3231
             SP EV QMGK EG+DLPN + A  Q LP   + C+ +++QK +RN MNGIPLGSLDY
Sbjct  837   SPHEVQQMGK-EGLDLPNGVQAQTQTLPGNVNGCDDYMNQKGSRNTMNGIPLGSLDY  892



>gb|ACM66271.1| ARF8 [Solanum melongena]
Length=891

 Score =  1273 bits (3295),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 687/897 (77%), Positives = 757/897 (84%), Gaps = 15/897 (2%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MRVS +G NPQ EE TGEKKCLNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRVSSSGFNPQPEEATGEKKCLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  60

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YPGLP QLICQLHN+TMHAD ETDEVYAQMTLQPLS QEQKDVCLLPAELG
Sbjct  61    KEVDAHIPNYPGLPPQLICQLHNLTMHADVETDEVYAQMTLQPLSPQEQKDVCLLPAELG  120

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PSKQPTNYFCKTLTAS TSTHGGFSVPRRAAEKVFPPLDYSQQPP QELIAKDLHGNEW
Sbjct  121   IPSKQPTNYFCKTLTASGTSTHGGFSVPRRAAEKVFPPLDYSQQPPCQELIAKDLHGNEW  180

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS
Sbjct  181   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  240

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTR+SVGMR
Sbjct  241   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRISVGMR  300

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAG+RQPRVSLWEIE
Sbjct  301   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGDRQPRVSLWEIE  360

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPFSLRLKRPWPSGLPS  G  NGDM ++SPLSWLRG+MGDQG+QSLNFQG
Sbjct  361   PLTTFPMYPSPFSLRLKRPWPSGLPSLTGFPNGDMAMNSPLSWLRGDMGDQGMQSLNFQG  420

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMATldssklasqqsllqfqqsipsssssliqsqml  2007
             +G+TPFMQPR+DAS+LGLQPDI QTMA LD SKLA+Q  +   Q    SS+S      + 
Sbjct  421   FGVTPFMQPRMDASLLGLQPDILQTMAALDPSKLANQSLMQFQQSIPNSSASLSQSQMLQ  480

Query  2008  qRPHPQQNLLQSFQENQVISqaqilqqqlqrqq----syneqqqqqlhpppiqqfqeqqq  2175
                H  QNL+Q F EN +ISQAQ+LQQQLQR+Q         Q Q      +    + QQ
Sbjct  481   PS-HSHQNLIQGFSENHLISQAQMLQQQLQRRQNFNDQQQLLQPQLQQHQEVNSQFQHQQ  539

Query  2176  MSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHD  2355
              +K I+SL +M S TQ  LSH   LSST  QQ+FSD++G HV +S+NS+ QSL  SFS D
Sbjct  540   RTKAISSLSQMASVTQPHLSHLPVLSSTGSQQTFSDMLGTHVNSSSNSNMQSLLSSFSRD  599

Query  2356  EASQLLNMHETNPLA--TLPSKRIALESQVSSRATPYVVSQ-ADMISPNSKVSDLPTFLP  2526
              A  +LNMHET+PL   +  SKRIALESQ+ SR TP+V+SQ  ++I+PN+KVSDL + LP
Sbjct  600   GAPAVLNMHETHPLVSSSSSSKRIALESQLPSRVTPFVLSQPENVIAPNTKVSDLSSLLP  659

Query  2527  PFPGKE-FPEYQGVAYSQGNNALLGVNTDSSILLQNGISNLKNSGGENGFLNMPFSTCNF  2703
             PFPG+E F +Y+G   SQ +NAL G  TDS  +LQ G+SN+K S G+NG L++P++   F
Sbjct  660   PFPGRESFSDYKGAEDSQ-SNALYGF-TDSLNILQTGMSNMKGSSGDNGSLSIPYAISTF  717

Query  2704  TSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKF  2883
             TS VG +YPLN DM  SSCVDESGFLQSSEN DQAN  NR FVKV KSGSFGRSLDISKF
Sbjct  718   TSTVGNEYPLNSDMTASSCVDESGFLQSSENGDQANQTNRIFVKVQKSGSFGRSLDISKF  777

Query  2884  SSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKIL  3063
             SSYHELRSELARMFGLEGLLEDPERSGWQLV VDRENDVLLLGDDPWQEFVNNVWYIKIL
Sbjct  778   SSYHELRSELARMFGLEGLLEDPERSGWQLVIVDRENDVLLLGDDPWQEFVNNVWYIKIL  837

Query  3064  SPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRN-MNGIPLGSLDY  3231
             SP+EV QMGK EG+DL N +    QRLP   + C+ +++QK +RN MNGIPLGSLDY
Sbjct  838   SPYEVQQMGK-EGLDLLNGV--RTQRLPGNVNGCDDYMNQKGSRNTMNGIPLGSLDY  891



>ref|NP_001234663.1| auxin response factor 6 [Solanum lycopersicum]
 gb|ACU30063.2| auxin response factor 6 [Solanum lycopersicum]
Length=881

 Score =  1201 bits (3107),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 667/900 (74%), Positives = 732/900 (81%), Gaps = 31/900 (3%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG NPQ E   GEKK LNSELWHACAGPLVSLP +G+RVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSAGFNPQPEMAAGEKKSLNSELWHACAGPLVSLPHVGTRVVYFPQGHSEQVAASTN  60

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KEI+ HIPSYPGLP QLICQLHNVTM AD ETDEVYAQMTLQPL+ QEQKDVCLLPAELG
Sbjct  61    KEINGHIPSYPGLPPQLICQLHNVTMDADVETDEVYAQMTLQPLTPQEQKDVCLLPAELG  120

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
               SKQP+NYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPP QELI KDLHGNEW
Sbjct  121   TLSKQPSNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPVQELIGKDLHGNEW  180

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+VIFIWNENNQLLLGIRRANRPQTV+PS
Sbjct  181   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVIFIWNENNQLLLGIRRANRPQTVLPS  240

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIF+NPRA PS+FVIPLAKYAKAVYHTRVSVGMR
Sbjct  241   SVLSSDSMHIGLLAAAAHAAATNSRFTIFFNPRACPSEFVIPLAKYAKAVYHTRVSVGMR  300

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             F+MLFETEESS+RRYMGTITGI DLDPVRWPNSHW+SVKVGWDESTAGERQPRVSLWEIE
Sbjct  301   FQMLFETEESSIRRYMGTITGIGDLDPVRWPNSHWQSVKVGWDESTAGERQPRVSLWEIE  360

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPFSLRLKRPWP GLPSFPGLSNGDM ++S L WL G MGDQGIQSLNFQG
Sbjct  361   PLTTFPMYPSPFSLRLKRPWPPGLPSFPGLSNGDMTMNSQLPWLHGGMGDQGIQSLNFQG  420

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMATldssklasqqsllqfqqsipsssssliqsqml  2007
             +G+TPFMQPR DASMLGLQPDI Q MA LDSSKLA+Q  +        S+SS   Q    
Sbjct  421   FGVTPFMQPRFDASMLGLQPDILQAMAALDSSKLANQPLMQFQHIPSTSASSIQSQLL--  478

Query  2008  qRPHP---QQNLLQSFQENQVISqaqilqqqlqrqqsyneqqqqqlhpppiqqfqeqq--  2172
                HP   Q   LQ   ENQ+ISQAQ+LQQQLQ  QSYN QQQQ          Q Q+  
Sbjct  479   ---HPSNLQHTFLQGLPENQLISQAQMLQQQLQCHQSYNTQQQQLQRQRLYHDQQLQEPH  535

Query  2173  --qMSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSST-QSLPRS  2343
               Q      +  ++ S TQSQLSH Q L ST  QQ+FSDLVGNH+ TSNNSST QSL  S
Sbjct  536   QVQRQDQQQTKAQLCSATQSQLSHLQVLGSTGSQQTFSDLVGNHINTSNNSSTMQSLLSS  595

Query  2344  FSHDEASQLLNMHETN--PLATLPSKRIALESQVSSRATPYVVSQADMIS-PNSKVSDLP  2514
             FS + AS  LNM ETN     +  SKRIALESQ+ S+A PY+V+QA++++ PN+KVSD  
Sbjct  596   FSRNGASTSLNMPETNSLVSPSSSSKRIALESQIPSQA-PYMVTQAEVLTVPNTKVSDFS  654

Query  2515  TFLPPFPGKEFPEYQGVAYSQGNNALLGVNTDSSILLQNGISNLKNSGGENGFLNMPFST  2694
             T   P PG++  +YQ VA SQ NNAL GV         NG+SNLK +  ENG L +P++T
Sbjct  655   TLFSPNPGRQVLDYQAVAVSQ-NNALFGV---------NGMSNLKGNSPENGSLPVPYAT  704

Query  2695  CNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDI  2874
               FTS VG +YP+N DM TSSCVDESG LQSSENVDQAN    TFVKV+KS SFGRSLDI
Sbjct  705   STFTSTVGGEYPVNSDMTTSSCVDESGVLQSSENVDQANSLTETFVKVYKSESFGRSLDI  764

Query  2875  SKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYI  3054
             SKFSSY+ELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPW EFVN+VWYI
Sbjct  765   SKFSSYNELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWHEFVNSVWYI  824

Query  3055  KILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRN-MNGIPLGSLDY  3231
             KILSP EV QMGK +G+DLP+      QR+ + G+ C+  +++  + N MNGIPLGSL+Y
Sbjct  825   KILSPLEVQQMGK-QGLDLPS--AGKTQRITSNGNGCDDSMNRNHSCNIMNGIPLGSLEY  881



>gb|ADK91822.1| auxin response factor 6 [Solanum lycopersicum]
Length=868

 Score =  1186 bits (3069),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 659/886 (74%), Positives = 722/886 (81%), Gaps = 31/886 (3%)
 Frame = +1

Query  610   GTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAHIPSYPGLP  789
               GEKK LNSELWHACAGPLVSLP +G+RVVYFPQGHSEQV ASTNKEI+ HIPSYPGLP
Sbjct  2     AAGEKKSLNSELWHACAGPLVSLPHVGTRVVYFPQGHSEQVAASTNKEINGHIPSYPGLP  61

Query  790   AQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPTNYFCKTL  969
              QLICQLHNVTM AD ETDEVYAQMTLQPL+ QEQKDVCLLPAELG  SKQP+NYFCKTL
Sbjct  62    PQLICQLHNVTMDADVETDEVYAQMTLQPLTPQEQKDVCLLPAELGTLSKQPSNYFCKTL  121

Query  970   TASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFRGQPKRHL  1149
             TASDTSTHGGFSVPRRAAEKVFPPLDYSQQPP QELI KDLHGNEWKFRH+FRGQPKRHL
Sbjct  122   TASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPVQELIGKDLHGNEWKFRHIFRGQPKRHL  181

Query  1150  LTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLLa  1329
             LTTGWSVFVSAKRLVAGD+VIFIWNENNQLLLGIRRANRPQTV+PSSVLSSDSMHIGLLA
Sbjct  182   LTTGWSVFVSAKRLVAGDSVIFIWNENNQLLLGIRRANRPQTVLPSSVLSSDSMHIGLLA  241

Query  1330  aaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFETEESSVRR  1509
             AAAHAAATNSRFTIF+NPRA PS+FVIPLAKYAKAVYHTRVSVGMRFRMLFETEESS+RR
Sbjct  242   AAAHAAATNSRFTIFFNPRACPSEFVIPLAKYAKAVYHTRVSVGMRFRMLFETEESSIRR  301

Query  1510  YMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFSL  1689
             YMGTITGI DLDPVRWPNSHW+SVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFSL
Sbjct  302   YMGTITGIGDLDPVRWPNSHWQSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFSL  361

Query  1690  RLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPFMQPRLDAS  1869
             RLKRPWP GLPSFPGLSNGDM ++S L WL G MGDQGIQSLNFQG+G+TPFMQPR DAS
Sbjct  362   RLKRPWPPGLPSFPGLSNGDMTMNSQLPWLHGGMGDQGIQSLNFQGFGVTPFMQPRFDAS  421

Query  1870  MLGLQPDIYQTMATldssklasqqsllqfqqsipsssssliqsqmlqRPHP---QQNLLQ  2040
             MLGLQPDI Q MA LDSSKLA+Q  +        S+SS   Q       HP   Q   LQ
Sbjct  422   MLGLQPDILQAMAALDSSKLANQPLMQFQHIPSTSASSIQSQLL-----HPSNLQHTFLQ  476

Query  2041  SFQENQVISqaqilqqqlqrqqsyneqqqqqlhpppiqqfqeqq----qMSKPITSLPRM  2208
                ENQ+ISQAQ+LQQQLQ  QSYN QQQQ          Q Q+    Q      +  ++
Sbjct  477   GLPENQLISQAQMLQQQLQCHQSYNTQQQQLQRQRLYHDQQLQEPHQVQRQDQQQTKAQL  536

Query  2209  NSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSST-QSLPRSFSHDEASQLLNMHE  2385
              S TQSQLSH Q L ST  QQ+FSDLVGNH+ TSNNSST QSL  SFS + AS  LNM E
Sbjct  537   CSATQSQLSHLQVLGSTGSQQTFSDLVGNHINTSNNSSTMQSLLSSFSRNGASTSLNMPE  596

Query  2386  TN--PLATLPSKRIALESQVSSRATPYVVSQADMIS-PNSKVSDLPTFLPPFPGKEFPEY  2556
             TN     +  SKRIALESQ+ S+A PY+V+QA++++ PN+KVSD  T   P PG++  +Y
Sbjct  597   TNSLVSPSSSSKRIALESQIPSQA-PYMVTQAEVLTVPNTKVSDFSTLFSPNPGRQVLDY  655

Query  2557  QGVAYSQGNNALLGVNTDSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLN  2736
             Q VA SQ NNAL GV         NG+SNLK +  ENG L +P++T  FTS VG +YP+N
Sbjct  656   QAVAVSQ-NNALFGV---------NGMSNLKGNSPENGSLPVPYATSTFTSTVGGEYPVN  705

Query  2737  PDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELA  2916
              DM TSSCVDESG LQSSENVDQAN    TFVKV+KS SFGRSLDISKFSSY+ELRSELA
Sbjct  706   SDMTTSSCVDESGVLQSSENVDQANSLTETFVKVYKSESFGRSLDISKFSSYNELRSELA  765

Query  2917  RMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKE  3096
             RMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPW EFVN+VWYIKILSP EV QMGK 
Sbjct  766   RMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWHEFVNSVWYIKILSPLEVQQMGK-  824

Query  3097  EGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRN-MNGIPLGSLDY  3231
             +G+DLP+      QR+ + G+ C+  +++  + N MNGIPLGSL+Y
Sbjct  825   QGLDLPS--AGKTQRITSNGNGCDDSMNRNHSCNIMNGIPLGSLEY  868



>gb|KDO63433.1| hypothetical protein CISIN_1g002390mg [Citrus sinensis]
Length=898

 Score =  1157 bits (2994),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 633/906 (70%), Positives = 726/906 (80%), Gaps = 26/906 (3%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR++ +G N Q +EG  EKKCLNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLATSGFNQQTQEG--EKKCLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP LP QLICQLHN+TMHAD ETDEVYAQMTLQPLS QEQKDV LLPAELG
Sbjct  59    KEVDAHIPNYPNLPPQLICQLHNLTMHADVETDEVYAQMTLQPLSPQEQKDVYLLPAELG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              P+KQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQ PPAQELIA+DLH NEW
Sbjct  119   APNKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQTPPAQELIARDLHDNEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA RPQTVMPS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRATRPQTVMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  239   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  299   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  358

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMY SPF LRLKRPWPSGLPSF G+ +GDM I+SPL WL+G +GDQGIQSLNFQG
Sbjct  359   PLTTFPMYSSPFPLRLKRPWPSGLPSFHGMKDGDMSINSPLMWLQGGVGDQGIQSLNFQG  418

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMATldssklasqqsllqfqqsipsssssliqsqml  2007
             YG+TP+MQPRLDAS+ GLQPD+YQ MA     ++ +  S     QS+     S   S   
Sbjct  419   YGVTPWMQPRLDASIPGLQPDVYQAMAAAALQEMRTVDSSKLASQSLLQFQQSQNVSNGT  478

Query  2008  qRPHPQQ---------NLLQSFQENQVISqaqilqqqlqrqqsyneqqqqqlhpppiqqf  2160
                 P+Q          LLQSFQENQ  +QAQ+LQQQLQRQ SYNEQ+QQQ      QQ 
Sbjct  479   ASMIPRQMLQQSQAQNALLQSFQENQASAQAQLLQQQLQRQHSYNEQRQQQQQVQQSQQL  538

Query  2161  qeqq---qMSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQS  2331
              +     Q+S  I++LP + S++QSQ    Q ++S   Q +FSD +GN + +S+ SS  +
Sbjct  539   HQLSVQPQISNVISTLPHLASSSQSQPPTLQTVASQCQQSNFSDSLGNPIASSDVSSMHT  598

Query  2332  LPRSFSHDEASQLLNMHETNPL---ATLPSKRIALESQVSSRATPYVVSQADMI-SPNSK  2499
             +  S S   AS LLN + +NP+   + + +K++ +++ V S  +  ++ Q + + +  S 
Sbjct  599   ILGSLSQAGASHLLNSNASNPIISSSAMLTKQVTVDNHVPSAVSHCILPQVEQLGAQQSN  658

Query  2500  VSDLPTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTDSSILLQNGISNLKNSGGENGFLN  2679
             VS+L + LPPFPG+E+  Y G    Q NN L GV+ DSS++ QNG+ NLKN   EN  L+
Sbjct  659   VSELASLLPPFPGREYSSYHGSGDPQ-NNLLFGVSIDSSLMGQNGLPNLKNISSENESLS  717

Query  2680  MPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFG  2859
             +P++  NFT+ VGTD+PLN DM TSSCVDESGFLQSSENVDQ NPP RTFVKVHKSGSFG
Sbjct  718   LPYAASNFTNNVGTDFPLNSDMTTSSCVDESGFLQSSENVDQVNPPTRTFVKVHKSGSFG  777

Query  2860  RSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVN  3039
             RSLDISKFSSY ELRSELARMFGLEG LEDP+RSGWQLVFVDRENDVLLLGDDPWQEFVN
Sbjct  778   RSLDISKFSSYDELRSELARMFGLEGQLEDPQRSGWQLVFVDRENDVLLLGDDPWQEFVN  837

Query  3040  NVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETR-NMNGIP-  3213
             NV YIKILSP EV QMGK  G+    + P   QRL +  ++ + +VS++E R + NG+  
Sbjct  838   NVGYIKILSPLEVQQMGK--GLSPVTSGPG--QRL-SSNNNFDDYVSRQELRSSSNGVAS  892

Query  3214  LGSLDY  3231
             +GS++Y
Sbjct  893   MGSINY  898



>ref|XP_006468969.1| PREDICTED: auxin response factor 6-like [Citrus sinensis]
Length=898

 Score =  1157 bits (2993),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 633/906 (70%), Positives = 726/906 (80%), Gaps = 26/906 (3%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR++ +G N Q +EG  EKKCLNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLATSGFNQQTQEG--EKKCLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP LP QLICQLHN+TMHAD ETDEVYAQMTLQPLS QEQKDV LLPAELG
Sbjct  59    KEVDAHIPNYPNLPPQLICQLHNLTMHADLETDEVYAQMTLQPLSPQEQKDVYLLPAELG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              P+KQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQ PPAQELIA+DLH NEW
Sbjct  119   APNKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQTPPAQELIARDLHDNEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA RPQTVMPS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRATRPQTVMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  239   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  299   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  358

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMY SPF LRLKRPWPSGLPSF G+ +GDM I+SPL WL+G +GDQGIQSLNFQG
Sbjct  359   PLTTFPMYSSPFPLRLKRPWPSGLPSFHGMKDGDMSINSPLMWLQGGVGDQGIQSLNFQG  418

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMATldssklasqqsllqfqqsipsssssliqsqml  2007
             YG+TP+MQPRLDAS+ GLQPD+YQ MA     ++ +  S     QS+     S   S   
Sbjct  419   YGVTPWMQPRLDASIPGLQPDVYQAMAAAALQEMRTVDSSKLASQSLLQFQQSQNVSNGT  478

Query  2008  qRPHPQQ---------NLLQSFQENQVISqaqilqqqlqrqqsyneqqqqqlhpppiqqf  2160
                 P+Q          LLQSFQENQ  +QAQ+LQQQLQRQ SYNEQ+QQQ      QQ 
Sbjct  479   ASMIPRQMLQQSQAQNALLQSFQENQASAQAQLLQQQLQRQHSYNEQRQQQQQVQQSQQL  538

Query  2161  qeqq---qMSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQS  2331
              +     Q+S  I++LP + S++QSQ    Q ++S   Q +FSD +GN + +S+ SS  +
Sbjct  539   HQLSVQPQISNVISTLPHLASSSQSQPPTLQTVASQCQQSNFSDSLGNPIASSDVSSMHT  598

Query  2332  LPRSFSHDEASQLLNMHETNPL---ATLPSKRIALESQVSSRATPYVVSQADMI-SPNSK  2499
             +  S S   AS LLN + +NP+   + + +K++ +++ V S  +  ++ Q + + +  S 
Sbjct  599   ILGSLSQAGASHLLNSNASNPIISSSAMLTKQVTVDNHVPSAVSHCILPQVEQLGAQQSN  658

Query  2500  VSDLPTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTDSSILLQNGISNLKNSGGENGFLN  2679
             VS+L + LPPFPG+E+  Y G    Q NN L GV+ DSS++ QNG+ NLKN   EN  L+
Sbjct  659   VSELASLLPPFPGREYSSYHGSGDPQ-NNLLFGVSIDSSLMGQNGLPNLKNISSENESLS  717

Query  2680  MPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFG  2859
             +P++  NFT+ VGTD+PLN DM TSSCVDESGFLQSSENVDQ NPP RTFVKVHKSGSFG
Sbjct  718   LPYAASNFTNNVGTDFPLNSDMTTSSCVDESGFLQSSENVDQVNPPTRTFVKVHKSGSFG  777

Query  2860  RSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVN  3039
             RSLDISKFSSY ELRSELARMFGLEG LEDP+RSGWQLVFVDRENDVLLLGDDPWQEFVN
Sbjct  778   RSLDISKFSSYDELRSELARMFGLEGQLEDPQRSGWQLVFVDRENDVLLLGDDPWQEFVN  837

Query  3040  NVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETR-NMNGIP-  3213
             NV YIKILSP EV QMGK  G+    + P   QRL +  ++ + +VS++E R + NG+  
Sbjct  838   NVGYIKILSPLEVQQMGK--GLSPVTSGPG--QRL-SSNNNFDDYVSRQELRSSSNGVAS  892

Query  3214  LGSLDY  3231
             +GS++Y
Sbjct  893   MGSINY  898



>ref|XP_006446840.1| hypothetical protein CICLE_v10014200mg [Citrus clementina]
 gb|ESR60080.1| hypothetical protein CICLE_v10014200mg [Citrus clementina]
Length=898

 Score =  1156 bits (2991),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 631/906 (70%), Positives = 724/906 (80%), Gaps = 26/906 (3%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR++ +G N Q +EG  EKKCLNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLATSGFNQQTQEG--EKKCLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP LP QLICQLHN+TMHAD ETDEVYAQMTLQPLS QEQKDV LLPAELG
Sbjct  59    KEVDAHIPNYPNLPPQLICQLHNLTMHADVETDEVYAQMTLQPLSPQEQKDVYLLPAELG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              P+KQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQ PPAQELIA+DLH NEW
Sbjct  119   APNKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQTPPAQELIARDLHDNEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA RPQTVMPS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRATRPQTVMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  239   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  299   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  358

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMY SPF LRLKRPWPSGLPSF G+ +GDM I+SPL WL+G +GDQGIQSLNFQG
Sbjct  359   PLTTFPMYSSPFPLRLKRPWPSGLPSFHGMKDGDMSINSPLMWLQGGVGDQGIQSLNFQG  418

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMATldssklasqqsllqfqqsipsssssliqsqml  2007
             YG+TP+MQPRLDAS+ GLQPD+YQ MA     ++ +  S     QS+     S   S   
Sbjct  419   YGVTPWMQPRLDASIPGLQPDVYQAMAAAALQEMRTVDSSKLASQSLLQFQQSQNVSNGT  478

Query  2008  qRPHPQQ---------NLLQSFQENQVISqaqilqqqlqrqqsyneqqqqqlhpppiqqf  2160
                 P+Q          LLQSFQEN   +QAQ+LQQQLQRQ SYNEQ+QQQ      QQ 
Sbjct  479   ASMIPRQMLQQSQAQNALLQSFQENHASAQAQLLQQQLQRQHSYNEQRQQQQQVQQSQQL  538

Query  2161  qeqq---qMSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQS  2331
              +     Q+S  I++LP + S++QSQ    Q ++S   Q +FSD +GN + +S+ SS  +
Sbjct  539   HQLSVQPQISNVISTLPHLASSSQSQPPTLQTVASQCQQSNFSDSLGNPIASSDVSSMHT  598

Query  2332  LPRSFSHDEASQLLNMHETNPL---ATLPSKRIALESQVSSRATPYVVSQADMI-SPNSK  2499
             +  S S   AS LLN + +NP+   + + +K++ +++ V S  +  ++ Q + + +  S 
Sbjct  599   ILGSLSQAGASHLLNSNASNPIISSSAMLTKQVTVDNHVPSAVSQCILPQVEQLGAQQSN  658

Query  2500  VSDLPTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTDSSILLQNGISNLKNSGGENGFLN  2679
             VS+L + LPPFPG+E+  Y G    Q NN L GV+ DSS++ QNG+ NLKN   EN  L+
Sbjct  659   VSELTSLLPPFPGREYSSYHGSGDPQ-NNLLFGVSIDSSLMGQNGLPNLKNISSENESLS  717

Query  2680  MPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFG  2859
             +P++  NFT+ VGTD+PLN DM TSSCVDESGFLQSSENVDQ NPP RTFVKVHKSGSFG
Sbjct  718   LPYAASNFTNNVGTDFPLNSDMTTSSCVDESGFLQSSENVDQVNPPTRTFVKVHKSGSFG  777

Query  2860  RSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVN  3039
             RSLDISKFSSY ELR ELARMFGLEG LEDP+RSGWQLVFVDRENDVLLLGDDPWQEFVN
Sbjct  778   RSLDISKFSSYDELRGELARMFGLEGQLEDPQRSGWQLVFVDRENDVLLLGDDPWQEFVN  837

Query  3040  NVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETR-NMNGIP-  3213
             NV YIKILSP EV QMGK  G+    + P   QRL +  ++ + +VS++E R + NG+  
Sbjct  838   NVGYIKILSPLEVQQMGK--GLSPVTSGPG--QRL-SSNNNFDDYVSRQELRSSSNGVAS  892

Query  3214  LGSLDY  3231
             +GS++Y
Sbjct  893   MGSINY  898



>gb|KDO63436.1| hypothetical protein CISIN_1g002390mg [Citrus sinensis]
Length=928

 Score =  1149 bits (2973),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 628/894 (70%), Positives = 717/894 (80%), Gaps = 24/894 (3%)
 Frame = +1

Query  604   EEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAHIPSYPG  783
             E   GEKKCLNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTNKE+DAHIP+YP 
Sbjct  41    ENFAGEKKCLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTNKEVDAHIPNYPN  100

Query  784   LPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPTNYFCK  963
             LP QLICQLHN+TMHAD ETDEVYAQMTLQPLS QEQKDV LLPAELG P+KQPTNYFCK
Sbjct  101   LPPQLICQLHNLTMHADVETDEVYAQMTLQPLSPQEQKDVYLLPAELGAPNKQPTNYFCK  160

Query  964   TLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFRGQPKR  1143
             TLTASDTSTHGGFSVPRRAAEKVFPPLDYSQ PPAQELIA+DLH NEWKFRH+FRGQPKR
Sbjct  161   TLTASDTSTHGGFSVPRRAAEKVFPPLDYSQTPPAQELIARDLHDNEWKFRHIFRGQPKR  220

Query  1144  HLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDSMHIGL  1323
             HLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA RPQTVMPSSVLSSDSMHIGL
Sbjct  221   HLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRATRPQTVMPSSVLSSDSMHIGL  280

Query  1324  LaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFETEESSV  1503
             LAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMRFRMLFETEESSV
Sbjct  281   LAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMRFRMLFETEESSV  340

Query  1504  RRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPF  1683
             RRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMY SPF
Sbjct  341   RRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYSSPF  400

Query  1684  SLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPFMQPRLD  1863
              LRLKRPWPSGLPSF G+ +GDM I+SPL WL+G +GDQGIQSLNFQGYG+TP+MQPRLD
Sbjct  401   PLRLKRPWPSGLPSFHGMKDGDMSINSPLMWLQGGVGDQGIQSLNFQGYGVTPWMQPRLD  460

Query  1864  ASMLGLQPDIYQTMATldssklasqqsllqfqqsipsssssliqsqmlqRPHPQQ-----  2028
             AS+ GLQPD+YQ MA     ++ +  S     QS+     S   S       P+Q     
Sbjct  461   ASIPGLQPDVYQAMAAAALQEMRTVDSSKLASQSLLQFQQSQNVSNGTASMIPRQMLQQS  520

Query  2029  ----NLLQSFQENQVISqaqilqqqlqrqqsyneqqqqqlhpppiqqfqeqq---qMSKP  2187
                  LLQSFQENQ  +QAQ+LQQQLQRQ SYNEQ+QQQ      QQ  +     Q+S  
Sbjct  521   QAQNALLQSFQENQASAQAQLLQQQLQRQHSYNEQRQQQQQVQQSQQLHQLSVQPQISNV  580

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQ  2367
             I++LP + S++QSQ    Q ++S   Q +FSD +GN + +S+ SS  ++  S S   AS 
Sbjct  581   ISTLPHLASSSQSQPPTLQTVASQCQQSNFSDSLGNPIASSDVSSMHTILGSLSQAGASH  640

Query  2368  LLNMHETNPL---ATLPSKRIALESQVSSRATPYVVSQADMI-SPNSKVSDLPTFLPPFP  2535
             LLN + +NP+   + + +K++ +++ V S  +  ++ Q + + +  S VS+L + LPPFP
Sbjct  641   LLNSNASNPIISSSAMLTKQVTVDNHVPSAVSHCILPQVEQLGAQQSNVSELASLLPPFP  700

Query  2536  GKEFPEYQGVAYSQGNNALLGVNTDSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGV  2715
             G+E+  Y G    Q NN L GV+ DSS++ QNG+ NLKN   EN  L++P++  NFT+ V
Sbjct  701   GREYSSYHGSGDPQ-NNLLFGVSIDSSLMGQNGLPNLKNISSENESLSLPYAASNFTNNV  759

Query  2716  GTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYH  2895
             GTD+PLN DM TSSCVDESGFLQSSENVDQ NPP RTFVKVHKSGSFGRSLDISKFSSY 
Sbjct  760   GTDFPLNSDMTTSSCVDESGFLQSSENVDQVNPPTRTFVKVHKSGSFGRSLDISKFSSYD  819

Query  2896  ELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFE  3075
             ELRSELARMFGLEG LEDP+RSGWQLVFVDRENDVLLLGDDPWQEFVNNV YIKILSP E
Sbjct  820   ELRSELARMFGLEGQLEDPQRSGWQLVFVDRENDVLLLGDDPWQEFVNNVGYIKILSPLE  879

Query  3076  VHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETR-NMNGIP-LGSLDY  3231
             V QMGK  G+    + P   QRL +  ++ + +VS++E R + NG+  +GS++Y
Sbjct  880   VQQMGK--GLSPVTSGPG--QRL-SSNNNFDDYVSRQELRSSSNGVASMGSINY  928



>gb|KHN12007.1| Auxin response factor 6 [Glycine soja]
Length=896

 Score =  1130 bits (2924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 629/906 (69%), Positives = 713/906 (79%), Gaps = 28/906 (3%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S +G NP AEE  GEKKCLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTN
Sbjct  1     MKLSSSGFNPPAEE-EGEKKCLNSELWHACAGPLVSLPLVGSRVVYFPQGHSEQVAASTN  59

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             +E+DAHIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQK+V LLPAELG
Sbjct  60    REVDAHIPNYPNLPPQLICQLHNVTMHADAETDEVYAQMTLQPLSPQEQKEVYLLPAELG  119

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              P KQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIA+DLH NEW
Sbjct  120   TPGKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIARDLHDNEW  179

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQT+MPS
Sbjct  180   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTIMPS  239

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  240   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  299

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  300   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  359

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRL+RPWPSGLPS  GL +GDM I SP  WL+G +GDQG+QSLNFQG
Sbjct  360   PLTTFPMYPSPFPLRLRRPWPSGLPSLYGLKDGDMGIGSPFMWLQGGLGDQGMQSLNFQG  419

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMA--------Tldssklasqqsllqfqqsipssss  1983
              G+TP+MQPRLDAS+ GLQP++YQ MA        T+D SK +      Q   ++PS+ +
Sbjct  420   LGVTPWMQPRLDASIPGLQPELYQAMASSAFQEIRTMDPSKSSQSLLQFQQTSNVPSAHA  479

Query  1984  sliqsqmlqRPHPQQNLLQSFQENQVISqaqilqqqlqrqqsyneqqqqqlhpppiqqfq  2163
             S +Q Q+L +  PQ  LL ++QENQV +Q+Q+LQQQL R   Y++ +QQQ     +   Q
Sbjct  480   SEVQRQVLPQSQPQNTLLHNYQENQVPAQSQLLQQQLHRYHPYSDPRQQQQQLKNLPVQQ  539

Query  2164  eqqqMSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRS  2343
             +   +  P+++     S TQSQ    QAL+S   QQSF +L+ NH+  S+ SS  SL  S
Sbjct  540   QLPNVISPLSNF---ASGTQSQSPPIQALASHCQQQSFPELMRNHISGSDVSSIHSLLGS  596

Query  2344  FSHDEASQLLNMHETNPL----ATLPSKRIALESQVSSRATPYVVSQADMI-SPNSKVSD  2508
             FS D  SQLLN+  +N +    A LP +      Q+ S A   V+ Q + + +  S VS+
Sbjct  597   FSQDGTSQLLNLSGSNSVMSSAAMLPKQITTEPPQLPSAAPQCVLPQVENLGTSQSNVSE  656

Query  2509  LPTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTD-SSILLQNGISNLKNSGGENGFLNMP  2685
             L   LPPF G+E   Y   A  Q +N L G+N D SS++LQNG+SNL+N G  N  L++P
Sbjct  657   LAA-LPPFAGREHSAYHAAADPQ-SNLLFGINIDPSSLMLQNGMSNLRNIGNVNNSLSLP  714

Query  2686  FSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRS  2865
             FS  N     GTD+PL+ +M TSSCVDESGFLQSSENVDQAN P  TFVKVHKSGSFGRS
Sbjct  715   FSASNCGGASGTDFPLSSNMTTSSCVDESGFLQSSENVDQANTPTGTFVKVHKSGSFGRS  774

Query  2866  LDISKFSSYHELRSELARMFGLEGLLEDP--ERSGWQLVFVDRENDVLLLGDDPWQEFVN  3039
             LDISKFSSY EL SELARMFGLEG LEDP  +RSGWQLVFVDRENDVLLLGDDPWQEFVN
Sbjct  775   LDISKFSSYDELISELARMFGLEGQLEDPKTQRSGWQLVFVDRENDVLLLGDDPWQEFVN  834

Query  3040  NVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETR-NMNGIP-  3213
             NVWYIKILSP EV QMGK     L  +  A   +L    +SC+ +VSQ+E R + NG+  
Sbjct  835   NVWYIKILSPLEVQQMGK----GLSPSTSAPGNKLSTPANSCDNYVSQQELRSSRNGMAS  890

Query  3214  LGSLDY  3231
             +GS  Y
Sbjct  891   MGSFHY  896



>gb|AHY24213.1| auxin response factor, partial [Dimocarpus longan]
Length=877

 Score =  1129 bits (2920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 622/883 (70%), Positives = 710/883 (80%), Gaps = 26/883 (3%)
 Frame = +1

Query  643   LWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAHIPSYPGLPAQLICQLHNVT  822
             LWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTNKE+DAHIP+YP LP QLICQLHNVT
Sbjct  1     LWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTNKEVDAHIPNYPSLPPQLICQLHNVT  60

Query  823   MHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPTNYFCKTLTASDTSTHGGF  1002
             MHAD ETDEVYAQMTLQPLS QEQKDV LLPAELG  SKQPTNYFCKTLTASDTSTHGGF
Sbjct  61    MHADVETDEVYAQMTLQPLSPQEQKDVYLLPAELGTGSKQPTNYFCKTLTASDTSTHGGF  120

Query  1003  SVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFRGQPKRHLLTTGWSVFVSA  1182
             SVPRRAAEKVFPPLDYSQ PPAQELIA+DLH NEWKFRH+FRGQPKRHLLTTGWSVFVSA
Sbjct  121   SVPRRAAEKVFPPLDYSQTPPAQELIARDLHDNEWKFRHIFRGQPKRHLLTTGWSVFVSA  180

Query  1183  KRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLLaaaahaaaTNSR  1362
             KRL+AGD+++FIWN+ NQLLLGIRRANRPQ VMPSSVLSSDSMHIGLLAAAAHAAATNSR
Sbjct  181   KRLIAGDSILFIWNDKNQLLLGIRRANRPQAVMPSSVLSSDSMHIGLLAAAAHAAATNSR  240

Query  1363  FTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFETEESSVRRYMGTITGISDL  1542
             FTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMRFRMLFETEESSVRRYMGTITGISDL
Sbjct  241   FTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMRFRMLFETEESSVRRYMGTITGISDL  300

Query  1543  DPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFSLRLKRPWPSGLP  1722
             DPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPF LRLKRPWPSGLP
Sbjct  301   DPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFPLRLKRPWPSGLP  360

Query  1723  SFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPFMQPRLDASMLGLQPDIYQT  1902
             SFP L +GDM I+SPL WL+G +GDQGIQSLNFQG+G++P+MQPRLD S+ GLQPD+YQ 
Sbjct  361   SFPVLKDGDMSINSPLMWLQGGVGDQGIQSLNFQGFGVSPWMQPRLDTSIPGLQPDVYQA  420

Query  1903  MATldssklasqqsllqfqqsipsssssliqs---------qmlqRPHPQQNLLQSFQEN  2055
             MA     ++ +  S     QS+     S   S         QMLQ+ HPQ   +QSFQ+N
Sbjct  421   MAAAALQEMRTVDSSKLASQSLLQFQQSQSVSNGPASLIPRQMLQQSHPQNAFVQSFQDN  480

Query  2056  QVISqaqilqqqlqrqqsyneqqqqqlhpppiqqfqeqqqMS----KPITSLPRMNSTTQ  2223
             Q  +QAQ+LQQQLQRQ SYN+Q+QQQ       Q   Q  +       I++LP + S +Q
Sbjct  481   QASAQAQLLQQQLQRQHSYNDQRQQQQQQVQQPQQLPQLSVQPQIPNIISTLPHLASASQ  540

Query  2224  SQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMHETNPLAT  2403
             SQ    QA++    Q SFSD +GN + TS+ SS  ++  S S D +S LL+ + +NP+ T
Sbjct  541   SQPPTLQAIAPQCQQPSFSDSLGNPIATSDVSSVHNILGSLSQDGSSHLLSSNVSNPIIT  600

Query  2404  ---LPSKRIALESQVSSRATPYVVSQADMI-SPNSKVSDLPTFLPPFPGKEFPEYQGVAY  2571
                + +K+++++  +SS  +  V+ Q +   +  S VS+L   LPPFPG+E+  YQG A 
Sbjct  601   SSSIITKQVSVDPHLSSGVSHCVLPQVEQFGTQQSHVSELANLLPPFPGREYSSYQGSAD  660

Query  2572  SQGNNALLGVNTDSSILL-QNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMG  2748
              Q NN L GV+ DSS L+ Q+G+ NLKN G EN  L +PF+  NFTS VGTD+PLN +M 
Sbjct  661   PQ-NNLLFGVSIDSSSLMAQHGLQNLKNIGSENDSLPLPFAASNFTSAVGTDFPLNSEMT  719

Query  2749  TSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFG  2928
             TSSCVDESGFL SSENV+Q N  NRTFVKVHKSGSFGRSLDISKFSSY ELRSELARMFG
Sbjct  720   TSSCVDESGFLHSSENVEQVNTSNRTFVKVHKSGSFGRSLDISKFSSYDELRSELARMFG  779

Query  2929  LEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGID  3108
             LEG LED +RSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSP EV QMGK EG+ 
Sbjct  780   LEGQLEDSQRSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPLEVQQMGK-EGLS  838

Query  3109  LPNNLPAANQRLPNGGSSCEVHVSQKETR-NMNGIP-LGSLDY  3231
               +++P   QRL N  ++C+ ++S++E R + NG+  +GSLDY
Sbjct  839   SMSSVPG--QRLSN--NNCDDYLSRQELRSSSNGVASMGSLDY  877



>ref|XP_003519519.1| PREDICTED: auxin response factor 6-like [Glycine max]
 gb|KHN38362.1| Auxin response factor 17 [Glycine soja]
Length=896

 Score =  1129 bits (2920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 631/906 (70%), Positives = 715/906 (79%), Gaps = 28/906 (3%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S +G NP AEE  GEKKCLNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MKLSSSGFNPPAEE-EGEKKCLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  59

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             +E+DAHIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQK+V LLPAELG
Sbjct  60    REVDAHIPNYPNLPPQLICQLHNVTMHADAETDEVYAQMTLQPLSPQEQKEVYLLPAELG  119

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIA+DLH NEW
Sbjct  120   TPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIARDLHDNEW  179

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQT+MPS
Sbjct  180   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTIMPS  239

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+F IPLAKY KAVYHTRVSVGMR
Sbjct  240   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFAIPLAKYVKAVYHTRVSVGMR  299

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  300   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  359

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRLKRPWPSGLPS  GL +GDM I SP  WL+G +GDQG+QSLNFQG
Sbjct  360   PLTTFPMYPSPFPLRLKRPWPSGLPSLYGLKDGDMGIGSPFMWLQGGLGDQGMQSLNFQG  419

Query  1828  YGITPFMQPRLDASMLGLQPDIYQT--------MATldssklasqqsllqfqqsipssss  1983
              G+TP+MQPRLD S+ GLQP++YQ         M T+D SK +      Q   ++PS+ +
Sbjct  420   LGVTPWMQPRLDPSIPGLQPELYQAITSSAFQEMRTMDLSKSSQSLLQFQQTSNVPSAHA  479

Query  1984  sliqsqmlqRPHPQQNLLQSFQENQVISqaqilqqqlqrqqsyneqqqqqlhpppiqqfq  2163
             S +Q Q+L +   Q  LL +FQENQV +Q+Q+LQQQL R   Y++QQQQQ     +   Q
Sbjct  480   SEVQRQLLPQSQLQNTLLHNFQENQVPAQSQLLQQQLHRYHPYSDQQQQQQQLKNLPVQQ  539

Query  2164  eqqqMSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRS  2343
             +   +  P++   +  S TQSQ    QAL+S   QQSF + + NH+  S+ S  QSL  S
Sbjct  540   QLPNVISPMS---KFASGTQSQSPPMQALASHCQQQSFPEPMRNHISGSDVSPIQSLLGS  596

Query  2344  FSHDEASQLLNMHETNPL----ATLPSKRIALESQVSSRATPYVVSQADMI-SPNSKVSD  2508
             FS D  SQLLN+  +N +    A LP +  A   Q+ S A+  ++ Q + + +  S VS+
Sbjct  597   FSQDGTSQLLNLSGSNSVMSSAAILPKQITAEPPQLPSAASQCILPQVENLGTSQSNVSE  656

Query  2509  LPTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTD-SSILLQNGISNLKNSGGENGFLNMP  2685
             L   LPPFPG+E   Y G A  Q +N L G+N D SS++LQ+G+SNL+N G  N  L++P
Sbjct  657   LAA-LPPFPGREHSAYHGAADPQ-SNLLFGINIDPSSLMLQSGMSNLRNIGKVNDSLSLP  714

Query  2686  FSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRS  2865
             FST N     GTD+PL+ +M TSSCVDESGFLQ SENVDQAN P  TFVKVHKSGSFGRS
Sbjct  715   FSTSNCGGATGTDFPLSSNMTTSSCVDESGFLQCSENVDQANIPTGTFVKVHKSGSFGRS  774

Query  2866  LDISKFSSYHELRSELARMFGLEGLLEDP--ERSGWQLVFVDRENDVLLLGDDPWQEFVN  3039
             LDISKFSSY EL SELARMFGLEG LEDP  +RSGWQLVFVDRENDVLLLGDDPWQEFVN
Sbjct  775   LDISKFSSYDELISELARMFGLEGQLEDPKTQRSGWQLVFVDRENDVLLLGDDPWQEFVN  834

Query  3040  NVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETR-NMNGIP-  3213
             NVWYIKILSP EV QMGK     L  +  A   +L    +SC+ +VSQ+E R + NG+  
Sbjct  835   NVWYIKILSPLEVQQMGKV----LSPSTSAPGDKLSTPVNSCDNYVSQQELRSSRNGMAS  890

Query  3214  LGSLDY  3231
             +GS  Y
Sbjct  891   MGSFHY  896



>gb|KDO63434.1| hypothetical protein CISIN_1g002390mg [Citrus sinensis]
Length=886

 Score =  1128 bits (2917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 622/906 (69%), Positives = 715/906 (79%), Gaps = 38/906 (4%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR++ +G N Q +EG  EKKCLNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLATSGFNQQTQEG--EKKCLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP LP QLICQLHN+TMHAD ETDE            QEQKDV LLPAELG
Sbjct  59    KEVDAHIPNYPNLPPQLICQLHNLTMHADVETDE------------QEQKDVYLLPAELG  106

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              P+KQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQ PPAQELIA+DLH NEW
Sbjct  107   APNKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQTPPAQELIARDLHDNEW  166

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA RPQTVMPS
Sbjct  167   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRATRPQTVMPS  226

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  227   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  286

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  287   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  346

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMY SPF LRLKRPWPSGLPSF G+ +GDM I+SPL WL+G +GDQGIQSLNFQG
Sbjct  347   PLTTFPMYSSPFPLRLKRPWPSGLPSFHGMKDGDMSINSPLMWLQGGVGDQGIQSLNFQG  406

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMATldssklasqqsllqfqqsipsssssliqsqml  2007
             YG+TP+MQPRLDAS+ GLQPD+YQ MA     ++ +  S     QS+     S   S   
Sbjct  407   YGVTPWMQPRLDASIPGLQPDVYQAMAAAALQEMRTVDSSKLASQSLLQFQQSQNVSNGT  466

Query  2008  qRPHPQQ---------NLLQSFQENQVISqaqilqqqlqrqqsyneqqqqqlhpppiqqf  2160
                 P+Q          LLQSFQENQ  +QAQ+LQQQLQRQ SYNEQ+QQQ      QQ 
Sbjct  467   ASMIPRQMLQQSQAQNALLQSFQENQASAQAQLLQQQLQRQHSYNEQRQQQQQVQQSQQL  526

Query  2161  qeqq---qMSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQS  2331
              +     Q+S  I++LP + S++QSQ    Q ++S   Q +FSD +GN + +S+ SS  +
Sbjct  527   HQLSVQPQISNVISTLPHLASSSQSQPPTLQTVASQCQQSNFSDSLGNPIASSDVSSMHT  586

Query  2332  LPRSFSHDEASQLLNMHETNPL---ATLPSKRIALESQVSSRATPYVVSQADMI-SPNSK  2499
             +  S S   AS LLN + +NP+   + + +K++ +++ V S  +  ++ Q + + +  S 
Sbjct  587   ILGSLSQAGASHLLNSNASNPIISSSAMLTKQVTVDNHVPSAVSHCILPQVEQLGAQQSN  646

Query  2500  VSDLPTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTDSSILLQNGISNLKNSGGENGFLN  2679
             VS+L + LPPFPG+E+  Y G    Q NN L GV+ DSS++ QNG+ NLKN   EN  L+
Sbjct  647   VSELASLLPPFPGREYSSYHGSGDPQ-NNLLFGVSIDSSLMGQNGLPNLKNISSENESLS  705

Query  2680  MPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFG  2859
             +P++  NFT+ VGTD+PLN DM TSSCVDESGFLQSSENVDQ NPP RTFVKVHKSGSFG
Sbjct  706   LPYAASNFTNNVGTDFPLNSDMTTSSCVDESGFLQSSENVDQVNPPTRTFVKVHKSGSFG  765

Query  2860  RSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVN  3039
             RSLDISKFSSY ELRSELARMFGLEG LEDP+RSGWQLVFVDRENDVLLLGDDPWQEFVN
Sbjct  766   RSLDISKFSSYDELRSELARMFGLEGQLEDPQRSGWQLVFVDRENDVLLLGDDPWQEFVN  825

Query  3040  NVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETR-NMNGIP-  3213
             NV YIKILSP EV QMGK  G+    + P   QRL +  ++ + +VS++E R + NG+  
Sbjct  826   NVGYIKILSPLEVQQMGK--GLSPVTSGPG--QRL-SSNNNFDDYVSRQELRSSSNGVAS  880

Query  3214  LGSLDY  3231
             +GS++Y
Sbjct  881   MGSINY  886



>ref|XP_006595764.1| PREDICTED: auxin response factor 6-like [Glycine max]
Length=896

 Score =  1126 bits (2913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 627/906 (69%), Positives = 712/906 (79%), Gaps = 28/906 (3%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S +G NP AEE  GEKKCLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTN
Sbjct  1     MKLSSSGFNPPAEE-EGEKKCLNSELWHACAGPLVSLPLVGSRVVYFPQGHSEQVAASTN  59

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             +E+DAHIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQK+V LLPAELG
Sbjct  60    REVDAHIPNYPNLPPQLICQLHNVTMHADAETDEVYAQMTLQPLSPQEQKEVYLLPAELG  119

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              P KQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIA+DLH NEW
Sbjct  120   TPGKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIARDLHDNEW  179

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQT+MPS
Sbjct  180   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTIMPS  239

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTR+SVGMR
Sbjct  240   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRISVGMR  299

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSV RYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  300   FRMLFETEESSVPRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  359

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRL+RPWPSGLPS  GL +GDM I SP  WL+G +GDQG+QSLNFQG
Sbjct  360   PLTTFPMYPSPFPLRLRRPWPSGLPSLYGLKDGDMGIGSPFMWLQGGLGDQGMQSLNFQG  419

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMA--------Tldssklasqqsllqfqqsipssss  1983
              G+TP+MQPRLDAS+ GLQP++YQ MA        T+D SK +      Q   ++PS+ +
Sbjct  420   LGVTPWMQPRLDASIPGLQPELYQAMASSAFQEIRTMDPSKSSQSLLQFQQTSNVPSAHA  479

Query  1984  sliqsqmlqRPHPQQNLLQSFQENQVISqaqilqqqlqrqqsyneqqqqqlhpppiqqfq  2163
             S +Q Q+L +  PQ  LL ++QENQV +Q+Q+LQQQL R   Y++ +QQQ     +   Q
Sbjct  480   SEVQRQVLPQSQPQNTLLHNYQENQVPAQSQLLQQQLHRYHPYSDPRQQQQQLKNLPVQQ  539

Query  2164  eqqqMSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRS  2343
             +   +  P+++     S TQSQ    QAL+S   QQSF +L+ NH+  S+ SS  SL  S
Sbjct  540   QLPNVISPLSNF---ASGTQSQSPPIQALASHCQQQSFPELMRNHISGSDVSSIHSLLGS  596

Query  2344  FSHDEASQLLNMHETNPL----ATLPSKRIALESQVSSRATPYVVSQADMI-SPNSKVSD  2508
             FS D  SQLLN+  +N +    A LP +      Q+ S A   V+ Q + + +  S VS+
Sbjct  597   FSQDGTSQLLNLSGSNSVMSSAAMLPKQITTEPPQLPSAAPQCVLPQVENLGTSQSNVSE  656

Query  2509  LPTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTD-SSILLQNGISNLKNSGGENGFLNMP  2685
             L   LPPF G+E   Y   A  Q +N L G+N D SS++LQNG+SNL+N G  N  L++P
Sbjct  657   L-AALPPFAGREHSAYHAAADPQ-SNLLFGINIDPSSLMLQNGMSNLRNIGNVNNSLSLP  714

Query  2686  FSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRS  2865
             FS  N     GTD+PL+ +M TSSCVDESGFLQSSENVDQAN P  TFVKVHKSGSFGRS
Sbjct  715   FSASNCGGASGTDFPLSSNMTTSSCVDESGFLQSSENVDQANTPTGTFVKVHKSGSFGRS  774

Query  2866  LDISKFSSYHELRSELARMFGLEGLLEDP--ERSGWQLVFVDRENDVLLLGDDPWQEFVN  3039
             LDISKFSSY EL SELARMFGLEG LEDP  +RSGWQLVFVDRENDVLLLGDDPWQEFVN
Sbjct  775   LDISKFSSYDELISELARMFGLEGQLEDPKTQRSGWQLVFVDRENDVLLLGDDPWQEFVN  834

Query  3040  NVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETR-NMNGIP-  3213
             NVWYIKILSP EV QMGK     L  +  A   +L    +SC+ +VSQ+E R + NG+  
Sbjct  835   NVWYIKILSPLEVQQMGK----GLSPSTSAPGNKLSTPANSCDNYVSQQELRSSRNGMAS  890

Query  3214  LGSLDY  3231
             +GS  Y
Sbjct  891   MGSFHY  896



>ref|XP_011032738.1| PREDICTED: auxin response factor 6-like isoform X2 [Populus euphratica]
Length=908

 Score =  1124 bits (2908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 615/907 (68%), Positives = 701/907 (77%), Gaps = 31/907 (3%)
 Frame = +1

Query  580   LAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEID  759
               G N Q  EG  +KKCLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTNKE+D
Sbjct  10    FTGFNQQTPEG--DKKCLNSELWHACAGPLVSLPLVGSRVVYFPQGHSEQVAASTNKEVD  67

Query  760   AHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSK  939
             AHIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS  +QKD  LLPAELG  SK
Sbjct  68    AHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLSQDDQKDAYLLPAELGTASK  127

Query  940   QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRH  1119
             QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFP LDYSQ PPAQELIA+DLH NEWKFRH
Sbjct  128   QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPALDYSQTPPAQELIARDLHDNEWKFRH  187

Query  1120  VFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLS  1299
             +FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQT MPSSVLS
Sbjct  188   IFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTFMPSSVLS  247

Query  1300  SDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRML  1479
             SDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPL KY KAVYHTRVSVGMRFRML
Sbjct  248   SDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLFKYIKAVYHTRVSVGMRFRML  307

Query  1480  FETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTT  1659
             FETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTT
Sbjct  308   FETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTT  367

Query  1660  FPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGIT  1839
             FPMYPS F +RLKRPWPSGLPSF GL +GD++I+SP+ WL+G +GD G+QSLNFQ +G+ 
Sbjct  368   FPMYPSAFPMRLKRPWPSGLPSFHGLKDGDLNINSPMMWLQGGVGDLGVQSLNFQSFGVA  427

Query  1840  PFMQPRLDASMLGLQPDIYQTMATldssklasqqsllqfqqsipsssssl---------i  1992
             P++QPR D SM  LQP++YQTMA     ++ + +S     QS      S           
Sbjct  428   PWIQPRFDTSMPALQPEMYQTMAAAALQEMRTVESSKLASQSHLQFQQSQNVSNGPTALT  487

Query  1993  qsqmlqRPHPQQNLLQSFQENQVISqaq--ilqqqlqrqqsyneqqqqqlhpppiqqfqe  2166
             Q QMLQ+ + Q  LLQ+FQENQ  +QAQ        + Q +  + QQ Q     +QQ ++
Sbjct  488   QRQMLQQSNLQHALLQNFQENQASTQAQFLQQHLLHRNQYTGQQLQQHQPQLQQVQQPKQ  547

Query  2167  qqqMSKP------ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQ  2328
               ++S P      I++LP + S   +Q    Q +SS   QQ+FS+ +GN +  S+ SS  
Sbjct  548   LNELSAPQQIPNVISALPHLTSVALTQSPSLQPISSRCQQQAFSEPLGNSIAASDVSSMH  607

Query  2329  SLPRSFSHDEASQLLNMHETNPLAT--LPSKRIALESQVSSRATPYVVSQADMI-SPNSK  2499
             S+  S S D  S LLN + +NP+ +  L SKR A++ Q+SS A    + Q + + +  S 
Sbjct  608   SVIGSLSQDGGSHLLNSNGSNPVISPALLSKRAAIDPQLSSGAAHCALPQVEQLRTTQST  667

Query  2500  VSDLPTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFL  2676
             VSDL T L PF G+E+  YQG    Q NN L GVN DSS  +LQ+GI NL+N G EN  L
Sbjct  668   VSDLATLLAPFSGREYSTYQGANDPQ-NNLLFGVNIDSSTFMLQHGIPNLRNIGTENDPL  726

Query  2677  NMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSF  2856
             +MPF+   FTS  G+D PLN DM  SSCVDESGFLQSSENVDQ NP  RTFVKVHKSGS+
Sbjct  727   SMPFAASTFTSATGSDIPLNSDMTASSCVDESGFLQSSENVDQVNPSTRTFVKVHKSGSY  786

Query  2857  GRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFV  3036
             GRSLDISKFSSY ELRSELAR+F LEGLLEDP+RSGWQLVF DRENDVLLLGDDPWQEFV
Sbjct  787   GRSLDISKFSSYDELRSELARLFCLEGLLEDPQRSGWQLVFGDRENDVLLLGDDPWQEFV  846

Query  3037  NNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRN-MNGIP  3213
             NNVWYIKILSP EV QMGK EG+    ++P+  Q+L N  S+C+ H++++  RN  NGI 
Sbjct  847   NNVWYIKILSPLEVQQMGK-EGLSPAASVPS--QKLSN--SNCDGHMNRQGFRNSSNGIA  901

Query  3214  -LGSLDY  3231
              +GSLDY
Sbjct  902   SMGSLDY  908



>ref|XP_007141460.1| hypothetical protein PHAVU_008G197600g [Phaseolus vulgaris]
 gb|ESW13454.1| hypothetical protein PHAVU_008G197600g [Phaseolus vulgaris]
Length=894

 Score =  1123 bits (2905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 610/906 (67%), Positives = 699/906 (77%), Gaps = 30/906 (3%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S +G N   EE  GEKKCLNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MKLSSSGFNQPGEE-EGEKKCLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  59

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             +E+DAHIP+YP LP QLICQLHNVTMHAD ETDEVYAQ+TLQPL+ QEQK+V L+PAELG
Sbjct  60    REVDAHIPNYPNLPPQLICQLHNVTMHADAETDEVYAQITLQPLNPQEQKEVYLMPAELG  119

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              P+KQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIA+DLH NEW
Sbjct  120   SPNKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIARDLHDNEW  179

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQT+MPS
Sbjct  180   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTIMPS  239

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  240   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  299

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRW NSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  300   FRMLFETEESSVRRYMGTITGISDLDPVRWSNSHWRSVKVGWDESTAGERQPRVSLWEIE  359

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRL+RPWP+GLPS  GL +GDM + SP  WL+G +GDQG+QSLNFQG
Sbjct  360   PLTTFPMYPSPFPLRLRRPWPTGLPSLYGLKDGDMGLGSPFMWLQGGLGDQGMQSLNFQG  419

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMATldssklasqqsllqfqqsipsssssliqsqml  2007
              G+ P+MQP+LD+S+ GLQP++YQ M +    ++ +       Q  +    +S + S   
Sbjct  420   LGVAPWMQPKLDSSIPGLQPELYQAMTSAAFQEMRTMDPSKSSQSLLQFQQTSNVPSAHT  479

Query  2008  qRPH--------PQQNLLQSFQENQVISqaqilqqqlqrqqsyneqqqqqlhpppiqqfq  2163
                H        PQ  LLQ+FQENQV        Q LQ+Q         Q     ++   
Sbjct  480   SEVHRQVLPQSQPQSTLLQNFQENQV----PPQSQLLQQQLHRYHPYSDQRQQQQLKNLP  535

Query  2164  eqqqMSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRS  2343
              QQQ+   I+ L    S TQSQ    QAL++   QQSF + + NH+  S+ S  QSL  S
Sbjct  536   VQQQLPNIISPLSNFASGTQSQSPPMQALATHCQQQSFPEPIRNHISGSDVSPIQSLLGS  595

Query  2344  FSHDEASQLLNMH----ETNPLATLPSKRIALESQVSSRATPYVVSQADMI-SPNSKVSD  2508
             FS D  SQLLN++      +  + LP K++ +ESQ+ S A   V+ Q + + +  S VS+
Sbjct  596   FSQDGTSQLLNLNGSNSIISSASILP-KQMTVESQLPSAAPQCVLPQVENLGTSQSNVSE  654

Query  2509  LPTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTD-SSILLQNGISNLKNSGGENGFLNMP  2685
             L   LPPFPG+E   Y G A  Q +N L G+N D SS++LQNG+SNL+N G  N  L++P
Sbjct  655   LAA-LPPFPGREHSAYHGAADPQ-SNLLFGINIDPSSLMLQNGMSNLRNMGNVNDSLSLP  712

Query  2686  FSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRS  2865
             FS  N     GTD+PL+ +M TSSC+DESGFLQSSENVDQAN P  TFVKVHKSGSFGRS
Sbjct  713   FSASNCGGATGTDFPLSSNMTTSSCMDESGFLQSSENVDQANTPTGTFVKVHKSGSFGRS  772

Query  2866  LDISKFSSYHELRSELARMFGLEGLLEDP--ERSGWQLVFVDRENDVLLLGDDPWQEFVN  3039
             LDISKFSSY ELRSELARMFGLEG LEDP  +RSGWQLVFVDRENDVLLLGDDPWQEFVN
Sbjct  773   LDISKFSSYDELRSELARMFGLEGQLEDPKTQRSGWQLVFVDRENDVLLLGDDPWQEFVN  832

Query  3040  NVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETR-NMNGIP-  3213
             NVWYIKILSP EV QMGK  G+    + P    +L   G+SC+ +V+Q+E R + NG+  
Sbjct  833   NVWYIKILSPLEVQQMGK--GVSPSTSAPG--HKLSTSGNSCDNYVNQQELRSSRNGMAS  888

Query  3214  LGSLDY  3231
             +GS  Y
Sbjct  889   MGSFHY  894



>ref|XP_002307574.2| hypothetical protein POPTR_0005s22930g [Populus trichocarpa]
 gb|EEE94570.2| hypothetical protein POPTR_0005s22930g [Populus trichocarpa]
Length=907

 Score =  1122 bits (2901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 616/905 (68%), Positives = 700/905 (77%), Gaps = 31/905 (3%)
 Frame = +1

Query  586   GVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAH  765
             G N Q  EG  +KKCLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTNKE+DAH
Sbjct  11    GFNQQTPEG--DKKCLNSELWHACAGPLVSLPHVGSRVVYFPQGHSEQVAASTNKEVDAH  68

Query  766   IPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQP  945
             IP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS  +QKD  LLPAELG  SKQP
Sbjct  69    IPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLSQDDQKDAYLLPAELGTASKQP  128

Query  946   TNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVF  1125
             TNYFCKTLTASDTSTHGGFSVPRRAAEKVFP LDYSQ PPAQELIA+DLH NEWKFRH+F
Sbjct  129   TNYFCKTLTASDTSTHGGFSVPRRAAEKVFPTLDYSQTPPAQELIARDLHDNEWKFRHIF  188

Query  1126  RGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSD  1305
             RGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQT MPSSVLSSD
Sbjct  189   RGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTFMPSSVLSSD  248

Query  1306  SMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFE  1485
             SMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPL KY KAVYHTRVSVGMRFRMLFE
Sbjct  249   SMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLVKYIKAVYHTRVSVGMRFRMLFE  308

Query  1486  TEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFP  1665
             TEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFP
Sbjct  309   TEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFP  368

Query  1666  MYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPF  1845
             MYPS F +RLKRPWPSGLPSF GL +GD++I+SP+ WL+G +GD G+QSLNFQ +G+ P+
Sbjct  369   MYPSAFPMRLKRPWPSGLPSFHGLQDGDLNINSPMMWLQGGVGDLGVQSLNFQSFGVAPW  428

Query  1846  MQPRLDASMLGLQPDIYQTMATldssklasqqsllqfqqsipsssssliqs---------  1998
             +QPR D SM  LQP++YQTMA     ++ + +S     QS      S   S         
Sbjct  429   IQPRFDTSMPALQPEMYQTMAAAALQEMRTVESSKLASQSHLQFQQSQNVSNGPAALIQR  488

Query  1999  qmlqRPHPQQNLLQSFQENQVISqaq--ilqqqlqrqqsyneqqqqqlhpppiqqfqeqq  2172
             QMLQ+ + Q  LLQ+FQENQ  +QAQ      Q + Q +  + QQ Q     +QQ ++  
Sbjct  489   QMLQQSNLQHALLQNFQENQASTQAQFLQQHLQHRNQYTGQQLQQHQPQLQQVQQPKQLN  548

Query  2173  qMSKP------ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSL  2334
             ++S P      I++LP + S   SQ    Q +SS   QQ+FS+ +GN +  S+ SS  S+
Sbjct  549   ELSAPQQIPNVISALPHLTSVAPSQSPSLQPISSQCQQQAFSEPLGNSIAASDVSSMHSV  608

Query  2335  PRSFSHDEASQLLNMHETNPLAT--LPSKRIALESQVSSRATPYVVSQADMI-SPNSKVS  2505
               S S D  S LLN + +NP+ +  L SKR A++ Q+SS A    + Q + + +  S VS
Sbjct  609   IGSLSQDGGSHLLNSNGSNPVISPALLSKRAAIDPQLSSGAAHCALPQVEQLRTTQSTVS  668

Query  2506  DLPTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNM  2682
             DL T L PF G+E+  YQG    Q NN L GVN DSS  +LQ+GI NL+N G EN  L+M
Sbjct  669   DLATLLAPFSGREYSTYQGANDPQ-NNLLFGVNIDSSTFMLQHGIPNLRNIGTENDPLSM  727

Query  2683  PFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGR  2862
             PF+   FTS  G+D PLN DM  SSCVDESGFLQSSENVDQ NP  RTFVKVHKSGS+GR
Sbjct  728   PFAASTFTSATGSDIPLNSDMTASSCVDESGFLQSSENVDQVNPSTRTFVKVHKSGSYGR  787

Query  2863  SLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNN  3042
             SLDISKFSSY ELRSELAR+F LEGLLEDP+RSGWQLVF DRENDVLLLGDDPWQEFVNN
Sbjct  788   SLDISKFSSYDELRSELARLFCLEGLLEDPQRSGWQLVFGDRENDVLLLGDDPWQEFVNN  847

Query  3043  VWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRN-MNGIP-L  3216
             VWYIKILSP EV QMGK EG+    ++P+  Q+L N  S+ + H++ +  RN  NGI  +
Sbjct  848   VWYIKILSPLEVQQMGK-EGLSPAASVPS--QKLSN--SNSDGHMNTQGFRNSSNGIASM  902

Query  3217  GSLDY  3231
             GSLDY
Sbjct  903   GSLDY  907



>gb|ABK95163.1| unknown [Populus trichocarpa]
Length=907

 Score =  1121 bits (2899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 616/905 (68%), Positives = 699/905 (77%), Gaps = 31/905 (3%)
 Frame = +1

Query  586   GVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAH  765
             G N Q  EG  +KKCLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTNKE+DAH
Sbjct  11    GFNQQTPEG--DKKCLNSELWHACAGPLVSLPHVGSRVVYFPQGHSEQVAASTNKEVDAH  68

Query  766   IPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQP  945
             IP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS  +QKD  LLPAELG  SKQP
Sbjct  69    IPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLSQDDQKDAYLLPAELGTASKQP  128

Query  946   TNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVF  1125
             TNYFCKTLTASDTSTHGGFSVPRRAAEKVFP LDYSQ PPAQELIA+DLH NEWKFRH+F
Sbjct  129   TNYFCKTLTASDTSTHGGFSVPRRAAEKVFPTLDYSQTPPAQELIARDLHDNEWKFRHIF  188

Query  1126  RGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSD  1305
             RGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQT MPSSVLSSD
Sbjct  189   RGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTFMPSSVLSSD  248

Query  1306  SMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFE  1485
             SMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPL KY KAVYHTRVSVGMRFRMLFE
Sbjct  249   SMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLVKYIKAVYHTRVSVGMRFRMLFE  308

Query  1486  TEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFP  1665
             TEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFP
Sbjct  309   TEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFP  368

Query  1666  MYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPF  1845
             MYPS F +RLKRPWPSGLPSF GL +GD++I+SP+ WL+G +GD G+QSLNFQ +G+ P+
Sbjct  369   MYPSAFPMRLKRPWPSGLPSFHGLQDGDLNINSPMMWLQGGVGDLGVQSLNFQSFGVAPW  428

Query  1846  MQPRLDASMLGLQPDIYQTMATldssklasqqsllqfqqsipsssssliqs---------  1998
             +QPR D SM  LQP++YQTMA     ++ + +S     QS      S   S         
Sbjct  429   IQPRFDTSMPALQPEMYQTMAAAALQEMRTVESSKLASQSHLQFQQSQNVSNGPAALIQR  488

Query  1999  qmlqRPHPQQNLLQSFQENQVISqaq--ilqqqlqrqqsyneqqqqqlhpppiqqfqeqq  2172
             QMLQ+ + Q  LLQ+FQENQ  +QAQ      Q + Q +  + QQ Q     +QQ ++  
Sbjct  489   QMLQQSNLQHALLQNFQENQASTQAQFLQQHLQHRNQYTGQQLQQHQPQLQQVQQPKQLN  548

Query  2173  qMSKP------ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSL  2334
             ++S P      I++LP + S   SQ    Q +SS   QQ+FS+ +GN +  S+ SS  S+
Sbjct  549   ELSAPQQIPNVISALPHLTSVAPSQSPSLQPISSQCQQQAFSEPLGNSIAASDVSSMHSV  608

Query  2335  PRSFSHDEASQLLNMHETNPLAT--LPSKRIALESQVSSRATPYVVSQADMI-SPNSKVS  2505
               S S D  S LLN + +NP+ +  L SKR A++ Q+SS A    + Q + + +  S VS
Sbjct  609   IGSLSQDGGSHLLNSNGSNPVISPALLSKRAAIDPQLSSGAAHCALPQVEQLRTTQSTVS  668

Query  2506  DLPTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNM  2682
             DL T L PF G+E+  YQG    Q NN L GVN DSS  +LQ+GI NL+N G EN  L+M
Sbjct  669   DLATLLAPFSGREYSTYQGANDPQ-NNLLFGVNIDSSTFMLQHGIPNLRNIGTENDPLSM  727

Query  2683  PFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGR  2862
             PF+   FTS  G+D PLN DM  SSCVDESGFLQSSENVDQ NP  RTFVKVHKSGS+GR
Sbjct  728   PFAASTFTSATGSDIPLNSDMTASSCVDESGFLQSSENVDQVNPSTRTFVKVHKSGSYGR  787

Query  2863  SLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNN  3042
             SLDISKFSSY ELRSELAR+F LEGLLEDP+RSGWQLVF DRENDVLLLGDDPWQEFVNN
Sbjct  788   SLDISKFSSYDELRSELARLFCLEGLLEDPQRSGWQLVFGDRENDVLLLGDDPWQEFVNN  847

Query  3043  VWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRN-MNGIP-L  3216
             VWYIKILSP EV QMGK EG+    ++P   Q+L N  S+ + H++ +  RN  NGI  +
Sbjct  848   VWYIKILSPLEVQQMGK-EGLSPAASVPC--QKLSN--SNSDGHMNTQGFRNSSNGIASM  902

Query  3217  GSLDY  3231
             GSLDY
Sbjct  903   GSLDY  907



>ref|XP_011032737.1| PREDICTED: auxin response factor 6-like isoform X1 [Populus euphratica]
Length=909

 Score =  1120 bits (2898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 615/908 (68%), Positives = 701/908 (77%), Gaps = 32/908 (4%)
 Frame = +1

Query  580   LAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEID  759
               G N Q  EG  +KKCLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTNKE+D
Sbjct  10    FTGFNQQTPEG--DKKCLNSELWHACAGPLVSLPLVGSRVVYFPQGHSEQVAASTNKEVD  67

Query  760   AHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSK  939
             AHIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS  +QKD  LLPAELG  SK
Sbjct  68    AHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLSQDDQKDAYLLPAELGTASK  127

Query  940   QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRH  1119
             QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFP LDYSQ PPAQELIA+DLH NEWKFRH
Sbjct  128   QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPALDYSQTPPAQELIARDLHDNEWKFRH  187

Query  1120  VFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLS  1299
             +FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQT MPSSVLS
Sbjct  188   IFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTFMPSSVLS  247

Query  1300  SDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRML  1479
             SDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPL KY KAVYHTRVSVGMRFRML
Sbjct  248   SDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLFKYIKAVYHTRVSVGMRFRML  307

Query  1480  FETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTT  1659
             FETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTT
Sbjct  308   FETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTT  367

Query  1660  FPMYPSPFSLRLKRPWPSGLPSF-PGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGI  1836
             FPMYPS F +RLKRPWPSGLPSF  GL +GD++I+SP+ WL+G +GD G+QSLNFQ +G+
Sbjct  368   FPMYPSAFPMRLKRPWPSGLPSFHAGLKDGDLNINSPMMWLQGGVGDLGVQSLNFQSFGV  427

Query  1837  TPFMQPRLDASMLGLQPDIYQTMATldssklasqqsllqfqqsipsssssl---------  1989
              P++QPR D SM  LQP++YQTMA     ++ + +S     QS      S          
Sbjct  428   APWIQPRFDTSMPALQPEMYQTMAAAALQEMRTVESSKLASQSHLQFQQSQNVSNGPTAL  487

Query  1990  iqsqmlqRPHPQQNLLQSFQENQVISqaq--ilqqqlqrqqsyneqqqqqlhpppiqqfq  2163
              Q QMLQ+ + Q  LLQ+FQENQ  +QAQ        + Q +  + QQ Q     +QQ +
Sbjct  488   TQRQMLQQSNLQHALLQNFQENQASTQAQFLQQHLLHRNQYTGQQLQQHQPQLQQVQQPK  547

Query  2164  eqqqMSKP------ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSST  2325
             +  ++S P      I++LP + S   +Q    Q +SS   QQ+FS+ +GN +  S+ SS 
Sbjct  548   QLNELSAPQQIPNVISALPHLTSVALTQSPSLQPISSRCQQQAFSEPLGNSIAASDVSSM  607

Query  2326  QSLPRSFSHDEASQLLNMHETNPLAT--LPSKRIALESQVSSRATPYVVSQADMI-SPNS  2496
              S+  S S D  S LLN + +NP+ +  L SKR A++ Q+SS A    + Q + + +  S
Sbjct  608   HSVIGSLSQDGGSHLLNSNGSNPVISPALLSKRAAIDPQLSSGAAHCALPQVEQLRTTQS  667

Query  2497  KVSDLPTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGF  2673
              VSDL T L PF G+E+  YQG    Q NN L GVN DSS  +LQ+GI NL+N G EN  
Sbjct  668   TVSDLATLLAPFSGREYSTYQGANDPQ-NNLLFGVNIDSSTFMLQHGIPNLRNIGTENDP  726

Query  2674  LNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGS  2853
             L+MPF+   FTS  G+D PLN DM  SSCVDESGFLQSSENVDQ NP  RTFVKVHKSGS
Sbjct  727   LSMPFAASTFTSATGSDIPLNSDMTASSCVDESGFLQSSENVDQVNPSTRTFVKVHKSGS  786

Query  2854  FGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEF  3033
             +GRSLDISKFSSY ELRSELAR+F LEGLLEDP+RSGWQLVF DRENDVLLLGDDPWQEF
Sbjct  787   YGRSLDISKFSSYDELRSELARLFCLEGLLEDPQRSGWQLVFGDRENDVLLLGDDPWQEF  846

Query  3034  VNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRN-MNGI  3210
             VNNVWYIKILSP EV QMGK EG+    ++P+  Q+L N  S+C+ H++++  RN  NGI
Sbjct  847   VNNVWYIKILSPLEVQQMGK-EGLSPAASVPS--QKLSN--SNCDGHMNRQGFRNSSNGI  901

Query  3211  P-LGSLDY  3231
               +GSLDY
Sbjct  902   ASMGSLDY  909



>gb|KDP38016.1| hypothetical protein JCGZ_04659 [Jatropha curcas]
Length=899

 Score =  1115 bits (2884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 623/909 (69%), Positives = 708/909 (78%), Gaps = 31/909 (3%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR++ AG NPQ +EG  EK+ LNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLASAGFNPQTQEG--EKRVLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQKD   LPAELG
Sbjct  59    KEVDAHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLSPQEQKDT-YLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NEW
Sbjct  118   TPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPL KY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLTKYVKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRLKRPWP GLPSF G+ + D+ ++SPL WLRG+ GD+GIQS+NFQG
Sbjct  358   PLTTFPMYPSPFPLRLKRPWPPGLPSFHGMKDDDLGMNSPLMWLRGD-GDRGIQSMNFQG  416

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMATldssklasqqsllqfqqsip---------sss  1980
              G+TP+MQPR+DASMLGLQ D+Y  MA     ++ +         S+          S +
Sbjct  417   LGVTPWMQPRVDASMLGLQTDMYHAMAAAALQEMRAIDPSKPSNTSLLQFQQHVNLPSRT  476

Query  1981  ssliqsqmlqRPHPQQNLLQSFQENQ-----VISqaqilqqqlqrqqsyneqqqqqlhpp  2145
             ++L+Q QMLQ   PQQ  LQS QENQ            L QQ  + Q     QQQQ   P
Sbjct  477   AALMQPQMLQSSQPQQAFLQSVQENQHQPQAQTQTQSHLLQQQLQHQHSLSTQQQQQPLP  536

Query  2146  piqqfqeqqqMSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSST  2325
               QQ  E QQ+   ++S+ +  S +QSQ    QA+SS   QQSFSD  GN V +S  S  
Sbjct  537   QQQQLVEHQQIQNVVSSISQFASASQSQSPPLQAISSLCQQQSFSDSNGNPVTSSVVSPL  596

Query  2326  QSLPRSFSHDEASQLLNMHETNPLAT---LPSKRIALESQVSSRATPYVVSQADMIS-PN  2493
              SL  SFS DE S L+NM  TNPL T    PSKR A+E  +SS A   V+ Q + +  P 
Sbjct  597   HSLMGSFSQDETSHLMNMPRTNPLMTSSAWPSKRAAVEPLISSGAPQCVLPQVEQLGPPQ  656

Query  2494  SKVSDLPTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTD-SSILLQNGISNLKNSGGENG  2670
             + +S     LPPFPG+     Q  A  Q ++ L GVN + SS+LLQ+G+S L+  G ++ 
Sbjct  657   ANISHSSVSLPPFPGRGCSLDQEGADPQ-SHLLFGVNIEPSSLLLQSGMSGLRGVGSDSD  715

Query  2671  FLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSG  2850
                +PFS+ N+ S  G+D+ LNP M  SSC+DESGFLQS ENV Q NPP+RTFVKV+KSG
Sbjct  716   STTIPFSSSNYMSTTGSDFSLNPAMTPSSCIDESGFLQSPENVGQVNPPSRTFVKVYKSG  775

Query  2851  SFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQE  3030
             SFGRSLDI+KFSSY+ELRSELARMFGLEG LEDP RSGWQLVFVDRENDVLLLGDDPW E
Sbjct  776   SFGRSLDITKFSSYNELRSELARMFGLEGQLEDPLRSGWQLVFVDRENDVLLLGDDPWPE  835

Query  3031  FVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMN-G  3207
             FVN+VW IKILSP EV QMGK  G++L N++P   QRL NG  SC+ + S++++RN++ G
Sbjct  836   FVNSVWCIKILSPQEVQQMGK-RGLELLNSVPI--QRLSNG--SCDDYASRQDSRNLSTG  890

Query  3208  I-PLGSLDY  3231
             I  +GSLDY
Sbjct  891   ITSVGSLDY  899



>ref|XP_010054260.1| PREDICTED: auxin response factor 6-like [Eucalyptus grandis]
Length=870

 Score =  1113 bits (2880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 605/870 (70%), Positives = 692/870 (80%), Gaps = 21/870 (2%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGT--GEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTAS  741
             MR+S +G N Q+ E +  GEKKCLNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV AS
Sbjct  1     MRLSSSGFNHQSPEASNAGEKKCLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAAS  60

Query  742   TNKEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAE  921
             TNKE+DAHIP+YP L  QLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQKD+ LLPAE
Sbjct  61    TNKEVDAHIPNYPNLSPQLICQLHNVTMHADVETDEVYAQMTLQPLSPQEQKDLYLLPAE  120

Query  922   LGMPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGN  1101
             LG PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIA+DLH N
Sbjct  121   LGTPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIARDLHDN  180

Query  1102  EWKFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVM  1281
             EWKFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVM
Sbjct  181   EWKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVM  240

Query  1282  PSSVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVG  1461
             PSSVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVG
Sbjct  241   PSSVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVG  300

Query  1462  MRFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWE  1641
             MRFRMLFETEESSVRRYMGTITGISDLDPVRW NSHWRSVKVGWDESTAGERQPRVSLWE
Sbjct  301   MRFRMLFETEESSVRRYMGTITGISDLDPVRWQNSHWRSVKVGWDESTAGERQPRVSLWE  360

Query  1642  IEPLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNF  1821
             IEPLTTFPMYPSPF LRLKRPWPSGLPSF  L +GDM ISS L WL+G +GDQG+QSLNF
Sbjct  361   IEPLTTFPMYPSPFPLRLKRPWPSGLPSFHALRDGDMSISSSLMWLQG-VGDQGVQSLNF  419

Query  1822  QGYGITPFMQPRLDASMLGLQPDIYQTMATldssklasqqsllqfqqsip---------s  1974
             QG+G+TP++QPR D SM  LQ D+YQ MA+     + +        QS+           
Sbjct  420   QGFGMTPWLQPRYDTSMAALQTDVYQAMASAALQDMRAVDPSKCASQSLLPLQQSQNVPM  479

Query  1975  ssssliqsqmlqRPHPQQNLLQSFQENQVISqaqilqqqlqrqqsyneqqqqqlhpppiq  2154
               +S+IQ QMLQ+   Q +LLQ FQENQ  +Q Q+LQ      Q   +QQ QQ      Q
Sbjct  480   GQASIIQRQMLQQSQSQNSLLQGFQENQATAQGQVLQHPSYNDQRQQQQQHQQQPQQSQQ  539

Query  2155  qfqeqqqMSKP--ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQ  2328
                   Q   P  IT+LP+  S  QSQ S   A+S +  Q  FSD + N ++ S+ S  Q
Sbjct  540   FNHTSLQQQMPNIITTLPQYGSIGQSQSSSLPAISQS-QQNIFSDGMENPIVASDVSPMQ  598

Query  2329  SLPRSFSHDEASQLLNMHETNPL--ATLPSKRIALESQVSSRATPYVVSQADMI-SPNSK  2499
             S+  S S D +SQLL+++ ++ +  ++L  K+ ++E  + S A   ++ Q + + + ++ 
Sbjct  599   SILGSISRDGSSQLLSVNGSDSMISSSLLKKQNSVEPHLLSEAAHCILPQVEQLATTHTN  658

Query  2500  VSDLPTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTDS-SILLQNGISNLKNSGGENGFL  2676
             VS+   +LPPFPG+E+  Y G    Q ++ L GVN DS S+++QNG+ +L+N G E+  L
Sbjct  659   VSEFANYLPPFPGREYSAYPGATDPQ-SSLLFGVNIDSTSLMMQNGMQHLRNIGSEHDSL  717

Query  2677  NMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSF  2856
             ++PF T NF S  GT++P N DM TSSCVDESGFLQSSENVDQ NPP RTFVKVHKSG+F
Sbjct  718   SVPFGTSNFASVAGTEFPHNSDMATSSCVDESGFLQSSENVDQVNPPTRTFVKVHKSGTF  777

Query  2857  GRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFV  3036
             GRSLDISKFSSY ELRSELARMFGLEG LEDP+RSGWQLVFVDREND+LLLGDDPWQEFV
Sbjct  778   GRSLDISKFSSYDELRSELARMFGLEGQLEDPQRSGWQLVFVDRENDILLLGDDPWQEFV  837

Query  3037  NNVWYIKILSPFEVHQMGKEEGIDLPNNLP  3126
             NNVWYIKILSP EV Q+GK +GI+  N++P
Sbjct  838   NNVWYIKILSPHEVKQLGK-QGINPANSVP  866



>gb|KDO63435.1| hypothetical protein CISIN_1g002390mg [Citrus sinensis]
Length=833

 Score =  1113 bits (2880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 600/836 (72%), Positives = 679/836 (81%), Gaps = 19/836 (2%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR++ +G N Q +EG  EKKCLNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLATSGFNQQTQEG--EKKCLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP LP QLICQLHN+TMHAD ETDEVYAQMTLQPLS QEQKDV LLPAELG
Sbjct  59    KEVDAHIPNYPNLPPQLICQLHNLTMHADVETDEVYAQMTLQPLSPQEQKDVYLLPAELG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              P+KQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQ PPAQELIA+DLH NEW
Sbjct  119   APNKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQTPPAQELIARDLHDNEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA RPQTVMPS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRATRPQTVMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  239   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  299   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  358

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMY SPF LRLKRPWPSGLPSF G+ +GDM I+SPL WL+G +GDQGIQSLNFQG
Sbjct  359   PLTTFPMYSSPFPLRLKRPWPSGLPSFHGMKDGDMSINSPLMWLQGGVGDQGIQSLNFQG  418

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMATldssklasqqsllqfqqsipsssssliqsqml  2007
             YG+TP+MQPRLDAS+ GLQPD+YQ MA     ++ +  S     QS+     S   S   
Sbjct  419   YGVTPWMQPRLDASIPGLQPDVYQAMAAAALQEMRTVDSSKLASQSLLQFQQSQNVSNGT  478

Query  2008  qRPHPQQ---------NLLQSFQENQVISqaqilqqqlqrqqsyneqqqqqlhpppiqqf  2160
                 P+Q          LLQSFQENQ  +QAQ+LQQQLQRQ SYNEQ+QQQ      QQ 
Sbjct  479   ASMIPRQMLQQSQAQNALLQSFQENQASAQAQLLQQQLQRQHSYNEQRQQQQQVQQSQQL  538

Query  2161  qeqq---qMSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQS  2331
              +     Q+S  I++LP + S++QSQ    Q ++S   Q +FSD +GN + +S+ SS  +
Sbjct  539   HQLSVQPQISNVISTLPHLASSSQSQPPTLQTVASQCQQSNFSDSLGNPIASSDVSSMHT  598

Query  2332  LPRSFSHDEASQLLNMHETNPL---ATLPSKRIALESQVSSRATPYVVSQADMI-SPNSK  2499
             +  S S   AS LLN + +NP+   + + +K++ +++ V S  +  ++ Q + + +  S 
Sbjct  599   ILGSLSQAGASHLLNSNASNPIISSSAMLTKQVTVDNHVPSAVSHCILPQVEQLGAQQSN  658

Query  2500  VSDLPTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTDSSILLQNGISNLKNSGGENGFLN  2679
             VS+L + LPPFPG+E+  Y G    Q NN L GV+ DSS++ QNG+ NLKN   EN  L+
Sbjct  659   VSELASLLPPFPGREYSSYHGSGDPQ-NNLLFGVSIDSSLMGQNGLPNLKNISSENESLS  717

Query  2680  MPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFG  2859
             +P++  NFT+ VGTD+PLN DM TSSCVDESGFLQSSENVDQ NPP RTFVKVHKSGSFG
Sbjct  718   LPYAASNFTNNVGTDFPLNSDMTTSSCVDESGFLQSSENVDQVNPPTRTFVKVHKSGSFG  777

Query  2860  RSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQ  3027
             RSLDISKFSSY ELRSELARMFGLEG LEDP+RSGWQLVFVDRENDVLLLGDDPWQ
Sbjct  778   RSLDISKFSSYDELRSELARMFGLEGQLEDPQRSGWQLVFVDRENDVLLLGDDPWQ  833



>emb|CBI22060.3| unnamed protein product [Vitis vinifera]
Length=836

 Score =  1112 bits (2877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/869 (68%), Positives = 664/869 (76%), Gaps = 83/869 (10%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S +G   Q EEG  EKKCLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSSGFAHQTEEG--EKKCLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP L  QLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQK+VCLLPAELG
Sbjct  59    KEVDAHIPNYPSLAPQLICQLHNVTMHADVETDEVYAQMTLQPLSPQEQKEVCLLPAELG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDY+QQPPAQELIA+DLHGNEW
Sbjct  119   SPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYTQQPPAQELIARDLHGNEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRL+AGD+V+FIWNE NQLLLGIRRANRPQT+MPS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSVFVSAKRLIAGDSVLFIWNEKNQLLLGIRRANRPQTIMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKYAKAVYHTRVSVGMR
Sbjct  239   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYAKAVYHTRVSVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  299   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  358

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRLKRPWPS LPSF    +GDM I+SPL WLRG++GDQGIQSLNFQG
Sbjct  359   PLTTFPMYPSPFPLRLKRPWPSALPSFHAHKDGDMSINSPLMWLRGDIGDQGIQSLNFQG  418

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMATldssklasqqsllqfqqsipsssssliqsqml  2007
             YG+TP+MQPRLDASMLGLQ ++ Q +A     +L +                        
Sbjct  419   YGLTPWMQPRLDASMLGLQSNMQQAIAAASLQELRALDPSK-------------------  459

Query  2008  qRPHPQQNLLQSFQENQVISqaqilqqqlqrqqsyneqqqqqlhpppiqqfqeqqqMSKP  2187
                HP Q+LLQ FQ+ Q +S             S     + Q+      +  +QQ + K 
Sbjct  460   ---HPAQSLLQ-FQQPQNVS------------NSPASVFRGQIFCNNSCRLSDQQHIPKV  503

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQ  2367
             I++L +++S TQS     Q + S + QQ F D VGN + TS+ S+ QSL  SFS D  S 
Sbjct  504   ISALSQLSSPTQSLPPSLQTIPSPIQQQIFPDSVGNPITTSDVSTMQSLLGSFSQDGTSH  563

Query  2368  LLNMHETNPLATLPS---KRIALESQVSSRATPYVVSQA-DMISPNSKVSDLPTFLPPFP  2535
             LLN+H +NP+ +  +   K++A+E  + S  T  V+ Q  ++ +P S  S+L T LPPFP
Sbjct  564   LLNLHGSNPVISSSAFFPKQVAVEPPLPSGTTQCVLPQVEELATPPSNASELSTLLPPFP  623

Query  2536  GKEFPEYQGVAYSQGNNALLGVNTDSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGV  2715
             G++                                       EN  ++MPFST NF +  
Sbjct  624   GRD---------------------------------------ENDSVSMPFSTPNFANAP  644

Query  2716  GTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYH  2895
             GTD+PLN DM TSSC+DESGFLQSSEN++Q NPP RTFVKVHK GSFGRSLDI+KFSSY 
Sbjct  645   GTDFPLNSDMTTSSCIDESGFLQSSENLEQVNPPTRTFVKVHKLGSFGRSLDITKFSSYD  704

Query  2896  ELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFE  3075
             ELR EL RMFGLEG LEDP RSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSP E
Sbjct  705   ELRGELGRMFGLEGRLEDPLRSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPLE  764

Query  3076  VHQMGKEEGIDLPNNLPAANQRLPNGGSS  3162
             V QMGK EGI++PN +P+   R+ N G+S
Sbjct  765   VQQMGK-EGINVPNPIPS--HRISNSGNS  790



>ref|XP_009602215.1| PREDICTED: auxin response factor 6-like isoform X3 [Nicotiana 
tomentosiformis]
Length=778

 Score =  1108 bits (2866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 598/768 (78%), Positives = 655/768 (85%), Gaps = 11/768 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MRVS AG NPQ EE TGEKKCLNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRVSSAGFNPQPEEATGEKKCLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  60

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YPGLP QLICQLHN+TMHAD ETDEVYAQMTLQPLSAQEQKDVCLLPAELG
Sbjct  61    KEVDAHIPNYPGLPPQLICQLHNLTMHADVETDEVYAQMTLQPLSAQEQKDVCLLPAELG  120

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPP QELIAKDLHGNEW
Sbjct  121   IPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPCQELIAKDLHGNEW  180

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS
Sbjct  181   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  240

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKYAKAVYHTR+SVGMR
Sbjct  241   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYAKAVYHTRISVGMR  300

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  301   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  360

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPFSLRLKRPWPSGLPS PG  NG+M ++SPLSWLRG++GDQGIQSLNFQG
Sbjct  361   PLTTFPMYPSPFSLRLKRPWPSGLPSLPGFPNGNMTMNSPLSWLRGDIGDQGIQSLNFQG  420

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMATldssklasqqsllqfqqsipsssssliqsqml  2007
             YG+TPFMQPR+DASMLGLQPDI QTMA LD SKLA+Q  +   Q     S+S      + 
Sbjct  421   YGVTPFMQPRIDASMLGLQPDILQTMAALDPSKLANQSFMQFQQSIPGGSASLSHSQILQ  480

Query  2008  qRPHPQQNLLQSFQENQVISqaqilqqqlqrqqsyneqqqqqlhpppiqqfqeqqqM---  2178
                  QQNLL  F ENQ+ISQAQ+LQQQLQR+Q+YN+QQQ         Q     Q    
Sbjct  481   PS-LSQQNLLHGFSENQLISQAQMLQQQLQRRQNYNDQQQLLQPQLQQHQEVNSSQFQHQ  539

Query  2179  --SKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSH  2352
               +K ++SL +M S  Q QLSH Q LSST   Q+FSD++GNHV  S+NS+ QSL  SFS 
Sbjct  540   QQTKAMSSLSQMTSAAQPQLSHLQVLSSTGSPQTFSDILGNHVNASSNSTMQSLLSSFSR  599

Query  2353  DEASQLLNMHETNPLA--TLPSKRIALESQVSSRATPYVVSQ-ADMISPNSKVSDLPTFL  2523
             D AS +LNMHE +PL   +  SKRIALESQ+ SR TP+ V Q  D+IS N+KVSDL + L
Sbjct  600   DGASAVLNMHEAHPLVSSSSSSKRIALESQLPSRVTPFAVPQPEDVISHNTKVSDLSSLL  659

Query  2524  PPFPGKE-FPEYQGVAYSQGNNALLGVNTDSSILLQNGISNLKNSGGENGFLNMPFSTCN  2700
             PPFPG+E F +Y+GV  SQ N+AL G NTDS  +LQNG+SN+K+S G+NG L++P++T  
Sbjct  660   PPFPGRESFSDYRGVEDSQ-NSALYGFNTDSLNILQNGMSNMKDSSGDNGSLSIPYATST  718

Query  2701  FTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHK  2844
             FT+ VG +YP+N DM TSSCVDESGFLQSSEN DQANP NRTFVKVHK
Sbjct  719   FTNTVGNEYPINSDMTTSSCVDESGFLQSSENGDQANPTNRTFVKVHK  766



>ref|XP_006448968.1| hypothetical protein CICLE_v10014198mg [Citrus clementina]
 gb|ESR62208.1| hypothetical protein CICLE_v10014198mg [Citrus clementina]
Length=899

 Score =  1083 bits (2800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 604/908 (67%), Positives = 699/908 (77%), Gaps = 29/908 (3%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG +PQ +EG  EK+ LNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSTAGFSPQHQEG--EKRVLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQK+   LPAELG
Sbjct  59    KEVDAHIPNYPSLPPQLICQLHNVTMHADIETDEVYAQMTLQPLSPQEQKE-AYLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
               SKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NEW
Sbjct  118   TLSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+ NQLLLGIRRANRP TVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDKNQLLLGIRRANRPPTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYIKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPV+WPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDPVKWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMY SPF LRLKRPWP GLP+F G+ + D+ I+S L WLRG+ GD+G+QSLNFQG
Sbjct  358   PLTTFPMYSSPFPLRLKRPWPVGLPAFHGIKDEDLGINSQLMWLRGD-GDRGMQSLNFQG  416

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMATldssklasqqsllqfqqsip---------sss  1980
              G+TP+MQPR+DASMLGLQ D+YQ MA     ++ +         S+          S +
Sbjct  417   LGVTPWMQPRMDASMLGLQNDMYQAMAAAALREMRAVDPSKPNAASLMQFQQPQNLPSRT  476

Query  1981  ssliqsqmlqRPHPQQNLLQSFQENQVISqaqilqqqlqrqqsyneqqq----qqlhppp  2148
             S+L+QSQMLQ+ HPQQ  LQ  QENQ  SQ+Q   Q    Q            QQ   P 
Sbjct  477   SALVQSQMLQQSHPQQTFLQGVQENQHQSQSQTHSQSHLLQPQLQHSHSFNNQQQQPLPQ  536

Query  2149  iqqfqeqqqMSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQ  2328
              QQ  + QQ+   ++++ +  S +QSQ    QA+SS   QQSFSD  GN       S   
Sbjct  537   PQQQVDHQQIPSAVSAMSQFASVSQSQSPPMQAISSLCQQQSFSDSNGNPATNPIVSPLH  596

Query  2329  SLPRSFSHDEASQLLNMHETNPLA---TLPSKRIALESQVSSRATPYVVSQADMIS-PNS  2496
             SL  S++ DE+S LLN+  +NPL    T PSKR A+E   SS A   V+   + +  P++
Sbjct  597   SLLGSYAQDESSHLLNLPRSNPLIHSPTWPSKRAAVEPLFSSGAPQCVLPSVEQLGPPHA  656

Query  2497  KVSDLPTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTD-SSILLQNGISNLKNSGGENGF  2673
              +S     LPPFPG+E    Q V+    ++ L GVN + SS+L+QN +S+L   G  +  
Sbjct  657   NISQNSISLPPFPGRECSIDQEVSADPQSHLLFGVNIEPSSLLMQNEMSSLGGVGSNSDS  716

Query  2674  LNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGS  2853
               +PF++ N+ S  G D+ +NP++  SSC+DESGFLQS ENV Q NPPNRTFVKV+KSGS
Sbjct  717   TTIPFASSNYMSTAGADFSVNPEIAPSSCIDESGFLQSPENVGQVNPPNRTFVKVYKSGS  776

Query  2854  FGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEF  3033
             FGRSLDI+KFSSYHELRSELARMFGLEG LEDP RSGWQLVFVDRENDVLLLGD PW EF
Sbjct  777   FGRSLDITKFSSYHELRSELARMFGLEGHLEDPLRSGWQLVFVDRENDVLLLGDGPWPEF  836

Query  3034  VNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMNG--  3207
             VN+VW IKILSP EV QMGK  G +L N++P   QRL N  SSC+ + +++++RN++   
Sbjct  837   VNSVWCIKILSPPEVQQMGK-RGNELLNSVPI--QRLSN--SSCDDYATRQDSRNLSAGI  891

Query  3208  IPLGSLDY  3231
               +GSLD+
Sbjct  892   TSVGSLDF  899



>ref|XP_006468258.1| PREDICTED: auxin response factor 6-like isoform X1 [Citrus sinensis]
 gb|KDO75360.1| hypothetical protein CISIN_1g002624mg [Citrus sinensis]
Length=899

 Score =  1079 bits (2791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 603/908 (66%), Positives = 698/908 (77%), Gaps = 29/908 (3%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG +PQ +EG  EK+ LNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSTAGFSPQHQEG--EKRVLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQK+   LPAELG
Sbjct  59    KEVDAHIPNYPSLPPQLICQLHNVTMHADIETDEVYAQMTLQPLSPQEQKE-AYLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
               SKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NEW
Sbjct  118   TLSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+ NQLLLGIRRANRP TVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDKNQLLLGIRRANRPPTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYIKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPV+WPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDPVKWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMY SPF LRLKRPWP GLP+F G+ + D+ I+S L WLRG+ GD+G+QSLNFQG
Sbjct  358   PLTTFPMYSSPFPLRLKRPWPVGLPAFHGIKDEDLGINSQLMWLRGD-GDRGMQSLNFQG  416

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMATldssklasqqsllqfqqsip---------sss  1980
              G+TP+MQPR+DASMLGLQ D+YQ MA     ++ +         S+          S +
Sbjct  417   LGVTPWMQPRMDASMLGLQNDMYQAMAAAALREMRAVDPSKPNAASLMQFQQPQNLPSRT  476

Query  1981  ssliqsqmlqRPHPQQNLLQSFQENQVISqaqilqqqlqrqqsyneqqq----qqlhppp  2148
             S+L+QSQMLQ+ HPQQ  LQ  QENQ  SQ+Q   Q    Q            QQ   P 
Sbjct  477   SALVQSQMLQQSHPQQTFLQGVQENQHQSQSQTHSQSHLLQPQLQHSHSFNNQQQQPLPQ  536

Query  2149  iqqfqeqqqMSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQ  2328
              QQ  + QQ+   ++++ +  S +QSQ    QA+SS   QQSFSD  GN       S   
Sbjct  537   PQQQVDHQQIPSAVSAMSQFASVSQSQSPPMQAISSLCQQQSFSDSNGNPATNPIVSPLH  596

Query  2329  SLPRSFSHDEASQLLNMHETNPLA---TLPSKRIALESQVSSRATPYVVSQADMIS-PNS  2496
             SL  S++ DE+S LLN+  +NPL    T PSKR A+E   SS A   V+   + +  P++
Sbjct  597   SLLGSYAQDESSHLLNLPRSNPLIHSPTWPSKRAAVEPLFSSGAPQCVLPSVEQLGPPHA  656

Query  2497  KVSDLPTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTD-SSILLQNGISNLKNSGGENGF  2673
              +S     LPPFPG+E    Q  +    ++ L GVN + SS+L+QN +S+L   G  +  
Sbjct  657   NISQNSISLPPFPGRECSIDQEGSADPQSHLLFGVNIEPSSLLMQNEMSSLGGVGSNSDS  716

Query  2674  LNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGS  2853
               +PF++ N+ S  G D+ +NP++  SSC+DESGFLQS ENV Q NPPNRTFVKV+KSGS
Sbjct  717   TTIPFASSNYMSTAGADFSVNPEIAPSSCIDESGFLQSPENVGQVNPPNRTFVKVYKSGS  776

Query  2854  FGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEF  3033
             FGRSLDI+KFSSYHELRSELARMFGLEG LEDP RSGWQLVFVDRENDVLLLGD PW EF
Sbjct  777   FGRSLDITKFSSYHELRSELARMFGLEGHLEDPLRSGWQLVFVDRENDVLLLGDGPWPEF  836

Query  3034  VNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMNG--  3207
             VN+VW IKILSP EV QMGK  G +L N++P   QRL N  SSC+ + +++++RN++   
Sbjct  837   VNSVWCIKILSPPEVQQMGK-RGNELLNSVPI--QRLSN--SSCDDYATRQDSRNLSAGI  891

Query  3208  IPLGSLDY  3231
               +GSLD+
Sbjct  892   TSVGSLDF  899



>ref|XP_006468259.1| PREDICTED: auxin response factor 6-like isoform X2 [Citrus sinensis]
 gb|KDO75359.1| hypothetical protein CISIN_1g002624mg [Citrus sinensis]
Length=896

 Score =  1072 bits (2772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 602/908 (66%), Positives = 696/908 (77%), Gaps = 32/908 (4%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG +PQ +EG  EK+ LNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSTAGFSPQHQEG--EKRVLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQK+   LPAELG
Sbjct  59    KEVDAHIPNYPSLPPQLICQLHNVTMHADIETDEVYAQMTLQPLSPQEQKE-AYLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
               SKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NEW
Sbjct  118   TLSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+ NQLLLGIRRANRP TVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDKNQLLLGIRRANRPPTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYIKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPV+WPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDPVKWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMY SPF LRLKRPWP GLP+F    + D+ I+S L WLRG+ GD+G+QSLNFQG
Sbjct  358   PLTTFPMYSSPFPLRLKRPWPVGLPAF---HDEDLGINSQLMWLRGD-GDRGMQSLNFQG  413

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMATldssklasqqsllqfqqsip---------sss  1980
              G+TP+MQPR+DASMLGLQ D+YQ MA     ++ +         S+          S +
Sbjct  414   LGVTPWMQPRMDASMLGLQNDMYQAMAAAALREMRAVDPSKPNAASLMQFQQPQNLPSRT  473

Query  1981  ssliqsqmlqRPHPQQNLLQSFQENQVISqaqilqqqlqrqqsyneqqq----qqlhppp  2148
             S+L+QSQMLQ+ HPQQ  LQ  QENQ  SQ+Q   Q    Q            QQ   P 
Sbjct  474   SALVQSQMLQQSHPQQTFLQGVQENQHQSQSQTHSQSHLLQPQLQHSHSFNNQQQQPLPQ  533

Query  2149  iqqfqeqqqMSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQ  2328
              QQ  + QQ+   ++++ +  S +QSQ    QA+SS   QQSFSD  GN       S   
Sbjct  534   PQQQVDHQQIPSAVSAMSQFASVSQSQSPPMQAISSLCQQQSFSDSNGNPATNPIVSPLH  593

Query  2329  SLPRSFSHDEASQLLNMHETNPLA---TLPSKRIALESQVSSRATPYVVSQADMIS-PNS  2496
             SL  S++ DE+S LLN+  +NPL    T PSKR A+E   SS A   V+   + +  P++
Sbjct  594   SLLGSYAQDESSHLLNLPRSNPLIHSPTWPSKRAAVEPLFSSGAPQCVLPSVEQLGPPHA  653

Query  2497  KVSDLPTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTD-SSILLQNGISNLKNSGGENGF  2673
              +S     LPPFPG+E    Q  +    ++ L GVN + SS+L+QN +S+L   G  +  
Sbjct  654   NISQNSISLPPFPGRECSIDQEGSADPQSHLLFGVNIEPSSLLMQNEMSSLGGVGSNSDS  713

Query  2674  LNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGS  2853
               +PF++ N+ S  G D+ +NP++  SSC+DESGFLQS ENV Q NPPNRTFVKV+KSGS
Sbjct  714   TTIPFASSNYMSTAGADFSVNPEIAPSSCIDESGFLQSPENVGQVNPPNRTFVKVYKSGS  773

Query  2854  FGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEF  3033
             FGRSLDI+KFSSYHELRSELARMFGLEG LEDP RSGWQLVFVDRENDVLLLGD PW EF
Sbjct  774   FGRSLDITKFSSYHELRSELARMFGLEGHLEDPLRSGWQLVFVDRENDVLLLGDGPWPEF  833

Query  3034  VNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMNG--  3207
             VN+VW IKILSP EV QMGK  G +L N++P   QRL N  SSC+ + +++++RN++   
Sbjct  834   VNSVWCIKILSPPEVQQMGK-RGNELLNSVPI--QRLSN--SSCDDYATRQDSRNLSAGI  888

Query  3208  IPLGSLDY  3231
               +GSLD+
Sbjct  889   TSVGSLDF  896



>ref|XP_004150775.1| PREDICTED: auxin response factor 6-like [Cucumis sativus]
 gb|KGN65880.1| Auxin response factor 4 [Cucumis sativus]
Length=899

 Score =  1055 bits (2728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 587/910 (65%), Positives = 689/910 (76%), Gaps = 33/910 (4%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S  G +PQA EG  E++ LNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSAGGFSPQAPEG--ERRVLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             +E+DA IP+YP LP QLICQLHN+TMHAD ETDEVYAQMTLQPLSAQE K+   LPAELG
Sbjct  59    REVDAQIPNYPSLPPQLICQLHNLTMHADAETDEVYAQMTLQPLSAQELKE-AYLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PS+QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+S QPPAQELIA+DLH NEW
Sbjct  118   TPSRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSMQPPAQELIARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGDAV+FIWNE NQLLLGIRRA+RPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDAVLFIWNEKNQLLLGIRRASRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAAT SRFTIF+NPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATISRFTIFFNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRW NSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDPVRWQNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRLKRPWP+GLPSF G+ + D+ ++SP  WLRG+  D+GIQ LNFQG
Sbjct  358   PLTTFPMYPSPFPLRLKRPWPTGLPSF-GIKDSDLGMNSPFMWLRGDNSDRGIQCLNFQG  416

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMATldssklasqqsllqfqqsips---------ss  1980
              G++P+MQPRLD SM+G+Q D+YQ MAT    ++ +         S+            S
Sbjct  417   AGVSPWMQPRLDPSMMGMQSDMYQVMATAALQEMRAIDYSKISPASVLQFQQPQSLPCQS  476

Query  1981  ssliqsqmlqRPHPQQNLLQSFQENQVISqaqilqqqlqrqqsyneqqqqqlhpppiqqf  2160
             S+L+Q QML +  PQQ  LQS QENQ  SQ Q   Q    Q    +Q          QQ 
Sbjct  477   STLMQPQMLHQSQPQQAFLQSVQENQQHSQPQSQTQSHHLQPQLPQQSFNNHSQQHQQQP  536

Query  2161  qeqqqMS-----KPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSST  2325
             ++ Q +        I ++ +  S +QSQ    Q + S   Q SFSD  GN   +   S  
Sbjct  537   RQTQPLDHQQIPSSIPAISQFASCSQSQSPSLQTVPSLCQQPSFSDSNGNPATSPTVSPL  596

Query  2326  QSLPRSFSHDEASQLLNM---HETNPLATLPSKRIALESQVSSRATPYVVSQADMI-SPN  2493
              SL  SF  D++SQLLN+   H   P A  PSKR A++  + + A+ Y + Q +M+ +  
Sbjct  597   HSLAGSFVQDDSSQLLNLQRAHSVIPSAGWPSKRAAIDP-LCTGASQYFLPQVEMLGTQQ  655

Query  2494  SKVSDLPTFLPPFPGKEFP-EYQGVAYSQGNNALLGVNTD-SSILLQNGISNLKNSGGEN  2667
             S +S     LPPFPG+E P + +  +    N+ L GVN D SS+L+QNG+S L+    ++
Sbjct  656   SSISQNTVALPPFPGRECPIDDREESSDPQNHVLFGVNIDSSSLLMQNGMSTLRGVCNDS  715

Query  2668  GFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKS  2847
                 +PFS+ N+ S  GT++P+NP M +S+C+DESG LQS ENV Q NPPN TFVKVHKS
Sbjct  716   VSTTLPFSS-NYMSTAGTNFPVNPTMTSSNCIDESGLLQSHENVGQVNPPNGTFVKVHKS  774

Query  2848  GSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQ  3027
             G++ RSLDI+KF+SY ELRSELARMFGLEG LEDP RSGWQLVFVDRENDVLLLGD PW 
Sbjct  775   GTYSRSLDITKFNSYPELRSELARMFGLEGELEDPLRSGWQLVFVDRENDVLLLGDGPWP  834

Query  3028  EFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNM-N  3204
             EFVN+VW IKILSP EV  MGK  G++L N++P   QRL N  S+C+ + S++++RN+ +
Sbjct  835   EFVNSVWCIKILSPEEVQDMGK-RGLELLNSVPI--QRLSN--STCDDYGSRQDSRNLIS  889

Query  3205  GIP-LGSLDY  3231
             GI  +G LDY
Sbjct  890   GIASVGPLDY  899



>ref|XP_011047524.1| PREDICTED: auxin response factor 6-like isoform X2 [Populus euphratica]
Length=902

 Score =  1046 bits (2705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 592/913 (65%), Positives = 690/913 (76%), Gaps = 39/913 (4%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR S AG NPQ  E   EK+ LNSELWHACAGPLVSLP +GSR VYFPQGHSEQV ASTN
Sbjct  1     MRHSSAGFNPQTHEV--EKRVLNSELWHACAGPLVSLPAVGSRAVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DA IPSYP LPAQLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQKD   LPA++G
Sbjct  59    KEVDAQIPSYPSLPAQLICQLHNVTMHADVETDEVYAQMTLQPLSPQEQKD-AYLPADMG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NEW
Sbjct  118   TPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA RPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRATRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVY+TRVSVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYLKAVYYTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRM+FETEESSVRRYMGTITGISDLD VRWPNS WRS KVGWDEST GERQPRVSLWEIE
Sbjct  298   FRMMFETEESSVRRYMGTITGISDLDAVRWPNSQWRSAKVGWDESTDGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFP YPSPF LRLKRPW  GLPSF G+ N D+  +S L WLRG+ GD G+QSLNFQG
Sbjct  358   PLTTFPTYPSPFPLRLKRPWSPGLPSFHGIKNDDLGKNSSLMWLRGD-GDCGVQSLNFQG  416

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMATldssklasqqsllqfqqsips---------ss  1980
              G++P++QPR+DASMLGLQ D+YQTMAT    ++ +         S+            S
Sbjct  417   TGVSPWVQPRVDASMLGLQNDVYQTMATAAFQEMRTLDPSKSSSASLLQFQQHQNLPIRS  476

Query  1981  ssliqsqmlqRPHPQQNLLQSFQENQVISqaqilqqqlqrqqsyneqqqqqlhpppiqqf  2160
             ++L+Q +MLQ+  PQQ  LQ  QEN+  SQ       +Q+Q  ++            Q F
Sbjct  477   AALMQPRMLQQSPPQQTFLQGVQENKHQSQNPSQSHLIQQQLLHHHLLDSPHQQQQQQPF  536

Query  2161  qeqqqMSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNN--------  2316
              +QQQ++     +P   S T SQ +   + S T P Q+ S L   H  + +N        
Sbjct  537   LQQQQLAD--QQIPNGASATISQYAS-ASQSLTPPLQAIS-LCQQHSYSDSNGKPATIPV  592

Query  2317  -SSTQSLPRSFSHDEASQLLNMHETNPLAT---LPSKRIALESQVSSRATPYVVSQADMI  2484
              SS QSL  SF  +E+S LL++   NPL T    PSKR A+ES  SS A   +V+Q + +
Sbjct  593   VSSLQSLLDSFPPNESSHLLSLPRINPLVTSSGWPSKRAAVESLTSSGAPQCMVTQVEQL  652

Query  2485  SP-NSKVSDLPTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTD-SSILLQNGISNLKNSG  2658
              P  + ++     LPPFPG+E    Q     Q N+ L GVN + SS+LLQNG+S+L+  G
Sbjct  653   GPLQTSITPSSVSLPPFPGRECSIDQDGGTDQQNHLLFGVNIEPSSLLLQNGMSSLRGVG  712

Query  2659  GENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKV  2838
              ++    +PFS+ N+ S  GT++ LNP M  SSC+DES FLQS+ENV Q NPP RTFVKV
Sbjct  713   SDSDSTTIPFSS-NYMSTAGTNFSLNPAMTPSSCIDESCFLQSTENVSQGNPPTRTFVKV  771

Query  2839  HKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDD  3018
             +KSGSFGRSLDI+KFS+Y+ELRSEL+RMFGLEG LEDP RSGWQLVF+DRENDVLLLGD 
Sbjct  772   YKSGSFGRSLDITKFSNYNELRSELSRMFGLEGQLEDPLRSGWQLVFIDRENDVLLLGDG  831

Query  3019  PWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRN  3198
             PW EFVN+VW IKILSP EV QMGK  G++L N+ P   QRL NG  SC+ + +++++++
Sbjct  832   PWPEFVNSVWCIKILSPQEVQQMGK-RGLELLNSFPI--QRLSNG--SCDDYANRQDSKS  886

Query  3199  MN-GI-PLGSLDY  3231
             ++ GI  +GSLDY
Sbjct  887   LSTGITSVGSLDY  899



>ref|XP_011047523.1| PREDICTED: auxin response factor 6-like isoform X1 [Populus euphratica]
Length=904

 Score =  1042 bits (2694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 593/915 (65%), Positives = 690/915 (75%), Gaps = 41/915 (4%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR S AG NPQ  E   EK+ LNSELWHACAGPLVSLP +GSR VYFPQGHSEQV ASTN
Sbjct  1     MRHSSAGFNPQTHEV--EKRVLNSELWHACAGPLVSLPAVGSRAVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DA IPSYP LPAQLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQKD   LPA++G
Sbjct  59    KEVDAQIPSYPSLPAQLICQLHNVTMHADVETDEVYAQMTLQPLSPQEQKD-AYLPADMG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NEW
Sbjct  118   TPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA RPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRATRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVY+TRVSVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYLKAVYYTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRM+FETEESSVRRYMGTITGISDLD VRWPNS WRS KVGWDEST GERQPRVSLWEIE
Sbjct  298   FRMMFETEESSVRRYMGTITGISDLDAVRWPNSQWRSAKVGWDESTDGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGL--SNGDMHISSPLSWLRGNMGDQGIQSLNF  1821
             PLTTFP YPSPF LRLKRPW  GLPSF GL   N D+  +S L WLRG+ GD G+QSLNF
Sbjct  358   PLTTFPTYPSPFPLRLKRPWSPGLPSFHGLGIKNDDLGKNSSLMWLRGD-GDCGVQSLNF  416

Query  1822  QGYGITPFMQPRLDASMLGLQPDIYQTMATldssklasqqsllqfqqsips---------  1974
             QG G++P++QPR+DASMLGLQ D+YQTMAT    ++ +         S+           
Sbjct  417   QGTGVSPWVQPRVDASMLGLQNDVYQTMATAAFQEMRTLDPSKSSSASLLQFQQHQNLPI  476

Query  1975  ssssliqsqmlqRPHPQQNLLQSFQENQVISqaqilqqqlqrqqsyneqqqqqlhpppiq  2154
              S++L+Q +MLQ+  PQQ  LQ  QEN+  SQ       +Q+Q  ++            Q
Sbjct  477   RSAALMQPRMLQQSPPQQTFLQGVQENKHQSQNPSQSHLIQQQLLHHHLLDSPHQQQQQQ  536

Query  2155  qfqeqqqMSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNN------  2316
              F +QQQ++     +P   S T SQ +   + S T P Q+ S L   H  + +N      
Sbjct  537   PFLQQQQLAD--QQIPNGASATISQYAS-ASQSLTPPLQAIS-LCQQHSYSDSNGKPATI  592

Query  2317  ---SSTQSLPRSFSHDEASQLLNMHETNPLAT---LPSKRIALESQVSSRATPYVVSQAD  2478
                SS QSL  SF  +E+S LL++   NPL T    PSKR A+ES  SS A   +V+Q +
Sbjct  593   PVVSSLQSLLDSFPPNESSHLLSLPRINPLVTSSGWPSKRAAVESLTSSGAPQCMVTQVE  652

Query  2479  MISP-NSKVSDLPTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTD-SSILLQNGISNLKN  2652
              + P  + ++     LPPFPG+E    Q     Q N+ L GVN + SS+LLQNG+S+L+ 
Sbjct  653   QLGPLQTSITPSSVSLPPFPGRECSIDQDGGTDQQNHLLFGVNIEPSSLLLQNGMSSLRG  712

Query  2653  SGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFV  2832
              G ++    +PFS+ N+ S  GT++ LNP M  SSC+DES FLQS+ENV Q NPP RTFV
Sbjct  713   VGSDSDSTTIPFSS-NYMSTAGTNFSLNPAMTPSSCIDESCFLQSTENVSQGNPPTRTFV  771

Query  2833  KVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLG  3012
             KV+KSGSFGRSLDI+KFS+Y+ELRSEL+RMFGLEG LEDP RSGWQLVF+DRENDVLLLG
Sbjct  772   KVYKSGSFGRSLDITKFSNYNELRSELSRMFGLEGQLEDPLRSGWQLVFIDRENDVLLLG  831

Query  3013  DDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKET  3192
             D PW EFVN+VW IKILSP EV QMGK  G++L N+ P   QRL NG  SC+ + +++++
Sbjct  832   DGPWPEFVNSVWCIKILSPQEVQQMGK-RGLELLNSFPI--QRLSNG--SCDDYANRQDS  886

Query  3193  RNMN-GI-PLGSLDY  3231
             ++++ GI  +GSLDY
Sbjct  887   KSLSTGITSVGSLDY  901



>ref|XP_011007615.1| PREDICTED: auxin response factor 6-like [Populus euphratica]
 ref|XP_011007617.1| PREDICTED: auxin response factor 6-like [Populus euphratica]
Length=895

 Score =  1040 bits (2688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 582/905 (64%), Positives = 674/905 (74%), Gaps = 29/905 (3%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR S A  NPQ +EG  EK+ LNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV AST 
Sbjct  1     MRHSSASFNPQTQEG--EKRVLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTY  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DA IP+YP LP QLICQLHNVTMHAD ETDEVYAQ+TLQPLS QEQKD CL PA+LG
Sbjct  59    KEVDARIPNYPSLPPQLICQLHNVTMHADVETDEVYAQLTLQPLSPQEQKDACL-PADLG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NEW
Sbjct  118   TPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGI+RA RPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIKRAIRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVY+TRVSVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYLKAVYYTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLD  RWPNS WRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDVARWPNSLWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LR KRPW  GLPSF G+ + D+ ++S L WLRG+ GD+GIQSLN QG
Sbjct  358   PLTTFPMYPSPFPLRPKRPWTPGLPSFHGIKDDDLGMNSSLMWLRGD-GDRGIQSLNLQG  416

Query  1828  YGITPFMQPRLDASMLGLQPDIYQ---TMATldssklasqqsllqfqqsipsssssliqs  1998
              G+ P+MQPR D SM GLQ D+YQ   T A  +   L   +S            +  I++
Sbjct  417   MGVAPWMQPRFDTSMRGLQNDVYQTMATAAFQEMRALDPSKSSAASLLQFQQHQNLPIRN  476

Query  1999  qmlqRP------HPQQNLLQSFQENQVISqaqilqqqlqrqqsyneqqqqqlhpppiqqf  2160
               L +P        QQ  LQ  QEN+  SQ       + +Q  +           P+ Q 
Sbjct  477   AALMQPLMLQQSPSQQAFLQGVQENKHQSQTPTRSHLIHQQLQHQHSLDSPEQQQPLLQQ  536

Query  2161  qeqqqMSKP--ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSL  2334
             Q       P  + ++ +  S TQS     QA+S    Q SFSD  GN + +   S  QSL
Sbjct  537   QHLADQQIPNVVPAISQYASATQSLTPPLQAIS-LCQQHSFSDSNGNLMTSPVVSPLQSL  595

Query  2335  PRSFSHDEASQLLNMHETNPLAT---LPSKRIALESQVSSRATPYVVSQADMISP-NSKV  2502
               SF  DE+S L N   TNPL T    PSKR A+E  +SS A   ++SQ + + P  + +
Sbjct  596   LGSFPQDESSHLFNFPRTNPLITSSGWPSKRAAVEPLMSSVAPQCMMSQVEQLGPPQTSI  655

Query  2503  SDLPTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTD-SSILLQNGISNLKNSGGENGFLN  2679
             S     LPPFPG+E P  Q       ++ L GVN + SS+L+QNG+S L+  G ++  + 
Sbjct  656   SPSSVSLPPFPGRECPTEQDGGTDPQSHLLFGVNIEPSSLLMQNGLSGLRGVGSDSDSIT  715

Query  2680  MPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFG  2859
             +PFS+ N+ S  GT++ LNP M  SSC+DESGFLQS+E V Q NPP+RTFVKV+KSGSFG
Sbjct  716   VPFSS-NYMSIAGTNFSLNPAMAPSSCIDESGFLQSTEIVGQGNPPSRTFVKVYKSGSFG  774

Query  2860  RSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVN  3039
             RSLDI+KFS+Y+ELRSELA MFGLEG LEDP RSGWQLVF+DRENDVLLLGD PW EFVN
Sbjct  775   RSLDITKFSNYNELRSELACMFGLEGQLEDPLRSGWQLVFIDRENDVLLLGDGPWPEFVN  834

Query  3040  NVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNM-NGI-P  3213
             +VW IKILSP EV +MGK  G++L N +P   QRL NG  SC+ + ++++++N+ N I  
Sbjct  835   SVWCIKILSPQEVQKMGK-RGLELLNCVPI--QRLSNG--SCDDYANRQDSQNLSNAITS  889

Query  3214  LGSLD  3228
             +GSLD
Sbjct  890   VGSLD  894



>ref|XP_004164684.1| PREDICTED: LOW QUALITY PROTEIN: auxin response factor 6-like, 
partial [Cucumis sativus]
Length=884

 Score =  1039 bits (2687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 577/893 (65%), Positives = 677/893 (76%), Gaps = 31/893 (3%)
 Frame = +1

Query  619   EKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAHIPSYPGLPAQL  798
             E++ LNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTN+E+DA IP+YP LP QL
Sbjct  1     ERRVLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTNREVDAQIPNYPSLPPQL  60

Query  799   ICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPTNYFCKTLTAS  978
             ICQLHN+TMHAD ETDEVYAQMTLQPLSAQE K+   LPAELG PS+QPTNYFCKTLTAS
Sbjct  61    ICQLHNLTMHADAETDEVYAQMTLQPLSAQELKEA-YLPAELGTPSRQPTNYFCKTLTAS  119

Query  979   DTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFRGQPKRHLLTT  1158
             DTSTHGGFSVPRRAAEKVFPPLD+S QPPAQELIA+DLH NEWKFRH+FRGQPKRHLLTT
Sbjct  120   DTSTHGGFSVPRRAAEKVFPPLDFSMQPPAQELIARDLHDNEWKFRHIFRGQPKRHLLTT  179

Query  1159  GWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLLaaaa  1338
             GWSVFVSAKRLVAGDAV+FIWNE NQLLLGIRRA+RPQTVMPSSVLSSDSMH+GLLAAAA
Sbjct  180   GWSVFVSAKRLVAGDAVLFIWNEKNQLLLGIRRASRPQTVMPSSVLSSDSMHLGLLAAAA  239

Query  1339  haaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFETEESSVRRYMG  1518
             HAAAT SRFTIF+NPRASPS+FVIPLAKY KAVYHTRVSVGMRFRMLFET ESSVRRYMG
Sbjct  240   HAAATISRFTIFFNPRASPSEFVIPLAKYVKAVYHTRVSVGMRFRMLFETXESSVRRYMG  299

Query  1519  TITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFSLRLK  1698
             TITGISDLDPVRW NSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPF LRLK
Sbjct  300   TITGISDLDPVRWQNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFPLRLK  359

Query  1699  RPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPFMQPRLDASMLG  1878
             RPWP+GLPSF G+ + D+ ++SP  WLRG+  D+GIQ LNFQG G++P+MQPRLD SM+G
Sbjct  360   RPWPTGLPSF-GIKDSDLGMNSPFMWLRGDNSDRGIQCLNFQGAGVSPWMQPRLDPSMMG  418

Query  1879  LQPDIYQTMATldssklasqqsllqfqqsips---------ssssliqsqmlqRPHPQQN  2031
             +Q D+YQ MAT    ++ +         S+            SS+L+Q QML +  PQQ 
Sbjct  419   MQSDMYQVMATAALQEMRAIDYSKISPASVLQFQQPQSLPCQSSTLMQPQMLHQSQPQQA  478

Query  2032  LLQSFQENQVISqaqilqqqlqrqqsyneqqqqqlhpppiqqfqeqqqMS-----KPITS  2196
              LQS QENQ  SQ Q   Q    Q    +Q          QQ ++ Q +        I +
Sbjct  479   FLQSVQENQQHSQPQSQTQSHHLQPQLPQQSFNNHSQQHQQQPRQTQPLDHQQIPSSIPA  538

Query  2197  LPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLN  2376
             + +  S +QSQ    Q + S   Q SFSD  GN   +   S   SL  SF  D++SQLLN
Sbjct  539   ISQFASCSQSQSPSLQTVPSLCQQPSFSDSNGNPATSPTVSPLHSLAGSFVQDDSSQLLN  598

Query  2377  M---HETNPLATLPSKRIALESQVSSRATPYVVSQADMI-SPNSKVSDLPTFLPPFPGKE  2544
             +   H   P A  PSKR A++  + + A+ Y + Q +M+ +  S +S     LPPFPG+E
Sbjct  599   LQRAHSVIPSAGWPSKRAAIDP-LCTGASQYFLPQVEMLGTQQSSISQNTVALPPFPGRE  657

Query  2545  FP-EYQGVAYSQGNNALLGVNTD-SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVG  2718
              P + +  +    N+ L GVN D SS+L+QNG+S L+    ++    +PFS+ N+ S  G
Sbjct  658   CPIDDREESSDPQNHVLFGVNIDSSSLLMQNGMSTLRGVCNDSVSTTLPFSS-NYMSTAG  716

Query  2719  TDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHE  2898
             T++P+NP M +S+C+DESG LQS ENV Q NPPN TFVKVHKSG++ RSLDI+KF+SY E
Sbjct  717   TNFPVNPTMTSSNCIDESGLLQSHENVGQVNPPNGTFVKVHKSGTYSRSLDITKFNSYPE  776

Query  2899  LRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEV  3078
             LRSELARMFGLEG LEDP RSGWQLVFVDRENDVLLLGD PW EFVN+VW IKILSP EV
Sbjct  777   LRSELARMFGLEGELEDPLRSGWQLVFVDRENDVLLLGDGPWPEFVNSVWCIKILSPEEV  836

Query  3079  HQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNM-NGIP-LGSLDY  3231
               MGK  G++L N++P   QRL N  S+C+ + S++++RN+ +GI  +G LDY
Sbjct  837   QDMGK-RGLELLNSVPI--QRLSN--STCDDYGSRQDSRNLISGIASVGPLDY  884



>gb|KDO75361.1| hypothetical protein CISIN_1g002624mg [Citrus sinensis]
Length=834

 Score =  1026 bits (2653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 568/837 (68%), Positives = 648/837 (77%), Gaps = 22/837 (3%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG +PQ +EG  EK+ LNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSTAGFSPQHQEG--EKRVLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQK+   LPAELG
Sbjct  59    KEVDAHIPNYPSLPPQLICQLHNVTMHADIETDEVYAQMTLQPLSPQEQKE-AYLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
               SKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NEW
Sbjct  118   TLSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+ NQLLLGIRRANRP TVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDKNQLLLGIRRANRPPTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYIKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPV+WPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDPVKWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMY SPF LRLKRPWP GLP+F G+ + D+ I+S L WLRG+ GD+G+QSLNFQG
Sbjct  358   PLTTFPMYSSPFPLRLKRPWPVGLPAFHGIKDEDLGINSQLMWLRGD-GDRGMQSLNFQG  416

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMATldssklasqqsllqfqqsip---------sss  1980
              G+TP+MQPR+DASMLGLQ D+YQ MA     ++ +         S+          S +
Sbjct  417   LGVTPWMQPRMDASMLGLQNDMYQAMAAAALREMRAVDPSKPNAASLMQFQQPQNLPSRT  476

Query  1981  ssliqsqmlqRPHPQQNLLQSFQENQVISqaqilqqqlqrqqsyneqqq----qqlhppp  2148
             S+L+QSQMLQ+ HPQQ  LQ  QENQ  SQ+Q   Q    Q            QQ   P 
Sbjct  477   SALVQSQMLQQSHPQQTFLQGVQENQHQSQSQTHSQSHLLQPQLQHSHSFNNQQQQPLPQ  536

Query  2149  iqqfqeqqqMSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQ  2328
              QQ  + QQ+   ++++ +  S +QSQ    QA+SS   QQSFSD  GN       S   
Sbjct  537   PQQQVDHQQIPSAVSAMSQFASVSQSQSPPMQAISSLCQQQSFSDSNGNPATNPIVSPLH  596

Query  2329  SLPRSFSHDEASQLLNMHETNPLA---TLPSKRIALESQVSSRATPYVVSQADMIS-PNS  2496
             SL  S++ DE+S LLN+  +NPL    T PSKR A+E   SS A   V+   + +  P++
Sbjct  597   SLLGSYAQDESSHLLNLPRSNPLIHSPTWPSKRAAVEPLFSSGAPQCVLPSVEQLGPPHA  656

Query  2497  KVSDLPTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTD-SSILLQNGISNLKNSGGENGF  2673
              +S     LPPFPG+E    Q  +    ++ L GVN + SS+L+QN +S+L   G  +  
Sbjct  657   NISQNSISLPPFPGRECSIDQEGSADPQSHLLFGVNIEPSSLLMQNEMSSLGGVGSNSDS  716

Query  2674  LNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGS  2853
               +PF++ N+ S  G D+ +NP++  SSC+DESGFLQS ENV Q NPPNRTFVKV+KSGS
Sbjct  717   TTIPFASSNYMSTAGADFSVNPEIAPSSCIDESGFLQSPENVGQVNPPNRTFVKVYKSGS  776

Query  2854  FGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPW  3024
             FGRSLDI+KFSSYHELRSELARMFGLEG LEDP RSGWQLVFVDRENDVLLLGD PW
Sbjct  777   FGRSLDITKFSSYHELRSELARMFGLEGHLEDPLRSGWQLVFVDRENDVLLLGDGPW  833



>gb|KDO63437.1| hypothetical protein CISIN_1g002390mg [Citrus sinensis]
 gb|KDO63438.1| hypothetical protein CISIN_1g002390mg [Citrus sinensis]
Length=815

 Score =  1015 bits (2624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 565/821 (69%), Positives = 650/821 (79%), Gaps = 24/821 (3%)
 Frame = +1

Query  823   MHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPTNYFCKTLTASDTSTHGGF  1002
             MHAD ETDEVYAQMTLQPLS QEQKDV LLPAELG P+KQPTNYFCKTLTASDTSTHGGF
Sbjct  1     MHADVETDEVYAQMTLQPLSPQEQKDVYLLPAELGAPNKQPTNYFCKTLTASDTSTHGGF  60

Query  1003  SVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFRGQPKRHLLTTGWSVFVSA  1182
             SVPRRAAEKVFPPLDYSQ PPAQELIA+DLH NEWKFRH+FRGQPKRHLLTTGWSVFVSA
Sbjct  61    SVPRRAAEKVFPPLDYSQTPPAQELIARDLHDNEWKFRHIFRGQPKRHLLTTGWSVFVSA  120

Query  1183  KRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLLaaaahaaaTNSR  1362
             KRLVAGD+V+FIWNE NQLLLGIRRA RPQTVMPSSVLSSDSMHIGLLAAAAHAAATNSR
Sbjct  121   KRLVAGDSVLFIWNEKNQLLLGIRRATRPQTVMPSSVLSSDSMHIGLLAAAAHAAATNSR  180

Query  1363  FTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFETEESSVRRYMGTITGISDL  1542
             FTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMRFRMLFETEESSVRRYMGTITGISDL
Sbjct  181   FTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMRFRMLFETEESSVRRYMGTITGISDL  240

Query  1543  DPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFSLRLKRPWPSGLP  1722
             DPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMY SPF LRLKRPWPSGLP
Sbjct  241   DPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYSSPFPLRLKRPWPSGLP  300

Query  1723  SFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPFMQPRLDASMLGLQPDIYQT  1902
             SF G+ +GDM I+SPL WL+G +GDQGIQSLNFQGYG+TP+MQPRLDAS+ GLQPD+YQ 
Sbjct  301   SFHGMKDGDMSINSPLMWLQGGVGDQGIQSLNFQGYGVTPWMQPRLDASIPGLQPDVYQA  360

Query  1903  MATldssklasqqsllqfqqsipsssssliqsqmlqRPHPQQ---------NLLQSFQEN  2055
             MA     ++ +  S     QS+     S   S       P+Q          LLQSFQEN
Sbjct  361   MAAAALQEMRTVDSSKLASQSLLQFQQSQNVSNGTASMIPRQMLQQSQAQNALLQSFQEN  420

Query  2056  QVISqaqilqqqlqrqqsyneqqqqqlhpppiqqfqeqq---qMSKPITSLPRMNSTTQS  2226
             Q  +QAQ+LQQQLQRQ SYNEQ+QQQ      QQ  +     Q+S  I++LP + S++QS
Sbjct  421   QASAQAQLLQQQLQRQHSYNEQRQQQQQVQQSQQLHQLSVQPQISNVISTLPHLASSSQS  480

Query  2227  QLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMHETNPL---  2397
             Q    Q ++S   Q +FSD +GN + +S+ SS  ++  S S   AS LLN + +NP+   
Sbjct  481   QPPTLQTVASQCQQSNFSDSLGNPIASSDVSSMHTILGSLSQAGASHLLNSNASNPIISS  540

Query  2398  ATLPSKRIALESQVSSRATPYVVSQADMI-SPNSKVSDLPTFLPPFPGKEFPEYQGVAYS  2574
             + + +K++ +++ V S  +  ++ Q + + +  S VS+L + LPPFPG+E+  Y G    
Sbjct  541   SAMLTKQVTVDNHVPSAVSHCILPQVEQLGAQQSNVSELASLLPPFPGREYSSYHGSGDP  600

Query  2575  QGNNALLGVNTDSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTS  2754
             Q NN L GV+ DSS++ QNG+ NLKN   EN  L++P++  NFT+ VGTD+PLN DM TS
Sbjct  601   Q-NNLLFGVSIDSSLMGQNGLPNLKNISSENESLSLPYAASNFTNNVGTDFPLNSDMTTS  659

Query  2755  SCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLE  2934
             SCVDESGFLQSSENVDQ NPP RTFVKVHKSGSFGRSLDISKFSSY ELRSELARMFGLE
Sbjct  660   SCVDESGFLQSSENVDQVNPPTRTFVKVHKSGSFGRSLDISKFSSYDELRSELARMFGLE  719

Query  2935  GLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLP  3114
             G LEDP+RSGWQLVFVDRENDVLLLGDDPWQEFVNNV YIKILSP EV QMGK  G+   
Sbjct  720   GQLEDPQRSGWQLVFVDRENDVLLLGDDPWQEFVNNVGYIKILSPLEVQQMGK--GLSPV  777

Query  3115  NNLPAANQRLPNGGSSCEVHVSQKETR-NMNGIP-LGSLDY  3231
              + P   QRL +  ++ + +VS++E R + NG+  +GS++Y
Sbjct  778   TSGPG--QRL-SSNNNFDDYVSRQELRSSSNGVASMGSINY  815



>dbj|BAD19064.1| auxin response factor 4 [Cucumis sativus]
Length=816

 Score =   876 bits (2263),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 503/825 (61%), Positives = 597/825 (72%), Gaps = 31/825 (4%)
 Frame = +1

Query  823   MHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPTNYFCKTLTASDTSTHGGF  1002
             MHAD ETDEVYAQMTLQPLSAQE K+   LPAELG PS+QPTNYFCKTLTASDTSTHGGF
Sbjct  1     MHADAETDEVYAQMTLQPLSAQELKE-AYLPAELGTPSRQPTNYFCKTLTASDTSTHGGF  59

Query  1003  SVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFRGQPKRHLLTTGWSVFVSA  1182
             SVPRRAAEKVFPPLD+S QPPAQELIA+DLH NEWKFRH+FRGQPKRHLLTTGWSVFVSA
Sbjct  60    SVPRRAAEKVFPPLDFSMQPPAQELIARDLHDNEWKFRHIFRGQPKRHLLTTGWSVFVSA  119

Query  1183  KRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLLaaaahaaaTNSR  1362
             KRLVAGDAV+FIWNE NQLLLGIRRA+RPQTVMPSSVLSSDSMH+GLLAAAAHAAAT SR
Sbjct  120   KRLVAGDAVLFIWNEKNQLLLGIRRASRPQTVMPSSVLSSDSMHLGLLAAAAHAAATISR  179

Query  1363  FTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFETEESSVRRYMGTITGISDL  1542
             FTIF+NPRASPS+FVIPLAKY KAVYHTRVSVGMRFRMLFETE             +   
Sbjct  180   FTIFFNPRASPSEFVIPLAKYVKAVYHTRVSVGMRFRMLFETENQVFVATWAQSLALVTW  239

Query  1543  DPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFSLRLKRPWPSGLP  1722
              PVRW NSHWRSVKVGWDESTAGERQP+VSLWEIEPLTTFPMYPSPF LRLKRPWP+GLP
Sbjct  240   IPVRWQNSHWRSVKVGWDESTAGERQPKVSLWEIEPLTTFPMYPSPFPLRLKRPWPTGLP  299

Query  1723  SFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPFMQPRLDASMLGLQPDIYQT  1902
             SF G+ + D+ ++SP  WLRG+  D+GIQ LNFQG G++P+MQPRLD SM+G+Q D+YQ 
Sbjct  300   SF-GIKDSDLGMNSPFMWLRGDNSDRGIQCLNFQGAGVSPWMQPRLDPSMMGMQSDMYQV  358

Query  1903  MATldssklasqqsllqfqqsips---------ssssliqsqmlqRPHPQQNLLQSFQEN  2055
             MAT    ++ +         S+            SS+L+Q QML +  PQQ  LQS QEN
Sbjct  359   MATAALQEMRAIDYSKISPASVLQFQQPQSLPCQSSTLMQPQMLHQSQPQQAFLQSVQEN  418

Query  2056  QVISqaqilqqqlqrqqsyneqqqqqlhpppiqqfqeqqqMS-----KPITSLPRMNSTT  2220
             Q  SQ Q   Q    Q    +Q          QQ ++ Q +        I ++ +  S +
Sbjct  419   QQHSQPQSQTQSHHLQPQLPQQSFNNHSQQHQQQPRQNQPLDHQQIPSSIPAISQFASCS  478

Query  2221  QSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNM---HETN  2391
             QSQ    Q + S   Q SFSD  GN   +   S   SL  SF  D+ SQLLN+   H   
Sbjct  479   QSQSPSLQTVPSLCQQPSFSDSNGNPATSPTVSPLHSLAGSFVQDDFSQLLNLQRAHSVI  538

Query  2392  PLATLPSKRIALESQVSSRATPYVVSQADMI-SPNSKVSDLPTFLPPFPGKEFP-EYQGV  2565
             P A  PSKR A++  + + A+ Y + Q +M+ +  S +S     LPPFPG+E P + +  
Sbjct  539   PSAGWPSKRAAIDP-LCTGASQYFLPQVEMLGTQQSSISQNTVALPPFPGRECPIDDREE  597

Query  2566  AYSQGNNALLGVNTD-SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPD  2742
             +    N+ L G N D SS+L+QNG+S L+    ++    +PFS+ N+ S  GT++P+NP 
Sbjct  598   SSDPQNHVLFGANIDSSSLLMQNGMSTLRGVCNDSVSTTLPFSS-NYMSTAGTNFPVNPT  656

Query  2743  MGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARM  2922
             M +S+C+DESG LQS ENV Q NPPN TFVKVHKSG++ RSLDI+KF+SY ELRSELARM
Sbjct  657   MTSSNCIDESGLLQSHENVGQVNPPNGTFVKVHKSGTYSRSLDITKFNSYPELRSELARM  716

Query  2923  FGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEG  3102
             FGLEG LEDP RSGWQLVFVDRENDVLLLGD PW EFVN+VW IKILSP EV  MGK  G
Sbjct  717   FGLEGELEDPLRSGWQLVFVDRENDVLLLGDGPWPEFVNSVWCIKILSPEEVQDMGK-RG  775

Query  3103  IDLPNNLPAANQRLPNGGSSCEVHVSQKETRNM-NGIP-LGSLDY  3231
             ++L N++P   QRL N  S+C+ + S++++RN+ +GI  +G LDY
Sbjct  776   LELLNSVPI--QRLSN--STCDDYGSRQDSRNLISGIASVGPLDY  816



>ref|NP_001234540.1| auxin response factor 6-1 [Solanum lycopersicum]
 gb|ADJ96372.1| auxin response factor 6-1 [Solanum lycopersicum]
Length=524

 Score =   830 bits (2145),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/500 (86%), Positives = 456/500 (91%), Gaps = 2/500 (0%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MRVS +G NPQ EE  GEKKCLNSELWHACAGPLVSLPP+GSRVVYFPQGHS QV ASTN
Sbjct  1     MRVSSSGFNPQPEEA-GEKKCLNSELWHACAGPLVSLPPVGSRVVYFPQGHSVQVAASTN  59

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YPGLP QLICQLHN+TMHAD ETDEVYAQMTLQPLS QEQKDVCLLPAELG
Sbjct  60    KEVDAHIPNYPGLPPQLICQLHNLTMHADVETDEVYAQMTLQPLSPQEQKDVCLLPAELG  119

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PSK PTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPP QELIAKDLHGNEW
Sbjct  120   IPSKLPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPCQELIAKDLHGNEW  179

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             K RH+FRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQT+MP 
Sbjct  180   KLRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTLMPF  239

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHA ATN+RFTIFYNPRASPS+FVIPLAKYAKAVYHTR+SVGMR
Sbjct  240   SVLSSDSMHIGLLAAAAHATATNTRFTIFYNPRASPSEFVIPLAKYAKAVYHTRISVGMR  299

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPV WPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  300   FRMLFETEESSVRRYMGTITGISDLDPVCWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  359

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPFSLRLKRPWPSGLPS PG  N  + ++SPLSWLRG+MGDQG+QSLNFQG
Sbjct  360   PLTTFPMYPSPFSLRLKRPWPSGLPSLPGFPNVGLTMNSPLSWLRGDMGDQGMQSLNFQG  419

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMATldssklasqqsllqfqqsipsssssliqsqml  2007
             +G TPFMQPR+DASMLGLQPDI QTM T       + QSL+QFQ SIP+SS+ L Q QML
Sbjct  420   FGATPFMQPRMDASMLGLQPDILQTM-TALDPSKLANQSLMQFQHSIPNSSAPLSQIQML  478

Query  2008  qRPHPQQNLLQSFQENQVIS  2067
             Q  H Q NL+Q F EN +IS
Sbjct  479   QPSHSQHNLIQGFSENHLIS  498



>emb|CDP16075.1| unnamed protein product [Coffea canephora]
Length=894

 Score =   835 bits (2156),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/448 (90%), Positives = 428/448 (96%), Gaps = 4/448 (1%)
 Frame = +1

Query  568   MRVSLAGVN--PQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTAS  741
             MR+S  G++  PQ EEG  EKKCLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV AS
Sbjct  1     MRLSTPGLSTPPQPEEG--EKKCLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAAS  58

Query  742   TNKEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAE  921
             TNKE+DAHIP+YPGLPAQLICQLHN+TMHAD ETDEVYAQMTLQPLSAQEQKDVCLLPAE
Sbjct  59    TNKEVDAHIPNYPGLPAQLICQLHNLTMHADVETDEVYAQMTLQPLSAQEQKDVCLLPAE  118

Query  922   LGMPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGN  1101
             LG  SKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFP LDY+ QPPAQELIAKDLHGN
Sbjct  119   LGTASKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPTLDYTLQPPAQELIAKDLHGN  178

Query  1102  EWKFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVM  1281
             EWKFRH+FRGQPKRHLLTTGWSVFVSAKRL+AGD+VIFIWNENNQLLLGIRRA+RPQTVM
Sbjct  179   EWKFRHIFRGQPKRHLLTTGWSVFVSAKRLIAGDSVIFIWNENNQLLLGIRRASRPQTVM  238

Query  1282  PSSVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVG  1461
             PSSVLSSDSMHIGLLAAAAHAAATN+RFTIFYNPRASPS+FVIPLAKYAKAVYHTRVSVG
Sbjct  239   PSSVLSSDSMHIGLLAAAAHAAATNTRFTIFYNPRASPSEFVIPLAKYAKAVYHTRVSVG  298

Query  1462  MRFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWE  1641
             MRFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWE
Sbjct  299   MRFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWE  358

Query  1642  IEPLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNF  1821
             IEPLTTFPMYPSPFSLRLKRPWPSGLPS PGL++ DM+I++ LSWLRG++G QGIQSLNF
Sbjct  359   IEPLTTFPMYPSPFSLRLKRPWPSGLPSLPGLNSSDMNINAQLSWLRGDIGGQGIQSLNF  418

Query  1822  QGYGITPFMQPRLDASMLGLQPDIYQTM  1905
             QG+G TP+MQPRLDAS+LGLQPDIYQ M
Sbjct  419   QGFGATPWMQPRLDASVLGLQPDIYQAM  446


 Score =   444 bits (1142),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 237/357 (66%), Positives = 284/357 (80%), Gaps = 11/357 (3%)
 Frame = +1

Query  2176  MSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHD  2355
             +SK +++   + S TQSQ S  QAL ST  QQ+FSD+  NHV ++N+SS QSL  SFS D
Sbjct  544   ISKNVSNFSTIESVTQSQFSPLQALGSTCQQQTFSDI--NHVTSTNSSSMQSLLNSFSSD  601

Query  2356  EASQLLNMHET--NPLATLPSKRIALESQVSSRATPYVVSQAD-MISPNSKVSDLPTFLP  2526
              AS LLN+H        +  SKRIAL+SQ+SSRAT  V ++AD M +P+SKVSDL T LP
Sbjct  602   GASHLLNVHGVYSLASPSSSSKRIALDSQLSSRATQSVAARADNMSTPDSKVSDLSTLLP  661

Query  2527  PFPGKEFPEYQGVAYSQGNNALLGVNTDSSILLQNGISNLKNSGGENGFLNMPFSTCNFT  2706
             P  G+EF +++G+  SQ NN L G+N+DSS++LQNGIS+L N  GE+   ++PF+T  +T
Sbjct  662   PVSGREFAQFKGMTDSQ-NNGLFGINSDSSLMLQNGISHLINGSGESESFSVPFATSTYT  720

Query  2707  SGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFS  2886
             S +GTD PL+ DM TSSC+DES F+QS+ENVDQANPP +TFVKVHKSGSFGRSLDISKFS
Sbjct  721   SALGTDLPLSSDMTTSSCMDESVFMQSAENVDQANPPTKTFVKVHKSGSFGRSLDISKFS  780

Query  2887  SYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILS  3066
             SYHELRSELARMFGLEGLLEDP+RSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILS
Sbjct  781   SYHELRSELARMFGLEGLLEDPQRSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILS  840

Query  3067  PFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRN-MNGIP-LGSLDY  3231
             P EV QMGK EGIDLPN+ P    RLP+ G+SC+ ++SQKETRN MNGIP +GSL Y
Sbjct  841   PLEVQQMGK-EGIDLPNSAPL--HRLPSSGNSCDDYMSQKETRNSMNGIPTVGSLHY  894



>ref|XP_006351989.1| PREDICTED: auxin response factor 6-like isoform X1 [Solanum tuberosum]
Length=884

 Score =   823 bits (2127),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/448 (89%), Positives = 416/448 (93%), Gaps = 1/448 (0%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M+VS +G N Q EE  GEKKCLNSELWHACAGPLVSLP +G+RVVYFPQGHSEQV ASTN
Sbjct  1     MKVSTSGFNSQPEEA-GEKKCLNSELWHACAGPLVSLPHVGTRVVYFPQGHSEQVAASTN  59

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KEI+ HIP+YPGLP QLICQLHNVTM AD ETDEVYAQMTLQPL+ QEQKDVCLLPAELG
Sbjct  60    KEINGHIPNYPGLPPQLICQLHNVTMDADVETDEVYAQMTLQPLTPQEQKDVCLLPAELG  119

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
               SKQP NYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPP QELI KDLHGNEW
Sbjct  120   TLSKQPNNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPVQELIGKDLHGNEW  179

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+VIFIWNENNQLLLGIRRANRPQTV+PS
Sbjct  180   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVIFIWNENNQLLLGIRRANRPQTVLPS  239

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHA ATNSRFTIF+NPRA PS+FVIPLAKYAKAVYHTRVSVGMR
Sbjct  240   SVLSSDSMHIGLLAAAAHATATNSRFTIFFNPRACPSEFVIPLAKYAKAVYHTRVSVGMR  299

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESS+RRYMGTITGI DLDP RWPNSHW+SVKVGWDESTAGERQPRVSLWEIE
Sbjct  300   FRMLFETEESSIRRYMGTITGIGDLDPARWPNSHWQSVKVGWDESTAGERQPRVSLWEIE  359

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPFSLRLKRPWP GLPSFPGLSNGDM +SS L WL G MGDQGIQSLNFQG
Sbjct  360   PLTTFPMYPSPFSLRLKRPWPPGLPSFPGLSNGDMTMSSQLPWLHGGMGDQGIQSLNFQG  419

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
             +G+TPF+ PR DASMLGLQPDI Q MAT
Sbjct  420   FGVTPFVHPRFDASMLGLQPDILQAMAT  447


 Score =   395 bits (1016),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 228/350 (65%), Positives = 265/350 (76%), Gaps = 21/350 (6%)
 Frame = +1

Query  2203  RMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSST-QSLPRSFSHDEASQLLNM  2379
             ++ S TQSQLSH Q L ST  QQ+FSDLVGNH+ TSNN ST QSL  SFS + AS  LNM
Sbjct  549   QLCSATQSQLSHLQVLGSTGSQQTFSDLVGNHINTSNNRSTMQSLLSSFSRNGASTFLNM  608

Query  2380  HETNPLATLPS--KRIALESQVSSRATPYVVSQADMIS-PNSKVSDLPTFLPPFPGKEFP  2550
              ETN L +  S  KRIALESQ+ S+A PY+V+QA++++ PN+KVSD  T   P PG++  
Sbjct  609   PETNSLVSPSSSSKRIALESQIPSQA-PYIVTQAEVLTVPNTKVSDFSTLFSPNPGRQVL  667

Query  2551  EYQGVAYSQGNNALLGVNTDSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYP  2730
             +YQ VA SQ NNAL GVN         G+SNLK +  EN  L MP++T  FTS VG++YP
Sbjct  668   DYQAVAVSQ-NNALFGVN---------GMSNLKGNSPENRSLPMPYATSAFTSTVGSEYP  717

Query  2731  LNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSE  2910
             +  DM TSSCVDESG LQSSENVDQAN    TFVKV+KS SFGRSLDISKFSSY+ELRSE
Sbjct  718   VTSDMTTSSCVDESGVLQSSENVDQANSLTETFVKVYKSESFGRSLDISKFSSYNELRSE  777

Query  2911  LARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMG  3090
             LARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPW EFVN+VWYIKILSP EV QMG
Sbjct  778   LARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWHEFVNSVWYIKILSPLEVQQMG  837

Query  3091  KEEGIDLPNNLPAANQRL-PNG-GSSCEVHVSQKETRN-MNGIPLGSLDY  3231
             K EG+DLP+      QR+  NG G+ C+  +++  + N MNGIPLGSLDY
Sbjct  838   K-EGLDLPS--AGKTQRITSNGNGNGCDDFMNRNHSCNIMNGIPLGSLDY  884



>ref|XP_006351990.1| PREDICTED: auxin response factor 6-like isoform X2 [Solanum tuberosum]
Length=883

 Score =   823 bits (2125),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/448 (89%), Positives = 416/448 (93%), Gaps = 2/448 (0%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M+VS +G N Q EEG  EKKCLNSELWHACAGPLVSLP +G+RVVYFPQGHSEQV ASTN
Sbjct  1     MKVSTSGFNSQPEEG--EKKCLNSELWHACAGPLVSLPHVGTRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KEI+ HIP+YPGLP QLICQLHNVTM AD ETDEVYAQMTLQPL+ QEQKDVCLLPAELG
Sbjct  59    KEINGHIPNYPGLPPQLICQLHNVTMDADVETDEVYAQMTLQPLTPQEQKDVCLLPAELG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
               SKQP NYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPP QELI KDLHGNEW
Sbjct  119   TLSKQPNNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPVQELIGKDLHGNEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+VIFIWNENNQLLLGIRRANRPQTV+PS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVIFIWNENNQLLLGIRRANRPQTVLPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHA ATNSRFTIF+NPRA PS+FVIPLAKYAKAVYHTRVSVGMR
Sbjct  239   SVLSSDSMHIGLLAAAAHATATNSRFTIFFNPRACPSEFVIPLAKYAKAVYHTRVSVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESS+RRYMGTITGI DLDP RWPNSHW+SVKVGWDESTAGERQPRVSLWEIE
Sbjct  299   FRMLFETEESSIRRYMGTITGIGDLDPARWPNSHWQSVKVGWDESTAGERQPRVSLWEIE  358

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPFSLRLKRPWP GLPSFPGLSNGDM +SS L WL G MGDQGIQSLNFQG
Sbjct  359   PLTTFPMYPSPFSLRLKRPWPPGLPSFPGLSNGDMTMSSQLPWLHGGMGDQGIQSLNFQG  418

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
             +G+TPF+ PR DASMLGLQPDI Q MAT
Sbjct  419   FGVTPFVHPRFDASMLGLQPDILQAMAT  446


 Score =   395 bits (1016),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 228/350 (65%), Positives = 265/350 (76%), Gaps = 21/350 (6%)
 Frame = +1

Query  2203  RMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSST-QSLPRSFSHDEASQLLNM  2379
             ++ S TQSQLSH Q L ST  QQ+FSDLVGNH+ TSNN ST QSL  SFS + AS  LNM
Sbjct  548   QLCSATQSQLSHLQVLGSTGSQQTFSDLVGNHINTSNNRSTMQSLLSSFSRNGASTFLNM  607

Query  2380  HETNPLATLPS--KRIALESQVSSRATPYVVSQADMIS-PNSKVSDLPTFLPPFPGKEFP  2550
              ETN L +  S  KRIALESQ+ S+A PY+V+QA++++ PN+KVSD  T   P PG++  
Sbjct  608   PETNSLVSPSSSSKRIALESQIPSQA-PYIVTQAEVLTVPNTKVSDFSTLFSPNPGRQVL  666

Query  2551  EYQGVAYSQGNNALLGVNTDSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYP  2730
             +YQ VA SQ NNAL GVN         G+SNLK +  EN  L MP++T  FTS VG++YP
Sbjct  667   DYQAVAVSQ-NNALFGVN---------GMSNLKGNSPENRSLPMPYATSAFTSTVGSEYP  716

Query  2731  LNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSE  2910
             +  DM TSSCVDESG LQSSENVDQAN    TFVKV+KS SFGRSLDISKFSSY+ELRSE
Sbjct  717   VTSDMTTSSCVDESGVLQSSENVDQANSLTETFVKVYKSESFGRSLDISKFSSYNELRSE  776

Query  2911  LARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMG  3090
             LARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPW EFVN+VWYIKILSP EV QMG
Sbjct  777   LARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWHEFVNSVWYIKILSPLEVQQMG  836

Query  3091  KEEGIDLPNNLPAANQRL-PNG-GSSCEVHVSQKETRN-MNGIPLGSLDY  3231
             K EG+DLP+      QR+  NG G+ C+  +++  + N MNGIPLGSLDY
Sbjct  837   K-EGLDLPS--AGKTQRITSNGNGNGCDDFMNRNHSCNIMNGIPLGSLDY  883



>ref|XP_011085439.1| PREDICTED: auxin response factor 6-like [Sesamum indicum]
Length=929

 Score =   823 bits (2125),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/503 (83%), Positives = 442/503 (88%), Gaps = 11/503 (2%)
 Frame = +1

Query  586   GVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAH  765
             G N Q EEG  E KCLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTNKE+D+ 
Sbjct  13    GFNAQPEEG--ETKCLNSELWHACAGPLVSLPQIGSRVVYFPQGHSEQVAASTNKEVDST  70

Query  766   IPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQP  945
             IP+YPGL  QLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQKD+CLLPAELG  SKQP
Sbjct  71    IPNYPGLQPQLICQLHNVTMHADVETDEVYAQMTLQPLSPQEQKDLCLLPAELGTASKQP  130

Query  946   TNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVF  1125
             TNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQ PPAQEL+AKDLHGNEWKFRH+F
Sbjct  131   TNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQTPPAQELMAKDLHGNEWKFRHIF  190

Query  1126  RGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSD  1305
             RGQPKRHLLTTGWSVFVSAKRLVAGD+VIFIWNENNQLLLGIRRANRPQTVMPSSVLSSD
Sbjct  191   RGQPKRHLLTTGWSVFVSAKRLVAGDSVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSD  250

Query  1306  SMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFE  1485
             SMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKYAKAVYHTRVSVGMRFRMLFE
Sbjct  251   SMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYAKAVYHTRVSVGMRFRMLFE  310

Query  1486  TEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFP  1665
             T+ESSVRRYMGTITGISDLD VRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFP
Sbjct  311   TDESSVRRYMGTITGISDLDAVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFP  370

Query  1666  MYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPF  1845
             MYPSPFSLRLKRPWPS LPSFPGL +GDM ++SPL+WLRG +GDQG+QSLNFQ +G++P+
Sbjct  371   MYPSPFSLRLKRPWPSALPSFPGLRDGDMSVNSPLAWLRGGIGDQGVQSLNFQRFGVSPW  430

Query  1846  MQPRLDASMLGLQPDIYQTMATldssklasqqsll---------qfqqsipsssssliqs  1998
             MQPRLD SMLGLQPDIY  MA     +  S              Q      S+S    Q+
Sbjct  431   MQPRLDTSMLGLQPDIYHVMAAAALQETGSLDPSKLSHQPLLQFQQNVPNLSASLIQNQN  490

Query  1999  qmlqRPHPQQNLLQSFQENQVIS  2067
             QMLQ PH QQN LQ+F EN VIS
Sbjct  491   QMLQTPHNQQNFLQNFPENSVIS  513


 Score =   391 bits (1004),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 213/356 (60%), Positives = 273/356 (77%), Gaps = 10/356 (3%)
 Frame = +1

Query  2179  SKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDE  2358
             +K I ++ ++   + SQ +  Q  SST    +FSDL+GNH+ ++NNSS  S+  SFSH+ 
Sbjct  579   NKTIPTVSQIGPASVSQFTPLQGFSSTSQLLNFSDLIGNHMTSANNSSMSSVLSSFSHEG  638

Query  2359  ASQLLNMHETNPLATLPS--KRIALESQVSSRATPY-VVSQADMISPNSKVSDLPTFLPP  2529
              + L+N+H  NP+ +  S  KR+AL+ Q+ S+ + + V  Q +++ P+SKV+DLP  LPP
Sbjct  639   TTNLVNLHGPNPIVSHSSSSKRVALDPQLPSKVSQFGVPHQEELVIPSSKVTDLPALLPP  698

Query  2530  FPGKEFPEYQGVAYSQGNNALLGVNTDSSILLQNGISNLKNSGGENGFLNMPFSTCNFTS  2709
             FPG++FP++QGV  S  NN L GVN DSS ++ +G+S L+NSG ENG L+MPF+T  F S
Sbjct  699   FPGRDFPDFQGVTDSH-NNLLYGVNNDSSAIMPSGMSTLRNSGNENGSLSMPFATPAFAS  757

Query  2710  GVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSS  2889
                TD+PLN DM TSSCVDESG+LQSSENVDQ NPP  TFVKVHKSGSFGRSLDISKFSS
Sbjct  758   AGRTDFPLNSDMTTSSCVDESGYLQSSENVDQTNPPPGTFVKVHKSGSFGRSLDISKFSS  817

Query  2890  YHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSP  3069
             Y+ELRSELA MFGLEGLLEDP+RSGWQLVFVDRENDVLLLGDDPWQEFVN+VWYIKILSP
Sbjct  818   YNELRSELAHMFGLEGLLEDPQRSGWQLVFVDRENDVLLLGDDPWQEFVNSVWYIKILSP  877

Query  3070  FEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETR-NMNGIP-LGSLDY  3231
              EV QMGK EG+D PN++   +  L + G+SC+  +S+ + R ++NGIP +G+LDY
Sbjct  878   LEVQQMGK-EGLD-PNSV--QSHYLSSNGNSCDEFMSRNDPRTSLNGIPSVGTLDY  929



>ref|XP_010106165.1| Auxin response factor 6 [Morus notabilis]
 gb|EXC08253.1| Auxin response factor 6 [Morus notabilis]
Length=1035

 Score =   822 bits (2123),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/442 (90%), Positives = 416/442 (94%), Gaps = 2/442 (0%)
 Frame = +1

Query  586   GVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAH  765
             G N QA++G  EKKCLNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTNKE+DAH
Sbjct  128   GFNHQAQDG--EKKCLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTNKEVDAH  185

Query  766   IPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQP  945
             IP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQKDV LLPAELG PSKQP
Sbjct  186   IPNYPNLPPQLICQLHNVTMHADVETDEVYAQMTLQPLSPQEQKDVYLLPAELGTPSKQP  245

Query  946   TNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVF  1125
             TNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIA+DLH NEWKFRH+F
Sbjct  246   TNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIARDLHDNEWKFRHIF  305

Query  1126  RGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSD  1305
             RGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPSSVLSSD
Sbjct  306   RGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPSSVLSSD  365

Query  1306  SMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFE  1485
             SMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMRFRMLFE
Sbjct  366   SMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMRFRMLFE  425

Query  1486  TEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFP  1665
             TEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFP
Sbjct  426   TEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFP  485

Query  1666  MYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPF  1845
             MYPSPF LRLKRPWPSGLPSF  L +GDM I+SPL WL+G +GDQG+QSLNFQG G+ P+
Sbjct  486   MYPSPFPLRLKRPWPSGLPSFHALKDGDMSINSPLMWLQGGIGDQGLQSLNFQGLGLAPW  545

Query  1846  MQPRLDASMLGLQPDIYQTMAT  1911
             MQPRLDASM G+QPD+YQ MA 
Sbjct  546   MQPRLDASMAGVQPDVYQAMAA  567


 Score =   384 bits (986),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 209/355 (59%), Positives = 262/355 (74%), Gaps = 12/355 (3%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQ  2367
             +++LP  +S TQSQ    QA+ S   Q +F D VGN + +S+ S   S+  S S +  SQ
Sbjct  686   MSALPNFSSGTQSQSPSLQAIPSQCQQPTFPDPVGNPISSSDVSQIHSILGSLSQNGGSQ  745

Query  2368  LLNMHETNPL---ATLPSKRIALESQVSSRATPYVVSQADMISP-NSKVSDLPTFLPPFP  2535
             LLN+  +N +   ++L +K+IA+E Q+ S     V+ Q + ++P  S VSDL T LPPFP
Sbjct  746   LLNLSGSNSVIASSSLLAKQIAVEPQIPSGTAQSVLPQVEQLAPPQSNVSDL-TSLPPFP  804

Query  2536  GKEFPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSG  2712
             G+E+  YQG    Q +N L GVN DSS +++QNG+S L+N G EN  L+MPF + N++S 
Sbjct  805   GREYSAYQGATDPQ-SNLLFGVNIDSSSLMMQNGMSTLRNMGSENDSLSMPFGSSNYSSA  863

Query  2713  VGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSY  2892
              GTD+PLN DM TSSCVDESGFLQSSEN DQ NPP RTFVKVHKSGSFGRSLDISKFSSY
Sbjct  864   TGTDFPLNSDMTTSSCVDESGFLQSSENGDQVNPPTRTFVKVHKSGSFGRSLDISKFSSY  923

Query  2893  HELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPF  3072
              ELRSELARMFGLEG LEDP+RSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSP 
Sbjct  924   DELRSELARMFGLEGQLEDPQRSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPL  983

Query  3073  EVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRN-MNGIP-LGSLDY  3231
             EV QMGK EG+   +++P+   +L N  ++C+ ++S+++ RN  NGIP +G LDY
Sbjct  984   EVQQMGK-EGLSPASSVPS--HKLSNSNNACDDYISRQDMRNSSNGIPSMGDLDY  1035



>ref|XP_010657096.1| PREDICTED: auxin response factor 17-like [Vitis vinifera]
Length=947

 Score =   817 bits (2111),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/448 (89%), Positives = 420/448 (94%), Gaps = 2/448 (0%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S +G   Q EEG  EKKCLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSSGFAHQTEEG--EKKCLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP L  QLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQK+VCLLPAELG
Sbjct  59    KEVDAHIPNYPSLAPQLICQLHNVTMHADVETDEVYAQMTLQPLSPQEQKEVCLLPAELG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDY+QQPPAQELIA+DLHGNEW
Sbjct  119   SPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYTQQPPAQELIARDLHGNEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRL+AGD+V+FIWNE NQLLLGIRRANRPQT+MPS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSVFVSAKRLIAGDSVLFIWNEKNQLLLGIRRANRPQTIMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKYAKAVYHTRVSVGMR
Sbjct  239   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYAKAVYHTRVSVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  299   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  358

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRLKRPWPS LPSF    +GDM I+SPL WLRG++GDQGIQSLNFQG
Sbjct  359   PLTTFPMYPSPFPLRLKRPWPSALPSFHAHKDGDMSINSPLMWLRGDIGDQGIQSLNFQG  418

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
             YG+TP+MQPRLDASMLGLQ ++ Q +A 
Sbjct  419   YGLTPWMQPRLDASMLGLQSNMQQAIAA  446


 Score =   382 bits (980),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 204/336 (61%), Positives = 251/336 (75%), Gaps = 9/336 (3%)
 Frame = +1

Query  2176  MSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHD  2355
             + K I++L +++S TQS     Q + S + QQ F D VGN + TS+ S+ QSL  SFS D
Sbjct  614   IPKVISALSQLSSPTQSLPPSLQTIPSPIQQQIFPDSVGNPITTSDVSTMQSLLGSFSQD  673

Query  2356  EASQLLNMHETNPLATLPS---KRIALESQVSSRATPYVVSQAD-MISPNSKVSDLPTFL  2523
               S LLN+H +NP+ +  +   K++A+E  + S  T  V+ Q + + +P S  S+L T L
Sbjct  674   GTSHLLNLHGSNPVISSSAFFPKQVAVEPPLPSGTTQCVLPQVEELATPPSNASELSTLL  733

Query  2524  PPFPGKEFPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCN  2700
             PPFPG+E+  YQGVA  Q NN L GVN DSS ++LQNG+SNL++ G EN  ++MPFST N
Sbjct  734   PPFPGREYSVYQGVADPQ-NNLLFGVNIDSSSLMLQNGMSNLRSIGSENDSVSMPFSTPN  792

Query  2701  FTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISK  2880
             F +  GTD+PLN DM TSSC+DESGFLQSSEN++Q NPP RTFVKVHK GSFGRSLDI+K
Sbjct  793   FANAPGTDFPLNSDMTTSSCIDESGFLQSSENLEQVNPPTRTFVKVHKLGSFGRSLDITK  852

Query  2881  FSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKI  3060
             FSSY ELR EL RMFGLEG LEDP RSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKI
Sbjct  853   FSSYDELRGELGRMFGLEGRLEDPLRSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKI  912

Query  3061  LSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCE  3168
             LSP EV QMGK EGI++PN +P+   R+ N G+SC+
Sbjct  913   LSPLEVQQMGK-EGINVPNPIPS--HRISNSGNSCD  945



>ref|XP_008229616.1| PREDICTED: auxin response factor 6-like isoform X2 [Prunus mume]
Length=915

 Score =   812 bits (2097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/442 (89%), Positives = 414/442 (94%), Gaps = 2/442 (0%)
 Frame = +1

Query  586   GVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAH  765
             G N Q +EG  EKKCLNSELWHACAGPLVSLP LGSRVVYFPQGHSEQV ASTNKE+DAH
Sbjct  11    GFNHQPQEG--EKKCLNSELWHACAGPLVSLPLLGSRVVYFPQGHSEQVAASTNKEVDAH  68

Query  766   IPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQP  945
             IP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQKDV LLPAELG  SKQP
Sbjct  69    IPNYPNLPPQLICQLHNVTMHADVETDEVYAQMTLQPLSPQEQKDVYLLPAELGAASKQP  128

Query  946   TNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVF  1125
             TNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIA+DLH NEWKFRH+F
Sbjct  129   TNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIARDLHDNEWKFRHIF  188

Query  1126  RGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSD  1305
             RGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPSSVLSSD
Sbjct  189   RGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPSSVLSSD  248

Query  1306  SMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFE  1485
             SMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMRFRMLFE
Sbjct  249   SMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMRFRMLFE  308

Query  1486  TEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFP  1665
             TEESSVRRYMGTITGISDLD VRW NSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFP
Sbjct  309   TEESSVRRYMGTITGISDLDSVRWTNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFP  368

Query  1666  MYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPF  1845
             MYPSPF LRLKRPWPSG+PSF GL +GDM I++PL WL+G +GDQGIQSLNFQG+G+TP+
Sbjct  369   MYPSPFPLRLKRPWPSGIPSFHGLKDGDMGINAPLMWLQGGVGDQGIQSLNFQGFGVTPW  428

Query  1846  MQPRLDASMLGLQPDIYQTMAT  1911
             MQPRLDASM GLQP++YQ MA 
Sbjct  429   MQPRLDASMAGLQPEVYQAMAA  450


 Score =   358 bits (918),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 210/355 (59%), Positives = 255/355 (72%), Gaps = 13/355 (4%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQ  2367
             +++L    S TQSQ +  QA+ S   QQSF D VGN + +S+     S+  S S D AS 
Sbjct  567   MSALSNFASATQSQSASLQAIPSQPQQQSFPDPVGNPISSSDVPPIHSILGSLSQDGASH  626

Query  2368  LLNMHETNPLAT--LPSKRIALESQVSSRATPYVVSQADMI-SPNSKVSDLPTFLPPFPG  2538
             LLN+  +N + +  L  K+IA E Q+SS A   V+ Q + + +P S +S+L T LPPFPG
Sbjct  627   LLNLSGSNSVISSSLLPKQIAGEQQLSSGAAQCVLPQVEQLGTPQSNISEL-TALPPFPG  685

Query  2539  KEFPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSGV  2715
             +E+  +QG    Q +N L GVN DSS ++L NGI  L+N G  N  L+MPF   ++TS  
Sbjct  686   REYSAFQGGTDPQ-SNLLFGVNIDSSSLMLHNGIPTLRNIGNGNDSLSMPFGASSYTSAT  744

Query  2716  GTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYH  2895
             G D+PLN DM TSSCVDESGFLQSSENVDQ NP  R FVKVHKSGSFGRSLDISKFSSY 
Sbjct  745   GNDFPLNSDMTTSSCVDESGFLQSSENVDQVNP-TRNFVKVHKSGSFGRSLDISKFSSYD  803

Query  2896  ELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFE  3075
             ELRSELARMFGLEG LEDP+RSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSP E
Sbjct  804   ELRSELARMFGLEGQLEDPQRSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPHE  863

Query  3076  VHQMGKEEGIDLPNNLPAANQRLPNGG-SSCEVHVSQKETRN-MNGIP-LGSLDY  3231
             V QMGK EG +   ++P+   +L NGG ++C+ +VS+++ RN  NGI  LGSLDY
Sbjct  864   VQQMGK-EGHNRAASVPS--NKLSNGGNNTCDDYVSRQDLRNSTNGIASLGSLDY  915



>gb|ABN10955.2| auxin response factor 8 [Ipomoea nil]
Length=838

 Score =   809 bits (2089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/437 (92%), Positives = 413/437 (95%), Gaps = 4/437 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN
Sbjct  1     MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  60

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG
Sbjct  61    KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  120

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW
Sbjct  121   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  180

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS
Sbjct  181   KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  240

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR
Sbjct  241   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  300

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  301   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  360

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQ-GIQSLNFQ  1824
             PLTTFPMY S F LRLKRPW  G  SF   +N    + + ++WLRG +G+Q G QS+N Q
Sbjct  361   PLTTFPMYSSLFPLRLKRPWYPGPSSFQDSNN---EVINGMTWLRGEIGEQGGPQSVNLQ  417

Query  1825  GYGITPFMQPRLDASML  1875
              +G+ P+MQ R+D +ML
Sbjct  418   SFGMLPWMQQRVDPAML  434


 Score =   190 bits (482),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 133/338 (39%), Positives = 175/338 (52%), Gaps = 59/338 (17%)
 Frame = +1

Query  2254  STVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMHETNPLATLPSKRIALES  2433
             S +P  SFS    N     + SS QS+  S   + +S LLN   T   A    +    +S
Sbjct  548   SNIPSPSFSKT--NFAPPVSPSSMQSMLGSLCPEGSSNLLNFKRTGQSALNEHQPQVQQS  605

Query  2434  QVSSRATPYVVSQADMISPNSKVSDLPTFLPPFPGKEFPEYQ-GVAYSQGNNALLGVNTD  2610
                  A  ++ + ++ +S            P +PGKE    Q   A    N +  G + D
Sbjct  606   WSPKFANSHISTCSNSVS-----------TPSYPGKEASSQQETCALDAQNQSFFGASID  654

Query  2611  S-SILLQNGISNLKNS---------GGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSC  2760
             S  +LL   +S++  S          G +GF N P+                        
Sbjct  655   SPGLLLPTTLSSVTTSVVADVSSLPSGASGFQNSPYGYVQ--------------------  694

Query  2761  VDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGL  2940
              D S  + S+  VD + P  RTF+KV+KSG  GRSLDI++ SSYHELR ELA+MFG+EGL
Sbjct  695   -DSSELVSSAGQVDPSTP--RTFIKVYKSGYVGRSLDITRISSYHELRQELAQMFGIEGL  751

Query  2941  LEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNN  3120
             LEDP+RSGWQLVFVDRENDVLLLGDDPW+ FVNNVWYIKILSP +V ++GK+E   L  N
Sbjct  752   LEDPQRSGWQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPEDVQKLGKQEAKSLSRN  811

Query  3121  LPAANQRLPNGGSSCEVHVSQKETRNMNGIP-LGSLDY  3231
                  +R+   G+    H+S        G P LGSL+Y
Sbjct  812   ---TMERMNGSGADGRDHLS--------GFPSLGSLEY  838



>ref|XP_002532983.1| Auxin response factor, putative [Ricinus communis]
 gb|EEF29407.1| Auxin response factor, putative [Ricinus communis]
Length=478

 Score =   794 bits (2050),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/447 (87%), Positives = 415/447 (93%), Gaps = 4/447 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG NPQ +EG  E + LNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSAGFNPQTQEG--ENRVLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQKD   LPAELG
Sbjct  59    KEVDAHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLSPQEQKD-AYLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              P+KQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NEW
Sbjct  118   TPNKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRLKRPWP GLPSF G+ + D+ ++SPL WLRG+  D+GIQS+NFQG
Sbjct  358   PLTTFPMYPSPFPLRLKRPWPPGLPSFHGIKDDDLGMNSPLMWLRGD-ADRGIQSMNFQG  416

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMA  1908
              G+TP+MQPR+DASMLGLQ D+YQ MA
Sbjct  417   LGVTPWMQPRVDASMLGLQTDMYQAMA  443



>ref|XP_010275911.1| PREDICTED: auxin response factor 6-like isoform X2 [Nelumbo nucifera]
Length=897

 Score =   810 bits (2092),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/448 (88%), Positives = 419/448 (94%), Gaps = 3/448 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S +G   QA+EG  EK+CLNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSSGFTHQAQEG--EKRCLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQKD   LPAELG
Sbjct  59    KEVDAHIPNYPNLPPQLICQLHNVTMHADVETDEVYAQMTLQPLSLQEQKD-AYLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NEW
Sbjct  118   TPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPL+KY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLSKYVKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRLKRPWP GLPS  G+ + DM I+SPL WLRG+ GD+GIQSLNFQG
Sbjct  358   PLTTFPMYPSPFPLRLKRPWPPGLPSLHGIKDDDMGINSPLMWLRGDGGDRGIQSLNFQG  417

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
              G+TP++QPRLDAS+LGLQPDIYQ MAT
Sbjct  418   IGVTPWVQPRLDASILGLQPDIYQAMAT  445


 Score =   294 bits (753),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 180/356 (51%), Positives = 226/356 (63%), Gaps = 42/356 (12%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQ  2367
             ++++  + S +QSQ    Q +SS   Q +F     + V TS  S    L  SFSHDE S 
Sbjct  576   MSAMSHLASVSQSQPPSLQGISSFCEQPNFVGSNSHPVTTSAVSPLHGLLGSFSHDETSH  635

Query  2368  LLNMHETNPLATLPS-----KRIALESQVSSRATPYVVSQAD-MISPNSKVSDLPTFLPP  2529
             LLN+  T PL  +PS     KR A+E  + S  T   + Q + M +  + +S     LPP
Sbjct  636   LLNLPRTTPL--IPSTTWFPKRAAVEPLLPSGGTQCALPQVEQMAAAQTNLSQHSISLPP  693

Query  2530  FPGKEFPEYQGVAYSQGNNALLGVNTDSSILLQNGISNLKNSGGENGFLNMPFSTCNFTS  2709
             FPG+E    Q                            L+  G E     MPF++ NF S
Sbjct  694   FPGRECSVDQ--------------------------EGLRGVGSEGDSATMPFAS-NFVS  726

Query  2710  GVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSS  2889
               GT++PLNP + TSSC+DES FLQS ENV Q NPP RTFVKV+KSGSFGRSLDI++FSS
Sbjct  727   ATGTEFPLNPVVTTSSCLDESTFLQSPENVGQVNPPTRTFVKVYKSGSFGRSLDITRFSS  786

Query  2890  YHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSP  3069
             YHELRSELARMFGLEG LEDP RSGWQLVFVDRENDVLLLGDDPWQEFVN+VW IKILSP
Sbjct  787   YHELRSELARMFGLEGQLEDPLRSGWQLVFVDRENDVLLLGDDPWQEFVNSVWCIKILSP  846

Query  3070  FEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMN-GI-PLGSLDY  3231
              EV QMGK +G++L N++P   QRL    +SC+ +V+++++RN++ GI  +GSLDY
Sbjct  847   QEVQQMGK-QGVELLNSVPI--QRL--SSNSCDDYVNRQDSRNLSTGITSVGSLDY  897



>ref|XP_010275910.1| PREDICTED: auxin response factor 6-like isoform X1 [Nelumbo nucifera]
Length=924

 Score =   810 bits (2093),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/448 (88%), Positives = 419/448 (94%), Gaps = 3/448 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S +G   QA+EG  EK+CLNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSSGFTHQAQEG--EKRCLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQKD   LPAELG
Sbjct  59    KEVDAHIPNYPNLPPQLICQLHNVTMHADVETDEVYAQMTLQPLSLQEQKD-AYLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NEW
Sbjct  118   TPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPL+KY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLSKYVKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRLKRPWP GLPS  G+ + DM I+SPL WLRG+ GD+GIQSLNFQG
Sbjct  358   PLTTFPMYPSPFPLRLKRPWPPGLPSLHGIKDDDMGINSPLMWLRGDGGDRGIQSLNFQG  417

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
              G+TP++QPRLDAS+LGLQPDIYQ MAT
Sbjct  418   IGVTPWVQPRLDASILGLQPDIYQAMAT  445


 Score =   325 bits (832),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 192/357 (54%), Positives = 244/357 (68%), Gaps = 17/357 (5%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQ  2367
             ++++  + S +QSQ    Q +SS   Q +F     + V TS  S    L  SFSHDE S 
Sbjct  576   MSAMSHLASVSQSQPPSLQGISSFCEQPNFVGSNSHPVTTSAVSPLHGLLGSFSHDETSH  635

Query  2368  LLNMHETNPLATLPS-----KRIALESQVSSRATPYVVSQAD-MISPNSKVSDLPTFLPP  2529
             LLN+  T PL  +PS     KR A+E  + S  T   + Q + M +  + +S     LPP
Sbjct  636   LLNLPRTTPL--IPSTTWFPKRAAVEPLLPSGGTQCALPQVEQMAAAQTNLSQHSISLPP  693

Query  2530  FPGKEFPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFT  2706
             FPG+E    Q  +    ++ L GVN DSS +L+QNG+S L+  G E     MPF++ NF 
Sbjct  694   FPGRECSVDQEGSTDPQSHLLFGVNIDSSSLLMQNGMSGLRGVGSEGDSATMPFAS-NFV  752

Query  2707  SGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFS  2886
             S  GT++PLNP + TSSC+DES FLQS ENV Q NPP RTFVKV+KSGSFGRSLDI++FS
Sbjct  753   SATGTEFPLNPVVTTSSCLDESTFLQSPENVGQVNPPTRTFVKVYKSGSFGRSLDITRFS  812

Query  2887  SYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILS  3066
             SYHELRSELARMFGLEG LEDP RSGWQLVFVDRENDVLLLGDDPWQEFVN+VW IKILS
Sbjct  813   SYHELRSELARMFGLEGQLEDPLRSGWQLVFVDRENDVLLLGDDPWQEFVNSVWCIKILS  872

Query  3067  PFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMN-GI-PLGSLDY  3231
             P EV QMGK +G++L N++P   QRL    +SC+ +V+++++RN++ GI  +GSLDY
Sbjct  873   PQEVQQMGK-QGVELLNSVPI--QRL--SSNSCDDYVNRQDSRNLSTGITSVGSLDY  924



>emb|CBI30950.3| unnamed protein product [Vitis vinifera]
Length=531

 Score =   795 bits (2052),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/448 (87%), Positives = 415/448 (93%), Gaps = 3/448 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG   Q +EG  EK+CLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSPAGFTHQTQEG--EKRCLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQKD   LPAELG
Sbjct  59    KEVDAHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLSPQEQKD-AYLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PSKQP+NYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NEW
Sbjct  118   VPSKQPSNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKYAKAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYAKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRLKRPWP GLPS  G+ + D+ ++SPL WLRG+  D+GIQSLNFQG
Sbjct  358   PLTTFPMYPSPFPLRLKRPWPPGLPSLHGIKDDDLGMNSPLMWLRGDNVDRGIQSLNFQG  417

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
              G+ P+MQPRLDASMLGLQ D+YQ MA 
Sbjct  418   IGVNPWMQPRLDASMLGLQTDMYQAMAA  445



>ref|XP_007217690.1| hypothetical protein PRUPE_ppa001069mg [Prunus persica]
 gb|EMJ18889.1| hypothetical protein PRUPE_ppa001069mg [Prunus persica]
Length=919

 Score =   810 bits (2091),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/442 (89%), Positives = 413/442 (93%), Gaps = 2/442 (0%)
 Frame = +1

Query  586   GVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAH  765
             G N Q +EG  EKKCLNSELWHACAGPLVSLP LGSRVVYFPQGHSEQV ASTNKE+DAH
Sbjct  11    GFNHQPQEG--EKKCLNSELWHACAGPLVSLPLLGSRVVYFPQGHSEQVAASTNKEVDAH  68

Query  766   IPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQP  945
             IP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQKDV LLPAELG  SKQP
Sbjct  69    IPNYPNLPPQLICQLHNVTMHADVETDEVYAQMTLQPLSPQEQKDVYLLPAELGAASKQP  128

Query  946   TNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVF  1125
             TNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIA+DLH NEWKFRH+F
Sbjct  129   TNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIARDLHDNEWKFRHIF  188

Query  1126  RGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSD  1305
             RGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPSSVLSSD
Sbjct  189   RGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPSSVLSSD  248

Query  1306  SMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFE  1485
             SMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVI LAKY KAVYHTRVSVGMRFRMLFE
Sbjct  249   SMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVITLAKYVKAVYHTRVSVGMRFRMLFE  308

Query  1486  TEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFP  1665
             TEESSVRRYMGTITGISDLD VRW NSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFP
Sbjct  309   TEESSVRRYMGTITGISDLDSVRWTNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFP  368

Query  1666  MYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPF  1845
             MYPSPF LRLKRPWPSG+PSF GL +GDM I++PL WL+G +GDQGIQSLNFQG+G+TP+
Sbjct  369   MYPSPFPLRLKRPWPSGIPSFHGLKDGDMGINAPLMWLQGGVGDQGIQSLNFQGFGVTPW  428

Query  1846  MQPRLDASMLGLQPDIYQTMAT  1911
             MQPRLDASM GLQP++YQ MA 
Sbjct  429   MQPRLDASMAGLQPEVYQAMAA  450


 Score =   359 bits (921),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 208/355 (59%), Positives = 255/355 (72%), Gaps = 13/355 (4%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQ  2367
             +++L    S TQSQ +  QA+ S   QQSF D VGN + +S+     S+  S S D AS 
Sbjct  571   MSALSNFASATQSQSASLQAIPSQSQQQSFPDPVGNPISSSDVPPIHSILGSLSQDGASH  630

Query  2368  LLNMHETNPLAT--LPSKRIALESQVSSRATPYVVSQADMI-SPNSKVSDLPTFLPPFPG  2538
             LL++  +N + +  L  K+IA E Q+SS A   V+ Q + + +P S +S+L T LPPFPG
Sbjct  631   LLDLSGSNSVISSSLLPKQIAGEQQLSSGAAQCVLPQVEQLGTPQSNISEL-TALPPFPG  689

Query  2539  KEFPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSGV  2715
             +E+  +QG    Q +N L GVN DSS ++L NGI  L+N G  N  L+MPF   ++TS  
Sbjct  690   REYSAFQGGTDPQ-SNLLFGVNIDSSSLMLHNGIPTLRNIGNGNDSLSMPFGASSYTSAT  748

Query  2716  GTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYH  2895
             G D+PLN DM TSSCVDESGFLQSSENVDQ NP  R FVKVHKSGSFGRSLDISKFSSY 
Sbjct  749   GNDFPLNSDMTTSSCVDESGFLQSSENVDQVNP-TRNFVKVHKSGSFGRSLDISKFSSYD  807

Query  2896  ELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFE  3075
             ELRSELARMFGLEG LEDP+RSGWQLVF DRENDVLLLGDDPWQEFVNNVWYIKILSP E
Sbjct  808   ELRSELARMFGLEGQLEDPQRSGWQLVFGDRENDVLLLGDDPWQEFVNNVWYIKILSPLE  867

Query  3076  VHQMGKEEGIDLPNNLPAANQRLPNGG-SSCEVHVSQKETRN-MNGIP-LGSLDY  3231
             V QMGK EG++   ++P+   +L NGG ++C+ +VS+++ RN  NGI  LGSLDY
Sbjct  868   VQQMGK-EGLNCAASVPS--NKLSNGGNTTCDDYVSRQDVRNSTNGIASLGSLDY  919



>ref|XP_010688802.1| PREDICTED: auxin response factor 6 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=931

 Score =   810 bits (2092),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/448 (87%), Positives = 422/448 (94%), Gaps = 2/448 (0%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S +G   Q EEG  EKK LNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSSGFPHQPEEG--EKKVLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP LPAQLICQLH+VTMHAD ETDEVY+QMTLQPL+ QEQKDVCLLPAELG
Sbjct  59    KEVDAHIPNYPSLPAQLICQLHDVTMHADVETDEVYSQMTLQPLTLQEQKDVCLLPAELG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
               SKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDY+QQPPAQELIA+DLH NEW
Sbjct  119   TASKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYTQQPPAQELIARDLHDNEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+VIFIWNE NQLLLGIRRANRPQTVMPS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVIFIWNEKNQLLLGIRRANRPQTVMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAA+TNSRFT+F+NPRASPS+FV+PLAKY KAVYHTRVSVGMR
Sbjct  239   SVLSSDSMHIGLLAAAAHAASTNSRFTVFFNPRASPSEFVVPLAKYVKAVYHTRVSVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWP+SHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  299   FRMLFETEESSVRRYMGTITGISDLDPVRWPSSHWRSVKVGWDESTAGERQPRVSLWEIE  358

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRLKRPWPSGLPSFP L +GDM ++SPL WL+  +GD+ + SLNFQG
Sbjct  359   PLTTFPMYPSPFPLRLKRPWPSGLPSFPVLKDGDMGLNSPLMWLQREVGDRCMPSLNFQG  418

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
             YG+TP+MQPRLD++MLGLQPDI+QTMA+
Sbjct  419   YGLTPWMQPRLDSAMLGLQPDIFQTMAS  446


 Score =   337 bits (863),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 189/357 (53%), Positives = 241/357 (68%), Gaps = 14/357 (4%)
 Frame = +1

Query  2176  MSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHD  2355
             ++K I+  P    +TQS  +  + +SS  PQQ FS+ + N V  ++ S   SL  SFS D
Sbjct  584   IAKVISKTPPFGPSTQSLPTSLETISSPCPQQLFSNSIMNSVTAADISPMHSLLNSFSLD  643

Query  2356  EASQLLNMHETNPLAT---LPSKRIALESQVSSRATPYVVSQADMISPNSKVSDLPTFLP  2526
               S+ + + ++NPL +   L SKR+A+E Q+SS A   +    D+  P S++S+L + LP
Sbjct  644   GGSRQVTLTDSNPLVSSTPLLSKRVAVEPQLSSTAPCSLPQVEDLAGPQSRISELSSLLP  703

Query  2527  PFPGKEFPEYQGVAYSQGNNALLGVNTDSSILLQNGISNLKNSGGENGFLNMPFSTCNFT  2706
             P PG++F  Y G+   Q NN L GVN       QN ++NL++   EN  L+M F+  +F 
Sbjct  704   PLPGRDFSIYHGIGDPQ-NNLLFGVNVQ-----QNELANLRSHNNENDSLSMQFACSSFP  757

Query  2707  SGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFS  2886
             S  GTD+P   D+  +SCVDESGFLQSSEN D  NPP+ TFVKV KSGS GRSLDISKFS
Sbjct  758   SAAGTDFPPASDIMATSCVDESGFLQSSENDDHVNPPSGTFVKVQKSGSLGRSLDISKFS  817

Query  2887  SYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILS  3066
             SY ELRSELA MFGLEG LEDP RSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILS
Sbjct  818   SYQELRSELAHMFGLEGQLEDPLRSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILS  877

Query  3067  PFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETR-NMNGIP-LGSLDY  3231
             P EV QMGK EG++ PN++P    +  N  +SC+ +  Q++ R N NG+  + SLDY
Sbjct  878   PQEVQQMGK-EGLNFPNSIPRPKHQ--NSFNSCDDYTLQQDLRHNSNGMASVTSLDY  931



>ref|XP_009376828.1| PREDICTED: auxin response factor 6-like [Pyrus x bretschneideri]
 ref|XP_009376836.1| PREDICTED: auxin response factor 6-like [Pyrus x bretschneideri]
Length=931

 Score =   808 bits (2088),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/442 (89%), Positives = 413/442 (93%), Gaps = 2/442 (0%)
 Frame = +1

Query  586   GVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAH  765
             G N Q +EG  EKKCLNSELWHACAGPLVSLP LGSRVVYFPQGHSEQV ASTNKE+DAH
Sbjct  11    GFNHQLQEG--EKKCLNSELWHACAGPLVSLPLLGSRVVYFPQGHSEQVAASTNKEVDAH  68

Query  766   IPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQP  945
              P+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPL+ QEQKDV LLPAELG  SKQP
Sbjct  69    FPNYPNLPPQLICQLHNVTMHADVETDEVYAQMTLQPLNPQEQKDVYLLPAELGAASKQP  128

Query  946   TNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVF  1125
             TNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIA+DLH NEWKFRH+F
Sbjct  129   TNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIARDLHDNEWKFRHIF  188

Query  1126  RGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSD  1305
             RGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPSSVLSSD
Sbjct  189   RGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPSSVLSSD  248

Query  1306  SMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFE  1485
             SMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMRFRMLFE
Sbjct  249   SMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMRFRMLFE  308

Query  1486  TEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFP  1665
             TEESSVRRYMGTITGISDLD VRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFP
Sbjct  309   TEESSVRRYMGTITGISDLDSVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFP  368

Query  1666  MYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPF  1845
             MYPSPF LRLKRPW SG+PSF GL +GDM I+SPL WL+G +GDQG+QSLNFQG+G++P+
Sbjct  369   MYPSPFPLRLKRPWASGVPSFHGLKDGDMGINSPLMWLQGGLGDQGMQSLNFQGFGVSPW  428

Query  1846  MQPRLDASMLGLQPDIYQTMAT  1911
             MQPRLDASM GLQPD+YQ MA 
Sbjct  429   MQPRLDASMAGLQPDVYQAMAA  450


 Score =   326 bits (835),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 202/354 (57%), Positives = 249/354 (70%), Gaps = 12/354 (3%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQ  2367
             +++LP   S T SQ +  Q++SS   QQSF D VGN + +S+     S+  S S D  S 
Sbjct  584   MSALPNFASITPSQSASMQSISSQSQQQSFPDPVGNPIPSSDVPPIHSILGSLSQDGTSH  643

Query  2368  LLNMHETNPLAT--LPSKRIALESQVSSRATPYVVSQADMIS-PNSKVSDLPTFLPPFPG  2538
             LL++  +N   +  L SK+   E Q+SS A   V+ Q + +  P S  S++ T LPPFPG
Sbjct  644   LLHLSGSNSAISSSLLSKQTTSEPQLSSGAAQCVLPQVEQLRRPQSSFSEI-TALPPFPG  702

Query  2539  KEFPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSGV  2715
             +E+  +QG    Q +N L GVN DSS ++L NGI NL+N G  N  +++PF   N+ SG 
Sbjct  703   REYSAFQGGTDPQ-SNLLFGVNIDSSSLMLHNGIPNLRNIGNGNDSVSVPFGASNYASGT  761

Query  2716  GTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYH  2895
             G D+PLN DM TSSCVDESGFLQSSENVDQ NP   TFVKVHK GSFGRSLDISKFSSY 
Sbjct  762   GNDFPLNSDMTTSSCVDESGFLQSSENVDQVNPTG-TFVKVHKLGSFGRSLDISKFSSYD  820

Query  2896  ELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFE  3075
             +LRSELARMFGLEG LEDP+RSGWQLVFVDRENDVLLLGDDPWQEFVNNV+YIKILSP E
Sbjct  821   DLRSELARMFGLEGQLEDPQRSGWQLVFVDRENDVLLLGDDPWQEFVNNVYYIKILSPLE  880

Query  3076  VHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRN-MNGIP-LGSLDY  3231
             V QMGK EG++   ++P  N +L NG ++   +VS+++ RN  NGI  LGSLDY
Sbjct  881   VQQMGK-EGLNSVASVP--NNKLSNGSNTTVDYVSRQDLRNSRNGIASLGSLDY  931



>ref|XP_004304523.1| PREDICTED: auxin response factor 17-like [Fragaria vesca subsp. 
vesca]
Length=915

 Score =   805 bits (2078),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/440 (88%), Positives = 410/440 (93%), Gaps = 2/440 (0%)
 Frame = +1

Query  592   NPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAHIP  771
             N Q +EG  EKKCLNSELWHACAGPLVSLP LGSRVVYFPQGHSEQV ASTNKE+DAHIP
Sbjct  14    NHQPQEG--EKKCLNSELWHACAGPLVSLPALGSRVVYFPQGHSEQVAASTNKEVDAHIP  71

Query  772   SYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPTN  951
             +YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQKDV L+PAELG PSKQPTN
Sbjct  72    NYPNLPPQLICQLHNVTMHADVETDEVYAQMTLQPLSPQEQKDVYLMPAELGNPSKQPTN  131

Query  952   YFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFRG  1131
             YFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIA+DLH NEWKFRH+FRG
Sbjct  132   YFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIARDLHDNEWKFRHIFRG  191

Query  1132  QPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDSM  1311
             QPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPSSVLSSDSM
Sbjct  192   QPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPSSVLSSDSM  251

Query  1312  HIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFETE  1491
             HIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMRFRMLFETE
Sbjct  252   HIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMRFRMLFETE  311

Query  1492  ESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMY  1671
             ESSVRRYMGTITGISDLD VRW NSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMY
Sbjct  312   ESSVRRYMGTITGISDLDSVRWSNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMY  371

Query  1672  PSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPFMQ  1851
             PSPF LRLKRPWPSG+PSF  L +GDM +++PL WL+G +GD  +QSLNFQG+G+TP+MQ
Sbjct  372   PSPFPLRLKRPWPSGMPSFHALKDGDMGMNAPLMWLQGGVGDPAMQSLNFQGFGMTPWMQ  431

Query  1852  PRLDASMLGLQPDIYQTMAT  1911
             PRLD SM GLQPD+YQ MA 
Sbjct  432   PRLDTSMAGLQPDVYQAMAA  451


 Score =   358 bits (918),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 207/345 (60%), Positives = 247/345 (72%), Gaps = 12/345 (3%)
 Frame = +1

Query  2209  NSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMHET  2388
             N  TQSQ +  QA+ S   QQSF++ VGN + +S+     S+  S S D ASQLLN+  +
Sbjct  579   NFATQSQSASLQAIPSQTQQQSFTEPVGNAISSSDVPPIHSILGSLSQDGASQLLNLTGS  638

Query  2389  NPLATLPSKRIALESQVSSRATPYVVSQADMI-SPNSKVSDLPTFLPPFPGKEFPEYQGV  2565
             N      S    +ESQ+ S A    + Q D + +P S +S+L T LPPFPG+E+  +QG 
Sbjct  639   NS-GVSSSLLPKVESQLPSGAAQCGLPQVDQLGTPQSNISEL-TALPPFPGREY-SFQGA  695

Query  2566  AYSQGNNALLGVNTD-SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPD  2742
                Q +N L GVN D SS++LQNGI NL+N G     L+MPF   N+T+  G DYPLN D
Sbjct  696   NDPQ-SNLLFGVNIDASSLMLQNGIPNLRNIGNGTDSLSMPFGASNYTT-TGNDYPLNSD  753

Query  2743  MGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARM  2922
             M TSSCVDESGFLQSSENVDQ NPP RTFVKVHK GSFGRSLDISKFSSY ELRSEL  M
Sbjct  754   MTTSSCVDESGFLQSSENVDQINPPTRTFVKVHKLGSFGRSLDISKFSSYDELRSELGSM  813

Query  2923  FGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEG  3102
             FGLEG LEDP+RSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSP EV QMGK EG
Sbjct  814   FGLEGQLEDPQRSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPLEVQQMGK-EG  872

Query  3103  IDLPNNLPAANQRLPNGGSSCEVHVSQKETRN-MNGIP-LGSLDY  3231
             ++   ++P+  Q+  NG S+C+ +VS+++ RN  NGI  LGSLDY
Sbjct  873   LNSVASVPS--QKQSNGNSTCDDYVSRQDMRNSSNGIASLGSLDY  915



>ref|XP_010688801.1| PREDICTED: auxin response factor 6 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=934

 Score =   804 bits (2076),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/451 (87%), Positives = 422/451 (94%), Gaps = 5/451 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQ---VTA  738
             MR+S +G   Q EEG  EKK LNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQ   V A
Sbjct  1     MRLSSSGFPHQPEEG--EKKVLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQCLQVAA  58

Query  739   STNKEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPA  918
             STNKE+DAHIP+YP LPAQLICQLH+VTMHAD ETDEVY+QMTLQPL+ QEQKDVCLLPA
Sbjct  59    STNKEVDAHIPNYPSLPAQLICQLHDVTMHADVETDEVYSQMTLQPLTLQEQKDVCLLPA  118

Query  919   ELGMPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHG  1098
             ELG  SKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDY+QQPPAQELIA+DLH 
Sbjct  119   ELGTASKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYTQQPPAQELIARDLHD  178

Query  1099  NEWKFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTV  1278
             NEWKFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+VIFIWNE NQLLLGIRRANRPQTV
Sbjct  179   NEWKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVIFIWNEKNQLLLGIRRANRPQTV  238

Query  1279  MPSSVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSV  1458
             MPSSVLSSDSMHIGLLAAAAHAA+TNSRFT+F+NPRASPS+FV+PLAKY KAVYHTRVSV
Sbjct  239   MPSSVLSSDSMHIGLLAAAAHAASTNSRFTVFFNPRASPSEFVVPLAKYVKAVYHTRVSV  298

Query  1459  GMRFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLW  1638
             GMRFRMLFETEESSVRRYMGTITGISDLDPVRWP+SHWRSVKVGWDESTAGERQPRVSLW
Sbjct  299   GMRFRMLFETEESSVRRYMGTITGISDLDPVRWPSSHWRSVKVGWDESTAGERQPRVSLW  358

Query  1639  EIEPLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLN  1818
             EIEPLTTFPMYPSPF LRLKRPWPSGLPSFP L +GDM ++SPL WL+  +GD+ + SLN
Sbjct  359   EIEPLTTFPMYPSPFPLRLKRPWPSGLPSFPVLKDGDMGLNSPLMWLQREVGDRCMPSLN  418

Query  1819  FQGYGITPFMQPRLDASMLGLQPDIYQTMAT  1911
             FQGYG+TP+MQPRLD++MLGLQPDI+QTMA+
Sbjct  419   FQGYGLTPWMQPRLDSAMLGLQPDIFQTMAS  449


 Score =   336 bits (862),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 189/357 (53%), Positives = 241/357 (68%), Gaps = 14/357 (4%)
 Frame = +1

Query  2176  MSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHD  2355
             ++K I+  P    +TQS  +  + +SS  PQQ FS+ + N V  ++ S   SL  SFS D
Sbjct  587   IAKVISKTPPFGPSTQSLPTSLETISSPCPQQLFSNSIMNSVTAADISPMHSLLNSFSLD  646

Query  2356  EASQLLNMHETNPLAT---LPSKRIALESQVSSRATPYVVSQADMISPNSKVSDLPTFLP  2526
               S+ + + ++NPL +   L SKR+A+E Q+SS A   +    D+  P S++S+L + LP
Sbjct  647   GGSRQVTLTDSNPLVSSTPLLSKRVAVEPQLSSTAPCSLPQVEDLAGPQSRISELSSLLP  706

Query  2527  PFPGKEFPEYQGVAYSQGNNALLGVNTDSSILLQNGISNLKNSGGENGFLNMPFSTCNFT  2706
             P PG++F  Y G+   Q NN L GVN       QN ++NL++   EN  L+M F+  +F 
Sbjct  707   PLPGRDFSIYHGIGDPQ-NNLLFGVNVQ-----QNELANLRSHNNENDSLSMQFACSSFP  760

Query  2707  SGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFS  2886
             S  GTD+P   D+  +SCVDESGFLQSSEN D  NPP+ TFVKV KSGS GRSLDISKFS
Sbjct  761   SAAGTDFPPASDIMATSCVDESGFLQSSENDDHVNPPSGTFVKVQKSGSLGRSLDISKFS  820

Query  2887  SYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILS  3066
             SY ELRSELA MFGLEG LEDP RSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILS
Sbjct  821   SYQELRSELAHMFGLEGQLEDPLRSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILS  880

Query  3067  PFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETR-NMNGIP-LGSLDY  3231
             P EV QMGK EG++ PN++P    +  N  +SC+ +  Q++ R N NG+  + SLDY
Sbjct  881   PQEVQQMGK-EGLNFPNSIPRPKHQ--NSFNSCDDYTLQQDLRHNSNGMASVTSLDY  934



>gb|KHG01675.1| Auxin response factor 6 -like protein [Gossypium arboreum]
Length=798

 Score =   796 bits (2056),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/449 (86%), Positives = 414/449 (92%), Gaps = 3/449 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S +G N Q EEG  EKKCLNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSSGFNQQTEEG--EKKCLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQK+V LLPAELG
Sbjct  59    KEVDAHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLSPQEQKNVFLLPAELG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYS QPPAQEL+A+DLH NEW
Sbjct  119   TPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSLQPPAQELVARDLHENEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPS
Sbjct  179   KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVY+TRVSVGMR
Sbjct  239   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYYTRVSVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDP RWPNSHWRSVKVGWDESTAGE+QPRVSLWEIE
Sbjct  299   FRMLFETEESSVRRYMGTITGISDLDPGRWPNSHWRSVKVGWDESTAGEKQPRVSLWEIE  358

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMY SPF LRLKRPWPS LPSF    +GD +I+S + WL+G +GDQG+QSLNFQG
Sbjct  359   PLTTFPMYSSPFPLRLKRPWPSALPSFHAFKDGDTNINSQMMWLQGGIGDQGLQSLNFQG  418

Query  1828  YGITPFMQPRLD-ASMLGLQPDIYQTMAT  1911
             +G+ P+MQPRLD +S+  +QPD+YQ MA 
Sbjct  419   FGVAPWMQPRLDTSSIQSVQPDLYQAMAA  447


 Score =   353 bits (905),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 190/305 (62%), Positives = 224/305 (73%), Gaps = 18/305 (6%)
 Frame = +1

Query  2221  QSQLSHFQALSSTVP-------QQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNM  2379
             Q Q+   QA SS++P       QQ+FSD +GN +  SN SS QS+  S SH  AS LLN+
Sbjct  484   QRQMLQHQAQSSSLPTAASECQQQTFSDPLGNSLALSNASSMQSILGSLSHAGASHLLNL  543

Query  2380  HETNPL--ATLPSKRIALESQVSSRATPYVVSQAD---MISPNSKVSDLPTFLPPFPGKE  2544
               +NP+  ++L SK +A+E Q+SS    YV+ Q +   M+  N     L   LPPFPG+E
Sbjct  544   KGSNPIISSSLLSKPVAIEPQLSSETANYVLPQVEHLGMVQSNV----LSNLLPPFPGRE  599

Query  2545  FPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGT  2721
             +  YQ     Q NN L GV+ DSS ++LQ G++NLKN+G EN  L+MP++  NFTS  GT
Sbjct  600   YSAYQSSTDPQ-NNFLFGVSIDSSSLMLQQGMTNLKNTGNENDSLSMPYAASNFTSASGT  658

Query  2722  DYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHEL  2901
             D+PLN DM TSSCVDESG+LQSSE VDQ NPP  TFVKVHK GSFGRSLDISKFSSY+EL
Sbjct  659   DFPLNSDMTTSSCVDESGYLQSSEYVDQVNPPTGTFVKVHKLGSFGRSLDISKFSSYNEL  718

Query  2902  RSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVH  3081
             R ELARMFGLEG LEDP+RSGWQLVFVDREND+LLLGDDPWQEFVNNVWYIKILSP EV 
Sbjct  719   RCELARMFGLEGQLEDPQRSGWQLVFVDRENDILLLGDDPWQEFVNNVWYIKILSPLEVQ  778

Query  3082  QMGKE  3096
             QMGKE
Sbjct  779   QMGKE  783



>gb|EYU42851.1| hypothetical protein MIMGU_mgv1a001422mg [Erythranthe guttata]
Length=822

 Score =   796 bits (2057),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/444 (89%), Positives = 412/444 (93%), Gaps = 5/444 (1%)
 Frame = +1

Query  586   GVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAH  765
             G N Q EEG  EKKCLNSELWHACAGPLVSLP LGSRVVYFPQGHSEQV ASTNKEIDA 
Sbjct  11    GANAQQEEG--EKKCLNSELWHACAGPLVSLPLLGSRVVYFPQGHSEQVAASTNKEIDAA  68

Query  766   IPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQP  945
             IP+YPGL  QLICQLHNVTMHAD ETDEVYAQMTLQPL+ QEQKD+CLLPAELG PSKQP
Sbjct  69    IPNYPGLQPQLICQLHNVTMHADIETDEVYAQMTLQPLTPQEQKDICLLPAELGSPSKQP  128

Query  946   TNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVF  1125
             TNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQ PP QELIAKDLHGNEWKFRH+F
Sbjct  129   TNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQTPPCQELIAKDLHGNEWKFRHIF  188

Query  1126  RGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSD  1305
             RGQPKRHLLTTGWSVFVSAKRLVAGD+VIFIWNENNQL LGIRRANRPQ VMPSSVLSSD
Sbjct  189   RGQPKRHLLTTGWSVFVSAKRLVAGDSVIFIWNENNQLFLGIRRANRPQAVMPSSVLSSD  248

Query  1306  SMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFE  1485
             SMHIGLLAAAAHAAATNSRFTIF+NPRASPS+FVIPLAKYAK+ YHTRVSVGMRFRMLFE
Sbjct  249   SMHIGLLAAAAHAAATNSRFTIFFNPRASPSEFVIPLAKYAKSAYHTRVSVGMRFRMLFE  308

Query  1486  TEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFP  1665
             TEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFP
Sbjct  309   TEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFP  368

Query  1666  MYPSPFSLRLKRPWPSGLPSFPGLSN-GDMHISSPLSWLRGNMGDQG-IQSLNFQGY-GI  1836
             MYPSPFSLR+KRPWPSGLPSFPGL + GDM ++SP++WLRG MGDQG +Q LNFQG  G 
Sbjct  369   MYPSPFSLRMKRPWPSGLPSFPGLKDGGDMSMNSPITWLRGGMGDQGMMQQLNFQGIGGG  428

Query  1837  TPFMQPRLDASMLGLQPDIYQTMA  1908
             + +MQPRLD SM  +QPDIYQ MA
Sbjct  429   SHWMQPRLDPSMFCMQPDIYQVMA  452


 Score =   257 bits (656),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 145/266 (55%), Positives = 184/266 (69%), Gaps = 25/266 (9%)
 Frame = +1

Query  2365  QLLNMHETNPLATLPSKRIAL-----ESQVSSRATPYVVSQ-ADMISPNSKVSDLPTFLP  2526
              ++N+H  N   +  SKR+AL      S+VSS ++ + V    ++++P+SK S+L   LP
Sbjct  564   HIMNLHGPN---SSSSKRVALLDPQIPSKVSSTSSHFGVPHLEELVTPHSKGSELSAVLP  620

Query  2527  PFPGKEFPEYQGVAYSQGNNALL-----------GVNTDSSILLQNGISNLKNSGGENGF  2673
             PF G++F ++Q V     NN              G+ +  +++  N  +N   +G E   
Sbjct  621   PFLGRDFSDFQSVTNHSHNNNNNSNNNNNNNDNNGLYSSGNVMNNNNNNNNNGNGSEQ--  678

Query  2674  LNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGS  2853
             L+M ++T  F +G G D+P+N DM +SSCVDESG+LQSSENVD   P +R FVKVHKSGS
Sbjct  679   LSMAYATSAFVNGAGGDFPINSDMTSSSCVDESGYLQSSENVD---PTSRAFVKVHKSGS  735

Query  2854  FGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEF  3033
             FGRSLDISKFSSY ELR EL+RMFGLEG LED +RSGWQLVFVDREND+LLLGDDPWQEF
Sbjct  736   FGRSLDISKFSSYDELRGELSRMFGLEGFLEDSQRSGWQLVFVDRENDILLLGDDPWQEF  795

Query  3034  VNNVWYIKILSPFEVHQMGKEEGIDL  3111
             VN+VWYIKILSP EV QMGKEEG D 
Sbjct  796   VNSVWYIKILSPLEVQQMGKEEGRDF  821



>ref|XP_007048898.1| Auxin response factor 6 isoform 2 [Theobroma cacao]
 gb|EOX93055.1| Auxin response factor 6 isoform 2 [Theobroma cacao]
Length=913

 Score =   798 bits (2062),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/449 (87%), Positives = 413/449 (92%), Gaps = 3/449 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S +G N Q +EG  EKKCLNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSSGFNQQTQEG--EKKCLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP LP QL+CQLHNVTMHAD ETDEVYAQMTLQPLS QEQKDV LLPAELG
Sbjct  59    KEVDAHIPNYPSLPPQLLCQLHNVTMHADVETDEVYAQMTLQPLSPQEQKDVYLLPAELG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NEW
Sbjct  119   NPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA+RPQTVMPS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRASRPQTVMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  239   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  299   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  358

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LRLKRPWPS LPSF    +GDM I+S L WL+G +GDQGIQSLNFQG
Sbjct  359   PLTTFPMYPSAFPLRLKRPWPSALPSFHAFKDGDMSINSQLMWLQGGVGDQGIQSLNFQG  418

Query  1828  YGITPFMQPRLDASML-GLQPDIYQTMAT  1911
             +G+ P++QPR D S L G+QP +YQ M  
Sbjct  419   FGVAPWIQPRHDTSSLPGVQPYLYQAMGA  447


 Score =   364 bits (935),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 197/336 (59%), Positives = 251/336 (75%), Gaps = 11/336 (3%)
 Frame = +1

Query  2245  ALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMHETNPL---ATLPSK  2415
              ++S   QQ+F D +GN + TS+ SS QS+  S S + AS LLN++ +NP+   +TL SK
Sbjct  582   VVASQCQQQTFPDSIGNSIATSDVSSMQSILGSLSQNGASHLLNLNGSNPVISSSTLLSK  641

Query  2416  RIALESQVSSRATPYVVSQADMI-SPNSKVSDLPTFLPPFPGKEFPEYQGVAYSQGNNAL  2592
              +A+E Q+SS A   V+ Q + + +  S VS+L   LPPFPG+E+  Y G    Q NN L
Sbjct  642   PVAVEPQLSSGAANCVLPQVEQLGTARSNVSELSNLLPPFPGREYSAYHGSTDPQ-NNLL  700

Query  2593  LGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDE  2769
              GV+ DSS ++LQ+G++NLKN G EN  L++P++  NFTS  GTD+PLN DM TSSCVDE
Sbjct  701   FGVSIDSSSLMLQHGMTNLKNIGNENDSLSLPYAASNFTSASGTDFPLNSDMTTSSCVDE  760

Query  2770  SGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLED  2949
             SG+LQSSENVDQ NP   TF+KVHKSGSFGRSLDISKFSSY ELR ELARMFGLEG LED
Sbjct  761   SGYLQSSENVDQVNPTTGTFLKVHKSGSFGRSLDISKFSSYDELRCELARMFGLEGQLED  820

Query  2950  PERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPA  3129
             P+RSGWQLVFVDREND+LLLGDDPWQEFVNNVWYIKILSP EV QMGK EG+    ++P+
Sbjct  821   PQRSGWQLVFVDRENDILLLGDDPWQEFVNNVWYIKILSPHEVQQMGK-EGLTPATSVPS  879

Query  3130  ANQRLPNGGSSCEVHVSQKETRNM-NGIP-LGSLDY  3231
               QRL +  + C+ ++S+++ R+  NG+  +GSL+Y
Sbjct  880   --QRLTHSSNHCDDYMSRQDLRSSGNGLASMGSLEY  913



>ref|XP_002279808.1| PREDICTED: auxin response factor 6 [Vitis vinifera]
Length=908

 Score =   797 bits (2059),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/448 (87%), Positives = 415/448 (93%), Gaps = 3/448 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG   Q +EG  EK+CLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSPAGFTHQTQEG--EKRCLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQKD   LPAELG
Sbjct  59    KEVDAHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLSPQEQKD-AYLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PSKQP+NYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NEW
Sbjct  118   VPSKQPSNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKYAKAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYAKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRLKRPWP GLPS  G+ + D+ ++SPL WLRG+  D+GIQSLNFQG
Sbjct  358   PLTTFPMYPSPFPLRLKRPWPPGLPSLHGIKDDDLGMNSPLMWLRGDNVDRGIQSLNFQG  417

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
              G+ P+MQPRLDASMLGLQ D+YQ MA 
Sbjct  418   IGVNPWMQPRLDASMLGLQTDMYQAMAA  445


 Score =   324 bits (830),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 190/339 (56%), Positives = 235/339 (69%), Gaps = 14/339 (4%)
 Frame = +1

Query  2239  FQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMHETNPL----ATL  2406
              Q +SS   QQSFSD  GN   +   S  QSL  SF  DE+S LLNM  +  L    A L
Sbjct  576   LQTISSLCQQQSFSDSTGNPGTSPIISPLQSLLGSFPQDESSNLLNMPRSTSLMPSAAWL  635

Query  2407  PSKRIALESQVSSRATPYVVSQADMIS-PNSKVSDLPTFLPPFPGKEFPEYQGVAYSQGN  2583
             P KR+A+E  + S A+  ++ Q + +  P + +S     LPPFPG+E    Q  +    +
Sbjct  636   P-KRVAVEPLLPSGASQCILPQVEQLGQPQTNISQNSISLPPFPGRECSIDQEGSTDPQS  694

Query  2584  NALLGVNTD-SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSC  2760
             + L GVN + SS+L+QNG+S L+  G E+    +PFS+ NF S  GTD+ LNP M  SSC
Sbjct  695   HLLFGVNIEPSSLLMQNGMSGLRGVGSESDSTAIPFSSSNFMSSTGTDFSLNPAMTPSSC  754

Query  2761  VDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGL  2940
             +DESGFLQS ENV Q NPP RTFVKV+KSGSFGRSLDI+KFSSYHELR ELARMFGLEG 
Sbjct  755   IDESGFLQSPENVGQVNPPTRTFVKVYKSGSFGRSLDITKFSSYHELRGELARMFGLEGQ  814

Query  2941  LEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNN  3120
             LEDP RSGWQLVFVDRENDVLLLGDDPW EFVN+VW IKILS  EV QMGK  G++L N+
Sbjct  815   LEDPRRSGWQLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSLQEVQQMGK-RGLELLNS  873

Query  3121  LPAANQRLPNGGSSCEVHVSQKETRNMN-GI-PLGSLDY  3231
             +P   QRL +  SSC+ + S++++RN++ GI  +GSLDY
Sbjct  874   VPI--QRLTS--SSCDDYASRQDSRNLSTGITSVGSLDY  908



>ref|XP_010090447.1| Auxin response factor 6 [Morus notabilis]
 gb|EXB39505.1| Auxin response factor 6 [Morus notabilis]
Length=902

 Score =   796 bits (2056),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/448 (86%), Positives = 415/448 (93%), Gaps = 3/448 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S  G +PQ +EG  EK+ LNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSVGFSPQPQEG--EKRVLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQKD   LPAELG
Sbjct  59    KEVDAHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLSPQEQKD-AYLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NEW
Sbjct  118   TPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVF+SAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFISAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGI DLDPVRWPNSHWRSVKVGWDESTAG+RQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGIGDLDPVRWPNSHWRSVKVGWDESTAGDRQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRLKRPWP GLP+F G+   D+ ++SPL WLRG+ GD+G+Q++NFQG
Sbjct  358   PLTTFPMYPSPFPLRLKRPWPPGLPAFHGIKEDDLGMNSPLMWLRGDYGDRGLQAMNFQG  417

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
              G+TP+MQPR+DASMLGLQPD+YQ MA 
Sbjct  418   IGVTPWMQPRVDASMLGLQPDMYQAMAA  445


 Score =   307 bits (786),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 187/347 (54%), Positives = 236/347 (68%), Gaps = 12/347 (3%)
 Frame = +1

Query  2212  STTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSH-DEASQLLNMHET  2388
             S +QSQ    QA+SS   Q +FSD  G  V +S  S   S+  SF   DEAS LLN+  +
Sbjct  561   SASQSQSPSLQAISSMCQQPNFSDSNGTAVTSSIVSPLHSILGSFPPPDEASHLLNLPRS  620

Query  2389  N-PLATLPSKRIALESQVSSRATPYVVSQADMISP-NSKVSDLPTFLPPFPGKEFPEYQG  2562
             N   A  PSKR A+E  +++  T   + Q + + P  + +S     LPPFPG+E    Q 
Sbjct  621   NLSSAVWPSKRAAVEPLIAAGPTQCALPQVEQLGPPQTNLSPNSVSLPPFPGRECAIDQE  680

Query  2563  VAYSQGNNALLGVNTD-SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNP  2739
                   ++ L GVN + SS+L+QNGISNL+  G E+    +PF + ++ S  GT++ LNP
Sbjct  681   GNTDPQSHLLFGVNIEPSSLLMQNGISNLRGVGSESDSTTIPFPSSSYMSTTGTNFSLNP  740

Query  2740  D-MGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELA  2916
               +  SSC+DESGFLQS EN  Q N PNRTFVKVHKSGSFGRSLDI+KFSSY+ELR ELA
Sbjct  741   AAIAPSSCIDESGFLQSPENAGQGNNPNRTFVKVHKSGSFGRSLDITKFSSYNELRGELA  800

Query  2917  RMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKE  3096
             RMFGLEG LEDP RSGWQLVFVDRENDVLLLGDDPW EFVN+VW IKILSP EV QMGK 
Sbjct  801   RMFGLEGELEDPVRSGWQLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQQMGK-  859

Query  3097  EGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNM-NGI-PLGSLDY  3231
              G++L N++  + QRL N  +SC+ + S +++RN+ +GI  +GSLDY
Sbjct  860   RGLELLNSV--SIQRLAN--NSCDDYPSCEDSRNLSSGITSVGSLDY  902



>ref|XP_008229615.1| PREDICTED: auxin response factor 6-like isoform X1 [Prunus mume]
Length=947

 Score =   796 bits (2055),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/474 (83%), Positives = 414/474 (87%), Gaps = 34/474 (7%)
 Frame = +1

Query  586   GVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAH  765
             G N Q +EG  EKKCLNSELWHACAGPLVSLP LGSRVVYFPQGHSEQV ASTNKE+DAH
Sbjct  11    GFNHQPQEG--EKKCLNSELWHACAGPLVSLPLLGSRVVYFPQGHSEQVAASTNKEVDAH  68

Query  766   IPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQP  945
             IP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQKDV LLPAELG  SKQP
Sbjct  69    IPNYPNLPPQLICQLHNVTMHADVETDEVYAQMTLQPLSPQEQKDVYLLPAELGAASKQP  128

Query  946   TNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVF  1125
             TNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIA+DLH NEWKFRH+F
Sbjct  129   TNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIARDLHDNEWKFRHIF  188

Query  1126  RGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSD  1305
             RGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPSSVLSSD
Sbjct  189   RGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPSSVLSSD  248

Query  1306  SMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFE  1485
             SMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMRFRMLFE
Sbjct  249   SMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMRFRMLFE  308

Query  1486  TEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFP  1665
             TEESSVRRYMGTITGISDLD VRW NSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFP
Sbjct  309   TEESSVRRYMGTITGISDLDSVRWTNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFP  368

Query  1666  MYPSPFSLRLKRPWPSGLPSF--------------------------------PGLSNGD  1749
             MYPSPF LRLKRPWPSG+PSF                                 GL +GD
Sbjct  369   MYPSPFPLRLKRPWPSGIPSFHGIFGFMLEEHMVSYVSKNVFFAPLILSGMFISGLKDGD  428

Query  1750  MHISSPLSWLRGNMGDQGIQSLNFQGYGITPFMQPRLDASMLGLQPDIYQTMAT  1911
             M I++PL WL+G +GDQGIQSLNFQG+G+TP+MQPRLDASM GLQP++YQ MA 
Sbjct  429   MGINAPLMWLQGGVGDQGIQSLNFQGFGVTPWMQPRLDASMAGLQPEVYQAMAA  482


 Score =   358 bits (919),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 210/355 (59%), Positives = 255/355 (72%), Gaps = 13/355 (4%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQ  2367
             +++L    S TQSQ +  QA+ S   QQSF D VGN + +S+     S+  S S D AS 
Sbjct  599   MSALSNFASATQSQSASLQAIPSQPQQQSFPDPVGNPISSSDVPPIHSILGSLSQDGASH  658

Query  2368  LLNMHETNPLAT--LPSKRIALESQVSSRATPYVVSQADMI-SPNSKVSDLPTFLPPFPG  2538
             LLN+  +N + +  L  K+IA E Q+SS A   V+ Q + + +P S +S+L T LPPFPG
Sbjct  659   LLNLSGSNSVISSSLLPKQIAGEQQLSSGAAQCVLPQVEQLGTPQSNISEL-TALPPFPG  717

Query  2539  KEFPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSGV  2715
             +E+  +QG    Q +N L GVN DSS ++L NGI  L+N G  N  L+MPF   ++TS  
Sbjct  718   REYSAFQGGTDPQ-SNLLFGVNIDSSSLMLHNGIPTLRNIGNGNDSLSMPFGASSYTSAT  776

Query  2716  GTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYH  2895
             G D+PLN DM TSSCVDESGFLQSSENVDQ NP  R FVKVHKSGSFGRSLDISKFSSY 
Sbjct  777   GNDFPLNSDMTTSSCVDESGFLQSSENVDQVNP-TRNFVKVHKSGSFGRSLDISKFSSYD  835

Query  2896  ELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFE  3075
             ELRSELARMFGLEG LEDP+RSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSP E
Sbjct  836   ELRSELARMFGLEGQLEDPQRSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPHE  895

Query  3076  VHQMGKEEGIDLPNNLPAANQRLPNGG-SSCEVHVSQKETRN-MNGIP-LGSLDY  3231
             V QMGK EG +   ++P+   +L NGG ++C+ +VS+++ RN  NGI  LGSLDY
Sbjct  896   VQQMGK-EGHNRAASVPS--NKLSNGGNNTCDDYVSRQDLRNSTNGIASLGSLDY  947



>ref|XP_007024963.1| Auxin response factor 6 isoform 2 [Theobroma cacao]
 gb|EOY27585.1| Auxin response factor 6 isoform 2 [Theobroma cacao]
Length=902

 Score =   791 bits (2043),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/449 (86%), Positives = 414/449 (92%), Gaps = 3/449 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEG-TGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTAST  744
             MR++ AG NPQ +E   GEK+ LNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV AST
Sbjct  1     MRLASAGFNPQTQEDFAGEKRVLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAAST  60

Query  745   NKEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAEL  924
             NKE+DAHIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQK+   LPAEL
Sbjct  61    NKEVDAHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLSPQEQKE-AYLPAEL  119

Query  925   GMPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNE  1104
             G PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NE
Sbjct  120   GTPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNE  179

Query  1105  WKFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMP  1284
             WKFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMP
Sbjct  180   WKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMP  239

Query  1285  SSVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGM  1464
             SSVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGM
Sbjct  240   SSVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYIKAVYHTRVSVGM  299

Query  1465  RFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEI  1644
             RFRMLFETEESSVRRYMGTITGISDLDP RWPNSHWRSVKVGWDESTAGERQPRVSLWEI
Sbjct  300   RFRMLFETEESSVRRYMGTITGISDLDPARWPNSHWRSVKVGWDESTAGERQPRVSLWEI  359

Query  1645  EPLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQ  1824
             EPLTTFPMYP+PF LRLKRPWP GLPSF G+ + D+ ++SPL WLRG+  D+G+QSLN Q
Sbjct  360   EPLTTFPMYPAPFPLRLKRPWPPGLPSFHGIKDDDLGMNSPLMWLRGD-ADRGMQSLNLQ  418

Query  1825  GYGITPFMQPRLDASMLGLQPDIYQTMAT  1911
             G G+TP+MQPRLDASM+GL  D+YQ MA 
Sbjct  419   GIGVTPWMQPRLDASMVGLPADMYQAMAA  447


 Score =   315 bits (808),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 188/335 (56%), Positives = 235/335 (70%), Gaps = 14/335 (4%)
 Frame = +1

Query  2248  LSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMHETNPL---ATLPSKR  2418
             + S   QQSFSD  GN V +   S   SL  SF  DE+S LLN+  +NP+   A  PSKR
Sbjct  575   MPSLCQQQSFSDSNGNTVTSPIVSPLHSLLGSFPQDESSNLLNLPRSNPVITSAAWPSKR  634

Query  2419  IALESQVSSRATPYVVSQADMISPN-SKVSDLPTFLPPFPGKEFPEYQGVAYSQGNNALL  2595
              A+E  +SS +   V+ Q + + P  + +S     LPPFPG+E    Q       ++ L 
Sbjct  635   AAVEV-LSSGSPQCVLPQVEQLGPTQTNMSQNSISLPPFPGRECSIDQEGGTDPQSHLLF  693

Query  2596  GVNTD-SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDES  2772
             GVN + SS+L+ NG+S+L+  G ++    +PFS+ N+ S  GTD+ +NP M  SSC+DES
Sbjct  694   GVNIEPSSLLMPNGMSSLRGVGSDSDSTTIPFSS-NYMSTAGTDFSVNPAMTPSSCIDES  752

Query  2773  GFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDP  2952
             GFLQS ENV Q NP  RTFVKV+KSGSFGRSLDISKFSSY+ELRSELARMFGLEG LEDP
Sbjct  753   GFLQSPENVGQGNPQTRTFVKVYKSGSFGRSLDISKFSSYNELRSELARMFGLEGQLEDP  812

Query  2953  ERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAA  3132
              RSGWQLVFVDRENDVLLLGDDPW EFVN+VW IKILSP EV QMGK  G++L N++P  
Sbjct  813   LRSGWQLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQQMGK-RGLELLNSVPV-  870

Query  3133  NQRLPNGGSSCEVHVSQKETRNM-NGIP-LGSLDY  3231
              QRL NG  SC+ +VS++++RN+ +GI  +GSLDY
Sbjct  871   -QRLSNG--SCDDYVSRQDSRNLSSGIASVGSLDY  902



>ref|XP_007024962.1| Auxin response factor 6 isoform 1 [Theobroma cacao]
 gb|EOY27584.1| Auxin response factor 6 isoform 1 [Theobroma cacao]
Length=899

 Score =   791 bits (2042),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/448 (86%), Positives = 414/448 (92%), Gaps = 4/448 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR++ AG NPQ +EG  EK+ LNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLASAGFNPQTQEG--EKRVLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQK+   LPAELG
Sbjct  59    KEVDAHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLSPQEQKE-AYLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NEW
Sbjct  118   TPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYIKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDP RWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDPARWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYP+PF LRLKRPWP GLPSF G+ + D+ ++SPL WLRG+  D+G+QSLN QG
Sbjct  358   PLTTFPMYPAPFPLRLKRPWPPGLPSFHGIKDDDLGMNSPLMWLRGD-ADRGMQSLNLQG  416

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
              G+TP+MQPRLDASM+GL  D+YQ MA 
Sbjct  417   IGVTPWMQPRLDASMVGLPADMYQAMAA  444


 Score =   316 bits (809),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 188/335 (56%), Positives = 235/335 (70%), Gaps = 14/335 (4%)
 Frame = +1

Query  2248  LSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMHETNPL---ATLPSKR  2418
             + S   QQSFSD  GN V +   S   SL  SF  DE+S LLN+  +NP+   A  PSKR
Sbjct  572   MPSLCQQQSFSDSNGNTVTSPIVSPLHSLLGSFPQDESSNLLNLPRSNPVITSAAWPSKR  631

Query  2419  IALESQVSSRATPYVVSQADMISPN-SKVSDLPTFLPPFPGKEFPEYQGVAYSQGNNALL  2595
              A+E  +SS +   V+ Q + + P  + +S     LPPFPG+E    Q       ++ L 
Sbjct  632   AAVEV-LSSGSPQCVLPQVEQLGPTQTNMSQNSISLPPFPGRECSIDQEGGTDPQSHLLF  690

Query  2596  GVNTD-SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDES  2772
             GVN + SS+L+ NG+S+L+  G ++    +PFS+ N+ S  GTD+ +NP M  SSC+DES
Sbjct  691   GVNIEPSSLLMPNGMSSLRGVGSDSDSTTIPFSS-NYMSTAGTDFSVNPAMTPSSCIDES  749

Query  2773  GFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDP  2952
             GFLQS ENV Q NP  RTFVKV+KSGSFGRSLDISKFSSY+ELRSELARMFGLEG LEDP
Sbjct  750   GFLQSPENVGQGNPQTRTFVKVYKSGSFGRSLDISKFSSYNELRSELARMFGLEGQLEDP  809

Query  2953  ERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAA  3132
              RSGWQLVFVDRENDVLLLGDDPW EFVN+VW IKILSP EV QMGK  G++L N++P  
Sbjct  810   LRSGWQLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQQMGK-RGLELLNSVPV-  867

Query  3133  NQRLPNGGSSCEVHVSQKETRNM-NGIP-LGSLDY  3231
              QRL NG  SC+ +VS++++RN+ +GI  +GSLDY
Sbjct  868   -QRLSNG--SCDDYVSRQDSRNLSSGIASVGSLDY  899



>ref|XP_011096635.1| PREDICTED: auxin response factor 6 isoform X1 [Sesamum indicum]
Length=903

 Score =   788 bits (2034),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/448 (86%), Positives = 413/448 (92%), Gaps = 2/448 (0%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S AG+N Q+ E  G+K CLNSELWHACAGPLVSLP +GS VVYFPQGHSEQV ASTN
Sbjct  1     MKLSSAGLNQQSPEA-GDKDCLNSELWHACAGPLVSLPSIGSHVVYFPQGHSEQVAASTN  59

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DA IP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQK+V  LPA+LG
Sbjct  60    KEVDAQIPNYPSLPPQLICQLHNVTMHADIETDEVYAQMTLQPLSPQEQKEVSFLPADLG  119

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NEW
Sbjct  120   APSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHNNEW  179

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPS
Sbjct  180   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPS  239

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  240   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  299

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  300   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  359

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF+LRLKRPWP GLPSF G+   DM ++SPL WLRG++ D+G+QSLN QG
Sbjct  360   PLTTFPMYPSPFALRLKRPWPPGLPSFTGIKTTDMGLNSPLMWLRGDVVDRGMQSLN-QG  418

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
              G TP+MQP LD+S+LG+Q DIYQ MA 
Sbjct  419   MGATPWMQPGLDSSVLGMQNDIYQAMAA  446


 Score =   306 bits (784),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 178/327 (54%), Positives = 225/327 (69%), Gaps = 10/327 (3%)
 Frame = +1

Query  2272  SFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMHETNPLAT---LPSKRIALESQVS  2442
             +FSD     V  +  S   SL  S + DE S  LNM  ++ L +    P+KR+AL+  +S
Sbjct  580   NFSDSNVKPVAGNITSPLHSLLGSVTQDETSNHLNMPRSSNLLSSNGWPTKRVALDPLIS  639

Query  2443  SRATPYVVSQADMISP-NSKVSDLPTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTDSS-  2616
                +  +  Q D + P N+ V+  P  LPPFPG+E    Q  +    N+ L GVN DSS 
Sbjct  640   GGISQAITPQIDQLGPSNTNVTPNPVSLPPFPGRECLIEQEASNDPQNHFLFGVNIDSSP  699

Query  2617  ILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSEN  2796
             +L+QNGI NLK  G ++    + F++ +F S  G DY LNP + +SSC+DESGFL SS+N
Sbjct  700   LLMQNGIPNLKAVGSDSDNATVVFASSSFMSSSGADYSLNPTVTSSSCLDESGFLLSSDN  759

Query  2797  VDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLV  2976
             V   NPPNRTFVKV+KSGSFGRSLDISKFSSYHELRSELA+MFGLEG LEDP RSGWQLV
Sbjct  760   VGHVNPPNRTFVKVYKSGSFGRSLDISKFSSYHELRSELAQMFGLEGQLEDPLRSGWQLV  819

Query  2977  FVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGG  3156
             FVDRENDVLLLGDDPW EFVN+VW IKILSP EV +MGK  G++L N++P     LPNG 
Sbjct  820   FVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQEMGK-RGLELLNSVPIQKLPLPNG-  877

Query  3157  SSCEVHVSQKETRNMN-GIP-LGSLDY  3231
              +C+   +++E RNM+ GIP +G+LD+
Sbjct  878   -TCDGFANRQEARNMSAGIPSVGTLDF  903



>ref|XP_011096636.1| PREDICTED: auxin response factor 6 isoform X2 [Sesamum indicum]
Length=902

 Score =   787 bits (2032),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/448 (86%), Positives = 413/448 (92%), Gaps = 3/448 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S AG+N Q+ EG  +K CLNSELWHACAGPLVSLP +GS VVYFPQGHSEQV ASTN
Sbjct  1     MKLSSAGLNQQSPEG--DKDCLNSELWHACAGPLVSLPSIGSHVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DA IP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQK+V  LPA+LG
Sbjct  59    KEVDAQIPNYPSLPPQLICQLHNVTMHADIETDEVYAQMTLQPLSPQEQKEVSFLPADLG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NEW
Sbjct  119   APSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHNNEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  239   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  299   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  358

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF+LRLKRPWP GLPSF G+   DM ++SPL WLRG++ D+G+QSLN QG
Sbjct  359   PLTTFPMYPSPFALRLKRPWPPGLPSFTGIKTTDMGLNSPLMWLRGDVVDRGMQSLN-QG  417

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
              G TP+MQP LD+S+LG+Q DIYQ MA 
Sbjct  418   MGATPWMQPGLDSSVLGMQNDIYQAMAA  445


 Score =   306 bits (784),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 178/327 (54%), Positives = 225/327 (69%), Gaps = 10/327 (3%)
 Frame = +1

Query  2272  SFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMHETNPLAT---LPSKRIALESQVS  2442
             +FSD     V  +  S   SL  S + DE S  LNM  ++ L +    P+KR+AL+  +S
Sbjct  579   NFSDSNVKPVAGNITSPLHSLLGSVTQDETSNHLNMPRSSNLLSSNGWPTKRVALDPLIS  638

Query  2443  SRATPYVVSQADMISP-NSKVSDLPTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTDSS-  2616
                +  +  Q D + P N+ V+  P  LPPFPG+E    Q  +    N+ L GVN DSS 
Sbjct  639   GGISQAITPQIDQLGPSNTNVTPNPVSLPPFPGRECLIEQEASNDPQNHFLFGVNIDSSP  698

Query  2617  ILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSEN  2796
             +L+QNGI NLK  G ++    + F++ +F S  G DY LNP + +SSC+DESGFL SS+N
Sbjct  699   LLMQNGIPNLKAVGSDSDNATVVFASSSFMSSSGADYSLNPTVTSSSCLDESGFLLSSDN  758

Query  2797  VDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLV  2976
             V   NPPNRTFVKV+KSGSFGRSLDISKFSSYHELRSELA+MFGLEG LEDP RSGWQLV
Sbjct  759   VGHVNPPNRTFVKVYKSGSFGRSLDISKFSSYHELRSELAQMFGLEGQLEDPLRSGWQLV  818

Query  2977  FVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGG  3156
             FVDRENDVLLLGDDPW EFVN+VW IKILSP EV +MGK  G++L N++P     LPNG 
Sbjct  819   FVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQEMGK-RGLELLNSVPIQKLPLPNG-  876

Query  3157  SSCEVHVSQKETRNMN-GIP-LGSLDY  3231
              +C+   +++E RNM+ GIP +G+LD+
Sbjct  877   -TCDGFANRQEARNMSAGIPSVGTLDF  902



>gb|KCW75879.1| hypothetical protein EUGRSUZ_D00264 [Eucalyptus grandis]
Length=829

 Score =   781 bits (2018),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/448 (86%), Positives = 411/448 (92%), Gaps = 6/448 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG +PQA+EG  EK+ LNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSAGFSPQAQEG--EKRVLNSELWHACAGPLVSLPAIGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             +E+DA IP+YP LP QL+CQLHNVTMHAD ETDEVYAQMTLQPLS QEQK+   LPAELG
Sbjct  59    QEVDAQIPNYPSLPPQLVCQLHNVTMHADIETDEVYAQMTLQPLSPQEQKE-AYLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYS QPPAQELIA+DLH NEW
Sbjct  118   SPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSLQPPAQELIARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLG+RRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGVRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLS DSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVI LAKY KAVYHTRVSVGMR
Sbjct  238   SVLSCDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVISLAKYIKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGI DLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGICDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRLKRPWP GLPS+ GL + DM I+SP  WLR   GD+G+QSLNFQG
Sbjct  358   PLTTFPMYPSPFPLRLKRPWPPGLPSY-GLRDDDMGIASPSMWLRD--GDRGMQSLNFQG  414

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
              G+TP++QPRLDASMLGLQPD+YQ MA 
Sbjct  415   MGLTPWLQPRLDASMLGLQPDMYQAMAA  442


 Score =   232 bits (591),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 141/275 (51%), Positives = 179/275 (65%), Gaps = 8/275 (3%)
 Frame = +1

Query  2215  TTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMHETNP  2394
              +QS  +  Q + S   Q SFSD  GN V +   S  Q+L  SF+ D ++  LN+  TN 
Sbjct  557   ASQSHTASLQTMPSLCQQLSFSDSTGNPVTSPVVSPLQTLLGSFTQDGSTHHLNLPRTNS  616

Query  2395  LATLPS---KRIALESQVSSRATPYVVSQADMISP-NSKVSDLPTFLPPFPGKEFPEYQG  2562
               +  S   KR A+ES V S  +  V+ Q D + P  + +S     LPPFPG+E  + Q 
Sbjct  617   SVSPSSWPSKRAAIESLVPSGPSQRVLPQMDQLGPPQNNLSPSSVSLPPFPGRECLD-QE  675

Query  2563  VAYSQGNNALLGVNTD-SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNP  2739
             V   Q ++ L GVN + SS+L+QNGIS+L+  G E+   +MPF + N+ S  G D+  NP
Sbjct  676   VTDVQ-SHLLFGVNLEPSSLLMQNGISSLRAVGSESDSTSMPFPS-NYISNSGADFAPNP  733

Query  2740  DMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELAR  2919
              +     +D+SGFLQS EN++Q N P RTFVKV+KSGSFGRSLDI+KFSSY+ELRSELAR
Sbjct  734   SVAPPGGIDDSGFLQSPENLNQVNVPTRTFVKVYKSGSFGRSLDITKFSSYNELRSELAR  793

Query  2920  MFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPW  3024
             MF LEG LEDP RSGWQLVFVDREND LLLGD PW
Sbjct  794   MFSLEGQLEDPVRSGWQLVFVDRENDSLLLGDGPW  828



>ref|XP_008439586.1| PREDICTED: LOW QUALITY PROTEIN: auxin response factor 6 [Cucumis 
melo]
Length=915

 Score =   784 bits (2024),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/447 (86%), Positives = 410/447 (92%), Gaps = 3/447 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG +PQA EG  E++ LNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV  STN
Sbjct  1     MRLSTAGFSPQAPEG--ERRVLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAISTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             +E+DAHIPSYP LP QLICQLHNVTMHAD ETDEVYAQMTLQPL+AQEQK+   LPAELG
Sbjct  59    REVDAHIPSYPSLPPQLICQLHNVTMHADIETDEVYAQMTLQPLTAQEQKE-PYLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NEW
Sbjct  118   APSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+VIFIWNE NQLLLGIRRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVIFIWNEKNQLLLGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+F+IPLAKY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFIIPLAKYVKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLD  RWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDSTRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRLKRPWP+G PSF GL   D+ ++S L WLRG+  D+GIQ LNF G
Sbjct  358   PLTTFPMYPSPFPLRLKRPWPTGFPSFHGLKEDDLGLNSQLMWLRGDGLDRGIQPLNFPG  417

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMA  1908
              G+ P+MQPRLDASM+GLQP+IYQ MA
Sbjct  418   IGVAPWMQPRLDASMVGLQPEIYQAMA  444


 Score =   299 bits (766),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 187/360 (52%), Positives = 246/360 (68%), Gaps = 22/360 (6%)
 Frame = +1

Query  2185  PITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSL-PRSFSHDEA  2361
             PI+++ + +S +QS     Q +     QQSFSD   NHV +   S   SL   SFS DE+
Sbjct  567   PISTMSQFSSASQS----LQTIPPLCRQQSFSDSNPNHVTSPIISPLHSLLSGSFSQDES  622

Query  2362  SQLLNMHETNPL---ATLPSKRIALESQVSSRATPYVVSQADMISPN-SKVSDLPTFLPP  2529
             SQ+LN+  TNP+   +T PSKR A++  ++S  + +V+ Q + I    + +S     LPP
Sbjct  623   SQILNLPRTNPMIHSSTWPSKRAAIDPLLTSGNSQFVLPQGENIGTTPANISQNAISLPP  682

Query  2530  FPGKEFPEYQGVAYSQGNNALLGVNTD-SSILLQNGISNLKNSGGENGFLNMPFSTCNFT  2706
             FPG+E    QG    Q +N L GVN + SS+L+QNG+ NL+    ++    +PFS+ N+ 
Sbjct  683   FPGRECSLDQGNVDPQ-SNLLFGVNIEPSSLLMQNGMPNLRGICSDSDSTAIPFSS-NYV  740

Query  2707  SGVGTDYPLNPD-MGT-SSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISK  2880
             +  G ++  NP   GT S+C+++SGFLQS EN  Q NPP RTFVKV+KSGSFGRSLDISK
Sbjct  741   NTAGANFSANPTGTGTPSNCIEDSGFLQSPENTGQVNPPTRTFVKVYKSGSFGRSLDISK  800

Query  2881  FSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKI  3060
             FSSYH+LRSELA MFGLEG LEDP RSGWQLVFVDRENDVLLLGDDPW EFVN+VW IKI
Sbjct  801   FSSYHQLRSELAHMFGLEGKLEDPLRSGWQLVFVDRENDVLLLGDDPWPEFVNSVWCIKI  860

Query  3061  LSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKE-TRNM-NGI-PLGSLDY  3231
             LSP EV  MGK  G++L N++P   QRL NG  SC+ + +++E +RN+ +GI  +GSL+Y
Sbjct  861   LSPQEVEDMGK-RGLELLNSVPI--QRLSNG--SCDNYANRQESSRNLSSGITSVGSLEY  915



>emb|CDP05666.1| unnamed protein product [Coffea canephora]
Length=906

 Score =   783 bits (2023),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/448 (84%), Positives = 410/448 (92%), Gaps = 2/448 (0%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG   Q  EG  E++CLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSPAGFTQQPPEG--ERRCLNSELWHACAGPLVSLPAIGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQK+   LPA+LG
Sbjct  59    KEVDAHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLSPQEQKEASYLPADLG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NEW
Sbjct  119   SPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  239   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNS+WRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  299   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSYWRSVKVGWDESTAGERQPRVSLWEIE  358

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRLKRPWP GLPSF G+ + +M I+SPL W RG++G++ +  LN+QG
Sbjct  359   PLTTFPMYPSPFPLRLKRPWPLGLPSFNGMKDDEMGINSPLMWFRGDVGERALHCLNYQG  418

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
              G+ P+MQPR+DA +LG+Q D+YQ MA 
Sbjct  419   IGVAPWMQPRVDAPILGMQTDLYQAMAA  446


 Score =   311 bits (797),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 190/364 (52%), Positives = 237/364 (65%), Gaps = 23/364 (6%)
 Frame = +1

Query  2176  MSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHD  2355
             +S   T LP++ S++Q Q    QA+S  + QQSFSD  GN V +S  S  QSL  S   D
Sbjct  554   VSSVATVLPQLTSSSQVQSHSIQAIS-PMHQQSFSDSNGNSVTSSILSPLQSLLGSVPQD  612

Query  2356  EASQLLNMHETNPLATL---PSKRIALESQVSSRATPYVVSQA------DMISPNSKVSD  2508
             EAS LL++  ++ L +    P KR+A++  +     P  VSQ       +M  PN+ +S 
Sbjct  613   EASHLLSVPRSSSLLSPSGWPPKRVAIDPIL-----PLGVSQCISPLMEEMGPPNNSISQ  667

Query  2509  LPTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMP  2685
                 LPPFPG+E    Q       N+ L GVN DSS +L+QNG+SNL+    + G   +P
Sbjct  668   NSVSLPPFPGRECSIDQEGTNDPQNSLLFGVNIDSSSLLIQNGMSNLRGVVSDGGCTTIP  727

Query  2686  FSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRS  2865
             F + N+    GT +  NP+M  SSC+ ESGFL+S +N+ Q NP  RTFVKV+KSGSFGRS
Sbjct  728   FPSSNYAGTTGTKFQQNPEMTPSSCIQESGFLRSPDNIGQGNPATRTFVKVYKSGSFGRS  787

Query  2866  LDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNV  3045
             LDISKFSSYHELR ELAR+FGLEGLLEDP RSGWQLVFVDRENDVLLLGDDPW EFVN+V
Sbjct  788   LDISKFSSYHELRIELARLFGLEGLLEDPLRSGWQLVFVDRENDVLLLGDDPWPEFVNSV  847

Query  3046  WYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRN--MNGIPLG  3219
             W IKILSP EV  MGK  G++L N+ P  N RLPNG  SC+ + S +E RN       +G
Sbjct  848   WCIKILSPQEVQHMGK-RGLELLNSAP--NSRLPNG--SCDDYASLQEPRNAITRMTSVG  902

Query  3220  SLDY  3231
             SL+Y
Sbjct  903   SLNY  906



>ref|XP_004166469.1| PREDICTED: auxin response factor 6-like [Cucumis sativus]
 gb|KGN49430.1| hypothetical protein Csa_6G524670 [Cucumis sativus]
Length=916

 Score =   783 bits (2021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/448 (86%), Positives = 410/448 (92%), Gaps = 3/448 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG +PQA EG  E++ LNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV  STN
Sbjct  1     MRLSTAGFSPQAPEG--ERRVLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAISTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             +E+DAHIPSYP LP QLICQLHNVTMHAD ETDEVYAQMTLQPL+AQEQK+   LPAELG
Sbjct  59    REVDAHIPSYPSLPPQLICQLHNVTMHADIETDEVYAQMTLQPLTAQEQKE-PYLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NEW
Sbjct  118   APSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+VIFIWNE NQLLLGIRRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVIFIWNEKNQLLLGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+F+IPLAKY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFIIPLAKYVKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLD  RWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDSTRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRLKRPWP+G PSF GL   D+ ++S L WLRG+  D+GIQ LNF G
Sbjct  358   PLTTFPMYPSPFPLRLKRPWPTGFPSFHGLKEDDLGLNSQLMWLRGDGLDRGIQPLNFPG  417

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
              G+ P+MQPRLDASM+GLQP+IYQ MA 
Sbjct  418   IGVAPWMQPRLDASMVGLQPEIYQAMAA  445


 Score =   298 bits (764),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 186/333 (56%), Positives = 234/333 (70%), Gaps = 18/333 (5%)
 Frame = +1

Query  2266  QQSFSDLVGNHVMTSNNSSTQSL-PRSFSHDEASQLLNMHETNPL---ATLPSKRIALES  2433
             QQSFSD   NHV +   S   SL   SFS DE+SQ+LN+  TNP+   +T PSKR A++ 
Sbjct  591   QQSFSDSNPNHVTSPIISPLHSLLGGSFSQDESSQMLNLPRTNPMIHSSTWPSKRAAIDP  650

Query  2434  QVSSRATPYVVSQADMISPN-SKVSDLPTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTD  2610
              +SS  + +V+SQ + I    + +S     LPPFPG+E    QG    Q +N L GVN +
Sbjct  651   LLSSGNSQFVLSQGENIGTTPANISQNAFSLPPFPGRECSLDQGNVDPQ-SNLLFGVNIE  709

Query  2611  -SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPD-MGT-SSCVDESGFL  2781
              SS+L+QNG+ NL+    ++    +PFS+ N+ +  GT++  NP   GT S+C ++SGFL
Sbjct  710   PSSLLMQNGMPNLRGICSDSDSTAIPFSS-NYVNTAGTNFSANPTGTGTPSNCNEDSGFL  768

Query  2782  QSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERS  2961
             QS EN  Q NPP RTFVKV+KSGSFGRSLDISKFSSYH+LRSELA MFGLEG LEDP RS
Sbjct  769   QSPENTGQVNPPTRTFVKVYKSGSFGRSLDISKFSSYHQLRSELAHMFGLEGELEDPLRS  828

Query  2962  GWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQR  3141
             GWQLVFVDRENDVLLLGDDPW EFVN+VW IKILSP EV  MGK  G++L N++P   QR
Sbjct  829   GWQLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQDMGK-RGLELLNSVPI--QR  885

Query  3142  LPNGGSSCEVHVSQKE-TRNMN-GI-PLGSLDY  3231
             L NG  SC+ + +++E +RNMN GI  +GSL+Y
Sbjct  886   LSNG--SCDNYANRQESSRNMNSGITSVGSLEY  916



>dbj|BAD19063.1| auxin response factor 3 [Cucumis sativus]
Length=916

 Score =   782 bits (2020),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/447 (86%), Positives = 410/447 (92%), Gaps = 3/447 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG +PQA EG  E++ LNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV  STN
Sbjct  1     MRLSTAGFSPQAPEG--ERRVLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAISTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             +E+DAHIPSYP LP QLICQLHNVTMHAD ETDEVYAQMTLQPL+AQEQK+   LPAELG
Sbjct  59    REVDAHIPSYPSLPPQLICQLHNVTMHADIETDEVYAQMTLQPLTAQEQKE-PYLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NEW
Sbjct  118   APSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+VIFIWNE NQLLLGIRRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVIFIWNEKNQLLLGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+F+IPLAKY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFIIPLAKYVKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLD  RWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDSTRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRLKRPWP+G PSF GL   D+ ++S L WLRG+  D+GIQ LNF G
Sbjct  358   PLTTFPMYPSPFPLRLKRPWPTGFPSFHGLKEDDLGLNSQLMWLRGDGLDRGIQPLNFPG  417

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMA  1908
              G+ P+MQPRLDASM+GLQP+IYQ MA
Sbjct  418   IGVAPWMQPRLDASMVGLQPEIYQAMA  444


 Score =   290 bits (743),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 182/333 (55%), Positives = 230/333 (69%), Gaps = 18/333 (5%)
 Frame = +1

Query  2266  QQSFSDLVGNHVMTSNNSSTQSL-PRSFSHDEASQLLNMHETNPL---ATLPSKRIALES  2433
             QQSFSD   NHV +   S   SL   SFS DE+SQ+LN+   NP+   +T PSKR A++ 
Sbjct  591   QQSFSDSNPNHVTSPIISPLHSLLGGSFSQDESSQMLNLPRNNPMIHSSTWPSKRAAIDP  650

Query  2434  QVSSRATPYVVSQADMISPN-SKVSDLPTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTD  2610
              +SS  + +V+SQ + I    + +S     LPPFPG+E    QG    Q +N L GVN +
Sbjct  651   LLSSGNSQFVLSQGENIGTTPANISQNAFTLPPFPGRECSLDQGNVDPQ-SNLLFGVNIE  709

Query  2611  -SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPD-MGT-SSCVDESGFL  2781
              SS+L+QNG+ NL+    ++    +PFS+ N+ +  GT++  NP   GT S+C ++SGFL
Sbjct  710   PSSLLMQNGMPNLRGICSDSDSTAIPFSS-NYVNTAGTNFSANPTGTGTPSNCNEDSGFL  768

Query  2782  QSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERS  2961
              S EN  Q NPP  TFVKV+KSGSFGRSLDISKFS YH+LRSELA MFGLEG LEDP RS
Sbjct  769   HSPENTGQVNPPTTTFVKVYKSGSFGRSLDISKFSRYHQLRSELAHMFGLEGELEDPLRS  828

Query  2962  GWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQR  3141
             GWQLVFVDRENDVLLLGDDPW EFVN+VW IKILSP EV  MGK  G++L N++P   QR
Sbjct  829   GWQLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQDMGK-RGLELLNSVPI--QR  885

Query  3142  LPNGGSSCEVHVSQKE-TRNMN-GI-PLGSLDY  3231
             L NG  SC+ + +++E +RNMN GI  +GSL+Y
Sbjct  886   LSNG--SCDNYANRQESSRNMNSGITSVGSLEY  916



>ref|XP_010275037.1| PREDICTED: auxin response factor 6 [Nelumbo nucifera]
Length=958

 Score =   784 bits (2024),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/447 (87%), Positives = 411/447 (92%), Gaps = 3/447 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S +G   QA+EG  EK+ LNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSSGFIHQAQEG--EKRVLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS +EQK+   LP ELG
Sbjct  59    KEVDAHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLSPEEQKE-PYLPTELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NEW
Sbjct  118   TPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVI LAKY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVITLAKYVKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRLKRPWP GLPS  G+ + D+ I+S L  LRG+ GD+GIQSLNFQG
Sbjct  358   PLTTFPMYPSPFPLRLKRPWPPGLPSLHGMKDDDLGINSQLMCLRGDGGDRGIQSLNFQG  417

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMA  1908
              G+TP+MQPRLDASMLGLQ D+YQ MA
Sbjct  418   IGVTPWMQPRLDASMLGLQTDMYQAMA  444


 Score =   346 bits (888),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 202/347 (58%), Positives = 242/347 (70%), Gaps = 12/347 (3%)
 Frame = +1

Query  2212  STTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMHETN  2391
             S +QSQ    QA+SS   Q SF+D  GN V TS+ S   SL  SF  DE SQLLN+  T 
Sbjct  617   SQSQSQPPSLQAISSLCEQPSFADSNGNPVTTSSVSPLHSLLGSFPQDETSQLLNLPRTT  676

Query  2392  ---PLATLPSKRIALESQVSSRATPYVVSQAD-MISPNSKVSDLPTFLPPFPGKEFPEYQ  2559
                P  T   KR A+E  + S AT  V+ Q + M  P + VS     LPPFPG+E    Q
Sbjct  677   SLIPSTTWLPKRAAVEPLLPSGATQCVLPQVEQMPQPQTNVSQNSISLPPFPGRECSVDQ  736

Query  2560  GVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLN  2736
               +    ++ L GVN DSS +L+QNG+S L   G ++    MPF+  NF S  GTD+PLN
Sbjct  737   EGSSDPQSHLLFGVNIDSSSLLMQNGMSGLGGVGSDSDSTTMPFAASNFISSTGTDFPLN  796

Query  2737  PDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELA  2916
             P + TSSC+DESGFLQS ENV Q NPP RTFVKVHKSGSFGRSLDI++FSSYHELRSELA
Sbjct  797   PAVTTSSCLDESGFLQSPENVGQVNPPTRTFVKVHKSGSFGRSLDITRFSSYHELRSELA  856

Query  2917  RMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKE  3096
             R+FGLEG LEDP RSGWQLVFVDRENDVLLLGDDPWQEFVNNVW IKILSP EV QMGK 
Sbjct  857   RLFGLEGQLEDPLRSGWQLVFVDRENDVLLLGDDPWQEFVNNVWCIKILSPQEVQQMGK-  915

Query  3097  EGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNM-NGI-PLGSLDY  3231
             +GI+L N++P   QRL    +SC+ +VS++++RN+ +GI  +G LDY
Sbjct  916   QGIELLNSVPI--QRL--SSNSCDDYVSRQDSRNLSSGITSVGLLDY  958



>ref|XP_010052021.1| PREDICTED: auxin response factor 6 [Eucalyptus grandis]
 gb|KCW75878.1| hypothetical protein EUGRSUZ_D00264 [Eucalyptus grandis]
Length=897

 Score =   781 bits (2018),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/448 (86%), Positives = 411/448 (92%), Gaps = 6/448 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG +PQA+EG  EK+ LNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSAGFSPQAQEG--EKRVLNSELWHACAGPLVSLPAIGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             +E+DA IP+YP LP QL+CQLHNVTMHAD ETDEVYAQMTLQPLS QEQK+   LPAELG
Sbjct  59    QEVDAQIPNYPSLPPQLVCQLHNVTMHADIETDEVYAQMTLQPLSPQEQKE-AYLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYS QPPAQELIA+DLH NEW
Sbjct  118   SPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSLQPPAQELIARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLG+RRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGVRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLS DSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVI LAKY KAVYHTRVSVGMR
Sbjct  238   SVLSCDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVISLAKYIKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGI DLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGICDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRLKRPWP GLPS+ GL + DM I+SP  WLR   GD+G+QSLNFQG
Sbjct  358   PLTTFPMYPSPFPLRLKRPWPPGLPSY-GLRDDDMGIASPSMWLRD--GDRGMQSLNFQG  414

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
              G+TP++QPRLDASMLGLQPD+YQ MA 
Sbjct  415   MGLTPWLQPRLDASMLGLQPDMYQAMAA  442


 Score =   289 bits (740),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 178/346 (51%), Positives = 231/346 (67%), Gaps = 15/346 (4%)
 Frame = +1

Query  2215  TTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMHETNP  2394
              +QS  +  Q + S   Q SFSD  GN V +   S  Q+L  SF+ D ++  LN+  TN 
Sbjct  557   ASQSHTASLQTMPSLCQQLSFSDSTGNPVTSPVVSPLQTLLGSFTQDGSTHHLNLPRTNS  616

Query  2395  LATLPS---KRIALESQVSSRATPYVVSQADMISP-NSKVSDLPTFLPPFPGKEFPEYQG  2562
               +  S   KR A+ES V S  +  V+ Q D + P  + +S     LPPFPG+E  + Q 
Sbjct  617   SVSPSSWPSKRAAIESLVPSGPSQRVLPQMDQLGPPQNNLSPSSVSLPPFPGRECLD-QE  675

Query  2563  VAYSQGNNALLGVNTD-SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNP  2739
             V   Q ++ L GVN + SS+L+QNGIS+L+  G E+   +MPF + N+ S  G D+  NP
Sbjct  676   VTDVQ-SHLLFGVNLEPSSLLMQNGISSLRAVGSESDSTSMPFPS-NYISNSGADFAPNP  733

Query  2740  DMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELAR  2919
              +     +D+SGFLQS EN++Q N P RTFVKV+KSGSFGRSLDI+KFSSY+ELRSELAR
Sbjct  734   SVAPPGGIDDSGFLQSPENLNQVNVPTRTFVKVYKSGSFGRSLDITKFSSYNELRSELAR  793

Query  2920  MFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEE  3099
             MF LEG LEDP RSGWQLVFVDREND LLLGD PW EFVN+VW IKILSP EV QMGK++
Sbjct  794   MFSLEGQLEDPVRSGWQLVFVDRENDSLLLGDGPWPEFVNSVWCIKILSPQEVQQMGKQD  853

Query  3100  GIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMN-GIP-LGSLDY  3231
              ++L N++P   QR  NGG  C+   +++++R +N GIP +GSLDY
Sbjct  854   -LELLNSIPV--QRHSNGG--CDEFTNRQDSRTINSGIPSVGSLDY  894



>ref|XP_010908739.1| PREDICTED: auxin response factor 17-like isoform X3 [Elaeis guineensis]
Length=821

 Score =   778 bits (2008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/447 (86%), Positives = 411/447 (92%), Gaps = 4/447 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR S +G+  Q +E   E++CLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRPSSSGLANQPQEE--EQRCLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KEID HIP+YP L +QLICQLH+VTMHAD ETDEVYAQMTLQPLS QEQK+    P ELG
Sbjct  59    KEIDTHIPNYPSLQSQLICQLHDVTMHADAETDEVYAQMTLQPLSLQEQKEP-YHPTELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLHGNEW
Sbjct  118   TPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHGNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNENNQLLLGIRRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNENNQLLLGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRLKRPWP+GLPS  G  + D+ +SSPL WLR + G+ GIQSLNFQG
Sbjct  358   PLTTFPMYPSPFPLRLKRPWPTGLPSLHGGKDDDLDLSSPLRWLR-DGGNPGIQSLNFQG  416

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMA  1908
              G+TP++ PR+DASMLGLQ D+YQ+MA
Sbjct  417   VGVTPWLHPRIDASMLGLQSDMYQSMA  443


 Score =   130 bits (327),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 93/222 (42%), Positives = 126/222 (57%), Gaps = 11/222 (5%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQ  2367
             +++L + +S + SQ S  Q +S     Q+ +D  GN V TS+     ++ + FS D+A  
Sbjct  566   VSALSQFSSASHSQ-SPLQKISLFSQPQNLADSNGNSVSTSSAFPLHNILQPFSPDDAP-  623

Query  2368  LLNMHETNPLAT---LPSKRIALESQVSSRATPYV--VSQADMISPNSKVSDLPTFLPPF  2532
              L++  T PL T    PSKR+ALES + S A   V  V Q     PN+    +   L PF
Sbjct  624   -LSLPRTTPLITSSPWPSKRVALESILPSGAQFVVPHVEQLGATQPNASPHSV--TLAPF  680

Query  2533  PGKEFPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTS  2709
             PG+E    Q  +    NN L GVN DSS +L+QNG+SNL+N   E     MP++ C F S
Sbjct  681   PGRECSVDQDGSMDSQNNLLFGVNIDSSSLLVQNGMSNLRNVVNETDSAAMPYAACKFLS  740

Query  2710  GVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVK  2835
               GTD+PLN  + TSSC+D+SGFL S ENVD  N  + TFVK
Sbjct  741   SSGTDFPLNQALTTSSCLDKSGFLHSVENVDHMNHQSGTFVK  782



>ref|XP_011026193.1| PREDICTED: auxin response factor 6-like isoform X2 [Populus euphratica]
Length=930

 Score =   780 bits (2015),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/442 (85%), Positives = 402/442 (91%), Gaps = 2/442 (0%)
 Frame = +1

Query  586   GVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAH  765
             G N   +EG  + KCLNSELWHACAGPLVSLP +GSR VYFPQGHSEQV ASTNKE+DAH
Sbjct  12    GFNQVTQEG--DNKCLNSELWHACAGPLVSLPHVGSRAVYFPQGHSEQVAASTNKEVDAH  69

Query  766   IPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQP  945
             IP+YP LPAQLICQLHNVTMHAD ETDEVYAQMTLQPLS ++QKD  LLPAELG  SKQP
Sbjct  70    IPNYPSLPAQLICQLHNVTMHADVETDEVYAQMTLQPLSPEDQKDAYLLPAELGTASKQP  129

Query  946   TNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVF  1125
             +NYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQ PPAQELIA+DLH NEWKFRH+F
Sbjct  130   SNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQTPPAQELIARDLHDNEWKFRHIF  189

Query  1126  RGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSD  1305
             RGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPSSVLSSD
Sbjct  190   RGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPSSVLSSD  249

Query  1306  SMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFE  1485
             SMHIGLLAAAAHAAATNSRFTIFYNPR SPS+FVIPL KY KAVYHTRVSVGMRFRMLFE
Sbjct  250   SMHIGLLAAAAHAAATNSRFTIFYNPRTSPSEFVIPLVKYVKAVYHTRVSVGMRFRMLFE  309

Query  1486  TEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFP  1665
             TEESSVRRYMGTITGISDLDP RWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFP
Sbjct  310   TEESSVRRYMGTITGISDLDPARWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFP  369

Query  1666  MYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPF  1845
             MYPS F +RLKRPWPSGLPSF GL + D+ I+SP+ WL+G +GD G+ SLNFQ +G+ P+
Sbjct  370   MYPSAFPMRLKRPWPSGLPSFHGLKDEDLSINSPVMWLQGGVGDPGVHSLNFQNFGVAPW  429

Query  1846  MQPRLDASMLGLQPDIYQTMAT  1911
             +QPR +ASM  LQPD+YQTMA 
Sbjct  430   IQPRFEASMPALQPDVYQTMAA  451


 Score =   335 bits (858),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 201/369 (54%), Positives = 243/369 (66%), Gaps = 30/369 (8%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQ  2367
             I++LP + S   S     Q + S   QQ+FS+ +GN +  S  SS  S+  S   D    
Sbjct  566   ISALPHLISVAPSHSPSLQVIPSQCQQQAFSEPLGNPIAASVVSSVPSIMGSLPQDRG-H  624

Query  2368  LLNMHETNPL--ATLPSKRIALESQVSSRATPYVVSQADMI-SPNSKVSDLPTFLPPFPG  2538
             LLN + +NP+  +TL SK+ A   Q+SS A P V+ Q +   +  S VSDL T L PF G
Sbjct  625   LLNSNGSNPVRSSTLLSKQAAFGPQLSSGAAPGVLPQVEQSGTTQSAVSDLATLLAPFSG  684

Query  2539  KEFPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSGV  2715
             +E+  YQG      NN L GVN DSS  +LQ+GI NL+N G EN  L+MPF+   FTS  
Sbjct  685   REYSTYQG---DPQNNLLFGVNIDSSTFMLQHGIPNLRNIGTENDPLSMPFTASTFTSAP  741

Query  2716  GTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYH  2895
             G D PL  DM  SSC+DESGFLQSSENVDQ NP  RTFVKVHKSGS+GRSLDISKFSSY 
Sbjct  742   GGDIPLTSDMTASSCIDESGFLQSSENVDQVNPSTRTFVKVHKSGSYGRSLDISKFSSYD  801

Query  2896  ELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFE  3075
             ELRSELAR+F LEG LEDP+RS WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSP E
Sbjct  802   ELRSELARLFCLEGQLEDPQRSVWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPLE  861

Query  3076  VHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRN----------------MNG  3207
             V QMGK EG+    ++P+  Q+L N  SS + ++++++ RN                 NG
Sbjct  862   VQQMGK-EGLTSAASVPS--QKLSN--SSSDGYMNRQDFRNSSNPDGYLNRQDFRNSSNG  916

Query  3208  IP-LGSLDY  3231
             I  +GSLDY
Sbjct  917   IASIGSLDY  925



>ref|XP_007048897.1| Auxin response factor 6 isoform 1 [Theobroma cacao]
 gb|EOX93054.1| Auxin response factor 6 isoform 1 [Theobroma cacao]
Length=1006

 Score =   783 bits (2022),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/487 (80%), Positives = 414/487 (85%), Gaps = 41/487 (8%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S +G N Q +EG  EKKCLNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSSGFNQQTQEG--EKKCLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP LP QL+CQLHNVTMHAD ETDEVYAQMTLQPLS QEQKDV LLPAELG
Sbjct  59    KEVDAHIPNYPSLPPQLLCQLHNVTMHADVETDEVYAQMTLQPLSPQEQKDVYLLPAELG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NEW
Sbjct  119   NPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA+RPQTVMPS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRASRPQTVMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  239   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  299   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  358

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSF---------------------------------  1728
             PLTTFPMYPS F LRLKRPWPS LPSF                                 
Sbjct  359   PLTTFPMYPSAFPLRLKRPWPSALPSFHGMLESSLRMVEITHISSRLHLKLGVFLIYTES  418

Query  1729  -----PGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPFMQPRLDASML-GLQPD  1890
                  P   +GDM I+S L WL+G +GDQGIQSLNFQG+G+ P++QPR D S L G+QP 
Sbjct  419   IYFALPAFKDGDMSINSQLMWLQGGVGDQGIQSLNFQGFGVAPWIQPRHDTSSLPGVQPY  478

Query  1891  IYQTMAT  1911
             +YQ M  
Sbjct  479   LYQAMGA  485


 Score =   322 bits (825),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 191/391 (49%), Positives = 246/391 (63%), Gaps = 66/391 (17%)
 Frame = +1

Query  2245  ALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMHETNPL---ATLPSK  2415
              ++S   QQ+F D +GN + TS+ SS QS+  S S + AS LLN++ +NP+   +TL SK
Sbjct  620   VVASQCQQQTFPDSIGNSIATSDVSSMQSILGSLSQNGASHLLNLNGSNPVISSSTLLSK  679

Query  2416  RIALESQVSSRATPYVVSQADMI-SPNSKVSDLPTFLPPFPGKEFPEYQGVAYSQGNNAL  2592
              +A+E Q+SS A   V+ Q + + +  S VS+L   LPPFPG+E+  Y G    Q NN L
Sbjct  680   PVAVEPQLSSGAANCVLPQVEQLGTARSNVSELSNLLPPFPGREYSAYHGSTDPQ-NNLL  738

Query  2593  LGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDE  2769
              GV+ DSS ++LQ+G++NLKN G EN  L++P++  NFTS  GTD+PLN DM TSSCVDE
Sbjct  739   FGVSIDSSSLMLQHGMTNLKNIGNENDSLSLPYAASNFTSASGTDFPLNSDMTTSSCVDE  798

Query  2770  SGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLED  2949
             SG+LQSSENVDQ NP   TF+KVHKSGSFGRSLDISKFSSY ELR ELARMFGLEG LED
Sbjct  799   SGYLQSSENVDQVNPTTGTFLKVHKSGSFGRSLDISKFSSYDELRCELARMFGLEGQLED  858

Query  2950  PERSGWQLVFVDRENDVLLLGDDPWQE---------------------------------  3030
             P+RSGWQLVFVDREND+LLLGDDPW                                   
Sbjct  859   PQRSGWQLVFVDRENDILLLGDDPWHADSPYILVLKICAYQATALLALRNLDFQFLYDAD  918

Query  3031  ---------------FVNNVW-------YIKILSPFEVHQMGKEEGIDLPNNLPAANQRL  3144
                            F  + W       YIKILSP EV QMGK EG+    ++P+  QRL
Sbjct  919   HIYRSSKFFLFPFNYFPGSTWEFVNNVWYIKILSPHEVQQMGK-EGLTPATSVPS--QRL  975

Query  3145  PNGGSSCEVHVSQKETRNM-NGIP-LGSLDY  3231
              +  + C+ ++S+++ R+  NG+  +GSL+Y
Sbjct  976   THSSNHCDDYMSRQDLRSSGNGLASMGSLEY  1006



>ref|XP_011096637.1| PREDICTED: auxin response factor 6 isoform X3 [Sesamum indicum]
Length=901

 Score =   778 bits (2010),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/448 (85%), Positives = 411/448 (92%), Gaps = 4/448 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S AG+N Q+ E  G+K CLNSELWHACAGPLVSLP +GS VVYFPQGHSEQV ASTN
Sbjct  1     MKLSSAGLNQQSPEA-GDKDCLNSELWHACAGPLVSLPSIGSHVVYFPQGHSEQVAASTN  59

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DA IP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQK+V  LPA+LG
Sbjct  60    KEVDAQIPNYPSLPPQLICQLHNVTMHADIETDEVYAQMTLQPLSPQEQKEVSFLPADLG  119

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NEW
Sbjct  120   APSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHNNEW  179

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPS
Sbjct  180   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPS  239

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNP  SPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  240   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNP--SPSEFVIPLAKYVKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF+LRLKRPWP GLPSF G+   DM ++SPL WLRG++ D+G+QSLN QG
Sbjct  358   PLTTFPMYPSPFALRLKRPWPPGLPSFTGIKTTDMGLNSPLMWLRGDVVDRGMQSLN-QG  416

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
              G TP+MQP LD+S+LG+Q DIYQ MA 
Sbjct  417   MGATPWMQPGLDSSVLGMQNDIYQAMAA  444


 Score =   306 bits (784),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 178/327 (54%), Positives = 225/327 (69%), Gaps = 10/327 (3%)
 Frame = +1

Query  2272  SFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMHETNPLAT---LPSKRIALESQVS  2442
             +FSD     V  +  S   SL  S + DE S  LNM  ++ L +    P+KR+AL+  +S
Sbjct  578   NFSDSNVKPVAGNITSPLHSLLGSVTQDETSNHLNMPRSSNLLSSNGWPTKRVALDPLIS  637

Query  2443  SRATPYVVSQADMISP-NSKVSDLPTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTDSS-  2616
                +  +  Q D + P N+ V+  P  LPPFPG+E    Q  +    N+ L GVN DSS 
Sbjct  638   GGISQAITPQIDQLGPSNTNVTPNPVSLPPFPGRECLIEQEASNDPQNHFLFGVNIDSSP  697

Query  2617  ILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSEN  2796
             +L+QNGI NLK  G ++    + F++ +F S  G DY LNP + +SSC+DESGFL SS+N
Sbjct  698   LLMQNGIPNLKAVGSDSDNATVVFASSSFMSSSGADYSLNPTVTSSSCLDESGFLLSSDN  757

Query  2797  VDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLV  2976
             V   NPPNRTFVKV+KSGSFGRSLDISKFSSYHELRSELA+MFGLEG LEDP RSGWQLV
Sbjct  758   VGHVNPPNRTFVKVYKSGSFGRSLDISKFSSYHELRSELAQMFGLEGQLEDPLRSGWQLV  817

Query  2977  FVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGG  3156
             FVDRENDVLLLGDDPW EFVN+VW IKILSP EV +MGK  G++L N++P     LPNG 
Sbjct  818   FVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQEMGK-RGLELLNSVPIQKLPLPNG-  875

Query  3157  SSCEVHVSQKETRNMN-GIP-LGSLDY  3231
              +C+   +++E RNM+ GIP +G+LD+
Sbjct  876   -TCDGFANRQEARNMSAGIPSVGTLDF  901



>ref|XP_004134558.1| PREDICTED: auxin response factor 6-like [Cucumis sativus]
Length=902

 Score =   778 bits (2010),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/448 (85%), Positives = 408/448 (91%), Gaps = 1/448 (0%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG +    + +GE++ LNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV  STN
Sbjct  1     MRLSTAGFSELVSKFSGERRVLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAISTN  60

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             +E+DAHIPSYP LP QLICQLHNVTMHAD ETDEVYAQMTLQPL+AQEQK+   LPAELG
Sbjct  61    REVDAHIPSYPSLPPQLICQLHNVTMHADIETDEVYAQMTLQPLTAQEQKE-PYLPAELG  119

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NEW
Sbjct  120   APSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNEW  179

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+VIFIWNE NQLLLGIRRANRPQTVMPS
Sbjct  180   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVIFIWNEKNQLLLGIRRANRPQTVMPS  239

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+F+IPLAKY KAVYHTRVSVGMR
Sbjct  240   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFIIPLAKYVKAVYHTRVSVGMR  299

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLD  RWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  300   FRMLFETEESSVRRYMGTITGISDLDSTRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  359

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRLKRPWP+G PSF GL   D+ ++S L WLRG+  D+GIQ LNF G
Sbjct  360   PLTTFPMYPSPFPLRLKRPWPTGFPSFHGLKEDDLGLNSQLMWLRGDGLDRGIQPLNFPG  419

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
              G+ P+MQPRLDASM+GLQP+IYQ MA 
Sbjct  420   IGVAPWMQPRLDASMVGLQPEIYQAMAA  447


 Score =   298 bits (764),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 186/333 (56%), Positives = 234/333 (70%), Gaps = 18/333 (5%)
 Frame = +1

Query  2266  QQSFSDLVGNHVMTSNNSSTQSL-PRSFSHDEASQLLNMHETNPL---ATLPSKRIALES  2433
             QQSFSD   NHV +   S   SL   SFS DE+SQ+LN+  TNP+   +T PSKR A++ 
Sbjct  577   QQSFSDSNPNHVTSPIISPLHSLLGGSFSQDESSQMLNLPRTNPMIHSSTWPSKRAAIDP  636

Query  2434  QVSSRATPYVVSQADMISPN-SKVSDLPTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTD  2610
              +SS  + +V+SQ + I    + +S     LPPFPG+E    QG    Q +N L GVN +
Sbjct  637   LLSSGNSQFVLSQGENIGTTPANISQNAFSLPPFPGRECSLDQGNVDPQ-SNLLFGVNIE  695

Query  2611  -SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPD-MGT-SSCVDESGFL  2781
              SS+L+QNG+ NL+    ++    +PFS+ N+ +  GT++  NP   GT S+C ++SGFL
Sbjct  696   PSSLLMQNGMPNLRGICSDSDSTAIPFSS-NYVNTAGTNFSANPTGTGTPSNCNEDSGFL  754

Query  2782  QSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERS  2961
             QS EN  Q NPP RTFVKV+KSGSFGRSLDISKFSSYH+LRSELA MFGLEG LEDP RS
Sbjct  755   QSPENTGQVNPPTRTFVKVYKSGSFGRSLDISKFSSYHQLRSELAHMFGLEGELEDPLRS  814

Query  2962  GWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQR  3141
             GWQLVFVDRENDVLLLGDDPW EFVN+VW IKILSP EV  MGK  G++L N++P   QR
Sbjct  815   GWQLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQDMGK-RGLELLNSVPI--QR  871

Query  3142  LPNGGSSCEVHVSQKE-TRNMN-GI-PLGSLDY  3231
             L NG  SC+ + +++E +RNMN GI  +GSL+Y
Sbjct  872   LSNG--SCDNYANRQESSRNMNSGITSVGSLEY  902



>ref|XP_010908738.1| PREDICTED: auxin response factor 17-like isoform X2 [Elaeis guineensis]
Length=884

 Score =   777 bits (2006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/448 (85%), Positives = 411/448 (92%), Gaps = 4/448 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR S +G+  Q +E   E++CLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRPSSSGLANQPQEE--EQRCLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KEID HIP+YP L +QLICQLH+VTMHAD ETDEVYAQMTLQPLS QEQK+    P ELG
Sbjct  59    KEIDTHIPNYPSLQSQLICQLHDVTMHADAETDEVYAQMTLQPLSLQEQKE-PYHPTELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLHGNEW
Sbjct  118   TPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHGNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNENNQLLLGIRRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNENNQLLLGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRLKRPWP+GLPS  G  + D+ +SSPL WLR + G+ GIQSLNFQG
Sbjct  358   PLTTFPMYPSPFPLRLKRPWPTGLPSLHGGKDDDLDLSSPLRWLR-DGGNPGIQSLNFQG  416

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
              G+TP++ PR+DASMLGLQ D+YQ+MA 
Sbjct  417   VGVTPWLHPRIDASMLGLQSDMYQSMAA  444


 Score =   291 bits (745),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 182/356 (51%), Positives = 236/356 (66%), Gaps = 18/356 (5%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQ  2367
             +++L + +S + SQ S  Q +S     Q+ +D  GN V TS+     ++ + FS D+A  
Sbjct  539   VSALSQFSSASHSQ-SPLQKISLFSQPQNLADSNGNSVSTSSAFPLHNILQPFSPDDAP-  596

Query  2368  LLNMHETNPLAT---LPSKRIALESQVSSRATPYV--VSQADMISPNSKVSDLPTFLPPF  2532
              L++  T PL T    PSKR+ALES + S A   V  V Q     PN+  S     L PF
Sbjct  597   -LSLPRTTPLITSSPWPSKRVALESILPSGAQFVVPHVEQLGATQPNA--SPHSVTLAPF  653

Query  2533  PGKEFPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTS  2709
             PG+E    Q  +    NN L GVN DSS +L+QNG+SNL+N   E     MP++ C F S
Sbjct  654   PGRECSVDQDGSMDSQNNLLFGVNIDSSSLLVQNGMSNLRNVVNETDSAAMPYAACKFLS  713

Query  2710  GVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSS  2889
               GTD+PLN  + TSSC+D+SGFL S ENVD  N  + TFVKV+KSGS+GR LDI++FSS
Sbjct  714   SSGTDFPLNQALTTSSCLDKSGFLHSVENVDHMNHQSGTFVKVYKSGSYGRLLDIARFSS  773

Query  2890  YHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSP  3069
             YHELRSEL R+FGLEG LEDP RSGWQLVFVDREND LL+GDDPWQEFVNNV  IKILSP
Sbjct  774   YHELRSELGRLFGLEGRLEDPVRSGWQLVFVDRENDALLVGDDPWQEFVNNVDCIKILSP  833

Query  3070  FEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMN-GI-PLGSLDY  3231
              EV QMGK +G+ L N+ P   +RLP+  +SC+ + S++++ N++ GI  +GSL+Y
Sbjct  834   QEVQQMGK-QGVGLLNSAPI--KRLPS--NSCDGYGSRQDSSNLSTGITSVGSLNY  884



>ref|XP_010908734.1| PREDICTED: auxin response factor 17-like isoform X1 [Elaeis guineensis]
 ref|XP_010908736.1| PREDICTED: auxin response factor 17-like isoform X1 [Elaeis guineensis]
 ref|XP_010908737.1| PREDICTED: auxin response factor 17-like isoform X1 [Elaeis guineensis]
Length=911

 Score =   777 bits (2007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/448 (85%), Positives = 411/448 (92%), Gaps = 4/448 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR S +G+  Q +E   E++CLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRPSSSGLANQPQEE--EQRCLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KEID HIP+YP L +QLICQLH+VTMHAD ETDEVYAQMTLQPLS QEQK+    P ELG
Sbjct  59    KEIDTHIPNYPSLQSQLICQLHDVTMHADAETDEVYAQMTLQPLSLQEQKE-PYHPTELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLHGNEW
Sbjct  118   TPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHGNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNENNQLLLGIRRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNENNQLLLGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRLKRPWP+GLPS  G  + D+ +SSPL WLR + G+ GIQSLNFQG
Sbjct  358   PLTTFPMYPSPFPLRLKRPWPTGLPSLHGGKDDDLDLSSPLRWLR-DGGNPGIQSLNFQG  416

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
              G+TP++ PR+DASMLGLQ D+YQ+MA 
Sbjct  417   VGVTPWLHPRIDASMLGLQSDMYQSMAA  444


 Score =   291 bits (745),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 182/356 (51%), Positives = 236/356 (66%), Gaps = 18/356 (5%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQ  2367
             +++L + +S + SQ S  Q +S     Q+ +D  GN V TS+     ++ + FS D+A  
Sbjct  566   VSALSQFSSASHSQ-SPLQKISLFSQPQNLADSNGNSVSTSSAFPLHNILQPFSPDDAP-  623

Query  2368  LLNMHETNPLAT---LPSKRIALESQVSSRATPYV--VSQADMISPNSKVSDLPTFLPPF  2532
              L++  T PL T    PSKR+ALES + S A   V  V Q     PN+  S     L PF
Sbjct  624   -LSLPRTTPLITSSPWPSKRVALESILPSGAQFVVPHVEQLGATQPNA--SPHSVTLAPF  680

Query  2533  PGKEFPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTS  2709
             PG+E    Q  +    NN L GVN DSS +L+QNG+SNL+N   E     MP++ C F S
Sbjct  681   PGRECSVDQDGSMDSQNNLLFGVNIDSSSLLVQNGMSNLRNVVNETDSAAMPYAACKFLS  740

Query  2710  GVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSS  2889
               GTD+PLN  + TSSC+D+SGFL S ENVD  N  + TFVKV+KSGS+GR LDI++FSS
Sbjct  741   SSGTDFPLNQALTTSSCLDKSGFLHSVENVDHMNHQSGTFVKVYKSGSYGRLLDIARFSS  800

Query  2890  YHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSP  3069
             YHELRSEL R+FGLEG LEDP RSGWQLVFVDREND LL+GDDPWQEFVNNV  IKILSP
Sbjct  801   YHELRSELGRLFGLEGRLEDPVRSGWQLVFVDRENDALLVGDDPWQEFVNNVDCIKILSP  860

Query  3070  FEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMN-GI-PLGSLDY  3231
              EV QMGK +G+ L N+ P   +RLP+  +SC+ + S++++ N++ GI  +GSL+Y
Sbjct  861   QEVQQMGK-QGVGLLNSAPI--KRLPS--NSCDGYGSRQDSSNLSTGITSVGSLNY  911



>ref|XP_002300854.2| hypothetical protein POPTR_0002s05590g [Populus trichocarpa]
 gb|EEE80127.2| hypothetical protein POPTR_0002s05590g [Populus trichocarpa]
Length=936

 Score =   778 bits (2009),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/442 (84%), Positives = 401/442 (91%), Gaps = 2/442 (0%)
 Frame = +1

Query  586   GVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAH  765
             G N   +EG  + KCLNSELWHACAGPLVSLP +GSR VYFPQGHSEQV ASTNKE+DAH
Sbjct  12    GFNQVTQEG--DNKCLNSELWHACAGPLVSLPHVGSRAVYFPQGHSEQVAASTNKEVDAH  69

Query  766   IPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQP  945
             IP+YP LPAQLICQLHNVTMHAD ETDEVYAQMTLQPLS +++KD  LLPAELG  SKQP
Sbjct  70    IPNYPSLPAQLICQLHNVTMHADVETDEVYAQMTLQPLSPEDKKDAYLLPAELGTASKQP  129

Query  946   TNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVF  1125
             +NYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQ PPAQELIA+DLH NEWKFRH+F
Sbjct  130   SNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQTPPAQELIARDLHDNEWKFRHIF  189

Query  1126  RGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSD  1305
             RGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPSSVLSSD
Sbjct  190   RGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPSSVLSSD  249

Query  1306  SMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFE  1485
             SMHIGLLAAAAHAAATNSRFTIFYNPR SPS+FVIPL KY KAVYHTRVSVGMRFRMLFE
Sbjct  250   SMHIGLLAAAAHAAATNSRFTIFYNPRTSPSEFVIPLVKYIKAVYHTRVSVGMRFRMLFE  309

Query  1486  TEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFP  1665
             TEESSVRRYMGTITGISDLDP RWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFP
Sbjct  310   TEESSVRRYMGTITGISDLDPARWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFP  369

Query  1666  MYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPF  1845
             MYPS F +RLKRPWPSGLPSF GL + D+ I+SP+ WL+G +GD G+ SLNFQ +G  P+
Sbjct  370   MYPSAFPMRLKRPWPSGLPSFHGLKDDDLSINSPMMWLQGGVGDLGVHSLNFQNFGAAPW  429

Query  1846  MQPRLDASMLGLQPDIYQTMAT  1911
             +QPR +ASM  LQPD+YQTMA 
Sbjct  430   IQPRFEASMPALQPDVYQTMAA  451


 Score =   343 bits (879),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 203/369 (55%), Positives = 246/369 (67%), Gaps = 28/369 (8%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQ  2367
             I++LP + S   S     QA+ S   QQ+FS+ +GN +  S  SS  S+  S   D    
Sbjct  570   ISALPHLTSVAPSHSPSLQAIPSQCQQQAFSEPLGNLIAASGVSSVPSIMGSLPQDRG-H  628

Query  2368  LLNMHETNPLAT--LPSKRIALESQVSSRATPYVVSQADMI-SPNSKVSDLPTFLPPFPG  2538
             LLN + +NP+++  L SK+ A   Q+SS A P V+ Q +   +  S VSDL T L PF G
Sbjct  629   LLNSNGSNPVSSSALLSKQAAFGPQLSSGAAPGVLPQVEQSGTTQSAVSDLATLLAPFSG  688

Query  2539  KEFPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSGV  2715
             +E+  YQG    Q NN L GVN DSS  +LQ+GI NL+N G EN  L+MPF+   FTS  
Sbjct  689   REYSTYQGANDPQ-NNLLFGVNIDSSTFMLQHGIPNLRNIGTENDPLSMPFTASTFTSAT  747

Query  2716  GTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYH  2895
             G+D PL  DM  SSCVDESGFLQSSENVDQ NP  RTFVKVHKSGS+GRSLDISKFSSY 
Sbjct  748   GSDIPLTSDMTASSCVDESGFLQSSENVDQVNPSTRTFVKVHKSGSYGRSLDISKFSSYD  807

Query  2896  ELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFE  3075
             ELRSELAR+F LEG LED +RSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSP E
Sbjct  808   ELRSELARLFCLEGQLEDRQRSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPLE  867

Query  3076  VHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRN----------------MNG  3207
             V QMGK EG+    ++P+  Q+L N  S+ + +++++E RN                 NG
Sbjct  868   VQQMGK-EGLTSAASVPS--QKLSN--STSDGYMNRQEFRNSSNPDGYLNRQDFRNSSNG  922

Query  3208  IP-LGSLDY  3231
             I  +GSLDY
Sbjct  923   IASMGSLDY  931



>ref|XP_010538262.1| PREDICTED: auxin response factor 6 [Tarenaya hassleriana]
Length=883

 Score =   775 bits (2002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/449 (85%), Positives = 411/449 (92%), Gaps = 10/449 (2%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG NPQA EG  E++ LNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSAGFNPQAHEG--ERRVLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+D HIP+YP L  QLICQLHNVTMHAD ETDEVYAQMTLQPL+ QEQKD   LPAELG
Sbjct  59    KEVDTHIPNYPSLQPQLICQLHNVTMHADVETDEVYAQMTLQPLNPQEQKD-PYLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PS+QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDY+QQPPAQELIA+DLH NEW
Sbjct  118   VPSRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYTQQPPAQELIARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+ NQLLLGIRRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDKNQLLLGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVG+R
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGLR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISD+DPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDMDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRLKRPWPSGLPSF GL   D+ +SSP+ W      D+G+QSLNFQG
Sbjct  358   PLTTFPMYPSPFPLRLKRPWPSGLPSFHGLKEDDLGMSSPIMW------DRGLQSLNFQG  411

Query  1828  YGITPFMQPRLDAS-MLGLQPDIYQTMAT  1911
              G+TP+MQPRLD S +LG+Q D+YQ MA 
Sbjct  412   VGVTPWMQPRLDPSGLLGMQNDVYQAMAA  440


 Score =   288 bits (737),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 181/341 (53%), Positives = 223/341 (65%), Gaps = 12/341 (4%)
 Frame = +1

Query  2212  STTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNN-SSTQSLPRSFSHDEASQLLNMHET  2388
             S +QS  S  Q+L     QQSFSD  GN+ MTS+  S   SL  +F  DE+SQLLN+  T
Sbjct  531   SASQSITSPLQSLMPLCHQQSFSDSNGNNPMTSSVVSPLHSLLGNFPQDESSQLLNLTRT  590

Query  2389  NPL---ATLPSKRIALESQV----SSRATPYVVSQADMISPNSKVSDLPTFLPPFPGKEF  2547
             N     +  PSKR A++S      +   T  V+ Q    S  S VS     LPPFPG+E 
Sbjct  591   NSAMNSSGWPSKRAAVDSSFQPSGAGNNTQCVMEQLGQQSHASNVSPSSVSLPPFPGREC  650

Query  2548  PEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTC-NFTSGVG-  2718
                Q       ++ L GVN DSS +L+ +G+SNL+  G EN    +PF+T  NFT+ VG 
Sbjct  651   SIEQEGNTDPHSHLLFGVNIDSSPLLMPSGMSNLRGIGLENDNTILPFNTSSNFTNTVGI  710

Query  2719  TDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHE  2898
              D+  N  M  S+C+DESGFLQSSEN    NP + TFVKV+KSGSFGRSLDISKFSSYHE
Sbjct  711   NDFSSNLAMTPSNCIDESGFLQSSENPGSDNPQSTTFVKVYKSGSFGRSLDISKFSSYHE  770

Query  2899  LRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEV  3078
             LRSELA MFGLEG LEDP RSGWQLVFVDRENDVLLLGDDPW EFVN+VW IKILSP EV
Sbjct  771   LRSELAHMFGLEGQLEDPLRSGWQLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEV  830

Query  3079  HQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNM  3201
              +MGK +G++L N+  +  +   NGG  CE   ++++ R++
Sbjct  831   QEMGK-QGLELLNSGQSVQKLAANGGGGCEDFRNRQDPRSL  870



>ref|XP_008371645.1| PREDICTED: auxin response factor 6 [Malus domestica]
Length=893

 Score =   775 bits (2001),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/448 (85%), Positives = 411/448 (92%), Gaps = 3/448 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S A  +PQ++EG  EK+ LNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSAAFSPQSQEG--EKRVLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPL+ QEQKD   LPA LG
Sbjct  59    KEVDAHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLNPQEQKD-GYLPAGLG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              P+KQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NEW
Sbjct  118   SPNKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAV HT +SVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYIKAVCHTCISVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDP RWPNSHWRSVKVGWDESTAGERQPRVSLWE+E
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDPARWPNSHWRSVKVGWDESTAGERQPRVSLWEVE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LRLKRPWP GLPSF G+ + D+ ++S L WL+GN GD+G+QSL+F G
Sbjct  358   PLTTFPMYPSTFPLRLKRPWPPGLPSFNGMRDNDLGMNSQLMWLQGNNGDRGMQSLSFSG  417

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
              GITP+MQPRLDASM+GLQPD+YQ MA 
Sbjct  418   MGITPWMQPRLDASMIGLQPDMYQAMAA  445


 Score =   291 bits (746),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 178/355 (50%), Positives = 240/355 (68%), Gaps = 13/355 (4%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQ  2367
             ++S+ +  S +QSQ    Q ++S   QQS+SD  GN   ++  S   SL  SF  DE+S 
Sbjct  545   VSSMTQFASASQSQSPSLQVVTSLCQQQSYSDSNGNPATSTILSPLHSLMGSFPQDESSH  604

Query  2368  LLNMHETNPLAT---LPSKRIALESQVSSRATPYVVSQADMISP-NSKVSDLPTFLPPFP  2535
             LLN+  TN L +    PSKR A++  +SS  T  ++ +A+ + P +  +S     LPPFP
Sbjct  605   LLNLPRTNQLISSDGWPSKRAAIDP-LSSGVTQCILPRAEQLGPPHITMSQNSISLPPFP  663

Query  2536  GKEFPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSG  2712
             G+E    Q       ++ L GVN +SS +++Q+G+SNL+  G       + F + N+ S 
Sbjct  664   GRECSLDQEGGTDPQSHLLFGVNIESSPLIMQSGMSNLRGVGSNCDSTTLHFPSSNYMST  723

Query  2713  VGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSY  2892
              GTD+ LNP +  SSC+DES FLQS EN D+ +P NR FVKV+KSGSFGRSLDI+KFSSY
Sbjct  724   GGTDFSLNPAVTPSSCIDESRFLQSPENADRGDPLNRNFVKVYKSGSFGRSLDITKFSSY  783

Query  2893  HELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPF  3072
              ELR+ELAR+FGLEG L+DP RSGWQLVFVDRENDVLLLGDDPW EFVN+VW IKILSP 
Sbjct  784   QELRNELARLFGLEGELDDPVRSGWQLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQ  843

Query  3073  EVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNM-NGI-PLGSLDY  3231
             EV QMGK  G++L  ++P  NQR PN  + C+ + S++++RN+ +GI  +GSL+Y
Sbjct  844   EVQQMGK-RGLELLKSVP--NQRPPN--NICDDYGSRQDSRNLSSGITSVGSLEY  893



>ref|XP_011026192.1| PREDICTED: auxin response factor 6-like isoform X1 [Populus euphratica]
Length=931

 Score =   776 bits (2004),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/443 (85%), Positives = 402/443 (91%), Gaps = 3/443 (1%)
 Frame = +1

Query  586   GVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAH  765
             G N   +EG  + KCLNSELWHACAGPLVSLP +GSR VYFPQGHSEQV ASTNKE+DAH
Sbjct  12    GFNQVTQEG--DNKCLNSELWHACAGPLVSLPHVGSRAVYFPQGHSEQVAASTNKEVDAH  69

Query  766   IPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQP  945
             IP+YP LPAQLICQLHNVTMHAD ETDEVYAQMTLQPLS ++QKD  LLPAELG  SKQP
Sbjct  70    IPNYPSLPAQLICQLHNVTMHADVETDEVYAQMTLQPLSPEDQKDAYLLPAELGTASKQP  129

Query  946   TNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVF  1125
             +NYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQ PPAQELIA+DLH NEWKFRH+F
Sbjct  130   SNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQTPPAQELIARDLHDNEWKFRHIF  189

Query  1126  RGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSD  1305
             RGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPSSVLSSD
Sbjct  190   RGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPSSVLSSD  249

Query  1306  SMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFE  1485
             SMHIGLLAAAAHAAATNSRFTIFYNPR SPS+FVIPL KY KAVYHTRVSVGMRFRMLFE
Sbjct  250   SMHIGLLAAAAHAAATNSRFTIFYNPRTSPSEFVIPLVKYVKAVYHTRVSVGMRFRMLFE  309

Query  1486  TEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFP  1665
             TEESSVRRYMGTITGISDLDP RWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFP
Sbjct  310   TEESSVRRYMGTITGISDLDPARWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFP  369

Query  1666  MYPSPFSLRLKRPWPSGLPSF-PGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITP  1842
             MYPS F +RLKRPWPSGLPSF  GL + D+ I+SP+ WL+G +GD G+ SLNFQ +G+ P
Sbjct  370   MYPSAFPMRLKRPWPSGLPSFHAGLKDEDLSINSPVMWLQGGVGDPGVHSLNFQNFGVAP  429

Query  1843  FMQPRLDASMLGLQPDIYQTMAT  1911
             ++QPR +ASM  LQPD+YQTMA 
Sbjct  430   WIQPRFEASMPALQPDVYQTMAA  452


 Score =   335 bits (858),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 201/369 (54%), Positives = 243/369 (66%), Gaps = 30/369 (8%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQ  2367
             I++LP + S   S     Q + S   QQ+FS+ +GN +  S  SS  S+  S   D    
Sbjct  567   ISALPHLISVAPSHSPSLQVIPSQCQQQAFSEPLGNPIAASVVSSVPSIMGSLPQDRG-H  625

Query  2368  LLNMHETNPL--ATLPSKRIALESQVSSRATPYVVSQADMI-SPNSKVSDLPTFLPPFPG  2538
             LLN + +NP+  +TL SK+ A   Q+SS A P V+ Q +   +  S VSDL T L PF G
Sbjct  626   LLNSNGSNPVRSSTLLSKQAAFGPQLSSGAAPGVLPQVEQSGTTQSAVSDLATLLAPFSG  685

Query  2539  KEFPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSGV  2715
             +E+  YQG      NN L GVN DSS  +LQ+GI NL+N G EN  L+MPF+   FTS  
Sbjct  686   REYSTYQG---DPQNNLLFGVNIDSSTFMLQHGIPNLRNIGTENDPLSMPFTASTFTSAP  742

Query  2716  GTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYH  2895
             G D PL  DM  SSC+DESGFLQSSENVDQ NP  RTFVKVHKSGS+GRSLDISKFSSY 
Sbjct  743   GGDIPLTSDMTASSCIDESGFLQSSENVDQVNPSTRTFVKVHKSGSYGRSLDISKFSSYD  802

Query  2896  ELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFE  3075
             ELRSELAR+F LEG LEDP+RS WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSP E
Sbjct  803   ELRSELARLFCLEGQLEDPQRSVWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPLE  862

Query  3076  VHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRN----------------MNG  3207
             V QMGK EG+    ++P+  Q+L N  SS + ++++++ RN                 NG
Sbjct  863   VQQMGK-EGLTSAASVPS--QKLSN--SSSDGYMNRQDFRNSSNPDGYLNRQDFRNSSNG  917

Query  3208  IP-LGSLDY  3231
             I  +GSLDY
Sbjct  918   IASIGSLDY  926



>ref|XP_009399037.1| PREDICTED: auxin response factor 17 [Musa acuminata subsp. malaccensis]
 ref|XP_009399038.1| PREDICTED: auxin response factor 17 [Musa acuminata subsp. malaccensis]
Length=926

 Score =   776 bits (2003),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/448 (85%), Positives = 411/448 (92%), Gaps = 5/448 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S +G+  Q +EG  E+KCLNSELWHACAGPLV LP +GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSSGLPQQTQEG--EQKCLNSELWHACAGPLVCLPAIGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+D HIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS +EQK+   LPAELG
Sbjct  59    KEVDGHIPNYPNLPPQLICQLHNVTMHADAETDEVYAQMTLQPLSLEEQKEP-YLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIA+DLH NEW
Sbjct  118   TPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE+NQLL+GIRRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNESNQLLIGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LRLKRPWPSGLPS  G  + D+ ++S L WL+   G++GIQSLNFQG
Sbjct  358   PLTTFPMYPSAFPLRLKRPWPSGLPSLHGGKDDDIGLNSSLMWLQD--GERGIQSLNFQG  415

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
             +G+TP+M  R ++S+LGLQPD+YQ MA+
Sbjct  416   FGMTPWMHQRCNSSILGLQPDMYQAMAS  443


 Score =   272 bits (695),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 173/355 (49%), Positives = 229/355 (65%), Gaps = 21/355 (6%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQ  2367
             +++L +  ST+Q+Q    Q ++S   QQ+  + + N + TS  S    +   FS +E S 
Sbjct  586   MSTLSQFASTSQAQTLSLQKMASLCQQQNLPETIINRMSTSGVSPLHGILHPFSAEETSG  645

Query  2368  LLNMHETNPL-ATLP--SKRIALES-QVSSRATPYVVSQADMISPNSKVSDLPTFLPPFP  2535
             L++M +T PL AT P  SKR+A+ES  V     P V      I+     S     +PP  
Sbjct  646   LVSMPKTTPLIATSPWSSKRLAVESIPVLQSMQPEVKQLGSQIN----FSQNAVTVPPSS  701

Query  2536  GKEFPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSG  2712
             G++    Q     + +N L  VN DSS +L+QNG+SNL+N   +     MPF      S 
Sbjct  702   GRDCSLNQECGMDRQSNLLSSVNIDSSSLLVQNGMSNLRNFDNDTVSTLMPF-----VST  756

Query  2713  VGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSY  2892
              GTDY L+  + +S+C+++S FLQS  +V   NP N TFVKV+KSGSFGRSLDI+KF+SY
Sbjct  757   TGTDYALHQALTSSNCIEDSEFLQSPNSVGVMNPQNGTFVKVYKSGSFGRSLDITKFNSY  816

Query  2893  HELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPF  3072
              ELRSEL R+FGLEGLLEDP RSGWQLVFVDRENDVLL+GDDPW EFVNNV  IKILSP 
Sbjct  817   PELRSELGRLFGLEGLLEDPLRSGWQLVFVDRENDVLLVGDDPWHEFVNNVSSIKILSPQ  876

Query  3073  EVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNM-NGIP-LGSLDY  3231
             EV QMGK EG+DL N   A N+R+P+  S  + ++S++E+RN+ NG+  +GSLDY
Sbjct  877   EVQQMGK-EGVDLLN--AATNRRIPSHTS--DEYISRQESRNLSNGMASVGSLDY  926



>ref|XP_010499563.1| PREDICTED: auxin response factor 6-like isoform X3 [Camelina 
sativa]
Length=921

 Score =   775 bits (2002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/451 (85%), Positives = 408/451 (90%), Gaps = 10/451 (2%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG NPQ  E TGEK+ LNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSAGFNPQPHEVTGEKRVLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  60

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP L  QLICQLHNVTMHAD ETDEVYAQMTLQPL+AQEQKD   LPAELG
Sbjct  61    KEVDAHIPNYPSLHPQLICQLHNVTMHADVETDEVYAQMTLQPLNAQEQKD-PYLPAELG  119

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PS+QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQEL+A+DLH NEW
Sbjct  120   VPSRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELMARDLHDNEW  179

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+ NQLLLGIRRANRPQTVMPS
Sbjct  180   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDKNQLLLGIRRANRPQTVMPS  239

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  240   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  299

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGI DLDP RW NSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  300   FRMLFETEESSVRRYMGTITGICDLDPTRWANSHWRSVKVGWDESTAGERQPRVSLWEIE  359

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGD--MHISSPLSWLRGNMGDQGIQSLNF  1821
             PLTTFPMYPSPF LRLKRPWP GLPSF GL   D  M +SSPL W      D+G+QSLNF
Sbjct  360   PLTTFPMYPSPFPLRLKRPWPPGLPSFHGLKEDDMGMSMSSPLMW------DRGLQSLNF  413

Query  1822  QGYGITPFMQPRLDAS-MLGLQPDIYQTMAT  1911
             QG G+ P+MQPRLD S +LG+Q D+YQ MA 
Sbjct  414   QGMGVNPWMQPRLDTSGLLGMQNDVYQAMAA  444


 Score =   283 bits (723),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 184/356 (52%), Positives = 233/356 (65%), Gaps = 25/356 (7%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQ  2367
             ++++ +  S +QS  S  Q+++S   QQSFSD  G     +  S   SL  +FS DE+SQ
Sbjct  567   VSTMSQFGSASQSNTSPLQSMASLCHQQSFSDTNGG---DNPISPLHSLLSNFSQDESSQ  623

Query  2368  LLNMHETNPLAT---LPSKRIALESQV----SSRATPYVVSQADMISPNSKVSDLPTFLP  2526
             LLN+  TN   T    PSKR A++S      +   T  V+ Q    S  S V      LP
Sbjct  624   LLNLTRTNSAMTSSGWPSKRPAVDSSFQHSGAGNNTQSVMEQLGQ-SHTSNVPPNAVSLP  682

Query  2527  PFPGKE--FPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENG-FLNMPFST  2694
             PFPG      E +G A    ++ L GVN DSS +L+ NG+SNL++ G E G    +PF++
Sbjct  683   PFPGGRECSIEQEGSASDPHSHLLFGVNIDSSSLLMPNGMSNLRSIGIEGGDSTTLPFTS  742

Query  2695  CNFTSGVGTDYPLNPDMGT-SSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLD  2871
              NF +    D+  N  M T SSC+DESGFLQSSEN+   NP + TFVKV+KSGSFGRSLD
Sbjct  743   SNFNN----DFSGNLAMTTPSSCIDESGFLQSSENIGSENPQSNTFVKVYKSGSFGRSLD  798

Query  2872  ISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWY  3051
             ISKFSSYHELRSELARMFGLEG LEDP RSGWQLVFVDRENDVLLLGDDPW EFV++VW 
Sbjct  799   ISKFSSYHELRSELARMFGLEGQLEDPVRSGWQLVFVDRENDVLLLGDDPWPEFVSSVWC  858

Query  3052  IKILSPFEVHQMGKEEGIDLPNNLPAAN--QRLPNGGSSCEVHVSQKETRNM-NGI  3210
             IKILSP EV QMGK  G++L N+ P++N   +LP+ G +C+   ++ + RN+ NGI
Sbjct  859   IKILSPQEVQQMGK-RGLELLNSAPSSNNVDKLPSNG-NCDDFGNRSDPRNLGNGI  912



>ref|XP_008777704.1| PREDICTED: auxin response factor 17-like [Phoenix dactylifera]
Length=916

 Score =   775 bits (2001),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/448 (85%), Positives = 413/448 (92%), Gaps = 4/448 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR S +G+  Q +E   E++CLNSELWHACAGPLVSLP +GSRV+YFPQGHSEQV ASTN
Sbjct  1     MRPSSSGLANQPQEE--EQRCLNSELWHACAGPLVSLPVVGSRVIYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KEID+HIP+YP L  QLICQLH+VTMHAD ETDEVYAQMTLQPLS QEQK+    P ELG
Sbjct  59    KEIDSHIPNYPSLQPQLICQLHDVTMHADAETDEVYAQMTLQPLSLQEQKEP-YHPTELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLHGNEW
Sbjct  118   TPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHGNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRL+AGD+V+FIWNENNQLLLGIRRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLIAGDSVLFIWNENNQLLLGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLA+Y KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAQYVKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYP+PF LRLKRPWP+GLPS  G  + D+ +SSPL WLR + G+ G+QSLNFQG
Sbjct  358   PLTTFPMYPTPFPLRLKRPWPTGLPSLHGGKDDDLDLSSPLRWLR-DGGNPGVQSLNFQG  416

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
              G+TP++QPRLDAS+LGLQPD+YQ+MA 
Sbjct  417   IGVTPWLQPRLDASVLGLQPDMYQSMAA  444


 Score =   280 bits (716),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 177/357 (50%), Positives = 234/357 (66%), Gaps = 20/357 (6%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQ  2367
             +++L + +S + SQ S  Q  SS   +Q+  D  GN V TS+     ++ R FS ++   
Sbjct  571   VSALSQFSSASHSQ-SPLQKNSSFSQRQNLPDSNGNSVSTSSAFPLHNILRPFSPEDTP-  628

Query  2368  LLNMHETNPL---ATLPSKRIALESQVSSRATPYV--VSQADMISPNSKVSDLPTFLPPF  2532
              L++  T PL   +  PSKR+A+ES + S A   V  V Q     PN+  S     L PF
Sbjct  629   -LSLPRTTPLIASSPWPSKRVAVESILPSGAQCVVPRVEQLGATQPNT--SPHSVTLAPF  685

Query  2533  PGKEFPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTS  2709
             PG+E     G    Q NN L GVN DSS +L+QNG+ +L+    E+    MP++ CNF S
Sbjct  686   PGRECSVDHGNMDPQ-NNLLFGVNIDSSSLLVQNGMPSLRTVVSESDSAAMPYAACNFLS  744

Query  2710  GVGTDYPLNPDMGTSSCVDESGFLQ-SSENVDQANPPNRTFVKVHKSGSFGRSLDISKFS  2886
               GTD+PLN  + +SSC+D+SGFL  S EN+D  N  + TFVKV+KSGS GR LDI+KFS
Sbjct  745   PSGTDFPLNQALTSSSCLDKSGFLHYSPENMDHVNSRSGTFVKVYKSGSLGRLLDITKFS  804

Query  2887  SYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILS  3066
             SYHELRSEL R+FGLEG LEDP RSGWQLVFVDREND LL+GDDPWQEFVN V+ IKIL+
Sbjct  805   SYHELRSELGRLFGLEGQLEDPVRSGWQLVFVDRENDALLVGDDPWQEFVNTVYCIKILA  864

Query  3067  PFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMNG--IPLGSLDY  3231
             P EV QMGK +G+DL N+ P   +RLP+  +SC+ + S++++RN++     +GSLDY
Sbjct  865   PQEVQQMGK-QGVDLLNSAPI--KRLPS--NSCDGYGSRQDSRNLSAGITSVGSLDY  916



>ref|NP_001280959.1| auxin response factor 6-like [Malus domestica]
 gb|ADL36576.1| ARF domain class transcription factor [Malus domestica]
Length=895

 Score =   774 bits (1998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/448 (84%), Positives = 411/448 (92%), Gaps = 3/448 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG +PQ++EG  EKK LNSELWHACAGPLVSLP +G+RVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSAGFSPQSQEG--EKKVLNSELWHACAGPLVSLPAVGTRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP++P LP QLICQLHNVTMHAD ETDEVYAQMTLQPL+ QEQKD   LPA LG
Sbjct  59    KEVDAHIPNHPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLNPQEQKD-GYLPAGLG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              P+KQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD++QQPPAQELIA+DLH NEW
Sbjct  118   SPNKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFTQQPPAQELIARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANR QTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRQQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHT +SVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYIKAVYHTCISVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDP RWPNSHWRSVKVGWDESTAGERQPRVSLWE+E
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDPARWPNSHWRSVKVGWDESTAGERQPRVSLWEVE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRLKRPW  GLPSF G+ + D+ ++S L WL+GN GD+G+QSLNF G
Sbjct  358   PLTTFPMYPSPFQLRLKRPWTPGLPSFNGMRDDDLGMNSQLVWLQGNNGDRGMQSLNFPG  417

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
              G+TP+MQPRLDASM+GLQ D+YQ MA 
Sbjct  418   MGVTPWMQPRLDASMIGLQSDMYQAMAA  445


 Score =   297 bits (761),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 180/355 (51%), Positives = 242/355 (68%), Gaps = 13/355 (4%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQ  2367
             ++SL +  S +QSQ    Q +++   QQSFSD  GN   ++  S   +L  SF  DE+S 
Sbjct  547   VSSLTQFASASQSQSPSLQVVTTLCHQQSFSDSNGNPATSTVISPLHNLMGSFPQDESSH  606

Query  2368  LLNMHETNPLAT---LPSKRIALESQVSSRATPYVVSQADMISP-NSKVSDLPTFLPPFP  2535
             LLN+  TN L +    PSKR A++  +SS  +  V+ + +   P ++ +S     LPPFP
Sbjct  607   LLNLPRTNQLISSDGWPSKRAAIDPLLSSGVSQCVLPRVEQFGPPHTTMSQNSISLPPFP  666

Query  2536  GKEFPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSG  2712
             G+E    Q       ++ L GVN +SS +++Q+G+SNL+  G + G   M F + N+ S 
Sbjct  667   GRECSLDQEGGTDPQSHLLFGVNIESSPLIMQSGMSNLRGVGSDCGSTTMHFPS-NYMST  725

Query  2713  VGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSY  2892
              G+D+ +NP +  SSC+ ESGFLQSSEN D  +P NR FVKV+KSGSFGRSLDI+KFSSY
Sbjct  726   AGSDFSINPAVTPSSCIHESGFLQSSENADNGDPLNRNFVKVYKSGSFGRSLDITKFSSY  785

Query  2893  HELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPF  3072
              ELR+ELARMFGLEG L+DP RSGWQLVFVDRENDVLLLGDDPW EFVN+VW IKILSP 
Sbjct  786   QELRNELARMFGLEGKLDDPVRSGWQLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQ  845

Query  3073  EVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNM-NGI-PLGSLDY  3231
             EV QMGK  G++L  ++P  NQRL N  +SC+ + S++++RN+ +GI  +GSL+Y
Sbjct  846   EVQQMGK-RGLELLKSVP--NQRLSN--NSCDDYGSRQDSRNLSSGITSVGSLEY  895



>ref|XP_002893612.1| hypothetical protein ARALYDRAFT_473256 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69871.1| hypothetical protein ARALYDRAFT_473256 [Arabidopsis lyrata subsp. 
lyrata]
Length=891

 Score =   773 bits (1997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/451 (85%), Positives = 408/451 (90%), Gaps = 10/451 (2%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG NPQ  E TGEK+ LNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSAGFNPQPHEVTGEKRVLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  60

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP L  QLICQLHNVTMHAD ETDEVYAQMTLQPL+AQEQKD   LPAELG
Sbjct  61    KEVDAHIPNYPSLHPQLICQLHNVTMHADVETDEVYAQMTLQPLNAQEQKDP-YLPAELG  119

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PS+QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQEL+A+DLH NEW
Sbjct  120   VPSRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELMARDLHDNEW  179

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+ NQLLLGIRRANRPQTVMPS
Sbjct  180   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDKNQLLLGIRRANRPQTVMPS  239

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  240   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  299

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGI DLDP RW NSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  300   FRMLFETEESSVRRYMGTITGICDLDPSRWANSHWRSVKVGWDESTAGERQPRVSLWEIE  359

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGD--MHISSPLSWLRGNMGDQGIQSLNF  1821
             PLTTFPMYPSPF LRLKRPWP GLPSF GL   D  M +SSPL W      D+G+QSLNF
Sbjct  360   PLTTFPMYPSPFPLRLKRPWPPGLPSFHGLKEDDMGMSMSSPLMW------DRGLQSLNF  413

Query  1822  QGYGITPFMQPRLDAS-MLGLQPDIYQTMAT  1911
             QG G  P+MQPRLDAS +LG+Q D+YQ MA 
Sbjct  414   QGMGGNPWMQPRLDASGLLGMQNDVYQAMAA  444


 Score =   258 bits (660),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 177/355 (50%), Positives = 220/355 (62%), Gaps = 67/355 (19%)
 Frame = +1

Query  2212  STTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNN--SSTQSLPRSFSHDEASQLLNMHE  2385
             S +QS  S  Q+++S   QQSFSD  G      NN  S   +L  +FS DE+SQLLN+  
Sbjct  589   SASQSNTSPLQSMTSLCHQQSFSDTNGG-----NNPISPLHTLLSNFSQDESSQLLNLTR  643

Query  2386  TNPLAT---LPSKRIA--LESQVSSRATPYVVSQADMISPNSKVSDLPTFLPPFPGKEFP  2550
             TN   T    PSKR A  +E +VS+              P+S +                
Sbjct  644   TNSAMTSSGWPSKRPACSIEQEVSAS------------DPHSHL----------------  675

Query  2551  EYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENG-FLNMPFSTCNFTSGVGTD  2724
                          L GVN DSS +L+ NG+SNL++ G E G    +PF++ NF +    D
Sbjct  676   -------------LFGVNIDSSSLLMPNGMSNLRSIGIEGGDSTALPFTSSNFNN----D  718

Query  2725  YPLNPDMGT-SSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHEL  2901
             +  N  M T SSC+DESGFLQSSEN+   NP + TFVKV+KSGSFGRSLDISKFSSYHEL
Sbjct  719   FSGNLAMTTPSSCIDESGFLQSSENLGTENPQSNTFVKVYKSGSFGRSLDISKFSSYHEL  778

Query  2902  RSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVH  3081
             RSELARMFGLEG LEDP RSGWQLVFVDRENDVLLLGDDPW EFV++VW IKILSP EV 
Sbjct  779   RSELARMFGLEGQLEDPVRSGWQLVFVDRENDVLLLGDDPWPEFVSSVWCIKILSPQEVQ  838

Query  3082  QMGKEEGIDLPNNLPAAN--QRLPNGGSSCEVHVSQKETRNM-NGIPL--GSLDY  3231
             QMGK  G++L N+ P++N   +LP+ G +C+   ++ + RN+ NGI    GS +Y
Sbjct  839   QMGK-RGLELLNSAPSSNNVDKLPSNG-NCDDFGNRSDPRNLGNGIASVGGSFNY  891



>ref|XP_008784820.1| PREDICTED: LOW QUALITY PROTEIN: auxin response factor 6-like 
[Phoenix dactylifera]
Length=988

 Score =   777 bits (2006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/451 (85%), Positives = 413/451 (92%), Gaps = 8/451 (2%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVT---A  738
             MR+S +G+  Q +EG  E+KCLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV+   A
Sbjct  1     MRLSTSGLPQQTQEG--EQKCLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVSLYAA  58

Query  739   STNKEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPA  918
             STNKEIDA IP+YP LP QLICQLHN+TMHAD ETDEVYAQMTLQPLS +EQKD   LPA
Sbjct  59    STNKEIDAQIPNYPNLPPQLICQLHNLTMHADAETDEVYAQMTLQPLSPEEQKDP-YLPA  117

Query  919   ELGMPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHG  1098
             ELG PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+D+H 
Sbjct  118   ELGTPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDIHD  177

Query  1099  NEWKFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTV  1278
             NEWKFRH+FRGQPKRHLLTTGWSVFVSAKRL+AGD+V+FIWNENNQLLLGIRRANRPQTV
Sbjct  178   NEWKFRHIFRGQPKRHLLTTGWSVFVSAKRLIAGDSVLFIWNENNQLLLGIRRANRPQTV  237

Query  1279  MPSSVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSV  1458
             MPSSVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSV
Sbjct  238   MPSSVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSV  297

Query  1459  GMRFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLW  1638
             GMRFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDES AGERQPRVSLW
Sbjct  298   GMRFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESIAGERQPRVSLW  357

Query  1639  EIEPLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLN  1818
             EIEPLTTFPMYPS F LRLKRPWPSGLPS  G  + D+ +SSPL WLR   GD+G+ SLN
Sbjct  358   EIEPLTTFPMYPSAFPLRLKRPWPSGLPSLHGCKDDDVRLSSPLMWLRD--GDRGMPSLN  415

Query  1819  FQGYGITPFMQPRLDASMLGLQPDIYQTMAT  1911
             FQG G+TP++QPRL+ASMLGLQPD+YQ +A 
Sbjct  416   FQGLGVTPWIQPRLNASMLGLQPDMYQAVAA  446


 Score =   271 bits (692),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 173/355 (49%), Positives = 234/355 (66%), Gaps = 19/355 (5%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRS-FSHDEAS  2364
             ++SL ++ ST+QS  S  Q +SS   QQ+F D+  N   TS+ S   ++ RS FS +E  
Sbjct  646   VSSLSQLASTSQSLSSSLQTISSFCRQQNFPDININPASTSDVSPLHNILRSSFSPEETP  705

Query  2365  QLLNMHETNPLAT---LPSKRIALESQVSSRATPYVVSQADMISPNSKVSDLPTFLPPFP  2535
              +LN+  T+ L+T    PSKR+A+ES + + +   + SQ   +   S +S     LPPFP
Sbjct  706   NILNLPRTSSLSTSVTWPSKRLAVESVLPAESQ-GLQSQVAQLGQQSNISQQSVTLPPFP  764

Query  2536  GKEFPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSG  2712
             G+++   Q        + L G + DSS +L+QNG+ NL++ G       MPF T      
Sbjct  765   GRDYSLDQECNTDXSKHLLFGAHIDSSSLLMQNGMPNLRSVGSGTDSTAMPFLT-----A  819

Query  2713  VGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSY  2892
              GTD+PLN  + +S+C++E GFLQ  ENV   NP N TFVKV+KSGS+GRSLDI+KF+SY
Sbjct  820   AGTDFPLNQALTSSNCIEEPGFLQPPENVGHMNPQNGTFVKVYKSGSYGRSLDITKFNSY  879

Query  2893  HELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPF  3072
              ELRSEL R+FGLEG L+DP RSGWQLVF+DRENDVLLLGDDPWQEFVNNVW IKILSP 
Sbjct  880   PELRSELGRLFGLEGQLDDPMRSGWQLVFIDRENDVLLLGDDPWQEFVNNVWCIKILSPQ  939

Query  3073  EVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNM-NGI-PLGSLDY  3231
             E+ QMGK  G +LP   P+  +RLP+  S  + +++++++RNM NGI  +  LDY
Sbjct  940   EM-QMGKGGG-ELPGTAPS--RRLPS--SRYDDYMNRQDSRNMSNGISSMLPLDY  988



>ref|XP_009360948.1| PREDICTED: auxin response factor 6 [Pyrus x bretschneideri]
Length=893

 Score =   773 bits (1996),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/448 (85%), Positives = 410/448 (92%), Gaps = 3/448 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG +PQ++EG  EK+ LNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSAGFSPQSQEG--EKRVLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE DA IP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPL+ QEQKD   LPA LG
Sbjct  59    KEADARIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLNPQEQKD-GYLPAGLG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              P+KQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NEW
Sbjct  118   SPNKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLA Y KAVYHT +SVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLATYIKAVYHTCISVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDP RWPNSHWRSVKVGWDESTAG+RQPRVSLWE+E
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDPARWPNSHWRSVKVGWDESTAGDRQPRVSLWEVE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LRLKRPWP GLPSF G+ + D+ ++S L WL+GN GD+G+QSL+F G
Sbjct  358   PLTTFPMYPSTFPLRLKRPWPPGLPSFSGMRDDDLGMNSQLMWLQGNNGDRGMQSLSFSG  417

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
              GITP+MQPRLDASM+GLQPD+YQ MA 
Sbjct  418   MGITPWMQPRLDASMIGLQPDMYQAMAA  445


 Score =   290 bits (743),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 177/355 (50%), Positives = 238/355 (67%), Gaps = 13/355 (4%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQ  2367
             ++S+ +  S +QSQ    Q ++S   Q+SFSD  GN   ++  S   SL  SF  DE+S 
Sbjct  545   VSSMTQFASASQSQSPSLQVVTSLCQQESFSDSNGNPATSTILSPLHSLMGSFPQDESSH  604

Query  2368  LLNMHETNPLAT---LPSKRIALESQVSSRATPYVVSQADMISP-NSKVSDLPTFLPPFP  2535
             LL +  TN L +    PSKR A++  +SS  +  ++ +A+ + P +  +S     LPPFP
Sbjct  605   LLTLPRTNQLISSDGWPSKRAAID-LLSSGVSQCILPRAEQLGPPHITMSQNSISLPPFP  663

Query  2536  GKEFPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSG  2712
             G+E    Q       ++ L GVN +SS +++Q+G+SNL+  G       + F + N+ S 
Sbjct  664   GRECSLDQEGGTDPQSHLLFGVNIESSPLIMQSGMSNLRGVGSNCDTTTLHFPSSNYMST  723

Query  2713  VGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSY  2892
              GTD+ L   +  SSC+DESGFLQS EN D  +P  R FVKVHKSGSFGRSLDI+KF+SY
Sbjct  724   GGTDFSLQTAVTPSSCIDESGFLQSPENADHGDPLKRNFVKVHKSGSFGRSLDITKFNSY  783

Query  2893  HELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPF  3072
              ELR+ELARMFGLEG L+DP RSGWQLVFVDRENDVLLLGDDPW EFVN+VW IKILSP 
Sbjct  784   QELRNELARMFGLEGELDDPVRSGWQLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQ  843

Query  3073  EVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNM-NGI-PLGSLDY  3231
             EV QMGK  G++L  ++P  NQRLPN  +SC+ + S++++RN+ +GI  +GSL+Y
Sbjct  844   EVQQMGK-RGLELLKSVP--NQRLPN--NSCDDYGSRQDSRNLSSGITSVGSLEY  893



>ref|XP_010478419.1| PREDICTED: auxin response factor 6 isoform X3 [Camelina sativa]
Length=922

 Score =   774 bits (1999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/451 (85%), Positives = 407/451 (90%), Gaps = 10/451 (2%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG NPQ  E TGEK+ LNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSAGFNPQPHEVTGEKRVLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  60

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP L  QLICQLHNVTMHAD ETDEVYAQMTLQPL+AQEQKD   LPAELG
Sbjct  61    KEVDAHIPNYPSLHPQLICQLHNVTMHADVETDEVYAQMTLQPLNAQEQKD-PYLPAELG  119

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PS+QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQEL+A+DLH NEW
Sbjct  120   VPSRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELMARDLHDNEW  179

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+ NQLLLGIRRANRPQTVMPS
Sbjct  180   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDKNQLLLGIRRANRPQTVMPS  239

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  240   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  299

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGI DLDP RW NSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  300   FRMLFETEESSVRRYMGTITGICDLDPTRWANSHWRSVKVGWDESTAGERQPRVSLWEIE  359

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGD--MHISSPLSWLRGNMGDQGIQSLNF  1821
             PLTTFPMYPSPF LRLKRPWP GLPSF GL   D  M +SSPL W      D+G+QSLNF
Sbjct  360   PLTTFPMYPSPFPLRLKRPWPPGLPSFHGLKEDDMGMSMSSPLMW------DRGLQSLNF  413

Query  1822  QGYGITPFMQPRLDAS-MLGLQPDIYQTMAT  1911
             QG G+ P+MQPRLD S  LG+Q D+YQ MA 
Sbjct  414   QGMGVNPWMQPRLDTSGFLGMQNDVYQAMAA  444


 Score =   283 bits (725),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 186/358 (52%), Positives = 234/358 (65%), Gaps = 29/358 (8%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNN--SSTQSLPRSFSHDEA  2361
             ++++ +  S +QS  S  Q+++S   QQSFSD  G      NN  S   SL  +FS DE+
Sbjct  568   VSTMSQFGSASQSNTSPLQSMASLCHQQSFSDTNGG-----NNPISPLHSLLSNFSQDES  622

Query  2362  SQLLNMHETNPLAT---LPSKRIALESQV----SSRATPYVVSQADMISPNSKVSDLPTF  2520
             SQLLN+  TN   T    PSKR A++S      +   T  V+ Q    S  S V      
Sbjct  623   SQLLNLTRTNSAMTSSGWPSKRPAVDSSFQHSGAGNNTQSVMEQLGQ-SHTSNVPPNAVS  681

Query  2521  LPPFPGKE--FPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENG-FLNMPF  2688
             LPPFPG      E +G A    ++ L GVN DSS +L+ NG+SNL++ G E G    +PF
Sbjct  682   LPPFPGGRECSIEQEGSASDPHSHLLFGVNIDSSSLLMPNGMSNLRSIGIEGGDSTTLPF  741

Query  2689  STCNFTSGVGTDYPLNPDMGT-SSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRS  2865
             ++ NF +    D+  N  M T SSC+DESGFLQSSEN+   NP + TFVKV+KSGSFGRS
Sbjct  742   TSSNFNN----DFSGNLAMTTPSSCIDESGFLQSSENIGSENPQSNTFVKVYKSGSFGRS  797

Query  2866  LDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNV  3045
             LDISKFSSYHELRSELARMFGLEG LEDP RSGWQLVFVDRENDVLLLGDDPW EFV++V
Sbjct  798   LDISKFSSYHELRSELARMFGLEGQLEDPVRSGWQLVFVDRENDVLLLGDDPWPEFVSSV  857

Query  3046  WYIKILSPFEVHQMGKEEGIDLPNNLPAAN--QRLPNGGSSCEVHVSQKETRNM-NGI  3210
             W IKILSP EV QMGK  G++L N+ P++N   +LP+ G +C+   ++ + RN+ NGI
Sbjct  858   WCIKILSPQEVQQMGK-RGLELLNSAPSSNNVDKLPSNG-NCDDFGNRSDPRNLGNGI  913



>ref|NP_001031115.1| auxin response factor 6 [Arabidopsis thaliana]
 sp|Q9ZTX8.2|ARFF_ARATH RecName: Full=Auxin response factor 6 [Arabidopsis thaliana]
 gb|AAT67072.1| ARF6 [Arabidopsis thaliana]
 gb|AEE31207.1| auxin response factor 6 [Arabidopsis thaliana]
Length=935

 Score =   774 bits (1999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/451 (85%), Positives = 408/451 (90%), Gaps = 10/451 (2%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG NPQ  E TGEK+ LNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSAGFNPQPHEVTGEKRVLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  60

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP L  QLICQLHNVTMHAD ETDEVYAQMTLQPL+AQEQKD   LPAELG
Sbjct  61    KEVDAHIPNYPSLHPQLICQLHNVTMHADVETDEVYAQMTLQPLNAQEQKD-PYLPAELG  119

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PS+QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQEL+A+DLH NEW
Sbjct  120   VPSRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELMARDLHDNEW  179

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+ NQLLLGIRRANRPQTVMPS
Sbjct  180   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDKNQLLLGIRRANRPQTVMPS  239

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  240   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  299

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGI DLDP RW NSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  300   FRMLFETEESSVRRYMGTITGICDLDPTRWANSHWRSVKVGWDESTAGERQPRVSLWEIE  359

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGD--MHISSPLSWLRGNMGDQGIQSLNF  1821
             PLTTFPMYPSPF LRLKRPWP GLPSF GL   D  M +SSPL W      D+G+QSLNF
Sbjct  360   PLTTFPMYPSPFPLRLKRPWPPGLPSFHGLKEDDMGMSMSSPLMW------DRGLQSLNF  413

Query  1822  QGYGITPFMQPRLDAS-MLGLQPDIYQTMAT  1911
             QG G+ P+MQPRLD S +LG+Q D+YQ MA 
Sbjct  414   QGMGVNPWMQPRLDTSGLLGMQNDVYQAMAA  444


 Score =   276 bits (705),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 186/365 (51%), Positives = 234/365 (64%), Gaps = 32/365 (9%)
 Frame = +1

Query  2197  LPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNN--SSTQSLPRSFSHDEASQL  2370
             + +  S +Q   S  Q+++S   QQSFSD  G      NN  S   +L  +FS DE+SQL
Sbjct  583   MSQFGSASQPNTSPLQSMTSLCHQQSFSDTNG-----GNNPISPLHTLLSNFSQDESSQL  637

Query  2371  LNMHETNPLAT---LPSKRIALESQ-----VSSRATPYVVSQADMISPNSKVSDLPTFLP  2526
             L++  TN   T    PSKR A++S        +  T  V+ Q    S  S V      LP
Sbjct  638   LHLTRTNSAMTSSGWPSKRPAVDSSFQHSGAGNNNTQSVLEQLGQ-SHTSNVPPNAVSLP  696

Query  2527  PFPGKE--FPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENG-FLNMPFST  2694
             PFPG      E +G A    ++ L GVN DSS +L+ NG+SNL++ G E G    +PF++
Sbjct  697   PFPGGRECSIEQEGSASDPHSHLLFGVNIDSSSLLMPNGMSNLRSIGIEGGDSTTLPFTS  756

Query  2695  CNFTSGVGTDYPLNPDMGT-SSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLD  2871
              NF +    D+  N  M T SSC+DESGFLQSSEN+   NP + TFVKV+KSGSFGRSLD
Sbjct  757   SNFNN----DFSGNLAMTTPSSCIDESGFLQSSENLGSENPQSNTFVKVYKSGSFGRSLD  812

Query  2872  ISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWY  3051
             ISKFSSYHELRSELARMFGLEG LEDP RSGWQLVFVDRENDVLLLGDDPW EFV++VW 
Sbjct  813   ISKFSSYHELRSELARMFGLEGQLEDPVRSGWQLVFVDRENDVLLLGDDPWPEFVSSVWC  872

Query  3052  IKILSPFEVHQMGKEEGIDLPNNLPAAN--QRLPNGGSSCEVHVSQKETRNM-NGIPL--  3216
             IKILSP EV QMGK  G++L N+ P++N   +LP+ G +C+   ++ + RN+ NGI    
Sbjct  873   IKILSPQEVQQMGK-RGLELLNSAPSSNNVDKLPSNG-NCDDFGNRSDPRNLGNGIASVG  930

Query  3217  GSLDY  3231
             GS +Y
Sbjct  931   GSFNY  935



>ref|XP_009377485.1| PREDICTED: auxin response factor 6-like [Pyrus x bretschneideri]
Length=893

 Score =   773 bits (1995),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/448 (85%), Positives = 410/448 (92%), Gaps = 3/448 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG +PQ++EG  EK+ LNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSAGFSPQSQEG--EKRVLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE DA IP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPL+ QEQKD   LPA LG
Sbjct  59    KEADARIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLNPQEQKD-GYLPAGLG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              P+KQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NEW
Sbjct  118   SPNKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLA Y KAVYHT +SVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLATYIKAVYHTCISVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDP RWPNSHWRSVKVGWDESTAG+RQPRVSLWE+E
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDPARWPNSHWRSVKVGWDESTAGDRQPRVSLWEVE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LRLKRPWP GLPSF G+ + D+ ++S L WL+GN GD+G+QSL+F G
Sbjct  358   PLTTFPMYPSTFPLRLKRPWPPGLPSFSGMRDDDLGMNSQLMWLQGNNGDRGMQSLSFSG  417

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
              GITP+MQPRLDASM+GLQPD+YQ MA 
Sbjct  418   MGITPWMQPRLDASMIGLQPDMYQAMAA  445


 Score =   294 bits (752),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 179/355 (50%), Positives = 239/355 (67%), Gaps = 13/355 (4%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQ  2367
             ++S+ +  S +QSQ    Q ++S   Q+SFSD  GN   ++  S   SL  SF  DE+S 
Sbjct  545   VSSMTQFASASQSQSPSLQVVTSLCQQESFSDSNGNPATSTILSPLHSLMGSFPQDESSH  604

Query  2368  LLNMHETNPLAT---LPSKRIALESQVSSRATPYVVSQADMISP-NSKVSDLPTFLPPFP  2535
             LLN+  TN L +    PSKR A++  +SS  +  ++ QA+ + P +  +S     LPPFP
Sbjct  605   LLNLPRTNQLISSDGWPSKRAAID-LLSSGVSQCILPQAEQLGPPHITMSQNSISLPPFP  663

Query  2536  GKEFPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSG  2712
             G+E    Q       ++ L GVN +SS +++Q+G+SNL+  G       + F + N+ S 
Sbjct  664   GRECSLDQEGGTDPQSHLLFGVNIESSPLIMQSGMSNLRGVGSNCDTTTLHFPSSNYMST  723

Query  2713  VGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSY  2892
              GTD+ L   +  SSC+DESGFLQS EN D  +P  R FVKVHKSGSFGRSLDI+KF+SY
Sbjct  724   GGTDFSLQTAVTPSSCIDESGFLQSPENADHGDPLKRNFVKVHKSGSFGRSLDITKFNSY  783

Query  2893  HELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPF  3072
              ELR+ELARMFGLEG L+DP RSGWQLVFVDRENDVLLLGDDPW EFVN+VW IKILSP 
Sbjct  784   QELRNELARMFGLEGELDDPVRSGWQLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQ  843

Query  3073  EVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNM-NGI-PLGSLDY  3231
             EV QMGK  G++L  ++P  NQRLPN  +SC+ + S++++RN+ +GI  +GSL+Y
Sbjct  844   EVQQMGK-RGLELLKSVP--NQRLPN--NSCDDYGSRQDSRNLSSGITSVGSLEY  893



>ref|XP_008371797.1| PREDICTED: auxin response factor 6-like [Malus domestica]
Length=895

 Score =   773 bits (1995),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/448 (84%), Positives = 410/448 (92%), Gaps = 3/448 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG +PQ++EG  EKK LNSELWHACAGPLVSLP +G+RVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSAGFSPQSQEG--EKKVLNSELWHACAGPLVSLPAVGTRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP++P LP QLICQLHNVTMHAD ETDEVYAQMTLQPL+ QEQKD   LPA LG
Sbjct  59    KEVDAHIPNHPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLNPQEQKD-GYLPAGLG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              P+KQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD++QQPPAQELIA+DLH NEW
Sbjct  118   SPNKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFTQQPPAQELIARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANR QTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRQQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHT +SVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYIKAVYHTCISVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDP RWPNSHWRSVKVGWDESTAGERQPRVSLWE+E
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDPARWPNSHWRSVKVGWDESTAGERQPRVSLWEVE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRLKRPW  GLPSF G+ + D+ ++S L WL+GN GD+G+QSLNF G
Sbjct  358   PLTTFPMYPSPFQLRLKRPWTPGLPSFNGMRDDDLGMNSQLVWLQGNNGDRGMQSLNFPG  417

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
              G+TP+MQPRLDASM+GLQ D YQ MA 
Sbjct  418   MGVTPWMQPRLDASMIGLQSDXYQAMAA  445


 Score =   295 bits (754),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 179/355 (50%), Positives = 241/355 (68%), Gaps = 13/355 (4%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQ  2367
             ++SL +  S +QSQ    Q +++   QQSFSD  GN   ++  S   +L  SF  DE+S 
Sbjct  547   VSSLTQFASASQSQSPSLQVVTTLCHQQSFSDSNGNPATSTVISPLHNLMGSFPQDESSH  606

Query  2368  LLNMHETNPLAT---LPSKRIALESQVSSRATPYVVSQADMISP-NSKVSDLPTFLPPFP  2535
             LLN+  TN L +    PSKR A++  +SS  +  V+ + +   P ++ +S     LPPFP
Sbjct  607   LLNLPRTNQLISSDGWPSKRAAIDPLLSSGVSQCVLPRVEQFGPPHTTMSQNSISLPPFP  666

Query  2536  GKEFPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSG  2712
             G+E    Q       ++ L GVN +SS +++Q+G+SNL+  G + G   M F + N+ S 
Sbjct  667   GRECSLDQEGGTDPQSHLLFGVNIESSPLIMQSGMSNLRGVGSDCGSTTMHFPS-NYMST  725

Query  2713  VGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSY  2892
              G+D+ +NP +  SSC+ ESGFLQSSEN D  +P NR FVKV+KSGSFGRSLDI+KFSSY
Sbjct  726   AGSDFSINPAVTPSSCIHESGFLQSSENADNGDPLNRNFVKVYKSGSFGRSLDITKFSSY  785

Query  2893  HELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPF  3072
              ELR+ELA MFGLEG L+DP RSGWQLVFVDRENDVLLLGDDPW EFVN+VW IKILSP 
Sbjct  786   QELRNELAHMFGLEGELDDPVRSGWQLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQ  845

Query  3073  EVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNM-NGI-PLGSLDY  3231
             EV QMGK  G++L  ++P  NQRL N  +SC+ + S++++RN+ +GI  +GSL+Y
Sbjct  846   EVQQMGK-RGLELLKSVP--NQRLSN--NSCDDYGSRQDSRNLSSGITSVGSLEY  895



>ref|XP_008444734.1| PREDICTED: auxin response factor 6-like [Cucumis melo]
Length=902

 Score =   773 bits (1995),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/448 (84%), Positives = 410/448 (92%), Gaps = 4/448 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S  G +PQA EG  E++ LNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSAGGFSPQAPEG--ERRVLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DA IP+YP LP QLICQLHN+TMHAD ETDEVYAQMTLQPLSAQE K+   LPAELG
Sbjct  59    KEVDAQIPNYPSLPPQLICQLHNLTMHADAETDEVYAQMTLQPLSAQELKE-AYLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PS+QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+S QPPAQELIA+DLH NEW
Sbjct  118   TPSRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSMQPPAQELIARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGDAV+FIWNE NQLLLGIRRA+RPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDAVLFIWNEKNQLLLGIRRASRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAAT SRFTIF+NPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATISRFTIFFNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRW NSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDPVRWQNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRLKRPWP+GLPSF G+ + D+ ++SP  WLRG+  D+GIQ LNFQG
Sbjct  358   PLTTFPMYPSPFPLRLKRPWPTGLPSF-GIKDSDLGMNSPFMWLRGDNSDRGIQCLNFQG  416

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
              G++P+MQPRLD SM+G+Q D+YQ MAT
Sbjct  417   AGVSPWMQPRLDPSMMGMQSDMYQVMAT  444


 Score =   314 bits (805),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 186/356 (52%), Positives = 243/356 (68%), Gaps = 15/356 (4%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQ  2367
             I ++ +  S +QSQ    Q + S   Q SFSD  GN V +   S   SL  SF  D++SQ
Sbjct  554   IPAISQFASCSQSQSPSLQTVPSLCQQPSFSDSNGNPVTSPAVSPLHSLAGSFVQDDSSQ  613

Query  2368  LLNM---HETNPLATLPSKRIALESQVSSRATPYVVSQADMI-SPNSKVSDLPTFLPPFP  2535
             LLN+   H   P A  PSKR A++  V + A+ Y + Q +M+ +P S +S     LPPFP
Sbjct  614   LLNLQRAHSVIPEAGWPSKRAAIDP-VCTGASQYFLPQVEMLGTPQSSISQNTVALPPFP  672

Query  2536  GKEFP-EYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTS  2709
             G+E P + +       N+ L GVN DSS +L+QNG+SNL+  G ++    +PFS+ N+ S
Sbjct  673   GRECPIDDREEGSDPQNHVLFGVNIDSSSLLMQNGMSNLRGVGNDSVSTTLPFSS-NYMS  731

Query  2710  GVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSS  2889
               G+++ +NP M +S+C+DESG LQS ENV Q NPPN TFVKVHKSG++ RSLDI+KF+S
Sbjct  732   TAGSNFSVNPTMTSSNCIDESGLLQSHENVGQVNPPNGTFVKVHKSGTYSRSLDITKFNS  791

Query  2890  YHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSP  3069
             Y ELRSELARMFGLEG LEDP RSGWQLVFVDRENDVLLLGD PW EFVN+VW IKILSP
Sbjct  792   YPELRSELARMFGLEGELEDPLRSGWQLVFVDRENDVLLLGDGPWPEFVNSVWCIKILSP  851

Query  3070  FEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNM-NGIP-LGSLDY  3231
              EV  MGK  G++L N++P   QRL N  S+C+ + S++++RN+ +GI  +G LDY
Sbjct  852   EEVQDMGK-RGLELLNSVPI--QRLSN--STCDDYGSRQDSRNLISGIASVGPLDY  902



>ref|XP_010941526.1| PREDICTED: auxin response factor 17-like isoform X1 [Elaeis guineensis]
Length=919

 Score =   773 bits (1996),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/448 (86%), Positives = 411/448 (92%), Gaps = 4/448 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S +G+  Q +E   E++ LNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRISSSGLANQPQEE--EQRYLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KEID+HIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQK+   LP ELG
Sbjct  59    KEIDSHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLSPQEQKEP-YLPTELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQEL+A+DLHGNEW
Sbjct  118   TPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELMARDLHGNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNENNQLLLGIR ANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNENNQLLLGIRHANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYIKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRLKRPWP+GLPS  G  + D  ++SPL WLR + G+ GIQSLNFQG
Sbjct  358   PLTTFPMYPSPFHLRLKRPWPTGLPSLHGGKDDDAGLNSPLMWLR-DGGNPGIQSLNFQG  416

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
              GITP+MQPRLDA + GLQPD+YQ+MA 
Sbjct  417   IGITPWMQPRLDALIHGLQPDMYQSMAA  444


 Score =   288 bits (736),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 178/357 (50%), Positives = 237/357 (66%), Gaps = 17/357 (5%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQ  2367
             +++L    S +QSQ    Q +SS    Q++ D   N V T++ S   ++ R FS ++ S+
Sbjct  571   VSALSHFTSASQSQTPMLQTISSFSQPQNYPDSNSNSVSTNSTSPLHNIMRPFSPEDISR  630

Query  2368  LLNMHETNPLAT---LPSKRIALESQVSSRATPYV--VSQADMISPNSKVSDLPTFLPPF  2532
             L ++  T PL T      KRIA+ES + S A   V  V Q     PN     +   LPPF
Sbjct  631   L-SLPRTTPLGTSSPWSCKRIAVESVLPSGAQCVVPHVEQLGATQPNPSPQSV--TLPPF  687

Query  2533  PGKEFPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTS  2709
             P +E    Q  +    NN L GVN DSS +L+QNG+ +L+    E+    MP+  CNF S
Sbjct  688   PVRECSVDQDGSTDPQNNLLFGVNIDSSSLLVQNGMPSLRTVASESDSAAMPYGACNFLS  747

Query  2710  GVGTDYPLNPDMGTSSCVDESGFLQSSENVDQ-ANPPNRTFVKVHKSGSFGRSLDISKFS  2886
               GTD+PLN  + +SSC+D S FLQS ENVDQ ++P + TFVKV+K+GSFGRSLDI++FS
Sbjct  748   PSGTDFPLNQALTSSSCLDASRFLQSPENVDQVSHPQSGTFVKVYKAGSFGRSLDITRFS  807

Query  2887  SYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILS  3066
             SYHELRSEL R+FGLEG LEDP RSGWQLVFVDRENDVLL+GDDPWQEFVN V+ IKILS
Sbjct  808   SYHELRSELGRLFGLEGQLEDPVRSGWQLVFVDRENDVLLVGDDPWQEFVNTVYCIKILS  867

Query  3067  PFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMNG--IPLGSLDY  3231
             P EV QMG+ +G+DL ++ P   +RLP+  +SC+ +VS++++RN++     +GSLDY
Sbjct  868   PQEVQQMGR-QGVDLLSSAPI--KRLPS--NSCDGYVSRQDSRNLSSGVTSVGSLDY  919



>ref|XP_009115164.1| PREDICTED: auxin response factor 6 isoform X1 [Brassica rapa]
Length=905

 Score =   772 bits (1993),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/453 (85%), Positives = 408/453 (90%), Gaps = 12/453 (3%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG NPQ  E TGEK+ LNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSTAGFNPQPHEVTGEKRVLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  60

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP L  QLICQLHNVTMHAD ETDEVYAQMTLQPL+AQEQKD   LPAELG
Sbjct  61    KEVDAHIPNYPSLHPQLICQLHNVTMHADVETDEVYAQMTLQPLNAQEQKD-PYLPAELG  119

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PS+QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQEL+A+DLH NEW
Sbjct  120   VPSRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELMARDLHDNEW  179

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+ N+L LGIRRANRPQTVMPS
Sbjct  180   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDKNRLFLGIRRANRPQTVMPS  239

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  240   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  299

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGI DLDP RW NSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  300   FRMLFETEESSVRRYMGTITGICDLDPTRWANSHWRSVKVGWDESTAGERQPRVSLWEIE  359

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMH----ISSPLSWLRGNMGDQGIQSL  1815
             PLTTFPMYPSPF LRLKRPWP GLPSF GL   DM     +SSPL W      D+G+QSL
Sbjct  360   PLTTFPMYPSPFPLRLKRPWPPGLPSFHGLKEDDMSMGMGMSSPLMW------DRGLQSL  413

Query  1816  NFQGYGITPFMQPRLDAS-MLGLQPDIYQTMAT  1911
             NFQG G+ P+MQPRLDAS +LG+Q D+YQ MA 
Sbjct  414   NFQGMGVNPWMQPRLDASGLLGMQNDVYQAMAA  446


 Score =   256 bits (655),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 179/355 (50%), Positives = 226/355 (64%), Gaps = 33/355 (9%)
 Frame = +1

Query  2242  QALSSTVPQQSFSDLVGNHVMTSNN--SSTQSLPRSFSHDEASQLLNMHETNPLATL---  2406
             Q+++S   QQSF D  G +    NN  S   +L  +FS DE+SQLLN+  T   A +   
Sbjct  559   QSMTSLCQQQSFLDTNGGN----NNPMSPLHTLLSNFSQDESSQLLNLTRTTNSAAMTSS  614

Query  2407  --PSKR--IALESQVSSRATPYVVSQADMISPNSKVSDLPTFLPPFPG--KEFP-EYQGV  2565
               PSKR  + L S  ++  T  V+ Q       S V      LPPFPG  +E   E +G 
Sbjct  615   GWPSKRPAVDLSSFGNNSNTQSVIEQLGQSHSTSNVPPNAVSLPPFPGGGRECSIEQEGG  674

Query  2566  AYSQGNNALL-GVNTDSS-ILLQNGISNLKNSGGENG-FLNMPFSTCNFTSGVGTDYPLN  2736
             + S  ++ LL GVN DSS +L+ NG+SNL++ G E G    +PF+T NF +        N
Sbjct  675   SPSDPHSHLLFGVNIDSSSLLMPNGMSNLRSIGIEGGDSTTLPFTTSNFNNDFSGG---N  731

Query  2737  PDMGT-SSCVDESGFLQSSENVDQANP-PNRTFVKVHKSGSFGRSLDISKFSSYHELRSE  2910
               M T SSC+DE GFLQSSEN+   N   N TFVKV+KSGSFGRSLDI+KFSSYHELRSE
Sbjct  732   LAMTTPSSCLDEPGFLQSSENLGSENQQSNNTFVKVYKSGSFGRSLDITKFSSYHELRSE  791

Query  2911  LARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMG  3090
             LARMFGLEG LEDP RSGWQLVFVDRENDVLLLGDDPW EFV++VW IKILSP EV QMG
Sbjct  792   LARMFGLEGQLEDPVRSGWQLVFVDRENDVLLLGDDPWPEFVSSVWCIKILSPQEVQQMG  851

Query  3091  KEEGIDLPNNLPAAN-----QRLPNGGSSCEVHVSQKETRNM-NGIPL--GSLDY  3231
             K  G++L N+ P ++     ++LP+   +C+   ++ + RN+ NGI    GS +Y
Sbjct  852   K-RGLELLNSAPPSSNNNVVEKLPSNNGNCDDFGNRSDPRNLGNGIASVGGSFNY  905



>ref|XP_006415485.1| hypothetical protein EUTSA_v10006747mg [Eutrema salsugineum]
 gb|ESQ33838.1| hypothetical protein EUTSA_v10006747mg [Eutrema salsugineum]
Length=901

 Score =   771 bits (1990),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/451 (85%), Positives = 408/451 (90%), Gaps = 10/451 (2%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S A  +PQ  E TGEK+ LNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSAAFSPQPHEVTGEKRVLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  60

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP L  QLICQLHNVTMHAD ETDEVYAQMTLQPL+AQEQKD   LPAELG
Sbjct  61    KEVDAHIPNYPSLHPQLICQLHNVTMHADVETDEVYAQMTLQPLNAQEQKD-PYLPAELG  119

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PS+QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQEL+A+DLH NEW
Sbjct  120   VPSRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELMARDLHDNEW  179

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+ NQLLLGIRRANRPQTVMPS
Sbjct  180   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDKNQLLLGIRRANRPQTVMPS  239

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIF+NPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  240   SVLSSDSMHLGLLAAAAHAAATNSRFTIFFNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  299

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGI DLDP RW NSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  300   FRMLFETEESSVRRYMGTITGICDLDPARWANSHWRSVKVGWDESTAGERQPRVSLWEIE  359

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGD--MHISSPLSWLRGNMGDQGIQSLNF  1821
             PLTTFPMYPSPF LRLKRPWP GLPSF GL   D  M +SSPL W      D+G+QSLNF
Sbjct  360   PLTTFPMYPSPFPLRLKRPWPPGLPSFHGLKEDDMGMGMSSPLMW------DRGLQSLNF  413

Query  1822  QGYGITPFMQPRLDAS-MLGLQPDIYQTMAT  1911
             QG G+ P+MQPRLDAS +LG+Q D+YQ MA 
Sbjct  414   QGMGVNPWMQPRLDASGLLGMQNDVYQAMAA  444


 Score =   279 bits (714),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 185/368 (50%), Positives = 238/368 (65%), Gaps = 30/368 (8%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNN--SSTQSLPRSFSHDEA  2361
             ++++ +  S +QS  S  Q+++S   QQSFSD  G      NN  S   SL  +FS DE+
Sbjct  544   VSAMSQFGSASQSNTSPLQSMTSLCHQQSFSDTNGG-----NNPISPLHSLLSNFSQDES  598

Query  2362  SQLLNMHETNPLAT---LPSKRIALESQVSSRATPYVVSQADMIS-PNSKVSDLP---TF  2520
             SQLLN+  TN   T    PSKR A++S           +Q+ M     S  S++P     
Sbjct  599   SQLLNLTRTNSAMTSSGWPSKRPAVDSTFQHSGAGNNNTQSVMEQLGQSHTSNVPPNAVS  658

Query  2521  LPPFPG--KEFP-EYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENG-FLNMP  2685
             LPPFPG  +E   E +G A    ++ L GVN DSS +L+ NG+SNL++ G E G    +P
Sbjct  659   LPPFPGGGRECSIEQEGSASDPHSHLLFGVNIDSSSLLMPNGMSNLRSIGIEGGDSTTLP  718

Query  2686  FSTCNFTSGVGTDYPLNPDMGT-SSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGR  2862
             F++  F +    D+  N  M T SSC+DESGFLQSSEN+   N  + TFVKV+KSGSFGR
Sbjct  719   FTSSTFNN----DFSGNLAMTTPSSCIDESGFLQSSENLGSENQQSNTFVKVYKSGSFGR  774

Query  2863  SLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNN  3042
             SLDI+KFSSYHELRSELARMFGLEG LEDP RSGWQLVFVDRENDVLLLGDDPW EFV++
Sbjct  775   SLDITKFSSYHELRSELARMFGLEGQLEDPVRSGWQLVFVDRENDVLLLGDDPWPEFVSS  834

Query  3043  VWYIKILSPFEVHQMGKEEGIDLPNNLPAAN--QRLPNGGSSCEVHVSQKETRNM-NGIP  3213
             VW IKILSP EV QMGK  G++L N+ P++N   +LP+   +C+   ++ + RN+ NGI 
Sbjct  835   VWCIKILSPQEVQQMGK-RGLELLNSAPSSNNVDKLPSNNGNCDDFGNRSDPRNLGNGIA  893

Query  3214  L--GSLDY  3231
                GS +Y
Sbjct  894   SVGGSFNY  901



>ref|XP_007212802.1| hypothetical protein PRUPE_ppa001179mg [Prunus persica]
 gb|EMJ14001.1| hypothetical protein PRUPE_ppa001179mg [Prunus persica]
Length=887

 Score =   770 bits (1988),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/448 (85%), Positives = 410/448 (92%), Gaps = 6/448 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG +PQ++EG  EK+ LNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSAGFSPQSQEG--EKRVLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQKD   LPA LG
Sbjct  59    KEVDAHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLSPQEQKD-GYLPAGLG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              P+KQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NEW
Sbjct  118   NPNKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNP  SPS+FVIPL KY KAVYHT +SVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNP--SPSEFVIPLTKYIKAVYHTCISVGMR  295

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDP RWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  296   FRMLFETEESSVRRYMGTITGISDLDP-RWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  354

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRLKRPWP GLPSF G+ + D+ ++S L WLRG+ GD+GIQSLNF G
Sbjct  355   PLTTFPMYPSPFPLRLKRPWPPGLPSFHGIRDDDLGMNSQLMWLRGDNGDRGIQSLNFPG  414

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
              G+TP+MQPRLDASM+GLQ D+YQ MA 
Sbjct  415   IGVTPYMQPRLDASMIGLQTDMYQAMAA  442


 Score =   307 bits (786),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 181/333 (54%), Positives = 225/333 (68%), Gaps = 12/333 (4%)
 Frame = +1

Query  2251  SSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMHETNPL---ATLPSKRI  2421
             +S   QQSFSD  GN   ++  S   SL  SF  DE S LLN+  TN L      PSKR 
Sbjct  561   TSLCQQQSFSDSNGNPATSTILSPLHSLMGSFPQDEPSHLLNLPRTNQLISSGAWPSKRA  620

Query  2422  ALESQVSSRATPYVVSQADMISP-NSKVSDLPTFLPPFPGKEFPEYQGVAYSQGNNALLG  2598
             A+E  +SS  +  V+   + + P  + +S     LPPFPG+E    Q  +    ++ L G
Sbjct  621   AIEPLLSSGVSQCVLPHVEQLGPPQTTISQNSISLPPFPGRECSIDQEGSTDPQSHLLFG  680

Query  2599  VNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESG  2775
             VN +SS +L+QNG+SNL+  G ++    M F   N+ S  GTD+ LNP +  SSC+DESG
Sbjct  681   VNIESSSLLMQNGMSNLRGVGSDSDSTTMHFPP-NYLSTTGTDFSLNPAVTPSSCIDESG  739

Query  2776  FLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPE  2955
             FLQS ENV   NP N  FVKV+KSGSFGRSLDI+KFSSYHELR ELARMFGLEG LEDP 
Sbjct  740   FLQSPENVGHGNPLNNNFVKVYKSGSFGRSLDITKFSSYHELRGELARMFGLEGELEDPV  799

Query  2956  RSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAAN  3135
             RSGWQLVFVDRENDVLLLGDDPW EFVN+VW IKILSP EV QMGK  G+DL  ++P   
Sbjct  800   RSGWQLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPHEVQQMGK-RGLDLLKSVPT--  856

Query  3136  QRLPNGGSSCEVHVSQKETRNMNGI-PLGSLDY  3231
             QRL N  +SC+ + S++++RN++GI  +GSL+Y
Sbjct  857   QRLSN--NSCDDYGSRQDSRNLSGITSVGSLEY  887



>emb|CDY02285.1| BnaA09g26170D [Brassica napus]
Length=873

 Score =   768 bits (1984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/451 (85%), Positives = 409/451 (91%), Gaps = 11/451 (2%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG NPQ  E TGEK+ LNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSTAGFNPQPHEVTGEKRVLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  60

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP L  QLICQLHNVTMHAD ETDEVYAQMTLQPL+AQEQKD   LPAELG
Sbjct  61    KEVDAHIPNYPSLHPQLICQLHNVTMHADVETDEVYAQMTLQPLNAQEQKD-PYLPAELG  119

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PS+QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQEL+A+DLH NEW
Sbjct  120   VPSRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELMARDLHDNEW  179

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+ NQLLLGIRRANRPQTVMPS
Sbjct  180   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDKNQLLLGIRRANRPQTVMPS  239

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  240   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  299

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGI DLDP RW NSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  300   FRMLFETEESSVRRYMGTITGICDLDPTRWANSHWRSVKVGWDESTAGERQPRVSLWEIE  359

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSF--PGLSNGDMHISSPLSWLRGNMGDQGIQSLNF  1821
             PLTTFPMYPSPF LRLKRPWP GLPSF    +S G M +SSPL W      D+G+QSLNF
Sbjct  360   PLTTFPMYPSPFPLRLKRPWPPGLPSFHEDDMSMG-MGMSSPLMW------DRGLQSLNF  412

Query  1822  QGYGITPFMQPRLDAS-MLGLQPDIYQTMAT  1911
             QG G+ P+MQPRLDAS +LG+Q D+YQ MA 
Sbjct  413   QGMGVNPWMQPRLDASGLLGMQNDVYQAMAA  443


 Score =   257 bits (656),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 179/355 (50%), Positives = 226/355 (64%), Gaps = 33/355 (9%)
 Frame = +1

Query  2242  QALSSTVPQQSFSDLVGNHVMTSNN--SSTQSLPRSFSHDEASQLLNMHETNPLATL---  2406
             Q+++S   QQSF D  G +    NN  S   +L  +FS DE+SQLLN+  T   A +   
Sbjct  527   QSMTSLCQQQSFLDTNGGN----NNPMSPLHTLLSNFSQDESSQLLNLTRTTNSAAMTSS  582

Query  2407  --PSKR--IALESQVSSRATPYVVSQADMISPNSKVSDLPTFLPPFPG--KEFP-EYQGV  2565
               PSKR  + L S  ++  T  V+ Q       S V      LPPFPG  +E   E +G 
Sbjct  583   GWPSKRPAVDLSSFGNNSNTQSVIEQLGQSHNTSNVPPNAVSLPPFPGGGRECSIEQEGG  642

Query  2566  AYSQGNNALL-GVNTDSS-ILLQNGISNLKNSGGENG-FLNMPFSTCNFTSGVGTDYPLN  2736
             + S  ++ LL GVN DSS +L+ NG+SNL++ G E G    +PF+T NF +        N
Sbjct  643   SPSDPHSHLLFGVNIDSSSLLMPNGMSNLRSIGIEGGDSTTLPFTTSNFNNDFSGG---N  699

Query  2737  PDMGT-SSCVDESGFLQSSENVDQANP-PNRTFVKVHKSGSFGRSLDISKFSSYHELRSE  2910
               M T SSC+DE GFLQSSEN+   N   N TFVKV+KSGSFGRSLDI+KFSSYHELRSE
Sbjct  700   LAMTTPSSCIDEPGFLQSSENLGSENQQSNNTFVKVYKSGSFGRSLDITKFSSYHELRSE  759

Query  2911  LARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMG  3090
             LARMFGLEG LEDP RSGWQLVFVDRENDVLLLGDDPW EFV++VW IKILSP EV QMG
Sbjct  760   LARMFGLEGQLEDPVRSGWQLVFVDRENDVLLLGDDPWPEFVSSVWCIKILSPQEVQQMG  819

Query  3091  KEEGIDLPNNLPAAN-----QRLPNGGSSCEVHVSQKETRNM-NGIPL--GSLDY  3231
             K  G++L N+ P ++     ++LP+   +C+   ++ + RN+ NGI    GS +Y
Sbjct  820   K-RGLELLNSAPPSSNNNVVEKLPSNNGNCDDFGNRSDPRNLGNGIASVGGSFNY  873



>gb|KFK27496.1| hypothetical protein AALP_AA8G390400 [Arabis alpina]
Length=941

 Score =   771 bits (1990),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/453 (85%), Positives = 409/453 (90%), Gaps = 12/453 (3%)
 Frame = +1

Query  568   MRVSLAGV--NPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTAS  741
             MR+S AG   NPQ  E TGEK+ LNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV AS
Sbjct  1     MRLSSAGAGFNPQPHEVTGEKRVLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAAS  60

Query  742   TNKEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAE  921
             TNKE+DAHIP+YP L  QLICQLHNVTMHAD ETDEVYAQMTLQPL+AQEQKD   LPAE
Sbjct  61    TNKEVDAHIPNYPSLHPQLICQLHNVTMHADVETDEVYAQMTLQPLNAQEQKD-PYLPAE  119

Query  922   LGMPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGN  1101
             LG+PS+QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQEL+A+DLH N
Sbjct  120   LGVPSRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELMARDLHDN  179

Query  1102  EWKFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVM  1281
             EWKFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+ NQLLLGIRRANRPQTVM
Sbjct  180   EWKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDKNQLLLGIRRANRPQTVM  239

Query  1282  PSSVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVG  1461
             PSSVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVG
Sbjct  240   PSSVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVG  299

Query  1462  MRFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWE  1641
             MRFRMLFETEESSVRRYMGTITGI DLDP RW NSHWRSVKVGWDESTAGERQPRVSLWE
Sbjct  300   MRFRMLFETEESSVRRYMGTITGICDLDPTRWANSHWRSVKVGWDESTAGERQPRVSLWE  359

Query  1642  IEPLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGD--MHISSPLSWLRGNMGDQGIQSL  1815
             IEPLTTFPMYPSPF LRLKRPWP GLPSF GL   D  M +SSPL W      D+G+QSL
Sbjct  360   IEPLTTFPMYPSPFPLRLKRPWPPGLPSFHGLKEDDMGMSMSSPLMW------DRGLQSL  413

Query  1816  NFQGYGITPFMQPRLDAS-MLGLQPDIYQTMAT  1911
             NFQG G+ P+MQPR+DA+ +LG+Q D+YQ MA 
Sbjct  414   NFQGMGVNPWMQPRMDATGLLGMQNDVYQAMAA  446


 Score =   276 bits (706),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 185/365 (51%), Positives = 235/365 (64%), Gaps = 29/365 (8%)
 Frame = +1

Query  2191  TSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNN--SSTQSLPRSFSHDEAS  2364
              ++ +  S +QS  S   +++S   QQSFSD  G      NN  S   +L  +FS DE+S
Sbjct  588   AAMSQFGSASQSNSSPLHSMNSMCQQQSFSDTNGG-----NNPISPLHTLLSNFSQDESS  642

Query  2365  QLLNMHETNPLAT---LPSKRIALES--QVSSRATPYVVSQADMISPN-SKVSDLPTFLP  2526
             QLLN+  TN   T    PSKR A+ES  Q+S            +  P+ S VS     LP
Sbjct  643   QLLNLTRTNSAMTSSGWPSKRPAVESSFQLSGAGNNTQSVMEQLGQPHTSNVSPNAVSLP  702

Query  2527  PFPGKE--FPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENG-FLNMPFST  2694
             PFPG      E +G A    ++ L GVN DSS +L+ NG+SNL++ G E G    +PF++
Sbjct  703   PFPGGRECSIEQEGSASDPHSHLLFGVNIDSSSLLMPNGMSNLRSIGIEGGDSTTLPFTS  762

Query  2695  CNFTSGVGTDYPLNPDMGT-SSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLD  2871
              N+ +    D+  N  M T SSC+DESGFLQSSEN+   N  + TFVKV+KSGSFGRSLD
Sbjct  763   SNYNN----DFSGNLAMTTPSSCIDESGFLQSSENLGSENQQSNTFVKVYKSGSFGRSLD  818

Query  2872  ISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWY  3051
             I+KFSSYHELRSELARMFGLEG LEDP RSGWQLVFVDRENDVLLLGDDPW EFV++VW 
Sbjct  819   ITKFSSYHELRSELARMFGLEGQLEDPVRSGWQLVFVDRENDVLLLGDDPWPEFVSSVWC  878

Query  3052  IKILSPFEVHQMGKEEGIDLPNNLPAAN--QRLPNGGSSCEVHVSQKETRNM-NGIPL--  3216
             IKILSP EV QMGK  G++L N+ P++N   +LP+ G +C+   ++ + RN+ NGI    
Sbjct  879   IKILSPQEVQQMGK-RGLELLNSAPSSNNVDKLPSNG-NCDDFGNRSDPRNLGNGIASVG  936

Query  3217  GSLDY  3231
             GS +Y
Sbjct  937   GSFNY  941



>ref|XP_010462991.1| PREDICTED: auxin response factor 6-like [Camelina sativa]
Length=795

 Score =   765 bits (1976),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/457 (84%), Positives = 408/457 (89%), Gaps = 16/457 (4%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG NPQ  E TGEK+ LNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSAGFNPQPHEVTGEKRVLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  60

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP L  QLICQLHNVTMHAD ETDEVYAQMTLQPL+AQEQKD   LPAELG
Sbjct  61    KEVDAHIPNYPSLHPQLICQLHNVTMHADVETDEVYAQMTLQPLNAQEQKD-PYLPAELG  119

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PS+QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQEL+A+DLH NEW
Sbjct  120   VPSRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELMARDLHDNEW  179

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+ NQLLLGIRRANRPQTVMPS
Sbjct  180   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDKNQLLLGIRRANRPQTVMPS  239

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNP------RASPSDFVIPLAKYAKAVYHTR  1449
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNP      RASPS+FVIPLAKY KAVYHTR
Sbjct  240   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRNPLFFRASPSEFVIPLAKYVKAVYHTR  299

Query  1450  VSVGMRFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRV  1629
             VSVGMRFRMLFETEESSVRRYMGTITGI DLDP RW NSHWRSVKVGWDESTAGERQPRV
Sbjct  300   VSVGMRFRMLFETEESSVRRYMGTITGICDLDPTRWANSHWRSVKVGWDESTAGERQPRV  359

Query  1630  SLWEIEPLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGD--MHISSPLSWLRGNMGDQG  1803
             SLWEIEPLTTFPMYPSPF LRLKRPWP GLPSF GL   D  M +SSPL W      D+G
Sbjct  360   SLWEIEPLTTFPMYPSPFPLRLKRPWPPGLPSFHGLKEDDMGMSMSSPLMW------DRG  413

Query  1804  IQSLNFQGYGITPFMQPRLDAS-MLGLQPDIYQTMAT  1911
             +QS+NFQG G+ P+MQPRLD S +LG+Q D+YQ MA 
Sbjct  414   LQSVNFQGMGVNPWMQPRLDTSGLLGMQNDVYQAMAA  450


 Score =   181 bits (459),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 120/157 (76%), Gaps = 9/157 (6%)
 Frame = +1

Query  2749  TSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFG  2928
             T+S +  SG+      VD +      FVKV+KSGSFGRSLDISKFSSYHELRSELARMFG
Sbjct  636   TNSAMTSSGWPSKRPAVDSS----FQFVKVYKSGSFGRSLDISKFSSYHELRSELARMFG  691

Query  2929  LEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGID  3108
             LEG LEDP RSGWQLVFVDRENDVLLLGDDPW EFV++VW IKILSP EV QMGK  G++
Sbjct  692   LEGQLEDPVRSGWQLVFVDRENDVLLLGDDPWPEFVSSVWCIKILSPQEVQQMGK-RGLE  750

Query  3109  LPNNLPAAN--QRLPNGGSSCEVHVSQKETRNM-NGI  3210
             L N+ P++N   +LP+ G +C+   ++ + RN+ NGI
Sbjct  751   LLNSAPSSNNVDKLPSNG-NCDDFGNRSDPRNLGNGI  786



>ref|XP_010499564.1| PREDICTED: auxin response factor 6-like isoform X4 [Camelina 
sativa]
Length=919

 Score =   769 bits (1987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/451 (85%), Positives = 407/451 (90%), Gaps = 12/451 (3%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG NPQ  EG  EK+ LNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSAGFNPQPHEG--EKRVLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP L  QLICQLHNVTMHAD ETDEVYAQMTLQPL+AQEQKD   LPAELG
Sbjct  59    KEVDAHIPNYPSLHPQLICQLHNVTMHADVETDEVYAQMTLQPLNAQEQKD-PYLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PS+QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQEL+A+DLH NEW
Sbjct  118   VPSRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELMARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+ NQLLLGIRRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDKNQLLLGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGI DLDP RW NSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGICDLDPTRWANSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGD--MHISSPLSWLRGNMGDQGIQSLNF  1821
             PLTTFPMYPSPF LRLKRPWP GLPSF GL   D  M +SSPL W      D+G+QSLNF
Sbjct  358   PLTTFPMYPSPFPLRLKRPWPPGLPSFHGLKEDDMGMSMSSPLMW------DRGLQSLNF  411

Query  1822  QGYGITPFMQPRLDAS-MLGLQPDIYQTMAT  1911
             QG G+ P+MQPRLD S +LG+Q D+YQ MA 
Sbjct  412   QGMGVNPWMQPRLDTSGLLGMQNDVYQAMAA  442


 Score =   283 bits (723),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 184/356 (52%), Positives = 233/356 (65%), Gaps = 25/356 (7%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQ  2367
             ++++ +  S +QS  S  Q+++S   QQSFSD  G     +  S   SL  +FS DE+SQ
Sbjct  565   VSTMSQFGSASQSNTSPLQSMASLCHQQSFSDTNGG---DNPISPLHSLLSNFSQDESSQ  621

Query  2368  LLNMHETNPLAT---LPSKRIALESQV----SSRATPYVVSQADMISPNSKVSDLPTFLP  2526
             LLN+  TN   T    PSKR A++S      +   T  V+ Q    S  S V      LP
Sbjct  622   LLNLTRTNSAMTSSGWPSKRPAVDSSFQHSGAGNNTQSVMEQLGQ-SHTSNVPPNAVSLP  680

Query  2527  PFPGKE--FPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENG-FLNMPFST  2694
             PFPG      E +G A    ++ L GVN DSS +L+ NG+SNL++ G E G    +PF++
Sbjct  681   PFPGGRECSIEQEGSASDPHSHLLFGVNIDSSSLLMPNGMSNLRSIGIEGGDSTTLPFTS  740

Query  2695  CNFTSGVGTDYPLNPDMGT-SSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLD  2871
              NF +    D+  N  M T SSC+DESGFLQSSEN+   NP + TFVKV+KSGSFGRSLD
Sbjct  741   SNFNN----DFSGNLAMTTPSSCIDESGFLQSSENIGSENPQSNTFVKVYKSGSFGRSLD  796

Query  2872  ISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWY  3051
             ISKFSSYHELRSELARMFGLEG LEDP RSGWQLVFVDRENDVLLLGDDPW EFV++VW 
Sbjct  797   ISKFSSYHELRSELARMFGLEGQLEDPVRSGWQLVFVDRENDVLLLGDDPWPEFVSSVWC  856

Query  3052  IKILSPFEVHQMGKEEGIDLPNNLPAAN--QRLPNGGSSCEVHVSQKETRNM-NGI  3210
             IKILSP EV QMGK  G++L N+ P++N   +LP+ G +C+   ++ + RN+ NGI
Sbjct  857   IKILSPQEVQQMGK-RGLELLNSAPSSNNVDKLPSNG-NCDDFGNRSDPRNLGNGI  910



>ref|XP_010923658.1| PREDICTED: auxin response factor 17 isoform X2 [Elaeis guineensis]
Length=949

 Score =   769 bits (1987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/443 (86%), Positives = 405/443 (91%), Gaps = 5/443 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S +G+  Q +EG  E+KCLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSTSGLPQQTQEG--EQKCLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KEIDAHIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS +EQKD+  LPAELG
Sbjct  59    KEIDAHIPNYPNLPPQLICQLHNVTMHADAETDEVYAQMTLQPLSPEEQKDL-YLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
               SKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPP QELIA+DLH NEW
Sbjct  118   TLSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPVQELIARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+VIFIWNENNQLLLGIRRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVIFIWNENNQLLLGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLS DSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  238   SVLSCDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LRLKRPWPSGLPS  G  + ++ ++    WLR   GD G+ SL+FQG
Sbjct  358   PLTTFPMYPSAFPLRLKRPWPSGLPSLHGGKDDEIGLNPSPMWLRD--GDHGLPSLSFQG  415

Query  1828  YGITPFMQPRLDASMLGLQPDIY  1896
              G+TP+MQPRL+ASMLGLQPD+Y
Sbjct  416   LGVTPWMQPRLNASMLGLQPDLY  438


 Score =   294 bits (753),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 185/354 (52%), Positives = 230/354 (65%), Gaps = 17/354 (5%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQ  2367
             ++SL ++ ST+QS  S  Q +SS   QQ+F     N    S  S   S+ RSFS +E S 
Sbjct  607   VSSLSQLASTSQSPSSSLQTISSFCQQQTFPGTTMNAASISGVSPLHSILRSFSPEETSN  666

Query  2368  LLNMHETNPLAT---LPSKRIALESQVSSRATPYVVSQADMISPNSKVSDLPTFLPPFPG  2538
             +LN+  T  L+T     SKR+A+ES +SS  T  V  Q + +   S +S     LPPFPG
Sbjct  667   ILNLPRTTSLSTSGTWSSKRLAVESMLSS-GTQCVQPQVEQLDQQSNISQHSVTLPPFPG  725

Query  2539  KEFPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSGV  2715
             K+    Q       N+ L GV+ DSS +L+QNGI NL++ G E     MPF T       
Sbjct  726   KDCLLDQECNTDPQNHVLFGVHIDSSSLLMQNGIKNLRSVGSETDSTAMPFLT-----AA  780

Query  2716  GTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYH  2895
             GTD+PLN  + +S+C +ESG LQS EN    NP N TFVKV+KSGSFGRSLDI++F+SY 
Sbjct  781   GTDFPLNQALTSSNCAEESGLLQSPENGGHVNPQNGTFVKVYKSGSFGRSLDITRFNSYP  840

Query  2896  ELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFE  3075
             ELRSEL R+FGLEG LEDP RSGWQLVFVDRENDVLLLGDDPWQEFVNNVW IKILSP E
Sbjct  841   ELRSELGRLFGLEGQLEDPMRSGWQLVFVDRENDVLLLGDDPWQEFVNNVWCIKILSPQE  900

Query  3076  VHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNM-NGIP-LGSLDY  3231
             V QMGKE G  L     A ++RLP  GS C+ + S++++R+M NGI  +  LDY
Sbjct  901   VQQMGKEGGELLST---APSKRLP--GSGCDGYSSRQDSRSMRNGIASVMPLDY  949



>ref|XP_010478420.1| PREDICTED: auxin response factor 6 isoform X4 [Camelina sativa]
Length=920

 Score =   768 bits (1984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/451 (85%), Positives = 406/451 (90%), Gaps = 12/451 (3%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG NPQ  EG  EK+ LNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSAGFNPQPHEG--EKRVLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP L  QLICQLHNVTMHAD ETDEVYAQMTLQPL+AQEQKD   LPAELG
Sbjct  59    KEVDAHIPNYPSLHPQLICQLHNVTMHADVETDEVYAQMTLQPLNAQEQKD-PYLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PS+QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQEL+A+DLH NEW
Sbjct  118   VPSRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELMARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+ NQLLLGIRRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDKNQLLLGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGI DLDP RW NSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGICDLDPTRWANSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGD--MHISSPLSWLRGNMGDQGIQSLNF  1821
             PLTTFPMYPSPF LRLKRPWP GLPSF GL   D  M +SSPL W      D+G+QSLNF
Sbjct  358   PLTTFPMYPSPFPLRLKRPWPPGLPSFHGLKEDDMGMSMSSPLMW------DRGLQSLNF  411

Query  1822  QGYGITPFMQPRLDAS-MLGLQPDIYQTMAT  1911
             QG G+ P+MQPRLD S  LG+Q D+YQ MA 
Sbjct  412   QGMGVNPWMQPRLDTSGFLGMQNDVYQAMAA  442


 Score =   283 bits (725),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 186/358 (52%), Positives = 234/358 (65%), Gaps = 29/358 (8%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNN--SSTQSLPRSFSHDEA  2361
             ++++ +  S +QS  S  Q+++S   QQSFSD  G      NN  S   SL  +FS DE+
Sbjct  566   VSTMSQFGSASQSNTSPLQSMASLCHQQSFSDTNGG-----NNPISPLHSLLSNFSQDES  620

Query  2362  SQLLNMHETNPLAT---LPSKRIALESQV----SSRATPYVVSQADMISPNSKVSDLPTF  2520
             SQLLN+  TN   T    PSKR A++S      +   T  V+ Q    S  S V      
Sbjct  621   SQLLNLTRTNSAMTSSGWPSKRPAVDSSFQHSGAGNNTQSVMEQLGQ-SHTSNVPPNAVS  679

Query  2521  LPPFPGKE--FPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENG-FLNMPF  2688
             LPPFPG      E +G A    ++ L GVN DSS +L+ NG+SNL++ G E G    +PF
Sbjct  680   LPPFPGGRECSIEQEGSASDPHSHLLFGVNIDSSSLLMPNGMSNLRSIGIEGGDSTTLPF  739

Query  2689  STCNFTSGVGTDYPLNPDMGT-SSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRS  2865
             ++ NF +    D+  N  M T SSC+DESGFLQSSEN+   NP + TFVKV+KSGSFGRS
Sbjct  740   TSSNFNN----DFSGNLAMTTPSSCIDESGFLQSSENIGSENPQSNTFVKVYKSGSFGRS  795

Query  2866  LDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNV  3045
             LDISKFSSYHELRSELARMFGLEG LEDP RSGWQLVFVDRENDVLLLGDDPW EFV++V
Sbjct  796   LDISKFSSYHELRSELARMFGLEGQLEDPVRSGWQLVFVDRENDVLLLGDDPWPEFVSSV  855

Query  3046  WYIKILSPFEVHQMGKEEGIDLPNNLPAAN--QRLPNGGSSCEVHVSQKETRNM-NGI  3210
             W IKILSP EV QMGK  G++L N+ P++N   +LP+ G +C+   ++ + RN+ NGI
Sbjct  856   WCIKILSPQEVQQMGK-RGLELLNSAPSSNNVDKLPSNG-NCDDFGNRSDPRNLGNGI  911



>ref|NP_174323.1| auxin response factor 6 [Arabidopsis thaliana]
 gb|AAG51093.1|AC025295_1 auxin response factor 6 (ARF6) [Arabidopsis thaliana]
 gb|AAD01513.1| ARF6 [Arabidopsis thaliana]
 gb|AEE31206.1| auxin response factor 6 [Arabidopsis thaliana]
Length=933

 Score =   768 bits (1984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/451 (85%), Positives = 407/451 (90%), Gaps = 12/451 (3%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG NPQ  EG  EK+ LNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSAGFNPQPHEG--EKRVLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP L  QLICQLHNVTMHAD ETDEVYAQMTLQPL+AQEQKD   LPAELG
Sbjct  59    KEVDAHIPNYPSLHPQLICQLHNVTMHADVETDEVYAQMTLQPLNAQEQKD-PYLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PS+QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQEL+A+DLH NEW
Sbjct  118   VPSRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELMARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+ NQLLLGIRRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDKNQLLLGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGI DLDP RW NSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGICDLDPTRWANSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGD--MHISSPLSWLRGNMGDQGIQSLNF  1821
             PLTTFPMYPSPF LRLKRPWP GLPSF GL   D  M +SSPL W      D+G+QSLNF
Sbjct  358   PLTTFPMYPSPFPLRLKRPWPPGLPSFHGLKEDDMGMSMSSPLMW------DRGLQSLNF  411

Query  1822  QGYGITPFMQPRLDAS-MLGLQPDIYQTMAT  1911
             QG G+ P+MQPRLD S +LG+Q D+YQ MA 
Sbjct  412   QGMGVNPWMQPRLDTSGLLGMQNDVYQAMAA  442


 Score =   276 bits (705),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 186/365 (51%), Positives = 234/365 (64%), Gaps = 32/365 (9%)
 Frame = +1

Query  2197  LPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNN--SSTQSLPRSFSHDEASQL  2370
             + +  S +Q   S  Q+++S   QQSFSD  G      NN  S   +L  +FS DE+SQL
Sbjct  581   MSQFGSASQPNTSPLQSMTSLCHQQSFSDTNG-----GNNPISPLHTLLSNFSQDESSQL  635

Query  2371  LNMHETNPLAT---LPSKRIALESQ-----VSSRATPYVVSQADMISPNSKVSDLPTFLP  2526
             L++  TN   T    PSKR A++S        +  T  V+ Q    S  S V      LP
Sbjct  636   LHLTRTNSAMTSSGWPSKRPAVDSSFQHSGAGNNNTQSVLEQLGQ-SHTSNVPPNAVSLP  694

Query  2527  PFPGKE--FPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENG-FLNMPFST  2694
             PFPG      E +G A    ++ L GVN DSS +L+ NG+SNL++ G E G    +PF++
Sbjct  695   PFPGGRECSIEQEGSASDPHSHLLFGVNIDSSSLLMPNGMSNLRSIGIEGGDSTTLPFTS  754

Query  2695  CNFTSGVGTDYPLNPDMGT-SSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLD  2871
              NF +    D+  N  M T SSC+DESGFLQSSEN+   NP + TFVKV+KSGSFGRSLD
Sbjct  755   SNFNN----DFSGNLAMTTPSSCIDESGFLQSSENLGSENPQSNTFVKVYKSGSFGRSLD  810

Query  2872  ISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWY  3051
             ISKFSSYHELRSELARMFGLEG LEDP RSGWQLVFVDRENDVLLLGDDPW EFV++VW 
Sbjct  811   ISKFSSYHELRSELARMFGLEGQLEDPVRSGWQLVFVDRENDVLLLGDDPWPEFVSSVWC  870

Query  3052  IKILSPFEVHQMGKEEGIDLPNNLPAAN--QRLPNGGSSCEVHVSQKETRNM-NGIPL--  3216
             IKILSP EV QMGK  G++L N+ P++N   +LP+ G +C+   ++ + RN+ NGI    
Sbjct  871   IKILSPQEVQQMGK-RGLELLNSAPSSNNVDKLPSNG-NCDDFGNRSDPRNLGNGIASVG  928

Query  3217  GSLDY  3231
             GS +Y
Sbjct  929   GSFNY  933



>ref|XP_010499561.1| PREDICTED: auxin response factor 6-like isoform X1 [Camelina 
sativa]
Length=927

 Score =   768 bits (1982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/457 (84%), Positives = 408/457 (89%), Gaps = 16/457 (4%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG NPQ  E TGEK+ LNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSAGFNPQPHEVTGEKRVLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  60

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP L  QLICQLHNVTMHAD ETDEVYAQMTLQPL+AQEQKD   LPAELG
Sbjct  61    KEVDAHIPNYPSLHPQLICQLHNVTMHADVETDEVYAQMTLQPLNAQEQKD-PYLPAELG  119

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PS+QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQEL+A+DLH NEW
Sbjct  120   VPSRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELMARDLHDNEW  179

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+ NQLLLGIRRANRPQTVMPS
Sbjct  180   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDKNQLLLGIRRANRPQTVMPS  239

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNP------RASPSDFVIPLAKYAKAVYHTR  1449
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNP      RASPS+FVIPLAKY KAVYHTR
Sbjct  240   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRNPLFFRASPSEFVIPLAKYVKAVYHTR  299

Query  1450  VSVGMRFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRV  1629
             VSVGMRFRMLFETEESSVRRYMGTITGI DLDP RW NSHWRSVKVGWDESTAGERQPRV
Sbjct  300   VSVGMRFRMLFETEESSVRRYMGTITGICDLDPTRWANSHWRSVKVGWDESTAGERQPRV  359

Query  1630  SLWEIEPLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGD--MHISSPLSWLRGNMGDQG  1803
             SLWEIEPLTTFPMYPSPF LRLKRPWP GLPSF GL   D  M +SSPL W      D+G
Sbjct  360   SLWEIEPLTTFPMYPSPFPLRLKRPWPPGLPSFHGLKEDDMGMSMSSPLMW------DRG  413

Query  1804  IQSLNFQGYGITPFMQPRLDAS-MLGLQPDIYQTMAT  1911
             +QSLNFQG G+ P+MQPRLD S +LG+Q D+YQ MA 
Sbjct  414   LQSLNFQGMGVNPWMQPRLDTSGLLGMQNDVYQAMAA  450


 Score =   282 bits (722),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 184/356 (52%), Positives = 233/356 (65%), Gaps = 25/356 (7%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQ  2367
             ++++ +  S +QS  S  Q+++S   QQSFSD  G     +  S   SL  +FS DE+SQ
Sbjct  573   VSTMSQFGSASQSNTSPLQSMASLCHQQSFSDTNGG---DNPISPLHSLLSNFSQDESSQ  629

Query  2368  LLNMHETNPLAT---LPSKRIALESQV----SSRATPYVVSQADMISPNSKVSDLPTFLP  2526
             LLN+  TN   T    PSKR A++S      +   T  V+ Q    S  S V      LP
Sbjct  630   LLNLTRTNSAMTSSGWPSKRPAVDSSFQHSGAGNNTQSVMEQLGQ-SHTSNVPPNAVSLP  688

Query  2527  PFPGKE--FPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENG-FLNMPFST  2694
             PFPG      E +G A    ++ L GVN DSS +L+ NG+SNL++ G E G    +PF++
Sbjct  689   PFPGGRECSIEQEGSASDPHSHLLFGVNIDSSSLLMPNGMSNLRSIGIEGGDSTTLPFTS  748

Query  2695  CNFTSGVGTDYPLNPDMGT-SSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLD  2871
              NF +    D+  N  M T SSC+DESGFLQSSEN+   NP + TFVKV+KSGSFGRSLD
Sbjct  749   SNFNN----DFSGNLAMTTPSSCIDESGFLQSSENIGSENPQSNTFVKVYKSGSFGRSLD  804

Query  2872  ISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWY  3051
             ISKFSSYHELRSELARMFGLEG LEDP RSGWQLVFVDRENDVLLLGDDPW EFV++VW 
Sbjct  805   ISKFSSYHELRSELARMFGLEGQLEDPVRSGWQLVFVDRENDVLLLGDDPWPEFVSSVWC  864

Query  3052  IKILSPFEVHQMGKEEGIDLPNNLPAAN--QRLPNGGSSCEVHVSQKETRNM-NGI  3210
             IKILSP EV QMGK  G++L N+ P++N   +LP+ G +C+   ++ + RN+ NGI
Sbjct  865   IKILSPQEVQQMGK-RGLELLNSAPSSNNVDKLPSNG-NCDDFGNRSDPRNLGNGI  918



>ref|XP_006306714.1| hypothetical protein CARUB_v10008239mg [Capsella rubella]
 gb|EOA39612.1| hypothetical protein CARUB_v10008239mg [Capsella rubella]
Length=926

 Score =   768 bits (1982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/451 (85%), Positives = 408/451 (90%), Gaps = 10/451 (2%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG NPQ  E TGEK+ LNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSAGFNPQPHEVTGEKRVLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  60

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP L  QLICQLHNVTMHAD ETDEVYAQMTLQPL+AQEQKD   LPAELG
Sbjct  61    KEVDAHIPNYPSLHPQLICQLHNVTMHADVETDEVYAQMTLQPLNAQEQKD-PYLPAELG  119

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PS+QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQEL+A+DLH NEW
Sbjct  120   VPSRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELMARDLHDNEW  179

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+ NQLLLGIRRANRPQTVMPS
Sbjct  180   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDKNQLLLGIRRANRPQTVMPS  239

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  240   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  299

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGI DLDP RW NSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  300   FRMLFETEESSVRRYMGTITGICDLDPTRWANSHWRSVKVGWDESTAGERQPRVSLWEIE  359

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGD--MHISSPLSWLRGNMGDQGIQSLNF  1821
             PLTTFPMYPSPF LRLKRPWP GLPSF GL   D  M +SSPL W      D+G+QSLNF
Sbjct  360   PLTTFPMYPSPFPLRLKRPWPPGLPSFHGLKEDDMSMSMSSPLMW------DRGLQSLNF  413

Query  1822  QGYGITPFMQPRLDAS-MLGLQPDIYQTMAT  1911
             QG G+ P+MQPRLD S +LG+Q D+YQ MA 
Sbjct  414   QGMGVNPWMQPRLDTSGLLGMQNDVYQAMAA  444


 Score =   281 bits (720),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 186/358 (52%), Positives = 233/358 (65%), Gaps = 29/358 (8%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNN--SSTQSLPRSFSHDEA  2361
             ++++ +  S +QS  S  Q+++S   QQSFSD  G      NN  S   SL  +FS DE+
Sbjct  572   VSAMSQFGSASQSNTSPLQSMASLCHQQSFSDTNGG-----NNPISPLHSLLSNFSQDES  626

Query  2362  SQLLNMHETNPLAT---LPSKRIALESQ----VSSRATPYVVSQADMISPNSKVSDLPTF  2520
             SQLLN+  TN   T    PSKR A++S     V    T  V+ Q    S  S V      
Sbjct  627   SQLLNLTRTNSAMTSSGWPSKRPAVDSSFQHSVPGNNTQSVMEQLGQ-SHTSNVPPNAVS  685

Query  2521  LPPFPGKE--FPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENG-FLNMPF  2688
             LPPFPG      E +G A    ++ L GVN DSS +L+ NG+SNL++ G E G    +PF
Sbjct  686   LPPFPGGRECSIEQEGSASDPHSHLLFGVNIDSSSLLMPNGMSNLRSIGIEGGDSTTLPF  745

Query  2689  STCNFTSGVGTDYPLNPDMGT-SSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRS  2865
             ++ N  +    D+  N  M T SSC+DESGFLQSSEN+   NP + TFVKV+KSGSFGRS
Sbjct  746   TSSNLNN----DFSGNLAMTTPSSCIDESGFLQSSENLGSENPQSNTFVKVYKSGSFGRS  801

Query  2866  LDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNV  3045
             LDISKFSSYHELRSELARMFGLEG LEDP RSGWQLVFVDRENDVLLLGDDPW EFV++V
Sbjct  802   LDISKFSSYHELRSELARMFGLEGQLEDPVRSGWQLVFVDRENDVLLLGDDPWPEFVSSV  861

Query  3046  WYIKILSPFEVHQMGKEEGIDLPNNLPAAN--QRLPNGGSSCEVHVSQKETRNM-NGI  3210
             W IKILSP EV QMGK  G++L N+ P++N   +LP+ G +C+   ++ + RN+ NGI
Sbjct  862   WCIKILSPQEVQQMGK-RGLELLNSAPSSNNVDKLPSNG-NCDDFGNRSDPRNLGNGI  917



>ref|XP_010478417.1| PREDICTED: auxin response factor 6 isoform X1 [Camelina sativa]
Length=928

 Score =   767 bits (1981),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/457 (84%), Positives = 407/457 (89%), Gaps = 16/457 (4%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG NPQ  E TGEK+ LNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSAGFNPQPHEVTGEKRVLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  60

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP L  QLICQLHNVTMHAD ETDEVYAQMTLQPL+AQEQKD   LPAELG
Sbjct  61    KEVDAHIPNYPSLHPQLICQLHNVTMHADVETDEVYAQMTLQPLNAQEQKD-PYLPAELG  119

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PS+QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQEL+A+DLH NEW
Sbjct  120   VPSRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELMARDLHDNEW  179

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+ NQLLLGIRRANRPQTVMPS
Sbjct  180   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDKNQLLLGIRRANRPQTVMPS  239

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNP------RASPSDFVIPLAKYAKAVYHTR  1449
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNP      RASPS+FVIPLAKY KAVYHTR
Sbjct  240   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRNPLFFRASPSEFVIPLAKYVKAVYHTR  299

Query  1450  VSVGMRFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRV  1629
             VSVGMRFRMLFETEESSVRRYMGTITGI DLDP RW NSHWRSVKVGWDESTAGERQPRV
Sbjct  300   VSVGMRFRMLFETEESSVRRYMGTITGICDLDPTRWANSHWRSVKVGWDESTAGERQPRV  359

Query  1630  SLWEIEPLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGD--MHISSPLSWLRGNMGDQG  1803
             SLWEIEPLTTFPMYPSPF LRLKRPWP GLPSF GL   D  M +SSPL W      D+G
Sbjct  360   SLWEIEPLTTFPMYPSPFPLRLKRPWPPGLPSFHGLKEDDMGMSMSSPLMW------DRG  413

Query  1804  IQSLNFQGYGITPFMQPRLDAS-MLGLQPDIYQTMAT  1911
             +QSLNFQG G+ P+MQPRLD S  LG+Q D+YQ MA 
Sbjct  414   LQSLNFQGMGVNPWMQPRLDTSGFLGMQNDVYQAMAA  450


 Score =   283 bits (725),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 186/358 (52%), Positives = 234/358 (65%), Gaps = 29/358 (8%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNN--SSTQSLPRSFSHDEA  2361
             ++++ +  S +QS  S  Q+++S   QQSFSD  G      NN  S   SL  +FS DE+
Sbjct  574   VSTMSQFGSASQSNTSPLQSMASLCHQQSFSDTNGG-----NNPISPLHSLLSNFSQDES  628

Query  2362  SQLLNMHETNPLAT---LPSKRIALESQV----SSRATPYVVSQADMISPNSKVSDLPTF  2520
             SQLLN+  TN   T    PSKR A++S      +   T  V+ Q    S  S V      
Sbjct  629   SQLLNLTRTNSAMTSSGWPSKRPAVDSSFQHSGAGNNTQSVMEQLGQ-SHTSNVPPNAVS  687

Query  2521  LPPFPGKE--FPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENG-FLNMPF  2688
             LPPFPG      E +G A    ++ L GVN DSS +L+ NG+SNL++ G E G    +PF
Sbjct  688   LPPFPGGRECSIEQEGSASDPHSHLLFGVNIDSSSLLMPNGMSNLRSIGIEGGDSTTLPF  747

Query  2689  STCNFTSGVGTDYPLNPDMGT-SSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRS  2865
             ++ NF +    D+  N  M T SSC+DESGFLQSSEN+   NP + TFVKV+KSGSFGRS
Sbjct  748   TSSNFNN----DFSGNLAMTTPSSCIDESGFLQSSENIGSENPQSNTFVKVYKSGSFGRS  803

Query  2866  LDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNV  3045
             LDISKFSSYHELRSELARMFGLEG LEDP RSGWQLVFVDRENDVLLLGDDPW EFV++V
Sbjct  804   LDISKFSSYHELRSELARMFGLEGQLEDPVRSGWQLVFVDRENDVLLLGDDPWPEFVSSV  863

Query  3046  WYIKILSPFEVHQMGKEEGIDLPNNLPAAN--QRLPNGGSSCEVHVSQKETRNM-NGI  3210
             W IKILSP EV QMGK  G++L N+ P++N   +LP+ G +C+   ++ + RN+ NGI
Sbjct  864   WCIKILSPQEVQQMGK-RGLELLNSAPSSNNVDKLPSNG-NCDDFGNRSDPRNLGNGI  919



>gb|KHG10285.1| Auxin response factor 6 -like protein [Gossypium arboreum]
Length=843

 Score =   764 bits (1973),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/433 (87%), Positives = 402/433 (93%), Gaps = 3/433 (1%)
 Frame = +1

Query  613   TGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAHIPSYPGLPA  792
              GEK+ LNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV A+TNKE+DAHIP+YP LP 
Sbjct  47    AGEKRVLNSELWHACAGPLVSLPHVGSRVVYFPQGHSEQVAATTNKEVDAHIPNYPSLPP  106

Query  793   QLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPTNYFCKTLT  972
             QLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQK+   LPAELG PSKQPTNYFCKTLT
Sbjct  107   QLICQLHNVTMHADVETDEVYAQMTLQPLSPQEQKE-AYLPAELGTPSKQPTNYFCKTLT  165

Query  973   ASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFRGQPKRHLL  1152
             ASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NEWKFRH+FRGQPKRHLL
Sbjct  166   ASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNEWKFRHIFRGQPKRHLL  225

Query  1153  TTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLLaa  1332
             TTGWSVFVSAKRLVAGD+V+FIWN+ NQLLLGIRRANRPQTVMPSSVLSSDSMH+GLLAA
Sbjct  226   TTGWSVFVSAKRLVAGDSVLFIWNDKNQLLLGIRRANRPQTVMPSSVLSSDSMHLGLLAA  285

Query  1333  aahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFETEESSVRRY  1512
             AAHAAATNSRFTIFYNPRASPS+FVI L+KY KAVYHTRVSVGMRFRMLFETEESSVRRY
Sbjct  286   AAHAAATNSRFTIFYNPRASPSEFVITLSKYVKAVYHTRVSVGMRFRMLFETEESSVRRY  345

Query  1513  MGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFSLR  1692
             MGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWE+EPLTTFPMYPSPF LR
Sbjct  346   MGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEVEPLTTFPMYPSPFPLR  405

Query  1693  LKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPFMQPRLDASM  1872
             LKRPWP GLPSF GL + D+ +SS L WL+G+ G +G+Q LNFQG G++P+MQPRLDASM
Sbjct  406   LKRPWPPGLPSFHGLKDDDLGMSS-LMWLQGDAG-RGMQHLNFQGIGVSPWMQPRLDASM  463

Query  1873  LGLQPDIYQTMAT  1911
             LGLQ D+YQ MA 
Sbjct  464   LGLQTDMYQAMAA  476


 Score =   309 bits (792),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 187/340 (55%), Positives = 238/340 (70%), Gaps = 15/340 (4%)
 Frame = +1

Query  2233  SHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMHETNPLATL--  2406
             S  Q++ S   QQSFSD  GN V +   S   SL  SF  DE+S LLN+  T P+ T   
Sbjct  512   SPLQSIPSLGQQQSFSDSNGNPVTSPVVSPLHSLLGSFPQDESSNLLNLPRTTPVMTTSA  571

Query  2407  -PSKRIALESQVSSRATPYVVSQADMISPN-SKVSDLPTFLPPFPGKEFPEYQGVAYSQG  2580
              PSKR A++  +SS +   V+ Q + + P+ + +S     LPPFPG+E    QG    Q 
Sbjct  572   WPSKRAAVDV-LSSGSPQCVLPQVEQLGPSQTNMSQNSISLPPFPGRECSIDQGGTDPQ-  629

Query  2581  NNALLGVNTD-SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSS  2757
             ++ L GVN + SS+L+QNG+S L+  G ++   ++PF + N+ S  G D+ +NP M  SS
Sbjct  630   SHLLFGVNIEPSSVLMQNGMSGLRGVGTDSDSTSIPFFS-NYMSTAGNDFSVNPAMAPSS  688

Query  2758  CVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEG  2937
             C+DESGFLQS ENV Q+NP  RTFVKV+KSGSFGRSLDIS FS+Y+ELRSELA MFGLEG
Sbjct  689   CIDESGFLQSQENVGQSNPQTRTFVKVYKSGSFGRSLDISAFSNYNELRSELAHMFGLEG  748

Query  2938  LLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPN  3117
              LEDP RSGWQLVFVDRENDVLLLGDDPW EFVN+VW IKILSP EV QMGK  G++L N
Sbjct  749   QLEDPLRSGWQLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQQMGK-RGLELLN  807

Query  3118  NLPAANQRLPNGGSSCEVHVSQKETRNM-NGIP-LGSLDY  3231
             ++P   QRL NG  SC+ +VS++++RN+ +GI  +GSLDY
Sbjct  808   SVPV--QRLSNG--SCDDYVSRQDSRNLSSGIASVGSLDY  843



>ref|XP_009115165.1| PREDICTED: auxin response factor 6 isoform X2 [Brassica rapa]
Length=903

 Score =   766 bits (1978),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/453 (84%), Positives = 407/453 (90%), Gaps = 14/453 (3%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG NPQ  EG  EK+ LNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSTAGFNPQPHEG--EKRVLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP L  QLICQLHNVTMHAD ETDEVYAQMTLQPL+AQEQKD   LPAELG
Sbjct  59    KEVDAHIPNYPSLHPQLICQLHNVTMHADVETDEVYAQMTLQPLNAQEQKD-PYLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PS+QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQEL+A+DLH NEW
Sbjct  118   VPSRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELMARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+ N+L LGIRRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDKNRLFLGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGI DLDP RW NSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGICDLDPTRWANSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMH----ISSPLSWLRGNMGDQGIQSL  1815
             PLTTFPMYPSPF LRLKRPWP GLPSF GL   DM     +SSPL W      D+G+QSL
Sbjct  358   PLTTFPMYPSPFPLRLKRPWPPGLPSFHGLKEDDMSMGMGMSSPLMW------DRGLQSL  411

Query  1816  NFQGYGITPFMQPRLDAS-MLGLQPDIYQTMAT  1911
             NFQG G+ P+MQPRLDAS +LG+Q D+YQ MA 
Sbjct  412   NFQGMGVNPWMQPRLDASGLLGMQNDVYQAMAA  444


 Score =   256 bits (655),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 179/355 (50%), Positives = 226/355 (64%), Gaps = 33/355 (9%)
 Frame = +1

Query  2242  QALSSTVPQQSFSDLVGNHVMTSNN--SSTQSLPRSFSHDEASQLLNMHETNPLATL---  2406
             Q+++S   QQSF D  G +    NN  S   +L  +FS DE+SQLLN+  T   A +   
Sbjct  557   QSMTSLCQQQSFLDTNGGN----NNPMSPLHTLLSNFSQDESSQLLNLTRTTNSAAMTSS  612

Query  2407  --PSKR--IALESQVSSRATPYVVSQADMISPNSKVSDLPTFLPPFPG--KEFP-EYQGV  2565
               PSKR  + L S  ++  T  V+ Q       S V      LPPFPG  +E   E +G 
Sbjct  613   GWPSKRPAVDLSSFGNNSNTQSVIEQLGQSHSTSNVPPNAVSLPPFPGGGRECSIEQEGG  672

Query  2566  AYSQGNNALL-GVNTDSS-ILLQNGISNLKNSGGENG-FLNMPFSTCNFTSGVGTDYPLN  2736
             + S  ++ LL GVN DSS +L+ NG+SNL++ G E G    +PF+T NF +        N
Sbjct  673   SPSDPHSHLLFGVNIDSSSLLMPNGMSNLRSIGIEGGDSTTLPFTTSNFNNDFSGG---N  729

Query  2737  PDMGT-SSCVDESGFLQSSENVDQANP-PNRTFVKVHKSGSFGRSLDISKFSSYHELRSE  2910
               M T SSC+DE GFLQSSEN+   N   N TFVKV+KSGSFGRSLDI+KFSSYHELRSE
Sbjct  730   LAMTTPSSCLDEPGFLQSSENLGSENQQSNNTFVKVYKSGSFGRSLDITKFSSYHELRSE  789

Query  2911  LARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMG  3090
             LARMFGLEG LEDP RSGWQLVFVDRENDVLLLGDDPW EFV++VW IKILSP EV QMG
Sbjct  790   LARMFGLEGQLEDPVRSGWQLVFVDRENDVLLLGDDPWPEFVSSVWCIKILSPQEVQQMG  849

Query  3091  KEEGIDLPNNLPAAN-----QRLPNGGSSCEVHVSQKETRNM-NGIPL--GSLDY  3231
             K  G++L N+ P ++     ++LP+   +C+   ++ + RN+ NGI    GS +Y
Sbjct  850   K-RGLELLNSAPPSSNNNVVEKLPSNNGNCDDFGNRSDPRNLGNGIASVGGSFNY  903



>ref|XP_008225531.1| PREDICTED: auxin response factor 6 [Prunus mume]
Length=889

 Score =   764 bits (1973),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/448 (84%), Positives = 405/448 (90%), Gaps = 4/448 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG +PQ++EG  EK+ LNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSAGFSPQSQEG--EKRVLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQKD   LPA LG
Sbjct  59    KEVDAHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLSPQEQKD-GYLPAGLG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              P+KQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NEW
Sbjct  118   NPNKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPR       IPL KY KAVYHT +SVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRYESLQXXIPLTKYIKAVYHTCISVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDP RWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDP-RWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  356

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRLKRPWP GLPSF G+ + D+ ++S L WLRG+ GD+GIQSLNF G
Sbjct  357   PLTTFPMYPSPFPLRLKRPWPPGLPSFHGIRDDDLGMNSQLMWLRGDNGDRGIQSLNFPG  416

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
              G+TP+MQPRLDASM+GLQ D+YQ MA 
Sbjct  417   IGVTPYMQPRLDASMIGLQTDMYQAMAA  444


 Score =   304 bits (779),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 180/333 (54%), Positives = 225/333 (68%), Gaps = 12/333 (4%)
 Frame = +1

Query  2251  SSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMHETNPLAT---LPSKRI  2421
             +S   QQSFSD  GN   ++  S   SL  SF  DE S LLN+  TN L +    PSKR 
Sbjct  563   TSLCQQQSFSDSNGNPATSTILSPLHSLMGSFPQDEPSHLLNLPRTNQLVSSGAWPSKRA  622

Query  2422  ALESQVSSRATPYVVSQADMISP-NSKVSDLPTFLPPFPGKEFPEYQGVAYSQGNNALLG  2598
             A+E  +SS  +  V+   + + P  + +S     LPPFPG+E    Q  +    ++ L G
Sbjct  623   AIEPLLSSGVSQCVLPHVEQLGPPQTTISQNSISLPPFPGRECSIDQEGSTDPQSHLLFG  682

Query  2599  VNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESG  2775
             VN +SS +L+QNG+SNL+  G ++    M F   N+ S  GTD+ LNP +  SSC+DESG
Sbjct  683   VNIESSSLLMQNGMSNLRGVGSDSDSTTMHFPP-NYLSTTGTDFSLNPAVTPSSCIDESG  741

Query  2776  FLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPE  2955
             FLQS ENV   N  N  FVKV+KSGSFGRSLDI+KFSSYHELR ELARMFGLEG LEDP 
Sbjct  742   FLQSPENVGHGNTLNNNFVKVYKSGSFGRSLDITKFSSYHELRGELARMFGLEGELEDPV  801

Query  2956  RSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAAN  3135
             RSGWQLVFVDRENDVLLLGDDPW EFVN+VW IKILSP EV QMGK  G+DL  ++P   
Sbjct  802   RSGWQLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPHEVQQMGK-RGLDLLKSVPT--  858

Query  3136  QRLPNGGSSCEVHVSQKETRNMNGI-PLGSLDY  3231
             QRL N  +SC+ + S++++RN++GI  +GSL+Y
Sbjct  859   QRLSN--NSCDDYGSRQDSRNLSGITSVGSLEY  889



>ref|XP_011012265.1| PREDICTED: auxin response factor 6-like [Populus euphratica]
Length=902

 Score =   764 bits (1974),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/448 (84%), Positives = 404/448 (90%), Gaps = 4/448 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR S AG NPQ  E   EK+ LNSELWHACAGPLVSLP +GSR VYFPQGHSEQV ASTN
Sbjct  1     MRHSSAGFNPQTHEV--EKRVLNSELWHACAGPLVSLPAVGSRAVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DA IPSYP LPAQLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQKD   LPA++G
Sbjct  59    KEVDAQIPSYPSLPAQLICQLHNVTMHADVETDEVYAQMTLQPLSPQEQKD-AYLPADMG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NEW
Sbjct  118   TPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSA RLVAGD+V+FIWNE NQLLLGI+RA RPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSATRLVAGDSVLFIWNEKNQLLLGIKRAIRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVY+TRVSVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYLKAVYYTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRM+FETEESSVRRYMGTITGISDLD VRWPNS WRS KVGWDEST GERQPRVSLWEIE
Sbjct  298   FRMMFETEESSVRRYMGTITGISDLDAVRWPNSQWRSAKVGWDESTDGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFP YPSPF LRLKRPW  GLPSF G+ N D+  +S L WLRG+ GD G+QSLNFQG
Sbjct  358   PLTTFPTYPSPFPLRLKRPWSPGLPSFHGIKNDDLGKNSSLMWLRGD-GDCGVQSLNFQG  416

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
              G++P++QPR+DASMLGLQ D+YQTMAT
Sbjct  417   TGVSPWVQPRVDASMLGLQNDVYQTMAT  444


 Score =   309 bits (792),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 185/347 (53%), Positives = 238/347 (69%), Gaps = 14/347 (4%)
 Frame = +1

Query  2212  STTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMHETN  2391
             S +QS     QA+S    Q S+SD  G        SS QSL  SF  +E+S LL++   N
Sbjct  560   SASQSLTPPLQAIS-LCQQHSYSDSNGKPATIPVVSSLQSLLDSFPPNESSHLLSLPRIN  618

Query  2392  PLAT---LPSKRIALESQVSSRATPYVVSQADMISP-NSKVSDLPTFLPPFPGKEFPEYQ  2559
             PL T    PSKR A+ES  SS A   +V+Q + +    + ++     LPPFPG+E    Q
Sbjct  619   PLVTSSGWPSKRAAVESLTSSGAPQCMVTQVEQLGLLQTSITPSSVSLPPFPGRECSIDQ  678

Query  2560  GVAYSQGNNALLGVNTD-SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLN  2736
                  Q N+ L GVN + SS+LLQNG+S+L+  G ++    +PFS+ N+ S  GT++ LN
Sbjct  679   DGGTDQQNHLLFGVNIEPSSLLLQNGMSSLRGVGSDSDSTTIPFSS-NYMSTAGTNFSLN  737

Query  2737  PDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELA  2916
             P M  SSC+DES FLQS+ENV Q NPP RTFVKV+KSGSFGRSLDI+KFS+Y+ELRSEL+
Sbjct  738   PAMTPSSCIDESCFLQSTENVSQGNPPTRTFVKVYKSGSFGRSLDITKFSNYNELRSELS  797

Query  2917  RMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKE  3096
             RMFGLEG LEDP RSGWQLVF+DRENDVLLLGD PW EFVN+VW IKILSP EV QMGK 
Sbjct  798   RMFGLEGQLEDPLRSGWQLVFIDRENDVLLLGDGPWPEFVNSVWCIKILSPQEVQQMGK-  856

Query  3097  EGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMN-GI-PLGSLDY  3231
              G++L N+ P   QRL NG  SC+ + +++++++++ GI  +GSLDY
Sbjct  857   RGLELLNSFPI--QRLSNG--SCDDYANRQDSKSLSTGITSVGSLDY  899



>ref|XP_010923656.1| PREDICTED: auxin response factor 17 isoform X1 [Elaeis guineensis]
 ref|XP_010923657.1| PREDICTED: auxin response factor 17 isoform X1 [Elaeis guineensis]
Length=950

 Score =   766 bits (1977),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/444 (86%), Positives = 405/444 (91%), Gaps = 6/444 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S +G+  Q +EG  E+KCLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSTSGLPQQTQEG--EQKCLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KEIDAHIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS +EQKD+  LPAELG
Sbjct  59    KEIDAHIPNYPNLPPQLICQLHNVTMHADAETDEVYAQMTLQPLSPEEQKDL-YLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
               SKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPP QELIA+DLH NEW
Sbjct  118   TLSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPVQELIARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+VIFIWNENNQLLLGIRRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVIFIWNENNQLLLGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLS DSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  238   SVLSCDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSF-PGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQ  1824
             PLTTFPMYPS F LRLKRPWPSGLPS   G  + ++ ++    WLR   GD G+ SL+FQ
Sbjct  358   PLTTFPMYPSAFPLRLKRPWPSGLPSLHAGGKDDEIGLNPSPMWLRD--GDHGLPSLSFQ  415

Query  1825  GYGITPFMQPRLDASMLGLQPDIY  1896
             G G+TP+MQPRL+ASMLGLQPD+Y
Sbjct  416   GLGVTPWMQPRLNASMLGLQPDLY  439


 Score =   294 bits (753),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 185/354 (52%), Positives = 230/354 (65%), Gaps = 17/354 (5%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQ  2367
             ++SL ++ ST+QS  S  Q +SS   QQ+F     N    S  S   S+ RSFS +E S 
Sbjct  608   VSSLSQLASTSQSPSSSLQTISSFCQQQTFPGTTMNAASISGVSPLHSILRSFSPEETSN  667

Query  2368  LLNMHETNPLAT---LPSKRIALESQVSSRATPYVVSQADMISPNSKVSDLPTFLPPFPG  2538
             +LN+  T  L+T     SKR+A+ES +SS  T  V  Q + +   S +S     LPPFPG
Sbjct  668   ILNLPRTTSLSTSGTWSSKRLAVESMLSS-GTQCVQPQVEQLDQQSNISQHSVTLPPFPG  726

Query  2539  KEFPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSGV  2715
             K+    Q       N+ L GV+ DSS +L+QNGI NL++ G E     MPF T       
Sbjct  727   KDCLLDQECNTDPQNHVLFGVHIDSSSLLMQNGIKNLRSVGSETDSTAMPFLT-----AA  781

Query  2716  GTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYH  2895
             GTD+PLN  + +S+C +ESG LQS EN    NP N TFVKV+KSGSFGRSLDI++F+SY 
Sbjct  782   GTDFPLNQALTSSNCAEESGLLQSPENGGHVNPQNGTFVKVYKSGSFGRSLDITRFNSYP  841

Query  2896  ELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFE  3075
             ELRSEL R+FGLEG LEDP RSGWQLVFVDRENDVLLLGDDPWQEFVNNVW IKILSP E
Sbjct  842   ELRSELGRLFGLEGQLEDPMRSGWQLVFVDRENDVLLLGDDPWQEFVNNVWCIKILSPQE  901

Query  3076  VHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNM-NGIP-LGSLDY  3231
             V QMGKE G  L     A ++RLP  GS C+ + S++++R+M NGI  +  LDY
Sbjct  902   VQQMGKEGGELLST---APSKRLP--GSGCDGYSSRQDSRSMRNGIASVMPLDY  950



>ref|XP_003593869.1| Auxin response factor [Medicago truncatula]
 gb|AES64120.1| auxin response factor 2 [Medicago truncatula]
Length=908

 Score =   764 bits (1972),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/448 (83%), Positives = 405/448 (90%), Gaps = 5/448 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S A  +P  +EG  EK+ L+SELWHACAGPLVSLP +GSRVVYFPQGHSEQV  STN
Sbjct  1     MRLSSASFSPPPQEG--EKRVLDSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAVSTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP LP QLICQLHN+TMHAD ETDEVYAQMTLQPL+AQEQK+   LPAELG
Sbjct  59    KEVDAHIPNYPSLPPQLICQLHNLTMHADVETDEVYAQMTLQPLNAQEQKE-AYLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLHGNEW
Sbjct  118   TPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHGNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA+RPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRASRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRA PS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRACPSEFVIPLAKYVKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGI DLD VRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGICDLDSVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRLKRPWP GLPSF G+ + D  +SSPL WLR    D+G+QSLN+QG
Sbjct  358   PLTTFPMYPSPFPLRLKRPWPPGLPSFHGMKDDDFGMSSPLMWLRDT--DRGLQSLNYQG  415

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
              G+ P+MQPR D +ML +Q D+YQ +A 
Sbjct  416   IGVNPWMQPRFDPAMLNMQTDMYQAVAA  443


 Score =   268 bits (686),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 179/366 (49%), Positives = 234/366 (64%), Gaps = 21/366 (6%)
 Frame = +1

Query  2176  MSKPITSLPRMNSTTQSQLSH-FQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSH  2352
             +S  ++++ +  S TQ Q     QALSS   QQSFSD   N   T  +     +  SF H
Sbjct  550   ISGSVSTMSQFVSATQPQSPPPMQALSSLCHQQSFSDSNVNSSTTIVSPLHSIMGSSFPH  609

Query  2353  DEASQLLNMHETNPLATL------PSKRIALESQVSSRATPYVVSQADMIS-PNSKVSDL  2511
             DE+S L+++  T+    +      PSKRIA++  +SS A+  ++ Q + +    + +S  
Sbjct  610   DESSLLMSLPRTSSWVPVQNSTGWPSKRIAVDPLLSSGASQCILPQVEQLGQARNSMSQN  669

Query  2512  PTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTD-SSILLQNGISNLKN-SGGENGFLNMP  2685
                LPPFPG+E    Q  +    +N L GVN D SS+LL NG+SN K  SG  N    M 
Sbjct  670   AITLPPFPGRECSIDQEGSNDPQSNLLFGVNIDPSSLLLHNGMSNFKGISGNNNDSSTMS  729

Query  2686  F-STCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPP-NRTFVKVHKSGSFG  2859
             +  + ++ +  G D  LN   G +  + ESGFL + EN +Q N P N+TFVKV+KSGSFG
Sbjct  730   YHQSSSYMNTAGADSSLN--HGVTPSIGESGFLHTQENGEQGNNPLNKTFVKVYKSGSFG  787

Query  2860  RSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVN  3039
             RSLDI+KFSSY+ELRSELARMFGLEG LEDP RSGWQLVFVDRENDVLLLGD PW EFVN
Sbjct  788   RSLDITKFSSYNELRSELARMFGLEGELEDPVRSGWQLVFVDRENDVLLLGDGPWPEFVN  847

Query  3040  NVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNM-NGI-P  3213
             +VW IKILSP EV QMG   G+ L N++P   QRL N  S C+ +VS++++RN+ +GI  
Sbjct  848   SVWCIKILSPEEVQQMGN-TGLGLLNSVPI--QRLSN--SICDDYVSRQDSRNLSSGITT  902

Query  3214  LGSLDY  3231
             +GSLDY
Sbjct  903   VGSLDY  908



>ref|XP_004293501.1| PREDICTED: auxin response factor 17-like [Fragaria vesca subsp. 
vesca]
Length=880

 Score =   762 bits (1968),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/447 (84%), Positives = 408/447 (91%), Gaps = 3/447 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG +PQ +EG  EK+ LNSELWHACAGPLV LP +GSRVVYFPQGHSEQVTASTN
Sbjct  1     MRLSSAGFSPQPQEG--EKRVLNSELWHACAGPLVCLPAVGSRVVYFPQGHSEQVTASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
              E+D+HIP++P LP QLICQLHNVTMHAD ETDEVYAQMTLQPL+ QEQKD   LPA LG
Sbjct  59    MEVDSHIPNHPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLNPQEQKD-GYLPAGLG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              P+KQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NEW
Sbjct  118   SPNKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAA+TNSRFTIFYNPRASPS+FVIPLAKY KAVYHT +SVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAASTNSRFTIFYNPRASPSEFVIPLAKYIKAVYHTHISVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLD  RWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDAARWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LRLKRPWP GLPS+ GL   D +++SPL WLRG+ GD+GIQSLN+ G
Sbjct  358   PLTTFPMYPSSFPLRLKRPWPPGLPSYNGLREDDHNMNSPLLWLRGDTGDRGIQSLNYHG  417

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMA  1908
              G+TP+MQPR DASM+GLQ D+YQ MA
Sbjct  418   IGVTPWMQPRFDASMIGLQTDMYQAMA  444


 Score =   288 bits (736),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 177/355 (50%), Positives = 231/355 (65%), Gaps = 23/355 (6%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQ  2367
             I+S+ +  S +QS+   FQ ++S   QQSF D  GN   ++  S   SL  SFS DE+S 
Sbjct  542   ISSMNQFASASQSRSPSFQVITSPCQQQSFPDSNGNSATSTTLSPLSSLMGSFSQDESSN  601

Query  2368  LLNMHETNPLAT---LPSKRIALESQVSSRATPYVVSQADMISP-NSKVSDLPTFLPPFP  2535
             LLN+  TNPL +    PSKR A+E  +SS     V+ Q + + P  + +S  P  LPPFP
Sbjct  602   LLNVPRTNPLLSSSGWPSKRAAIEPLLSSGVPQCVLPQVEQLGPPQTTISHSPISLPPFP  661

Query  2536  GKEFPEYQGVAYSQGNNALLGVNTDSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGV  2715
             G+E    Q  +     + L G+N          +SNL+  G ++    + F + N+ S  
Sbjct  662   GRECSIDQEGSTDPQTHLLFGIN----------MSNLRAVGSDSVSTTIHFPS-NYMSTT  710

Query  2716  GTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYH  2895
              TD+ LNP +  S+C+DESGFLQS ENV   N PN  FVKV+KSGS+GRSLDI+KFSSYH
Sbjct  711   ETDFSLNPAVTPSNCIDESGFLQSPENVGHENQPNGNFVKVYKSGSYGRSLDITKFSSYH  770

Query  2896  ELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFE  3075
             ELR ELARMFGL+G LEDP RSGWQLVFVDRENDVLLLGDDPW EFVN+VW IKILSP E
Sbjct  771   ELRRELARMFGLDGELEDPVRSGWQLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQE  830

Query  3076  VHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVH-VSQKETRNM-NGI-PLGSLDY  3231
             V QMGK  G++L  ++P   QRL    +SC+ +  S++++RN+ +GI  +GSL+Y
Sbjct  831   VQQMGK-RGLELLKSVPM--QRL--SSNSCDDYGGSRQDSRNLSSGITSVGSLEY  880



>ref|XP_008794474.1| PREDICTED: auxin response factor 17 [Phoenix dactylifera]
Length=944

 Score =   764 bits (1973),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/443 (85%), Positives = 405/443 (91%), Gaps = 5/443 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S +G+  Q +EG  E+KCLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSTSGLPQQTQEG--EQKCLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KEIDAHIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS +EQKD+  LPAELG
Sbjct  59    KEIDAHIPNYPNLPPQLICQLHNVTMHADAETDEVYAQMTLQPLSLEEQKDL-YLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
               SKQPTNYFCKTLTASDTSTHGGFSVPRR+AEKVFPPLD+SQQPP QELIA+DLH NEW
Sbjct  118   TLSKQPTNYFCKTLTASDTSTHGGFSVPRRSAEKVFPPLDFSQQPPVQELIARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+VIFIWNENNQLLLGIRRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVIFIWNENNQLLLGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLS DSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  238   SVLSCDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRW NSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDPVRWQNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LRLKRPWPSGLPS  G  + ++ ++ P  WLR   GD G+ SL+FQG
Sbjct  358   PLTTFPMYPSAFPLRLKRPWPSGLPSLHGGKDDEIGLNLPPMWLRD--GDHGLPSLSFQG  415

Query  1828  YGITPFMQPRLDASMLGLQPDIY  1896
              G+TP+MQPRL+ASMLGLQPD++
Sbjct  416   LGVTPWMQPRLNASMLGLQPDMH  438


 Score =   292 bits (747),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 182/355 (51%), Positives = 231/355 (65%), Gaps = 20/355 (6%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVG-NHVMTSNNSSTQSLPRSFSHDEAS  2364
             ++SL ++ ST+QS  S  Q LSS   QQ+F      N    S  S   S+ RSFS +E S
Sbjct  603   VSSLSQLASTSQSP-SSLQTLSSFCQQQTFPGTTNMNPASMSGVSPLHSILRSFSPEETS  661

Query  2365  QLLNMHETNPLAT---LPSKRIALESQVSSRATPYVVSQADMISPNSKVSDLPTFLPPFP  2535
              +LN   T+ ++T     SKR+A+ES + S  T  +  Q + +   S +S     LPPFP
Sbjct  662   NILNFPRTSSVSTSGTWSSKRLAVESMLPS-GTQCMQPQVEQLDQQSNISQHSVTLPPFP  720

Query  2536  GKEFPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSG  2712
             GK+    Q       N+ L GV+ DSS +L+QNG+ NL++ G E     MPF T      
Sbjct  721   GKDCLLDQECNTDPQNHLLFGVHIDSSPLLMQNGMRNLRSVGSETDSTAMPFLT-----A  775

Query  2713  VGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSY  2892
              GTD+PLN  + +SSC +E G LQSSEN    NP N TFVKV+KSGSFGRSLDI++F++Y
Sbjct  776   AGTDFPLNQVLTSSSCAEEPGLLQSSENGVHVNPQNGTFVKVYKSGSFGRSLDITRFNNY  835

Query  2893  HELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPF  3072
              ELRSEL R+FGLEG LEDP RSGWQLVFVDRENDVLLLGDDPWQEFVNNVW IKIL+P 
Sbjct  836   PELRSELGRLFGLEGQLEDPMRSGWQLVFVDRENDVLLLGDDPWQEFVNNVWCIKILAPQ  895

Query  3073  EVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNM-NGIP-LGSLDY  3231
             EV QMGK  G +LP+  P+  +RLP  GS C+ + S++++RNM NGI  +  LDY
Sbjct  896   EVQQMGK--GGELPSAAPS--KRLP--GSGCDGYASRQDSRNMSNGIASVMPLDY  944



>ref|XP_010499562.1| PREDICTED: auxin response factor 6-like isoform X2 [Camelina 
sativa]
Length=925

 Score =   762 bits (1968),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/457 (84%), Positives = 407/457 (89%), Gaps = 18/457 (4%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG NPQ  EG  EK+ LNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSAGFNPQPHEG--EKRVLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP L  QLICQLHNVTMHAD ETDEVYAQMTLQPL+AQEQKD   LPAELG
Sbjct  59    KEVDAHIPNYPSLHPQLICQLHNVTMHADVETDEVYAQMTLQPLNAQEQKD-PYLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PS+QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQEL+A+DLH NEW
Sbjct  118   VPSRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELMARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+ NQLLLGIRRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDKNQLLLGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNP------RASPSDFVIPLAKYAKAVYHTR  1449
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNP      RASPS+FVIPLAKY KAVYHTR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRNPLFFRASPSEFVIPLAKYVKAVYHTR  297

Query  1450  VSVGMRFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRV  1629
             VSVGMRFRMLFETEESSVRRYMGTITGI DLDP RW NSHWRSVKVGWDESTAGERQPRV
Sbjct  298   VSVGMRFRMLFETEESSVRRYMGTITGICDLDPTRWANSHWRSVKVGWDESTAGERQPRV  357

Query  1630  SLWEIEPLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGD--MHISSPLSWLRGNMGDQG  1803
             SLWEIEPLTTFPMYPSPF LRLKRPWP GLPSF GL   D  M +SSPL W      D+G
Sbjct  358   SLWEIEPLTTFPMYPSPFPLRLKRPWPPGLPSFHGLKEDDMGMSMSSPLMW------DRG  411

Query  1804  IQSLNFQGYGITPFMQPRLDAS-MLGLQPDIYQTMAT  1911
             +QSLNFQG G+ P+MQPRLD S +LG+Q D+YQ MA 
Sbjct  412   LQSLNFQGMGVNPWMQPRLDTSGLLGMQNDVYQAMAA  448


 Score =   282 bits (722),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 184/356 (52%), Positives = 233/356 (65%), Gaps = 25/356 (7%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQ  2367
             ++++ +  S +QS  S  Q+++S   QQSFSD  G     +  S   SL  +FS DE+SQ
Sbjct  571   VSTMSQFGSASQSNTSPLQSMASLCHQQSFSDTNGG---DNPISPLHSLLSNFSQDESSQ  627

Query  2368  LLNMHETNPLAT---LPSKRIALESQV----SSRATPYVVSQADMISPNSKVSDLPTFLP  2526
             LLN+  TN   T    PSKR A++S      +   T  V+ Q    S  S V      LP
Sbjct  628   LLNLTRTNSAMTSSGWPSKRPAVDSSFQHSGAGNNTQSVMEQLGQ-SHTSNVPPNAVSLP  686

Query  2527  PFPGKE--FPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENG-FLNMPFST  2694
             PFPG      E +G A    ++ L GVN DSS +L+ NG+SNL++ G E G    +PF++
Sbjct  687   PFPGGRECSIEQEGSASDPHSHLLFGVNIDSSSLLMPNGMSNLRSIGIEGGDSTTLPFTS  746

Query  2695  CNFTSGVGTDYPLNPDMGT-SSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLD  2871
              NF +    D+  N  M T SSC+DESGFLQSSEN+   NP + TFVKV+KSGSFGRSLD
Sbjct  747   SNFNN----DFSGNLAMTTPSSCIDESGFLQSSENIGSENPQSNTFVKVYKSGSFGRSLD  802

Query  2872  ISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWY  3051
             ISKFSSYHELRSELARMFGLEG LEDP RSGWQLVFVDRENDVLLLGDDPW EFV++VW 
Sbjct  803   ISKFSSYHELRSELARMFGLEGQLEDPVRSGWQLVFVDRENDVLLLGDDPWPEFVSSVWC  862

Query  3052  IKILSPFEVHQMGKEEGIDLPNNLPAAN--QRLPNGGSSCEVHVSQKETRNM-NGI  3210
             IKILSP EV QMGK  G++L N+ P++N   +LP+ G +C+   ++ + RN+ NGI
Sbjct  863   IKILSPQEVQQMGK-RGLELLNSAPSSNNVDKLPSNG-NCDDFGNRSDPRNLGNGI  916



>ref|XP_010940157.1| PREDICTED: LOW QUALITY PROTEIN: auxin response factor 17-like 
[Elaeis guineensis]
Length=965

 Score =   763 bits (1971),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/447 (85%), Positives = 406/447 (91%), Gaps = 5/447 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S +G+  Q +EG  E+KCLNSELWHACAGPLVSLP +G+RVVYFPQGHSEQV ASTN
Sbjct  1     MRLSTSGLPQQTQEG--EQKCLNSELWHACAGPLVSLPAVGNRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KEIDAHIP+YP LP QLICQLHN+TMHAD ETDEVYAQMTLQPLS +EQKD   LPAELG
Sbjct  59    KEIDAHIPNYPNLPPQLICQLHNLTMHADAETDEVYAQMTLQPLSLEEQKD-PYLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NEW
Sbjct  118   TPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+F    KRHLLTTGWSVFVSAKRLVAGD+V+FIWNENNQLLLGIRRANRPQTVMPS
Sbjct  178   KFRHIFPWSAKRHLLTTGWSVFVSAKRLVAGDSVLFIWNENNQLLLGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDES AGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESIAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LRLKRPWPSGLPS  G  + D+ ++ PL WLR   GD+ + SL+FQG
Sbjct  358   PLTTFPMYPSAFPLRLKRPWPSGLPSLQGCKDDDIRLNYPLMWLRD--GDRRMPSLSFQG  415

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMA  1908
              G TP+MQPRL+ASMLG+QPD+YQ +A
Sbjct  416   LGTTPWMQPRLNASMLGIQPDMYQAVA  442


 Score =   280 bits (716),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 170/346 (49%), Positives = 231/346 (67%), Gaps = 17/346 (5%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQ  2367
             ++SL ++ ST+QS  S  Q +SS   QQSF D+  N   TS+ S   ++ RSFS +E   
Sbjct  624   VSSLSQLASTSQSLSSSLQTISSFCRQQSFPDININPATTSDVSPLHNILRSFSPEETPN  683

Query  2368  LLNMHETNPLAT---LPSKRIALESQVSSRATPYVVSQADMISPNSKVSDLPTFLPPFPG  2538
             +LN+  T+ L+T    PSKR+A+ES + +  T  + SQ   +   S +S     LPPFPG
Sbjct  684   VLNLPRTSSLSTSVTWPSKRLAVESMLPTE-TRCLQSQVAQLGQESNISQHSVTLPPFPG  742

Query  2539  KEFPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSGV  2715
             +++   Q       N+ L GV+ DSS +L+QNG+ NL++ G       MPF T       
Sbjct  743   RDYSLDQECNTDAQNHLLFGVHIDSSSLLMQNGMPNLRSIGSGTDSTAMPFLTI-----A  797

Query  2716  GTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYH  2895
             GTD+PLN  + +S+C++E GFLQS ENV   NP + TFVKV+KSGS+GRSLDI+KF+SY 
Sbjct  798   GTDFPLNQAITSSNCIEEPGFLQSPENVGHMNPQSGTFVKVYKSGSYGRSLDITKFNSYP  857

Query  2896  ELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFE  3075
             ELR+EL R+FGLEG LEDP RSGWQLVF+DRENDVLLLGDDPWQEFVNNVW I+ILSP E
Sbjct  858   ELRTELGRLFGLEGQLEDPMRSGWQLVFIDRENDVLLLGDDPWQEFVNNVWCIRILSPQE  917

Query  3076  VHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNM-NGI  3210
             +    ++EG +LP   P   +R P+G  S + +++++++RNM NGI
Sbjct  918   MQT--RKEGGELPTTAPT--KRFPSG--SYDEYMNKQDSRNMSNGI  957



>ref|XP_009399230.1| PREDICTED: auxin response factor 17-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009399231.1| PREDICTED: auxin response factor 17-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009399232.1| PREDICTED: auxin response factor 17-like [Musa acuminata subsp. 
malaccensis]
Length=909

 Score =   761 bits (1966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/448 (83%), Positives = 405/448 (90%), Gaps = 4/448 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR++   +  Q +E   E +CLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLTSPTLTTQPQEE--EPRCLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+D+ IP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLSAQEQKD   LPA+LG
Sbjct  59    KEVDSQIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLSAQEQKD-PYLPADLG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQEL+A+DLHGNEW
Sbjct  118   TPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELVARDLHGNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNENNQLLLGIRRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNENNQLLLGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVI L KY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVISLTKYVKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGE+QPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGEKQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LR KRPWP+GLP F G  + +  ++SPL WLR + G+  +QSLNFQG
Sbjct  358   PLTTFPMYPSSFPLRFKRPWPTGLPFFHGGRDDEFSLNSPLMWLR-DGGNPALQSLNFQG  416

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
              G+TP+MQPRL  SML LQPD++QT+A 
Sbjct  417   VGVTPWMQPRLGTSMLALQPDMHQTVAA  444


 Score =   271 bits (693),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 162/330 (49%), Positives = 211/330 (64%), Gaps = 17/330 (5%)
 Frame = +1

Query  2269  QSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNM-HETNPLATLP--SKRIALESQV  2439
             + F D  GN V  S+ S   ++    S +E SQLL++     P+ + P  SKRIA+ES +
Sbjct  588   KDFPDSNGNSVSASSVSPLDNILHQISPEETSQLLSLPRYAQPVTSNPWSSKRIAVESML  647

Query  2440  SSRATPYVVSQADMIS---PNSKVSDLPTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTD  2610
              S A   V+SQ + I    PN  +  +   LPPFPG+E    Q  +    N  + GVN D
Sbjct  648   PSGAQ-SVLSQVEQIGSGQPNIPLQSV--VLPPFPGRECSVNQDGSMDIQNQHMFGVNID  704

Query  2611  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  2790
             SSI +QNGI +L          N+ ++ CN     G D+P+N  +  S+ + ESG LQS+
Sbjct  705   SSISVQNGIRSLGTGVNGTNSTNIVYAACNLLRSAGNDFPINQAVNGSNGLHESGLLQST  764

Query  2791  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  2970
             ENVDQ N  + TFVKV+KSGSFGRSLDI++FSSYHELRSEL  +FGLEG LEDP RSGWQ
Sbjct  765   ENVDQVNSQSGTFVKVYKSGSFGRSLDITRFSSYHELRSELGHLFGLEGQLEDPLRSGWQ  824

Query  2971  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  3150
             LVFVDRE+DVLL+GDDPWQEFVN+V  IKILSP EV QMGK +G+D  N+ P   +RL +
Sbjct  825   LVFVDREDDVLLVGDDPWQEFVNSVSCIKILSPEEVQQMGK-QGVDFVNSAPI--KRLQS  881

Query  3151  GGSSCEVHVSQKETRNMNG---IPLGSLDY  3231
              G  C+ +VSQ+ +RN++      +GS  Y
Sbjct  882   NG--CDDYVSQQHSRNLSAARITSVGSFKY  909



>ref|XP_010478418.1| PREDICTED: auxin response factor 6 isoform X2 [Camelina sativa]
Length=926

 Score =   762 bits (1967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/457 (84%), Positives = 406/457 (89%), Gaps = 18/457 (4%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG NPQ  EG  EK+ LNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSAGFNPQPHEG--EKRVLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP L  QLICQLHNVTMHAD ETDEVYAQMTLQPL+AQEQKD   LPAELG
Sbjct  59    KEVDAHIPNYPSLHPQLICQLHNVTMHADVETDEVYAQMTLQPLNAQEQKD-PYLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PS+QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQEL+A+DLH NEW
Sbjct  118   VPSRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELMARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+ NQLLLGIRRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDKNQLLLGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNP------RASPSDFVIPLAKYAKAVYHTR  1449
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNP      RASPS+FVIPLAKY KAVYHTR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRNPLFFRASPSEFVIPLAKYVKAVYHTR  297

Query  1450  VSVGMRFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRV  1629
             VSVGMRFRMLFETEESSVRRYMGTITGI DLDP RW NSHWRSVKVGWDESTAGERQPRV
Sbjct  298   VSVGMRFRMLFETEESSVRRYMGTITGICDLDPTRWANSHWRSVKVGWDESTAGERQPRV  357

Query  1630  SLWEIEPLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGD--MHISSPLSWLRGNMGDQG  1803
             SLWEIEPLTTFPMYPSPF LRLKRPWP GLPSF GL   D  M +SSPL W      D+G
Sbjct  358   SLWEIEPLTTFPMYPSPFPLRLKRPWPPGLPSFHGLKEDDMGMSMSSPLMW------DRG  411

Query  1804  IQSLNFQGYGITPFMQPRLDAS-MLGLQPDIYQTMAT  1911
             +QSLNFQG G+ P+MQPRLD S  LG+Q D+YQ MA 
Sbjct  412   LQSLNFQGMGVNPWMQPRLDTSGFLGMQNDVYQAMAA  448


 Score =   283 bits (725),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 186/358 (52%), Positives = 234/358 (65%), Gaps = 29/358 (8%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNN--SSTQSLPRSFSHDEA  2361
             ++++ +  S +QS  S  Q+++S   QQSFSD  G      NN  S   SL  +FS DE+
Sbjct  572   VSTMSQFGSASQSNTSPLQSMASLCHQQSFSDTNGG-----NNPISPLHSLLSNFSQDES  626

Query  2362  SQLLNMHETNPLAT---LPSKRIALESQV----SSRATPYVVSQADMISPNSKVSDLPTF  2520
             SQLLN+  TN   T    PSKR A++S      +   T  V+ Q    S  S V      
Sbjct  627   SQLLNLTRTNSAMTSSGWPSKRPAVDSSFQHSGAGNNTQSVMEQLGQ-SHTSNVPPNAVS  685

Query  2521  LPPFPGKE--FPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENG-FLNMPF  2688
             LPPFPG      E +G A    ++ L GVN DSS +L+ NG+SNL++ G E G    +PF
Sbjct  686   LPPFPGGRECSIEQEGSASDPHSHLLFGVNIDSSSLLMPNGMSNLRSIGIEGGDSTTLPF  745

Query  2689  STCNFTSGVGTDYPLNPDMGT-SSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRS  2865
             ++ NF +    D+  N  M T SSC+DESGFLQSSEN+   NP + TFVKV+KSGSFGRS
Sbjct  746   TSSNFNN----DFSGNLAMTTPSSCIDESGFLQSSENIGSENPQSNTFVKVYKSGSFGRS  801

Query  2866  LDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNV  3045
             LDISKFSSYHELRSELARMFGLEG LEDP RSGWQLVFVDRENDVLLLGDDPW EFV++V
Sbjct  802   LDISKFSSYHELRSELARMFGLEGQLEDPVRSGWQLVFVDRENDVLLLGDDPWPEFVSSV  861

Query  3046  WYIKILSPFEVHQMGKEEGIDLPNNLPAAN--QRLPNGGSSCEVHVSQKETRNM-NGI  3210
             W IKILSP EV QMGK  G++L N+ P++N   +LP+ G +C+   ++ + RN+ NGI
Sbjct  862   WCIKILSPQEVQQMGK-RGLELLNSAPSSNNVDKLPSNG-NCDDFGNRSDPRNLGNGI  917



>ref|XP_004485979.1| PREDICTED: auxin response factor 6-like [Cicer arietinum]
Length=908

 Score =   760 bits (1962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/448 (83%), Positives = 405/448 (90%), Gaps = 5/448 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG +P  +EG  EK+ L+SELWHACAGPLVSLP +GSRVVYFPQGHSEQV  STN
Sbjct  1     MRLSSAGFSPPPQEG--EKRVLDSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAVSTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP LP QLICQLHN+TMHAD ETDEVYAQMTLQPL+AQEQK+   LPAELG
Sbjct  59    KEVDAHIPNYPSLPPQLICQLHNLTMHADVETDEVYAQMTLQPLNAQEQKE-AYLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
               SKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFP LD+SQQPPAQELIA+DLHG+EW
Sbjct  118   TASKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPSLDFSQQPPAQELIARDLHGHEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA+RPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRASRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPL KY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLTKYVKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRM+FETEESSVRRYMGTITGISDLD VRWPNSHWRSVKVGWDESTAGE+QPRVSLWEIE
Sbjct  298   FRMMFETEESSVRRYMGTITGISDLDSVRWPNSHWRSVKVGWDESTAGEKQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRLKRPWP GLPSF G+ + D  ++SPL WLR    D+G+QSLNFQG
Sbjct  358   PLTTFPMYPSPFPLRLKRPWPPGLPSFHGMKDDDFGMNSPLLWLRDT--DRGLQSLNFQG  415

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
              G+ P+MQPR D SML +Q D+YQ +A 
Sbjct  416   IGVNPWMQPRFDPSMLNMQADMYQAVAA  443


 Score =   271 bits (693),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 178/366 (49%), Positives = 233/366 (64%), Gaps = 27/366 (7%)
 Frame = +1

Query  2176  MSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSF-SH  2352
             MS+ +++ P++ S    Q     ALSS   QQSFSD   N   T+  S   S+  SF   
Sbjct  556   MSQFVSAAPQLQSPPMQQ-----ALSSLCNQQSFSDSNVNSS-TTIVSPLHSILGSFPQQ  609

Query  2353  DEASQLLNMHETNPLATL------PSKRIALESQVSSRATPYVVSQADMIS-PNSKVSDL  2511
             DE S LL++  TN    +      PSKR+A++  +SS A   ++ QA+ +  P + +S  
Sbjct  610   DETSHLLSLPRTNSWVPVQNSTGWPSKRVAVDPLLSSGAAQCILPQAEQLGQPQNTISQN  669

Query  2512  PTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTD-SSILLQNGISNLKN-SGGENGFLNMP  2685
                LPPFPG+E    Q  +    +N L GVN D SS+L+ NG+SN K  SGG +    MP
Sbjct  670   AITLPPFPGRECSIDQEGSNDPQSNLLFGVNIDPSSLLMHNGMSNFKGISGGNSDSSTMP  729

Query  2686  FSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQAN--PPNRTFVKVHKSGSFG  2859
             + + N+ +  G D  LN   G +S + +SGFL++ EN  Q N  P N TFVKV+K+GS+G
Sbjct  730   YQSSNYMNTAGNDSSLN--HGVTSSIGDSGFLRTPENAQQGNNNPLNETFVKVYKAGSYG  787

Query  2860  RSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVN  3039
             RSLDI+ FSSYHELR ELARMFGLEG LEDP RSGWQLVFVDRENDVLLLGD PW EFV+
Sbjct  788   RSLDITNFSSYHELRGELARMFGLEGELEDPVRSGWQLVFVDRENDVLLLGDGPWPEFVS  847

Query  3040  NVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNM-NGI-P  3213
             +VW IKILSP EV QMG   G+ L N++P   QRL NG   C+ +VS+++ R++ +GI  
Sbjct  848   SVWCIKILSPEEVQQMGN-TGLGLLNSVPI--QRLSNG--ICDGYVSRQDPRSLSSGITT  902

Query  3214  LGSLDY  3231
             +GSLDY
Sbjct  903   VGSLDY  908



>ref|XP_009797609.1| PREDICTED: auxin response factor 6-like isoform X2 [Nicotiana 
sylvestris]
Length=891

 Score =   759 bits (1961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/448 (82%), Positives = 401/448 (90%), Gaps = 4/448 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG N Q+ EG  E KCLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQVTASTN
Sbjct  1     MRLSSAGSNQQSPEG--ENKCLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVTASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE +AHIP+YP L  QLICQLHNVTMHAD ETDEVYAQMTLQPLS +EQK+   LP +LG
Sbjct  59    KEAEAHIPNYPSLAPQLICQLHNVTMHADMETDEVYAQMTLQPLSPEEQKEASFLPLDLG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPP QELIA+DLH NEW
Sbjct  119   IPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPVQELIARDLHDNEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD++IFIWNE NQL LGIRRANR QTVMPS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSIIFIWNEKNQLFLGIRRANRSQTVMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPR+ PSDFV+PLAKY KAVYHTR+SVGMR
Sbjct  239   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRSCPSDFVVPLAKYVKAVYHTRISVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGI DLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWE+E
Sbjct  299   FRMLFETEESSVRRYMGTITGIGDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEVE  358

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRLKR WP G P+  G+ + DM + +P+ WLR ++GD G QS+NFQG
Sbjct  359   PLTTFPMYPSPFPLRLKRSWPPGFPALSGMKDDDM-VMNPMMWLR-DVGDGGTQSINFQG  416

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
              G+TP+MQPR+D  + G+Q DIYQ MA 
Sbjct  417   IGVTPWMQPRIDVPIGGMQMDIYQAMAA  444


 Score =   273 bits (699),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 160/331 (48%), Positives = 215/331 (65%), Gaps = 18/331 (5%)
 Frame = +1

Query  2266  QQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMHETNPLAT---LPSKRIALE--  2430
             Q+SF+D   NH   S  +   SL  + + DE SQL+++  ++ L +    P KR+A++  
Sbjct  570   QESFTDTNVNHSTNSIVNPLHSLSGAVTRDEPSQLVSVPRSSSLLSPTGWPPKRVAVDPV  629

Query  2431  --SQVSSRATPYVVSQADMISPNSKVSDLPTFLPPFPGKEFPEYQGVAYSQGNNALLGVN  2604
               S  S R +P++       +PN  VS     LP FPG++ P  Q       N+ L G N
Sbjct  630   LPSASSQRMSPFIDQPG---TPNKNVSQNALSLPTFPGRDCPVGQEGNNDLHNHLLFGFN  686

Query  2605  TDSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQ  2784
              DS  L+Q+ + +L+  G +    N+PF++ N+ S  G D+  NP M  S C++  GF Q
Sbjct  687   IDSPSLMQSDMRSLRGVGSDCESANVPFASSNYLSNAGNDFAQNPVMALSGCINVPGFTQ  746

Query  2785  SSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG  2964
             +SEN  Q +P N TFVKV+KSGSFGRSLDI+KFSSYHELRSELARMFGLEGLLEDP RSG
Sbjct  747   TSENAGQESPHN-TFVKVYKSGSFGRSLDITKFSSYHELRSELARMFGLEGLLEDPLRSG  805

Query  2965  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRL  3144
             WQLVFVDRENDVLLLGDDPW EFVN+VW IKILSP +V QMGK +G++L N++  +    
Sbjct  806   WQLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPHDVQQMGK-QGLELLNSVSMSR---  861

Query  3145  PNGGSSCEVHVSQKETRNM-NGI-PLGSLDY  3231
              +  +SC+   ++ E+RNM +GI  + +LDY
Sbjct  862   -SSNNSCDDFANRSESRNMASGIMSVATLDY  891



>ref|XP_003542951.1| PREDICTED: auxin response factor 6-like isoform X1 [Glycine max]
Length=895

 Score =   759 bits (1960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/448 (84%), Positives = 403/448 (90%), Gaps = 5/448 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG +P  +EG  E + L+SELWHACAGPLVSLP +GSRVVYFPQGHSEQV  STN
Sbjct  1     MRLSSAGFSPPPQEG--ENRVLDSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAVSTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP LP QLICQLHN+TMHAD ETDEVYAQMTLQPL+ QEQK+   LPAELG
Sbjct  59    KEVDAHIPNYPSLPPQLICQLHNMTMHADAETDEVYAQMTLQPLNPQEQKE-AYLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLHGNEW
Sbjct  118   TPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHGNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRW NSHWRSVKVGWDESTAG+RQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDPVRWQNSHWRSVKVGWDESTAGDRQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRLKRPWP GLPSF G+ + D   +SPL WLR    D+G+ SLNFQG
Sbjct  358   PLTTFPMYPSPFPLRLKRPWPPGLPSFHGMKDDDFGPNSPLLWLRD--PDRGLPSLNFQG  415

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
              GI P+MQPR D +ML +Q D+YQ  A 
Sbjct  416   IGINPWMQPRFDPTMLNMQTDMYQAAAV  443


 Score =   283 bits (725),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 180/363 (50%), Positives = 232/363 (64%), Gaps = 19/363 (5%)
 Frame = +1

Query  2176  MSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHD  2355
             +S  ++++ +  S  Q Q    Q +SS   QQ+FSD  GN V T+  S   S+  SF  D
Sbjct  541   ISSAVSTMSQFVSAPQPQSPPMQVISSMCQQQNFSDSNGNTV-TTIVSPLHSILGSFPQD  599

Query  2356  EASQLLNMHETNPLATL------PSKRIALESQVSSRATPYVVSQADMIS-PNSKVSDLP  2514
             E S LLN+  T+    +      PSKR+A++  +SS A+  V+ Q + +  P S +S   
Sbjct  600   ETSHLLNLPRTSSWIPVQNSSGWPSKRVAVDPLLSSGASQCVLPQVEQLGQPQSTMSQNA  659

Query  2515  TFLPPFPGKEFPEYQGVAYSQGNNALLGVNTD-SSILLQNGISNLKNSGGENGFLNMPFS  2691
               LPPFPG+E    Q  +    N+ L GVN + SS+L+ NG+S+LK   G NG   +P+ 
Sbjct  660   ISLPPFPGRECSIDQEGSNDPQNHLLFGVNIEPSSLLMPNGMSSLKGVCGNNGSSTLPYQ  719

Query  2692  TCNF-TSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSL  2868
             + N+  +   TD  LN   G +  + +SGFLQ  E   Q NP N+TFVKV+KSGSFGRSL
Sbjct  720   SSNYLNTTTRTDSSLN--HGMTPNIGDSGFLQCLEEAGQGNPLNKTFVKVYKSGSFGRSL  777

Query  2869  DISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVW  3048
             DI+KFSSYHELR ELARMFGLEG LEDP RSGWQLVFVDRENDVLLLGD PW EFVN+VW
Sbjct  778   DITKFSSYHELRGELARMFGLEGELEDPVRSGWQLVFVDRENDVLLLGDGPWPEFVNSVW  837

Query  3049  YIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNM-NGI-PLGS  3222
              IKILSP EV QMG   G++L N+ P   QRL NG   C+ +VS+++ RN+  GI  +GS
Sbjct  838   CIKILSPQEVQQMGN-NGLELLNSFPI--QRLSNG--ICDDYVSRQDPRNLGTGITTVGS  892

Query  3223  LDY  3231
             LDY
Sbjct  893   LDY  895



>emb|CBA11994.1| putative auxin response factor 6 [Amborella trichopoda]
Length=914

 Score =   759 bits (1961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/432 (86%), Positives = 397/432 (92%), Gaps = 2/432 (0%)
 Frame = +1

Query  616   GEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAHIPSYPGLPAQ  795
             GEK+CLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTNKE+DAHIP+YP LP Q
Sbjct  15    GEKRCLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTNKEVDAHIPNYPSLPPQ  74

Query  796   LICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPTNYFCKTLTA  975
             LICQLHNVTMHAD ETDEVYAQMTLQPL+ QEQKD   LPA+LG   KQPTNYFCKTLTA
Sbjct  75    LICQLHNVTMHADVETDEVYAQMTLQPLNPQEQKD-AFLPADLGTSGKQPTNYFCKTLTA  133

Query  976   SDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFRGQPKRHLLT  1155
             SDTSTHGGFSVPRRAAEKVFPPLD++QQPPAQELIA+DLH NEWKFRH+FRGQPKRHLLT
Sbjct  134   SDTSTHGGFSVPRRAAEKVFPPLDFTQQPPAQELIARDLHDNEWKFRHIFRGQPKRHLLT  193

Query  1156  TGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLLaaa  1335
             TGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPSSVLSSDSMHIGLLAAA
Sbjct  194   TGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLLAAA  253

Query  1336  ahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFETEESSVRRYM  1515
             AHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMRFRMLFETEESSVRRYM
Sbjct  254   AHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMRFRMLFETEESSVRRYM  313

Query  1516  GTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFSLRL  1695
             GTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPF LRL
Sbjct  314   GTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFPLRL  373

Query  1696  KRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPFMQPRLDASML  1875
             KRPWP GLPS  G  + D+ +S+PL WLR +  D+ +QSLNFQG G++P+M  R D+S+L
Sbjct  374   KRPWPPGLPSLHGNKDDDLGMSAPLMWLR-DGADRNMQSLNFQGLGVSPWMPQRFDSSLL  432

Query  1876  GLQPDIYQTMAT  1911
             G+Q D+YQ MA 
Sbjct  433   GMQSDVYQAMAA  444


 Score =   262 bits (669),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 165/338 (49%), Positives = 220/338 (65%), Gaps = 27/338 (8%)
 Frame = +1

Query  2266  QQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMHETNPLATLP-----------S  2412
             Q SFSD  GN V T++ S  QS+  SF  DE+S L N+  TN  ATLP           S
Sbjct  588   QSSFSDSNGNPVTTTSISPLQSILGSFPPDESSHL-NLPRTNS-ATLPRDHMLPSAPWLS  645

Query  2413  KRIALESQVSSRATPYVVSQADMISPNSKVSDLPTFLPPFPGKEFP-EYQGVAYSQGNNA  2589
             KRI+++S + S   P V+   + ++    ++  P  L PFPG+E   + +G      ++ 
Sbjct  646   KRISIDSSLPS-GGPIVLPHVEQLATQPNMAQHPVSLLPFPGRECSVDQEGSVGDPQSHL  704

Query  2590  LLGVNTDSS-ILLQNGISNLKNSGGE-NGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCV  2763
             L GVN DSS +++QNG+S L+  GG+ +    + ++  NF    GTD+ LNP M  S C+
Sbjct  705   LFGVNIDSSSLMMQNGVSALRGLGGDIDPSAALSYAASNFLGNTGTDF-LNPGMAGSGCL  763

Query  2764  DESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLL  2943
             +ESGFL S ENV Q NP N  FVKV KSGSFGRSL+I++FSSY ELRSELARMFGLEG L
Sbjct  764   NESGFLPSPENVGQINPQN--FVKVCKSGSFGRSLEITRFSSYLELRSELARMFGLEGQL  821

Query  2944  EDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNL  3123
             EDP RSGWQL+++DR+NDVLLLGDDPW +FV N   IKILSP E+ QMGK +GI+L   +
Sbjct  822   EDPLRSGWQLIYIDRDNDVLLLGDDPWPDFVKNASCIKILSPQELQQMGK-QGIELLRTV  880

Query  3124  PAANQRLPNGGSSCEVHVSQKETRNM-NGIP-LGSLDY  3231
             P   Q+     S C+ +VS++++RN+ NGI  +G L+Y
Sbjct  881   PMQRQQ----SSICDDYVSRQDSRNLSNGIASVGPLEY  914



>ref|XP_009627654.1| PREDICTED: auxin response factor 6-like isoform X3 [Nicotiana 
tomentosiformis]
Length=891

 Score =   759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/447 (82%), Positives = 400/447 (89%), Gaps = 4/447 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG N Q+ EG  E KCLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQVTASTN
Sbjct  1     MRLSSAGSNQQSPEG--ENKCLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVTASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE +AHIP+YP L  QLICQLHNVTMHAD ETDEVYAQMTLQPLS +EQK+   LP +LG
Sbjct  59    KEAEAHIPNYPSLAPQLICQLHNVTMHADVETDEVYAQMTLQPLSPEEQKEASFLPLDLG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPP QELIA+DLH NEW
Sbjct  119   TPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPVQELIARDLHDNEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD++IFIWNE NQL LGIRRANR QTVMPS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSIIFIWNEKNQLFLGIRRANRSQTVMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPR+ PSDFV+PLAKY KAVYHTR+SVGMR
Sbjct  239   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRSCPSDFVVPLAKYVKAVYHTRISVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGI DLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWE+E
Sbjct  299   FRMLFETEESSVRRYMGTITGIGDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEVE  358

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRLKR WP G P+  G+ + DM + +P+ WLR ++GD G QS+NFQG
Sbjct  359   PLTTFPMYPSPFPLRLKRSWPPGFPALSGMKDDDM-VMNPMMWLR-DVGDGGTQSINFQG  416

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMA  1908
              G+TP+MQPR+D  + G+Q DIYQ MA
Sbjct  417   IGVTPWMQPRIDVPIGGMQMDIYQAMA  443


 Score =   271 bits (694),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 157/331 (47%), Positives = 212/331 (64%), Gaps = 18/331 (5%)
 Frame = +1

Query  2266  QQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMHETNPLAT---LPSKRIALE--  2430
             Q+SF+D   NH   S  +   SL  + + DE SQL+++  ++ L +    P KR+A++  
Sbjct  570   QESFTDTNVNHSTNSIVNPLHSLSGAVTRDEPSQLVSVPRSSSLLSPTGWPPKRVAVDPV  629

Query  2431  --SQVSSRATPYVVSQADMISPNSKVSDLPTFLPPFPGKEFPEYQGVAYSQGNNALLGVN  2604
               S  S R +PY+       +PN  VS     LP FPG++ P  Q       N+ L G N
Sbjct  630   LPSASSQRMSPYIDQSG---TPNKNVSQNALSLPTFPGRDCPVGQEGNNDPHNHLLFGFN  686

Query  2605  TDSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQ  2784
              DS  L+Q+ + +L+    +    N+PF++ N+ S  G D+  NP M  S C++  GF Q
Sbjct  687   IDSPSLMQSDMRSLRGVVSDCESTNVPFASSNYLSNAGNDFSQNPVMALSGCINVPGFTQ  746

Query  2785  SSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG  2964
             +SEN  Q +P N TFVKV+KSGSFGRSLDI+KFSSYHELRSELARMFGLEGLLEDP RSG
Sbjct  747   TSENAGQESPHN-TFVKVYKSGSFGRSLDITKFSSYHELRSELARMFGLEGLLEDPLRSG  805

Query  2965  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRL  3144
             WQLVFVDRENDVLLLGDDPW EFVN+VW IKILSP +V QMG+ +G++L N++  +    
Sbjct  806   WQLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPHDVQQMGR-QGLELLNSVSMSR---  861

Query  3145  PNGGSSCEVHVSQKETRNMNG--IPLGSLDY  3231
              +  +SC+   ++ E+RNM    + + +LDY
Sbjct  862   -SSNNSCDDFANRSESRNMTSGIMSVATLDY  891



>ref|XP_006415484.1| hypothetical protein EUTSA_v10006747mg [Eutrema salsugineum]
 gb|ESQ33837.1| hypothetical protein EUTSA_v10006747mg [Eutrema salsugineum]
Length=895

 Score =   759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/451 (84%), Positives = 404/451 (90%), Gaps = 16/451 (4%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S A  +PQ  E TGEK+ LNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSAAFSPQPHEVTGEKRVLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  60

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP L  QLICQLHNVTMHAD ETDEVYAQMTLQPL+AQEQKD   LPAELG
Sbjct  61    KEVDAHIPNYPSLHPQLICQLHNVTMHADVETDEVYAQMTLQPLNAQEQKD-PYLPAELG  119

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PS+QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQEL+A+DLH NEW
Sbjct  120   VPSRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELMARDLHDNEW  179

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+ NQLLLGIRRANRPQTVMPS
Sbjct  180   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDKNQLLLGIRRANRPQTVMPS  239

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIF+NPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  240   SVLSSDSMHLGLLAAAAHAAATNSRFTIFFNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  299

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGI DLDP RW NSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  300   FRMLFETEESSVRRYMGTITGICDLDPARWANSHWRSVKVGWDESTAGERQPRVSLWEIE  359

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGD--MHISSPLSWLRGNMGDQGIQSLNF  1821
             PLTTFPMYPSPF LRLKRPWP      PGL   D  M +SSPL W      D+G+QSLNF
Sbjct  360   PLTTFPMYPSPFPLRLKRPWP------PGLKEDDMGMGMSSPLMW------DRGLQSLNF  407

Query  1822  QGYGITPFMQPRLDAS-MLGLQPDIYQTMAT  1911
             QG G+ P+MQPRLDAS +LG+Q D+YQ MA 
Sbjct  408   QGMGVNPWMQPRLDASGLLGMQNDVYQAMAA  438


 Score =   279 bits (714),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 185/368 (50%), Positives = 238/368 (65%), Gaps = 30/368 (8%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNN--SSTQSLPRSFSHDEA  2361
             ++++ +  S +QS  S  Q+++S   QQSFSD  G      NN  S   SL  +FS DE+
Sbjct  538   VSAMSQFGSASQSNTSPLQSMTSLCHQQSFSDTNGG-----NNPISPLHSLLSNFSQDES  592

Query  2362  SQLLNMHETNPLAT---LPSKRIALESQVSSRATPYVVSQADMIS-PNSKVSDLP---TF  2520
             SQLLN+  TN   T    PSKR A++S           +Q+ M     S  S++P     
Sbjct  593   SQLLNLTRTNSAMTSSGWPSKRPAVDSTFQHSGAGNNNTQSVMEQLGQSHTSNVPPNAVS  652

Query  2521  LPPFPG--KEFP-EYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENG-FLNMP  2685
             LPPFPG  +E   E +G A    ++ L GVN DSS +L+ NG+SNL++ G E G    +P
Sbjct  653   LPPFPGGGRECSIEQEGSASDPHSHLLFGVNIDSSSLLMPNGMSNLRSIGIEGGDSTTLP  712

Query  2686  FSTCNFTSGVGTDYPLNPDMGT-SSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGR  2862
             F++  F +    D+  N  M T SSC+DESGFLQSSEN+   N  + TFVKV+KSGSFGR
Sbjct  713   FTSSTFNN----DFSGNLAMTTPSSCIDESGFLQSSENLGSENQQSNTFVKVYKSGSFGR  768

Query  2863  SLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNN  3042
             SLDI+KFSSYHELRSELARMFGLEG LEDP RSGWQLVFVDRENDVLLLGDDPW EFV++
Sbjct  769   SLDITKFSSYHELRSELARMFGLEGQLEDPVRSGWQLVFVDRENDVLLLGDDPWPEFVSS  828

Query  3043  VWYIKILSPFEVHQMGKEEGIDLPNNLPAAN--QRLPNGGSSCEVHVSQKETRNM-NGIP  3213
             VW IKILSP EV QMGK  G++L N+ P++N   +LP+   +C+   ++ + RN+ NGI 
Sbjct  829   VWCIKILSPQEVQQMGK-RGLELLNSAPSSNNVDKLPSNNGNCDDFGNRSDPRNLGNGIA  887

Query  3214  L--GSLDY  3231
                GS +Y
Sbjct  888   SVGGSFNY  895



>emb|CDY09598.1| BnaC05g23210D [Brassica napus]
Length=870

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/445 (85%), Positives = 404/445 (91%), Gaps = 11/445 (2%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG NPQ  E TGEK+ LNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSTAGFNPQPHEVTGEKRVLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  60

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP L  QLICQLHNVTMHAD ETDEVYAQMTLQPL+AQEQKD   LPAELG
Sbjct  61    KEVDAHIPNYPSLHPQLICQLHNVTMHADVETDEVYAQMTLQPLNAQEQKD-PYLPAELG  119

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PS+QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQEL+A+DLH NEW
Sbjct  120   VPSRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELMARDLHDNEW  179

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+ NQLLLGIRRANRPQTVMPS
Sbjct  180   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDKNQLLLGIRRANRPQTVMPS  239

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  240   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  299

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGI DLDP RW NSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  300   FRMLFETEESSVRRYMGTITGICDLDPTRWANSHWRSVKVGWDESTAGERQPRVSLWEIE  359

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSF--PGLSNGDMHISSPLSWLRGNMGDQGIQSLNF  1821
             PLTTFPMYPSPF LRLKRPWP GLPSF    +S G M +SSPL W      D+G+QSLNF
Sbjct  360   PLTTFPMYPSPFPLRLKRPWPPGLPSFHEDDMSMG-MGMSSPLMW------DRGLQSLNF  412

Query  1822  QGYGITPFMQPRLDAS-MLGLQPDI  1893
             QG G+ P+MQPRLDAS +LG+Q D 
Sbjct  413   QGMGVNPWMQPRLDASGLLGMQNDF  437


 Score =   256 bits (653),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 180/355 (51%), Positives = 225/355 (63%), Gaps = 33/355 (9%)
 Frame = +1

Query  2242  QALSSTVPQQSFSDLVGNHVMTSNN--SSTQSLPRSFSHDEASQLLNMHETNPLATL---  2406
             Q+++S   QQSF D  G +    NN  S   +L  +FS DE+SQLLN+  T   A +   
Sbjct  524   QSMTSLCQQQSFLDTNGGN----NNPMSPLHTLLSNFSQDESSQLLNLTRTTNSAAMTSS  579

Query  2407  --PSKR--IALESQVSSRATPYVVSQADMISPNSKVSDLPTFLPPFPG--KEFP-EYQGV  2565
               PSKR  + L S  ++  T  V+ Q       S V      LPPFPG  +E   E +G 
Sbjct  580   GWPSKRPAVDLSSFGNNSNTQSVIEQLGQSHNTSNVPPNAVSLPPFPGGGRECSIEQEGG  639

Query  2566  AYSQGNNALL-GVNTDSS-ILLQNGISNLKNSGGENG-FLNMPFSTCNFTSGVGTDYPLN  2736
             + S  ++ LL GVN DSS +L+ NG+SNL++ G E G    +PF+T NF +        N
Sbjct  640   SPSDPHSHLLFGVNIDSSSLLMPNGMSNLRSIGIEGGDSTTLPFTTSNFNNDFSGG---N  696

Query  2737  PDMGT-SSCVDESGFLQSSENVDQANP-PNRTFVKVHKSGSFGRSLDISKFSSYHELRSE  2910
               M T SSC+DE GFLQSSEN+   N   N TFVKV+KSGSFGRSLDI+KFSSYHELRSE
Sbjct  697   LAMTTPSSCIDEPGFLQSSENLGSENQQSNNTFVKVYKSGSFGRSLDITKFSSYHELRSE  756

Query  2911  LARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMG  3090
             LARMFGLEG LEDP RSGWQLVFVDRENDVLLLGDDPW EFV++VW IKILSP EV QMG
Sbjct  757   LARMFGLEGQLEDPVRSGWQLVFVDRENDVLLLGDDPWPEFVSSVWCIKILSPQEVQQMG  816

Query  3091  KEEGIDLPNNLPAAN-----QRLPNGGSSCEVHVSQKETRNM-NGIPL--GSLDY  3231
             K  G++L N+ P ++     ++LP+   +C+   S+ + RN  NGI    GS +Y
Sbjct  817   K-RGLELLNSAPPSSNNNVVEKLPSNNGNCDDFGSRSDPRNRGNGIASVGGSFNY  870



>ref|XP_011085226.1| PREDICTED: auxin response factor 6-like isoform X1 [Sesamum indicum]
Length=910

 Score =   759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/448 (83%), Positives = 406/448 (91%), Gaps = 2/448 (0%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S AG++ Q+ E  GEK CLNSELWHACAGPLVSLP +GS VVYFPQGHSEQV ASTN
Sbjct  1     MKLS-AGMDQQSPEA-GEKSCLNSELWHACAGPLVSLPAIGSHVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+D  IP+YP +  QLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQK+V  LPA+LG
Sbjct  59    KEVDGQIPNYPSVSPQLICQLHNVTMHADIETDEVYAQMTLQPLSPQEQKEVFFLPADLG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NEW
Sbjct  119   APSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHNNEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA RPQTVMPS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRAARPQTVMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAA+TNSRFTIFYNPRASPS+FVI LAK+ +AVYHTRVS+GMR
Sbjct  239   SVLSSDSMHLGLLAAAAHAASTNSRFTIFYNPRASPSEFVISLAKFVRAVYHTRVSIGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGI DLDP RWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  299   FRMLFETEESSVRRYMGTITGICDLDPARWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  358

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFP+YPSPFSLRLKRPWP GLPSF G+ N +M ++SP  WLRG + D G QSLNFQG
Sbjct  359   PLTTFPIYPSPFSLRLKRPWPPGLPSFSGMKNDEMGLNSPFMWLRGGVEDLGTQSLNFQG  418

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
              G+TP+MQPRLD S+LG+Q D+YQ +A 
Sbjct  419   MGMTPWMQPRLDNSVLGMQNDVYQAIAA  446


 Score =   289 bits (740),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 173/352 (49%), Positives = 235/352 (67%), Gaps = 12/352 (3%)
 Frame = +1

Query  2197  LPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLN  2376
             L R+++ +Q Q    Q +SS    Q+FS+ +   +  + ++    L      DEAS+LL+
Sbjct  564   LSRLSTNSQEQSESLQPISSM--HQNFSEPILKPMAANTSAPLHGLLGPAHQDEASKLLS  621

Query  2377  MHETNPLAT---LPSKRIALESQVSSRATPYVVSQADMI-SPNSKVSDLPTFLPPFPGKE  2544
             M  ++ L +    P+KR+AL+  +S   +    +Q + + S N+ V+     LPPFPG+E
Sbjct  622   MPRSSNLLSSSGWPTKRVALDPLLSDCVSQGNSTQLNHLGSSNTNVTQNAVSLPPFPGRE  681

Query  2545  FPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGT  2721
                 Q  +    N+ L GVN DSS +L+QNG+SNLK  G +     + F + ++ S    
Sbjct  682   CLIEQEGSNDPQNHFLFGVNIDSSSLLMQNGMSNLKGVGSDCDNAAIAFGSSSYMSSPVA  741

Query  2722  DYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHEL  2901
             DY L   + +S+ +DESGFL+SSENV   NP NRTFVKV+KSGSFGRSLDI+KFSSYHEL
Sbjct  742   DYSLKTTVTSSNGIDESGFLRSSENVGHENPSNRTFVKVYKSGSFGRSLDITKFSSYHEL  801

Query  2902  RSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVH  3081
             RSELA+MFGLEG LEDP RSGWQLVFVDRENDVLLLGDDPWQEFVN+VW IKILSP EV 
Sbjct  802   RSELAQMFGLEGQLEDPLRSGWQLVFVDRENDVLLLGDDPWQEFVNSVWCIKILSPQEVQ  861

Query  3082  QMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMN-GIP-LGSLDY  3231
             +MGK+  +++  ++P     LPNG S  + +VS++E RN+N GIP +G+LD+
Sbjct  862   EMGKQR-LEILTSVPVQRPPLPNGTS--DGYVSRQEARNINAGIPSVGTLDF  910



>ref|XP_011085227.1| PREDICTED: auxin response factor 6-like isoform X2 [Sesamum indicum]
Length=909

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/448 (83%), Positives = 406/448 (91%), Gaps = 3/448 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S AG++ Q+ EG  EK CLNSELWHACAGPLVSLP +GS VVYFPQGHSEQV ASTN
Sbjct  1     MKLS-AGMDQQSPEG--EKSCLNSELWHACAGPLVSLPAIGSHVVYFPQGHSEQVAASTN  57

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+D  IP+YP +  QLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQK+V  LPA+LG
Sbjct  58    KEVDGQIPNYPSVSPQLICQLHNVTMHADIETDEVYAQMTLQPLSPQEQKEVFFLPADLG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NEW
Sbjct  118   APSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHNNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA RPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRAARPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAA+TNSRFTIFYNPRASPS+FVI LAK+ +AVYHTRVS+GMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAASTNSRFTIFYNPRASPSEFVISLAKFVRAVYHTRVSIGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGI DLDP RWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGICDLDPARWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFP+YPSPFSLRLKRPWP GLPSF G+ N +M ++SP  WLRG + D G QSLNFQG
Sbjct  358   PLTTFPIYPSPFSLRLKRPWPPGLPSFSGMKNDEMGLNSPFMWLRGGVEDLGTQSLNFQG  417

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
              G+TP+MQPRLD S+LG+Q D+YQ +A 
Sbjct  418   MGMTPWMQPRLDNSVLGMQNDVYQAIAA  445


 Score =   289 bits (740),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 173/352 (49%), Positives = 235/352 (67%), Gaps = 12/352 (3%)
 Frame = +1

Query  2197  LPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLN  2376
             L R+++ +Q Q    Q +SS    Q+FS+ +   +  + ++    L      DEAS+LL+
Sbjct  563   LSRLSTNSQEQSESLQPISSM--HQNFSEPILKPMAANTSAPLHGLLGPAHQDEASKLLS  620

Query  2377  MHETNPLAT---LPSKRIALESQVSSRATPYVVSQADMI-SPNSKVSDLPTFLPPFPGKE  2544
             M  ++ L +    P+KR+AL+  +S   +    +Q + + S N+ V+     LPPFPG+E
Sbjct  621   MPRSSNLLSSSGWPTKRVALDPLLSDCVSQGNSTQLNHLGSSNTNVTQNAVSLPPFPGRE  680

Query  2545  FPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGT  2721
                 Q  +    N+ L GVN DSS +L+QNG+SNLK  G +     + F + ++ S    
Sbjct  681   CLIEQEGSNDPQNHFLFGVNIDSSSLLMQNGMSNLKGVGSDCDNAAIAFGSSSYMSSPVA  740

Query  2722  DYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHEL  2901
             DY L   + +S+ +DESGFL+SSENV   NP NRTFVKV+KSGSFGRSLDI+KFSSYHEL
Sbjct  741   DYSLKTTVTSSNGIDESGFLRSSENVGHENPSNRTFVKVYKSGSFGRSLDITKFSSYHEL  800

Query  2902  RSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVH  3081
             RSELA+MFGLEG LEDP RSGWQLVFVDRENDVLLLGDDPWQEFVN+VW IKILSP EV 
Sbjct  801   RSELAQMFGLEGQLEDPLRSGWQLVFVDRENDVLLLGDDPWQEFVNSVWCIKILSPQEVQ  860

Query  3082  QMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMN-GIP-LGSLDY  3231
             +MGK+  +++  ++P     LPNG S  + +VS++E RN+N GIP +G+LD+
Sbjct  861   EMGKQR-LEILTSVPVQRPPLPNGTS--DGYVSRQEARNINAGIPSVGTLDF  909



>ref|XP_002298839.1| auxin response factor 6 family protein [Populus trichocarpa]
 gb|EEE83644.1| auxin response factor 6 family protein [Populus trichocarpa]
Length=884

 Score =   757 bits (1954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/450 (84%), Positives = 403/450 (90%), Gaps = 6/450 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR S AG NPQ  E   EK+ LNSELWHACAGPLVSLP +GSR VYFPQGHSEQV ASTN
Sbjct  1     MRHSSAGFNPQTHEV--EKRVLNSELWHACAGPLVSLPAVGSRAVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE++A IPSYP LPAQLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQK    LPA++G
Sbjct  59    KEVNAQIPSYPSLPAQLICQLHNVTMHADVETDEVYAQMTLQPLSPQEQK-AAYLPADMG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQ PPAQELIA+DLH NEW
Sbjct  118   TPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQHPPAQELIARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA RPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRATRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVY+TRVSVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYLKAVYYTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRM+FETEESSVRRYMGTITGISDLD VRWPNS WRSVKVGWDEST GERQPRVSLWEIE
Sbjct  298   FRMMFETEESSVRRYMGTITGISDLDVVRWPNSQWRSVKVGWDESTDGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGL--SNGDMHISSPLSWLRGNMGDQGIQSLNF  1821
             PLTTFP YPSPF LRLKRPWP GLPSF GL   + D+  +  L WLRG+ GD G QSLNF
Sbjct  358   PLTTFPTYPSPFPLRLKRPWPPGLPSFHGLGIKDDDLGKNPSLMWLRGD-GDCGYQSLNF  416

Query  1822  QGYGITPFMQPRLDASMLGLQPDIYQTMAT  1911
             QG G++P++QPR+DASMLGLQ D+YQTMAT
Sbjct  417   QGTGVSPWVQPRVDASMLGLQNDVYQTMAT  446


 Score =   316 bits (809),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 186/355 (52%), Positives = 245/355 (69%), Gaps = 14/355 (4%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQ  2367
             ++++ +  S +QS     QA+S    Q S+SD  GN   +   SS QSL  SF  +E+S 
Sbjct  537   VSAISQYASASQSLTPPLQAIS-LCQQHSYSDSNGNPATSPAVSSLQSLLDSFPPNESSH  595

Query  2368  LLNMHETNPLAT---LPSKRIALESQVSSRATPYVVSQADMISP-NSKVSDLPTFLPPFP  2535
             LL+    NPL T    PSKR A+ES  SS A   +V+Q + + P ++ ++     LPPFP
Sbjct  596   LLSWPRINPLVTSSGWPSKRAAVESLTSSGAPQCMVTQVEQLGPLHTSITPSSVSLPPFP  655

Query  2536  GKEFPEYQGVAYSQGNNALLGVNTD-SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSG  2712
             G+E    +     Q N+ L GVN + SS+LLQNG+S+L+  G ++    +PFS+ N+ S 
Sbjct  656   GRECSIDRDGGTDQQNHLLFGVNIEPSSLLLQNGMSSLRGVGSDSDSTTIPFSS-NYIST  714

Query  2713  VGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSY  2892
              GT++ LNP M  SSC+D+S FLQS+EN  Q NPP RTFVKV+KSGSFGRSLDI+KFSSY
Sbjct  715   AGTNFSLNPAMTPSSCIDDSCFLQSTENASQGNPPTRTFVKVYKSGSFGRSLDITKFSSY  774

Query  2893  HELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPF  3072
             +ELRSEL+RMFGLEG LEDP RSGWQLVF+DRENDVLLLGD PW EFVN+VWYIKILSP 
Sbjct  775   NELRSELSRMFGLEGQLEDPLRSGWQLVFIDRENDVLLLGDGPWPEFVNSVWYIKILSPQ  834

Query  3073  EVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMN-GI-PLGSLDY  3231
             EV QMGK  G++L N+ P   QRL NG  SC+ + +++++++ + GI  +GSLDY
Sbjct  835   EVQQMGK-RGLELLNSFPI--QRLSNG--SCDDYANRQDSKSSSTGITSVGSLDY  884



>ref|XP_006656378.1| PREDICTED: auxin response factor 17-like [Oryza brachyantha]
Length=916

 Score =   757 bits (1955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/448 (83%), Positives = 404/448 (90%), Gaps = 7/448 (2%)
 Frame = +1

Query  565   GMRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTAST  744
             G  +     +P+A E   E KCLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV AST
Sbjct  8     GSVIPAQAASPEAVE---EHKCLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAAST  64

Query  745   NKEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAEL  924
             NKE+++ IP+YP LPAQLICQLHNVTMHAD ETDEVYAQMTLQPLS QE KD   LPAEL
Sbjct  65    NKEMESQIPNYPNLPAQLICQLHNVTMHADAETDEVYAQMTLQPLSPQELKDP-YLPAEL  123

Query  925   GMPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNE  1104
             G  +KQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD++QQPPAQELIAKDLHGNE
Sbjct  124   GTANKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFTQQPPAQELIAKDLHGNE  183

Query  1105  WKFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMP  1284
             WKFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+NNQLLLGIRRANRPQTVMP
Sbjct  184   WKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDNNQLLLGIRRANRPQTVMP  243

Query  1285  SSVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGM  1464
             SSVLSSDSMHIGLLAAAAHAA+TNSRFTIFYNPRASPS+FVIPLAKY KAVYHTR+SVGM
Sbjct  244   SSVLSSDSMHIGLLAAAAHAASTNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRISVGM  303

Query  1465  RFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEI  1644
             RFRMLFETEESSVRRYMGTITGISDLD  RWPNSHWRSVKVGWDESTAGERQPRVSLWEI
Sbjct  304   RFRMLFETEESSVRRYMGTITGISDLDAARWPNSHWRSVKVGWDESTAGERQPRVSLWEI  363

Query  1645  EPLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQ  1824
             EPLTTFPMYPSPF LRLKRPWP+GLPS  G  + D+  +S L WLR +  + G QSLNF 
Sbjct  364   EPLTTFPMYPSPFPLRLKRPWPTGLPSLHGGKDDDL--TSSLMWLRES-ANPGFQSLNFG  420

Query  1825  GYGITPFMQPRLDASMLGLQPDIYQTMA  1908
             G G++P+MQPR+DAS+LGLQPDIYQT+A
Sbjct  421   GLGMSPWMQPRMDASLLGLQPDIYQTIA  448


 Score =   246 bits (628),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 157/329 (48%), Positives = 215/329 (65%), Gaps = 22/329 (7%)
 Frame = +1

Query  2269  QSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMHETNPLATLP--SKRIALESQVS  2442
             QSF D   + +  SN S+  +  R FS +  S L     T      P  SKR+A+ES + 
Sbjct  602   QSFPDTNMSSLSPSNTSTIHNTLRPFSSEAPSHLSMPRPTAIPVPDPWSSKRVAVESLLP  661

Query  2443  SRATPYVVSQADMISPNSKVSDLP--TFLPPFPGKEFPEYQGVAYSQGNNALLGVNTDS-  2613
             SR  P V SQ + +  +S   ++P  + L P PG+     Q  +    N+ L GVN DS 
Sbjct  662   SR--PQVTSQIEQL--DSTTPNIPQSSALAPLPGRGCLVDQDGSSDPQNHLLFGVNIDSQ  717

Query  2614  SILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSE  2793
             S+L+Q GI +L+   GEN    +P+ST NF S    D+PL+  + ++ C+DESG++  S+
Sbjct  718   SLLMQGGIPSLQ---GENDSTAIPYSTSNFLSPSQNDFPLDQTLNSADCLDESGYVPCSQ  774

Query  2794  NVDQA-NPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  2970
             N DQ  N P  TFVKV+KSG++GRSLDI++FSSYHELR EL R+FGLEG LE+P RSGWQ
Sbjct  775   NSDQVINRPPATFVKVYKSGTYGRSLDITRFSSYHELRRELGRLFGLEGQLENPLRSGWQ  834

Query  2971  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  3150
             LVFVDRE+DVLL+GDDPWQEFVN+V  IKILSP EV QMGK    +L ++ P   +RL  
Sbjct  835   LVFVDREDDVLLVGDDPWQEFVNSVSCIKILSPQEVQQMGKP--FELLSSAPG--KRL--  888

Query  3151  GGSSCEVHVSQKETRNMN-GIP-LGSLDY  3231
              GSSC+ +VS++E+R+++ GI  +GS+++
Sbjct  889   -GSSCDDYVSRQESRSLSTGIASVGSVEF  916



>ref|XP_003546066.1| PREDICTED: auxin response factor 6-like isoform X1 [Glycine max]
Length=897

 Score =   755 bits (1950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/444 (84%), Positives = 401/444 (90%), Gaps = 5/444 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S A  +P  +EG  EK+ L+SELWHACAGPLVSLP +GSRVVYFPQGHSEQV  STN
Sbjct  1     MRLSSADFSPPPQEG--EKRVLDSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAVSTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP LP QLICQLHN+TMHAD ETDEVYAQMTLQPL+ QEQ +   LPAELG
Sbjct  59    KEVDAHIPNYPSLPPQLICQLHNMTMHADVETDEVYAQMTLQPLNPQEQNE-AYLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
               SKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLHGNEW
Sbjct  118   TASKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHGNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGI DLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGIGDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LRLKRPWP GLPSF G+ + D  ++SPL WLR    D+G+QSLNFQG
Sbjct  358   PLTTFPMYPSSFPLRLKRPWPPGLPSFHGMKDDDFGLNSPLLWLRDT--DRGLQSLNFQG  415

Query  1828  YGITPFMQPRLDASMLGLQPDIYQ  1899
              G+ P+MQPR D ++L +Q D+YQ
Sbjct  416   IGVNPWMQPRFDPTVLNMQTDMYQ  439


 Score =   284 bits (726),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 181/363 (50%), Positives = 237/363 (65%), Gaps = 21/363 (6%)
 Frame = +1

Query  2176  MSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHD  2355
             +S  ++++ ++ S  Q Q    QA+SS    Q+FS+  GN V T+  S   S+  SF  D
Sbjct  545   ISSAVSTMSQLFSAPQPQSPPMQAISSLC--QNFSNSNGNSV-TTIVSPLHSILGSFPQD  601

Query  2356  EASQLLNMHETNPLATL------PSKRIALESQVSSRATPYVVSQADMIS-PNSKVSDLP  2514
             E S LLN+  T+    +      PSKR+A++  +SS A+  V+ Q D +  P+S +S   
Sbjct  602   ETSHLLNLPRTSSWIPIQNSSGWPSKRVAVDPLLSSGASHCVLPQVDQLGQPHSTMSLNA  661

Query  2515  TFLPPFPGKEFPEYQGVAYSQGNNALLGVNTD-SSILLQNGISNLKNSGGENGFLNMPFS  2691
               LPPFPG+E    Q  +    N+ L GVN D SS+L+ NG+S+LK   G N    +P+ 
Sbjct  662   ITLPPFPGRESSIDQEGSNDPQNHLLFGVNIDPSSLLMPNGMSSLKGVSGNNNSSTLPYQ  721

Query  2692  TCNF-TSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSL  2868
             + N+  +  GTD  LN   G +  + +SGFL   E+  Q NP N+TFVKV+KSGSFGRSL
Sbjct  722   SSNYLNTTTGTDSSLN--HGMTPNIGDSGFLHCPEDAGQGNPLNKTFVKVYKSGSFGRSL  779

Query  2869  DISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVW  3048
             DI+KFSSYHELR ELARMFGLEG LEDP RSGWQLVFVDRENDVLLLGD PW EFVN+VW
Sbjct  780   DITKFSSYHELRGELARMFGLEGELEDPVRSGWQLVFVDRENDVLLLGDGPWPEFVNSVW  839

Query  3049  YIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMN-GI-PLGS  3222
              IKILSP EV QMG   G++L N++P  NQRL NG   C+ +VS+++ RN++ GI  +GS
Sbjct  840   CIKILSPQEVQQMGN-NGLELLNSVP--NQRLSNG--ICDDYVSRQDPRNLSTGITTVGS  894

Query  3223  LDY  3231
             LDY
Sbjct  895   LDY  897



>ref|XP_006594517.1| PREDICTED: auxin response factor 6-like isoform X2 [Glycine max]
Length=896

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/449 (84%), Positives = 403/449 (90%), Gaps = 6/449 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG +P  +EG  E + L+SELWHACAGPLVSLP +GSRVVYFPQGHSEQV  STN
Sbjct  1     MRLSSAGFSPPPQEG--ENRVLDSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAVSTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP LP QLICQLHN+TMHAD ETDEVYAQMTLQPL+ QEQK+   LPAELG
Sbjct  59    KEVDAHIPNYPSLPPQLICQLHNMTMHADAETDEVYAQMTLQPLNPQEQKE-AYLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLHGNEW
Sbjct  118   TPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHGNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRW NSHWRSVKVGWDESTAG+RQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDPVRWQNSHWRSVKVGWDESTAGDRQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSF-PGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQ  1824
             PLTTFPMYPSPF LRLKRPWP GLPSF  G+ + D   +SPL WLR    D+G+ SLNFQ
Sbjct  358   PLTTFPMYPSPFPLRLKRPWPPGLPSFHAGMKDDDFGPNSPLLWLRD--PDRGLPSLNFQ  415

Query  1825  GYGITPFMQPRLDASMLGLQPDIYQTMAT  1911
             G GI P+MQPR D +ML +Q D+YQ  A 
Sbjct  416   GIGINPWMQPRFDPTMLNMQTDMYQAAAV  444


 Score =   283 bits (724),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 180/363 (50%), Positives = 232/363 (64%), Gaps = 19/363 (5%)
 Frame = +1

Query  2176  MSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHD  2355
             +S  ++++ +  S  Q Q    Q +SS   QQ+FSD  GN V T+  S   S+  SF  D
Sbjct  542   ISSAVSTMSQFVSAPQPQSPPMQVISSMCQQQNFSDSNGNTV-TTIVSPLHSILGSFPQD  600

Query  2356  EASQLLNMHETNPLATL------PSKRIALESQVSSRATPYVVSQADMIS-PNSKVSDLP  2514
             E S LLN+  T+    +      PSKR+A++  +SS A+  V+ Q + +  P S +S   
Sbjct  601   ETSHLLNLPRTSSWIPVQNSSGWPSKRVAVDPLLSSGASQCVLPQVEQLGQPQSTMSQNA  660

Query  2515  TFLPPFPGKEFPEYQGVAYSQGNNALLGVNTD-SSILLQNGISNLKNSGGENGFLNMPFS  2691
               LPPFPG+E    Q  +    N+ L GVN + SS+L+ NG+S+LK   G NG   +P+ 
Sbjct  661   ISLPPFPGRECSIDQEGSNDPQNHLLFGVNIEPSSLLMPNGMSSLKGVCGNNGSSTLPYQ  720

Query  2692  TCNF-TSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSL  2868
             + N+  +   TD  LN   G +  + +SGFLQ  E   Q NP N+TFVKV+KSGSFGRSL
Sbjct  721   SSNYLNTTTRTDSSLN--HGMTPNIGDSGFLQCLEEAGQGNPLNKTFVKVYKSGSFGRSL  778

Query  2869  DISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVW  3048
             DI+KFSSYHELR ELARMFGLEG LEDP RSGWQLVFVDRENDVLLLGD PW EFVN+VW
Sbjct  779   DITKFSSYHELRGELARMFGLEGELEDPVRSGWQLVFVDRENDVLLLGDGPWPEFVNSVW  838

Query  3049  YIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNM-NGI-PLGS  3222
              IKILSP EV QMG   G++L N+ P   QRL NG   C+ +VS+++ RN+  GI  +GS
Sbjct  839   CIKILSPQEVQQMGN-NGLELLNSFPI--QRLSNG--ICDDYVSRQDPRNLGTGITTVGS  893

Query  3223  LDY  3231
             LDY
Sbjct  894   LDY  896



>ref|XP_006836327.1| hypothetical protein AMTR_s00092p00072950 [Amborella trichopoda]
 gb|ERM99180.1| hypothetical protein AMTR_s00092p00072950 [Amborella trichopoda]
Length=986

 Score =   758 bits (1957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/432 (86%), Positives = 397/432 (92%), Gaps = 2/432 (0%)
 Frame = +1

Query  616   GEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAHIPSYPGLPAQ  795
             GEK+CLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTNKE+DAHIP+YP LP Q
Sbjct  15    GEKRCLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTNKEVDAHIPNYPSLPPQ  74

Query  796   LICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPTNYFCKTLTA  975
             LICQLHNVTMHAD ETDEVYAQMTLQPL+ QEQKD   LPA+LG   KQPTNYFCKTLTA
Sbjct  75    LICQLHNVTMHADVETDEVYAQMTLQPLNPQEQKD-AFLPADLGTSGKQPTNYFCKTLTA  133

Query  976   SDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFRGQPKRHLLT  1155
             SDTSTHGGFSVPRRAAEKVFPPLD++QQPPAQELIA+DLH NEWKFRH+FRGQPKRHLLT
Sbjct  134   SDTSTHGGFSVPRRAAEKVFPPLDFTQQPPAQELIARDLHDNEWKFRHIFRGQPKRHLLT  193

Query  1156  TGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLLaaa  1335
             TGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPSSVLSSDSMHIGLLAAA
Sbjct  194   TGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLLAAA  253

Query  1336  ahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFETEESSVRRYM  1515
             AHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMRFRMLFETEESSVRRYM
Sbjct  254   AHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMRFRMLFETEESSVRRYM  313

Query  1516  GTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFSLRL  1695
             GTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPF LRL
Sbjct  314   GTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFPLRL  373

Query  1696  KRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPFMQPRLDASML  1875
             KRPWP GLPS  G  + D+ +S+PL WLR +  D+ +QSLNFQG G++P+M  R D+S+L
Sbjct  374   KRPWPPGLPSLHGNKDDDLGMSAPLMWLR-DGADRNMQSLNFQGLGVSPWMPQRFDSSLL  432

Query  1876  GLQPDIYQTMAT  1911
             G+Q D+YQ MA 
Sbjct  433   GMQSDVYQAMAA  444


 Score =   249 bits (635),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 156/322 (48%), Positives = 206/322 (64%), Gaps = 25/322 (8%)
 Frame = +1

Query  2266  QQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMHETNPLATLP-----------S  2412
             Q SFSD  GN V T++ S  QS+  SF  DE+S L N+  TN  ATLP           S
Sbjct  588   QSSFSDSNGNPVTTTSISPLQSILGSFPPDESSHL-NLPRTNS-ATLPRDHMLPSAPWLS  645

Query  2413  KRIALESQVSSRATPYVVSQADMISPNSKVSDLPTFLPPFPGKEFP-EYQGVAYSQGNNA  2589
             KRI+++S + S   P V+   + ++    ++  P  L PFPG+E   + +G      ++ 
Sbjct  646   KRISIDSSLPS-GGPIVLPHVEQLATQPNMAQHPVSLLPFPGRECSVDQEGSVGDPQSHL  704

Query  2590  LLGVNTDSS-ILLQNGISNLKNSGGE-NGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCV  2763
             L GVN DSS +++QNG+S L+  GG+ +    + ++  NF    GTD+ LNP M  S C+
Sbjct  705   LFGVNIDSSSLMMQNGVSALRGLGGDTDPSAALSYAASNFLGNPGTDF-LNPGMAGSGCL  763

Query  2764  DESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLL  2943
             +ESGFL S ENV Q NP N  FVKV KSGSFGRSL+I++FSSY ELRSELARMFGLEG L
Sbjct  764   NESGFLPSPENVGQINPQN--FVKVCKSGSFGRSLEITRFSSYLELRSELARMFGLEGQL  821

Query  2944  EDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNL  3123
             EDP RSGWQL+++DR+NDVLLLGDDPW +FV N   IKILSP E+ QMGK +GI+L   +
Sbjct  822   EDPLRSGWQLIYIDRDNDVLLLGDDPWPDFVKNASCIKILSPQELQQMGK-QGIELLRTV  880

Query  3124  PAANQRLPNGGSSCEVHVSQKE  3189
             P   Q+     S C+ +  ++E
Sbjct  881   PMQRQQ----SSICDDYEKREE  898



>ref|XP_007159383.1| hypothetical protein PHAVU_002G233600g [Phaseolus vulgaris]
 gb|ESW31377.1| hypothetical protein PHAVU_002G233600g [Phaseolus vulgaris]
Length=908

 Score =   754 bits (1948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/444 (84%), Positives = 401/444 (90%), Gaps = 5/444 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG +P  +EG  E++ L+SELWHACAGPLVSLP +GSRVVYFPQGHSEQV  STN
Sbjct  1     MRLSSAGFSPPPQEG--ERRVLDSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAVSTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KEIDAHIP+YP LP QLICQLHN+TMHAD ETDEVYAQMTLQPL+ QEQK+   LPAELG
Sbjct  59    KEIDAHIPNYPSLPPQLICQLHNMTMHADAETDEVYAQMTLQPLNPQEQKE-AYLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFP LD+SQQPPAQELIA+DLHGNEW
Sbjct  118   TPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPALDFSQQPPAQELIARDLHGNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEES VRRYMGTITGISDLDP RWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESGVRRYMGTITGISDLDPTRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRLKRPWP GLPSF G+ + D  ++S L WLR +  D+G+QS  FQG
Sbjct  358   PLTTFPMYPSPFPLRLKRPWPPGLPSFHGMKDDDFGLNSSLLWLRDS--DRGLQSPTFQG  415

Query  1828  YGITPFMQPRLDASMLGLQPDIYQ  1899
              G+ P+MQPR D SML +Q D+YQ
Sbjct  416   IGVNPWMQPRFDPSMLNMQTDMYQ  439


 Score =   282 bits (722),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 184/363 (51%), Positives = 233/363 (64%), Gaps = 20/363 (6%)
 Frame = +1

Query  2176  MSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHD  2355
             +S  ++S+ +  S    Q    QA+SS   QQ+FSD  GN V T   S   S+  SF  D
Sbjct  555   ISSAVSSMSQFVSAPPPQSPPMQAISSLCQQQNFSD--GNSVPTIV-SPLHSILGSFPQD  611

Query  2356  EASQLLNMHETNPLATL------PSKRIALESQVSSRATPYVVSQADMIS-PNSKVSDLP  2514
             E S LLN+  T+    +      PSKR+A++  +SS  +  V+   + +  P S VS   
Sbjct  612   ETSHLLNLPRTSSWIPVQNSSGWPSKRVAVDPLISSGVSQCVLPPVEQLGQPQSTVSQNA  671

Query  2515  TFLPPFPGKEFPEYQGVAYSQGNNALLGVNTD-SSILLQNGISNLKNSGGENGFLNMPFS  2691
               LPPFPG+E    Q  +    N+ L GVN D SS+L+ NG+SNLK     N    +P+ 
Sbjct  672   ITLPPFPGRECSIDQEGSNDPQNHLLFGVNIDPSSLLMPNGMSNLKGVSSNNDSSTLPYQ  731

Query  2692  TCNF-TSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSL  2868
             + N+  +  GTD  LN  + T S   ESG+LQS EN  Q NP N+TFVKV+KSGSFGRSL
Sbjct  732   SSNYLNTTTGTDSSLNHGI-TPSIGGESGYLQSPENAGQGNPLNKTFVKVYKSGSFGRSL  790

Query  2869  DISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVW  3048
             DI+KFSSYHELRSELA+MFGLEG LEDP RSGWQLVFVDRENDVLLLGD PW EFVN+VW
Sbjct  791   DITKFSSYHELRSELAQMFGLEGELEDPVRSGWQLVFVDRENDVLLLGDGPWPEFVNSVW  850

Query  3049  YIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMN-GI-PLGS  3222
              IKILSP EV QMG   G++L N++P   QRL NG   C+ +VS+++ RN++ GI  +GS
Sbjct  851   CIKILSPQEVQQMGN-PGLELLNSVPI--QRLSNG--ICDDYVSRQDPRNISPGITAVGS  905

Query  3223  LDY  3231
             LDY
Sbjct  906   LDY  908



>ref|XP_009393314.1| PREDICTED: auxin response factor 17-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009393315.1| PREDICTED: auxin response factor 17-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009393316.1| PREDICTED: auxin response factor 17-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009393317.1| PREDICTED: auxin response factor 17-like [Musa acuminata subsp. 
malaccensis]
Length=909

 Score =   754 bits (1948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/447 (83%), Positives = 403/447 (90%), Gaps = 3/447 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S +G+  Q +E T E++CLNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSSGLGNQQQEDTEEQRCLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  60

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KEID+ +PSY  LP QL+CQLHNVTMHAD E+DEVYAQMTLQPL+ +EQK+   LP ELG
Sbjct  61    KEIDS-LPSYRSLPPQLVCQLHNVTMHADVESDEVYAQMTLQPLNPEEQKE-PYLPTELG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
               SKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+S QPPAQELIA DLHGNEW
Sbjct  119   TASKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSLQPPAQELIAMDLHGNEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRL+AGD+V+FIWN+NNQLLLGIRRANRPQTVMPS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSVFVSAKRLIAGDSVLFIWNDNNQLLLGIRRANRPQTVMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTR+SVGMR
Sbjct  239   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRISVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGI DLDPV WPNSHWRSVKVGWDESTAGERQP+VSLWEIE
Sbjct  299   FRMLFETEESSVRRYMGTITGIGDLDPVHWPNSHWRSVKVGWDESTAGERQPKVSLWEIE  358

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF  RLKRPWP GLPS  G  + D  +SSP++W R N G+ G+QSLNFQG
Sbjct  359   PLTTFPMYPSPFPFRLKRPWPPGLPSLHGGKHDDFSLSSPVTWFR-NGGNPGLQSLNFQG  417

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMA  1908
              G+TP+ QPR D ++LGL PD+Y TMA
Sbjct  418   TGVTPWTQPRFDTTILGLPPDMYLTMA  444


 Score =   274 bits (700),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 168/348 (48%), Positives = 221/348 (64%), Gaps = 15/348 (4%)
 Frame = +1

Query  2212  STTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMHETN  2391
             S  QSQ +  Q +S     +SFSD   N V TS+ S   ++   FS  EAS LL+   TN
Sbjct  569   SEPQSQSATMQNISLISQSRSFSDSNTNCVSTSDASPLHNILSQFSPGEASHLLSWPRTN  628

Query  2392  PLAT---LPSKRIALESQVSSRATPYV--VSQADMISPNSKVSDLPTFLPPFPGKEFPEY  2556
              L T    PSK++A++S + S A   +  V Q  +  PN  +S     LPPFPG+E    
Sbjct  629   QLVTSGPRPSKQVAVDSILPSGAQCMIPRVEQLGVSEPN--ISQRSVMLPPFPGRECAVN  686

Query  2557  QGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPL  2733
             Q       N  L GVN DSS +L+QNG+++L N G E+    M +   NF      D+ L
Sbjct  687   QDGNMDARNQLLFGVNIDSSSLLMQNGMTSLCNVGRESDSTGMHYDASNFVGSSVHDFAL  746

Query  2734  NPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSEL  2913
             +  +  S  ++E+GFLQSS+N DQ N    TFVKV KSGSFGRSLDI++FSSY+ELRSEL
Sbjct  747   SQALTGSGGLEETGFLQSSQNADQLNQKGGTFVKVSKSGSFGRSLDITRFSSYNELRSEL  806

Query  2914  ARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGK  3093
              RMFGLEG LEDP RSGWQLVFVDREND+LL+GDDPWQEFVNNVW IKILSP EV QMGK
Sbjct  807   GRMFGLEGQLEDPLRSGWQLVFVDRENDILLVGDDPWQEFVNNVWCIKILSPQEVQQMGK  866

Query  3094  EEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMNG--IPLGSLDY  3231
              + ++  N+   + + LP  G  C+ ++S++++RN++     +GSL++
Sbjct  867   HD-VNFLNS--GSIKMLPTNG--CDDYISRQDSRNLSTRVASMGSLEH  909



>ref|XP_009385053.1| PREDICTED: auxin response factor 6-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009385054.1| PREDICTED: auxin response factor 6-like [Musa acuminata subsp. 
malaccensis]
Length=913

 Score =   754 bits (1946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/447 (83%), Positives = 400/447 (89%), Gaps = 4/447 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S  G+  Q  E   E+ CLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSGGLGNQQNEEAEEQVCLNSELWHACAGPLVSLPSVGSRVVYFPQGHSEQVAASTN  60

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE D+ +PSYP LP QL+CQLHNVTMHAD ETDEVY QMTLQPLS QEQKD  L+  E+G
Sbjct  61    KEFDS-LPSYPSLPPQLVCQLHNVTMHADVETDEVYGQMTLQPLSPQEQKDPYLI-TEMG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              P KQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIAKDLHGNEW
Sbjct  119   TPCKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIAKDLHGNEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+NNQLLLGIRRANRPQTVMPS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDNNQLLLGIRRANRPQTVMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAV+HTRVSVGMR
Sbjct  239   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVHHTRVSVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAG+RQPRVSLWEIE
Sbjct  299   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGQRQPRVSLWEIE  358

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF  RLKRPWP+GLPS  G    D+ ++SPL WL+ N G+ G+QSLNFQG
Sbjct  359   PLTTFPMYPSPFPFRLKRPWPTGLPSLYG-GKDDISLNSPLLWLQ-NGGNTGLQSLNFQG  416

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMA  1908
              G+TP+ QP  D  +LGLQP +YQ MA
Sbjct  417   IGVTPWTQPNFDTPILGLQPGMYQAMA  443


 Score =   281 bits (720),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 168/356 (47%), Positives = 233/356 (65%), Gaps = 15/356 (4%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQ  2367
             +++LP + S +QS  +  Q + S    Q+FS+  GN V TSN SS   +    S ++AS 
Sbjct  565   MSALPELISESQSPSTALQNILSFSQSQNFSNSNGNFVRTSNASSLHDILHQLSPEDASN  624

Query  2368  LLNMHETNPLAT---LPSKRIALESQVSSRATPYV--VSQADMISPNSKVSDLPTFLPPF  2532
             L +    N + T    PSKR+A+ES + S     +  V Q+ +  PN  ++     LPPF
Sbjct  625   LHSWSRGNQVFTSSPWPSKRVAIESMLPSGDQCVLPRVEQSGVSQPN--IAQRSVTLPPF  682

Query  2533  PGKEFPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTS  2709
             PG+E    Q       N+ L GVN DSS +L+QNG++NL N   E   +N+ ++  NF +
Sbjct  683   PGRECMVDQDGNVDGQNHLLFGVNIDSSPLLVQNGMANLSNIRNETDSMNIRYAASNFVA  742

Query  2710  GVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSS  2889
               G D+ LN  +  S+ ++E+GFL S ENVD  NP +RT VKV+KSGS GRSLDI+KFSS
Sbjct  743   SSGNDFALNQTLTGSNSLEEAGFLHSPENVDSLNPKSRTSVKVYKSGSLGRSLDIAKFSS  802

Query  2890  YHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSP  3069
             YHELRSEL  +FGLEG LEDP RSGWQLVFVDREND+LL+GDDPWQEFVN+VW IKILSP
Sbjct  803   YHELRSELGHLFGLEGQLEDPLRSGWQLVFVDRENDILLVGDDPWQEFVNSVWCIKILSP  862

Query  3070  FEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMN-GIP-LGSLDY  3231
              EV QMGK + ++  N+     +RLPN  +SC+ +++++++R ++ GI  +G+L+Y
Sbjct  863   QEVQQMGK-QSVEFLNS--TCIKRLPN--NSCDDYINRQDSRTVSTGIASVGTLEY  913



>gb|KHN47353.1| Auxin response factor 6 [Glycine soja]
Length=900

 Score =   753 bits (1944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/453 (83%), Positives = 403/453 (89%), Gaps = 10/453 (2%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG +P  +EG  E + L+SELWHACAGPLVSLP +GSRVVYFPQGHSEQV  STN
Sbjct  1     MRLSSAGFSPPPQEG--ENRVLDSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAVSTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP LP QLICQLHN+TMHAD ETDEVYAQMTLQPL+ QEQK+   LPAELG
Sbjct  59    KEVDAHIPNYPSLPPQLICQLHNMTMHADAETDEVYAQMTLQPLNPQEQKE-AYLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLHGNEW
Sbjct  118   TPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHGNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIW-----NENNQLLLGIRRANRPQ  1272
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIW     NE NQLLLGIRRANRPQ
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWQVILLNEKNQLLLGIRRANRPQ  237

Query  1273  TVMPSSVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRV  1452
             TVMPSSVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRV
Sbjct  238   TVMPSSVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRV  297

Query  1453  SVGMRFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVS  1632
             SVGMRFRMLFETEESSVRRYMGTITGISDLDPVRW NSHWRSVKVGWDESTAG+RQPRVS
Sbjct  298   SVGMRFRMLFETEESSVRRYMGTITGISDLDPVRWQNSHWRSVKVGWDESTAGDRQPRVS  357

Query  1633  LWEIEPLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQS  1812
             LWEIEPLTTFPMYPSPF LRLKRPWP GLPSF G+ + D   +SPL WLR    D+G+ S
Sbjct  358   LWEIEPLTTFPMYPSPFPLRLKRPWPPGLPSFHGMKDDDFGPNSPLLWLRD--PDRGLPS  415

Query  1813  LNFQGYGITPFMQPRLDASMLGLQPDIYQTMAT  1911
             LNFQG GI P+MQPR D +ML +Q D+YQ  A 
Sbjct  416   LNFQGIGINPWMQPRFDPTMLNMQTDMYQAAAV  448


 Score =   285 bits (729),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 181/363 (50%), Positives = 233/363 (64%), Gaps = 19/363 (5%)
 Frame = +1

Query  2176  MSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHD  2355
             +S  ++++ +  S  Q Q    QA+SS   QQ+FSD  GN V T+  S   S+  SF  D
Sbjct  546   ISSAVSTMSQFVSAPQPQSPPMQAISSMCQQQNFSDSNGNTV-TTIVSPLHSILGSFPQD  604

Query  2356  EASQLLNMHETNPLATL------PSKRIALESQVSSRATPYVVSQADMIS-PNSKVSDLP  2514
             E S LLN+  T+    +      PSKR+A++  +SS A+  V+ Q + +  P S +S   
Sbjct  605   ETSHLLNLPRTSSWIPVQNSSGWPSKRVAVDPLLSSGASQCVLPQVEQLGQPQSTMSQNA  664

Query  2515  TFLPPFPGKEFPEYQGVAYSQGNNALLGVNTD-SSILLQNGISNLKNSGGENGFLNMPFS  2691
               LPPFPG+E    Q  +    N+ L GVN + SS+L+ NG+S+LK   G NG   +P+ 
Sbjct  665   ISLPPFPGRECSIDQEGSNDPQNHLLFGVNIEPSSLLMPNGMSSLKGVCGNNGSSTLPYQ  724

Query  2692  TCNF-TSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSL  2868
             + N+  +   TD  LN   G +  + +SGFLQ  E   Q NP N+TFVKV+KSGSFGRSL
Sbjct  725   SSNYLNTTTRTDSSLN--HGMTPNIGDSGFLQCLEEAGQGNPLNKTFVKVYKSGSFGRSL  782

Query  2869  DISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVW  3048
             DI+KFSSYHELR ELARMFGLEG LEDP RSGWQLVFVDRENDVLLLGD PW EFVN+VW
Sbjct  783   DITKFSSYHELRGELARMFGLEGELEDPVRSGWQLVFVDRENDVLLLGDGPWPEFVNSVW  842

Query  3049  YIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNM-NGI-PLGS  3222
              IKILSP EV QMG   G++L N+ P   QRL NG   C+ +VS+++ RN+  GI  +GS
Sbjct  843   CIKILSPQEVQQMGN-NGLELLNSFPI--QRLSNG--ICDDYVSRQDPRNLGTGITTVGS  897

Query  3223  LDY  3231
             LDY
Sbjct  898   LDY  900



>ref|XP_002438851.1| hypothetical protein SORBIDRAFT_10g027220 [Sorghum bicolor]
 gb|EER90218.1| hypothetical protein SORBIDRAFT_10g027220 [Sorghum bicolor]
Length=919

 Score =   753 bits (1945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/444 (83%), Positives = 398/444 (90%), Gaps = 4/444 (1%)
 Frame = +1

Query  580   LAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEID  759
             +    P + E   E KCLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTNKE++
Sbjct  11    IPAAQPGSPEAVEEHKCLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTNKEME  70

Query  760   AHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSK  939
             + IP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPL+ QE KD   LPAELG  +K
Sbjct  71    SQIPNYPNLPPQLICQLHNVTMHADAETDEVYAQMTLQPLNPQELKD-PYLPAELGSANK  129

Query  940   QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRH  1119
             QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD++QQPP QEL+AKDLHGNEWKFRH
Sbjct  130   QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFTQQPPCQELMAKDLHGNEWKFRH  189

Query  1120  VFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLS  1299
             +FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+NNQLLLGIRRANRPQTVMPSSVLS
Sbjct  190   IFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDNNQLLLGIRRANRPQTVMPSSVLS  249

Query  1300  SDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRML  1479
             SDSMHIGLLAAAAHAA+TNSRFTIFYNPRASPS+FVIPLAKY KAVYHTR+SVGMRFRML
Sbjct  250   SDSMHIGLLAAAAHAASTNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRISVGMRFRML  309

Query  1480  FETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTT  1659
             FETEESSVRRYMGTITGISDLD VRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTT
Sbjct  310   FETEESSVRRYMGTITGISDLDSVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTT  369

Query  1660  FPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGIT  1839
             FPMYPSPF LRLKRPWP+GLPS  G  + D+  S  L WLR +  + G QSLNF G G+ 
Sbjct  370   FPMYPSPFPLRLKRPWPTGLPSLHGGKDDDLANS--LMWLR-DAANPGFQSLNFGGLGMN  426

Query  1840  PFMQPRLDASMLGLQPDIYQTMAT  1911
             P+MQPRLDAS+LGLQPD+YQ MAT
Sbjct  427   PWMQPRLDASLLGLQPDMYQAMAT  450


 Score =   246 bits (628),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 157/329 (48%), Positives = 217/329 (66%), Gaps = 21/329 (6%)
 Frame = +1

Query  2269  QSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMHETNPLATLP--SKRIALESQVS  2442
             QSF+D   + +  SN ++ Q+  R FS +  S L     T    + P  SKR+A+ES + 
Sbjct  604   QSFTDTNVSSLSPSNTNTMQNTLRPFSSEAVSHLSMPRPTAIPVSDPWSSKRVAVESLLP  663

Query  2443  SRATPYVVSQADMISPNSKVSDLP--TFLPPFPGKEFPEYQGVAYSQGNNALLGVNTDS-  2613
             SR  P V SQ + +  +S  + +P  + L P PG+     Q V     N+ L GV+ DS 
Sbjct  664   SR--PQVSSQMEQL--DSAPASIPHSSALAPLPGRGCLVDQDVNSDPQNHVLFGVSIDSQ  719

Query  2614  SILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQ-SS  2790
             S+L+Q GI  L+N    N    +P+ST NF S    D+PL+  + +  C+D+SG++   S
Sbjct  720   SLLMQGGIPGLQNG---NDSTAIPYSTSNFLSPSQNDFPLDHTLNSPGCLDDSGYVPPCS  776

Query  2791  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  2970
             +N DQ N P  TFVKV+KSG++GRSLDI++FSSYHELR EL R+FGLEG LEDP RSGWQ
Sbjct  777   DNSDQVNRPPATFVKVYKSGTYGRSLDITRFSSYHELRRELGRLFGLEGQLEDPLRSGWQ  836

Query  2971  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  3150
             LVFVDRE DVLL+GDDPWQEFV+ V  IKILSP EV QMGK +G++L ++ PA  +RL  
Sbjct  837   LVFVDREEDVLLVGDDPWQEFVSTVSCIKILSPQEVQQMGK-QGLELLSSGPA--RRL--  891

Query  3151  GGSSCEVHVSQKETRNMN-GIP-LGSLDY  3231
              GSSC+ +VS++E+R+++ GI  +GS+++
Sbjct  892   -GSSCDDYVSRQESRSLSTGIASVGSVEF  919



>ref|XP_004966207.1| PREDICTED: auxin response factor 17-like [Setaria italica]
Length=913

 Score =   753 bits (1944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/435 (85%), Positives = 396/435 (91%), Gaps = 4/435 (1%)
 Frame = +1

Query  607   EGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAHIPSYPGL  786
             E   E KCLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTNKE+++ IP+YP L
Sbjct  19    EAVEEHKCLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTNKEMESQIPNYPNL  78

Query  787   PAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPTNYFCKT  966
             P QLICQLHNVTMHAD ETDEVYAQMTLQPL+ QE KD   LPAELG  +KQPTNYFCKT
Sbjct  79    PPQLICQLHNVTMHADAETDEVYAQMTLQPLNPQELKD-PYLPAELGSANKQPTNYFCKT  137

Query  967   LTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFRGQPKRH  1146
             LTASDTSTHGGFSVPRRAAEKVFPPLD++QQPP QELIAKDLHGNEWKFRH+FRGQPKRH
Sbjct  138   LTASDTSTHGGFSVPRRAAEKVFPPLDFTQQPPCQELIAKDLHGNEWKFRHIFRGQPKRH  197

Query  1147  LLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLL  1326
             LLTTGWSVFVSAKRLVAGD+V+FIWN+NNQLLLGIRRA+RPQTVMPSSVLSSDSMHIGLL
Sbjct  198   LLTTGWSVFVSAKRLVAGDSVLFIWNDNNQLLLGIRRASRPQTVMPSSVLSSDSMHIGLL  257

Query  1327  aaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFETEESSVR  1506
             AAAAHAA+TNSRFTIFYNPRASPS+FVIPLAKY KAVYHTR+SVGMRFRMLFETEESSVR
Sbjct  258   AAAAHAASTNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRISVGMRFRMLFETEESSVR  317

Query  1507  RYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFS  1686
             RYMGTITGISDLD VRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPF 
Sbjct  318   RYMGTITGISDLDSVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFP  377

Query  1687  LRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPFMQPRLDA  1866
             LRLKRPWP+GLPS  G  + D+  ++ L WLR +  + G QSLNF G G+ P+MQPRLDA
Sbjct  378   LRLKRPWPTGLPSLHGGKDDDL--TNSLMWLR-DTANPGFQSLNFGGLGVNPWMQPRLDA  434

Query  1867  SMLGLQPDIYQTMAT  1911
             S+LGLQPD+YQ MAT
Sbjct  435   SLLGLQPDMYQAMAT  449


 Score =   246 bits (628),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 161/359 (45%), Positives = 229/359 (64%), Gaps = 20/359 (6%)
 Frame = +1

Query  2176  MSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHD  2355
             +S  +++  +++S  QS     Q +      QSF++   + +  SN ++ Q+  R FS +
Sbjct  568   VSNALSAFSQLSSAPQSSPVALQTILPFSQAQSFAETNMSSLSPSNATAMQNTLRPFSAE  627

Query  2356  EASQLLNMHETNPLATLP--SKRIALESQVSSRATPYVVSQADMISPNSKVSDLP--TFL  2523
              ASQL     T      P  SKR+A+ES + SR  P V SQ + +  NS    +P  + L
Sbjct  628   AASQLSMPRPTAVPVADPWSSKRVAVESLLPSR--PQVTSQMEQL--NSAPPSIPQSSAL  683

Query  2524  PPFPGKEFPEYQGVAYSQGNNALLGVNTDS-SILLQNGISNLKNSGGENGFLNMPFSTCN  2700
              P PG+   + Q V     N+ L GV+ DS S+L+Q GI  L+N    N    +P+ST N
Sbjct  684   APLPGRGCLD-QDVNSDPQNHLLFGVSIDSQSLLMQGGIPGLQNG---NDSTAIPYSTSN  739

Query  2701  FTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISK  2880
             F S    D+ L+  + +S C+D++G++  S+N DQ N    TFVKV+KSG++GRSLDI++
Sbjct  740   FLSPSQNDFSLDHTLNSSGCLDDAGYVPCSDNSDQVNRLPATFVKVYKSGTYGRSLDITR  799

Query  2881  FSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKI  3060
             FSSYHELR EL R+FGLEG LEDP RSGWQLVFVDRE DVLL+GDDPWQEFV+ V  IKI
Sbjct  800   FSSYHELRRELGRLFGLEGQLEDPMRSGWQLVFVDREEDVLLVGDDPWQEFVSTVSCIKI  859

Query  3061  LSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMN-GIP-LGSLDY  3231
             LSP EV QMGK +G++L ++  A  +RL   GSSC+ +VS++E+R+++ GI  +GS+++
Sbjct  860   LSPQEVQQMGK-QGLELLSSA-APARRL---GSSCDDYVSRQESRSLSTGIASVGSVEF  913



>ref|NP_001045993.1| Os02g0164900 [Oryza sativa Japonica Group]
 sp|Q6H6V4.1|ARFF_ORYSJ RecName: Full=Auxin response factor 6; AltName: Full=OsARF6a 
[Oryza sativa Japonica Group]
 sp|A2X1A1.1|ARFF_ORYSI RecName: Full=Auxin response factor 6; AltName: Full=OsARF6a 
[Oryza sativa Indica Group]
 dbj|BAD25169.1| putative auxin response transcription factor(ARF6) [Oryza sativa 
Japonica Group]
 dbj|BAD25545.1| putative auxin response transcription factor(ARF6) [Oryza sativa 
Japonica Group]
 dbj|BAF07907.1| Os02g0164900 [Oryza sativa Japonica Group]
 gb|EAY84611.1| hypothetical protein OsI_05979 [Oryza sativa Indica Group]
 gb|EAZ21860.1| hypothetical protein OsJ_05506 [Oryza sativa Japonica Group]
 dbj|BAG92035.1| unnamed protein product [Oryza sativa Japonica Group]
Length=908

 Score =   752 bits (1942),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/438 (84%), Positives = 399/438 (91%), Gaps = 4/438 (1%)
 Frame = +1

Query  595   PQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAHIPS  774
             P   E   E+KCLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTNKE+++ IP+
Sbjct  15    PSPPEVAEEQKCLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTNKEMESQIPN  74

Query  775   YPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPTNY  954
             YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS QE KD   LPAELG  SKQPTNY
Sbjct  75    YPNLPPQLICQLHNVTMHADAETDEVYAQMTLQPLSPQELKDP-FLPAELGTASKQPTNY  133

Query  955   FCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFRGQ  1134
             FCKTLTASDTSTHGGFSVPRRAAEKVFPPLD++QQPPAQEL+AKDLHGNEWKFRH+FRGQ
Sbjct  134   FCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFTQQPPAQELMAKDLHGNEWKFRHIFRGQ  193

Query  1135  PKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDSMH  1314
             PKRHLLTTGWSVFVSAKRLVAGD+V+FIWN++NQLLLGIRRANRPQTVMPSSVLSSDSMH
Sbjct  194   PKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDSNQLLLGIRRANRPQTVMPSSVLSSDSMH  253

Query  1315  IGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFETEE  1494
             IGLLAAAAHAA+TNSRFTIFYNPRASPS+FVIPLAKY KAVYHTR+SVGMRFRMLFETEE
Sbjct  254   IGLLAAAAHAASTNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRISVGMRFRMLFETEE  313

Query  1495  SSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYP  1674
             SSVRRYMGTITGISDLDPVRW NSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYP
Sbjct  314   SSVRRYMGTITGISDLDPVRWMNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYP  373

Query  1675  SPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPFMQP  1854
             SPF LRLKRPWP+GLPS  G    D+  +S L WLR +  + G QSLNF G G++P+MQP
Sbjct  374   SPFPLRLKRPWPTGLPSLYGGKEDDL--ASSLMWLRDSQ-NTGFQSLNFGGLGMSPWMQP  430

Query  1855  RLDASMLGLQPDIYQTMA  1908
             RLD+S+LGLQPD+YQT+A
Sbjct  431   RLDSSLLGLQPDMYQTIA  448


 Score =   256 bits (653),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 163/351 (46%), Positives = 227/351 (65%), Gaps = 21/351 (6%)
 Frame = +1

Query  2203  RMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMH  2382
             +++ST QS  S  Q +S    Q +F D   + +  SN SS     RSF  + AS L  + 
Sbjct  571   QLSSTPQSTPSTLQTVSPFSQQHNFPDTNISCLSPSNVSSMHDTLRSFPSEAASDLPGVP  630

Query  2383  ETNPLAT---LPSKRIALESQVSSRATPYVVSQADMISPNSKVSDLP--TFLPPFPGKEF  2547
                P+       SKR+A+ES ++SR  P+ +S + + + +   S +P  + L P PG+E 
Sbjct  631   RITPVPVSDPWSSKRVAVESTITSR--PHDIS-SQIENFDLTPSSIPQNSTLAPLPGREC  687

Query  2548  PEYQGVAYSQGNNALLGVNTDS-SILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTD  2724
                Q  +    N+ L GVN DS S+L+Q+GI +L N   EN    +P+ST NF S    D
Sbjct  688   LVDQDGSSDPQNHFLFGVNIDSQSLLMQDGIPSLHN---ENSSSTIPYSTSNFLSPSQDD  744

Query  2725  YPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELR  2904
             YPL+  + T  C+DESG++  S+N DQ   P+ TFVKV+KSG+ GR LDI++FSSYHELR
Sbjct  745   YPLSQTLTTPGCLDESGYVPCSDNADQVKRPHATFVKVYKSGTVGRLLDITRFSSYHELR  804

Query  2905  SELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQ  3084
             SE+ R+FGLEG LEDP RSGWQLVFVDRE+DVLL+GDDPWQEFVN+V  IKILSP EV Q
Sbjct  805   SEVGRLFGLEGQLEDPLRSGWQLVFVDREDDVLLVGDDPWQEFVNSVSCIKILSPQEVQQ  864

Query  3085  MGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMN-GIP-LGSLDY  3231
             MGK  GI+L      + +RL   G+SC+ ++S++E+R+++ GI  +GS+++
Sbjct  865   MGK-PGIEL---FSTSARRL---GNSCDNYMSRQESRSLSTGIASVGSVEF  908



>ref|XP_009797608.1| PREDICTED: auxin response factor 6-like isoform X1 [Nicotiana 
sylvestris]
Length=899

 Score =   752 bits (1941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/456 (81%), Positives = 401/456 (88%), Gaps = 12/456 (3%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG N Q+ EG  E KCLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQVTASTN
Sbjct  1     MRLSSAGSNQQSPEG--ENKCLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVTASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE +AHIP+YP L  QLICQLHNVTMHAD ETDEVYAQMTLQPLS +EQK+   LP +LG
Sbjct  59    KEAEAHIPNYPSLAPQLICQLHNVTMHADMETDEVYAQMTLQPLSPEEQKEASFLPLDLG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPP QELIA+DLH NEW
Sbjct  119   IPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPVQELIARDLHDNEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD++IFIWNE NQL LGIRRANR QTVMPS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSIIFIWNEKNQLFLGIRRANRSQTVMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPR+ PSDFV+PLAKY KAVYHTR+SVGMR
Sbjct  239   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRSCPSDFVVPLAKYVKAVYHTRISVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVK--------VGWDESTAGERQP  1623
             FRMLFETEESSVRRYMGTITGI DLDPVRWPNSHWRSVK        VGWDESTAGERQP
Sbjct  299   FRMLFETEESSVRRYMGTITGIGDLDPVRWPNSHWRSVKPLYSLGVGVGWDESTAGERQP  358

Query  1624  RVSLWEIEPLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQG  1803
             RVSLWE+EPLTTFPMYPSPF LRLKR WP G P+  G+ + DM + +P+ WLR ++GD G
Sbjct  359   RVSLWEVEPLTTFPMYPSPFPLRLKRSWPPGFPALSGMKDDDM-VMNPMMWLR-DVGDGG  416

Query  1804  IQSLNFQGYGITPFMQPRLDASMLGLQPDIYQTMAT  1911
              QS+NFQG G+TP+MQPR+D  + G+Q DIYQ MA 
Sbjct  417   TQSINFQGIGVTPWMQPRIDVPIGGMQMDIYQAMAA  452


 Score =   273 bits (699),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 160/331 (48%), Positives = 215/331 (65%), Gaps = 18/331 (5%)
 Frame = +1

Query  2266  QQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMHETNPLAT---LPSKRIALE--  2430
             Q+SF+D   NH   S  +   SL  + + DE SQL+++  ++ L +    P KR+A++  
Sbjct  578   QESFTDTNVNHSTNSIVNPLHSLSGAVTRDEPSQLVSVPRSSSLLSPTGWPPKRVAVDPV  637

Query  2431  --SQVSSRATPYVVSQADMISPNSKVSDLPTFLPPFPGKEFPEYQGVAYSQGNNALLGVN  2604
               S  S R +P++       +PN  VS     LP FPG++ P  Q       N+ L G N
Sbjct  638   LPSASSQRMSPFIDQPG---TPNKNVSQNALSLPTFPGRDCPVGQEGNNDLHNHLLFGFN  694

Query  2605  TDSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQ  2784
              DS  L+Q+ + +L+  G +    N+PF++ N+ S  G D+  NP M  S C++  GF Q
Sbjct  695   IDSPSLMQSDMRSLRGVGSDCESANVPFASSNYLSNAGNDFAQNPVMALSGCINVPGFTQ  754

Query  2785  SSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG  2964
             +SEN  Q +P N TFVKV+KSGSFGRSLDI+KFSSYHELRSELARMFGLEGLLEDP RSG
Sbjct  755   TSENAGQESPHN-TFVKVYKSGSFGRSLDITKFSSYHELRSELARMFGLEGLLEDPLRSG  813

Query  2965  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRL  3144
             WQLVFVDRENDVLLLGDDPW EFVN+VW IKILSP +V QMGK +G++L N++  +    
Sbjct  814   WQLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPHDVQQMGK-QGLELLNSVSMSR---  869

Query  3145  PNGGSSCEVHVSQKETRNM-NGI-PLGSLDY  3231
              +  +SC+   ++ E+RNM +GI  + +LDY
Sbjct  870   -SSNNSCDDFANRSESRNMASGIMSVATLDY  899



>gb|KHN12428.1| Auxin response factor 6 [Glycine soja]
Length=904

 Score =   752 bits (1941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/447 (83%), Positives = 399/447 (89%), Gaps = 5/447 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S  G +P  +EG  EK+ L+SELWHACAGPLVSLP +GSRVVYFPQGHSEQV  STN
Sbjct  1     MKLSSPGFSPPPQEG--EKRVLDSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAVSTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             +E+D HIP+YP LP QLICQLHN+TMHAD ETDEVYAQMTLQPL+ QEQK    LPAELG
Sbjct  59    REVDGHIPNYPSLPPQLICQLHNLTMHADTETDEVYAQMTLQPLNPQEQKG-AYLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCK LTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPP QELIA+DLHGNEW
Sbjct  118   TPSKQPTNYFCKILTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPCQELIARDLHGNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQ VMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQPVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLD +RWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDSIRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRLKRPWP GLP F GL + D  I+S L WLR    D+G+ SLNFQG
Sbjct  358   PLTTFPMYPSPFPLRLKRPWPPGLPLFHGLKDDDFGINSSLMWLRDT--DRGLPSLNFQG  415

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMA  1908
              G++P+MQPRLD SM+  Q D+YQ MA
Sbjct  416   IGVSPWMQPRLDPSMVNYQSDMYQAMA  442


 Score =   265 bits (676),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 173/363 (48%), Positives = 230/363 (63%), Gaps = 26/363 (7%)
 Frame = +1

Query  2176  MSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHD  2355
             +S  ++++ +  S  QSQ    QA+SS   QQSFSD  GN   T+  S   S+  SF  D
Sbjct  557   ISSVVSTMSQFVSAAQSQSPPMQAISSLGHQQSFSDSNGNPTTTAIVSPLHSILDSFPQD  616

Query  2356  EASQLLNMHETNPLATL-------PSKRIALESQVSSRATPYVVSQADMIS-PNSKVSDL  2511
             + S LL++  +     +       PSKR+ ++  +SS A+  V+ Q + +  P+S ++  
Sbjct  617   DTSHLLSLPRSTSWVPVQHSTAWPPSKRVVVDPLLSSGASQCVLPQVEQLGQPHSTMAQN  676

Query  2512  PTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTD-SSILLQNGISNLKNSGGENGFLNMPF  2688
                LP FPG+E    +G    Q N+ L GVN + SS+L+ NG+S+LK     +    +PF
Sbjct  677   GIALPGFPGREC-TIEGSNDPQ-NHLLFGVNIEPSSLLMHNGMSSLKGVSSNSDSPTIPF  734

Query  2689  STCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSL  2868
              + N+ +  G D  LNP  G +  + E+GFLQ+ EN  Q NP N+TFVKV+KSGSFGRSL
Sbjct  735   QSSNYLNTTGPDSSLNP--GMTHNIGETGFLQTPENGGQGNPSNKTFVKVYKSGSFGRSL  792

Query  2869  DISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVW  3048
             DI+KF+SY ELRSELARMFGLEG LEDP RSGWQLVFVD+ENDVLLLGD PW EFVN+V 
Sbjct  793   DITKFTSYPELRSELARMFGLEGELEDPVRSGWQLVFVDQENDVLLLGDGPWPEFVNSVG  852

Query  3049  YIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMN-GI-PLGS  3222
             YIKILSP EV QMG  E ++L N++P   QRL NG   CE      + RN++ GI  +GS
Sbjct  853   YIKILSPQEVQQMGNNE-LELLNSVPI--QRLSNG--VCE------DPRNLSTGITTVGS  901

Query  3223  LDY  3231
             L+Y
Sbjct  902   LNY  904



>ref|XP_003531170.1| PREDICTED: auxin response factor 6-like isoform X1 [Glycine max]
Length=904

 Score =   752 bits (1941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/447 (83%), Positives = 399/447 (89%), Gaps = 5/447 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S  G +P  +EG  EK+ L+SELWHACAGPLVSLP +GSRVVYFPQGHSEQV  STN
Sbjct  1     MKLSSPGFSPPPQEG--EKRVLDSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAVSTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             +E+D HIP+YP LP QLICQLHN+TMHAD ETDEVYAQMTLQPL+ QEQK    LPAELG
Sbjct  59    REVDGHIPNYPSLPPQLICQLHNLTMHADTETDEVYAQMTLQPLNPQEQKG-AYLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCK LTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPP QELIA+DLHGNEW
Sbjct  118   TPSKQPTNYFCKILTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPCQELIARDLHGNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQ VMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQPVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLD +RWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDSIRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRLKRPWP GLP F GL + D  I+S L WLR    D+G+ SLNFQG
Sbjct  358   PLTTFPMYPSPFPLRLKRPWPPGLPLFHGLKDDDFGINSSLMWLRDT--DRGLPSLNFQG  415

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMA  1908
              G++P+MQPRLD SM+  Q D+YQ MA
Sbjct  416   IGVSPWMQPRLDPSMVNYQSDMYQAMA  442


 Score =   265 bits (677),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 173/363 (48%), Positives = 230/363 (63%), Gaps = 26/363 (7%)
 Frame = +1

Query  2176  MSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHD  2355
             +S  ++++ +  S  QSQ    QA+SS   QQSFSD  GN   T+  S   S+  SF  D
Sbjct  557   ISSVVSTMSQFVSAAQSQSPPMQAISSLGHQQSFSDSNGNPTTTAIVSPLHSILDSFPQD  616

Query  2356  EASQLLNMHETNPLATL-------PSKRIALESQVSSRATPYVVSQADMIS-PNSKVSDL  2511
             + S LL++  +     +       PSKR+ ++  +SS A+  V+ Q + +  P+S ++  
Sbjct  617   DTSHLLSLPRSTSWVPVQHSTAWPPSKRVVVDPLLSSGASQCVLPQVEQLGQPHSTMAQN  676

Query  2512  PTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTD-SSILLQNGISNLKNSGGENGFLNMPF  2688
                LP FPG+E    +G    Q N+ L GVN + SS+L+ NG+S+LK     +    +PF
Sbjct  677   GIALPAFPGREC-TIEGSNDPQ-NHLLFGVNIEPSSLLMHNGMSSLKGVSSNSDSPTIPF  734

Query  2689  STCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSL  2868
              + N+ +  G D  LNP  G +  + E+GFLQ+ EN  Q NP N+TFVKV+KSGSFGRSL
Sbjct  735   QSSNYLNTTGPDSSLNP--GMTHNIGETGFLQTPENGGQGNPSNKTFVKVYKSGSFGRSL  792

Query  2869  DISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVW  3048
             DI+KF+SY ELRSELARMFGLEG LEDP RSGWQLVFVD+ENDVLLLGD PW EFVN+V 
Sbjct  793   DITKFTSYPELRSELARMFGLEGELEDPVRSGWQLVFVDQENDVLLLGDGPWPEFVNSVG  852

Query  3049  YIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMN-GI-PLGS  3222
             YIKILSP EV QMG  E ++L N++P   QRL NG   CE      + RN++ GI  +GS
Sbjct  853   YIKILSPQEVQQMGNNE-LELLNSVPI--QRLSNG--VCE------DPRNLSTGITTVGS  901

Query  3223  LDY  3231
             L+Y
Sbjct  902   LNY  904



>gb|EAZ38013.1| hypothetical protein OsJ_22358 [Oryza sativa Japonica Group]
Length=904

 Score =   751 bits (1940),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/434 (85%), Positives = 396/434 (91%), Gaps = 4/434 (1%)
 Frame = +1

Query  607   EGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAHIPSYPGL  786
             E   E+KCLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTNKE+++ IP+YP L
Sbjct  19    EAVEEQKCLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTNKEMESQIPNYPNL  78

Query  787   PAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPTNYFCKT  966
             P QLICQLHNVTMHAD ETDEVYAQMTLQPLS QE KD   LPAELG  +KQPTNYFCKT
Sbjct  79    PPQLICQLHNVTMHADAETDEVYAQMTLQPLSPQELKDP-YLPAELGSANKQPTNYFCKT  137

Query  967   LTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFRGQPKRH  1146
             LTASDTSTHGGFSVPRRAAEKVFPPLD++QQPPAQELIAKDLHGNEWKFRH+FRGQPKRH
Sbjct  138   LTASDTSTHGGFSVPRRAAEKVFPPLDFTQQPPAQELIAKDLHGNEWKFRHIFRGQPKRH  197

Query  1147  LLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLL  1326
             LLTTGWSVFVSAKRLVAGD+V+FIWN+NNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLL
Sbjct  198   LLTTGWSVFVSAKRLVAGDSVLFIWNDNNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLL  257

Query  1327  aaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFETEESSVR  1506
             AAAAHAA+TNSRFTIFYNPRASPS+FVIPL+KY KAVYHTR+SVGMRFRMLFETEESSVR
Sbjct  258   AAAAHAASTNSRFTIFYNPRASPSEFVIPLSKYVKAVYHTRISVGMRFRMLFETEESSVR  317

Query  1507  RYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFS  1686
             RYMGTITGISDLD  RWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPF 
Sbjct  318   RYMGTITGISDLDAARWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFP  377

Query  1687  LRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPFMQPRLDA  1866
             LRLKRPWP+GLPS  G  + D+  +S L WLR +  + G QSLNF G G+ P+MQPR DA
Sbjct  378   LRLKRPWPTGLPSLHGGKDDDL--TSSLMWLR-DSANPGFQSLNFGGLGMNPWMQPRFDA  434

Query  1867  SMLGLQPDIYQTMA  1908
             S+LGLQPD+YQT+A
Sbjct  435   SLLGLQPDMYQTIA  448


 Score =   192 bits (487),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 137/327 (42%), Positives = 191/327 (58%), Gaps = 31/327 (9%)
 Frame = +1

Query  2269  QSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMHETNPLATLP--SKRIALESQVS  2442
             QS+ D   + +  SN S+  +  R FS +  S L     T      P  SKR+A+ES + 
Sbjct  603   QSYPDTSMSSLSPSNTSTMHNALRPFSSEAPSHLSMPRPTAVPVPDPWSSKRVAVESLLP  662

Query  2443  SRATPYVVSQADMISPNSKVSDLPTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTDS-SI  2619
             SR  P V SQ + +   +      + L P PG+     Q       N+ L GVN DS S+
Sbjct  663   SR--PQVTSQMEQLDSTAPSIPQSSALAPLPGRGCLVDQDGNSDPQNHLLFGVNIDSQSL  720

Query  2620  LLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENV  2799
             L+Q GI +L+   GEN    +P+ST NF S    D+PL+  + ++ C+DESG++  S+N 
Sbjct  721   LMQGGIPSLQ---GENDSTAIPYSTSNFLSPSQNDFPLDQTLSSADCLDESGYVPCSQNS  777

Query  2800  DQA-NPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLV  2976
             DQ  N P  TFVK +     G  ++            EL R+FGLEG LE+P RSGWQLV
Sbjct  778   DQVINRPPATFVK-NICLQIGNPME------------ELGRLFGLEGQLENPLRSGWQLV  824

Query  2977  FVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGG  3156
             FVDRE+DVLL+GDDPWQEFVN+V  IKILSP EV QMGK    +L ++ P   +RL   G
Sbjct  825   FVDREDDVLLVGDDPWQEFVNSVSCIKILSPQEVQQMGKP--FELLSSAPG--KRL---G  877

Query  3157  SSCEVHVSQKETRNMN-GIP-LGSLDY  3231
             SSC+ +VS++E+R+++ GI  +GS+++
Sbjct  878   SSCDDYVSRQESRSLSTGIASVGSVEF  904



>ref|XP_006597509.1| PREDICTED: auxin response factor 6-like isoform X2 [Glycine max]
Length=898

 Score =   751 bits (1940),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/445 (83%), Positives = 401/445 (90%), Gaps = 6/445 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S A  +P  +EG  EK+ L+SELWHACAGPLVSLP +GSRVVYFPQGHSEQV  STN
Sbjct  1     MRLSSADFSPPPQEG--EKRVLDSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAVSTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP LP QLICQLHN+TMHAD ETDEVYAQMTLQPL+ QEQ +   LPAELG
Sbjct  59    KEVDAHIPNYPSLPPQLICQLHNMTMHADVETDEVYAQMTLQPLNPQEQNE-AYLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
               SKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLHGNEW
Sbjct  118   TASKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHGNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGI DLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGIGDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSF-PGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQ  1824
             PLTTFPMYPS F LRLKRPWP GLPSF  G+ + D  ++SPL WLR    D+G+QSLNFQ
Sbjct  358   PLTTFPMYPSSFPLRLKRPWPPGLPSFHAGMKDDDFGLNSPLLWLRDT--DRGLQSLNFQ  415

Query  1825  GYGITPFMQPRLDASMLGLQPDIYQ  1899
             G G+ P+MQPR D ++L +Q D+YQ
Sbjct  416   GIGVNPWMQPRFDPTVLNMQTDMYQ  440


 Score =   284 bits (726),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 181/363 (50%), Positives = 237/363 (65%), Gaps = 21/363 (6%)
 Frame = +1

Query  2176  MSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHD  2355
             +S  ++++ ++ S  Q Q    QA+SS    Q+FS+  GN V T+  S   S+  SF  D
Sbjct  546   ISSAVSTMSQLFSAPQPQSPPMQAISSLC--QNFSNSNGNSV-TTIVSPLHSILGSFPQD  602

Query  2356  EASQLLNMHETNPLATL------PSKRIALESQVSSRATPYVVSQADMIS-PNSKVSDLP  2514
             E S LLN+  T+    +      PSKR+A++  +SS A+  V+ Q D +  P+S +S   
Sbjct  603   ETSHLLNLPRTSSWIPIQNSSGWPSKRVAVDPLLSSGASHCVLPQVDQLGQPHSTMSLNA  662

Query  2515  TFLPPFPGKEFPEYQGVAYSQGNNALLGVNTD-SSILLQNGISNLKNSGGENGFLNMPFS  2691
               LPPFPG+E    Q  +    N+ L GVN D SS+L+ NG+S+LK   G N    +P+ 
Sbjct  663   ITLPPFPGRESSIDQEGSNDPQNHLLFGVNIDPSSLLMPNGMSSLKGVSGNNNSSTLPYQ  722

Query  2692  TCNF-TSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSL  2868
             + N+  +  GTD  LN   G +  + +SGFL   E+  Q NP N+TFVKV+KSGSFGRSL
Sbjct  723   SSNYLNTTTGTDSSLN--HGMTPNIGDSGFLHCPEDAGQGNPLNKTFVKVYKSGSFGRSL  780

Query  2869  DISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVW  3048
             DI+KFSSYHELR ELARMFGLEG LEDP RSGWQLVFVDRENDVLLLGD PW EFVN+VW
Sbjct  781   DITKFSSYHELRGELARMFGLEGELEDPVRSGWQLVFVDRENDVLLLGDGPWPEFVNSVW  840

Query  3049  YIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMN-GI-PLGS  3222
              IKILSP EV QMG   G++L N++P  NQRL NG   C+ +VS+++ RN++ GI  +GS
Sbjct  841   CIKILSPQEVQQMGN-NGLELLNSVP--NQRLSNG--ICDDYVSRQDPRNLSTGITTVGS  895

Query  3223  LDY  3231
             LDY
Sbjct  896   LDY  898



>ref|XP_006646917.1| PREDICTED: auxin response factor 6-like [Oryza brachyantha]
Length=916

 Score =   752 bits (1941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/435 (85%), Positives = 397/435 (91%), Gaps = 4/435 (1%)
 Frame = +1

Query  607   EGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAHIPSYPGL  786
             E   E+KCLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTNKE+++ IP+YP L
Sbjct  21    EVAEEQKCLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTNKEMESQIPNYPNL  80

Query  787   PAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPTNYFCKT  966
             P QLICQLHNVTMHAD ETDEVYAQMTLQPLS QE KD   LPAELG  SKQPTNYFCKT
Sbjct  81    PPQLICQLHNVTMHADAETDEVYAQMTLQPLSPQELKDP-FLPAELGTASKQPTNYFCKT  139

Query  967   LTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFRGQPKRH  1146
             LTASDTSTHGGFSVPRRAAEKVFPPLD++QQPPAQELIAKDLHGNEWKFRH+FRGQPKRH
Sbjct  140   LTASDTSTHGGFSVPRRAAEKVFPPLDFTQQPPAQELIAKDLHGNEWKFRHIFRGQPKRH  199

Query  1147  LLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLL  1326
             LLTTGWSVFVSAKRLVAGD+V+FIWN++NQLLLGIRRANRPQTVMPSSVLSSDSMHIGLL
Sbjct  200   LLTTGWSVFVSAKRLVAGDSVLFIWNDSNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLL  259

Query  1327  aaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFETEESSVR  1506
             AAAAHAA+TNSRFTIFYNPRASPS+FVIPLAKY KAVYHTR+SVGMRFRMLFETEESSVR
Sbjct  260   AAAAHAASTNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRISVGMRFRMLFETEESSVR  319

Query  1507  RYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFS  1686
             RYMGTITGISDLDPVRW NSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPF 
Sbjct  320   RYMGTITGISDLDPVRWQNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFP  379

Query  1687  LRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPFMQPRLDA  1866
             LRLKRPWPSGLPS  G    D+  +S L WLR    + G QSLNF G G++P+MQPRLD+
Sbjct  380   LRLKRPWPSGLPSLYGGKEDDL--ASSLMWLRDGQ-NSGFQSLNFGGLGMSPWMQPRLDS  436

Query  1867  SMLGLQPDIYQTMAT  1911
             S+LGLQPD+YQT+A 
Sbjct  437   SLLGLQPDMYQTIAA  451


 Score =   250 bits (638),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 161/351 (46%), Positives = 221/351 (63%), Gaps = 21/351 (6%)
 Frame = +1

Query  2203  RMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMH  2382
             +++ST QS  S  Q +S+   Q +F D     +  SN SS     R F  + AS L  + 
Sbjct  579   QLSSTPQSAPSTLQTVSAFSQQHNFPDANIGCLSPSNVSSMHDTLRPFHSEAASDLPGVP  638

Query  2383  ETNPLAT---LPSKRIALESQVSSRATPYVVSQADMISPNSKVSDLP--TFLPPFPGKEF  2547
                P+       SKR+A+ES +SSR  P+ +S + + + +   S +P  + L P PG+E 
Sbjct  639   RITPVPISDPWSSKRVAVESAISSR--PHAIS-SQLENFDLTPSTIPQNSTLAPLPGREC  695

Query  2548  PEYQGVAYSQGNNALLGVNTDS-SILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTD  2724
                Q       N+ L GVN DS S+L+Q+GI NL N   +N    +P+ST NF S    D
Sbjct  696   LVDQDGGSDPQNHFLFGVNIDSQSLLMQDGIPNLHN---DNDSSTIPYSTSNFLSPSQND  752

Query  2725  YPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELR  2904
             YPLN  + T  C+DE  +   S+N DQ   P  TFVKV+KSG+ GR LDI++FSSYHELR
Sbjct  753   YPLNQTLTTPGCLDEPEYGSCSDNADQVKRPPATFVKVYKSGTVGRLLDITRFSSYHELR  812

Query  2905  SELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQ  3084
             SE+ R+FGLEG LEDP RSGWQLVFVDRE+DVLL+GDDPWQEFVN+V  IKILSP EV Q
Sbjct  813   SEVGRLFGLEGQLEDPLRSGWQLVFVDREDDVLLVGDDPWQEFVNSVSCIKILSPQEVQQ  872

Query  3085  MGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMN-GIP-LGSLDY  3231
             MGK  GI+L      + +RL   G+SC+ +++++E+R+++ GI  +GS+++
Sbjct  873   MGK-PGIEL---FSTSARRL---GNSCDNYMNRQESRSLSTGIASVGSVEF  916



>sp|A2YG67.1|ARFQ_ORYSI RecName: Full=Auxin response factor 17 [Oryza sativa Indica Group]
 gb|EAZ02078.1| hypothetical protein OsI_24158 [Oryza sativa Indica Group]
Length=917

 Score =   751 bits (1940),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/434 (85%), Positives = 396/434 (91%), Gaps = 4/434 (1%)
 Frame = +1

Query  607   EGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAHIPSYPGL  786
             E   E+KCLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTNKE+++ IP+YP L
Sbjct  19    EAVEEQKCLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTNKEMESQIPNYPNL  78

Query  787   PAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPTNYFCKT  966
             P QLICQLHNVTMHAD ETDEVYAQMTLQPLS QE KD   LPAELG  +KQPTNYFCKT
Sbjct  79    PPQLICQLHNVTMHADAETDEVYAQMTLQPLSPQELKDP-YLPAELGSANKQPTNYFCKT  137

Query  967   LTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFRGQPKRH  1146
             LTASDTSTHGGFSVPRRAAEKVFPPLD++QQPPAQELIAKDLHGNEWKFRH+FRGQPKRH
Sbjct  138   LTASDTSTHGGFSVPRRAAEKVFPPLDFTQQPPAQELIAKDLHGNEWKFRHIFRGQPKRH  197

Query  1147  LLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLL  1326
             LLTTGWSVFVSAKRLVAGD+V+FIWN+NNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLL
Sbjct  198   LLTTGWSVFVSAKRLVAGDSVLFIWNDNNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLL  257

Query  1327  aaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFETEESSVR  1506
             AAAAHAA+TNSRFTIFYNPRASPS+FVIPL+KY KAVYHTR+SVGMRFRMLFETEESSVR
Sbjct  258   AAAAHAASTNSRFTIFYNPRASPSEFVIPLSKYVKAVYHTRISVGMRFRMLFETEESSVR  317

Query  1507  RYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFS  1686
             RYMGTITGISDLD  RWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPF 
Sbjct  318   RYMGTITGISDLDAARWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFP  377

Query  1687  LRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPFMQPRLDA  1866
             LRLKRPWP+GLPS  G  + D+  +S L WLR +  + G QSLNF G G+ P+MQPR DA
Sbjct  378   LRLKRPWPTGLPSLHGGKDDDL--TSSLMWLR-DSANPGFQSLNFGGLGMNPWMQPRFDA  434

Query  1867  SMLGLQPDIYQTMA  1908
             S+LGLQPD+YQT+A
Sbjct  435   SLLGLQPDMYQTIA  448


 Score =   245 bits (626),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 154/327 (47%), Positives = 211/327 (65%), Gaps = 18/327 (6%)
 Frame = +1

Query  2269  QSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMHETNPLATLP--SKRIALESQVS  2442
             QS+ D   + +  SN S+  +  R FS +  S L     T      P  SKR+A+ES + 
Sbjct  603   QSYPDTSMSSLSPSNTSTMHNALRPFSSEAPSHLSMPRPTAVPVPDPWSSKRVAVESLLP  662

Query  2443  SRATPYVVSQADMISPNSKVSDLPTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTDS-SI  2619
             SR  P V SQ + +   +      + L P PG+     Q       N+ L GVN DS S+
Sbjct  663   SR--PQVTSQMEQLDSTAPSIPQSSALAPLPGRGCLVDQDGNSDPQNHLLFGVNIDSQSL  720

Query  2620  LLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENV  2799
             L+Q GI +L+   GEN    +P+ST NF S +  D+PL+  + ++ C+DESG++  S+N 
Sbjct  721   LMQGGIPSLQ---GENDSTAIPYSTSNFLSPLQNDFPLDQTLSSADCLDESGYVPCSQNS  777

Query  2800  DQA-NPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLV  2976
             DQ  N P  TFVKV+KSG++GRSLDI++FSSYHELR EL R+FGLEG LE+P RSGWQLV
Sbjct  778   DQVINRPPATFVKVYKSGTYGRSLDITRFSSYHELRRELGRLFGLEGQLENPLRSGWQLV  837

Query  2977  FVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGG  3156
             FVDRE+DVLL+GDDPWQEFVN+V  IKILSP EV QMGK    +L ++ P   +RL   G
Sbjct  838   FVDREDDVLLVGDDPWQEFVNSVSCIKILSPQEVQQMGKP--FELLSSAPG--KRL---G  890

Query  3157  SSCEVHVSQKETRNMN-GIP-LGSLDY  3231
             SSC+ +VS++E+R+++ GI  +GS+++
Sbjct  891   SSCDDYVSRQESRSLSTGIASVGSVEF  917



>ref|XP_009627653.1| PREDICTED: auxin response factor 6-like isoform X2 [Nicotiana 
tomentosiformis]
Length=899

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/456 (81%), Positives = 400/456 (88%), Gaps = 12/456 (3%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG N Q+ EG  E KCLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQVTASTN
Sbjct  1     MRLSSAGSNQQSPEG--ENKCLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVTASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE +AHIP+YP L  QLICQLHNVTMHAD ETDEVYAQMTLQPLS +EQK+   LP +LG
Sbjct  59    KEAEAHIPNYPSLAPQLICQLHNVTMHADVETDEVYAQMTLQPLSPEEQKEASFLPLDLG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPP QELIA+DLH NEW
Sbjct  119   TPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPVQELIARDLHDNEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD++IFIWNE NQL LGIRRANR QTVMPS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSIIFIWNEKNQLFLGIRRANRSQTVMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPR+ PSDFV+PLAKY KAVYHTR+SVGMR
Sbjct  239   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRSCPSDFVVPLAKYVKAVYHTRISVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVK--------VGWDESTAGERQP  1623
             FRMLFETEESSVRRYMGTITGI DLDPVRWPNSHWRSVK        VGWDESTAGERQP
Sbjct  299   FRMLFETEESSVRRYMGTITGIGDLDPVRWPNSHWRSVKPLYSLGVGVGWDESTAGERQP  358

Query  1624  RVSLWEIEPLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQG  1803
             RVSLWE+EPLTTFPMYPSPF LRLKR WP G P+  G+ + DM + +P+ WLR ++GD G
Sbjct  359   RVSLWEVEPLTTFPMYPSPFPLRLKRSWPPGFPALSGMKDDDM-VMNPMMWLR-DVGDGG  416

Query  1804  IQSLNFQGYGITPFMQPRLDASMLGLQPDIYQTMAT  1911
              QS+NFQG G+TP+MQPR+D  + G+Q DIYQ MA 
Sbjct  417   TQSINFQGIGVTPWMQPRIDVPIGGMQMDIYQAMAA  452


 Score =   271 bits (693),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 157/331 (47%), Positives = 212/331 (64%), Gaps = 18/331 (5%)
 Frame = +1

Query  2266  QQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMHETNPLAT---LPSKRIALE--  2430
             Q+SF+D   NH   S  +   SL  + + DE SQL+++  ++ L +    P KR+A++  
Sbjct  578   QESFTDTNVNHSTNSIVNPLHSLSGAVTRDEPSQLVSVPRSSSLLSPTGWPPKRVAVDPV  637

Query  2431  --SQVSSRATPYVVSQADMISPNSKVSDLPTFLPPFPGKEFPEYQGVAYSQGNNALLGVN  2604
               S  S R +PY+       +PN  VS     LP FPG++ P  Q       N+ L G N
Sbjct  638   LPSASSQRMSPYIDQSG---TPNKNVSQNALSLPTFPGRDCPVGQEGNNDPHNHLLFGFN  694

Query  2605  TDSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQ  2784
              DS  L+Q+ + +L+    +    N+PF++ N+ S  G D+  NP M  S C++  GF Q
Sbjct  695   IDSPSLMQSDMRSLRGVVSDCESTNVPFASSNYLSNAGNDFSQNPVMALSGCINVPGFTQ  754

Query  2785  SSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG  2964
             +SEN  Q +P N TFVKV+KSGSFGRSLDI+KFSSYHELRSELARMFGLEGLLEDP RSG
Sbjct  755   TSENAGQESPHN-TFVKVYKSGSFGRSLDITKFSSYHELRSELARMFGLEGLLEDPLRSG  813

Query  2965  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRL  3144
             WQLVFVDRENDVLLLGDDPW EFVN+VW IKILSP +V QMG+ +G++L N++  +    
Sbjct  814   WQLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPHDVQQMGR-QGLELLNSVSMSR---  869

Query  3145  PNGGSSCEVHVSQKETRNMNG--IPLGSLDY  3231
              +  +SC+   ++ E+RNM    + + +LDY
Sbjct  870   -SSNNSCDDFANRSESRNMTSGIMSVATLDY  899



>gb|ADG43152.1| auxin response factor 18 [Zea mays]
Length=913

 Score =   751 bits (1939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/445 (83%), Positives = 398/445 (89%), Gaps = 4/445 (1%)
 Frame = +1

Query  577   SLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEI  756
             S+    P + E   E KCLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTNKEI
Sbjct  9     SVLPAQPGSPEAVEEHKCLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTNKEI  68

Query  757   DAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPS  936
             ++ IP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPL+ QE KD   LPAELG  +
Sbjct  69    ESQIPNYPNLPPQLICQLHNVTMHADAETDEVYAQMTLQPLNPQELKDP-YLPAELGSAN  127

Query  937   KQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFR  1116
             KQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD++QQPP QEL+AKDLHGNEWKFR
Sbjct  128   KQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFTQQPPCQELMAKDLHGNEWKFR  187

Query  1117  HVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVL  1296
             H+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+NNQLLLGIRRANRPQTVMPSSVL
Sbjct  188   HIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDNNQLLLGIRRANRPQTVMPSSVL  247

Query  1297  SSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRM  1476
             SSDSMHIGLLAAAAHAA+TNSRFTIFYNPRASPS+FVIPL KY KAVYHTR+SVGMRFRM
Sbjct  248   SSDSMHIGLLAAAAHAASTNSRFTIFYNPRASPSEFVIPLVKYVKAVYHTRISVGMRFRM  307

Query  1477  LFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLT  1656
             LFETEESSVRRYMGTITGI DLD VRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLT
Sbjct  308   LFETEESSVRRYMGTITGICDLDSVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLT  367

Query  1657  TFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGI  1836
             TFPMYPSPF LRLKRPWP+GLPS  G  + D+  S  L WLR +  + G QSLNF G G+
Sbjct  368   TFPMYPSPFPLRLKRPWPTGLPSLHGGKDDDLANS--LMWLR-DTANPGFQSLNFGGLGM  424

Query  1837  TPFMQPRLDASMLGLQPDIYQTMAT  1911
             +P+MQPRLDA++LGLQPD+YQ MAT
Sbjct  425   SPWMQPRLDATLLGLQPDMYQAMAT  449


 Score =   247 bits (631),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 155/347 (45%), Positives = 216/347 (62%), Gaps = 15/347 (4%)
 Frame = +1

Query  2176  MSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHD  2355
             +S  ++   +++  +QS     Q +      QSF+D     +  SN ++ Q+  R FS +
Sbjct  566   ISNALSPFSQLSPVSQSSPMALQTILPFSQAQSFTDTNVGSLSPSNGNTMQNTLRPFSSE  625

Query  2356  EASQLLNMHETNPLATLP--SKRIALESQVSSRATPYVVSQADMISPNSKVSDLPTFLPP  2529
               S L     T      P  SKR+A+ES + SR  P V SQ + + P        + L P
Sbjct  626   AVSHLSMPRPTAIPVADPWSSKRVAVESLLPSR--PQVSSQMEQLDPAPASIPHSSALAP  683

Query  2530  FPGKEFPEYQGVAYSQGNNALLGVNTDS-SILLQNGISNLKNSGGENGFLNMPFSTCNFT  2706
              PG+     Q V     N+ L GV+ DS S+L+Q GI  L+N    N    +P+ST NF 
Sbjct  684   LPGRGCLVDQDVNSDPQNHLLFGVSIDSQSLLMQGGIPGLQNG---NDSAAIPYSTSNFL  740

Query  2707  SGVGTDYPLNPDMGTSSCVDESGFLQ-SSENVDQANPPNRTFVKVHKSGSFGRSLDISKF  2883
             S    D+PL+  + +S C+D+SG++   S+N D+ N P  TFVKV+KSG++GRSLDI++F
Sbjct  741   SPSQNDFPLDHTLNSSGCLDDSGYVPPCSDNSDKVNRPPATFVKVYKSGTYGRSLDITRF  800

Query  2884  SSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKIL  3063
             SSYHELR EL R+FGLEG LEDP RSGWQLVFV+RE DVLL+GDDPWQEFV+ V  IKIL
Sbjct  801   SSYHELRRELGRLFGLEGQLEDPLRSGWQLVFVNREEDVLLVGDDPWQEFVSTVSCIKIL  860

Query  3064  SPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMN  3204
             SP EV QMGK +G++L ++ PA  +RL   GSSC+ +VS++E+R+++
Sbjct  861   SPQEVQQMGK-QGLELLSSAPA--RRL---GSSCDDYVSRQESRSLS  901



>ref|NP_001058360.1| Os06g0677800 [Oryza sativa Japonica Group]
 sp|Q653U3.1|ARFQ_ORYSJ RecName: Full=Auxin response factor 17 [Oryza sativa Japonica 
Group]
 dbj|BAD45527.1| putative auxin response factor [Oryza sativa Japonica Group]
 dbj|BAD45924.1| putative auxin response factor [Oryza sativa Japonica Group]
 dbj|BAF20274.1| Os06g0677800 [Oryza sativa Japonica Group]
Length=917

 Score =   751 bits (1939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/434 (85%), Positives = 396/434 (91%), Gaps = 4/434 (1%)
 Frame = +1

Query  607   EGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAHIPSYPGL  786
             E   E+KCLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTNKE+++ IP+YP L
Sbjct  19    EAVEEQKCLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTNKEMESQIPNYPNL  78

Query  787   PAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPTNYFCKT  966
             P QLICQLHNVTMHAD ETDEVYAQMTLQPLS QE KD   LPAELG  +KQPTNYFCKT
Sbjct  79    PPQLICQLHNVTMHADAETDEVYAQMTLQPLSPQELKDP-YLPAELGSANKQPTNYFCKT  137

Query  967   LTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFRGQPKRH  1146
             LTASDTSTHGGFSVPRRAAEKVFPPLD++QQPPAQELIAKDLHGNEWKFRH+FRGQPKRH
Sbjct  138   LTASDTSTHGGFSVPRRAAEKVFPPLDFTQQPPAQELIAKDLHGNEWKFRHIFRGQPKRH  197

Query  1147  LLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLL  1326
             LLTTGWSVFVSAKRLVAGD+V+FIWN+NNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLL
Sbjct  198   LLTTGWSVFVSAKRLVAGDSVLFIWNDNNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLL  257

Query  1327  aaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFETEESSVR  1506
             AAAAHAA+TNSRFTIFYNPRASPS+FVIPL+KY KAVYHTR+SVGMRFRMLFETEESSVR
Sbjct  258   AAAAHAASTNSRFTIFYNPRASPSEFVIPLSKYVKAVYHTRISVGMRFRMLFETEESSVR  317

Query  1507  RYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFS  1686
             RYMGTITGISDLD  RWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPF 
Sbjct  318   RYMGTITGISDLDAARWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFP  377

Query  1687  LRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPFMQPRLDA  1866
             LRLKRPWP+GLPS  G  + D+  +S L WLR +  + G QSLNF G G+ P+MQPR DA
Sbjct  378   LRLKRPWPTGLPSLHGGKDDDL--TSSLMWLR-DSANPGFQSLNFGGLGMNPWMQPRFDA  434

Query  1867  SMLGLQPDIYQTMA  1908
             S+LGLQPD+YQT+A
Sbjct  435   SLLGLQPDMYQTIA  448


 Score =   244 bits (622),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 154/327 (47%), Positives = 210/327 (64%), Gaps = 18/327 (6%)
 Frame = +1

Query  2269  QSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMHETNPLATLP--SKRIALESQVS  2442
             QS+ D   + +  SN S+  +  R FS +  S L     T      P  SKR+A+ES + 
Sbjct  603   QSYPDTSMSSLSPSNTSTMHNALRPFSSEAPSHLSMPRPTAVPVPDPWSSKRVAVESLLP  662

Query  2443  SRATPYVVSQADMISPNSKVSDLPTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTDS-SI  2619
             SR  P V SQ + +   +      + L P PG+     Q       N+ L GVN DS S+
Sbjct  663   SR--PQVTSQMEQLDSTAPSIPQSSALAPLPGRGCLVDQDGNSDPQNHLLFGVNIDSQSL  720

Query  2620  LLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENV  2799
             L+Q GI +L+   GEN    +P+ST NF S    D+PL+  + ++ C+DESG++  S+N 
Sbjct  721   LMQGGIPSLQ---GENDSTAIPYSTSNFLSPSQNDFPLDQTLSSADCLDESGYVPCSQNS  777

Query  2800  DQA-NPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLV  2976
             DQ  N P  TFVKV+KSG++GRSLDI++FSSYHELR EL R+FGLEG LE+P RSGWQLV
Sbjct  778   DQVINRPPATFVKVYKSGTYGRSLDITRFSSYHELRRELGRLFGLEGQLENPLRSGWQLV  837

Query  2977  FVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGG  3156
             FVDRE+DVLL+GDDPWQEFVN+V  IKILSP EV QMGK    +L ++ P   +RL   G
Sbjct  838   FVDREDDVLLVGDDPWQEFVNSVSCIKILSPQEVQQMGKP--FELLSSAPG--KRL---G  890

Query  3157  SSCEVHVSQKETRNMN-GIP-LGSLDY  3231
             SSC+ +VS++E+R+++ GI  +GS+++
Sbjct  891   SSCDDYVSRQESRSLSTGIASVGSVEF  917



>ref|XP_008644237.1| PREDICTED: uncharacterized protein LOC100502480 isoform X1 [Zea 
mays]
 ref|XP_008644238.1| PREDICTED: uncharacterized protein LOC100502480 isoform X1 [Zea 
mays]
Length=913

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/445 (83%), Positives = 398/445 (89%), Gaps = 4/445 (1%)
 Frame = +1

Query  577   SLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEI  756
             S+    P + E   E KCLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTNKEI
Sbjct  9     SVLPAQPGSPEAVEEHKCLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTNKEI  68

Query  757   DAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPS  936
             ++ IP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPL+ QE KD   LPAELG  +
Sbjct  69    ESQIPNYPNLPPQLICQLHNVTMHADAETDEVYAQMTLQPLNPQELKDP-YLPAELGSAN  127

Query  937   KQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFR  1116
             KQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD++QQPP QEL+AKDLHGNEWKFR
Sbjct  128   KQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFTQQPPCQELMAKDLHGNEWKFR  187

Query  1117  HVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVL  1296
             H+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+NNQLLLGIRRANRPQTVMPSSVL
Sbjct  188   HIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDNNQLLLGIRRANRPQTVMPSSVL  247

Query  1297  SSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRM  1476
             SSDSMHIGLLAAAAHAA+TNSRFTIFYNPRASPS+FVIPL KY KAVYHTR+SVGMRFRM
Sbjct  248   SSDSMHIGLLAAAAHAASTNSRFTIFYNPRASPSEFVIPLVKYVKAVYHTRISVGMRFRM  307

Query  1477  LFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLT  1656
             LFETEESSVRRYMGTITGI DLD VRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLT
Sbjct  308   LFETEESSVRRYMGTITGICDLDSVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLT  367

Query  1657  TFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGI  1836
             TFPMYPSPF LRLKRPWP+GLPS  G  + D+  S  L WLR +  + G QSLNF G G+
Sbjct  368   TFPMYPSPFPLRLKRPWPTGLPSLHGGKDDDLANS--LMWLR-DTANPGFQSLNFGGLGM  424

Query  1837  TPFMQPRLDASMLGLQPDIYQTMAT  1911
             +P+MQPRLDA++LGLQPD+YQ MAT
Sbjct  425   SPWMQPRLDATLLGLQPDMYQAMAT  449


 Score =   249 bits (636),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 156/347 (45%), Positives = 216/347 (62%), Gaps = 15/347 (4%)
 Frame = +1

Query  2176  MSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHD  2355
             +S  ++   +++  +QS     Q +      QSF+D     +  SN ++ Q+  R FS +
Sbjct  566   ISNALSPFSQLSPVSQSSPMALQTILPFSQAQSFTDTNVGSLSPSNGNTMQNTLRPFSSE  625

Query  2356  EASQLLNMHETNPLATLP--SKRIALESQVSSRATPYVVSQADMISPNSKVSDLPTFLPP  2529
               S L     T      P  SKR+A+ES + SR  P V SQ + + P        + L P
Sbjct  626   AVSHLSMPRPTAIPVADPWSSKRVAVESLLPSR--PQVSSQMEQLDPAPASIPHSSALAP  683

Query  2530  FPGKEFPEYQGVAYSQGNNALLGVNTDS-SILLQNGISNLKNSGGENGFLNMPFSTCNFT  2706
              PG+     Q V     N+ L GV+ DS S+L+Q GI  L+N    N    +P+ST NF 
Sbjct  684   LPGRGCLVDQDVNSDPQNHLLFGVSIDSQSLLMQGGIPGLQNG---NDSAAIPYSTSNFL  740

Query  2707  SGVGTDYPLNPDMGTSSCVDESGFLQ-SSENVDQANPPNRTFVKVHKSGSFGRSLDISKF  2883
             S    D+PL+  + +S C+D+SG++   S+N D+ N P  TFVKV+KSG++GRSLDI++F
Sbjct  741   SPSQNDFPLDHTLNSSGCLDDSGYVPPCSDNSDKVNRPPATFVKVYKSGTYGRSLDITRF  800

Query  2884  SSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKIL  3063
             SSYHELR EL R+FGLEG LEDP RSGWQLVFVDRE DVLL+GDDPWQEFV+ V  IKIL
Sbjct  801   SSYHELRRELGRLFGLEGQLEDPLRSGWQLVFVDREEDVLLVGDDPWQEFVSTVSCIKIL  860

Query  3064  SPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMN  3204
             SP EV QMGK +G++L ++ PA  +RL   GSSC+ +VS++E+R+++
Sbjct  861   SPQEVQQMGK-QGLELLSSAPA--RRL---GSSCDDYVSRQESRSLS  901



>ref|XP_002316773.1| auxin response factor 6 family protein [Populus trichocarpa]
 gb|EEE97385.1| auxin response factor 6 family protein [Populus trichocarpa]
Length=914

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/461 (81%), Positives = 404/461 (88%), Gaps = 17/461 (4%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR S A  NPQ +EG  EK+ LNSELWHACAGPLVSLP +GSRVVYF QGHSEQV ASTN
Sbjct  1     MRHSSASFNPQTQEG--EKRVLNSELWHACAGPLVSLPAVGSRVVYFAQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DA IP+YP LP QLICQLHNVTMHAD ETDEVYAQ+TLQPLS QEQKD   LPA+LG
Sbjct  59    KEVDARIPNYPSLPPQLICQLHNVTMHADVETDEVYAQLTLQPLSPQEQKD-AYLPADLG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NEW
Sbjct  118   TPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRL+AGD+V+FIWNE NQLLLGI+RA RPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLIAGDSVLFIWNEKNQLLLGIKRATRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+F+IPLAKY KAVY+TRVSVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFIIPLAKYLKAVYYTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLD  RWPNS WRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDVARWPNSLWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSF-------------PGLSNGDMHISSPLSWLRGN  1788
             PLTTFPMYPS F LRLKRPW  GL SF              G+ + D+ ++S L WLRG+
Sbjct  358   PLTTFPMYPSTFPLRLKRPWTPGLHSFHGKLLYTILRALMDGIKDDDLGMNSSLMWLRGD  417

Query  1789  MGDQGIQSLNFQGYGITPFMQPRLDASMLGLQPDIYQTMAT  1911
              GD+GIQSLN QG G+ P+MQPR+D SMLGLQ D+YQTMAT
Sbjct  418   -GDRGIQSLNLQGMGVAPWMQPRVDTSMLGLQNDVYQTMAT  457


 Score =   315 bits (807),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 188/354 (53%), Positives = 243/354 (69%), Gaps = 14/354 (4%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQ  2367
             ++++ +  S TQS     QA+S    Q SFSD  GN V +   S  QSL  SF  DE S 
Sbjct  564   VSAISQYASATQSLTPPLQAIS-LCQQHSFSDSNGNLVTSPVVSPLQSLLGSFPQDETSH  622

Query  2368  LLNMHETNPLAT---LPSKRIALESQVSSRATPYVVSQADMISP-NSKVSDLPTFLPPFP  2535
             L N   TNPL T    PSKR A++  +SS A   ++SQ + + P  + +S     L PFP
Sbjct  623   LFNFPRTNPLTTSSGWPSKRAAVDPLISSVAPQCMMSQVEQLGPPQTSISPSSVSLLPFP  682

Query  2536  GKEFPEYQGVAYSQGNNALLGVNTD-SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSG  2712
             G+E P  Q       ++ L GV+ + SS+L+QNG+S+L+  G ++    +PFS+ N+ S 
Sbjct  683   GRECPTEQDGGTDPQSHLLFGVSIEPSSLLMQNGLSSLRGVGSDSDSTTVPFSS-NYMSI  741

Query  2713  VGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSY  2892
              GT++ LNP M  SSC+DESGFLQS ENV Q NPP+RTFVKV+KSGSFGRSLDI+KFS+Y
Sbjct  742   AGTNFSLNPAMAPSSCIDESGFLQSMENVGQGNPPSRTFVKVYKSGSFGRSLDITKFSNY  801

Query  2893  HELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPF  3072
             +ELRSELA MFGLEG LEDP RSGWQLVF+DRENDVLLLGD PW EFVN+VW IKILSP 
Sbjct  802   NELRSELAFMFGLEGQLEDPLRSGWQLVFIDRENDVLLLGDGPWPEFVNSVWCIKILSPQ  861

Query  3073  EVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNM-NGI-PLGSLD  3228
             EV QMGK  G++L N++P   QRL NG  SC+ +V++++++N+ N I  +GSLD
Sbjct  862   EVQQMGK-RGLELLNSVPI--QRLSNG--SCDDYVNRQDSQNLSNAITSVGSLD  910



>gb|KHN06947.1| Auxin response factor 6 [Glycine soja]
Length=902

 Score =   749 bits (1935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/449 (83%), Positives = 401/449 (89%), Gaps = 10/449 (2%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S A  +P  +EG  EK+ L+SELWHACAGPLVSLP +GSRVVYFPQGHSEQV  STN
Sbjct  1     MRLSSADFSPPPQEG--EKRVLDSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAVSTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP LP QLICQLHN+TMHAD ETDEVYAQMTLQPL+ QEQ +   LPAELG
Sbjct  59    KEVDAHIPNYPSLPPQLICQLHNMTMHADVETDEVYAQMTLQPLNPQEQNE-AYLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
               SKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLHGNEW
Sbjct  118   TASKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHGNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIW-----NENNQLLLGIRRANRPQ  1272
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIW     NE NQLLLGIRRANRPQ
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWQVTLLNEKNQLLLGIRRANRPQ  237

Query  1273  TVMPSSVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRV  1452
             TVMPSSVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRV
Sbjct  238   TVMPSSVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRV  297

Query  1453  SVGMRFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVS  1632
             SVGMRFRMLFETEESSVRRYMGTITGI DLDPVRWPNSHWRSVKVGWDESTAGERQPRVS
Sbjct  298   SVGMRFRMLFETEESSVRRYMGTITGIGDLDPVRWPNSHWRSVKVGWDESTAGERQPRVS  357

Query  1633  LWEIEPLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQS  1812
             LWEIEPLTTFPMYPS F LRLKRPWP GLPSF G+ + D  ++SPL WLR    D+G+QS
Sbjct  358   LWEIEPLTTFPMYPSSFPLRLKRPWPPGLPSFHGMKDDDFGLNSPLLWLRDT--DRGLQS  415

Query  1813  LNFQGYGITPFMQPRLDASMLGLQPDIYQ  1899
             LNFQG G+ P+MQPR D ++L +Q D+YQ
Sbjct  416   LNFQGIGVNPWMQPRFDPTVLNMQTDMYQ  444


 Score =   283 bits (725),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 181/363 (50%), Positives = 237/363 (65%), Gaps = 21/363 (6%)
 Frame = +1

Query  2176  MSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHD  2355
             +S  ++++ ++ S  Q Q    QA+SS    Q+FS+  GN V T+  S   S+  SF  D
Sbjct  550   ISSAVSTMSQLFSAPQPQSPPMQAISSLC--QNFSNSNGNSV-TTIVSPLHSILGSFPQD  606

Query  2356  EASQLLNMHETNPLATL------PSKRIALESQVSSRATPYVVSQADMIS-PNSKVSDLP  2514
             E S LLN+  T+    +      PSKR+A++  +SS A+  V+ Q D +  P+S +S   
Sbjct  607   ETSHLLNLPRTSSWIPVQNSSGWPSKRVAVDPLLSSGASHCVLPQVDQLGQPHSTMSLNA  666

Query  2515  TFLPPFPGKEFPEYQGVAYSQGNNALLGVNTD-SSILLQNGISNLKNSGGENGFLNMPFS  2691
               LPPFPG+E    Q  +    N+ L GVN D SS+L+ NG+S+LK   G N    +P+ 
Sbjct  667   ITLPPFPGRESSIDQEGSNDPQNHLLFGVNIDPSSLLMPNGMSSLKGVSGNNNSSTLPYQ  726

Query  2692  TCNF-TSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSL  2868
             + N+  +  GTD  LN   G +  + +SGFL   E+  Q NP N+TFVKV+KSGSFGRSL
Sbjct  727   SSNYLNTTTGTDSSLN--HGMTPNIGDSGFLHCPEDAGQGNPLNKTFVKVYKSGSFGRSL  784

Query  2869  DISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVW  3048
             DI+KFSSYHELR ELARMFGLEG LEDP RSGWQLVFVDRENDVLLLGD PW EFVN+VW
Sbjct  785   DITKFSSYHELRGELARMFGLEGELEDPVRSGWQLVFVDRENDVLLLGDGPWPEFVNSVW  844

Query  3049  YIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMN-GI-PLGS  3222
              IKILSP EV QMG   G++L N++P  NQRL NG   C+ +VS+++ RN++ GI  +GS
Sbjct  845   CIKILSPQEVQQMGN-NGLELLNSVP--NQRLSNG--ICDDYVSRQDPRNLSTGITTVGS  899

Query  3223  LDY  3231
             LDY
Sbjct  900   LDY  902



>ref|XP_009627655.1| PREDICTED: auxin response factor 6-like isoform X4 [Nicotiana 
tomentosiformis]
Length=842

 Score =   747 bits (1929),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/462 (80%), Positives = 400/462 (87%), Gaps = 19/462 (4%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG N Q+ EG  E KCLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQVTASTN
Sbjct  1     MRLSSAGSNQQSPEG--ENKCLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVTASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE +AHIP+YP L  QLICQLHNVTMHAD ETDEVYAQMTLQPLS +EQK+   LP +LG
Sbjct  59    KEAEAHIPNYPSLAPQLICQLHNVTMHADVETDEVYAQMTLQPLSPEEQKEASFLPLDLG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPP QELIA+DLH NEW
Sbjct  119   TPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPVQELIARDLHDNEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD++IFIWNE NQL LGIRRANR QTVMPS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSIIFIWNEKNQLFLGIRRANRSQTVMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPR+ PSDFV+PLAKY KAVYHTR+SVGMR
Sbjct  239   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRSCPSDFVVPLAKYVKAVYHTRISVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSV---------------KVGWDES  1602
             FRMLFETEESSVRRYMGTITGI DLDPVRWPNSHWRSV               KVGWDES
Sbjct  299   FRMLFETEESSVRRYMGTITGIGDLDPVRWPNSHWRSVKGLSETASLLPRGRGKVGWDES  358

Query  1603  TAGERQPRVSLWEIEPLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLR  1782
             TAGERQPRVSLWE+EPLTTFPMYPSPF LRLKR WP G P+  G+ + DM + +P+ WLR
Sbjct  359   TAGERQPRVSLWEVEPLTTFPMYPSPFPLRLKRSWPPGFPALSGMKDDDM-VMNPMMWLR  417

Query  1783  GNMGDQGIQSLNFQGYGITPFMQPRLDASMLGLQPDIYQTMA  1908
              ++GD G QS+NFQG G+TP+MQPR+D  + G+Q DIYQ MA
Sbjct  418   -DVGDGGTQSINFQGIGVTPWMQPRIDVPIGGMQMDIYQAMA  458


 Score =   225 bits (574),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 129/260 (50%), Positives = 166/260 (64%), Gaps = 11/260 (4%)
 Frame = +1

Query  2266  QQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMHETNPLAT---LPSKRIALE--  2430
             Q+SF+D   NH   S  +   SL  + + DE SQL+++  ++ L +    P KR+A++  
Sbjct  585   QESFTDTNVNHSTNSIVNPLHSLSGAVTRDEPSQLVSVPRSSSLLSPTGWPPKRVAVDPV  644

Query  2431  --SQVSSRATPYVVSQADMISPNSKVSDLPTFLPPFPGKEFPEYQGVAYSQGNNALLGVN  2604
               S  S R +PY+       +PN  VS     LP FPG++ P  Q       N+ L G N
Sbjct  645   LPSASSQRMSPYIDQSG---TPNKNVSQNALSLPTFPGRDCPVGQEGNNDPHNHLLFGFN  701

Query  2605  TDSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQ  2784
              DS  L+Q+ + +L+    +    N+PF++ N+ S  G D+  NP M  S C++  GF Q
Sbjct  702   IDSPSLMQSDMRSLRGVVSDCESTNVPFASSNYLSNAGNDFSQNPVMALSGCINVPGFTQ  761

Query  2785  SSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG  2964
             +SEN  Q +P N TFVKV+KSGSFGRSLDI+KFSSYHELRSELARMFGLEGLLEDP RSG
Sbjct  762   TSENAGQESPHN-TFVKVYKSGSFGRSLDITKFSSYHELRSELARMFGLEGLLEDPLRSG  820

Query  2965  WQLVFVDRENDVLLLGDDPW  3024
             WQLVFVDRENDVLLLGDDPW
Sbjct  821   WQLVFVDRENDVLLLGDDPW  840



>ref|XP_009402570.1| PREDICTED: auxin response factor 6-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009402571.1| PREDICTED: auxin response factor 6-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=902

 Score =   749 bits (1934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/448 (83%), Positives = 400/448 (89%), Gaps = 3/448 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S +G   Q +E T E+ CLNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSSGPGNQQQEDTEEQVCLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  60

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KEID+ +PSYP LP QL+CQLHNVTMHAD ETDEVYAQMTLQPLS  EQKD   LPAELG
Sbjct  61    KEIDS-LPSYPSLPPQLVCQLHNVTMHADVETDEVYAQMTLQPLSLLEQKD-PYLPAELG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+ QQPPAQEL AKDLHGNEW
Sbjct  119   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFLQQPPAQELTAKDLHGNEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             +FRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+NNQLLLGIRRANRPQTVMPS
Sbjct  179   RFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDNNQLLLGIRRANRPQTVMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  239   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISD+DPV WPNSHWRSVKVGWDESTAG+RQPRVSLWEIE
Sbjct  299   FRMLFETEESSVRRYMGTITGISDIDPVHWPNSHWRSVKVGWDESTAGQRQPRVSLWEIE  358

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYP+ F  RLKRPWP+GLPS  G  +  + ++ P   L  N G+ G QSLNFQ 
Sbjct  359   PLTTFPMYPTSFPFRLKRPWPTGLPSLHGGKDDGISLNLP-QMLFQNGGNTGFQSLNFQD  417

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
               +TP+M+PRLD  +L LQPD+YQTMA 
Sbjct  418   ISVTPWMRPRLDNPVLSLQPDMYQTMAV  445


 Score =   249 bits (636),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 149/336 (44%), Positives = 207/336 (62%), Gaps = 11/336 (3%)
 Frame = +1

Query  2242  QALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMHETNPLAT---LPS  2412
             Q +SS    Q+F D  GN V T++ S   ++    S +EAS LL+    N + T     S
Sbjct  572   QNISSFSQPQNFPDSNGNSVSTASASPLHNILHQLSPEEASNLLSWPRGNQIVTSSSTSS  631

Query  2413  KRIALESQVSSRATPYVVSQADMISPNSKVSDLPTFLPPFPGKEFPEYQGVAYSQGNNAL  2592
             KR+A+ S + S     +     + +    +S     L PFP +++   Q       N+ L
Sbjct  632   KRMAIASMIPSEVQCMMPQVEQLGASQPAISQHSVILSPFPRRQYVVDQDGNMDGQNHLL  691

Query  2593  LGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDE  2769
              GVN DSS +L+QNG+SNL +   E   +NM ++  N     G D+ LN     S+ ++ 
Sbjct  692   FGVNIDSSSLLVQNGMSNLGHLSNETDSMNMHYAASNLVGSSGNDFGLNQAFTVSNGLEP  751

Query  2770  SGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLED  2949
              G LQ+  N+D  N  + TFVKV+KSGS GRSLDI+KFSSYHELRSEL R+FGLEG LED
Sbjct  752   PGLLQAPGNMDSLNQSSGTFVKVYKSGSCGRSLDITKFSSYHELRSELGRLFGLEGQLED  811

Query  2950  PERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPA  3129
             P RSGWQLVFVDREND+LL+GDDPWQEFVNNVW IKIL   EV QMGK    D  N   A
Sbjct  812   PLRSGWQLVFVDRENDILLVGDDPWQEFVNNVWCIKILMRQEVQQMGKPSA-DFLNT--A  868

Query  3130  ANQRLPNGGSSCEVHVSQKETRNMNGI--PLGSLDY  3231
              ++RLP+  +SC+ +++++++R+++ +   +G+L+Y
Sbjct  869   HSKRLPS--NSCDEYITRQDSRSLSTVTASVGTLEY  902



>ref|XP_009627652.1| PREDICTED: auxin response factor 6-like isoform X1 [Nicotiana 
tomentosiformis]
Length=906

 Score =   749 bits (1933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/462 (80%), Positives = 400/462 (87%), Gaps = 19/462 (4%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG N Q+ EG  E KCLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQVTASTN
Sbjct  1     MRLSSAGSNQQSPEG--ENKCLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVTASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE +AHIP+YP L  QLICQLHNVTMHAD ETDEVYAQMTLQPLS +EQK+   LP +LG
Sbjct  59    KEAEAHIPNYPSLAPQLICQLHNVTMHADVETDEVYAQMTLQPLSPEEQKEASFLPLDLG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPP QELIA+DLH NEW
Sbjct  119   TPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPVQELIARDLHDNEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD++IFIWNE NQL LGIRRANR QTVMPS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSIIFIWNEKNQLFLGIRRANRSQTVMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPR+ PSDFV+PLAKY KAVYHTR+SVGMR
Sbjct  239   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRSCPSDFVVPLAKYVKAVYHTRISVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSV---------------KVGWDES  1602
             FRMLFETEESSVRRYMGTITGI DLDPVRWPNSHWRSV               KVGWDES
Sbjct  299   FRMLFETEESSVRRYMGTITGIGDLDPVRWPNSHWRSVKGLSETASLLPRGRGKVGWDES  358

Query  1603  TAGERQPRVSLWEIEPLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLR  1782
             TAGERQPRVSLWE+EPLTTFPMYPSPF LRLKR WP G P+  G+ + DM + +P+ WLR
Sbjct  359   TAGERQPRVSLWEVEPLTTFPMYPSPFPLRLKRSWPPGFPALSGMKDDDM-VMNPMMWLR  417

Query  1783  GNMGDQGIQSLNFQGYGITPFMQPRLDASMLGLQPDIYQTMA  1908
              ++GD G QS+NFQG G+TP+MQPR+D  + G+Q DIYQ MA
Sbjct  418   -DVGDGGTQSINFQGIGVTPWMQPRIDVPIGGMQMDIYQAMA  458


 Score =   271 bits (694),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 157/331 (47%), Positives = 212/331 (64%), Gaps = 18/331 (5%)
 Frame = +1

Query  2266  QQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMHETNPLAT---LPSKRIALE--  2430
             Q+SF+D   NH   S  +   SL  + + DE SQL+++  ++ L +    P KR+A++  
Sbjct  585   QESFTDTNVNHSTNSIVNPLHSLSGAVTRDEPSQLVSVPRSSSLLSPTGWPPKRVAVDPV  644

Query  2431  --SQVSSRATPYVVSQADMISPNSKVSDLPTFLPPFPGKEFPEYQGVAYSQGNNALLGVN  2604
               S  S R +PY+       +PN  VS     LP FPG++ P  Q       N+ L G N
Sbjct  645   LPSASSQRMSPYIDQSG---TPNKNVSQNALSLPTFPGRDCPVGQEGNNDPHNHLLFGFN  701

Query  2605  TDSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQ  2784
              DS  L+Q+ + +L+    +    N+PF++ N+ S  G D+  NP M  S C++  GF Q
Sbjct  702   IDSPSLMQSDMRSLRGVVSDCESTNVPFASSNYLSNAGNDFSQNPVMALSGCINVPGFTQ  761

Query  2785  SSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG  2964
             +SEN  Q +P N TFVKV+KSGSFGRSLDI+KFSSYHELRSELARMFGLEGLLEDP RSG
Sbjct  762   TSENAGQESPHN-TFVKVYKSGSFGRSLDITKFSSYHELRSELARMFGLEGLLEDPLRSG  820

Query  2965  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRL  3144
             WQLVFVDRENDVLLLGDDPW EFVN+VW IKILSP +V QMG+ +G++L N++  +    
Sbjct  821   WQLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPHDVQQMGR-QGLELLNSVSMSR---  876

Query  3145  PNGGSSCEVHVSQKETRNMNG--IPLGSLDY  3231
              +  +SC+   ++ E+RNM    + + +LDY
Sbjct  877   -SSNNSCDDFANRSESRNMTSGIMSVATLDY  906



>ref|XP_007158734.1| hypothetical protein PHAVU_002G177600g [Phaseolus vulgaris]
 gb|ESW30728.1| hypothetical protein PHAVU_002G177600g [Phaseolus vulgaris]
Length=913

 Score =   749 bits (1933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/449 (83%), Positives = 400/449 (89%), Gaps = 6/449 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S AG +   +EG  EK+ L+SELWHACAGPLVSLP +GSRVVYFPQGHSEQV  STN
Sbjct  1     MKLSSAGFSTPPQEG--EKRVLDSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAVSTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             +E+D HIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQK+   LPAELG
Sbjct  59    REVDGHIPNYPSLPPQLICQLHNVTMHADTETDEVYAQMTLQPLSPQEQKE-AYLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCK LTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLHGNEW
Sbjct  118   TPSKQPTNYFCKILTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHGNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQ VMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQPVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEES VRRYMGTITGISDLD VRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESGVRRYMGTITGISDLDSVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSF-PGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQ  1824
             PLTTFPMYPSPF LRLKRPWP GLPSF  G+ + D  I+S L WLR    ++G+ SLNF 
Sbjct  358   PLTTFPMYPSPFPLRLKRPWPPGLPSFHAGMKDDDFGINSSLMWLRDT--ERGLPSLNFP  415

Query  1825  GYGITPFMQPRLDASMLGLQPDIYQTMAT  1911
             G G++P+MQPRLD SM+  Q D+YQ MA 
Sbjct  416   GVGVSPWMQPRLDPSMMNYQTDVYQAMAA  444


 Score =   274 bits (701),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 174/362 (48%), Positives = 233/362 (64%), Gaps = 19/362 (5%)
 Frame = +1

Query  2176  MSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHD  2355
             +S  ++++ +  S  QSQ    QA+SS   QQSFSD  GN V  +  S   S+  SFS D
Sbjct  561   ISNAVSTMSQFVSAPQSQSPPMQAISSLGHQQSFSDSNGNPVTNAIVSPLHSILGSFSQD  620

Query  2356  EASQLLNMHETN------PLATLPSKRIALESQVSSRATPYVVSQADMIS-PNSKVSDLP  2514
             E S LLN+  T+        A  PSKR+A++   SS A+  V+ Q + +  P S ++   
Sbjct  621   ETSHLLNLPRTSWVPVQPSTAWPPSKRVAVDPLFSSGASQCVLPQVEQLGQPQSTMAQNA  680

Query  2515  TFLPPFPGKEFPEYQGVAYSQGNNALLGVNTD-SSILLQNGISNLKNSGGENGFLNMPFS  2691
               LPPFP +E    +G    Q N+ L GVN + SS+L+ NG+S+LK     +G   +PF 
Sbjct  681   ITLPPFPSREC-AIEGSTDPQ-NHLLFGVNIEPSSLLMHNGLSSLKGVSSNSGPPTIPFQ  738

Query  2692  TCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLD  2871
             + N+ +  GTD  +NP  G +  + E+GFLQ+ EN  Q NP  +TFVKV+KSGSFGRSLD
Sbjct  739   SSNYLNTTGTDSSMNP--GMTHNIGEAGFLQTPENGGQGNPSIKTFVKVYKSGSFGRSLD  796

Query  2872  ISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWY  3051
             I+KF++YHELR ELARMFGLEG LEDP RSGWQLVFVD+ENDVLLLGD PW EFVN+V  
Sbjct  797   ITKFTNYHELRGELARMFGLEGELEDPVRSGWQLVFVDQENDVLLLGDGPWPEFVNSVGC  856

Query  3052  IKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMN-GI-PLGSL  3225
             IKILSP EV QMG   G++L N++P   QRL +G   C+ +   ++ R+++ GI  +GSL
Sbjct  857   IKILSPQEVQQMGN-NGLELLNSVPI--QRLSSG--VCDDYAGHEDPRSISTGITTVGSL  911

Query  3226  DY  3231
             +Y
Sbjct  912   NY  913



>ref|XP_006585093.1| PREDICTED: auxin response factor 6-like isoform X2 [Glycine max]
Length=905

 Score =   748 bits (1931),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/448 (83%), Positives = 399/448 (89%), Gaps = 6/448 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S  G +P  +EG  EK+ L+SELWHACAGPLVSLP +GSRVVYFPQGHSEQV  STN
Sbjct  1     MKLSSPGFSPPPQEG--EKRVLDSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAVSTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             +E+D HIP+YP LP QLICQLHN+TMHAD ETDEVYAQMTLQPL+ QEQK    LPAELG
Sbjct  59    REVDGHIPNYPSLPPQLICQLHNLTMHADTETDEVYAQMTLQPLNPQEQKG-AYLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCK LTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPP QELIA+DLHGNEW
Sbjct  118   TPSKQPTNYFCKILTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPCQELIARDLHGNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQ VMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQPVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLD +RWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDSIRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSF-PGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQ  1824
             PLTTFPMYPSPF LRLKRPWP GLP F  GL + D  I+S L WLR    D+G+ SLNFQ
Sbjct  358   PLTTFPMYPSPFPLRLKRPWPPGLPLFHAGLKDDDFGINSSLMWLRDT--DRGLPSLNFQ  415

Query  1825  GYGITPFMQPRLDASMLGLQPDIYQTMA  1908
             G G++P+MQPRLD SM+  Q D+YQ MA
Sbjct  416   GIGVSPWMQPRLDPSMVNYQSDMYQAMA  443


 Score =   265 bits (677),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 173/363 (48%), Positives = 230/363 (63%), Gaps = 26/363 (7%)
 Frame = +1

Query  2176  MSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHD  2355
             +S  ++++ +  S  QSQ    QA+SS   QQSFSD  GN   T+  S   S+  SF  D
Sbjct  558   ISSVVSTMSQFVSAAQSQSPPMQAISSLGHQQSFSDSNGNPTTTAIVSPLHSILDSFPQD  617

Query  2356  EASQLLNMHETNPLATL-------PSKRIALESQVSSRATPYVVSQADMIS-PNSKVSDL  2511
             + S LL++  +     +       PSKR+ ++  +SS A+  V+ Q + +  P+S ++  
Sbjct  618   DTSHLLSLPRSTSWVPVQHSTAWPPSKRVVVDPLLSSGASQCVLPQVEQLGQPHSTMAQN  677

Query  2512  PTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTD-SSILLQNGISNLKNSGGENGFLNMPF  2688
                LP FPG+E    +G    Q N+ L GVN + SS+L+ NG+S+LK     +    +PF
Sbjct  678   GIALPAFPGREC-TIEGSNDPQ-NHLLFGVNIEPSSLLMHNGMSSLKGVSSNSDSPTIPF  735

Query  2689  STCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSL  2868
              + N+ +  G D  LNP  G +  + E+GFLQ+ EN  Q NP N+TFVKV+KSGSFGRSL
Sbjct  736   QSSNYLNTTGPDSSLNP--GMTHNIGETGFLQTPENGGQGNPSNKTFVKVYKSGSFGRSL  793

Query  2869  DISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVW  3048
             DI+KF+SY ELRSELARMFGLEG LEDP RSGWQLVFVD+ENDVLLLGD PW EFVN+V 
Sbjct  794   DITKFTSYPELRSELARMFGLEGELEDPVRSGWQLVFVDQENDVLLLGDGPWPEFVNSVG  853

Query  3049  YIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMN-GI-PLGS  3222
             YIKILSP EV QMG  E ++L N++P   QRL NG   CE      + RN++ GI  +GS
Sbjct  854   YIKILSPQEVQQMGNNE-LELLNSVPI--QRLSNG--VCE------DPRNLSTGITTVGS  902

Query  3223  LDY  3231
             L+Y
Sbjct  903   LNY  905



>ref|XP_002451599.1| hypothetical protein SORBIDRAFT_04g004430 [Sorghum bicolor]
 gb|EES04575.1| hypothetical protein SORBIDRAFT_04g004430 [Sorghum bicolor]
Length=911

 Score =   746 bits (1925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/439 (84%), Positives = 394/439 (90%), Gaps = 4/439 (1%)
 Frame = +1

Query  595   PQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAHIPS  774
             P + E   E KCLNSELWHACAGPLVSLP +GSRVVYFPQGH EQV ASTNKE++A IP+
Sbjct  15    PGSPEEAEEHKCLNSELWHACAGPLVSLPAVGSRVVYFPQGHGEQVAASTNKEMEAQIPN  74

Query  775   YPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPTNY  954
             YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS QE KD   LPAELG  SKQPTNY
Sbjct  75    YPSLPPQLICQLHNVTMHADAETDEVYAQMTLQPLSPQELKDP-FLPAELGTASKQPTNY  133

Query  955   FCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFRGQ  1134
             FCKTLTASDTSTHGGFSVPRRAAEKVFPPLD++QQPPAQELIA DLHGNEWKFRH+FRGQ
Sbjct  134   FCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFNQQPPAQELIATDLHGNEWKFRHIFRGQ  193

Query  1135  PKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDSMH  1314
             PKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+NNQLLLGIRRANRPQTVMPSSVLSSDSMH
Sbjct  194   PKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDNNQLLLGIRRANRPQTVMPSSVLSSDSMH  253

Query  1315  IGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFETEE  1494
             IGLLAAAAHAA+TNSRFTIFYNPRASP +FVIP+AKY KAVYHTR+SVGMRFRMLFETEE
Sbjct  254   IGLLAAAAHAASTNSRFTIFYNPRASPCEFVIPMAKYVKAVYHTRISVGMRFRMLFETEE  313

Query  1495  SSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYP  1674
             SSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGE+QPRVSLWEIEPLTTFPMYP
Sbjct  314   SSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGEKQPRVSLWEIEPLTTFPMYP  373

Query  1675  SPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPFMQP  1854
             SPF+L LKRPWP+GLPS  G    D  ++S L WLR +  + G QSLNF G G +P+MQP
Sbjct  374   SPFALGLKRPWPTGLPSLYG--GRDDGLTSSLMWLR-DRANPGFQSLNFSGLGTSPWMQP  430

Query  1855  RLDASMLGLQPDIYQTMAT  1911
             RLD S+LGLQ D+YQT+A 
Sbjct  431   RLDNSLLGLQSDMYQTIAA  449


 Score =   242 bits (618),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 161/358 (45%), Positives = 223/358 (62%), Gaps = 24/358 (7%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQ  2367
             +++  +++S T S  S  Q + +   QQ+F D   + +  S+ SS   +      + AS 
Sbjct  568   LSAFSQLSSATHSPSSTLQTVPAFSHQQNFPDTNISSLSPSSGSSMHGMLGQLPSEAASS  627

Query  2368  LLNMHETNPLAT---LPSKRIALESQVSSRATPYVVS----QADMISPNSKVSDLPTFLP  2526
             L  +    P++      SKR+A+ES   SR  P+VVS    Q DM S N   S   + L 
Sbjct  628   LPCVAINTPVSVSDPWSSKRVAVESVNPSR--PHVVSPQIEQLDMASCNMPQS---SALA  682

Query  2527  PFPGKEFPEYQGVAYSQGNNALLGVNTDS-SILLQNGISNLKNSGGENGFLNMPFSTCNF  2703
             P PG+E    Q       N+ L GVN DS S+L+Q GI +L+N   +N    +P+ST NF
Sbjct  683   PLPGRECLVDQDGNSDPQNHLLFGVNIDSQSLLMQGGIPSLQN---DNSSGTIPYSTSNF  739

Query  2704  TSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKF  2883
              S    D+PLN  + ++ C+DESG+   +EN +QAN    TFVKV+KSG+ GR LDI++F
Sbjct  740   LSSSQNDFPLNQSLHSAGCLDESGYAPCAENSEQANQQFATFVKVYKSGNVGRLLDITRF  799

Query  2884  SSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKIL  3063
             SSY ELRSE+ R+FGLEG LEDP RSGWQLVFVDRE+DVLL+GDDPWQEFVN+V  IKIL
Sbjct  800   SSYDELRSEVGRLFGLEGQLEDPLRSGWQLVFVDREDDVLLVGDDPWQEFVNSVSCIKIL  859

Query  3064  SPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMNG--IPLGSLDY  3231
             SP EV QMGK  GI L ++ P+  +RL NG   C+ + S +E+R+++    P+GS+++
Sbjct  860   SPEEVQQMGK-PGIQLLSSAPS--RRLSNG---CDSYASMQESRSLSTGMAPVGSVEF  911



>gb|KHN46047.1| Auxin response factor 6 [Glycine soja]
Length=909

 Score =   744 bits (1922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/448 (82%), Positives = 399/448 (89%), Gaps = 6/448 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S +G +   +EG  EK+ L+SELWHACAGPLVSLP +GSRVVYFPQGHSEQV  STN
Sbjct  1     MKLSSSGFSSPPQEG--EKRVLDSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAVSTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             +E+D HIP+YP LP QLICQLHN+TMHAD ETDEVYAQMTLQPL+ QEQK+   LPAELG
Sbjct  59    REVDGHIPNYPSLPPQLICQLHNLTMHADTETDEVYAQMTLQPLNPQEQKE-AYLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCK LTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPP QELIA+DLHGNEW
Sbjct  118   TPSKQPTNYFCKILTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPCQELIARDLHGNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQ VMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQPVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIP AKY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPFAKYVKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLD VRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDSVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSF-PGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQ  1824
             PLTTFPMYPSPF LRLKRPWP GLPSF  GL + D   +S L WLR    D+G+ SLNFQ
Sbjct  358   PLTTFPMYPSPFPLRLKRPWPPGLPSFHAGLKDDDFGTNSSLMWLRDT--DRGLPSLNFQ  415

Query  1825  GYGITPFMQPRLDASMLGLQPDIYQTMA  1908
             G G++P++QPRLD SM+  Q D+YQ MA
Sbjct  416   GIGVSPWLQPRLDPSMVNYQSDMYQAMA  443


 Score =   269 bits (688),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 174/363 (48%), Positives = 231/363 (64%), Gaps = 20/363 (6%)
 Frame = +1

Query  2176  MSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHD  2355
             +S  ++++ +  S  QSQ    QA+SS   QQSFSD  GN V T+  S   S+  SF  D
Sbjct  556   ISSAVSTMSQFVSAPQSQSPPMQAISSLGHQQSFSDSNGNPVTTAVVSPLHSILGSFPQD  615

Query  2356  EASQLLNMHETNPLATL-------PSKRIALESQVSSRATPYVVSQADMIS-PNSKVSDL  2511
             + S LLN+  +     +        SKR+A++   SS A+  V+ Q + +  P S ++  
Sbjct  616   DTSHLLNLPRSTSWVPVQHSTAWPSSKRVAVDPLFSSGASQCVLPQVEQLGQPQSTMAQN  675

Query  2512  PTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTD-SSILLQNGISNLKNSGGENGFLNMPF  2688
                LPPFPG+E    +G    Q N+ L GVN + SS+L+ NG+S+LK     +    +PF
Sbjct  676   GIALPPFPGREC-TIEGSNDPQ-NHLLFGVNIEPSSLLMHNGMSSLKGVSSNSDSPTIPF  733

Query  2689  STCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSL  2868
              + N+ +    D  LNP  G +  + ESGFLQ+ EN  Q NP N+TFVKV+KSGSFGRSL
Sbjct  734   QSSNYLNTTVPDSSLNP--GMTHNIGESGFLQTPENGGQGNPTNKTFVKVYKSGSFGRSL  791

Query  2869  DISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVW  3048
             DI+KF+SY ELRSELARMFGLEG LEDP RSGWQLVFVD+ENDVLLLGD PW EFVN+V 
Sbjct  792   DITKFTSYPELRSELARMFGLEGELEDPVRSGWQLVFVDQENDVLLLGDGPWPEFVNSVG  851

Query  3049  YIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMN-GIPL-GS  3222
              IKILSP EV QMG   G++L N++P   QRL NG   C+ +  +++ RN++ GI + GS
Sbjct  852   CIKILSPQEVQQMGN-NGLELLNSVPI--QRLSNG--VCDDYAGREDPRNLSTGITIVGS  906

Query  3223  LDY  3231
             L+Y
Sbjct  907   LNY  909



>ref|XP_004504543.1| PREDICTED: auxin response factor 6-like isoform X2 [Cicer arietinum]
Length=917

 Score =   743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/447 (82%), Positives = 401/447 (90%), Gaps = 6/447 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M+ S AG +P   EG  EK+ L+SELWHACAGPLVSLP +GSRVVYFPQGHSEQV  STN
Sbjct  1     MKFSSAGFSPPPPEG--EKRVLDSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAVSTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             +E+D +IP+ P LP QLICQLHN+TMHAD ETDEVYAQMTLQPL+ +EQK+   LPAELG
Sbjct  59    REVDTYIPN-PSLPPQLICQLHNLTMHADTETDEVYAQMTLQPLNPEEQKE-AYLPAELG  116

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
               SKQPTNYFCK LTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLHG +W
Sbjct  117   AASKQPTNYFCKILTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHGIDW  176

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KF+H+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQ+LLGIRRANRPQ +MPS
Sbjct  177   KFKHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQMLLGIRRANRPQPMMPS  236

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  237   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  296

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLD VRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  297   FRMLFETEESSVRRYMGTITGISDLDSVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  356

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRLKRPWP GLPSF GL + D  ++SPL WLR    D+G+Q+LNFQG
Sbjct  357   PLTTFPMYPSPFPLRLKRPWPPGLPSFHGLKDDDFGMNSPLLWLRDT--DRGLQTLNFQG  414

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMA  1908
              G+ P+MQPRLD SM+ LQPD+YQ MA
Sbjct  415   IGVNPWMQPRLDPSMMHLQPDMYQAMA  441


 Score =   275 bits (703),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 175/363 (48%), Positives = 229/363 (63%), Gaps = 20/363 (6%)
 Frame = +1

Query  2176  MSKPITSLPRMNSTTQSQLSH-FQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSH  2352
             +S  ++++ +  ST QSQ +   QA+SS   QQ+F+D  GNHV TS  S   ++  SF +
Sbjct  564   ISSAVSTMSQFVSTPQSQPTQPMQAISSIGNQQNFTDSNGNHVTTSIVSPLHNMLGSFPN  623

Query  2353  DEASQLLNMHETNPLATL------PSKRIALESQVSSRATPYVVSQADMISPN-SKVSDL  2511
             DE S LLN+   N    +      PSKR+A++  +SS  T YV+ Q + +  + + +S  
Sbjct  624   DETSHLLNLPRQNSWVPVQSSTAWPSKRVAVDPLLSSGGTNYVLPQVEQLGQSQTTMSQN  683

Query  2512  PTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTD-SSILLQNGISNLKNSGGENGFLNMPF  2688
                LPPFPG+E    +G    Q N+ L G N + SS L+ N + NLK           PF
Sbjct  684   AVILPPFPGREC-AIEGSTDPQ-NHLLFGFNIEPSSHLVYNEMPNLKRVNSNCDSSTAPF  741

Query  2689  STCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSL  2868
              +  + +  G D  LNP  G +  + ES FLQ+ EN  Q N PNRTFVKV+KSGSFGRSL
Sbjct  742   QSSTYLNTAGADSSLNP--GMTHGIGESDFLQTPENGGQGNQPNRTFVKVYKSGSFGRSL  799

Query  2869  DISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVW  3048
             DI+KFS+YHELRSELARMFGLE  LEDP RSGWQLVFVD+ENDVLLLGD PW EFVN+VW
Sbjct  800   DITKFSNYHELRSELARMFGLERELEDPVRSGWQLVFVDQENDVLLLGDGPWPEFVNSVW  859

Query  3049  YIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMNG--IPLGS  3222
              IKILSP EV QMG   G++L N+  A NQR  NG   C+ +  ++++RN++     +GS
Sbjct  860   CIKILSPQEVQQMGN-NGLELLNS--AQNQRHSNG--ICDDYTGREDSRNLSTGLATVGS  914

Query  3223  LDY  3231
             LDY
Sbjct  915   LDY  917



>ref|XP_009402572.1| PREDICTED: auxin response factor 6-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=900

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/448 (83%), Positives = 399/448 (89%), Gaps = 5/448 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S +G   Q +E   E+ CLNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSSGPGNQQQEE--EQVCLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KEID+ +PSYP LP QL+CQLHNVTMHAD ETDEVYAQMTLQPLS  EQKD   LPAELG
Sbjct  59    KEIDS-LPSYPSLPPQLVCQLHNVTMHADVETDEVYAQMTLQPLSLLEQKD-PYLPAELG  116

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+ QQPPAQEL AKDLHGNEW
Sbjct  117   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFLQQPPAQELTAKDLHGNEW  176

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             +FRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+NNQLLLGIRRANRPQTVMPS
Sbjct  177   RFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDNNQLLLGIRRANRPQTVMPS  236

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  237   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  296

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISD+DPV WPNSHWRSVKVGWDESTAG+RQPRVSLWEIE
Sbjct  297   FRMLFETEESSVRRYMGTITGISDIDPVHWPNSHWRSVKVGWDESTAGQRQPRVSLWEIE  356

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYP+ F  RLKRPWP+GLPS  G  +  + ++ P   L  N G+ G QSLNFQ 
Sbjct  357   PLTTFPMYPTSFPFRLKRPWPTGLPSLHGGKDDGISLNLP-QMLFQNGGNTGFQSLNFQD  415

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
               +TP+M+PRLD  +L LQPD+YQTMA 
Sbjct  416   ISVTPWMRPRLDNPVLSLQPDMYQTMAV  443


 Score =   249 bits (636),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 149/336 (44%), Positives = 207/336 (62%), Gaps = 11/336 (3%)
 Frame = +1

Query  2242  QALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMHETNPLAT---LPS  2412
             Q +SS    Q+F D  GN V T++ S   ++    S +EAS LL+    N + T     S
Sbjct  570   QNISSFSQPQNFPDSNGNSVSTASASPLHNILHQLSPEEASNLLSWPRGNQIVTSSSTSS  629

Query  2413  KRIALESQVSSRATPYVVSQADMISPNSKVSDLPTFLPPFPGKEFPEYQGVAYSQGNNAL  2592
             KR+A+ S + S     +     + +    +S     L PFP +++   Q       N+ L
Sbjct  630   KRMAIASMIPSEVQCMMPQVEQLGASQPAISQHSVILSPFPRRQYVVDQDGNMDGQNHLL  689

Query  2593  LGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDE  2769
              GVN DSS +L+QNG+SNL +   E   +NM ++  N     G D+ LN     S+ ++ 
Sbjct  690   FGVNIDSSSLLVQNGMSNLGHLSNETDSMNMHYAASNLVGSSGNDFGLNQAFTVSNGLEP  749

Query  2770  SGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLED  2949
              G LQ+  N+D  N  + TFVKV+KSGS GRSLDI+KFSSYHELRSEL R+FGLEG LED
Sbjct  750   PGLLQAPGNMDSLNQSSGTFVKVYKSGSCGRSLDITKFSSYHELRSELGRLFGLEGQLED  809

Query  2950  PERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPA  3129
             P RSGWQLVFVDREND+LL+GDDPWQEFVNNVW IKIL   EV QMGK    D  N   A
Sbjct  810   PLRSGWQLVFVDRENDILLVGDDPWQEFVNNVWCIKILMRQEVQQMGKPSA-DFLNT--A  866

Query  3130  ANQRLPNGGSSCEVHVSQKETRNMNGI--PLGSLDY  3231
              ++RLP+  +SC+ +++++++R+++ +   +G+L+Y
Sbjct  867   HSKRLPS--NSCDEYITRQDSRSLSTVTASVGTLEY  900



>ref|XP_008679928.1| PREDICTED: auxin response factor 6 isoform X1 [Zea mays]
 gb|AFW66421.1| hypothetical protein ZEAMMB73_859793 [Zea mays]
 gb|AIB05231.1| ARF transcription factor, partial [Zea mays]
Length=914

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/439 (84%), Positives = 396/439 (90%), Gaps = 4/439 (1%)
 Frame = +1

Query  595   PQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAHIPS  774
             P + E   E KCLNSELWHACAGPLVSLP +GSRVVYFPQGH EQV ASTNKE++A IP+
Sbjct  15    PASPEEAEEHKCLNSELWHACAGPLVSLPSVGSRVVYFPQGHGEQVAASTNKEMEAQIPN  74

Query  775   YPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPTNY  954
             YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS QE KD   LPAELG  S QPTNY
Sbjct  75    YPSLPPQLICQLHNVTMHADAETDEVYAQMTLQPLSPQELKDP-FLPAELGTASNQPTNY  133

Query  955   FCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFRGQ  1134
             FCKTLTASDTSTHGGFSVPRRAAEKVFPPLD++QQPPAQELIAKDLHGN+WKFRH+FRGQ
Sbjct  134   FCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFNQQPPAQELIAKDLHGNDWKFRHIFRGQ  193

Query  1135  PKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDSMH  1314
             PKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+NNQLLLGIRRANRPQTVMPSSVLSSDSMH
Sbjct  194   PKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDNNQLLLGIRRANRPQTVMPSSVLSSDSMH  253

Query  1315  IGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFETEE  1494
             IGLLAAAAHAA+TNSRFTIFYNPRASP +FVIP+AKY KAVYHTR+SVGMRFRMLFETEE
Sbjct  254   IGLLAAAAHAASTNSRFTIFYNPRASPCEFVIPMAKYVKAVYHTRISVGMRFRMLFETEE  313

Query  1495  SSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYP  1674
             SSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGE+QPRVSLWEIEPLTTFPMYP
Sbjct  314   SSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGEKQPRVSLWEIEPLTTFPMYP  373

Query  1675  SPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPFMQP  1854
             SPF+L LKRPWP+GLPS  G   GD  ++S L WLR +  + G QSLNF G G++P+MQP
Sbjct  374   SPFALGLKRPWPAGLPSLYG-GRGD-GLTSSLMWLR-DRANPGFQSLNFSGLGMSPWMQP  430

Query  1855  RLDASMLGLQPDIYQTMAT  1911
             RLD S+LGLQ D+YQT+A 
Sbjct  431   RLDNSLLGLQSDMYQTIAA  449


 Score =   232 bits (591),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 151/357 (42%), Positives = 214/357 (60%), Gaps = 23/357 (6%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQ  2367
             +++  +++  T S  S  Q + +   QQ+F D   + +  S   S   +      + AS 
Sbjct  572   LSAFSQLSPATHSPPSALQTVPAFSHQQNFPDTNISSLSPSTGPSMHGMLGRLPSEAASS  631

Query  2368  LLNMHETNPLAT---LPSKRIALESQVSSRATPYV---VSQADMISPNSKVSDLPTFLPP  2529
             L  +    P++      SKR+A+ES    R  P+V   +   DM + N   S   + L P
Sbjct  632   LPCVAMNAPVSVSDPWSSKRVAVESVNPCR--PHVSPHIEHLDMATCNMPQS---SALAP  686

Query  2530  FPGKEFPEYQGVAYSQGNNALLGVNTDS-SILLQNGISNLKNSGGENGFLNMPFSTCNFT  2706
              PG+E    +       N+ L GV+ DS S+L+Q GI  L+N   +N    +P+ST NF 
Sbjct  687   LPGRECLVDEDGCSDPQNHLLFGVHIDSHSLLMQGGIPALQN---DNSSGTIPYSTSNFL  743

Query  2707  SGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFS  2886
             S    D+PLN  + ++ C+DES +L  +EN +QAN    TFVKV+KSG+ GR LDI++FS
Sbjct  744   SPSENDFPLNQPLRSAGCLDESDYLPCAENAEQANQQFATFVKVYKSGTVGRLLDITRFS  803

Query  2887  SYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILS  3066
             SY ELRSE+ R+FGLEG LEDP RSGWQLVFVDRE+DVLL+GDDPWQEFVN+V  IKILS
Sbjct  804   SYDELRSEVGRLFGLEGQLEDPLRSGWQLVFVDREDDVLLVGDDPWQEFVNSVSCIKILS  863

Query  3067  PFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMNG--IPLGSLDY  3231
             P EV +MGK  GI L ++ P+  +RL NG   C+ + S +E R ++    P+GS+++
Sbjct  864   PEEVQRMGK-PGIQLLSSAPS--RRLGNG---CDSYASMQEPRGLDAGMAPVGSVEF  914



>ref|XP_009109594.1| PREDICTED: auxin response factor 6-like [Brassica rapa]
Length=844

 Score =   740 bits (1910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/448 (84%), Positives = 402/448 (90%), Gaps = 14/448 (3%)
 Frame = +1

Query  568   MRVSLAGVNPQAE--EGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTAS  741
             MR+S AG NP     E TGEK+ LNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQV AS
Sbjct  1     MRLSSAGFNPHPHPHEVTGEKRVLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVAAS  60

Query  742   TNKEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAE  921
             TNKE+DAH P+YP L  QLICQLHNVTMHAD ETDEVYAQMTLQPL+AQEQKD   L AE
Sbjct  61    TNKEVDAHTPNYPSLQPQLICQLHNVTMHADVETDEVYAQMTLQPLNAQEQKD-SYLAAE  119

Query  922   LGMPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGN  1101
             LG+PS+QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDY+QQPPAQEL+A+DLH N
Sbjct  120   LGVPSRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYTQQPPAQELMARDLHDN  179

Query  1102  EWKFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVM  1281
             EWKFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+ NQLLLGIRRA+RPQTVM
Sbjct  180   EWKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDKNQLLLGIRRAHRPQTVM  239

Query  1282  PSSVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVG  1461
             PSSVLSSDSMH+GLLAAAAHAA+TNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVG
Sbjct  240   PSSVLSSDSMHLGLLAAAAHAASTNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVG  299

Query  1462  MRFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWE  1641
             MRFRMLFETEESSVRRYMGTITGI DLDP RW NSHWRSVKVGWDESTAG+RQPRVSLWE
Sbjct  300   MRFRMLFETEESSVRRYMGTITGICDLDPARWANSHWRSVKVGWDESTAGDRQPRVSLWE  359

Query  1642  IEPLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGD----MHISSPLSWLRGNMGDQGIQ  1809
             IEPLTTFPMYPSPF LRLKRPWPSGLPSF GL   D    M +SSPL W      D+G+Q
Sbjct  360   IEPLTTFPMYPSPFPLRLKRPWPSGLPSFHGLKEDDMGMGMGMSSPLMW------DRGLQ  413

Query  1810  SLNFQGYGITPFMQPRLDAS-MLGLQPD  1890
             S+NFQG G+ P+MQPRLDAS +LG+Q D
Sbjct  414   SMNFQGMGVNPWMQPRLDASGLLGMQND  441


 Score =   229 bits (583),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 172/353 (49%), Positives = 220/353 (62%), Gaps = 46/353 (13%)
 Frame = +1

Query  2233  SHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQ--SLPRSFSHDEASQLLNMHETNPLAT-  2403
             S  Q+++    QQSFSD  G      NN  TQ  +L  +F  DE+SQLLN+  TN   T 
Sbjct  518   SLLQSMTPLCHQQSFSDTNGG-----NNPITQLHTLLSNFPQDESSQLLNLTRTNSAMTS  572

Query  2404  --LPSKRIALESQVSSRATPYVVSQADM----ISPNSKVSDLPTFLPPFP-GKEFPEYQG  2562
                PSKR A++S     +T    +Q+ M     S  S VS     LPPFP G+E  E   
Sbjct  573   SGWPSKRPAIDSSFQ-HSTAVNNNQSVMEQLGQSHTSNVSPNAVSLPPFPSGQE--ENHS  629

Query  2563  VAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENG-FLNMPFSTCNFT---SGVGTDY  2727
               +S   + L GVN DSS +L+ NG+SNL++ G E G    +PF++  F    SG  T  
Sbjct  630   DPHS---HLLFGVNIDSSSLLIPNGMSNLRSIGIEGGDSTTLPFTSSTFNNEFSGTMTT-  685

Query  2728  PLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRS  2907
                     SSC++E GFLQ SEN  Q+N    TFVKV+KSGSFGRSLDI+KFSSY+ELRS
Sbjct  686   -------PSSCIEEPGFLQPSEN-QQSN----TFVKVYKSGSFGRSLDITKFSSYNELRS  733

Query  2908  ELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQM  3087
             ELARMFGLEG LEDP RSGWQLVFV RE  VLLLGDDPW EFV++VW IKILSP EV QM
Sbjct  734   ELARMFGLEGQLEDPVRSGWQLVFVGREYYVLLLGDDPWPEFVSSVWCIKILSPQEVQQM  793

Query  3088  GKEEGIDLPNNLPAAN--QRLPNGGSSCEVHVSQKETRNM-NGIPL--GSLDY  3231
             GK  G++L N+ P+++   ++P+ G +C+   ++ + R++ NGI    GS +Y
Sbjct  794   GK-RGLELLNSAPSSDNVDKVPSNG-NCDDFGNRSDPRSLGNGIASVGGSFNY  844



>emb|CDX90245.1| BnaA08g17390D [Brassica napus]
Length=852

 Score =   740 bits (1910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/448 (84%), Positives = 402/448 (90%), Gaps = 14/448 (3%)
 Frame = +1

Query  568   MRVSLAGVNPQAE--EGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTAS  741
             MR+S AG NP     E TGEK+ LNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQV AS
Sbjct  1     MRLSSAGFNPHPHPHEVTGEKRVLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVAAS  60

Query  742   TNKEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAE  921
             TNKE+DAH P+YP L  QLICQLHNVTMHAD ETDEVYAQMTLQPL+AQEQKD   L AE
Sbjct  61    TNKEVDAHTPNYPSLQPQLICQLHNVTMHADVETDEVYAQMTLQPLNAQEQKD-SYLAAE  119

Query  922   LGMPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGN  1101
             LG+PS+QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDY+QQPPAQEL+A+DLH N
Sbjct  120   LGVPSRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYTQQPPAQELMARDLHDN  179

Query  1102  EWKFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVM  1281
             EWKFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+ NQLLLGIRRA+RPQTVM
Sbjct  180   EWKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDKNQLLLGIRRAHRPQTVM  239

Query  1282  PSSVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVG  1461
             PSSVLSSDSMH+GLLAAAAHAA+TNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVG
Sbjct  240   PSSVLSSDSMHLGLLAAAAHAASTNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVG  299

Query  1462  MRFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWE  1641
             MRFRMLFETEESSVRRYMGTITGI DLDP RW NSHWRSVKVGWDESTAG+RQPRVSLWE
Sbjct  300   MRFRMLFETEESSVRRYMGTITGICDLDPARWANSHWRSVKVGWDESTAGDRQPRVSLWE  359

Query  1642  IEPLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGD----MHISSPLSWLRGNMGDQGIQ  1809
             IEPLTTFPMYPSPF LRLKRPWPSGLPSF GL   D    M +SSPL W      D+G+Q
Sbjct  360   IEPLTTFPMYPSPFPLRLKRPWPSGLPSFHGLKEDDMGMGMGMSSPLMW------DRGLQ  413

Query  1810  SLNFQGYGITPFMQPRLDAS-MLGLQPD  1890
             S+NFQG G+ P+MQPRLDAS +LG+Q D
Sbjct  414   SMNFQGMGVNPWMQPRLDASGLLGMQND  441


 Score =   238 bits (607),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 175/353 (50%), Positives = 223/353 (63%), Gaps = 46/353 (13%)
 Frame = +1

Query  2233  SHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQ--SLPRSFSHDEASQLLNMHETNPLAT-  2403
             S  Q+++    QQSFSD  G      NN  TQ  +L  +F  DE+SQLLN+  TN   T 
Sbjct  526   SLLQSMTPLCHQQSFSDTNGG-----NNPITQLHTLLSNFPQDESSQLLNLTRTNSAMTS  580

Query  2404  --LPSKRIALESQVSSRATPYVVSQADM----ISPNSKVSDLPTFLPPFP-GKEFPEYQG  2562
                PSKR A++S     +T    +Q+ M     S  S VS     LPPFP G+E  E   
Sbjct  581   SGWPSKRPAIDSSFQ-HSTAVNNNQSVMEQLGQSHTSNVSPNAVSLPPFPSGQE--ENHS  637

Query  2563  VAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENG-FLNMPFSTCNFT---SGVGTDY  2727
               +S   + L GVN DSS +L+ NG+SNL++ G E G    +PF++  F    SG  T  
Sbjct  638   DPHS---HLLFGVNIDSSSLLIPNGMSNLRSIGIEGGDSTTLPFTSSTFNNEFSGTMTT-  693

Query  2728  PLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRS  2907
                     SSC++E GFLQ SEN  Q+N    TFVKV+KSGSFGRSLDI+KFSSY+ELRS
Sbjct  694   -------PSSCIEEPGFLQPSEN-QQSN----TFVKVYKSGSFGRSLDITKFSSYNELRS  741

Query  2908  ELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQM  3087
             ELARMFGLEG LEDP RSGWQLVFVDRENDVLLLGDDPW EFV++VW IKILSP EV QM
Sbjct  742   ELARMFGLEGQLEDPVRSGWQLVFVDRENDVLLLGDDPWPEFVSSVWCIKILSPQEVQQM  801

Query  3088  GKEEGIDLPNNLPAAN--QRLPNGGSSCEVHVSQKETRNM-NGIPL--GSLDY  3231
             GK  G++L N+ P+++   ++P+ G +C+   ++ + R++ NGI    GS +Y
Sbjct  802   GK-RGLELLNSAPSSDNVDKVPSNG-NCDDFGNRSDPRSLGNGIASVGGSFNY  852



>ref|XP_003563403.1| PREDICTED: auxin response factor 17 [Brachypodium distachyon]
Length=907

 Score =   741 bits (1914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/443 (83%), Positives = 398/443 (90%), Gaps = 4/443 (1%)
 Frame = +1

Query  580   LAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEID  759
             L+G    + E   E KCLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTNKEI+
Sbjct  11    LSGQAAASPEDVEEHKCLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTNKEIE  70

Query  760   AHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSK  939
             + IP+YP LP QLICQLHNVTM+AD ETDEVYAQMTLQPL+ QE KD   LPAELG  +K
Sbjct  71    SQIPNYPNLPPQLICQLHNVTMNADPETDEVYAQMTLQPLNPQELKDP-YLPAELGTANK  129

Query  940   QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRH  1119
             QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD++ QPPAQEL AKDLHGNEWKFRH
Sbjct  130   QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFTLQPPAQELFAKDLHGNEWKFRH  189

Query  1120  VFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLS  1299
             +FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWN++NQLLLGIRRA RPQTVMPSSVLS
Sbjct  190   IFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDSNQLLLGIRRATRPQTVMPSSVLS  249

Query  1300  SDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRML  1479
             SDSMHIGLLAAAAHAA+TNSRFTIFYNPRASP +FVIPLAKY KAVYHTR+SVGMRFRML
Sbjct  250   SDSMHIGLLAAAAHAASTNSRFTIFYNPRASPCEFVIPLAKYVKAVYHTRISVGMRFRML  309

Query  1480  FETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTT  1659
             FETEESSVRRYMGTITGISDLD VRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTT
Sbjct  310   FETEESSVRRYMGTITGISDLDAVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTT  369

Query  1660  FPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGIT  1839
             FPMYP+PF LRLKRPWP+GLPS  G  + D+  +S L WLR +  + G QSLNF G G++
Sbjct  370   FPMYPTPFPLRLKRPWPTGLPSLHGGKDDDL--TSSLMWLR-DGSNPGFQSLNFGGVGMS  426

Query  1840  PFMQPRLDASMLGLQPDIYQTMA  1908
             P+MQPRLDAS+LGLQPDIYQT+A
Sbjct  427   PWMQPRLDASLLGLQPDIYQTIA  449


 Score =   238 bits (606),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 156/352 (44%), Positives = 219/352 (62%), Gaps = 16/352 (5%)
 Frame = +1

Query  2191  TSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQL  2370
             +S  +++S  QS  +  Q +      QSFSD   + +  S+ S+  +    FS + AS L
Sbjct  567   SSFSQLSSAPQSSPTTLQTVLPFSQPQSFSDTNMSSLSPSSASAMHNTLGPFSSEAASHL  626

Query  2371  LNMHETNPLATLP--SKRIALESQVSSRATPYVVSQADMISPNSKVSDLPTFLPPFPGKE  2544
                  T      P  SKR+A+ES ++SR  P   S  + +          + L P PG+ 
Sbjct  627   GMPRPTAVPVPDPWSSKRVAVESLLTSR--PQATSNIEHLDSTPPSIPQSSALAPLPGRG  684

Query  2545  FPEYQGVAYSQGNNALLGVNTDS-SILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGT  2721
                 Q       N+ L GVN DS S+L+Q GI +L +   EN    +P+ST NF S    
Sbjct  685   CLVDQDGNSDPQNHLLFGVNIDSQSLLMQGGIPSLHD---ENDSTTIPYSTSNFLSPSQN  741

Query  2722  DYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHEL  2901
             D+ L+  + +  C+DESG++  S N +Q N P  TFVKV+KSG++GRSLDI++FSSYHEL
Sbjct  742   DFSLDQTLNSPGCLDESGYVPCSHNPNQGNQPPATFVKVYKSGTYGRSLDITRFSSYHEL  801

Query  2902  RSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVH  3081
             R EL R+FGLEG LEDP RSGWQLVFVDRE DVLL+GDDPWQEFVN+V+ IKILSP EV 
Sbjct  802   RRELGRLFGLEGQLEDPLRSGWQLVFVDREEDVLLVGDDPWQEFVNSVFCIKILSPQEVQ  861

Query  3082  QMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMN-GIP-LGSLDY  3231
             QMGK +G++L ++ P+  +RL   GSSC+ + S++E+R+++ GI  +GS+++
Sbjct  862   QMGK-QGLELLSSAPS--KRL---GSSCDDYASRQESRSLSTGIASVGSVEF  907



>gb|ADG43150.1| auxin response factor 16 [Zea mays]
Length=905

 Score =   741 bits (1913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/439 (84%), Positives = 397/439 (90%), Gaps = 8/439 (2%)
 Frame = +1

Query  595   PQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAHIPS  774
             P+AEE     KCLNSELWHACAGPLVSLP +GSRVVYFPQGH EQV ASTNKE++A IP+
Sbjct  10    PEAEE----HKCLNSELWHACAGPLVSLPSVGSRVVYFPQGHGEQVAASTNKEMEAQIPN  65

Query  775   YPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPTNY  954
             YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS QE KD   LPAELG  S QPTNY
Sbjct  66    YPSLPPQLICQLHNVTMHADAETDEVYAQMTLQPLSPQELKDP-FLPAELGTASNQPTNY  124

Query  955   FCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFRGQ  1134
             FCKTLTASDTSTHGGFSVPRRAAEKVFPPLD++QQPPAQELIAKDLHGN+WKFRH+FRGQ
Sbjct  125   FCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFNQQPPAQELIAKDLHGNDWKFRHIFRGQ  184

Query  1135  PKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDSMH  1314
             PKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+NNQLLLGIRRANRPQTVMPSSVLSSDSMH
Sbjct  185   PKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDNNQLLLGIRRANRPQTVMPSSVLSSDSMH  244

Query  1315  IGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFETEE  1494
             IGLLAAAAHAA+TNSRFTIFYNPRASP +FVIP+AKY KAVYHTR+SVGMRFRMLFETEE
Sbjct  245   IGLLAAAAHAASTNSRFTIFYNPRASPCEFVIPMAKYVKAVYHTRISVGMRFRMLFETEE  304

Query  1495  SSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYP  1674
             SSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGE+QPRVSLWEIEPLTTFPMYP
Sbjct  305   SSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGEKQPRVSLWEIEPLTTFPMYP  364

Query  1675  SPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPFMQP  1854
             SPF+L LKRPWP+GLPS  G   GD  ++S L WLR +  + G QSLNF G G++P+MQP
Sbjct  365   SPFALGLKRPWPAGLPSLYG-GRGD-GLTSSLMWLR-DRANPGFQSLNFSGLGMSPWMQP  421

Query  1855  RLDASMLGLQPDIYQTMAT  1911
             RLD S+LGLQ D+YQT+A 
Sbjct  422   RLDNSLLGLQSDMYQTIAA  440


 Score =   232 bits (591),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 151/357 (42%), Positives = 214/357 (60%), Gaps = 23/357 (6%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQ  2367
             +++  +++  T S  S  Q + +   QQ+F D   + +  S   S   +      + AS 
Sbjct  563   LSAFSQLSPATHSPPSALQTVPAFSHQQNFPDTNISSLSPSTGPSMHGMLGRLPSEAASS  622

Query  2368  LLNMHETNPLAT---LPSKRIALESQVSSRATPYV---VSQADMISPNSKVSDLPTFLPP  2529
             L  +    P++      SKR+A+ES    R  P+V   +   DM + N   S   + L P
Sbjct  623   LPCVAMNAPVSVSDPWSSKRVAVESVNPCR--PHVSPHIEHLDMATCNMPQS---SALAP  677

Query  2530  FPGKEFPEYQGVAYSQGNNALLGVNTDS-SILLQNGISNLKNSGGENGFLNMPFSTCNFT  2706
              PG+E    +       N+ L GV+ DS S+L+Q GI  L+N   +N    +P+ST NF 
Sbjct  678   LPGRECLVDEDGCSDPQNHLLFGVHIDSHSLLMQGGIPALQN---DNSSGTIPYSTSNFL  734

Query  2707  SGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFS  2886
             S    D+PLN  + ++ C+DES +L  +EN +QAN    TFVKV+KSG+ GR LDI++FS
Sbjct  735   SPSENDFPLNQPLRSAGCLDESDYLPCAENAEQANQQFATFVKVYKSGTVGRLLDITRFS  794

Query  2887  SYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILS  3066
             SY ELRSE+ R+FGLEG LEDP RSGWQLVFVDRE+DVLL+GDDPWQEFVN+V  IKILS
Sbjct  795   SYDELRSEVGRLFGLEGQLEDPLRSGWQLVFVDREDDVLLVGDDPWQEFVNSVSCIKILS  854

Query  3067  PFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMNG--IPLGSLDY  3231
             P EV +MGK  GI L ++ P+  +RL NG   C+ + S +E R ++    P+GS+++
Sbjct  855   PEEVQRMGK-PGIQLLSSAPS--RRLGNG---CDSYASMQEPRGLDAGMAPVGSVEF  905



>ref|XP_008679929.1| PREDICTED: auxin response factor 6 isoform X2 [Zea mays]
Length=913

 Score =   741 bits (1914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/441 (83%), Positives = 398/441 (90%), Gaps = 8/441 (2%)
 Frame = +1

Query  589   VNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAHI  768
              +P+AEE     KCLNSELWHACAGPLVSLP +GSRVVYFPQGH EQV ASTNKE++A I
Sbjct  16    ASPEAEE----HKCLNSELWHACAGPLVSLPSVGSRVVYFPQGHGEQVAASTNKEMEAQI  71

Query  769   PSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPT  948
             P+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS QE KD   LPAELG  S QPT
Sbjct  72    PNYPSLPPQLICQLHNVTMHADAETDEVYAQMTLQPLSPQELKDP-FLPAELGTASNQPT  130

Query  949   NYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFR  1128
             NYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD++QQPPAQELIAKDLHGN+WKFRH+FR
Sbjct  131   NYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFNQQPPAQELIAKDLHGNDWKFRHIFR  190

Query  1129  GQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDS  1308
             GQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+NNQLLLGIRRANRPQTVMPSSVLSSDS
Sbjct  191   GQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDNNQLLLGIRRANRPQTVMPSSVLSSDS  250

Query  1309  MHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFET  1488
             MHIGLLAAAAHAA+TNSRFTIFYNPRASP +FVIP+AKY KAVYHTR+SVGMRFRMLFET
Sbjct  251   MHIGLLAAAAHAASTNSRFTIFYNPRASPCEFVIPMAKYVKAVYHTRISVGMRFRMLFET  310

Query  1489  EESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPM  1668
             EESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGE+QPRVSLWEIEPLTTFPM
Sbjct  311   EESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGEKQPRVSLWEIEPLTTFPM  370

Query  1669  YPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPFM  1848
             YPSPF+L LKRPWP+GLPS  G   GD  ++S L WLR +  + G QSLNF G G++P+M
Sbjct  371   YPSPFALGLKRPWPAGLPSLYG-GRGD-GLTSSLMWLR-DRANPGFQSLNFSGLGMSPWM  427

Query  1849  QPRLDASMLGLQPDIYQTMAT  1911
             QPRLD S+LGLQ D+YQT+A 
Sbjct  428   QPRLDNSLLGLQSDMYQTIAA  448


 Score =   232 bits (591),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 151/357 (42%), Positives = 214/357 (60%), Gaps = 23/357 (6%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQ  2367
             +++  +++  T S  S  Q + +   QQ+F D   + +  S   S   +      + AS 
Sbjct  571   LSAFSQLSPATHSPPSALQTVPAFSHQQNFPDTNISSLSPSTGPSMHGMLGRLPSEAASS  630

Query  2368  LLNMHETNPLAT---LPSKRIALESQVSSRATPYV---VSQADMISPNSKVSDLPTFLPP  2529
             L  +    P++      SKR+A+ES    R  P+V   +   DM + N   S   + L P
Sbjct  631   LPCVAMNAPVSVSDPWSSKRVAVESVNPCR--PHVSPHIEHLDMATCNMPQS---SALAP  685

Query  2530  FPGKEFPEYQGVAYSQGNNALLGVNTDS-SILLQNGISNLKNSGGENGFLNMPFSTCNFT  2706
              PG+E    +       N+ L GV+ DS S+L+Q GI  L+N   +N    +P+ST NF 
Sbjct  686   LPGRECLVDEDGCSDPQNHLLFGVHIDSHSLLMQGGIPALQN---DNSSGTIPYSTSNFL  742

Query  2707  SGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFS  2886
             S    D+PLN  + ++ C+DES +L  +EN +QAN    TFVKV+KSG+ GR LDI++FS
Sbjct  743   SPSENDFPLNQPLRSAGCLDESDYLPCAENAEQANQQFATFVKVYKSGTVGRLLDITRFS  802

Query  2887  SYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILS  3066
             SY ELRSE+ R+FGLEG LEDP RSGWQLVFVDRE+DVLL+GDDPWQEFVN+V  IKILS
Sbjct  803   SYDELRSEVGRLFGLEGQLEDPLRSGWQLVFVDREDDVLLVGDDPWQEFVNSVSCIKILS  862

Query  3067  PFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMNG--IPLGSLDY  3231
             P EV +MGK  GI L ++ P+  +RL NG   C+ + S +E R ++    P+GS+++
Sbjct  863   PEEVQRMGK-PGIQLLSSAPS--RRLGNG---CDSYASMQEPRGLDAGMAPVGSVEF  913



>ref|XP_004963222.1| PREDICTED: auxin response factor 25-like [Setaria italica]
Length=897

 Score =   740 bits (1910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/435 (83%), Positives = 392/435 (90%), Gaps = 3/435 (1%)
 Frame = +1

Query  607   EGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAHIPSYPGL  786
             E  GE++CLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTNKE+DA IP+YP L
Sbjct  14    ESDGEQRCLNSELWHACAGPLVSLPMVGSRVVYFPQGHSEQVAASTNKEVDAQIPNYPNL  73

Query  787   PAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPTNYFCKT  966
             P QLICQLHNVTMHAD ET+EVYAQMTLQPLS +EQK+   LP ELG  SKQPTNYFCKT
Sbjct  74    PPQLICQLHNVTMHADAETEEVYAQMTLQPLSPEEQKE-PFLPIELGAGSKQPTNYFCKT  132

Query  967   LTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFRGQPKRH  1146
             LTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPP QELIA+DLH NEWKFRH+FRGQPKRH
Sbjct  133   LTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPVQELIARDLHDNEWKFRHIFRGQPKRH  192

Query  1147  LLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLL  1326
             LLTTGWSVFVSAKRLVAGD++IFIWN+NNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLL
Sbjct  193   LLTTGWSVFVSAKRLVAGDSIIFIWNDNNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLL  252

Query  1327  aaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFETEESSVR  1506
             AAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMRFRMLFETEESSVR
Sbjct  253   AAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMRFRMLFETEESSVR  312

Query  1507  RYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFS  1686
             RYMGTITGISDLD  RWPNSHWRSVKVGWDESTAG++QPRVSLWEIEPLTTFPMYP+ F 
Sbjct  313   RYMGTITGISDLDSERWPNSHWRSVKVGWDESTAGDKQPRVSLWEIEPLTTFPMYPTAFP  372

Query  1687  LRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPFMQPRLDA  1866
             LRLKRPW SGLP F G  + +    S L WLR   G++G QSLNFQG+G++P++QPR+D 
Sbjct  373   LRLKRPWASGLPMFNGGRSDEFARYSSLMWLRD--GNRGAQSLNFQGFGVSPWLQPRIDY  430

Query  1867  SMLGLQPDIYQTMAT  1911
              +LGL+PD YQ MA 
Sbjct  431   PLLGLKPDTYQQMAA  445


 Score =   196 bits (498),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 127/306 (42%), Positives = 180/306 (59%), Gaps = 23/306 (8%)
 Frame = +1

Query  2338  RSFSHDEASQLLNMHETNPLAT---LPSKRIALESQVSSRATPYVVSQADMISPNSKVSD  2508
             ++FS  EAS LLN+  +  L      PSKR+A+E   +  A   V  + + +S  S VS 
Sbjct  607   QNFSSQEASNLLNLPRSGQLMASEGWPSKRLAVEPLANLEAQS-VQHKLEKVSHQSNVSH  665

Query  2509  LPTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTDSSILLQNGISNLKNSGGENGFLNMPF  2688
             +   L P   ++    Q +  +  ++ L      SS  + +G++ +++ G  +G   +  
Sbjct  666   ISGTLAPLSARDGSSAQALGTNVQSHLL-----SSSFAIHDGMTTVRSGGVGSGTDAITI  720

Query  2689  STCNFTSGVGTDYPLNPD--MGTSSCVDESGFLQSSENVDQANPP-NRTFVKVHKSGSFG  2859
             ++  ++     D  L P+  + TSSC+ ESG   S ++V   NP    TFVKV+KSGS G
Sbjct  721   ASLRYS-----DVNLLPENSLATSSCLGESGTFNSLDDVCGVNPSQGGTFVKVYKSGSLG  775

Query  2860  RSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVN  3039
             RSLDI++FSSY+ELRSEL R+FGLEG LEDP RSGWQLVFVDREND+LL+GDDPWQEFVN
Sbjct  776   RSLDITRFSSYYELRSELERLFGLEGQLEDPVRSGWQLVFVDRENDILLVGDDPWQEFVN  835

Query  3040  NVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMNG--IP  3213
             +VW IKILSP +V QM +  G DL   L      +     +C+ + +    +N+ G   P
Sbjct  836   SVWCIKILSPQDVQQMVR-GGDDL---LSTPGATMLQSSVACDDYSAGHSMQNLTGSIAP  891

Query  3214  LGSLDY  3231
             +  LDY
Sbjct  892   VVPLDY  897



>gb|AFD01302.1| auxin response factor 6 [Brassica rapa subsp. pekinensis]
Length=832

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/448 (83%), Positives = 400/448 (89%), Gaps = 14/448 (3%)
 Frame = +1

Query  568   MRVSLAGVNPQAE--EGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTAS  741
             MR+S AG NP     E TGEK+ LNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQV AS
Sbjct  1     MRLSSAGFNPHPHPHEVTGEKRVLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVAAS  60

Query  742   TNKEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAE  921
             TNKE+DAH P+YP L  QLICQLHNVTMHAD ETDEVYAQMTLQPL+AQEQKD   L AE
Sbjct  61    TNKEVDAHTPNYPSLQPQLICQLHNVTMHADVETDEVYAQMTLQPLNAQEQKD-SYLAAE  119

Query  922   LGMPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGN  1101
             LG+PS+QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDY+QQPPAQEL+A+DLH N
Sbjct  120   LGVPSRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYTQQPPAQELMARDLHDN  179

Query  1102  EWKFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVM  1281
             EWKFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+ NQLLLGIRRA+RPQTVM
Sbjct  180   EWKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDKNQLLLGIRRAHRPQTVM  239

Query  1282  PSSVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVG  1461
             PSSVLSSDSMH+GLLAAAAHAA TNSRFTIFYNPRAS S+FVIPLAKY KAVYHTRVSVG
Sbjct  240   PSSVLSSDSMHLGLLAAAAHAAPTNSRFTIFYNPRASTSEFVIPLAKYVKAVYHTRVSVG  299

Query  1462  MRFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWE  1641
             MRFRMLFETEESSVRRYMGTITGI DLDP RW NSHWRSVKVGWDESTAG+RQPRVSLWE
Sbjct  300   MRFRMLFETEESSVRRYMGTITGICDLDPARWANSHWRSVKVGWDESTAGDRQPRVSLWE  359

Query  1642  IEPLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGD----MHISSPLSWLRGNMGDQGIQ  1809
             IEPLTTFPMYPSPF LRLKRPWPSGLPSF GL   D    M +SSPL W      D+G+Q
Sbjct  360   IEPLTTFPMYPSPFPLRLKRPWPSGLPSFHGLKEDDMGMGMGMSSPLMW------DRGLQ  413

Query  1810  SLNFQGYGITPFMQPRLDAS-MLGLQPD  1890
             S+NFQG G+ P+MQPRLDAS +LG+Q D
Sbjct  414   SMNFQGMGVNPWMQPRLDASGLLGMQND  441


 Score =   203 bits (516),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 163/353 (46%), Positives = 211/353 (60%), Gaps = 58/353 (16%)
 Frame = +1

Query  2233  SHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQ--SLPRSFSHDEASQLLNMHETNPLAT-  2403
             S  Q+++    QQSFSD  G      NN  TQ  +L  +F  DE+SQLLN+  TN   T 
Sbjct  518   SLLQSMTPLCHQQSFSDTNGG-----NNPITQLHTLLSNFPQDESSQLLNLTRTNSAMTS  572

Query  2404  --LPSKRIALESQVSSRATPYVVSQADM----ISPNSKVSDLPTFLPPFP-GKEFPEYQG  2562
                PSKR A++S     +T    +Q+ M     S  S VS     LPPFP G+E  E   
Sbjct  573   SGWPSKRPAIDSSFQ-HSTAVNNNQSVMEQLGQSHTSNVSPNAVSLPPFPSGQE--ENHS  629

Query  2563  VAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENG-FLNMPFSTCNFT---SGVGTDY  2727
               +S   + L GVN DSS +L+ NG+SNL++ G E G    +PF++  F    SG  T  
Sbjct  630   DPHS---HLLFGVNIDSSSLLIPNGMSNLRSIGIEGGDSTTLPFTSSTFNNEFSGTMTT-  685

Query  2728  PLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRS  2907
                     SSC++E GFLQ SEN  Q+N    TFVKV+KSGSFGRSLDI+KFSSY+ELRS
Sbjct  686   -------PSSCIEEPGFLQPSEN-QQSN----TFVKVYKSGSFGRSLDITKFSSYNELRS  733

Query  2908  ELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQM  3087
             ELARMFGLEG LEDP RSGWQLVFV RE            EFV++VW IKILSP EV QM
Sbjct  734   ELARMFGLEGQLEDPVRSGWQLVFVGRE------------EFVSSVWCIKILSPQEVQQM  781

Query  3088  GKEEGIDLPNNLPAAN--QRLPNGGSSCEVHVSQKETRNM-NGIPL--GSLDY  3231
             GK  G++L N+ P+++   ++P+ G +C+   ++ + R++ NGI    GS +Y
Sbjct  782   GK-RGLELLNSAPSSDNVDKVPSNG-NCDDFGNRSDPRSLGNGIASVGGSFNY  832



>ref|XP_009384193.1| PREDICTED: auxin response factor 17-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384194.1| PREDICTED: auxin response factor 17-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384195.1| PREDICTED: auxin response factor 17-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384196.1| PREDICTED: auxin response factor 17-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=906

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/448 (82%), Positives = 399/448 (89%), Gaps = 5/448 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR++ + +  Q+EE   E +CLNSELWH CAGPLVSLP +GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLTSSNIPNQSEEE--ETRCLNSELWHTCAGPLVSLPAVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KEI++ IP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQKD   LP +LG
Sbjct  59    KEINSQIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLSPQEQKDP-YLPNDLG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
               +KQPTN+FCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPP QEL+A+DLH NEW
Sbjct  118   TSNKQPTNFFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPVQELVARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRHVFRGQPKRHLLTTGWS FVSAKRLVAGD+V+FIWNENNQLLLGIR ANRPQT MPS
Sbjct  178   KFRHVFRGQPKRHLLTTGWSTFVSAKRLVAGDSVLFIWNENNQLLLGIRHANRPQTFMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDP RWPNSHWR++KVGWDESTAGE+QPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDPARWPNSHWRALKVGWDESTAGEKQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F +RLKRPWP+GLP F G  N D+ ++ PL  LR + G+  IQSLNFQG
Sbjct  358   PLTTFPMYPSSFPVRLKRPWPTGLPFFHG-GNDDIDLNLPLMRLR-DGGNPAIQSLNFQG  415

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
              G+TP+MQPRLDA MLGLQPD+ Q M T
Sbjct  416   VGVTPWMQPRLDALMLGLQPDMCQAMTT  443


 Score =   271 bits (693),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 165/337 (49%), Positives = 206/337 (61%), Gaps = 13/337 (4%)
 Frame = +1

Query  2239  FQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMHETNPLATLP--S  2412
                +S +   + F D  GN V  SN S    + +  S +E SQL       P+ + P  S
Sbjct  577   LHMISPSCQLKDFPDSNGNSVSASNASPLHGIFQQNSSEETSQLSLPKYGQPVTSSPWSS  636

Query  2413  KRIALESQVSSRATPYV--VSQADMISPNSKVSDLPTFLPPFPGKEFPEYQGVAYSQGNN  2586
             KR A+ES +   A   +  V Q     PN  +S     LPPFPGKE    +       N 
Sbjct  637   KRAAVESGLPLGAQSVLSHVEQLGATQPN--ISLHSVMLPPFPGKECSASRDGNMDMQNQ  694

Query  2587  ALLGVNTDSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVD  2766
              L GVN D SIL QNGI +L     E    N+ ++TCN  S  G D+P+N  +   + +D
Sbjct  695   HLFGVNVDLSILAQNGIPSLNTGVSEICSTNLSYATCNLLSSSGNDFPINRALSGCNGLD  754

Query  2767  ESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLE  2946
             ES FL+S ENVDQANP +  FVKV+KSGSFGR+LDI+KFSSYH+LRSEL  +FGLEG LE
Sbjct  755   ESRFLRSHENVDQANPQSGLFVKVYKSGSFGRTLDITKFSSYHDLRSELGCLFGLEGQLE  814

Query  2947  DPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLP  3126
             DP RSGWQLVFVD ENDVLL+GDDPWQEFVN+V YIKILSP EV QMGK +GID  N+ P
Sbjct  815   DPLRSGWQLVFVDWENDVLLVGDDPWQEFVNSVSYIKILSPEEVQQMGK-QGIDFVNSAP  873

Query  3127  AANQRLPNGGSSCEVHVSQKETRNMNG--IPLGSLDY  3231
                +RL   G  C+ HVSQ+++ N++     +GS  Y
Sbjct  874   V--KRLQRNG--CDDHVSQQDSTNLSARITSVGSFKY  906



>gb|KEH20525.1| auxin response factor 2 [Medicago truncatula]
Length=914

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/447 (81%), Positives = 401/447 (90%), Gaps = 6/447 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S AG +P  +EG  EK+ L+SELWHACAGPLV LP  GSRVVYFPQGHSEQV  STN
Sbjct  1     MKLSSAGFSPPPQEG--EKRVLDSELWHACAGPLVCLPADGSRVVYFPQGHSEQVAVSTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             +E+D +IP+ P LP QLICQLHN+TMHAD ETDEVYAQMTLQPL+ +EQK+   LPAELG
Sbjct  59    REVDTYIPN-PSLPPQLICQLHNLTMHADTETDEVYAQMTLQPLNPEEQKE-AYLPAELG  116

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
               +KQPTNYFCK LTASDTSTHGGFSVPRRAAEKVFPPLD++QQPPAQELIA+DLHGN+W
Sbjct  117   TANKQPTNYFCKILTASDTSTHGGFSVPRRAAEKVFPPLDFTQQPPAQELIARDLHGNDW  176

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KF+H+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA+RPQ +MPS
Sbjct  177   KFKHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRASRPQHMMPS  236

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  237   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  296

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLD VRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  297   FRMLFETEESSVRRYMGTITGISDLDSVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  356

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPSPF LRLKRPWP GLPSF GL + D  ++SPL WLR    D+G+Q+LNFQG
Sbjct  357   PLTTFPMYPSPFPLRLKRPWPPGLPSFHGLKDDDFGMNSPLLWLRD--ADRGLQTLNFQG  414

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMA  1908
              G+ P+MQ RLD SM+ +QPD+YQ MA
Sbjct  415   MGVNPWMQARLDPSMMNMQPDMYQAMA  441


 Score =   265 bits (678),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 174/363 (48%), Positives = 227/363 (63%), Gaps = 25/363 (7%)
 Frame = +1

Query  2176  MSKPITSLPRMNSTTQSQLSH-FQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSH  2352
             MS  ++++ +  S   SQ +   QA+SS   QQ+FSD  GN V     S   ++  SFS+
Sbjct  566   MSNAVSTMSQFVSAPPSQSTQPMQAISSIGHQQNFSDSNGNPV-----SPLHNMLGSFSN  620

Query  2353  DEASQLLNMHETNPLATL------PSKRIALESQVSSRATPYVVSQADMISPN-SKVSDL  2511
             DE S LLN    N    +      PSKR+A++  +SS A+ YV+ Q + +  + + +S  
Sbjct  621   DETSHLLNFPRPNSWVPVQSSTARPSKRVAVDPLLSSGASHYVLPQVEQLGQSQTTMSQN  680

Query  2512  PTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTD-SSILLQNGISNLKNSGGENGFLNMPF  2688
                LPPFPG+E    +G    Q N+ L G N + SS L+ N +SNLK           PF
Sbjct  681   AITLPPFPGREC-AIEGNTDPQ-NHLLFGFNIEPSSHLVYNEMSNLKRVNSNCDSSTAPF  738

Query  2689  STCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSL  2868
              +  + +  G D  LNP  G +  V ESGF+Q+ EN  Q NP N+TFVKV+KSGSFGRSL
Sbjct  739   QSSTYLNTTGADSSLNP--GLTHGVGESGFMQTPENGGQGNPQNKTFVKVYKSGSFGRSL  796

Query  2869  DISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVW  3048
             DI+KFS+Y ELRSELARMFGLEG LEDP RSGWQLVFVD+ENDVLLLGD PW EFVN+VW
Sbjct  797   DITKFSNYPELRSELARMFGLEGELEDPVRSGWQLVFVDQENDVLLLGDGPWPEFVNSVW  856

Query  3049  YIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMNG--IPLGS  3222
              IKILSP EV QMG   G++L N+ P   QRL NG   C+ +  ++++RN++     +GS
Sbjct  857   CIKILSPQEVQQMGT-NGLELLNSAPT--QRLSNG--ICDDYTGREDSRNLSTGLTTVGS  911

Query  3223  LDY  3231
             LDY
Sbjct  912   LDY  914



>ref|XP_004504542.1| PREDICTED: auxin response factor 6-like isoform X1 [Cicer arietinum]
Length=918

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/448 (82%), Positives = 401/448 (90%), Gaps = 7/448 (2%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M+ S AG +P   EG  EK+ L+SELWHACAGPLVSLP +GSRVVYFPQGHSEQV  STN
Sbjct  1     MKFSSAGFSPPPPEG--EKRVLDSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAVSTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             +E+D +IP+ P LP QLICQLHN+TMHAD ETDEVYAQMTLQPL+ +EQK+   LPAELG
Sbjct  59    REVDTYIPN-PSLPPQLICQLHNLTMHADTETDEVYAQMTLQPLNPEEQKE-AYLPAELG  116

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
               SKQPTNYFCK LTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLHG +W
Sbjct  117   AASKQPTNYFCKILTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHGIDW  176

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KF+H+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQ+LLGIRRANRPQ +MPS
Sbjct  177   KFKHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQMLLGIRRANRPQPMMPS  236

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  237   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  296

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLD VRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  297   FRMLFETEESSVRRYMGTITGISDLDSVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  356

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSF-PGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQ  1824
             PLTTFPMYPSPF LRLKRPWP GLPSF  GL + D  ++SPL WLR    D+G+Q+LNFQ
Sbjct  357   PLTTFPMYPSPFPLRLKRPWPPGLPSFHAGLKDDDFGMNSPLLWLRDT--DRGLQTLNFQ  414

Query  1825  GYGITPFMQPRLDASMLGLQPDIYQTMA  1908
             G G+ P+MQPRLD SM+ LQPD+YQ MA
Sbjct  415   GIGVNPWMQPRLDPSMMHLQPDMYQAMA  442


 Score =   275 bits (703),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 175/363 (48%), Positives = 229/363 (63%), Gaps = 20/363 (6%)
 Frame = +1

Query  2176  MSKPITSLPRMNSTTQSQLSH-FQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSH  2352
             +S  ++++ +  ST QSQ +   QA+SS   QQ+F+D  GNHV TS  S   ++  SF +
Sbjct  565   ISSAVSTMSQFVSTPQSQPTQPMQAISSIGNQQNFTDSNGNHVTTSIVSPLHNMLGSFPN  624

Query  2353  DEASQLLNMHETNPLATL------PSKRIALESQVSSRATPYVVSQADMISPN-SKVSDL  2511
             DE S LLN+   N    +      PSKR+A++  +SS  T YV+ Q + +  + + +S  
Sbjct  625   DETSHLLNLPRQNSWVPVQSSTAWPSKRVAVDPLLSSGGTNYVLPQVEQLGQSQTTMSQN  684

Query  2512  PTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTD-SSILLQNGISNLKNSGGENGFLNMPF  2688
                LPPFPG+E    +G    Q N+ L G N + SS L+ N + NLK           PF
Sbjct  685   AVILPPFPGREC-AIEGSTDPQ-NHLLFGFNIEPSSHLVYNEMPNLKRVNSNCDSSTAPF  742

Query  2689  STCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSL  2868
              +  + +  G D  LNP  G +  + ES FLQ+ EN  Q N PNRTFVKV+KSGSFGRSL
Sbjct  743   QSSTYLNTAGADSSLNP--GMTHGIGESDFLQTPENGGQGNQPNRTFVKVYKSGSFGRSL  800

Query  2869  DISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVW  3048
             DI+KFS+YHELRSELARMFGLE  LEDP RSGWQLVFVD+ENDVLLLGD PW EFVN+VW
Sbjct  801   DITKFSNYHELRSELARMFGLERELEDPVRSGWQLVFVDQENDVLLLGDGPWPEFVNSVW  860

Query  3049  YIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMNG--IPLGS  3222
              IKILSP EV QMG   G++L N+  A NQR  NG   C+ +  ++++RN++     +GS
Sbjct  861   CIKILSPQEVQQMGN-NGLELLNS--AQNQRHSNG--ICDDYTGREDSRNLSTGLATVGS  915

Query  3223  LDY  3231
             LDY
Sbjct  916   LDY  918



>ref|NP_001067266.1| Os12g0613700 [Oryza sativa Japonica Group]
 sp|Q2QM84.1|ARFY_ORYSJ RecName: Full=Auxin response factor 25; AltName: Full=OsARF6b 
[Oryza sativa Japonica Group]
 gb|ABA99400.1| Auxin response factor 6, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF30285.1| Os12g0613700 [Oryza sativa Japonica Group]
 gb|EAZ21209.1| hypothetical protein OsJ_36859 [Oryza sativa Japonica Group]
Length=899

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/443 (83%), Positives = 394/443 (89%), Gaps = 7/443 (2%)
 Frame = +1

Query  595   PQA-EEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAHIP  771
             PQA  E  GE++CLNSELWHACAGPLVSLP + SRVVYFPQGHSEQV ASTNKE+DA IP
Sbjct  12    PQALPENDGEQRCLNSELWHACAGPLVSLPVVRSRVVYFPQGHSEQVAASTNKEVDAQIP  71

Query  772   SYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPTN  951
             +YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS +EQK+   LP ELG  SKQPTN
Sbjct  72    NYPNLPPQLICQLHNVTMHADAETDEVYAQMTLQPLSPEEQKEP-FLPMELGAASKQPTN  130

Query  952   YFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFRG  1131
             YFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NEWKFRH+FRG
Sbjct  131   YFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNEWKFRHIFRG  190

Query  1132  QPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDSM  1311
             QPKRHLLTTGWSVFVSAKRLVAGD+VIFIWN+NNQLLLGIRRANR QTVMPSSVLSSDSM
Sbjct  191   QPKRHLLTTGWSVFVSAKRLVAGDSVIFIWNDNNQLLLGIRRANRQQTVMPSSVLSSDSM  250

Query  1312  HIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFETE  1491
             HIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMRFRMLFETE
Sbjct  251   HIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMRFRMLFETE  310

Query  1492  ESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMY  1671
             ESSVRRYMGTIT ISDLD VRWPNSHWRSVKVGWDEST G++QPRVSLWEIEPLTTFPMY
Sbjct  311   ESSVRRYMGTITSISDLDSVRWPNSHWRSVKVGWDESTTGDKQPRVSLWEIEPLTTFPMY  370

Query  1672  PSPFSLRLKRPWPSGLP---SFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITP  1842
             PS F LRLKRPW SGLP    F G  N D    S L WLR   G++G QSLNFQG+G++P
Sbjct  371   PSAFPLRLKRPWASGLPMHGMFNGGGNDDFARYSSLMWLRD--GNRGTQSLNFQGHGVSP  428

Query  1843  FMQPRLDASMLGLQPDIYQTMAT  1911
             ++QPR+D+ +LGL+PD YQ MA 
Sbjct  429   WLQPRIDSPLLGLKPDTYQQMAA  451


 Score =   182 bits (463),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 133/341 (39%), Positives = 180/341 (53%), Gaps = 31/341 (9%)
 Frame = +1

Query  2251  SSTVPQQSFSDLVGNHVMTSNNSSTQSLP--------RSFSHDEASQLLNMHETNPLAT-  2403
             S + PQ   S L G+     N     S P         +FS+ EAS LL +  ++ L   
Sbjct  576   SGSAPQAQSSLLSGSSFYNQNLLEGNSDPPLHLHNNFHNFSNQEASNLLILPRSSQLMAS  635

Query  2404  --LPSKRIALESQVSSRATPYVVSQADMISPNSKVSDLPTFLPPFPGKEFPEYQGVAYSQ  2577
                PSKR+ LES V   A P +  + + ++ +  +S  P   PP   +     Q      
Sbjct  636   DGWPSKRLTLESAVHPEA-PSMHPKIEKVN-HQGISHFPGAFPPQSARGCSIVQDCRADA  693

Query  2578  GNNALLGVNTDSSILLQNGISNL-KNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTS  2754
              N  L      SS  LQ+G++++  ++  E   + +P    +     G D      + TS
Sbjct  694   ENRLL-----SSSFELQDGMTSIITDANRETDTMAIPLLRYS-----GADLTTENTLATS  743

Query  2755  SCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLE  2934
             +C+ ESG      N+        TFVKV+KSGS GRSLDIS+FSSY ELRSEL R+FGLE
Sbjct  744   NCLGESGTFNPLNNISVNPSQGATFVKVYKSGSLGRSLDISRFSSYCELRSELERLFGLE  803

Query  2935  GLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLP  3114
             G LEDP RSGWQLVFVDREND+LL+GDDPWQEF N+VW IKILSP EV Q+ +  G D  
Sbjct  804   GQLEDPVRSGWQLVFVDRENDILLVGDDPWQEFANSVWCIKILSPQEVQQLVR--GGDGL  861

Query  3115  NNLPAANQRLPNGGSSCEVHVSQKETRNMNG--IPLGSLDY  3231
              + P A  +  N   +C+ + +    +N+ G    +  LDY
Sbjct  862   LSSPGARMQQSN---ACDDYSASHNMQNIAGNIASVAPLDY  899



>ref|XP_008648945.1| PREDICTED: auxin response factor 17-like isoform X1 [Zea mays]
Length=860

 Score =   736 bits (1899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/441 (82%), Positives = 392/441 (89%), Gaps = 4/441 (1%)
 Frame = +1

Query  589   VNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAHI  768
              N  A     E KCLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTNKE+++ I
Sbjct  27    TNTSAVTDVEEHKCLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTNKEMESQI  86

Query  769   PSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPT  948
             PSYP LP QLICQLHNVTM AD ET+EVYAQMTLQPL+ QE KD   LPAELG+ SKQPT
Sbjct  87    PSYPNLPPQLICQLHNVTMQADAETEEVYAQMTLQPLNPQELKD-PYLPAELGLVSKQPT  145

Query  949   NYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFR  1128
             NYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD++QQPP QEL+A DLHGNEWKFRH+FR
Sbjct  146   NYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFTQQPPCQELMATDLHGNEWKFRHIFR  205

Query  1129  GQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDS  1308
             GQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+NNQLLLGIRRANRPQTVMPSSVLSSDS
Sbjct  206   GQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDNNQLLLGIRRANRPQTVMPSSVLSSDS  265

Query  1309  MHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFET  1488
             MHIGLLAAAAHAA+TNSRFTIFYNPRASPS+FVIPLAKY KAVYHTR+SVGMRFRMLFET
Sbjct  266   MHIGLLAAAAHAASTNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRISVGMRFRMLFET  325

Query  1489  EESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPM  1668
             EESSVRRYMGTITGISDLD VRWPNSHWRSVKVGWDESTAG+RQPRVSLWEIEPLTTFP 
Sbjct  326   EESSVRRYMGTITGISDLDSVRWPNSHWRSVKVGWDESTAGDRQPRVSLWEIEPLTTFPT  385

Query  1669  YPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPFM  1848
             Y SPF LRLKRPWP+GLPS  G  + D+  ++ L WLR +  + G QSLNF G G+  +M
Sbjct  386   YTSPFPLRLKRPWPTGLPSLHGGKDDDL--ANSLMWLR-DTTNPGFQSLNFGGLGMNSWM  442

Query  1849  QPRLDASMLGLQPDIYQTMAT  1911
             QPRLD S+LGLQPD+YQ MAT
Sbjct  443   QPRLDTSLLGLQPDMYQAMAT  463


 Score =   196 bits (499),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 126/290 (43%), Positives = 175/290 (60%), Gaps = 13/290 (4%)
 Frame = +1

Query  2176  MSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHD  2355
             +S  +++  +++S +QS     Q +      QSF+D   + +  SN ++ Q+  R FS +
Sbjct  578   VSNALSAFSQLSSASQSTPMALQTILPFSQAQSFTDTSASSLSPSNTNTMQNTLRPFSSE  637

Query  2356  EASQLLNMHETN-PLATL-PSKRIALESQVSSRATPYVVSQADMISPNSKVSDLP--TFL  2523
               S L     T  P+     SKR A+ES + SR  P   SQ   +  +S  + +P  + L
Sbjct  638   AVSHLSMPRPTAIPVPDAWSSKRAAVESLLPSR--PQDSSQMQQL--DSTPASIPHSSAL  693

Query  2524  PPFPGKEFPEYQGVAYSQGNNALLGVNTDS-SILLQNGISNLKNSGGENGFLNMPFSTCN  2700
              P PG+     Q       N+ L GV+ DS S+L++ GI  L+N    N    +P+ST N
Sbjct  694   APLPGRGCLVDQDANPDPQNHLLFGVSIDSQSLLMEGGIHGLQNG---NDSTAIPYSTSN  750

Query  2701  FTSGVGTDYPLNPDMGTSSCVDESGFLQ-SSENVDQANPPNRTFVKVHKSGSFGRSLDIS  2877
             F S    D+PL+  + +S C+D+SG++   S+N DQ N P  TFVKV+KSG++GRSLDI+
Sbjct  751   FLSPSQNDFPLDHTLNSSGCLDDSGYVPPCSDNSDQVNRPPATFVKVYKSGTYGRSLDIT  810

Query  2878  KFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQ  3027
             +FSSYHELR EL R+FGLEG LEDP RSGWQLVFVDRE DVLL+GDDPWQ
Sbjct  811   RFSSYHELRRELGRLFGLEGQLEDPLRSGWQLVFVDREEDVLLVGDDPWQ  860



>gb|EAY83881.1| hypothetical protein OsI_39101 [Oryza sativa Indica Group]
Length=899

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/443 (83%), Positives = 394/443 (89%), Gaps = 7/443 (2%)
 Frame = +1

Query  595   PQA-EEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAHIP  771
             PQA  E  GE++CLNSELWHACAGPLVSLP + SRVVYFPQGHSEQV ASTNKE+DA IP
Sbjct  12    PQALPENDGEQRCLNSELWHACAGPLVSLPVVRSRVVYFPQGHSEQVAASTNKEVDAQIP  71

Query  772   SYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPTN  951
             +YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS +EQK+   LP ELG  SKQPTN
Sbjct  72    NYPNLPPQLICQLHNVTMHADAETDEVYAQMTLQPLSPEEQKEP-FLPMELGAASKQPTN  130

Query  952   YFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFRG  1131
             YFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NEWKFRH+FRG
Sbjct  131   YFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNEWKFRHIFRG  190

Query  1132  QPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDSM  1311
             QPKRHLLTTGWSVFVSAKRLVAGD+VIFIWN+NNQLLLGIRRANR QTVMPSSVLSSDSM
Sbjct  191   QPKRHLLTTGWSVFVSAKRLVAGDSVIFIWNDNNQLLLGIRRANRQQTVMPSSVLSSDSM  250

Query  1312  HIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFETE  1491
             HIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMRFRMLFETE
Sbjct  251   HIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMRFRMLFETE  310

Query  1492  ESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMY  1671
             ESSVRRYMGTIT ISDLD VRWPNSHWRSVKVGWDEST G++QPRVSLWEIEPLTTFPMY
Sbjct  311   ESSVRRYMGTITSISDLDSVRWPNSHWRSVKVGWDESTTGDKQPRVSLWEIEPLTTFPMY  370

Query  1672  PSPFSLRLKRPWPSGLP---SFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITP  1842
             PS F LRLKRPW SGLP    F G  N D    S L WLR   G++G QSLNFQG+G++P
Sbjct  371   PSAFPLRLKRPWASGLPMHGMFNGGGNDDFARYSSLMWLRD--GNRGTQSLNFQGHGVSP  428

Query  1843  FMQPRLDASMLGLQPDIYQTMAT  1911
             ++QPR+D+ +LGL+PD YQ MA 
Sbjct  429   WLQPRIDSPLLGLKPDTYQQMAA  451


 Score =   183 bits (465),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 133/341 (39%), Positives = 181/341 (53%), Gaps = 31/341 (9%)
 Frame = +1

Query  2251  SSTVPQQSFSDLVGNHVMTSNNSSTQSLP--------RSFSHDEASQLLNMHETNPLAT-  2403
             S + PQ   S L G+     N     S P         +FS+ E S LL++  ++ L   
Sbjct  576   SGSAPQAQSSLLSGSSFYNQNLLEGNSDPPLHLHNNFHNFSNQEPSNLLSLPRSSQLMAS  635

Query  2404  --LPSKRIALESQVSSRATPYVVSQADMISPNSKVSDLPTFLPPFPGKEFPEYQGVAYSQ  2577
                PSKR+ALES V   A P +  + + ++ +  +S  P   PP   +     Q      
Sbjct  636   DGWPSKRLALESAVHPEA-PSMHPKIEKVN-HQGISHFPGAFPPQSARGCSIVQDCRADA  693

Query  2578  GNNALLGVNTDSSILLQNGISNL-KNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTS  2754
              N  L      SS  LQ+G++++  ++  E   + +P    +     G D      + TS
Sbjct  694   ENRLL-----SSSFELQDGMTSIITDANRETDTMAIPLLRYS-----GADLTTENTLATS  743

Query  2755  SCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLE  2934
             +C+ ESG      N+        TFVKV+KSGS GRSLDIS+FSSY ELRSEL R+FGLE
Sbjct  744   NCLGESGTFNPLNNISVNPSQGATFVKVYKSGSLGRSLDISRFSSYCELRSELERLFGLE  803

Query  2935  GLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLP  3114
             G LEDP RSGWQLVFVDREND+LL+GDDPWQEF N+VW IKILSP EV Q+ +  G D  
Sbjct  804   GQLEDPVRSGWQLVFVDRENDILLVGDDPWQEFANSVWCIKILSPQEVQQLVR--GGDGL  861

Query  3115  NNLPAANQRLPNGGSSCEVHVSQKETRNMNG--IPLGSLDY  3231
              + P A  +  N   +C+ + +    +N+ G    +  LDY
Sbjct  862   LSSPGARMQQSN---ACDDYSASHNMQNIAGNIASVAPLDY  899



>gb|ADG43156.1| auxin response factor 22 [Zea mays]
Length=925

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/441 (83%), Positives = 391/441 (89%), Gaps = 4/441 (1%)
 Frame = +1

Query  589   VNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAHI  768
              N  A     E KCLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTNKE+++ I
Sbjct  27    TNTSAVTDVEEHKCLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTNKEMESQI  86

Query  769   PSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPT  948
             PSYP LP QLICQLHNVTM AD ET+EVYAQMTLQPL+ QE KD   LPAELG+ SKQPT
Sbjct  87    PSYPNLPPQLICQLHNVTMQADAETEEVYAQMTLQPLNPQELKDP-YLPAELGLVSKQPT  145

Query  949   NYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFR  1128
             NYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD++QQPP QEL+A DLHGNEWKFRH+FR
Sbjct  146   NYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFTQQPPCQELMATDLHGNEWKFRHIFR  205

Query  1129  GQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDS  1308
             GQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+NNQLLLGIRRANRPQTVMPSSVLSSDS
Sbjct  206   GQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDNNQLLLGIRRANRPQTVMPSSVLSSDS  265

Query  1309  MHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFET  1488
             MHIGLLAAAAHAA+TNSRFTIFYNPRASPS+FVIPLAKY KAVYHTR+SVGMRFRMLFET
Sbjct  266   MHIGLLAAAAHAASTNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRISVGMRFRMLFET  325

Query  1489  EESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPM  1668
             EESSVRRYMGTITGISDLD VRWPNSHWRSVKVGWDESTAG+RQPRVSLWEIEPLTTFP 
Sbjct  326   EESSVRRYMGTITGISDLDSVRWPNSHWRSVKVGWDESTAGDRQPRVSLWEIEPLTTFPT  385

Query  1669  YPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPFM  1848
             Y SPF LRLKRPWP+GLPS  G  + D+  S  L WLR +  + G QSLNF G G+  +M
Sbjct  386   YTSPFPLRLKRPWPTGLPSLHGGKDDDLANS--LMWLR-DTTNPGFQSLNFGGLGMNSWM  442

Query  1849  QPRLDASMLGLQPDIYQTMAT  1911
             QPRLD S+LGLQPD+YQ MAT
Sbjct  443   QPRLDTSLLGLQPDMYQAMAT  463


 Score =   244 bits (623),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 160/360 (44%), Positives = 228/360 (63%), Gaps = 20/360 (6%)
 Frame = +1

Query  2176  MSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHD  2355
             +S  +++  +++S +QS     Q +      QSF+D   + +  SN ++ Q+  R FS +
Sbjct  578   VSNALSAFSQLSSASQSTPMALQTILPFSQAQSFTDTSASSLSPSNTNTMQNTLRPFSSE  637

Query  2356  EASQLLNMHETN-PLATL-PSKRIALESQVSSRATPYVVSQADMISPNSKVSDLP--TFL  2523
               S L     T  P+     SKR A+ES + SR  P   SQ   +  +S  + +P  + L
Sbjct  638   AVSHLSMPRPTAIPVPDAWSSKRAAVESLLPSR--PQDSSQMQQL--DSTPASIPHSSAL  693

Query  2524  PPFPGKEFPEYQGVAYSQGNNALLGVNTDS-SILLQNGISNLKNSGGENGFLNMPFSTCN  2700
              P PG+     Q       N+ L GV+ DS S+L++ GI  L+N    N    +P+ST N
Sbjct  694   APLPGRGCLVDQDANPDPQNHLLFGVSIDSQSLLMEGGIHGLQNG---NDSTAIPYSTSN  750

Query  2701  FTSGVGTDYPLNPDMGTSSCVDESGFLQ-SSENVDQANPPNRTFVKVHKSGSFGRSLDIS  2877
             F S    D+PL+  + +S C+D+SG++   S+N DQ N P  TFVKV+KSG++GRSLDI+
Sbjct  751   FLSPSQNDFPLDHTLNSSGCLDDSGYVPPCSDNSDQVNRPPATFVKVYKSGTYGRSLDIT  810

Query  2878  KFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIK  3057
             +FSSYHELR EL R+FGLEG LEDP RSGWQLVFVDRE DVLL+GDDPWQEF + V  IK
Sbjct  811   RFSSYHELRRELGRLFGLEGQLEDPLRSGWQLVFVDREEDVLLVGDDPWQEFASTVSCIK  870

Query  3058  ILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMN-GIP-LGSLDY  3231
             ILSP EV QMGK +G++L ++ PAA +RL   GSSC+ +VS++E+R+++ GI  +GS+++
Sbjct  871   ILSPQEVQQMGK-QGLELLSSAPAA-RRL---GSSCDGYVSRQESRSLSTGIASVGSVEF  925



>ref|XP_004951871.1| PREDICTED: auxin response factor 6-like isoform X1 [Setaria italica]
Length=907

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/441 (83%), Positives = 393/441 (89%), Gaps = 6/441 (1%)
 Frame = +1

Query  595   PQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAHIPS  774
             P + E   E KCLNSELWHACAGPLVSLP +GSRVVYFPQGH EQV ASTNKE+++ IP+
Sbjct  15    PASPEEAEENKCLNSELWHACAGPLVSLPAVGSRVVYFPQGHGEQVAASTNKEMESQIPN  74

Query  775   YPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPTNY  954
             YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS QE KD   LPAELG  SKQPTNY
Sbjct  75    YPSLPPQLICQLHNVTMHADAETDEVYAQMTLQPLSPQELKDP-FLPAELGGASKQPTNY  133

Query  955   FCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFRGQ  1134
             FCKTLTASDTSTHGGFSVPRRAAEKVFPPLD++QQPPAQELIAKDLHGNEWKFRH+FRGQ
Sbjct  134   FCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFNQQPPAQELIAKDLHGNEWKFRHIFRGQ  193

Query  1135  PKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDSMH  1314
             PKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+NNQLLLGIRRANRPQTVMPSSVLSSDSMH
Sbjct  194   PKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDNNQLLLGIRRANRPQTVMPSSVLSSDSMH  253

Query  1315  IGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFETEE  1494
             IGLLAAAAHAA+TNSRFTIFYNPRASP +FVIPLAKY KAVYHTR+SVGMRFRMLFETEE
Sbjct  254   IGLLAAAAHAASTNSRFTIFYNPRASPCEFVIPLAKYVKAVYHTRISVGMRFRMLFETEE  313

Query  1495  SSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYP  1674
             SSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGE+QPRVSLWEIEPLTTFPMYP
Sbjct  314   SSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGEKQPRVSLWEIEPLTTFPMYP  373

Query  1675  SPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGI--TPFM  1848
             SPF+L LKRPWP+GLPS  G    D  ++S L WLR    +   QSLNF G G   +P+M
Sbjct  374   SPFALGLKRPWPTGLPSLYG--GRDDGLTSSLMWLRDGT-NPSFQSLNFGGLGTSPSPWM  430

Query  1849  QPRLDASMLGLQPDIYQTMAT  1911
             QPR+D S+LGLQ D+YQT+A 
Sbjct  431   QPRMDNSLLGLQSDMYQTIAA  451


 Score =   242 bits (617),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 161/360 (45%), Positives = 224/360 (62%), Gaps = 28/360 (8%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQ  2367
             +++  +++S TQS  S   A+ +   QQ+F+D   + +  S  SS Q +      D  S 
Sbjct  564   LSAFSQLSSVTQSPSSTLPAVPAFSHQQNFADTNISALSPSGGSSMQGMLGQLPSDAPSS  623

Query  2368  LLNMHETNPLAT---LPSKRIALESQVSSRATPYVVS----QADMISPNSKVSDLP--TF  2520
             L  +    PL+      SKR+A+ES   SR  P+VVS    Q DM   N     LP  + 
Sbjct  624   LPCVARNTPLSISDPWSSKRVAVESVNPSR--PHVVSAQIEQLDMTPCN-----LPQNSA  676

Query  2521  LPPFPGKEFPEYQGVAYSQGNNALLGVNTDS-SILLQNGISNLKNSGGENGFLNMPFSTC  2697
             L P PG+     Q  +    N+ L GVN DS S+L+Q GI   +N   +N    +P+ST 
Sbjct  677   LAPLPGRGCLVDQDESSDPQNHLLFGVNIDSQSLLMQGGIPGHQN---DNDSSTIPYSTS  733

Query  2698  NFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDIS  2877
             NF S    D+PL   + ++ C+DES ++ S+EN +QAN    TFVKV+KSG+ GR LDI+
Sbjct  734   NFLSPSQNDFPLGQPLPSTGCLDESSYVPSAENSEQANQQFATFVKVYKSGTVGRLLDIT  793

Query  2878  KFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIK  3057
             +FSSY ELRSE+ R+FGLEG LEDP RSGWQLVFVD E+DVLL+GDDPWQEFVN+V  IK
Sbjct  794   RFSSYDELRSEVGRLFGLEGQLEDPLRSGWQLVFVDGEDDVLLVGDDPWQEFVNSVSCIK  853

Query  3058  ILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMNG--IPLGSLDY  3231
             ILS  EV QMGK +GI+L ++ PA  +RL NG   C+ +VS++E++N++    P+GS+++
Sbjct  854   ILSLEEVQQMGK-QGIELLSSAPA--RRLSNG---CDSYVSRQESKNLSTGMTPVGSVEF  907



>ref|XP_003575362.1| PREDICTED: auxin response factor 6-like isoform X1 [Brachypodium 
distachyon]
Length=915

 Score =   736 bits (1900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/439 (82%), Positives = 392/439 (89%), Gaps = 4/439 (1%)
 Frame = +1

Query  595   PQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAHIPS  774
             P + E   E KCLNSELWHACAGPLVSLP +GSRV+YFPQGHSEQV+ASTNKEI++ IP+
Sbjct  15    PGSPEVAEEHKCLNSELWHACAGPLVSLPAVGSRVLYFPQGHSEQVSASTNKEIESQIPN  74

Query  775   YPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPTNY  954
             YP LP QLICQLHNV MHAD ETDEV AQMTLQPLS QE KD   LPAELG  +KQPTNY
Sbjct  75    YPNLPPQLICQLHNVIMHADAETDEVCAQMTLQPLSPQELKD-PFLPAELGTANKQPTNY  133

Query  955   FCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFRGQ  1134
             FCKTLTASDTSTHGGFSVPRRAAEKVFPPLD++QQPPAQEL+AKDLHGNEWKFRH+FRGQ
Sbjct  134   FCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFTQQPPAQELMAKDLHGNEWKFRHIFRGQ  193

Query  1135  PKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDSMH  1314
             PKRHLLTTGWSVF+SAKRLVAGD+V+FIWN+NNQLLLGIRRANRPQTVMPSSVLSSDSMH
Sbjct  194   PKRHLLTTGWSVFISAKRLVAGDSVLFIWNDNNQLLLGIRRANRPQTVMPSSVLSSDSMH  253

Query  1315  IGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFETEE  1494
             IGLLAAAAHAA+TNSRFTIFYNPRASPS+FVIPLAKY KAVYHTR+SVGMRFRMLFETEE
Sbjct  254   IGLLAAAAHAASTNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRISVGMRFRMLFETEE  313

Query  1495  SSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYP  1674
             SSVRRYMGTITGISDLDP RWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTT PMY 
Sbjct  314   SSVRRYMGTITGISDLDPARWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTIPMYS  373

Query  1675  SPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPFMQP  1854
             SPF +RLKRPWP+GLPS  G    D+  +S L WLR +  + G QS NF G G+ P+MQP
Sbjct  374   SPFPMRLKRPWPTGLPSLYGGKEDDL--TSSLMWLR-DGANPGFQSFNFGGLGMNPWMQP  430

Query  1855  RLDASMLGLQPDIYQTMAT  1911
             RLD S+LGLQPD+YQ ++ 
Sbjct  431   RLDTSLLGLQPDMYQAISA  449


 Score =   263 bits (673),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 167/358 (47%), Positives = 229/358 (64%), Gaps = 24/358 (7%)
 Frame = +1

Query  2203  RMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMH  2382
             +++ +TQS  S  Q +S+   QQ+F D   N +   N SS   + R F  +  S L ++ 
Sbjct  567   QLSPSTQSPPSIMQTVSAFSQQQNFQDTDINSLSPLNISSMHDVLRPFPSEAGSNLQDVP  626

Query  2383  ETNPLAT---LPSKRIALESQVSSRATPYVVSQADMISPNSKVSDLP--TFLPPFPGKEF  2547
              T P+       SKR+ +ES + SR+    VS  + +  +S  S++P  + L P PG+E 
Sbjct  627   RTTPVPVSDPWSSKRVVMESVIPSRSH-VTVSHIEQL--DSAPSNIPQSSSLAPLPGRES  683

Query  2548  PEYQGVAYSQGNNALLGVNTDS-SILLQNGISNLKNSGG-------ENGFLNMPFSTCNF  2703
                Q       N+ L GVN DS S+L+Q+ I  L+N          +NG   +P+STCNF
Sbjct  684   VVDQDENSDHQNHLLFGVNIDSQSLLMQDDIPGLQNENDCIASLQDDNGSNTIPYSTCNF  743

Query  2704  TSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKF  2883
              S    ++PLN  + +S C+D SG++  SEN DQ N P  TFVKV+KSG+ GR LDI++F
Sbjct  744   LSPSQNNFPLNEALTSSGCLDGSGYVPFSENPDQVNRPPATFVKVYKSGAVGRLLDITRF  803

Query  2884  SSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKIL  3063
             SSYHELRSEL  +FGLEG LEDP RSGWQLVFVDRENDVLL+GDDPWQEFVN+V  IKIL
Sbjct  804   SSYHELRSELGHLFGLEGQLEDPVRSGWQLVFVDRENDVLLVGDDPWQEFVNSVSCIKIL  863

Query  3064  SPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMN-GI-PLGSLDY  3231
             SP EV QMGK +GI+L ++ PA  +RL NG   C+ +VS++E+RN++ GI  +GS+++
Sbjct  864   SPQEVQQMGK-QGIELLSSAPA--RRLGNG---CDNYVSRQESRNLSTGIAAVGSVEF  915



>dbj|BAB85915.1| auxin response factor 6b [Oryza sativa]
Length=880

 Score =   734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/435 (84%), Positives = 390/435 (90%), Gaps = 6/435 (1%)
 Frame = +1

Query  616   GEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAHIPSYPGLPAQ  795
             GE++CLNSELWHACAGPLVSLP + SRVVYFPQGHSEQV ASTNKE+DA IP+YP LP Q
Sbjct  1     GEQRCLNSELWHACAGPLVSLPVVRSRVVYFPQGHSEQVAASTNKEVDAQIPNYPNLPPQ  60

Query  796   LICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPTNYFCKTLTA  975
             LICQLHNVTMHAD ETDEVYAQMTLQPLS +EQK+   LP ELG  SKQPTNYFCKTLTA
Sbjct  61    LICQLHNVTMHADAETDEVYAQMTLQPLSPEEQKEP-FLPMELGAASKQPTNYFCKTLTA  119

Query  976   SDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFRGQPKRHLLT  1155
             SDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NEWKFRH+FRGQPKRHLLT
Sbjct  120   SDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNEWKFRHIFRGQPKRHLLT  179

Query  1156  TGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLLaaa  1335
             TGWSVFVSAKRLVAGD+VIFIWN+NNQLLLGIRRANR QTVMPSSVLSSDSMHIGLLAAA
Sbjct  180   TGWSVFVSAKRLVAGDSVIFIWNDNNQLLLGIRRANRQQTVMPSSVLSSDSMHIGLLAAA  239

Query  1336  ahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFETEESSVRRYM  1515
             AHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMRFRMLFETEESSVRRYM
Sbjct  240   AHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMRFRMLFETEESSVRRYM  299

Query  1516  GTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFSLRL  1695
             GTIT ISDLD VRWPNSHWRSVKVGWDEST G++QPRVSLWEIEPLTTFPMYPS F LRL
Sbjct  300   GTITSISDLDSVRWPNSHWRSVKVGWDESTTGDKQPRVSLWEIEPLTTFPMYPSAFPLRL  359

Query  1696  KRPWPSGLP---SFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPFMQPRLDA  1866
             KRPW SGLP    F G  N D    S L WLR   G++G QSLNFQG+G++P++QPR+D+
Sbjct  360   KRPWASGLPMHGMFNGGGNDDFARYSSLMWLRD--GNRGTQSLNFQGHGVSPWLQPRIDS  417

Query  1867  SMLGLQPDIYQTMAT  1911
              +LGL+PD YQ MA 
Sbjct  418   PLLGLKPDTYQQMAA  432


 Score =   182 bits (463),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 133/341 (39%), Positives = 180/341 (53%), Gaps = 31/341 (9%)
 Frame = +1

Query  2251  SSTVPQQSFSDLVGNHVMTSNNSSTQSLP--------RSFSHDEASQLLNMHETNPLAT-  2403
             S + PQ   S L G+     N     S P         +FS+ EAS LL +  ++ L   
Sbjct  557   SGSAPQAQSSLLSGSSFYNQNLLEGNSDPPLHLHNNFHNFSNQEASNLLILPRSSQLMAS  616

Query  2404  --LPSKRIALESQVSSRATPYVVSQADMISPNSKVSDLPTFLPPFPGKEFPEYQGVAYSQ  2577
                PSKR+ LES V   A P +  + + ++ +  +S  P   PP   +     Q      
Sbjct  617   DGWPSKRLTLESAVHPEA-PSMHPKIEKVN-HQGISHFPGAFPPQSARGCSIVQDCRADA  674

Query  2578  GNNALLGVNTDSSILLQNGISNL-KNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTS  2754
              N  L      SS  LQ+G++++  ++  E   + +P    +     G D      + TS
Sbjct  675   ENRLL-----SSSFELQDGMTSIITDANRETDTMAIPLLRYS-----GADLTTENTLATS  724

Query  2755  SCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLE  2934
             +C+ ESG      N+        TFVKV+KSGS GRSLDIS+FSSY ELRSEL R+FGLE
Sbjct  725   NCLGESGTFNPLNNISVNPSQGATFVKVYKSGSLGRSLDISRFSSYCELRSELERLFGLE  784

Query  2935  GLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLP  3114
             G LEDP RSGWQLVFVDREND+LL+GDDPWQEF N+VW IKILSP EV Q+ +  G D  
Sbjct  785   GQLEDPVRSGWQLVFVDRENDILLVGDDPWQEFANSVWCIKILSPQEVQQLVR--GGDGL  842

Query  3115  NNLPAANQRLPNGGSSCEVHVSQKETRNMNG--IPLGSLDY  3231
              + P A  +  N   +C+ + +    +N+ G    +  LDY
Sbjct  843   LSSPGARMQQSN---ACDDYSASHNMQNIAGNIASVAPLDY  880



>gb|KEH20526.1| auxin response factor 2 [Medicago truncatula]
Length=915

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/448 (81%), Positives = 401/448 (90%), Gaps = 7/448 (2%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S AG +P  +EG  EK+ L+SELWHACAGPLV LP  GSRVVYFPQGHSEQV  STN
Sbjct  1     MKLSSAGFSPPPQEG--EKRVLDSELWHACAGPLVCLPADGSRVVYFPQGHSEQVAVSTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             +E+D +IP+ P LP QLICQLHN+TMHAD ETDEVYAQMTLQPL+ +EQK+   LPAELG
Sbjct  59    REVDTYIPN-PSLPPQLICQLHNLTMHADTETDEVYAQMTLQPLNPEEQKE-AYLPAELG  116

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
               +KQPTNYFCK LTASDTSTHGGFSVPRRAAEKVFPPLD++QQPPAQELIA+DLHGN+W
Sbjct  117   TANKQPTNYFCKILTASDTSTHGGFSVPRRAAEKVFPPLDFTQQPPAQELIARDLHGNDW  176

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KF+H+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA+RPQ +MPS
Sbjct  177   KFKHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRASRPQHMMPS  236

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  237   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  296

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLD VRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  297   FRMLFETEESSVRRYMGTITGISDLDSVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  356

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSF-PGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQ  1824
             PLTTFPMYPSPF LRLKRPWP GLPSF  GL + D  ++SPL WLR    D+G+Q+LNFQ
Sbjct  357   PLTTFPMYPSPFPLRLKRPWPPGLPSFHAGLKDDDFGMNSPLLWLRD--ADRGLQTLNFQ  414

Query  1825  GYGITPFMQPRLDASMLGLQPDIYQTMA  1908
             G G+ P+MQ RLD SM+ +QPD+YQ MA
Sbjct  415   GMGVNPWMQARLDPSMMNMQPDMYQAMA  442


 Score =   265 bits (678),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 174/363 (48%), Positives = 227/363 (63%), Gaps = 25/363 (7%)
 Frame = +1

Query  2176  MSKPITSLPRMNSTTQSQLSH-FQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSH  2352
             MS  ++++ +  S   SQ +   QA+SS   QQ+FSD  GN V     S   ++  SFS+
Sbjct  567   MSNAVSTMSQFVSAPPSQSTQPMQAISSIGHQQNFSDSNGNPV-----SPLHNMLGSFSN  621

Query  2353  DEASQLLNMHETNPLATL------PSKRIALESQVSSRATPYVVSQADMISPN-SKVSDL  2511
             DE S LLN    N    +      PSKR+A++  +SS A+ YV+ Q + +  + + +S  
Sbjct  622   DETSHLLNFPRPNSWVPVQSSTARPSKRVAVDPLLSSGASHYVLPQVEQLGQSQTTMSQN  681

Query  2512  PTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTD-SSILLQNGISNLKNSGGENGFLNMPF  2688
                LPPFPG+E    +G    Q N+ L G N + SS L+ N +SNLK           PF
Sbjct  682   AITLPPFPGREC-AIEGNTDPQ-NHLLFGFNIEPSSHLVYNEMSNLKRVNSNCDSSTAPF  739

Query  2689  STCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSL  2868
              +  + +  G D  LNP  G +  V ESGF+Q+ EN  Q NP N+TFVKV+KSGSFGRSL
Sbjct  740   QSSTYLNTTGADSSLNP--GLTHGVGESGFMQTPENGGQGNPQNKTFVKVYKSGSFGRSL  797

Query  2869  DISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVW  3048
             DI+KFS+Y ELRSELARMFGLEG LEDP RSGWQLVFVD+ENDVLLLGD PW EFVN+VW
Sbjct  798   DITKFSNYPELRSELARMFGLEGELEDPVRSGWQLVFVDQENDVLLLGDGPWPEFVNSVW  857

Query  3049  YIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMNG--IPLGS  3222
              IKILSP EV QMG   G++L N+ P   QRL NG   C+ +  ++++RN++     +GS
Sbjct  858   CIKILSPQEVQQMGT-NGLELLNSAPT--QRLSNG--ICDDYTGREDSRNLSTGLTTVGS  912

Query  3223  LDY  3231
             LDY
Sbjct  913   LDY  915



>ref|XP_002443554.1| hypothetical protein SORBIDRAFT_08g021460 [Sorghum bicolor]
 gb|EES17392.1| hypothetical protein SORBIDRAFT_08g021460 [Sorghum bicolor]
Length=895

 Score =   734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/435 (83%), Positives = 390/435 (90%), Gaps = 3/435 (1%)
 Frame = +1

Query  607   EGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAHIPSYPGL  786
             E  GE++CLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTNKE+DA IP+YP L
Sbjct  14    ESDGEQRCLNSELWHACAGPLVSLPVVGSRVVYFPQGHSEQVAASTNKEVDAQIPNYPNL  73

Query  787   PAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPTNYFCKT  966
             P QLICQLHNVTMHAD ET+EVYAQMTLQPLS +EQK+   LP ELG  SKQPTNYFCKT
Sbjct  74    PPQLICQLHNVTMHADAETEEVYAQMTLQPLSPEEQKEP-FLPIELGAGSKQPTNYFCKT  132

Query  967   LTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFRGQPKRH  1146
             LTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPP QEL+A+DLH NEWKFRH+FRGQPKRH
Sbjct  133   LTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPVQELVARDLHDNEWKFRHIFRGQPKRH  192

Query  1147  LLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLL  1326
             LLTTGWSVFVSAKRLVAGD++IFIWN+NNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLL
Sbjct  193   LLTTGWSVFVSAKRLVAGDSIIFIWNDNNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLL  252

Query  1327  aaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFETEESSVR  1506
             AAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMRFRMLFETEESSVR
Sbjct  253   AAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMRFRMLFETEESSVR  312

Query  1507  RYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFS  1686
             RYMGTITGISDLD  RWPNSHWRSVKVGWDESTAG++QPRVSLWEIEPLTTFPMYP+ F 
Sbjct  313   RYMGTITGISDLDSERWPNSHWRSVKVGWDESTAGDKQPRVSLWEIEPLTTFPMYPTAFP  372

Query  1687  LRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPFMQPRLDA  1866
             LRLKRPW SGLP F G  + +    S L WLR   G++G QSLNFQG G +P++QPR+D 
Sbjct  373   LRLKRPWASGLPMFNGGRSDEFARYSSLMWLRD--GNRGAQSLNFQGLGASPWLQPRIDY  430

Query  1867  SMLGLQPDIYQTMAT  1911
              ++GL+PD YQ MA 
Sbjct  431   PLMGLKPDTYQQMAA  445


 Score =   204 bits (519),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 133/305 (44%), Positives = 182/305 (60%), Gaps = 24/305 (8%)
 Frame = +1

Query  2341  SFSHDEASQLLNMHETNPLAT---LPSKRIALESQVSSRATPYVVSQADMISPNSKVSDL  2511
             +FS  E+S LLN+  +  L      PSKR+A+ES       P V  + + ++  S VS +
Sbjct  607   NFSSQESSNLLNLPRSGQLMASEGWPSKRLAVESLAGHELQP-VQLKLEKVNHQSNVSHV  665

Query  2512  PTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTDSSILLQNGISNLKNSGGENGFLNMPFS  2691
                LPP   ++    Q    +  +N L      SS  + +G+S +++ G  +G   +  +
Sbjct  666   SGTLPPLSARDGSSAQACGTNVQSNLL-----SSSFAIHDGLSTVRSGGVGSGTDAITIA  720

Query  2692  TCNFTSGVGTDYPLNPD--MGTSSCVDESGFLQSSENVDQANPP-NRTFVKVHKSGSFGR  2862
             +  +      D  L P+  + TSSC+ ESG   S ++V   NP    TFVKV+KSGS GR
Sbjct  721   SLRYG-----DMNLLPENSIATSSCLGESGTFNSLDDVCGVNPSQGGTFVKVYKSGSLGR  775

Query  2863  SLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNN  3042
             SLDI++FSSY+ELRSEL R+FGLEG LEDP RSGWQLVFVDREND+LL+GDDPWQEFVN+
Sbjct  776   SLDITRFSSYYELRSELERLFGLEGQLEDPVRSGWQLVFVDRENDILLVGDDPWQEFVNS  835

Query  3043  VWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMNGI--PL  3216
             VW IKILSP +V QM +  G DL   L A   R+    S C+ + +  + +N+ GI  P+
Sbjct  836   VWCIKILSPQDVQQMVRGGG-DL---LSAPGARMLQ-SSVCDDYSAGHDMQNLTGIIAPV  890

Query  3217  GSLDY  3231
               LDY
Sbjct  891   VPLDY  895



>ref|XP_007141982.1| hypothetical protein PHAVU_008G242400g [Phaseolus vulgaris]
 gb|ESW13976.1| hypothetical protein PHAVU_008G242400g [Phaseolus vulgaris]
Length=844

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/437 (83%), Positives = 391/437 (89%), Gaps = 5/437 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S +G+  Q  EG GEKKCLNSELWHACAGPLVSLP  G+RVVYFPQGHSEQV A+TN
Sbjct  1     MKLSTSGLGQQGHEG-GEKKCLNSELWHACAGPLVSLPTAGTRVVYFPQGHSEQVAATTN  59

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             +E+D HIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPL+ QEQKD   LP ELG
Sbjct  60    REVDGHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLTPQEQKDT-FLPMELG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PSKQP+NYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH  EW
Sbjct  119   IPSKQPSNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDVEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNS FT+FYNPRASPS+FVIPL+KY KAVYHTRVSVGMR
Sbjct  239   SVLSSDSMHIGLLAAAAHAAATNSCFTVFYNPRASPSEFVIPLSKYIKAVYHTRVSVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  299   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  358

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LRLKRPW  G  SF    +G    ++ L WLRG  GDQG+ SL+FQG
Sbjct  359   PLTTFPMYPSLFPLRLKRPWHPGTSSF---HDGRDEATNGLIWLRGGPGDQGLNSLSFQG  415

Query  1828  YGITPFMQPRLDASMLG  1878
              G+ P+MQ R+D ++LG
Sbjct  416   SGLLPWMQQRMDPTLLG  432


 Score =   187 bits (475),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 138/220 (63%), Gaps = 27/220 (12%)
 Frame = +1

Query  2581  NNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSS  2757
             N  L GVN DSS +LL   +     +  +     MP     F + +   YP         
Sbjct  649   NPILFGVNIDSSGLLLPTTVPRYTTASADTDASAMPLGESGFQASL---YP---------  696

Query  2758  CV-DESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLE  2934
             CV D S  L+S+  VD  N   RTFVKV+KSGS GRSLDIS+FSSYHELR ELA+MFG+E
Sbjct  697   CVQDSSELLRSAGQVDPQNQ-TRTFVKVYKSGSVGRSLDISRFSSYHELREELAQMFGIE  755

Query  2935  GLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLP  3114
             G LEDP RSGWQLVFVDRENDVLLLGDDPW+ FVNNVWYIKILSP ++ +MG++    L 
Sbjct  756   GKLEDPLRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDIQKMGEQAVESLG  815

Query  3115  NNLPAANQRLPNGGSSCEVHVSQKETRNMNGIP-LGSLDY  3231
                P++ QRL + G+     VS        G+P +GSL+Y
Sbjct  816   ---PSSGQRLNSTGADSHEIVS--------GLPSIGSLEY  844



>ref|XP_010233862.1| PREDICTED: auxin response factor 6-like isoform X3 [Brachypodium 
distachyon]
Length=913

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/431 (83%), Positives = 389/431 (90%), Gaps = 4/431 (1%)
 Frame = +1

Query  619   EKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAHIPSYPGLPAQL  798
             E KCLNSELWHACAGPLVSLP +GSRV+YFPQGHSEQV+ASTNKEI++ IP+YP LP QL
Sbjct  21    EHKCLNSELWHACAGPLVSLPAVGSRVLYFPQGHSEQVSASTNKEIESQIPNYPNLPPQL  80

Query  799   ICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPTNYFCKTLTAS  978
             ICQLHNV MHAD ETDEV AQMTLQPLS QE KD   LPAELG  +KQPTNYFCKTLTAS
Sbjct  81    ICQLHNVIMHADAETDEVCAQMTLQPLSPQELKDP-FLPAELGTANKQPTNYFCKTLTAS  139

Query  979   DTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFRGQPKRHLLTT  1158
             DTSTHGGFSVPRRAAEKVFPPLD++QQPPAQEL+AKDLHGNEWKFRH+FRGQPKRHLLTT
Sbjct  140   DTSTHGGFSVPRRAAEKVFPPLDFTQQPPAQELMAKDLHGNEWKFRHIFRGQPKRHLLTT  199

Query  1159  GWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLLaaaa  1338
             GWSVF+SAKRLVAGD+V+FIWN+NNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLLAAAA
Sbjct  200   GWSVFISAKRLVAGDSVLFIWNDNNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLLAAAA  259

Query  1339  haaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFETEESSVRRYMG  1518
             HAA+TNSRFTIFYNPRASPS+FVIPLAKY KAVYHTR+SVGMRFRMLFETEESSVRRYMG
Sbjct  260   HAASTNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRISVGMRFRMLFETEESSVRRYMG  319

Query  1519  TITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFSLRLK  1698
             TITGISDLDP RWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTT PMY SPF +RLK
Sbjct  320   TITGISDLDPARWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTIPMYSSPFPMRLK  379

Query  1699  RPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPFMQPRLDASMLG  1878
             RPWP+GLPS  G    D+  +S L WLR +  + G QS NF G G+ P+MQPRLD S+LG
Sbjct  380   RPWPTGLPSLYGGKEDDL--TSSLMWLR-DGANPGFQSFNFGGLGMNPWMQPRLDTSLLG  436

Query  1879  LQPDIYQTMAT  1911
             LQPD+YQ ++ 
Sbjct  437   LQPDMYQAISA  447


 Score =   263 bits (673),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 167/358 (47%), Positives = 229/358 (64%), Gaps = 24/358 (7%)
 Frame = +1

Query  2203  RMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMH  2382
             +++ +TQS  S  Q +S+   QQ+F D   N +   N SS   + R F  +  S L ++ 
Sbjct  565   QLSPSTQSPPSIMQTVSAFSQQQNFQDTDINSLSPLNISSMHDVLRPFPSEAGSNLQDVP  624

Query  2383  ETNPLAT---LPSKRIALESQVSSRATPYVVSQADMISPNSKVSDLP--TFLPPFPGKEF  2547
              T P+       SKR+ +ES + SR+    VS  + +  +S  S++P  + L P PG+E 
Sbjct  625   RTTPVPVSDPWSSKRVVMESVIPSRSH-VTVSHIEQL--DSAPSNIPQSSSLAPLPGRES  681

Query  2548  PEYQGVAYSQGNNALLGVNTDS-SILLQNGISNLKNSGG-------ENGFLNMPFSTCNF  2703
                Q       N+ L GVN DS S+L+Q+ I  L+N          +NG   +P+STCNF
Sbjct  682   VVDQDENSDHQNHLLFGVNIDSQSLLMQDDIPGLQNENDCIASLQDDNGSNTIPYSTCNF  741

Query  2704  TSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKF  2883
              S    ++PLN  + +S C+D SG++  SEN DQ N P  TFVKV+KSG+ GR LDI++F
Sbjct  742   LSPSQNNFPLNEALTSSGCLDGSGYVPFSENPDQVNRPPATFVKVYKSGAVGRLLDITRF  801

Query  2884  SSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKIL  3063
             SSYHELRSEL  +FGLEG LEDP RSGWQLVFVDRENDVLL+GDDPWQEFVN+V  IKIL
Sbjct  802   SSYHELRSELGHLFGLEGQLEDPVRSGWQLVFVDRENDVLLVGDDPWQEFVNSVSCIKIL  861

Query  3064  SPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMN-GI-PLGSLDY  3231
             SP EV QMGK +GI+L ++ PA  +RL NG   C+ +VS++E+RN++ GI  +GS+++
Sbjct  862   SPQEVQQMGK-QGIELLSSAPA--RRLGNG---CDNYVSRQESRNLSTGIAAVGSVEF  913



>emb|CBI27334.3| unnamed protein product [Vitis vinifera]
Length=486

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/438 (82%), Positives = 387/438 (88%), Gaps = 6/438 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S +G+  Q +   GEKKCLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV A+TN
Sbjct  1     MKLSTSGLG-QQQGHEGEKKCLNSELWHACAGPLVSLPTVGSRVVYFPQGHSEQVAATTN  59

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+D HIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPL+ QEQKD   LP ELG
Sbjct  60    KEVDGHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLTPQEQKDT-FLPVELG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH  EW
Sbjct  119   IPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDVEW  178

Query  1108  KFRHVFRG-QPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMP  1284
             KFRH+FRG QPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA RPQTVMP
Sbjct  179   KFRHIFRGRQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRATRPQTVMP  238

Query  1285  SSVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGM  1464
             SSVLSSDSMHIGLLAAAAHAAATNS FTIFYNPRASPS+FVIPL+KY KAV+HTRVSVGM
Sbjct  239   SSVLSSDSMHIGLLAAAAHAAATNSCFTIFYNPRASPSEFVIPLSKYVKAVFHTRVSVGM  298

Query  1465  RFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEI  1644
             RFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEI
Sbjct  299   RFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEI  358

Query  1645  EPLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQ  1824
             EPLTTFPMYPS F LRLKRPW  G  S   L +     ++ L WLRG  GDQG+QSLNFQ
Sbjct  359   EPLTTFPMYPSLFPLRLKRPWHPGASS---LHDSRDEAANGLMWLRGETGDQGLQSLNFQ  415

Query  1825  GYGITPFMQPRLDASMLG  1878
               G+ P+ Q RLD + LG
Sbjct  416   TVGMFPWTQQRLDPTFLG  433



>ref|XP_008662061.1| PREDICTED: auxin response factor 25-like [Zea mays]
 tpg|DAA47508.1| TPA: hypothetical protein ZEAMMB73_035781 [Zea mays]
Length=897

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/435 (83%), Positives = 389/435 (89%), Gaps = 3/435 (1%)
 Frame = +1

Query  607   EGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAHIPSYPGL  786
             E  GE++CLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTNKE+DA IP+YP L
Sbjct  14    ESDGEQRCLNSELWHACAGPLVSLPVVGSRVVYFPQGHSEQVAASTNKEVDAQIPNYPNL  73

Query  787   PAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPTNYFCKT  966
             P QLICQLHNVTMHAD ET+EVYAQMTLQPLS +EQKD   LP ELG  SKQPTNYFCKT
Sbjct  74    PPQLICQLHNVTMHADAETEEVYAQMTLQPLSPEEQKDP-FLPIELGAGSKQPTNYFCKT  132

Query  967   LTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFRGQPKRH  1146
             LTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPP QEL+A+DLH NEWKFRH+FRGQPKRH
Sbjct  133   LTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPVQELVARDLHDNEWKFRHIFRGQPKRH  192

Query  1147  LLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLL  1326
             LLTTGWSVFVSAKRLVAGD++IFIWN+NNQLLLGIRRA+RPQTVMPSSVLSSDSMHIGLL
Sbjct  193   LLTTGWSVFVSAKRLVAGDSIIFIWNDNNQLLLGIRRASRPQTVMPSSVLSSDSMHIGLL  252

Query  1327  aaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFETEESSVR  1506
             AAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMRFRMLFETEESSVR
Sbjct  253   AAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMRFRMLFETEESSVR  312

Query  1507  RYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFS  1686
             RYMGTITGISDLD  RWPNSHWRSVKVGWDESTAG++QPRVSLWEIEPLTTFPMYP+ F 
Sbjct  313   RYMGTITGISDLDSERWPNSHWRSVKVGWDESTAGDKQPRVSLWEIEPLTTFPMYPTAFP  372

Query  1687  LRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPFMQPRLDA  1866
             LRLKRPW SGLP F G  + +    S L WLR   G++G QSLNFQG G +P++QPR+D 
Sbjct  373   LRLKRPWASGLPMFNGGRSDEFARYSSLMWLRD--GNRGAQSLNFQGLGASPWLQPRIDN  430

Query  1867  SMLGLQPDIYQTMAT  1911
              +L L+PD YQ MA 
Sbjct  431   PLLSLKPDTYQQMAA  445


 Score =   201 bits (511),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 130/305 (43%), Positives = 179/305 (59%), Gaps = 23/305 (8%)
 Frame = +1

Query  2341  SFSHDEASQLLNMHETNPLAT---LPSKRIALESQVSSRATPYVVSQADMISPNSKVSDL  2511
             +FS  E+S LLN+  +  L      PSKR+A+ES       P +  + + +S  S VS  
Sbjct  608   NFSSQESSNLLNLPRSGQLMASEGWPSKRLAVESLAGHEIQP-LQHKLEKVSHQSTVSHC  666

Query  2512  PTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTDSSILLQNGISNLKNSGGENGFLNMPFS  2691
                LPP   ++    Q    +  ++ L      SS  + +G+S +++ G  +G   +  +
Sbjct  667   SGTLPPLSARDGSSAQACGTNVQSHLL-----PSSFAIHDGLSTIRSGGVGSGTDAITIA  721

Query  2692  TCNFTSGVGTDYPLNPD--MGTSSCVDESGFLQSSENVDQANPP-NRTFVKVHKSGSFGR  2862
             +  ++     D  L P+  + TSSC+ ESG   S ++V   NP    TFVKV+KSGS GR
Sbjct  722   SLRYS-----DANLLPENSIATSSCLGESGTFNSLDDVCGVNPSQGGTFVKVYKSGSLGR  776

Query  2863  SLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNN  3042
             SLDI++F SY+ELR EL R+FGLEG LEDP RSGWQLVFVDRENDVLLLGDDPWQEFVN+
Sbjct  777   SLDITRFGSYYELRVELERLFGLEGQLEDPARSGWQLVFVDRENDVLLLGDDPWQEFVNS  836

Query  3043  VWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMNG--IPL  3216
             V  IKILSP ++ QM +  G DL   L A   R+   GS C+ + +  + +N+ G   P+
Sbjct  837   VGCIKILSPQDLQQMARGGGGDL---LSAPGARMLQ-GSVCDDYSAGHDVQNLTGSIAPV  892

Query  3217  GSLDY  3231
               LDY
Sbjct  893   VPLDY  897



>emb|CDY12048.1| BnaC03g59640D [Brassica napus]
Length=847

 Score =   731 bits (1886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/447 (83%), Positives = 399/447 (89%), Gaps = 15/447 (3%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG NP   EG  EK+ LNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSAGFNPHPHEG--EKRVLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAH P+YP L  QLICQLHNVTMHAD ETDEVYAQMTLQPL+ QEQKD   L AELG
Sbjct  59    KEVDAHTPNYPSLQPQLICQLHNVTMHADVETDEVYAQMTLQPLNGQEQKD-PYLAAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PS+QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDY+QQPPAQEL+A+DLH NEW
Sbjct  118   VPSRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYTQQPPAQELMARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+ NQLLLGIRRA+RPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDKNQLLLGIRRAHRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAA+TNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAASTNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGI DLDP RW NSHWRSVKVGWDESTAG+RQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGICDLDPARWANSHWRSVKVGWDESTAGDRQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGD----MHISSPLSWLRGNMGDQGIQSL  1815
             PLTTFPMYPSPF LRLKRPWPSGLPSF GL   D    M +SSPL W      D+G+Q +
Sbjct  358   PLTTFPMYPSPFPLRLKRPWPSGLPSFHGLKEDDMGMGMGMSSPLMW------DRGLQPM  411

Query  1816  NFQGYGITPFMQPR-LDAS-MLGLQPD  1890
             NFQG G+ P+MQPR LDAS +LG+Q D
Sbjct  412   NFQGMGVNPWMQPRPLDASGLLGMQND  438


 Score =   239 bits (610),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 176/353 (50%), Positives = 222/353 (63%), Gaps = 46/353 (13%)
 Frame = +1

Query  2233  SHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQ--SLPRSFSHDEASQLLNMHETNPLAT-  2403
             S  Q+++    QQSFSD  G      NN  TQ  +L  +F  DE+SQLLN+  TN   T 
Sbjct  521   SLLQSMTPLCHQQSFSDTNG-----GNNPITQLHTLLSNFPQDESSQLLNLTRTNSAMTS  575

Query  2404  --LPSKRIALESQVSSRATPYVVSQADM----ISPNSKVSDLPTFLPPFP-GKEFPEYQG  2562
                PSKR A++S     +T    +Q+ M     S  S VS     LPPFP G+E  E   
Sbjct  576   SGWPSKRPAIDSSFQ-HSTAVNNNQSVMEQLGQSHTSNVSPNAVSLPPFPSGQE--ENPS  632

Query  2563  VAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENG-FLNMPFSTCNFT---SGVGTDY  2727
               +S   + L GVN DSS +L+ NG+SNL++ G E G    +PF++  F    SG  T  
Sbjct  633   DPHS---HLLFGVNIDSSSLLIPNGMSNLRSIGIEGGDSTTLPFTSSTFNNEFSGTMTT-  688

Query  2728  PLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRS  2907
                     SSC++E GFLQ SEN  Q+N    TFVKVHKSGSFGRSLDI+KFSSY+ELRS
Sbjct  689   -------PSSCIEEQGFLQPSEN-QQSN----TFVKVHKSGSFGRSLDITKFSSYNELRS  736

Query  2908  ELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQM  3087
             ELARMFGLEG LEDP RSGWQLVFVDRENDVLLLGDDPW EFV++VW IKILSP EV QM
Sbjct  737   ELARMFGLEGQLEDPVRSGWQLVFVDRENDVLLLGDDPWPEFVSSVWCIKILSPQEVQQM  796

Query  3088  GKEEGIDLPNNLPAAN--QRLPNGGSSCEVHVSQKETRNM-NGIPL--GSLDY  3231
             GK  G++L N+ P++    ++P+ G +C+   ++ + R++ NGI    GS +Y
Sbjct  797   GK-RGLELLNSAPSSTNVDKVPSNG-NCDDLGNRSDPRSLGNGIASVGGSFNY  847



>gb|AIB05454.1| ARF transcription factor, partial [Zea mays]
Length=897

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/435 (83%), Positives = 389/435 (89%), Gaps = 3/435 (1%)
 Frame = +1

Query  607   EGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAHIPSYPGL  786
             E  GE++CLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTNKE+DA IP+YP L
Sbjct  14    ESDGEQRCLNSELWHACAGPLVSLPVVGSRVVYFPQGHSEQVAASTNKEVDAQIPNYPNL  73

Query  787   PAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPTNYFCKT  966
             P QLICQLHNVTMHAD ET+EVYAQMTLQPLS +EQKD   LP ELG  SKQPTNYFCKT
Sbjct  74    PPQLICQLHNVTMHADAETEEVYAQMTLQPLSPEEQKDP-FLPIELGAGSKQPTNYFCKT  132

Query  967   LTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFRGQPKRH  1146
             LTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPP QEL+A+DLH NEWKFRH+FRGQPKRH
Sbjct  133   LTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPVQELVARDLHDNEWKFRHIFRGQPKRH  192

Query  1147  LLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLL  1326
             LLTTGWSVFVSAKRLVAGD++IFIWN+NNQLLLGIRRA+RPQTVMPSSVLSSDSMHIGLL
Sbjct  193   LLTTGWSVFVSAKRLVAGDSIIFIWNDNNQLLLGIRRASRPQTVMPSSVLSSDSMHIGLL  252

Query  1327  aaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFETEESSVR  1506
             AAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMRFRMLFETEESSVR
Sbjct  253   AAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMRFRMLFETEESSVR  312

Query  1507  RYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFS  1686
             RYMGTITGISDLD  RWPNSHWRSVKVGWDESTAG++QPRVSLWEIEPLTTFPMYP+ F 
Sbjct  313   RYMGTITGISDLDSERWPNSHWRSVKVGWDESTAGDKQPRVSLWEIEPLTTFPMYPTAFP  372

Query  1687  LRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPFMQPRLDA  1866
             LRLKRPW SGLP F G  + +    S L WLR   G++G QSLNFQG G +P++QPR+D 
Sbjct  373   LRLKRPWASGLPMFNGGRSDEFARYSSLMWLRD--GNRGAQSLNFQGLGASPWLQPRIDY  430

Query  1867  SMLGLQPDIYQTMAT  1911
              +L L+PD YQ MA 
Sbjct  431   PLLSLKPDTYQQMAA  445


 Score =   201 bits (511),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 130/305 (43%), Positives = 179/305 (59%), Gaps = 23/305 (8%)
 Frame = +1

Query  2341  SFSHDEASQLLNMHETNPLAT---LPSKRIALESQVSSRATPYVVSQADMISPNSKVSDL  2511
             +FS  E+S LLN+  +  L      PSKR+A+ES       P +  + + +S  S VS  
Sbjct  608   NFSSQESSNLLNLPRSGQLMASEGWPSKRLAVESLAGHEIQP-LQHKLEKVSHQSTVSHC  666

Query  2512  PTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTDSSILLQNGISNLKNSGGENGFLNMPFS  2691
                LPP   ++    Q    +  ++ L      SS  + +G+S +++ G  +G   +  +
Sbjct  667   SGTLPPLSARDGSSAQACGTNVQSHLL-----PSSFAIHDGLSTIRSGGVGSGTDAITIA  721

Query  2692  TCNFTSGVGTDYPLNPD--MGTSSCVDESGFLQSSENVDQANPP-NRTFVKVHKSGSFGR  2862
             +  ++     D  L P+  + TSSC+ ESG   S ++V   NP    TFVKV+KSGS GR
Sbjct  722   SLRYS-----DANLLPENSIATSSCLGESGTFNSLDDVCGVNPSQGGTFVKVYKSGSLGR  776

Query  2863  SLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNN  3042
             SLDI++F SY+ELR EL R+FGLEG LEDP RSGWQLVFVDRENDVLLLGDDPWQEFVN+
Sbjct  777   SLDITRFGSYYELRVELERLFGLEGQLEDPARSGWQLVFVDRENDVLLLGDDPWQEFVNS  836

Query  3043  VWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMNG--IPL  3216
             V  IKILSP ++ QM +  G DL   L A   R+   GS C+ + +  + +N+ G   P+
Sbjct  837   VGCIKILSPQDLQQMARGGGGDL---LSAPGARMLQ-GSVCDDYSAGHDVQNLTGSIAPV  892

Query  3217  GSLDY  3231
               LDY
Sbjct  893   VPLDY  897



>dbj|BAK00026.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=891

 Score =   732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/439 (82%), Positives = 389/439 (89%), Gaps = 7/439 (2%)
 Frame = +1

Query  607   EGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAHIPSYPGL  786
             E  GE++CLNSELWHACAGPLVSLP +GSRV+YFPQGHSEQV ASTNKE+DA IP+YP L
Sbjct  16    ENDGEQRCLNSELWHACAGPLVSLPAVGSRVIYFPQGHSEQVAASTNKEVDAQIPNYPNL  75

Query  787   PAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPTNYFCKT  966
             P QLICQLHNVTMHAD ETDEVYAQMTLQPLS +EQK+   LP ELG  SKQPTNYFCKT
Sbjct  76    PPQLICQLHNVTMHADAETDEVYAQMTLQPLSPEEQKEP-FLPIELGAASKQPTNYFCKT  134

Query  967   LTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFRGQPKRH  1146
             LTASDTSTHGGFSVPRR+AEKVFPPLD+S QPP QELIAKDLH NEWKFRH+FRGQPKRH
Sbjct  135   LTASDTSTHGGFSVPRRSAEKVFPPLDFSLQPPCQELIAKDLHDNEWKFRHIFRGQPKRH  194

Query  1147  LLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLL  1326
             LLTTGWSVFVSAKRLVAGD+VIFIWN+NNQLLLGIR ANRPQTVMPSSVLSSDSMHIGLL
Sbjct  195   LLTTGWSVFVSAKRLVAGDSVIFIWNDNNQLLLGIRHANRPQTVMPSSVLSSDSMHIGLL  254

Query  1327  aaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFETEESSVR  1506
             AAAAHAAATNSRFTIFYNPRASPS+F+IPLAKY K+VYHTRVSVGMRFRMLFETEESSVR
Sbjct  255   AAAAHAAATNSRFTIFYNPRASPSEFIIPLAKYVKSVYHTRVSVGMRFRMLFETEESSVR  314

Query  1507  RYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFS  1686
             RYMGTIT ISDLD  RWPNSHWRSVKVGWDESTAGE+QPRVSLWEIEPLTTFPMYP+ F 
Sbjct  315   RYMGTITTISDLDSARWPNSHWRSVKVGWDESTAGEKQPRVSLWEIEPLTTFPMYPTAFP  374

Query  1687  LRLKRPWPSGLPS----FPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPFMQP  1854
             LRLKRPW SG+PS    F G+ N D    S L WL    GD+G QSLNFQG G +P++QP
Sbjct  375   LRLKRPWASGMPSMHGMFNGVKNDDFARYSSLMWL--GDGDRGAQSLNFQGVGASPWLQP  432

Query  1855  RLDASMLGLQPDIYQTMAT  1911
             R+D+ +LGL+PD YQ MA 
Sbjct  433   RIDSPLLGLKPDTYQQMAA  451


 Score =   185 bits (470),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 127/306 (42%), Positives = 178/306 (58%), Gaps = 24/306 (8%)
 Frame = +1

Query  2338  RSFSHDEASQLLNMHETNPLAT---LPSKRIALE--SQVSSRATPYVVSQADMISPNSKV  2502
             R+FS  +AS L+++  T+ L      PSKR+A+E    + SR+   V  + + ++  S +
Sbjct  602   RNFSSQDASNLVSLPRTDQLMAPEGWPSKRLAVEPLGHIESRS---VQPKHENVNHQSNI  658

Query  2503  SDLPTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTDSSILLQNGISNLKNSGGENGFLNM  2682
             S     L P   ++    Q    +  N+ L      SS   Q+G++  +  G  +G ++M
Sbjct  659   SHFAGTLAPQSARDSSSVQAYVANVDNHFL-----SSSFAFQDGMAGARG-GSSSGTVSM  712

Query  2683  PFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPP-NRTFVKVHKSGSFG  2859
                   ++   G D P    + TSSC+ ESG   S +N+   +P  +  FVKV KSGS G
Sbjct  713   AIPLLRYS---GEDLPPADTLATSSCLGESGTFNSLDNMCGVDPSQDGIFVKVCKSGSPG  769

Query  2860  RSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVN  3039
             RSLDI+KFSSY+ELRSEL  +FGLEG LEDP RSGWQLVFVDREND+LL+GDDPWQEFVN
Sbjct  770   RSLDITKFSSYYELRSELEHLFGLEGQLEDPVRSGWQLVFVDRENDILLVGDDPWQEFVN  829

Query  3040  NVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMNG--IP  3213
             +V  IKILSP EV +M +  G  L ++ P A  R+   G  C+ +    + +N+ G    
Sbjct  830   SVGCIKILSPQEVQRMVR-GGEGLLSSAPGA--RMAQ-GDVCDGYSGGHDLQNLTGSMAS  885

Query  3214  LGSLDY  3231
             + SLDY
Sbjct  886   VPSLDY  891



>ref|XP_006596491.1| PREDICTED: auxin response factor 8-like [Glycine max]
Length=843

 Score =   730 bits (1885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/437 (82%), Positives = 390/437 (89%), Gaps = 5/437 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S +G+  Q  EG GEKKCLNSELWHACAGPLVSLP  G+RVVYFPQGHSEQV A+TN
Sbjct  1     MKLSTSGLGQQGHEG-GEKKCLNSELWHACAGPLVSLPTAGTRVVYFPQGHSEQVAATTN  59

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             +E+D HIP+YP LP QL+CQLHNVTMHAD ETDEVYAQMTLQPL+ QEQKD   LP ELG
Sbjct  60    REVDGHIPNYPSLPPQLVCQLHNVTMHADVETDEVYAQMTLQPLTPQEQKDT-FLPMELG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PSKQP+NYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH  EW
Sbjct  119   VPSKQPSNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDVEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNS FT+FYNPRASPS+FVIPL+KY KAVYHTRVSVGMR
Sbjct  239   SVLSSDSMHIGLLAAAAHAAATNSCFTVFYNPRASPSEFVIPLSKYIKAVYHTRVSVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  299   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  358

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LRLKRPW  G  SF    +G    ++ L WLRG  GDQ + SLNFQG
Sbjct  359   PLTTFPMYPSLFPLRLKRPWHPGTSSF---HDGRDEATNGLMWLRGGPGDQALNSLNFQG  415

Query  1828  YGITPFMQPRLDASMLG  1878
              G+ P+MQ R+D ++LG
Sbjct  416   SGLLPWMQQRMDPTLLG  432


 Score =   190 bits (482),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 116/220 (53%), Positives = 138/220 (63%), Gaps = 27/220 (12%)
 Frame = +1

Query  2581  NNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSS  2757
             N  L GVN DSS +LL   +     +  E     MP     F S      PL P      
Sbjct  648   NPILFGVNIDSSGLLLPTTVPRYTTASAEIDASAMPIGESGFQS------PLYP------  695

Query  2758  CV-DESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLE  2934
             CV D S  +QS+  VD  N   RTFVKV+KSGS GRSLDIS+FSSYHELR ELA+MFG+E
Sbjct  696   CVQDSSELVQSAGQVDPQNQ-TRTFVKVYKSGSVGRSLDISRFSSYHELREELAQMFGIE  754

Query  2935  GLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLP  3114
             G LEDP RSGWQLVFVDRENDVLLLGDDPW+ FVNNVWYIKILSP ++H+MG++    L 
Sbjct  755   GKLEDPLRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDIHKMGEQAVESLG  814

Query  3115  NNLPAANQRLPNGGSSCEVHVSQKETRNMNGIP-LGSLDY  3231
                P++  RL + G+     VS        G+P +GSL+Y
Sbjct  815   ---PSSGHRLNSTGADSHEIVS--------GLPSIGSLEY  843



>gb|ABF69979.1| transcriptional factor B3 family protein [Musa acuminata]
Length=898

 Score =   731 bits (1888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/433 (83%), Positives = 388/433 (90%), Gaps = 13/433 (3%)
 Frame = +1

Query  613   TGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAHIPSYPGLPA  792
             T E +CLNSELWHACAGPLVSLP +GSRV            ASTNKE+D+ IP+YP LP 
Sbjct  14    TEEPRCLNSELWHACAGPLVSLPAVGSRVA-----------ASTNKEVDSQIPNYPSLPP  62

Query  793   QLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPTNYFCKTLT  972
             QLICQLHNVTMHAD ETDEVYAQMTLQPLSAQEQKD   LPA+LG PSKQPTNYFCKTLT
Sbjct  63    QLICQLHNVTMHADVETDEVYAQMTLQPLSAQEQKD-PYLPADLGTPSKQPTNYFCKTLT  121

Query  973   ASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFRGQPKRHLL  1152
             ASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQEL+A+DLHGNEWKFRH+FRGQPKRHLL
Sbjct  122   ASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELVARDLHGNEWKFRHIFRGQPKRHLL  181

Query  1153  TTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLLaa  1332
             TTGWSVFVSAKRLVAGD+V+FIWNENNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLLAA
Sbjct  182   TTGWSVFVSAKRLVAGDSVLFIWNENNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLLAA  241

Query  1333  aahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFETEESSVRRY  1512
             AAHAAATNSRFTIFYNPRASPS+FVIPL KY KAVYHTRVSVGMRFRMLFETEESSVRRY
Sbjct  242   AAHAAATNSRFTIFYNPRASPSEFVIPLTKYVKAVYHTRVSVGMRFRMLFETEESSVRRY  301

Query  1513  MGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFSLR  1692
             MGTITGISDLDPVRWPNSHWRSVKVGWDESTAGE+QPRVSLWEIEPLTTFPMYPS F LR
Sbjct  302   MGTITGISDLDPVRWPNSHWRSVKVGWDESTAGEKQPRVSLWEIEPLTTFPMYPSSFPLR  361

Query  1693  LKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPFMQPRLDASM  1872
              KRPWP+GLP F G  + +  ++SPL WLR + G+  +QSLNFQG G+TP+MQPRL  SM
Sbjct  362   FKRPWPTGLPFFHGGRDDEFSLNSPLMWLR-DGGNPALQSLNFQGVGVTPWMQPRLGTSM  420

Query  1873  LGLQPDIYQTMAT  1911
             L LQPD++QT+A 
Sbjct  421   LALQPDMHQTVAA  433


 Score =   275 bits (702),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 163/330 (49%), Positives = 212/330 (64%), Gaps = 17/330 (5%)
 Frame = +1

Query  2269  QSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNM-HETNPLATLP--SKRIALESQV  2439
             + F D  GN V  S+ S   ++    S +E SQLL++     P+ + P  SKRIA+ES +
Sbjct  577   KDFPDSNGNSVSASSVSPLDNILHQISPEETSQLLSLPRYAQPVTSNPWSSKRIAVESML  636

Query  2440  SSRATPYVVSQADMIS---PNSKVSDLPTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTD  2610
              S A   V+SQ + I    PN  +  +   LPPFPG+E    Q       N  + GVN D
Sbjct  637   PSGAQ-SVLSQVEQIGSGQPNIPLQSV--VLPPFPGRECSMNQDGNMDIQNQHMFGVNID  693

Query  2611  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  2790
             SSI +QNGI +L          N+P++ CN     G D+P+N  +  S+ +DESG LQS+
Sbjct  694   SSISVQNGIRSLGTGVNGTNSTNIPYAACNLLRSAGNDFPINQAVNGSNGLDESGLLQST  753

Query  2791  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  2970
             ENVD+ N  + TFVKV+KSGSFGRSLDI++FSSYHELRSEL  +FGLEG LEDP RSGWQ
Sbjct  754   ENVDRVNSQSGTFVKVYKSGSFGRSLDITRFSSYHELRSELGHLFGLEGQLEDPLRSGWQ  813

Query  2971  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  3150
             LVFVDRE+DVLL+GDDPWQEFVN+V  IKILSP EV QMGK +G+D  N+ P   +RL +
Sbjct  814   LVFVDREDDVLLVGDDPWQEFVNSVSCIKILSPEEVQQMGK-QGVDFVNSAPI--KRLQS  870

Query  3151  GGSSCEVHVSQKETRNMNG---IPLGSLDY  3231
              G  C+ +VSQ+ +RN++      +GS  Y
Sbjct  871   NG--CDDYVSQQHSRNLSAARITSVGSFKY  898



>ref|XP_010250595.1| PREDICTED: auxin response factor 8 isoform X1 [Nelumbo nucifera]
 ref|XP_010250602.1| PREDICTED: auxin response factor 8 isoform X1 [Nelumbo nucifera]
Length=844

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/448 (81%), Positives = 400/448 (89%), Gaps = 7/448 (2%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S +G+  Q +EG  +K+CLNSELWHACAGPLVSLP +G+RVVYFPQGHSEQV ASTN
Sbjct  1     MKLSTSGMVQQGQEG--QKRCLNSELWHACAGPLVSLPTVGTRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+D+HIP+YP LP QLICQLH+VTMHAD ETDEVYAQMTLQPL+ +EQK+   LPAELG
Sbjct  59    KEVDSHIPNYPNLPPQLICQLHDVTMHADVETDEVYAQMTLQPLTPEEQKET-YLPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH  EW
Sbjct  118   VPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDVEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPL+K+ KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLSKFVKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDP RWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDPARWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LRLKRPW  G+ S   L +    +++ L WLRG  G++G+QSLNFQ 
Sbjct  358   PLTTFPMYPSLFPLRLKRPWHPGVSS---LHDNKDDVANGLMWLRGETGERGLQSLNFQA  414

Query  1828  YGITPFMQPRLDASMLGLQPD-IYQTMA  1908
              G++P+M  R+D S+LG + D  Y  MA
Sbjct  415   LGVSPWMHQRVDTSLLGNEHDHQYHNMA  442


 Score =   191 bits (484),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 120/244 (49%), Positives = 148/244 (61%), Gaps = 30/244 (12%)
 Frame = +1

Query  2512  PTFLPPFPGKEFP-EYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMP  2685
             P  LP FP K    +    +    N+ L GVN DSS +LL   + NL +S  E    +MP
Sbjct  627   PVPLPTFPVKGGAVDLDNCSGDPQNHTLFGVNIDSSPLLLPTSVPNLGSSSVEPDVSSMP  686

Query  2686  FSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRS  2865
             F    F + +              C++ S  L +S    Q +PP RTFVKV+KSGS GRS
Sbjct  687   FGGSGFQNSL------------YGCMENSSDLLNS--AGQVDPPTRTFVKVYKSGSVGRS  732

Query  2866  LDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNV  3045
             LDIS+FSSYHELR EL +MFG+E  LEDP RSGWQLVFVDRENDVLLLGDDPW+ FVNNV
Sbjct  733   LDISRFSSYHELREELGQMFGIEEQLEDPLRSGWQLVFVDRENDVLLLGDDPWESFVNNV  792

Query  3046  WYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNM-NGI-PLG  3219
             WYIKILSP +V ++GK+E   L +N    +QR  N         S  + RN  +GI  +G
Sbjct  793   WYIKILSPEDVQKLGKQEVDALSSN---GDQRHSN---------SSYDVRNFTSGISSVG  840

Query  3220  SLDY  3231
             SL+Y
Sbjct  841   SLEY  844



>ref|XP_010237021.1| PREDICTED: auxin response factor 25-like [Brachypodium distachyon]
Length=886

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/439 (82%), Positives = 391/439 (89%), Gaps = 7/439 (2%)
 Frame = +1

Query  607   EGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAHIPSYPGL  786
             E  GE++CLNSELWHACAGPLVSLP +GSRV+YFPQGHSEQV ASTNKE+D  IP+YP L
Sbjct  7     ENDGEQRCLNSELWHACAGPLVSLPVVGSRVIYFPQGHSEQVAASTNKEVDGQIPNYPNL  66

Query  787   PAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPTNYFCKT  966
             P QLICQLHNVTMHAD ETDEVYAQMTLQPLS +EQK+   LP ELG  SKQPTNYFCKT
Sbjct  67    PPQLICQLHNVTMHADVETDEVYAQMTLQPLSPEEQKEP-FLPIELGAASKQPTNYFCKT  125

Query  967   LTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFRGQPKRH  1146
             LTASDTSTHGGFSVPRR+AEKVFPPLD+S QPP QELIA+DLH NEWKFRH+FRGQPKRH
Sbjct  126   LTASDTSTHGGFSVPRRSAEKVFPPLDFSLQPPCQELIARDLHDNEWKFRHIFRGQPKRH  185

Query  1147  LLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLL  1326
             LLTTGWSVFVSAKRLVAGD+VIFIWN+NNQLLLGIR ANRPQT+MPSSVLSSDSMHIGLL
Sbjct  186   LLTTGWSVFVSAKRLVAGDSVIFIWNDNNQLLLGIRHANRPQTIMPSSVLSSDSMHIGLL  245

Query  1327  aaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFETEESSVR  1506
             AAAAHAAATNSRFTIFYNPR+SPS+FVIPLAKY K+VYHTRVSVGMRFRMLFETEESSVR
Sbjct  246   AAAAHAAATNSRFTIFYNPRSSPSEFVIPLAKYVKSVYHTRVSVGMRFRMLFETEESSVR  305

Query  1507  RYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFS  1686
             RYMGT+T ISDLD VRWPNSHWRSVKVGWDESTAGE+QPRVSLWEIEPLTTFPMYP+ F 
Sbjct  306   RYMGTVTAISDLDSVRWPNSHWRSVKVGWDESTAGEKQPRVSLWEIEPLTTFPMYPTAFP  365

Query  1687  LRLKRPWPSGLPS----FPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPFMQP  1854
             LRLKRPW SGLPS    F G+ N D    S L WL GN GD+G QS NFQG G++P++QP
Sbjct  366   LRLKRPWASGLPSMHGMFNGVKNDDFARYSSLMWL-GN-GDRGTQSSNFQGLGVSPWLQP  423

Query  1855  RLDASMLGLQPDIYQTMAT  1911
             R+++ +LGL+PD YQ MA 
Sbjct  424   RIESPLLGLKPDTYQQMAA  442


 Score =   192 bits (487),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 131/326 (40%), Positives = 185/326 (57%), Gaps = 36/326 (11%)
 Frame = +1

Query  2269  QSFSDLVGNHVMTSNNSSTQSLP---RSFSHDEASQLLNMHETNPLAT---LPSKRIALE  2430
             QS S     +++  NN  +  +    R FS  EAS L+++ +++ L      PSKR+A+E
Sbjct  574   QSHSPFYQQNLLEGNNDPSLHMHNSFRDFSSQEASNLVSLPQSSQLMAPEGWPSKRLAVE  633

Query  2431  --SQVSSRATPYVVSQADMISPNSKVSDLPTFLPPFPGKEFPEYQGVAYSQGNNALLGVN  2604
               + V SR+    +   +     + +S     L     ++    Q            G N
Sbjct  634   PLAHVESRSARPKLENGNH---QNSISHFAGTLASESARDCSSVQAC----------GSN  680

Query  2605  TDSSIL---LQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESG  2775
              D+ +L   L +G+S+++   G NG ++M      +    G D P    + TSSC+ ES 
Sbjct  681   IDNQLLSSSLHDGMSSVRGGSG-NGTVSMAIPLFRYD---GEDLPPANSLATSSCLGESA  736

Query  2776  FLQSSENVDQANPPNR-TFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDP  2952
                S +N+   NP    TFVKV+KSGS GRSLDI+KFSSY+ELRSEL  +FGLEG LEDP
Sbjct  737   TFNSLDNICGVNPSQGGTFVKVYKSGSPGRSLDITKFSSYYELRSELEHLFGLEGQLEDP  796

Query  2953  ERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKE-EGIDLPNNLPA  3129
              RSGWQLVFVDREND+LL+GDDPWQEFVN+VW IKILSP +VHQM +  EG+     L A
Sbjct  797   VRSGWQLVFVDRENDILLVGDDPWQEFVNSVWCIKILSPQDVHQMVRNGEGL-----LSA  851

Query  3130  ANQRLPNGGSSCEVHVSQKETRNMNG  3207
             +  R+   G+ C+ + +  + +N+ G
Sbjct  852   SGARMMQ-GNVCDDYSASHDLQNLTG  876



>ref|XP_006664743.1| PREDICTED: auxin response factor 25-like [Oryza brachyantha]
Length=897

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/438 (83%), Positives = 389/438 (89%), Gaps = 6/438 (1%)
 Frame = +1

Query  607   EGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAHIPSYPGL  786
             E  GE++CLNSELWHACAGPLVSLP + SRVVYFPQGHSEQV ASTNKE+DA IP+YP L
Sbjct  17    ENDGEQRCLNSELWHACAGPLVSLPMVRSRVVYFPQGHSEQVAASTNKEVDAQIPNYPNL  76

Query  787   PAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPTNYFCKT  966
             P QLICQLHNVTMHAD ETDEVYAQMTLQPLS +EQK+   LP ELG  SKQPTNYFCKT
Sbjct  77    PPQLICQLHNVTMHADAETDEVYAQMTLQPLSPEEQKEP-FLPMELGAASKQPTNYFCKT  135

Query  967   LTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFRGQPKRH  1146
             LTASDTSTHGGFSVPRRAAEKVFPPLD+S QPPAQELIA+DLH NEWKFRH+FRGQPKRH
Sbjct  136   LTASDTSTHGGFSVPRRAAEKVFPPLDFSLQPPAQELIARDLHENEWKFRHIFRGQPKRH  195

Query  1147  LLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLL  1326
             LLTTGWSVFVSAKRLVAGD+VIFIWN+NNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLL
Sbjct  196   LLTTGWSVFVSAKRLVAGDSVIFIWNDNNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLL  255

Query  1327  aaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFETEESSVR  1506
             AAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMRFRMLFETEESSVR
Sbjct  256   AAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMRFRMLFETEESSVR  315

Query  1507  RYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFS  1686
             RYMGTIT ISDLD VRWPNSHWRSVKVGWDEST G++QPRVSLWEIEPLTTFPMYPS F 
Sbjct  316   RYMGTITSISDLDSVRWPNSHWRSVKVGWDESTTGDKQPRVSLWEIEPLTTFPMYPSAFP  375

Query  1687  LRLKRPWPSGLP---SFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPFMQPR  1857
             LRLKRPW SGLP    F G  N D      L WLR   G++G Q+LNFQG+GI+P++QPR
Sbjct  376   LRLKRPWASGLPMHGMFNGGGNDDFARYPSLMWLRD--GNRGAQTLNFQGHGISPWLQPR  433

Query  1858  LDASMLGLQPDIYQTMAT  1911
             +D+ +LG++ D YQ MA 
Sbjct  434   IDSPLLGVKTDTYQQMAA  451


 Score =   181 bits (459),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 122/303 (40%), Positives = 173/303 (57%), Gaps = 22/303 (7%)
 Frame = +1

Query  2341  SFSHDEASQLLNMHETNPLAT---LPSKRIALESQVSSRATPYVVSQADMISPNSKVSDL  2511
             +FS  EAS +L++  ++ L      PSK++A+ES V   A P ++ + + ++ ++ +S  
Sbjct  611   NFSSQEASDILSLPPSSQLMASNGWPSKQLAVESIVHPEAQP-MLPKIEKVNHHTSISHF  669

Query  2512  PTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTDSSILLQNGISNL-KNSGGENGFLNMPF  2688
             P   P    +     Q    +  +N LL     SS  LQ+G++++  ++  E   + +P 
Sbjct  670   PGTFPSQSARGCSVVQDCG-ADADNRLLS----SSFELQDGMTSIISDASRETDTMAIPL  724

Query  2689  STCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSL  2868
                N     G D      + TS+C+ ESG      NV        TFVKV+KSGS GRSL
Sbjct  725   LRYN-----GADLTTENTLATSNCLGESGTFNHLNNVCVNPSQGATFVKVYKSGSLGRSL  779

Query  2869  DISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVW  3048
             DIS+FSSY ELRSEL  +FGLEG LEDP RSGWQLVFVDREND+LL+GDDPWQEF N+VW
Sbjct  780   DISRFSSYCELRSELEHLFGLEGQLEDPVRSGWQLVFVDRENDILLVGDDPWQEFANSVW  839

Query  3049  YIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMNG--IPLGS  3222
              IKILSP EV ++ +  G D   + P A  +  N   +C+ + +    +N+ G    +  
Sbjct  840   CIKILSPQEVQKLVR--GGDGLLSSPGARIQQSN---ACDDYSASHNMQNIPGNIASVAP  894

Query  3223  LDY  3231
             LDY
Sbjct  895   LDY  897



>ref|XP_003616115.1| Auxin response factor [Medicago truncatula]
 gb|AES99073.1| auxin response factor 2 [Medicago truncatula]
Length=841

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/437 (82%), Positives = 391/437 (89%), Gaps = 5/437 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S +G++ Q  EG GEKKCLNSELWHACAGPLVSLP  G+RVVYFPQGHSEQV+A+TN
Sbjct  1     MKLSTSGMSQQGHEG-GEKKCLNSELWHACAGPLVSLPTAGTRVVYFPQGHSEQVSATTN  59

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             +EID  IP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPL+ QEQKD   LP ELG
Sbjct  60    REIDGQIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLTPQEQKDT-FLPMELG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH  EW
Sbjct  119   IPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDVEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA+RPQTVMPS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRASRPQTVMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNS FT+F+NPRASPS+FVIPL+KY KAVYHTRVSVGMR
Sbjct  239   SVLSSDSMHIGLLAAAAHAAATNSCFTVFFNPRASPSEFVIPLSKYIKAVYHTRVSVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTIT ISD+DPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  299   FRMLFETEESSVRRYMGTITSISDMDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  358

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LRLKRPW  G  SF    +G    ++ L W+RG  GD G+ ++NFQG
Sbjct  359   PLTTFPMYPSLFPLRLKRPWHPGTSSF---LDGRDEATNGLMWMRGGPGDHGLNAMNFQG  415

Query  1828  YGITPFMQPRLDASMLG  1878
              G+ P+MQPRLD ++LG
Sbjct  416   AGLLPWMQPRLDPTLLG  432


 Score =   186 bits (471),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 112/220 (51%), Positives = 136/220 (62%), Gaps = 27/220 (12%)
 Frame = +1

Query  2581  NNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSS  2757
             N+ L GVN DSS +LL   +     +        MP    +F    G+ YP         
Sbjct  646   NSVLFGVNIDSSGLLLPTTVPRYTTASAHADASTMPLGESSFQ---GSPYP---------  693

Query  2758  CV-DESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLE  2934
             C+ D S  LQS+  VD  N     FVKV+KSGS GRSLDIS+F+SYHELR ELA+MFG+E
Sbjct  694   CMQDSSELLQSAGQVDAQNQ-TPIFVKVYKSGSVGRSLDISRFNSYHELREELAQMFGIE  752

Query  2935  GLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLP  3114
             G  EDP RSGWQLVFVDRENDVLLLGDDPW+ FVNNVWYIKILSP ++ +MG+E    L 
Sbjct  753   GKFEDPLRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDIQKMGEEAIESLG  812

Query  3115  NNLPAANQRLPNGGSSCEVHVSQKETRNMNGIP-LGSLDY  3231
                P++ QR+ N G+     VS        G+P LGSL+Y
Sbjct  813   ---PSSGQRMNNTGAESHDIVS--------GLPSLGSLEY  841



>ref|XP_010233861.1| PREDICTED: auxin response factor 6-like isoform X2 [Brachypodium 
distachyon]
Length=914

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/439 (82%), Positives = 391/439 (89%), Gaps = 5/439 (1%)
 Frame = +1

Query  595   PQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAHIPS  774
             P + E   E KCLNSELWHACAGPLVSLP +GSRV+YFPQGHSEQV+ASTNKEI++ IP+
Sbjct  15    PGSPEVAEEHKCLNSELWHACAGPLVSLPAVGSRVLYFPQGHSEQVSASTNKEIESQIPN  74

Query  775   YPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPTNY  954
             YP LP QLICQLHNV MHAD ETDEV AQMTLQPLS  E KD   LPAELG  +KQPTNY
Sbjct  75    YPNLPPQLICQLHNVIMHADAETDEVCAQMTLQPLSP-ELKD-PFLPAELGTANKQPTNY  132

Query  955   FCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFRGQ  1134
             FCKTLTASDTSTHGGFSVPRRAAEKVFPPLD++QQPPAQEL+AKDLHGNEWKFRH+FRGQ
Sbjct  133   FCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFTQQPPAQELMAKDLHGNEWKFRHIFRGQ  192

Query  1135  PKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDSMH  1314
             PKRHLLTTGWSVF+SAKRLVAGD+V+FIWN+NNQLLLGIRRANRPQTVMPSSVLSSDSMH
Sbjct  193   PKRHLLTTGWSVFISAKRLVAGDSVLFIWNDNNQLLLGIRRANRPQTVMPSSVLSSDSMH  252

Query  1315  IGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFETEE  1494
             IGLLAAAAHAA+TNSRFTIFYNPRASPS+FVIPLAKY KAVYHTR+SVGMRFRMLFETEE
Sbjct  253   IGLLAAAAHAASTNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRISVGMRFRMLFETEE  312

Query  1495  SSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYP  1674
             SSVRRYMGTITGISDLDP RWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTT PMY 
Sbjct  313   SSVRRYMGTITGISDLDPARWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTIPMYS  372

Query  1675  SPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPFMQP  1854
             SPF +RLKRPWP+GLPS  G    D+  +S L WLR +  + G QS NF G G+ P+MQP
Sbjct  373   SPFPMRLKRPWPTGLPSLYGGKEDDL--TSSLMWLR-DGANPGFQSFNFGGLGMNPWMQP  429

Query  1855  RLDASMLGLQPDIYQTMAT  1911
             RLD S+LGLQPD+YQ ++ 
Sbjct  430   RLDTSLLGLQPDMYQAISA  448


 Score =   263 bits (673),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 167/358 (47%), Positives = 229/358 (64%), Gaps = 24/358 (7%)
 Frame = +1

Query  2203  RMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMH  2382
             +++ +TQS  S  Q +S+   QQ+F D   N +   N SS   + R F  +  S L ++ 
Sbjct  566   QLSPSTQSPPSIMQTVSAFSQQQNFQDTDINSLSPLNISSMHDVLRPFPSEAGSNLQDVP  625

Query  2383  ETNPLAT---LPSKRIALESQVSSRATPYVVSQADMISPNSKVSDLP--TFLPPFPGKEF  2547
              T P+       SKR+ +ES + SR+    VS  + +  +S  S++P  + L P PG+E 
Sbjct  626   RTTPVPVSDPWSSKRVVMESVIPSRSH-VTVSHIEQL--DSAPSNIPQSSSLAPLPGRES  682

Query  2548  PEYQGVAYSQGNNALLGVNTDS-SILLQNGISNLKNSGG-------ENGFLNMPFSTCNF  2703
                Q       N+ L GVN DS S+L+Q+ I  L+N          +NG   +P+STCNF
Sbjct  683   VVDQDENSDHQNHLLFGVNIDSQSLLMQDDIPGLQNENDCIASLQDDNGSNTIPYSTCNF  742

Query  2704  TSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKF  2883
              S    ++PLN  + +S C+D SG++  SEN DQ N P  TFVKV+KSG+ GR LDI++F
Sbjct  743   LSPSQNNFPLNEALTSSGCLDGSGYVPFSENPDQVNRPPATFVKVYKSGAVGRLLDITRF  802

Query  2884  SSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKIL  3063
             SSYHELRSEL  +FGLEG LEDP RSGWQLVFVDRENDVLL+GDDPWQEFVN+V  IKIL
Sbjct  803   SSYHELRSELGHLFGLEGQLEDPVRSGWQLVFVDRENDVLLVGDDPWQEFVNSVSCIKIL  862

Query  3064  SPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMN-GI-PLGSLDY  3231
             SP EV QMGK +GI+L ++ PA  +RL NG   C+ +VS++E+RN++ GI  +GS+++
Sbjct  863   SPQEVQQMGK-QGIELLSSAPA--RRLGNG---CDNYVSRQESRNLSTGIAAVGSVEF  914



>ref|XP_006575466.1| PREDICTED: auxin response factor 8-like isoform X1 [Glycine max]
Length=847

 Score =   727 bits (1876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/437 (82%), Positives = 388/437 (89%), Gaps = 5/437 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S +G+  Q  EG GEKKCLNSELWHACAGPLVSLP  G+RV YFPQGHSEQV A+TN
Sbjct  1     MKLSTSGLGQQGHEG-GEKKCLNSELWHACAGPLVSLPTAGTRVAYFPQGHSEQVAATTN  59

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             +E+D HIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPL+ QEQKD   LP ELG
Sbjct  60    REVDGHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLTPQEQKDT-FLPMELG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PSKQP+NYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH  EW
Sbjct  119   VPSKQPSNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDVEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNS FT+FYNPRASPS+FVIPL+KY KAVYHTRVSVGMR
Sbjct  239   SVLSSDSMHIGLLAAAAHAAATNSCFTVFYNPRASPSEFVIPLSKYIKAVYHTRVSVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  299   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  358

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LRLKRPW  G  SF    +G    ++ L WLRG  GDQ + SLNFQG
Sbjct  359   PLTTFPMYPSLFPLRLKRPWHPGTSSF---HDGRDEATNGLMWLRGGPGDQALNSLNFQG  415

Query  1828  YGITPFMQPRLDASMLG  1878
              G+ P+MQ R+D ++L 
Sbjct  416   SGLLPWMQQRMDPTLLA  432


 Score =   189 bits (479),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 138/219 (63%), Gaps = 25/219 (11%)
 Frame = +1

Query  2581  NNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSS  2757
             N  L GVN DSS +LL   +     +  ++    MP     F S      PL P      
Sbjct  652   NPILFGVNIDSSGLLLPTTVPRYTTASADSDASAMPLGESGFQS------PLYP-----C  700

Query  2758  CVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEG  2937
               D S  +QS+  VD  N   RTFVKV+KSGS GRSLDIS+FSSYHELR ELA+MFG+EG
Sbjct  701   GQDSSELVQSAGQVDPQNQ-TRTFVKVYKSGSVGRSLDISRFSSYHELREELAQMFGIEG  759

Query  2938  LLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPN  3117
              LEDP RSGWQLVFVDRENDVLLLGDDPW+ FVNNVWYIKILSP ++H+MG++    L +
Sbjct  760   KLEDPLRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDIHKMGEQA---LES  816

Query  3118  NLPAANQRLPNGGSSCEVHVSQKETRNMNGIP-LGSLDY  3231
               P+  QRL + G+     VS        G+P +GSL+Y
Sbjct  817   LGPSPGQRLNSTGADSHEIVS--------GLPSIGSLEY  847



>gb|KGN50892.1| hypothetical protein Csa_5G315370 [Cucumis sativus]
Length=783

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/437 (82%), Positives = 386/437 (88%), Gaps = 5/437 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S +G   Q  EG GEKKCLNSELWHACAGPLVSLP  G+RVVYFPQGHSEQV A+TN
Sbjct  1     MKLSTSGFGQQDHEG-GEKKCLNSELWHACAGPLVSLPTAGTRVVYFPQGHSEQVAATTN  59

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+D HIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPL+AQEQKD   LP ELG
Sbjct  60    KEVDGHIPNYPNLPPQLICQLHNVTMHADVETDEVYAQMTLQPLTAQEQKDT-FLPMELG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PS+QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIAKDLH  EW
Sbjct  119   IPSRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIAKDLHDIEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA RPQTVMPS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRATRPQTVMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNS FT+FYNPRASPS+FVIPL KY KAV+HTRVSVGMR
Sbjct  239   SVLSSDSMHIGLLAAAAHAAATNSCFTVFYNPRASPSEFVIPLTKYVKAVFHTRVSVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  299   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  358

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LRLKRPW  G+ S   + +     S+ L WLRG +G+QG+ SLN Q 
Sbjct  359   PLTTFPMYPSLFPLRLKRPWHPGVSS---VHDNREDASNGLMWLRGGVGEQGLHSLNLQS  415

Query  1828  YGITPFMQPRLDASMLG  1878
                 P++Q RLD+SM G
Sbjct  416   VSSLPWLQQRLDSSMFG  432


 Score =   155 bits (391),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 107/144 (74%), Gaps = 14/144 (10%)
 Frame = +1

Query  2806  ANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEG-LLEDPERSGWQLVFV  2982
             ++ P+ T   V+K+GS GRSLDIS+FSSY ELR ELA+MFG+EG L+EDP RSGWQLVFV
Sbjct  652   SDSPSPTLFGVYKTGSVGRSLDISRFSSYQELREELAQMFGIEGQLVEDPRRSGWQLVFV  711

Query  2983  DRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSS  3162
             DRENDVLLLGDDPW+ FVNNV +IKILSP +  ++G E+ I+  N  P   QRL +GG+ 
Sbjct  712   DRENDVLLLGDDPWEAFVNNVGFIKILSPEDFQKLG-EQAIESFN--PIVGQRLTSGGN-  767

Query  3163  CEVHVSQKETRNMNGIP-LGSLDY  3231
                     E  N++G+P +GSL+Y
Sbjct  768   --------EAGNVSGLPSVGSLEY  783



>ref|XP_008813056.1| PREDICTED: auxin response factor 12-like isoform X2 [Phoenix 
dactylifera]
Length=591

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/448 (79%), Positives = 393/448 (88%), Gaps = 9/448 (2%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S AG+  QA+EG GEK+CLNSELWHACAGPLV LP +G+RVVYFPQGHSEQV ASTN
Sbjct  1     MKLSTAGLVQQAQEG-GEKRCLNSELWHACAGPLVCLPTVGTRVVYFPQGHSEQVAASTN  59

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE++  IP+YP LP QLICQLH+VTMHAD ETDEVYAQMTLQPL+ QE  D   LPAELG
Sbjct  60    KEVEGQIPNYPNLPPQLICQLHDVTMHADVETDEVYAQMTLQPLNPQELND-AYLPAELG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             + SKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQEL+A+DLH  EW
Sbjct  119   IMSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELLARDLHDVEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA+RPQTVMPS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRASRPQTVMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPL+KY KAV+HTRVSVGMR
Sbjct  239   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLSKYVKAVFHTRVSVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTIT ISDL P+RWPNSHWRSVK+GWDESTAGER PRVSLWEIE
Sbjct  299   FRMLFETEESSVRRYMGTITEISDLGPLRWPNSHWRSVKIGWDESTAGERPPRVSLWEIE  358

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LRLKRPW  G+PSF    N        L WLRG  GD+G+QS+NFQ 
Sbjct  359   PLTTFPMYPSLFPLRLKRPWYPGVPSFHDEGNA-------LMWLRGGSGDRGLQSINFQS  411

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
              G+ P++Q R+++++LG   D YQ MA 
Sbjct  412   PGMGPWVQQRMESTLLGNDHDQYQAMAA  439


 Score =   170 bits (430),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 110/154 (71%), Gaps = 14/154 (9%)
 Frame = +1

Query  2635  ISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANP  2814
             +  L+ +  +N    MP+++ +  + +             S  + SG LQ   N ++A+P
Sbjct  447   VPGLRTNSIDNDISTMPYASSSLQNSI-----------YGSLKESSGVLQ---NAEEADP  492

Query  2815  PNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDREN  2994
               +TFVKV+KSGS GRSLDI++F+SY ELR EL++MFG++G LEDP RSGWQLVFVDREN
Sbjct  493   TTKTFVKVYKSGSVGRSLDITRFNSYDELREELSQMFGIKGRLEDPLRSGWQLVFVDREN  552

Query  2995  DVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKE  3096
             DVLLLGDDPW+ FVNNVWYIKILSP +V +MGK+
Sbjct  553   DVLLLGDDPWESFVNNVWYIKILSPEDVQEMGKQ  586



>ref|XP_008776642.1| PREDICTED: auxin response factor 17-like [Phoenix dactylifera]
Length=912

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/449 (82%), Positives = 394/449 (88%), Gaps = 18/449 (4%)
 Frame = +1

Query  568   MRVSLAGVN--PQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTAS  741
             MR+S + +   PQ EE    K+ LNSELWHACAGPLV+LP +GSRVVYFPQGHSEQV AS
Sbjct  4     MRISSSDLANLPQEEE----KRYLNSELWHACAGPLVALPAVGSRVVYFPQGHSEQVAAS  59

Query  742   TNKEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAE  921
             TNKEID+HIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQK+   LP E
Sbjct  60    TNKEIDSHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLSPQEQKEP-YLPTE  118

Query  922   LGMPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGN  1101
             LG PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLHGN
Sbjct  119   LGTPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHGN  178

Query  1102  EWKFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVM  1281
             EWKFRH+FRG          WSVFVSAKRLVAGD+V+FIWNENNQLLLGIR ANRPQTVM
Sbjct  179   EWKFRHIFRG----------WSVFVSAKRLVAGDSVLFIWNENNQLLLGIRHANRPQTVM  228

Query  1282  PSSVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVG  1461
             PSSVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVG
Sbjct  229   PSSVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVG  288

Query  1462  MRFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWE  1641
             MRFRMLFETEESSVRRYMGTITGI+DLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWE
Sbjct  289   MRFRMLFETEESSVRRYMGTITGINDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWE  348

Query  1642  IEPLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNF  1821
             IEPLTTFPMYP+PF L  KRPWP+GLPS  G  + D  ++SPL WLR + G+ GIQSLNF
Sbjct  349   IEPLTTFPMYPAPFPLSFKRPWPTGLPSLHGGKDDDTSLNSPLMWLR-DGGNPGIQSLNF  407

Query  1822  QGYGITPFMQPRLDASMLGLQPDIYQTMA  1908
             QG G TP+MQPRLDA     QPD+YQ+MA
Sbjct  408   QGIGSTPWMQPRLDALGHSRQPDMYQSMA  436


 Score =   313 bits (801),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 182/355 (51%), Positives = 236/355 (66%), Gaps = 12/355 (3%)
 Frame = +1

Query  2188  ITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQ  2367
             +++L +  S +QSQ    Q  SS    Q++ D  GN V T++ S   ++ R FS ++AS 
Sbjct  563   VSALSQFTSASQSQSPTLQTFSSFSQPQNYPDSNGNSVSTTSTSPLHNILRPFSPEDASH  622

Query  2368  LLNMHETNPLAT---LPSKRIALESQVSSRATPYVVSQADMISPNSKVSDLPTFLPPFPG  2538
             LL++  T PL T      KRIA+ES + S A   V     + S     S     LPPFPG
Sbjct  623   LLSLPRTTPLGTSSPWSCKRIAVESVLPSGAQCVVAHVEQLGSTQPNPSPQSVTLPPFPG  682

Query  2539  KEFPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSGV  2715
             +E    Q       NN L GVN DSS +L+QNG+ +L+    E+    +P++ CNF S  
Sbjct  683   RECSVDQDGTTDPQNNLLFGVNIDSSSLLVQNGMPSLRTGANESDSAAVPYAACNFLSPS  742

Query  2716  GTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNR-TFVKVHKSGSFGRSLDISKFSSY  2892
             GTD+PLN  + +SSC+DESGFLQS ENVDQ N P   TFVKV+KSGSFGRSLDI++FSSY
Sbjct  743   GTDFPLNQALTSSSCLDESGFLQSPENVDQVNNPQSGTFVKVYKSGSFGRSLDITRFSSY  802

Query  2893  HELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPF  3072
             HELR EL R+FGLEG LEDP RSGWQLVFVDRENDVLL+GDDPWQEFVN V+ IKILSP 
Sbjct  803   HELRGELGRLFGLEGQLEDPVRSGWQLVFVDRENDVLLVGDDPWQEFVNTVYCIKILSPQ  862

Query  3073  EVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMNG--IPLGSLDY  3231
             EV QMGK +G++L N+ P   +R P+  +SC+ +VS++++RN++     +GSLDY
Sbjct  863   EVQQMGK-QGVNLLNSAPI--KRPPS--NSCDGYVSRQDSRNLSSSITSVGSLDY  912



>ref|XP_006591281.1| PREDICTED: auxin response factor 8-like [Glycine max]
Length=844

 Score =   724 bits (1869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/448 (81%), Positives = 393/448 (88%), Gaps = 7/448 (2%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S +G+  Q  EG GEKKCLNSELWHACAGPLVSLP  G+RVVYFPQGHSEQV A+TN
Sbjct  1     MKLSTSGLGQQGHEG-GEKKCLNSELWHACAGPLVSLPTAGTRVVYFPQGHSEQVAATTN  59

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             +EID HIP+YP LP QLICQLHN+TMHAD ETDEVYAQMTLQPL+ QEQKD   LP ELG
Sbjct  60    REIDGHIPNYPSLPPQLICQLHNITMHADVETDEVYAQMTLQPLTPQEQKDT-FLPMELG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PSKQP+NYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH  EW
Sbjct  119   IPSKQPSNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDVEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWS+FVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSIFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNS FT+FYNPRASPS+FVIPL+KY KAVYHTR+SVGMR
Sbjct  239   SVLSSDSMHIGLLAAAAHAAATNSCFTVFYNPRASPSEFVIPLSKYIKAVYHTRISVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLD VRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  299   FRMLFETEESSVRRYMGTITGISDLDSVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  358

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LRLKRPW  G  S   L +G    ++ L WLRG   DQG+ SLNFQG
Sbjct  359   PLTTFPMYPSLFPLRLKRPWHPGTSS---LHDGRDEATNGLMWLRGGPVDQGLNSLNFQG  415

Query  1828  Y-GITPFMQPRLDASMLG-LQPDIYQTM  1905
               G+ P+MQ RLD ++LG  Q   YQ M
Sbjct  416   AGGMLPWMQQRLDPTLLGNDQNQQYQAM  443


 Score =   181 bits (459),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 112/222 (50%), Positives = 137/222 (62%), Gaps = 31/222 (14%)
 Frame = +1

Query  2581  NNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSS  2757
             N+ L GVN DSS +LL   +     S  +     MP +   F    G+ Y          
Sbjct  649   NSTLFGVNIDSSGLLLPTTVPGYTTSSADTNSSTMPLAESGFQ---GSLY---------G  696

Query  2758  CV-DESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLE  2934
             C+ D S  LQS+ + D  N   +TFVKV+KSGS GRSLDIS+FSSYHELR ELA+MFG+E
Sbjct  697   CMQDSSELLQSAGHTDPENQ-TQTFVKVYKSGSVGRSLDISRFSSYHELREELAQMFGIE  755

Query  2935  GLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKE--EGID  3108
             G LEDP RSGWQLVFVDRENDVLLLGDDPW+ FVNNVWYIKILSP ++ +MG +  E + 
Sbjct  756   GKLEDPLRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDIQKMGDQAVESLA  815

Query  3109  LPNNLPAANQRLPNGGSSCEVHVSQKETRNMNGIP-LGSLDY  3231
             L      + QRL   G+  +  VS        G P +GSL+Y
Sbjct  816   L-----GSGQRLNGTGAESQDIVS--------GPPSIGSLEY  844



>ref|XP_004148912.1| PREDICTED: auxin response factor 8-like [Cucumis sativus]
Length=836

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/437 (82%), Positives = 386/437 (88%), Gaps = 5/437 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S +G   Q  EG GEKKCLNSELWHACAGPLVSLP  G+RVVYFPQGHSEQV A+TN
Sbjct  1     MKLSTSGFGQQDHEG-GEKKCLNSELWHACAGPLVSLPTAGTRVVYFPQGHSEQVAATTN  59

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+D HIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPL+AQEQKD   LP ELG
Sbjct  60    KEVDGHIPNYPNLPPQLICQLHNVTMHADVETDEVYAQMTLQPLTAQEQKDT-FLPMELG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PS+QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIAKDLH  EW
Sbjct  119   IPSRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIAKDLHDIEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA RPQTVMPS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRATRPQTVMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNS FT+FYNPRASPS+FVIPL KY KAV+HTRVSVGMR
Sbjct  239   SVLSSDSMHIGLLAAAAHAAATNSCFTVFYNPRASPSEFVIPLTKYVKAVFHTRVSVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  299   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  358

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LRLKRPW  G+ S   + +     S+ L WLRG +G+QG+ SLN Q 
Sbjct  359   PLTTFPMYPSLFPLRLKRPWHPGVSS---VHDNREDASNGLMWLRGGVGEQGLHSLNLQS  415

Query  1828  YGITPFMQPRLDASMLG  1878
                 P++Q RLD+SM G
Sbjct  416   VSSLPWLQQRLDSSMFG  432


 Score =   179 bits (453),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 115/242 (48%), Positives = 148/242 (61%), Gaps = 30/242 (12%)
 Frame = +1

Query  2521  LPPFPGKE-FPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFST  2694
              PPF G++   E +       +  L GVN DSS +LL + +    +        +MP   
Sbjct  620   FPPFSGRDSILELRNCNSDSPSPTLFGVNIDSSGLLLPSNVPTYTSPSIGPDSSSMPLGD  679

Query  2695  CNFTSGVGTDYPLNPDMGTSSCV-DESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLD  2871
               F + +             SCV D S  L +S  VD +NP  RTFVKV+K+GS GRSLD
Sbjct  680   SGFQNSL------------YSCVQDSSELLHNSGQVDPSNP-TRTFVKVYKTGSVGRSLD  726

Query  2872  ISKFSSYHELRSELARMFGLEG-LLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVW  3048
             IS+FSSY ELR ELA+MFG+EG L+EDP RSGWQLVFVDRENDVLLLGDDPW+ FVNNV 
Sbjct  727   ISRFSSYQELREELAQMFGIEGQLVEDPRRSGWQLVFVDRENDVLLLGDDPWEAFVNNVG  786

Query  3049  YIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMNGIP-LGSL  3225
             +IKILSP +  ++G E+ I+  N  P   QRL +GG+         E  N++G+P +GSL
Sbjct  787   FIKILSPEDFQKLG-EQAIESFN--PIVGQRLTSGGN---------EAGNVSGLPSVGSL  834

Query  3226  DY  3231
             +Y
Sbjct  835   EY  836



>ref|XP_008463127.1| PREDICTED: auxin response factor 8 [Cucumis melo]
Length=852

 Score =   724 bits (1869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/437 (82%), Positives = 387/437 (89%), Gaps = 5/437 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S +G   Q  EG GEKKCLNSELWHACAGPLVSLP  G+RVVYFPQGHSEQV A+TN
Sbjct  1     MKLSTSGFGQQDHEG-GEKKCLNSELWHACAGPLVSLPTAGTRVVYFPQGHSEQVAATTN  59

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+D HIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPL+AQEQKD   LP ELG
Sbjct  60    KEVDGHIPNYPNLPPQLICQLHNVTMHADVETDEVYAQMTLQPLTAQEQKDT-FLPMELG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PS+QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIAKDLH  EW
Sbjct  119   IPSRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIAKDLHDIEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA RPQTVMPS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRATRPQTVMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNS FT+FYNPRASPS+FVIPL KY KAV+HTRVSVGMR
Sbjct  239   SVLSSDSMHIGLLAAAAHAAATNSCFTVFYNPRASPSEFVIPLTKYVKAVFHTRVSVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  299   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  358

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LR+KRPW  G+ S   + +     S+ L WLRG +G+QG+ SLN Q 
Sbjct  359   PLTTFPMYPSLFPLRMKRPWHPGVSS---VHDNRDDASNGLMWLRGGVGEQGLHSLNLQS  415

Query  1828  YGITPFMQPRLDASMLG  1878
              G  P++Q RLD+SM G
Sbjct  416   VGSLPWLQQRLDSSMFG  432


 Score =   182 bits (463),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 149/248 (60%), Gaps = 43/248 (17%)
 Frame = +1

Query  2521  LPPFPGKE-FPEYQGVAYSQGNNALLGVNTDSSILLQNGISNLKNSGGENGFLNMPFSTC  2697
              PPF G++   E         +  L GVN DSS LL                  +P +  
Sbjct  637   FPPFSGRDSILELGNCNSDSPSPTLFGVNIDSSGLL------------------LPSNVP  678

Query  2698  NFTS-GVGTDYPLNPDMGTS-------SCV-DESGFLQSSENVDQANPPNRTFVKVHKSG  2850
              ++S  +G D    P MG S       SCV D S  L +S  VD +NP  RTFVKV+KSG
Sbjct  679   TYSSPSIGPDSSSIP-MGDSGFQNSLYSCVQDSSELLHNSGQVDPSNP-TRTFVKVYKSG  736

Query  2851  SFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQE  3030
             S GRSLDIS+FSSY ELR ELA+MFG+EG LEDP RSGWQLVFVDRENDVLLLGDDPW+ 
Sbjct  737   SVGRSLDISRFSSYQELREELAQMFGIEGQLEDPHRSGWQLVFVDRENDVLLLGDDPWEA  796

Query  3031  FVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMNGI  3210
             FVNNV YIKILSP +  ++G E+ I+  N  P   QRL +GG+         E  N++G+
Sbjct  797   FVNNVGYIKILSPEDFQKLG-EQAIESFN--PIVGQRLTSGGN---------EAGNVSGL  844

Query  3211  P-LGSLDY  3231
             P +GSL+Y
Sbjct  845   PSVGSLEY  852



>ref|XP_002266678.2| PREDICTED: auxin response factor 8 [Vitis vinifera]
Length=846

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/437 (83%), Positives = 387/437 (89%), Gaps = 5/437 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S +G+  Q +   GEKKCLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV A+TN
Sbjct  1     MKLSTSGLG-QQQGHEGEKKCLNSELWHACAGPLVSLPTVGSRVVYFPQGHSEQVAATTN  59

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+D HIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPL+ QEQKD   LP ELG
Sbjct  60    KEVDGHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLTPQEQKDT-FLPVELG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH  EW
Sbjct  119   IPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDVEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA RPQTVMPS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRATRPQTVMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNS FTIFYNPRASPS+FVIPL+KY KAV+HTRVSVGMR
Sbjct  239   SVLSSDSMHIGLLAAAAHAAATNSCFTIFYNPRASPSEFVIPLSKYVKAVFHTRVSVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  299   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  358

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LRLKRPW  G  S   L +     ++ L WLRG  GDQG+QSLNFQ 
Sbjct  359   PLTTFPMYPSLFPLRLKRPWHPGASS---LHDSRDEAANGLMWLRGETGDQGLQSLNFQT  415

Query  1828  YGITPFMQPRLDASMLG  1878
              G+ P+ Q RLD + LG
Sbjct  416   VGMFPWTQQRLDPTFLG  432


 Score =   186 bits (472),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 119/243 (49%), Positives = 149/243 (61%), Gaps = 27/243 (11%)
 Frame = +1

Query  2515  TFLPPFPGKEFP-EYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPF  2688
             T LPPF GK+   E +       N+ L GVN DSS +LL   + +  +S  +    +MP 
Sbjct  627   TSLPPFTGKDAAVEPENCNLDAQNHTLFGVNIDSSGLLLPTTVPSFGSSSVDADVSSMPL  686

Query  2689  STCNFTSGVGTDYPLNPDMGTSSCV-DESGFLQSSENVDQANPPNRTFVKVHKSGSFGRS  2865
                 F   +              CV D S  LQ++  VD   P +RTFVKV+KSGS GRS
Sbjct  687   GASGFQGSL------------FGCVQDPSELLQNAGQVDPPTP-SRTFVKVYKSGSVGRS  733

Query  2866  LDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNV  3045
             LDI++FSSYHELR EL +MFG+EG LE+P RSGWQLVFVDRENDVLLLGDDPW+ FVNNV
Sbjct  734   LDITRFSSYHELREELGQMFGIEGKLENPLRSGWQLVFVDRENDVLLLGDDPWEAFVNNV  793

Query  3046  WYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMNGIP-LGS  3222
             WYIKILSP +V +MGK +GI+     P + QR+ + G+     VS        G+P  GS
Sbjct  794   WYIKILSPEDVQKMGK-QGIE-SGFSPNSAQRMNSSGTDDRDLVS--------GLPSAGS  843

Query  3223  LDY  3231
             L+Y
Sbjct  844   LEY  846



>ref|XP_007146950.1| hypothetical protein PHAVU_006G084200g [Phaseolus vulgaris]
 gb|ESW18944.1| hypothetical protein PHAVU_006G084200g [Phaseolus vulgaris]
Length=841

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/447 (81%), Positives = 391/447 (87%), Gaps = 5/447 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S +G+  Q  E  GEKKCLNSELWHACAGPLVSLP  G+RVVYFPQGHSEQV A+TN
Sbjct  1     MKLSTSGLGQQGLE-VGEKKCLNSELWHACAGPLVSLPTAGTRVVYFPQGHSEQVAATTN  59

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             +EID HIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPL+ QEQKD   LP ELG
Sbjct  60    REIDGHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLTPQEQKDT-FLPMELG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PSKQP+NYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH  EW
Sbjct  119   IPSKQPSNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDVEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWS+FVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSIFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNS FT+FYNPRASPS+FVIPL+KY KAVYHTR+SVGMR
Sbjct  239   SVLSSDSMHIGLLAAAAHAAATNSCFTVFYNPRASPSEFVIPLSKYIKAVYHTRISVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEES VRRYMGTITGISDLD VRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  299   FRMLFETEESGVRRYMGTITGISDLDSVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  358

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LRLKRPW  G  S    S  +   S+ L WLRG  GDQG+ SLNFQG
Sbjct  359   PLTTFPMYPSLFPLRLKRPWHPGSSSLHDGSRDE--ASNGLMWLRGGPGDQGLNSLNFQG  416

Query  1828  YGITPFMQPRLDASMLGL-QPDIYQTM  1905
              G+ P+MQ R+D ++LG  Q   YQ M
Sbjct  417   GGMLPWMQQRMDPTLLGSDQNQQYQAM  443


 Score =   184 bits (467),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 112/222 (50%), Positives = 136/222 (61%), Gaps = 31/222 (14%)
 Frame = +1

Query  2581  NNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSS  2757
             N+ L GVN DSS +LL   +     S  +     MP     F   +              
Sbjct  646   NSTLFGVNIDSSGLLLPTTVPGYSTSSADTNSSTMPLGESGFQGSL------------FG  693

Query  2758  CV-DESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLE  2934
             C+ D S  LQS+ +VD  N   +TFVKV+KSGS GRSLDIS+FSSYHELR ELA+MFG+E
Sbjct  694   CMQDSSELLQSAGHVDPQNQ-TQTFVKVYKSGSVGRSLDISRFSSYHELREELAQMFGIE  752

Query  2935  GLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKE--EGID  3108
             G LEDP RSGWQLVFVDRENDVLLLGDDPW+ FVNNVWYIKILSP ++ +MG++  E + 
Sbjct  753   GKLEDPPRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDIQKMGEQAVESLA  812

Query  3109  LPNNLPAANQRLPNGGSSCEVHVSQKETRNMNGIP-LGSLDY  3231
             L      + QRL   G+  +  VS        G P +GSLDY
Sbjct  813   L-----GSGQRLNGTGAESQDIVS--------GPPSIGSLDY  841



>ref|XP_002526195.1| Auxin response factor, putative [Ricinus communis]
 gb|EEF36199.1| Auxin response factor, putative [Ricinus communis]
Length=826

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/447 (81%), Positives = 389/447 (87%), Gaps = 7/447 (2%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S +G+  Q  EG  EKKCLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV A+TN
Sbjct  1     MKLSTSGLGQQGHEG--EKKCLNSELWHACAGPLVSLPTVGSRVVYFPQGHSEQVAATTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+D HIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPL+ QEQKD   LP ELG
Sbjct  59    KEVDGHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLTPQEQKDT-FLPMELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH  EW
Sbjct  118   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDVEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA RPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRATRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNS FTIFYNPRASPS+FVIPL+KY KAV+HTRVSVGMR
Sbjct  238   SVLSSDSMHIGLLAAAAHAAATNSCFTIFYNPRASPSEFVIPLSKYVKAVFHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LRL+RPW  G  S   L +      + L WLRG  GDQG+ SLNFQ 
Sbjct  358   PLTTFPMYPSLFPLRLRRPWHPGPSS---LHDNRDEAGNGLMWLRGGTGDQGLHSLNFQA  414

Query  1828  YGITPFMQPRLDASMLG-LQPDIYQTM  1905
               + P+ Q RLD ++LG  Q   YQ M
Sbjct  415   VNMFPWSQQRLDPALLGNDQNQWYQAM  441


 Score =   176 bits (445),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 116/179 (65%), Gaps = 18/179 (10%)
 Frame = +1

Query  2581  NNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSS  2757
             N    GVN DSS +LL   +     S  +    +MP     F S +              
Sbjct  656   NATNFGVNIDSSGLLLPTTVPRFSTSSVDADVSSMPIGDSGFQSSI-----------YGG  704

Query  2758  CVDESGFLQSSENVDQANPP--NRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGL  2931
               D S  L S+  VD   PP  +RTFVKV+K GS GRSLDIS+FSSYHELR ELA+MFG+
Sbjct  705   VQDSSELLPSAGQVD---PPTLSRTFVKVYKLGSVGRSLDISRFSSYHELREELAQMFGI  761

Query  2932  EGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGID  3108
             EG LE+P RSGWQLVFVDRENDVLLLGDDPW+ FVNNVWYIKILSP +V +MG E+G+D
Sbjct  762   EGKLENPHRSGWQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPEDVQKMG-EQGVD  819



>ref|XP_010540603.1| PREDICTED: auxin response factor 6-like isoform X2 [Tarenaya 
hassleriana]
Length=808

 Score =   721 bits (1862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/454 (80%), Positives = 396/454 (87%), Gaps = 24/454 (5%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG N QA EG  EK+ LNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSAGFNTQAHEG--EKRVLNSELWHACAGPLVSLPLVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP L  QLICQLHNVTMHAD ETDEVYAQMTLQPL+  EQKD   +PAELG
Sbjct  59    KEVDAHIPNYPSLQPQLICQLHNVTMHADVETDEVYAQMTLQPLNPDEQKDP-YIPAELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
               ++QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD++QQPPAQELIA+DLH NEW
Sbjct  118   ALTRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFTQQPPAQELIARDLHDNEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRL+AGDAV+FIWN+ NQLLLGIRRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLIAGDAVLFIWNDKNQLLLGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASP +FVIPLAKY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPCEFVIPLAKYVKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTI GI+DLDPVRWP+SHWRSVKVGWDESTAGE+QPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTIMGINDLDPVRWPHSHWRSVKVGWDESTAGEKQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSF--PGLSNGDM-HISSPLSWLRGNMGDQGIQSLN  1818
             PLTTFPMYPSPF LRLKRPWP GLPSF    +   D+  +SSPL W      D+G+Q+LN
Sbjct  358   PLTTFPMYPSPFPLRLKRPWPPGLPSFHVSSIKEDDLGMMSSPLMW------DRGLQTLN  411

Query  1819  FQGYGITPF---MQPRLDASMLGLQPDIYQTMAT  1911
             FQG+G+ P+    QPRL         D+YQTMA 
Sbjct  412   FQGFGLNPWTMMQQPRL---------DVYQTMAA  436


 Score =   261 bits (667),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 175/353 (50%), Positives = 225/353 (64%), Gaps = 30/353 (8%)
 Frame = +1

Query  2224  SQLSHFQALSSTVP----QQSFSD--LVGNHVMTSN-NSSTQSLPRSFSHDEAS---QLL  2373
             SQ + F + S ++P      SFSD   +GN+ MTS+  S   +L  +F  DE+S   Q+L
Sbjct  469   SQQTQFVSGSQSIPPLCHHLSFSDTNCIGNNPMTSSIVSPLHTLLGNFPQDESSSSHQML  528

Query  2374  NM-HETNPLAT--LPSKRIALESQVSSRATPYVVSQADMISPNSKVSDLPTFLPPFPGKE  2544
             N+   ++ +A+   PSKR A++S   S  +    +          V D    LPPFPG+E
Sbjct  529   NLTRSSSAMASSGWPSKRAAVDSSFQSSGSRNNSNNN-----TECVMDQ---LPPFPGRE  580

Query  2545  FPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGT  2721
                 Q       ++ L GV+ DSS +L+Q+G+SNL   G EN    +PF + N  S    
Sbjct  581   CLAEQDGNTDPHSHLLFGVSIDSSSLLMQSGVSNLNAIGIENDSTALPFLSSNTVSI--N  638

Query  2722  DYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHEL  2901
             D+  N  +  SSC+DESGFLQSS+NV   NP + TFVKV+KSGSFGRSLDISKFSSYHEL
Sbjct  639   DFSSNLAVMPSSCIDESGFLQSSDNVGSENPQSTTFVKVYKSGSFGRSLDISKFSSYHEL  698

Query  2902  RSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVH  3081
             RSELARMFG+EG LEDP RSGWQLVFVDRENDVLLLGDDPW EFVN+VW IKILSP EVH
Sbjct  699   RSELARMFGIEGRLEDPMRSGWQLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVH  758

Query  3082  QMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMNG---IPLGSLDY  3231
             +MGK  GI++ ++ P+  +++PNGG  CE   +  + RN+ G      GS DY
Sbjct  759   RMGK-RGIEILSSGPSV-RKIPNGG-GCEDFGNGHDPRNLGGSIASVAGSFDY  808



>ref|XP_007146949.1| hypothetical protein PHAVU_006G084200g [Phaseolus vulgaris]
 gb|ESW18943.1| hypothetical protein PHAVU_006G084200g [Phaseolus vulgaris]
Length=840

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/447 (81%), Positives = 391/447 (87%), Gaps = 6/447 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S +G+  Q  EG  EKKCLNSELWHACAGPLVSLP  G+RVVYFPQGHSEQV A+TN
Sbjct  1     MKLSTSGLGQQGLEG--EKKCLNSELWHACAGPLVSLPTAGTRVVYFPQGHSEQVAATTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             +EID HIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPL+ QEQKD   LP ELG
Sbjct  59    REIDGHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLTPQEQKDT-FLPMELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PSKQP+NYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH  EW
Sbjct  118   IPSKQPSNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDVEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWS+FVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSIFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNS FT+FYNPRASPS+FVIPL+KY KAVYHTR+SVGMR
Sbjct  238   SVLSSDSMHIGLLAAAAHAAATNSCFTVFYNPRASPSEFVIPLSKYIKAVYHTRISVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEES VRRYMGTITGISDLD VRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESGVRRYMGTITGISDLDSVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LRLKRPW  G  S    S  +   S+ L WLRG  GDQG+ SLNFQG
Sbjct  358   PLTTFPMYPSLFPLRLKRPWHPGSSSLHDGSRDE--ASNGLMWLRGGPGDQGLNSLNFQG  415

Query  1828  YGITPFMQPRLDASMLGL-QPDIYQTM  1905
              G+ P+MQ R+D ++LG  Q   YQ M
Sbjct  416   GGMLPWMQQRMDPTLLGSDQNQQYQAM  442


 Score =   184 bits (467),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 112/222 (50%), Positives = 136/222 (61%), Gaps = 31/222 (14%)
 Frame = +1

Query  2581  NNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSS  2757
             N+ L GVN DSS +LL   +     S  +     MP     F   +              
Sbjct  645   NSTLFGVNIDSSGLLLPTTVPGYSTSSADTNSSTMPLGESGFQGSL------------FG  692

Query  2758  CV-DESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLE  2934
             C+ D S  LQS+ +VD  N   +TFVKV+KSGS GRSLDIS+FSSYHELR ELA+MFG+E
Sbjct  693   CMQDSSELLQSAGHVDPQNQ-TQTFVKVYKSGSVGRSLDISRFSSYHELREELAQMFGIE  751

Query  2935  GLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKE--EGID  3108
             G LEDP RSGWQLVFVDRENDVLLLGDDPW+ FVNNVWYIKILSP ++ +MG++  E + 
Sbjct  752   GKLEDPPRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDIQKMGEQAVESLA  811

Query  3109  LPNNLPAANQRLPNGGSSCEVHVSQKETRNMNGIP-LGSLDY  3231
             L      + QRL   G+  +  VS        G P +GSLDY
Sbjct  812   L-----GSGQRLNGTGAESQDIVS--------GPPSIGSLDY  840



>ref|XP_003553137.1| PREDICTED: auxin response factor 8-like [Glycine max]
 gb|KHN08745.1| Auxin response factor 8 [Glycine soja]
Length=841

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/447 (81%), Positives = 391/447 (87%), Gaps = 6/447 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S +G+  Q  EG GEKKCLNSELWHACAGPLVSLP  G+RVVYFPQGHSEQV A+TN
Sbjct  1     MKLSTSGLGQQGHEG-GEKKCLNSELWHACAGPLVSLPTAGTRVVYFPQGHSEQVAATTN  59

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             +EID HIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPL+ QEQKD   L  ELG
Sbjct  60    REIDGHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLTPQEQKDT-FLSMELG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PSKQP+NYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+S QPPAQELIA+DLH  EW
Sbjct  119   IPSKQPSNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSLQPPAQELIARDLHDAEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWS+FVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSIFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNS FT+FYNPRASPS+FVIPL+KY KAVYHTR+SVGMR
Sbjct  239   SVLSSDSMHIGLLAAAAHAAATNSCFTVFYNPRASPSEFVIPLSKYIKAVYHTRISVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLD VRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  299   FRMLFETEESSVRRYMGTITGISDLDSVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  358

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LRLKRPW  G  S   L +G    ++ L W+RG   DQG+ SLNFQG
Sbjct  359   PLTTFPMYPSLFPLRLKRPWHPGTSS---LHDGRDEATNGLMWMRGGPVDQGLNSLNFQG  415

Query  1828  YGITPFMQPRLDASMLG-LQPDIYQTM  1905
              G+ P+MQ RLD ++LG  Q   YQ M
Sbjct  416   AGMLPWMQQRLDPTLLGNDQNQQYQAM  442


 Score =   189 bits (481),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 139/220 (63%), Gaps = 29/220 (13%)
 Frame = +1

Query  2581  NNALLGVNTDSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSC  2760
             N+ L GVN DSS LL   +     S  +     MP +   F    G+ Y          C
Sbjct  648   NSTLFGVNIDSSGLLPITVPGYTTSSADTNSSTMPLADSGFQ---GSLY---------GC  695

Query  2761  VDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGL  2940
             +D S  LQS+ +VD  N  ++TFVKV+KSGS GRSLDIS+FSSYHELR ELA+MFG+EG 
Sbjct  696   MDSSELLQSAGHVDPENQ-SQTFVKVYKSGSVGRSLDISRFSSYHELREELAQMFGIEGK  754

Query  2941  LEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKE--EGIDLP  3114
             LEDP RSGWQLVFVDRENDVLLLGDDPW+ FVNNVWYIKILSP ++ +MG++  E + L 
Sbjct  755   LEDPLRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDIQKMGEQAVESLAL-  813

Query  3115  NNLPAANQRLPNGGSSCEVHVSQKETRNMNGIP-LGSLDY  3231
                  + QRL   G+  +  VS        G P +GSL+Y
Sbjct  814   ----GSGQRLNGTGAESQDIVS--------GPPSIGSLEY  841



>tpg|DAA55140.1| TPA: hypothetical protein ZEAMMB73_057592 [Zea mays]
Length=781

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/435 (82%), Positives = 383/435 (88%), Gaps = 3/435 (1%)
 Frame = +1

Query  607   EGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAHIPSYPGL  786
             E  GE++CLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTNKE+DA IP+YP L
Sbjct  14    ESDGEQRCLNSELWHACAGPLVSLPVVGSRVVYFPQGHSEQVAASTNKEVDAQIPNYPNL  73

Query  787   PAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPTNYFCKT  966
             P QLICQLHNVTMHAD ET EVYAQMTLQPLS +EQK+   LP ELG  S QPTNYFCKT
Sbjct  74    PPQLICQLHNVTMHADAETGEVYAQMTLQPLSPEEQKEP-FLPIELGAGSNQPTNYFCKT  132

Query  967   LTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFRGQPKRH  1146
             LTASDTSTHGGFSVPRRAAEKVFPPLD+SQ PP QEL+A+DLH NEWKFRH+FRGQPKRH
Sbjct  133   LTASDTSTHGGFSVPRRAAEKVFPPLDFSQHPPVQELVARDLHDNEWKFRHIFRGQPKRH  192

Query  1147  LLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLL  1326
             LLTTGWSVFVSAKRLVAGD++IFIWN+NNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLL
Sbjct  193   LLTTGWSVFVSAKRLVAGDSIIFIWNDNNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLL  252

Query  1327  aaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFETEESSVR  1506
             AAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMRFRMLFETEESSVR
Sbjct  253   AAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMRFRMLFETEESSVR  312

Query  1507  RYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFS  1686
             RYMGTIT ISDLD  RWPNSHWRSVKVGWDESTAG++QPRVSLWEIEPL  FPMYP+ F 
Sbjct  313   RYMGTITCISDLDSERWPNSHWRSVKVGWDESTAGDKQPRVSLWEIEPLMAFPMYPTAFP  372

Query  1687  LRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPFMQPRLDA  1866
             LRLKRPW SGLP F G  + +    S L WLR   G++G QSLNFQG G +P++QPR+D 
Sbjct  373   LRLKRPWASGLPMFNGGRSDEFARYSSLMWLRD--GNRGAQSLNFQGLGASPWLQPRIDY  430

Query  1867  SMLGLQPDIYQTMAT  1911
              +LGL+ D YQ MA 
Sbjct  431   PLLGLKLDTYQQMAA  445



>gb|KDP36369.1| hypothetical protein JCGZ_09784 [Jatropha curcas]
Length=830

 Score =   721 bits (1862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/447 (81%), Positives = 390/447 (87%), Gaps = 7/447 (2%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S +G+  Q  EG  EKKCLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV A+TN
Sbjct  1     MKLSTSGLGQQGHEG--EKKCLNSELWHACAGPLVSLPTVGSRVVYFPQGHSEQVAATTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+D HIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPL+ QEQKD   LP ELG
Sbjct  59    KEVDGHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLTPQEQKDT-FLPMELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH  EW
Sbjct  118   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDVEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA RPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRATRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNS FT+FYNPRASPS+FVIPL+KY KAV+HTRVSVGMR
Sbjct  238   SVLSSDSMHIGLLAAAAHAAATNSCFTVFYNPRASPSEFVIPLSKYVKAVFHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LRL+RPW  G PS   L +      + L WLRG  G+QG+ SLNFQ 
Sbjct  358   PLTTFPMYPSLFPLRLRRPWHPG-PS--SLHDNRDEAGNGLMWLRGGTGEQGLHSLNFQA  414

Query  1828  YGITPFMQPRLDASMLG-LQPDIYQTM  1905
               + P+ Q RLD ++LG  Q   YQ M
Sbjct  415   VNMFPWTQQRLDPALLGNDQNQWYQAM  441


 Score =   177 bits (448),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 125/304 (41%), Positives = 167/304 (55%), Gaps = 33/304 (11%)
 Frame = +1

Query  2221  QSQLSHFQALSSTVPQQSFSD---LVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMHET-  2388
             Q Q    Q   S VP  SFS    +  +   +++ +  Q++  S   + +  LL+   T 
Sbjct  541   QIQGEQLQRQQSNVPSPSFSKTDFMDSSAKFSASTTPIQNMLGSLCAEGSGNLLDFTRTG  600

Query  2389  -NPLATLPSKRIALESQVSSRATPYVVSQADMISPNSKVSDLPTFLPPFPGKEFPEYQGV  2565
              + L TL ++++  +S V   A   V +  + +S       LP   P       PE   +
Sbjct  601   QSTLTTL-TEQLPQQSWVQKYAHSQVNAFTNSVS-------LPRSYPEKDPSMEPENCNL  652

Query  2566  AYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPD  2742
                   N   GVN DSS +LL   +     S  +    +MP     F + +         
Sbjct  653   DAQNATN--FGVNIDSSGLLLPTTLPRFATSSVDADVSSMPLGDSGFQNSM---------  701

Query  2743  MGTSSCVDESGFLQSSENVDQANPP--NRTFVKVHKSGSFGRSLDISKFSSYHELRSELA  2916
                    D S F+QS+  VD   PP  +RTFVKV+KSGS GRSLDIS+FSSYHELR ELA
Sbjct  702   --YGGVQDSSEFVQSAGQVD---PPTSSRTFVKVYKSGSVGRSLDISRFSSYHELREELA  756

Query  2917  RMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKE  3096
             +MFG+EG LE+P RSGWQLVFVDRENDVLLLGDDPW+ FVNNVWYIKILSP +V ++G E
Sbjct  757   QMFGIEGKLENPHRSGWQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPEDVQKLG-E  815

Query  3097  EGID  3108
             +G++
Sbjct  816   QGVE  819



>ref|XP_010540601.1| PREDICTED: auxin response factor 6-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010540602.1| PREDICTED: auxin response factor 6-like isoform X1 [Tarenaya 
hassleriana]
Length=809

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/454 (80%), Positives = 396/454 (87%), Gaps = 23/454 (5%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG N QA EG  EK+ LNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSAGFNTQAHEG--EKRVLNSELWHACAGPLVSLPLVGSRVVYFPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP L  QLICQLHNVTMHAD ETDEVYAQMTLQPL+ Q+++    +PAELG
Sbjct  59    KEVDAHIPNYPSLQPQLICQLHNVTMHADVETDEVYAQMTLQPLNPQDEQKDPYIPAELG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
               ++QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD++QQPPAQELIA+DLH NEW
Sbjct  119   ALTRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFTQQPPAQELIARDLHDNEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRL+AGDAV+FIWN+ NQLLLGIRRANRPQTVMPS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSVFVSAKRLIAGDAVLFIWNDKNQLLLGIRRANRPQTVMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMH+GLLAAAAHAAATNSRFTIFYNPRASP +FVIPLAKY KAVYHTRVSVGMR
Sbjct  239   SVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPCEFVIPLAKYVKAVYHTRVSVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTI GI+DLDPVRWP+SHWRSVKVGWDESTAGE+QPRVSLWEIE
Sbjct  299   FRMLFETEESSVRRYMGTIMGINDLDPVRWPHSHWRSVKVGWDESTAGEKQPRVSLWEIE  358

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSF--PGLSNGDM-HISSPLSWLRGNMGDQGIQSLN  1818
             PLTTFPMYPSPF LRLKRPWP GLPSF    +   D+  +SSPL W      D+G+Q+LN
Sbjct  359   PLTTFPMYPSPFPLRLKRPWPPGLPSFHVSSIKEDDLGMMSSPLMW------DRGLQTLN  412

Query  1819  FQGYGITPF---MQPRLDASMLGLQPDIYQTMAT  1911
             FQG+G+ P+    QPRL         D+YQTMA 
Sbjct  413   FQGFGLNPWTMMQQPRL---------DVYQTMAA  437


 Score =   261 bits (667),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 175/353 (50%), Positives = 225/353 (64%), Gaps = 30/353 (8%)
 Frame = +1

Query  2224  SQLSHFQALSSTVP----QQSFSD--LVGNHVMTSN-NSSTQSLPRSFSHDEAS---QLL  2373
             SQ + F + S ++P      SFSD   +GN+ MTS+  S   +L  +F  DE+S   Q+L
Sbjct  470   SQQTQFVSGSQSIPPLCHHLSFSDTNCIGNNPMTSSIVSPLHTLLGNFPQDESSSSHQML  529

Query  2374  NM-HETNPLAT--LPSKRIALESQVSSRATPYVVSQADMISPNSKVSDLPTFLPPFPGKE  2544
             N+   ++ +A+   PSKR A++S   S  +    +          V D    LPPFPG+E
Sbjct  530   NLTRSSSAMASSGWPSKRAAVDSSFQSSGSRNNSNNN-----TECVMDQ---LPPFPGRE  581

Query  2545  FPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGT  2721
                 Q       ++ L GV+ DSS +L+Q+G+SNL   G EN    +PF + N  S    
Sbjct  582   CLAEQDGNTDPHSHLLFGVSIDSSSLLMQSGVSNLNAIGIENDSTALPFLSSNTVSI--N  639

Query  2722  DYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHEL  2901
             D+  N  +  SSC+DESGFLQSS+NV   NP + TFVKV+KSGSFGRSLDISKFSSYHEL
Sbjct  640   DFSSNLAVMPSSCIDESGFLQSSDNVGSENPQSTTFVKVYKSGSFGRSLDISKFSSYHEL  699

Query  2902  RSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVH  3081
             RSELARMFG+EG LEDP RSGWQLVFVDRENDVLLLGDDPW EFVN+VW IKILSP EVH
Sbjct  700   RSELARMFGIEGRLEDPMRSGWQLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVH  759

Query  3082  QMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMNG---IPLGSLDY  3231
             +MGK  GI++ ++ P+  +++PNGG  CE   +  + RN+ G      GS DY
Sbjct  760   RMGK-RGIEILSSGPSV-RKIPNGG-GCEDFGNGHDPRNLGGSIASVAGSFDY  809



>gb|EMT04282.1| Auxin response factor 25 [Aegilops tauschii]
Length=1011

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/435 (82%), Positives = 388/435 (89%), Gaps = 7/435 (2%)
 Frame = +1

Query  619   EKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAHIPSYPGLPAQL  798
             E++CLNSELWHACAGPLVSLP +GSRV+YFPQGHSEQV ASTNKE+D+ IP+YP LP QL
Sbjct  139   EQRCLNSELWHACAGPLVSLPAVGSRVIYFPQGHSEQVAASTNKEVDSQIPNYPNLPPQL  198

Query  799   ICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPTNYFCKTLTAS  978
             ICQLHNVTMHAD ETDEVYAQMTLQPLS +EQK+   LP ELG  SKQPTNYFCKTLTAS
Sbjct  199   ICQLHNVTMHADAETDEVYAQMTLQPLSPEEQKEP-FLPIELGAASKQPTNYFCKTLTAS  257

Query  979   DTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFRGQPKRHLLTT  1158
             DTSTHGGFSVPRR+AEKVFPPLD+S QPP QELIAKDLH NEWKFRH+FRGQPKRHLLTT
Sbjct  258   DTSTHGGFSVPRRSAEKVFPPLDFSLQPPCQELIAKDLHDNEWKFRHIFRGQPKRHLLTT  317

Query  1159  GWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLLaaaa  1338
             GWSVFVSAKRLVAGD+VIFIWN+NNQLLLGIR ANRPQT+MPSSVLSSDSMHIGLLAAAA
Sbjct  318   GWSVFVSAKRLVAGDSVIFIWNDNNQLLLGIRHANRPQTIMPSSVLSSDSMHIGLLAAAA  377

Query  1339  haaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFETEESSVRRYMG  1518
             HAAATNSRFTIFYNPRASPS+F+IPLAKY K+VYHTRVSVGMRFRMLFETEESSVRRYMG
Sbjct  378   HAAATNSRFTIFYNPRASPSEFIIPLAKYVKSVYHTRVSVGMRFRMLFETEESSVRRYMG  437

Query  1519  TITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFSLRLK  1698
             TIT ISDLD VRWPNSHWRSVKVGWDESTAGE+QPRVSLWEIEPLTTFPMYP+ F LRLK
Sbjct  438   TITTISDLDSVRWPNSHWRSVKVGWDESTAGEKQPRVSLWEIEPLTTFPMYPTAFPLRLK  497

Query  1699  RPWPSGLPS----FPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPFMQPRLDA  1866
             RPW SGLPS    F G+ N D    S L WL    GD+G QSLNFQG G +P++QP++D+
Sbjct  498   RPWASGLPSMHDMFNGVKNDDFSRYSSLMWL--GDGDRGAQSLNFQGVGASPWLQPKMDS  555

Query  1867  SMLGLQPDIYQTMAT  1911
              +LGL+PD YQ MA 
Sbjct  556   PLLGLKPDTYQQMAA  570


 Score =   189 bits (481),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 130/308 (42%), Positives = 177/308 (57%), Gaps = 27/308 (9%)
 Frame = +1

Query  2338  RSFSHDEASQLLNMHETNPLAT---LPSKRIALE--SQVSSRATPYVVSQADMISPNSKV  2502
             R+FS  ++S L+++  T+ L      PSKR+A+E    + SR+   V  + + ++  S +
Sbjct  721   RNFSSQDSSNLVSLPRTDQLMAPEGWPSKRLAVEPLGHIESRS---VQPKHENVNHQSNM  777

Query  2503  SDLPTFLPPFPGKEFPEYQGVAYSQGNNALLGVNTDSSILLQNGISNLKNSGGENGFLNM  2682
             S     L P   ++    Q    +  N  L      SS   Q+G++  +  G  +G ++M
Sbjct  778   SHFAGTLAPQSARDSSSVQAYGANVDNQFL-----SSSFAFQDGMAGARG-GSSSGTVSM  831

Query  2683  PFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPP-NRTFVKVHKSGSFG  2859
                   ++   G D P    + TSSC+ ESG   S +N+   NP  + TFVKV+KSGS G
Sbjct  832   AIPLLRYS---GEDLPPADTLATSSCIGESGTFNSLDNMCGVNPSQDGTFVKVYKSGSPG  888

Query  2860  RSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVN  3039
             RSLDI+KFSSY+ELR EL  +FGLEG LEDP RSGWQLVFVDREND+LL+GDDPWQEFVN
Sbjct  889   RSLDITKFSSYYELRGELEHLFGLEGQLEDPVRSGWQLVFVDRENDILLVGDDPWQEFVN  948

Query  3040  NVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCE----VHVSQKETRNMNG  3207
             +V  IKILS  EV QM +  G  L ++ P A  R+   G+ C+     H  Q  T NM  
Sbjct  949   SVGCIKILSQQEVQQMVRGGGEGLLSSAPGA--RMAQ-GNVCDGYSGGHDLQNLTGNMAS  1005

Query  3208  IPLGSLDY  3231
             +P   LDY
Sbjct  1006  VP--PLDY  1011



>emb|CBA12001.1| putative auxin response factor 8 [Illicium parviflorum]
Length=794

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/432 (82%), Positives = 384/432 (89%), Gaps = 4/432 (1%)
 Frame = +1

Query  616   GEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAHIPSYPGLPAQ  795
             GEKK LNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV  STNKE++ HIP+YP L  Q
Sbjct  17    GEKKSLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAVSTNKEVNGHIPNYPSLSPQ  76

Query  796   LICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPTNYFCKTLTA  975
             LICQLHNVTMHAD ETDEVYAQMTLQPL+ QEQKD   LPAELG+PSKQPTNYFCKTLTA
Sbjct  77    LICQLHNVTMHADMETDEVYAQMTLQPLNQQEQKD-SYLPAELGVPSKQPTNYFCKTLTA  135

Query  976   SDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFRGQPKRHLLT  1155
             SDTSTHGGFSVPRRAAEKVFPPLD++QQPPAQEL+A+DLH  EWKFRH+FRGQPKRHLLT
Sbjct  136   SDTSTHGGFSVPRRAAEKVFPPLDFTQQPPAQELVARDLHDVEWKFRHIFRGQPKRHLLT  195

Query  1156  TGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLLaaa  1335
             TGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA+RPQTVMPSSVLSSDSMHIGLLAAA
Sbjct  196   TGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRASRPQTVMPSSVLSSDSMHIGLLAAA  255

Query  1336  ahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFETEESSVRRYM  1515
             AHAAATNSRFTIFYNPRASPS+FVIPL+KYAKAV+HTR+S  MRFRMLFET+ESSVRRYM
Sbjct  256   AHAAATNSRFTIFYNPRASPSEFVIPLSKYAKAVFHTRISDDMRFRMLFETDESSVRRYM  315

Query  1516  GTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFSLRL  1695
             G ITGISDLDPVRW NSHWRSVKV WDESTAGERQPRVSLWEIEPLTTFPMYPS F LRL
Sbjct  316   GRITGISDLDPVRWSNSHWRSVKVIWDESTAGERQPRVSLWEIEPLTTFPMYPSLFPLRL  375

Query  1696  KRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPFMQPRLDASML  1875
             KRPW  GLP+FP   + +   S+   WLRGN  ++G QSLNFQ +GI P+MQPR D  +L
Sbjct  376   KRPWHPGLPTFPDNKDDE---SNAFMWLRGNADERGFQSLNFQAFGIGPWMQPRFDPLLL  432

Query  1876  GLQPDIYQTMAT  1911
             G  PD YQ MA 
Sbjct  433   GTDPDQYQAMAA  444


 Score =   174 bits (441),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 94/115 (82%), Gaps = 4/115 (3%)
 Frame = +1

Query  2758  CVDES-GFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLE  2934
             C+DES G LQ   N  Q +PP RTFVKV+KSGS GRSLDI++FSSYHELR EL +MFGL 
Sbjct  649   CIDESSGLLQ---NEGQMDPPTRTFVKVYKSGSVGRSLDIAQFSSYHELREELGQMFGLG  705

Query  2935  GLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEE  3099
             G L DP RSGWQLVFVDRENDVLLLGDDPW+ FVNNVWYIKILSP +V  MGK +
Sbjct  706   GKLRDPLRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPDDVQNMGKHD  760



>gb|KHG28199.1| Auxin response factor 6 [Gossypium arboreum]
Length=892

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/450 (82%), Positives = 400/450 (89%), Gaps = 18/450 (4%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             MR+S AG +PQA EG  EK+ LNSELWHACAGPLVSLPP+GSRVVYFPQGHSEQV ASTN
Sbjct  1     MRLSSAGFSPQATEG--EKRVLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTN  58

Query  748   KE-IDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAEL  924
             KE +D H+P+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPL+ QEQK+   LPAEL
Sbjct  59    KEEVDVHVPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLNPQEQKE-AYLPAEL  117

Query  925   GMPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNE  1104
             G PS+QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH NE
Sbjct  118   GTPSRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNE  177

Query  1105  WKFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMP  1284
             WKFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMP
Sbjct  178   WKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMP  237

Query  1285  SSVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGM  1464
             SSVLSSDSMH+GLLAAAAHAA+TNSRFTIFYNPRASPS+FVIPL KY KAVYHTRVSVGM
Sbjct  238   SSVLSSDSMHLGLLAAAAHAASTNSRFTIFYNPRASPSEFVIPLTKYIKAVYHTRVSVGM  297

Query  1465  RFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEI  1644
             RFRMLFETEESSVRRYMGTITGISDLDP            VGWDESTAGERQPRVSLWEI
Sbjct  298   RFRMLFETEESSVRRYMGTITGISDLDP------------VGWDESTAGERQPRVSLWEI  345

Query  1645  EPLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQ  1824
             EPLTTFPMYPSPF LRLKRPWP+GLPSF G+ +  + ++SPL WL+G+ G +G+ SLNF 
Sbjct  346   EPLTTFPMYPSPFPLRLKRPWPAGLPSFHGIKDDGLGMNSPLMWLQGDAG-RGMPSLNFP  404

Query  1825  GYGITPFMQPRLD-ASMLGLQPDIYQTMAT  1911
             G G+ P+MQPRLD ASMLGLQ D++Q MA 
Sbjct  405   GIGVKPWMQPRLDAASMLGLQNDMHQAMAA  434


 Score =   328 bits (840),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 196/359 (55%), Positives = 248/359 (69%), Gaps = 14/359 (4%)
 Frame = +1

Query  2176  MSKPITSLPRMNSTTQSQLSHFQALSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHD  2355
             +S  ++++ +    +QS+ S FQA+ S   QQSFSD  G+ V +   S   SL  SF  D
Sbjct  541   ISTGVSAMSQYAPASQSRSSPFQAIPSLCQQQSFSDSNGHTVTSPIVSPLHSLLGSFPQD  600

Query  2356  EASQLLNMHETNPL---ATLPSKRIALESQVSSRATPYVVSQADMISPN-SKVSDLPTFL  2523
             E S LLN+  +NP+   A  PSKR A+E  +SS +   V+ Q + + P  + +S     L
Sbjct  601   EPSGLLNLPRSNPVITSAAWPSKRAAVEV-LSSGSPQCVLPQVEQLGPTQTNISHNSISL  659

Query  2524  PPFPGKEFPEYQGVAYSQGNNALLGVNTD-SSILLQNGISNLKNSGGENGFLNMPFSTCN  2700
             PPFPG+E    Q       ++ L GVN + SS+LLQNG+S+L+  G E+    +PFS+ N
Sbjct  660   PPFPGRECLIDQAAGTDPQSHLLFGVNIETSSLLLQNGMSSLRGVGSESDSTTIPFSS-N  718

Query  2701  FTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISK  2880
             + S  GTD+ +NP M  SSC+DE GFLQS ENV Q NP  RTFVKV+KSGSFGRSLDISK
Sbjct  719   YASTAGTDFSVNPAMTPSSCIDELGFLQSPENVGQENPQTRTFVKVYKSGSFGRSLDISK  778

Query  2881  FSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKI  3060
             FSSY+ELRSELARMFGLEG LEDP RSGWQLVFVDRENDVLLLGDDPW EFVN+VW IKI
Sbjct  779   FSSYNELRSELARMFGLEGQLEDPLRSGWQLVFVDRENDVLLLGDDPWPEFVNSVWCIKI  838

Query  3061  LSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNM-NGIP-LGSLDY  3231
             LSP EV QMGK  G++L N++P   QRL NG  SC+ + SQ+++RN+ +GI  +GSLDY
Sbjct  839   LSPQEVQQMGK-RGLELLNSVPV--QRLSNG--SCDDYASQQDSRNLSSGIASVGSLDY  892



>ref|XP_004288582.1| PREDICTED: auxin response factor 8-like isoform 1 [Fragaria vesca 
subsp. vesca]
Length=835

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/447 (80%), Positives = 393/447 (88%), Gaps = 8/447 (2%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S +G   Q  EG  EKKCLNSELWHACAGPLVSLP  G+RVVYFPQGHS+QV A+TN
Sbjct  1     MKLSTSGFGQQ--EGGAEKKCLNSELWHACAGPLVSLPTSGTRVVYFPQGHSDQVAATTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             K++DAHIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPL+ QEQK+   LP ELG
Sbjct  59    KQVDAHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLTPQEQKET-FLPMELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+S QPPAQELIA+DLH  EW
Sbjct  118   VPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSLQPPAQELIARDLHDVEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA RPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRATRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHA++TNS FT+FYNPRASPS+FVIPL+KY KAV+HTRVSVGMR
Sbjct  238   SVLSSDSMHIGLLAAAAHASSTNSCFTVFYNPRASPSEFVIPLSKYIKAVFHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LRLKRPW  G  S     + +   ++ L WLRG  G+QG+QS+NFQ 
Sbjct  358   PLTTFPMYPSLFPLRLKRPWHPGASSM----HDNRDEAANLMWLRGATGEQGLQSMNFQA  413

Query  1828  YGITPFMQPRLDASMLGLQPD-IYQTM  1905
              G+ P+MQ RLD++++G  P+  YQ M
Sbjct  414   VGMFPWMQQRLDSTLMGNDPNQQYQAM  440


 Score =   176 bits (447),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 112/244 (46%), Positives = 144/244 (59%), Gaps = 29/244 (12%)
 Frame = +1

Query  2512  PTFLPPFPGKEFPEYQGVAYSQGNN-ALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMP  2685
             P    PF  K+    Q    S   N  L GVN +SS ++    + N   S  +   + MP
Sbjct  617   PMSFAPFNEKDNAVEQENCNSDSQNPTLFGVNIESSGLVFPTTVPNFATSSND-ADMPMP  675

Query  2686  FSTCNFTSGVGTDYPLNPDMGTSSCV-DESGFLQSSENVDQANPPNRTFVKVHKSGSFGR  2862
                  F S +              C+ D +  L  +  VD   P N TFVKV+KSGS GR
Sbjct  676   LGDSGFQSSL------------YGCIQDSTELLHGAGQVDPPTP-NCTFVKVYKSGSVGR  722

Query  2863  SLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNN  3042
             SLDIS+FSSY++LR ELA+MFG+EG LED  RSGWQLVFVDRE+DVLLLGDDPW+ FVNN
Sbjct  723   SLDISRFSSYNQLREELAQMFGIEGKLEDCLRSGWQLVFVDREDDVLLLGDDPWESFVNN  782

Query  3043  VWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMNGIP-LG  3219
             VWYIKILSP +VH+MG ++ +D  +  P A QR+ +  +  + H+S        G+P LG
Sbjct  783   VWYIKILSPEDVHKMG-DQAVD--SFTPNAGQRVNSSANETQDHIS--------GLPSLG  831

Query  3220  SLDY  3231
             SL+Y
Sbjct  832   SLEY  835



>ref|XP_010675200.1| PREDICTED: auxin response factor 8 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=784

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/447 (80%), Positives = 390/447 (87%), Gaps = 6/447 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S +G+  Q  EG GEKKCLNSELWHACAGPLV LP  GSRVVYFPQGHSEQV A+TN
Sbjct  1     MKLSTSGLGQQGHEG-GEKKCLNSELWHACAGPLVCLPTAGSRVVYFPQGHSEQVAATTN  59

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             ++ID  IP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQKD+  LPA+ G
Sbjct  60    RDIDGQIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLSPQEQKDI-YLPADFG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PS+QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQEL+A+DLH  EW
Sbjct  119   IPSRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELVARDLHDVEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA RPQTVMPS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRATRPQTVMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAA TNS FT+F+NPRASPS+FVIPL+KY KAVYHTRVSVGMR
Sbjct  239   SVLSSDSMHIGLLAAAAHAANTNSCFTVFFNPRASPSEFVIPLSKYVKAVYHTRVSVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLD VRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  299   FRMLFETEESSVRRYMGTITGISDLDTVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  358

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LRLKRPW +G  S   LS+     ++ L WLRG  G+QG+ S+NFQ 
Sbjct  359   PLTTFPMYPSLFPLRLKRPWHAGTSS---LSDNIDDAANSLMWLRGQGGEQGLNSVNFQS  415

Query  1828  YGITPFMQPRLDASM-LGLQPDIYQTM  1905
              G+ P+MQ R+D+ + L  Q   YQ +
Sbjct  416   LGMYPWMQTRVDSLLPLSNQNQQYQAL  442


 Score =   144 bits (364),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 93/251 (37%), Positives = 134/251 (53%), Gaps = 18/251 (7%)
 Frame = +1

Query  2284  LVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMHETNPLATLPSKRIALESQVSSRATPYV  2463
             +  +H  T +N++   L  S +H     +L+   T  +  L        + ++ + + + 
Sbjct  549   MSSSHGKTDSNAANAELSSS-THSSMQNMLSSARTEGIGNLSDISNVNHTLLNEQTSQHP  607

Query  2464  VSQADMISPNSKVSDLPTFLPPFPGKEFP-EYQGVAYSQGNNALLGVNTDSS--ILLQNG  2634
             +   +  +P +   D  + LPP+PGK+   E    +    N+ + G N DSS  +L    
Sbjct  608   LVSLNSYTPINAFGDAVS-LPPYPGKDASLETGNCSLDVQNHNVFGANLDSSGLVLPMTM  666

Query  2635  ISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANP  2814
              +N + S  +    ++P     F + +              C   S  L S    D  NP
Sbjct  667   PTNYRASSNDTDLCSIPSGASGFHNSM------------YGCNSNSPELHSEGQGDLQNP  714

Query  2815  PNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDREN  2994
               RT+VKV+KSGS GRSLDIS+FSSYHELR EL +MFG+EG+L+DP RSGWQLVFVDREN
Sbjct  715   -TRTYVKVYKSGSVGRSLDISRFSSYHELREELGQMFGIEGMLDDPLRSGWQLVFVDREN  773

Query  2995  DVLLLGDDPWQ  3027
             DVLLLGDDPW+
Sbjct  774   DVLLLGDDPWE  784



>ref|XP_004490754.1| PREDICTED: auxin response factor 8-like [Cicer arietinum]
Length=833

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/448 (81%), Positives = 389/448 (87%), Gaps = 11/448 (2%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S +G++ Q  EG GEKKCLNSELWHACAGPLVSLP  G+RVVYFPQGHSEQV A+TN
Sbjct  1     MKLSTSGMSQQGHEG-GEKKCLNSELWHACAGPLVSLPTAGTRVVYFPQGHSEQVAATTN  59

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             +EID  IP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPL+ QEQKD   LP ELG
Sbjct  60    REIDGQIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLTPQEQKDT-FLPMELG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PSKQP+NYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH  EW
Sbjct  119   IPSKQPSNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDTEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA+RPQTVMPS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRASRPQTVMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNS FT+FYNPRASPS+FVIPL+KY KAVYHTRVSVGMR
Sbjct  239   SVLSSDSMHIGLLAAAAHAAATNSCFTVFYNPRASPSEFVIPLSKYIKAVYHTRVSVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTIT ISD+DP RWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  299   FRMLFETEESSVRRYMGTITSISDMDPARWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  358

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSF-PGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQ  1824
             PLTTFPMYPS F LRLKRPW  G  SF  G   G       L WLRG  GD G+ SLNFQ
Sbjct  359   PLTTFPMYPSLFPLRLKRPWHPGTSSFLDGRDEG-------LMWLRGGPGDHGLNSLNFQ  411

Query  1825  GYGITPFMQPRLDASMLG-LQPDIYQTM  1905
             G G+ P+MQ RL  ++LG  Q   YQ M
Sbjct  412   GAGLLPWMQQRLGPTLLGNDQNQQYQAM  439


 Score =   181 bits (459),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 135/220 (61%), Gaps = 27/220 (12%)
 Frame = +1

Query  2581  NNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSS  2757
             N+ L GVN DSS +LL   +     +  +     MP     F    G+ YP         
Sbjct  638   NSILFGVNIDSSGLLLPTTVPRYTTASADTDASTMPLGESGFQ---GSPYP---------  685

Query  2758  CV-DESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLE  2934
             C+ D S  LQS+  +D  N    TFVKV+K GS GRSLDIS+F+SYHEL  ELA+MFG+E
Sbjct  686   CMQDSSELLQSAGQIDNQNQ-TPTFVKVYKVGSVGRSLDISRFNSYHELWEELAQMFGIE  744

Query  2935  GLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLP  3114
             G  EDP RSGWQLVFVDRENDVLLLGDDPW+ FVNNVWYIKILSP ++ +MG++    L 
Sbjct  745   GKFEDPLRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDIQKMGEQAIESLG  804

Query  3115  NNLPAANQRLPNGGSSCEVHVSQKETRNMNGIP-LGSLDY  3231
                P++ QRL N G+     VS        G+P LGSL+Y
Sbjct  805   ---PSSGQRLNNTGAESHDIVS--------GLPSLGSLEY  833



>ref|XP_004162834.1| PREDICTED: auxin response factor 8-like [Cucumis sativus]
Length=854

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/437 (82%), Positives = 385/437 (88%), Gaps = 5/437 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S +G   Q  EG GEKKCLNSELWHACAGPLVSLP  G+RVVYFPQGHSEQV A+TN
Sbjct  1     MKLSTSGFGQQDHEG-GEKKCLNSELWHACAGPLVSLPTAGTRVVYFPQGHSEQVAATTN  59

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+D HIP+YP LP QLICQLHNVTMHA  ETDEVYAQMTLQPL+AQEQKD   LP ELG
Sbjct  60    KEVDGHIPNYPNLPPQLICQLHNVTMHAVVETDEVYAQMTLQPLTAQEQKDT-FLPMELG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PS+QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIAKDLH  EW
Sbjct  119   IPSRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIAKDLHDIEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA RPQTVMPS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRATRPQTVMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNS FT+FYNPRASPS+FVIPL KY KAV+HTRVSVGMR
Sbjct  239   SVLSSDSMHIGLLAAAAHAAATNSCFTVFYNPRASPSEFVIPLTKYVKAVFHTRVSVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  299   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  358

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LRLKRPW  G+ S   + +     S+ L WLRG +G+QG+ SLN Q 
Sbjct  359   PLTTFPMYPSLFPLRLKRPWHPGVSS---VHDNREDASNGLMWLRGGVGEQGLHSLNLQS  415

Query  1828  YGITPFMQPRLDASMLG  1878
                 P++Q RLD+SM G
Sbjct  416   VSSLPWLQQRLDSSMFG  432


 Score =   177 bits (450),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 115/242 (48%), Positives = 147/242 (61%), Gaps = 30/242 (12%)
 Frame = +1

Query  2521  LPPFPGKE-FPEYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFST  2694
              PPF G++   E         +  L GVN DSS +LL + +    +        +MP   
Sbjct  638   FPPFSGRDSILELGNCNSDSPSPTLFGVNIDSSGLLLPSNVPTYTSPSIGPDSSSMPLGD  697

Query  2695  CNFTSGVGTDYPLNPDMGTSSCV-DESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLD  2871
               F + +             SCV D S  L +S  VD +NP  RTFVKV+K+GS GRSLD
Sbjct  698   SGFQNSL------------YSCVQDSSELLHNSGQVDPSNP-TRTFVKVYKTGSVGRSLD  744

Query  2872  ISKFSSYHELRSELARMFGLEG-LLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVW  3048
             IS+FSSY ELR ELA+MFG+EG L+EDP RSGWQLVFVDRENDVLLLGDDPW+ FVNNV 
Sbjct  745   ISRFSSYQELREELAQMFGIEGQLVEDPRRSGWQLVFVDRENDVLLLGDDPWEAFVNNVG  804

Query  3049  YIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMNGIP-LGSL  3225
             +IKILSP +  ++G E+ I+  N  P   QRL +GG+         E  N++G+P +GSL
Sbjct  805   FIKILSPEDFQKLG-EQAIESFN--PIVGQRLTSGGN---------EAGNVSGLPSVGSL  852

Query  3226  DY  3231
             +Y
Sbjct  853   EY  854



>ref|XP_008813049.1| PREDICTED: auxin response factor 12-like isoform X1 [Phoenix 
dactylifera]
Length=804

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/447 (80%), Positives = 393/447 (88%), Gaps = 9/447 (2%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S AG+  QA+EG GEK+CLNSELWHACAGPLV LP +G+RVVYFPQGHSEQV ASTN
Sbjct  1     MKLSTAGLVQQAQEG-GEKRCLNSELWHACAGPLVCLPTVGTRVVYFPQGHSEQVAASTN  59

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE++  IP+YP LP QLICQLH+VTMHAD ETDEVYAQMTLQPL+ QE  D   LPAELG
Sbjct  60    KEVEGQIPNYPNLPPQLICQLHDVTMHADVETDEVYAQMTLQPLNPQELND-AYLPAELG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             + SKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQEL+A+DLH  EW
Sbjct  119   IMSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELLARDLHDVEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA+RPQTVMPS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRASRPQTVMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPL+KY KAV+HTRVSVGMR
Sbjct  239   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLSKYVKAVFHTRVSVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTIT ISDL P+RWPNSHWRSVK+GWDESTAGER PRVSLWEIE
Sbjct  299   FRMLFETEESSVRRYMGTITEISDLGPLRWPNSHWRSVKIGWDESTAGERPPRVSLWEIE  358

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LRLKRPW  G+PSF    N        L WLRG  GD+G+QS+NFQ 
Sbjct  359   PLTTFPMYPSLFPLRLKRPWYPGVPSFHDEGNA-------LMWLRGGSGDRGLQSINFQS  411

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMA  1908
              G+ P++Q R+++++LG   D YQ MA
Sbjct  412   PGMGPWVQQRMESTLLGNDHDQYQAMA  438


 Score =   193 bits (490),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 131/194 (68%), Gaps = 15/194 (8%)
 Frame = +1

Query  2518  FLPPFPGKEFP-EYQGVAYSQGNNALLGVNTDSSILLQNGISNLKNSGGENGFLNMPFST  2694
              LP FPGK+     +  +    N+ L GVN DSS LL + +  L+ +  +N    MP+++
Sbjct  620   LLPSFPGKDGSVGTENSSLDMQNHTLFGVNIDSSSLLSHAVPGLRTNSIDNDISTMPYAS  679

Query  2695  CNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDI  2874
              +  + +             S  + SG LQ   N ++A+P  +TFVKV+KSGS GRSLDI
Sbjct  680   SSLQNSI-----------YGSLKESSGVLQ---NAEEADPTTKTFVKVYKSGSVGRSLDI  725

Query  2875  SKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYI  3054
             ++F+SY ELR EL++MFG++G LEDP RSGWQLVFVDRENDVLLLGDDPW+ FVNNVWYI
Sbjct  726   TRFNSYDELREELSQMFGIKGRLEDPLRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYI  785

Query  3055  KILSPFEVHQMGKE  3096
             KILSP +V +MGK+
Sbjct  786   KILSPEDVQEMGKQ  799



>ref|XP_010675199.1| PREDICTED: auxin response factor 8 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=813

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/447 (80%), Positives = 390/447 (87%), Gaps = 6/447 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S +G+  Q  EG GEKKCLNSELWHACAGPLV LP  GSRVVYFPQGHSEQV A+TN
Sbjct  1     MKLSTSGLGQQGHEG-GEKKCLNSELWHACAGPLVCLPTAGSRVVYFPQGHSEQVAATTN  59

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             ++ID  IP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPLS QEQKD+  LPA+ G
Sbjct  60    RDIDGQIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLSPQEQKDI-YLPADFG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PS+QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQEL+A+DLH  EW
Sbjct  119   IPSRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELVARDLHDVEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA RPQTVMPS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRATRPQTVMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAA TNS FT+F+NPRASPS+FVIPL+KY KAVYHTRVSVGMR
Sbjct  239   SVLSSDSMHIGLLAAAAHAANTNSCFTVFFNPRASPSEFVIPLSKYVKAVYHTRVSVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLD VRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  299   FRMLFETEESSVRRYMGTITGISDLDTVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  358

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LRLKRPW +G  S   LS+     ++ L WLRG  G+QG+ S+NFQ 
Sbjct  359   PLTTFPMYPSLFPLRLKRPWHAGTSS---LSDNIDDAANSLMWLRGQGGEQGLNSVNFQS  415

Query  1828  YGITPFMQPRLDASM-LGLQPDIYQTM  1905
              G+ P+MQ R+D+ + L  Q   YQ +
Sbjct  416   LGMYPWMQTRVDSLLPLSNQNQQYQAL  442


 Score =   171 bits (434),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 107/273 (39%), Positives = 151/273 (55%), Gaps = 18/273 (7%)
 Frame = +1

Query  2284  LVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMHETNPLATLPSKRIALESQVSSRATPYV  2463
             +  +H  T +N++   L  S +H     +L+   T  +  L        + ++ + + + 
Sbjct  549   MSSSHGKTDSNAANAELSSS-THSSMQNMLSSARTEGIGNLSDISNVNHTLLNEQTSQHP  607

Query  2464  VSQADMISPNSKVSDLPTFLPPFPGKEFP-EYQGVAYSQGNNALLGVNTDSS--ILLQNG  2634
             +   +  +P +   D  + LPP+PGK+   E    +    N+ + G N DSS  +L    
Sbjct  608   LVSLNSYTPINAFGDAVS-LPPYPGKDASLETGNCSLDVQNHNVFGANLDSSGLVLPMTM  666

Query  2635  ISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANP  2814
              +N + S  +    ++P     F + +              C   S  L S    D  NP
Sbjct  667   PTNYRASSNDTDLCSIPSGASGFHNSM------------YGCNSNSPELHSEGQGDLQNP  714

Query  2815  PNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDREN  2994
               RT+VKV+KSGS GRSLDIS+FSSYHELR EL +MFG+EG+L+DP RSGWQLVFVDREN
Sbjct  715   -TRTYVKVYKSGSVGRSLDISRFSSYHELREELGQMFGIEGMLDDPLRSGWQLVFVDREN  773

Query  2995  DVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGK  3093
             DVLLLGDDPW+ FV NV YIKILSP +V ++GK
Sbjct  774   DVLLLGDDPWEAFVYNVSYIKILSPEDVQKLGK  806



>gb|AFQ94050.1| auxin response factor 1 [Camellia sinensis]
Length=820

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/435 (81%), Positives = 384/435 (88%), Gaps = 6/435 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S +G++ QA EG  E KCLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV A+TN
Sbjct  1     MKLSTSGLSQQAHEG--ENKCLNSELWHACAGPLVSLPTVGSRVVYFPQGHSEQVAATTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPL+ QEQKD   +P ELG
Sbjct  59    KEVDAHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLTPQEQKDT-YIPVELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPP QELIA+DLH  EW
Sbjct  118   IPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPCQELIARDLHDVEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA RPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRATRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAA+TNS FTIFYNPRASPS+FVIPL+KY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHIGLLAAAAHAASTNSCFTIFYNPRASPSEFVIPLSKYIKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGI DLDP+RW NSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGIGDLDPIRWANSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LRLKRPW  G  SF    +G     + ++WLRG  G+QG+ SLNFQ 
Sbjct  358   PLTTFPMYPSLFPLRLKRPWYPGASSF---QDGREGAVNGMTWLRGETGEQGLHSLNFQN  414

Query  1828  YGITPFMQPRLDASM  1872
              G+ P+ Q R+D + 
Sbjct  415   VGMFPWTQQRVDTTF  429


 Score =   190 bits (483),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 124/291 (43%), Positives = 163/291 (56%), Gaps = 39/291 (13%)
 Frame = +1

Query  2254  STVPQQSFSDL----VGNHVMTSNNSSTQSLPRSFSHDEASQLLNMHET-NPLATLPSKR  2418
             S VP  SFS +          TS     Q++  S S D ++ L N   T   + + PS++
Sbjct  543   SNVPSHSFSKIDFADSNAKFSTSVTPCIQNMLGSLSTDGSANLFNFSSTGQSMVSEPSQQ  602

Query  2419  IALESQVSSRATPYVVSQADMISPNSKVSDLPTFLPPFPGKEFP-EYQGVAYSQGNNALL  2595
               +     S+  P     A+ +S           L P+PGK+   E +  +    N+AL 
Sbjct  603   PWVSKFTHSQVNP----SANSVS-----------LTPYPGKDTAVEQENCSLDGQNHALF  647

Query  2596  GVNTDSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCV-DES  2772
             G N D  +LL   +S++  S       +MP     F S +              C+ D S
Sbjct  648   GANIDPGLLLPTTLSSIGTSSVNADVSSMPLGASGFQSSL------------YGCMQDSS  695

Query  2773  GFLQSSENVDQANPP--NRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLE  2946
               L S+  VD   PP  NRTFVKV+KSGS GRSLDIS+FSSY+ELR EL +MFG+EGLL+
Sbjct  696   ELLHSAAQVD---PPTANRTFVKVYKSGSVGRSLDISRFSSYNELREELGQMFGIEGLLK  752

Query  2947  DPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEE  3099
             DP+RSGWQLVFVDRE+DVLLLGD PW+ FVNNVWYIKILSP +V ++GK+E
Sbjct  753   DPQRSGWQLVFVDREDDVLLLGDGPWEAFVNNVWYIKILSPEDVLKLGKQE  803



>emb|CDP01733.1| unnamed protein product [Coffea canephora]
Length=845

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/444 (81%), Positives = 387/444 (87%), Gaps = 14/444 (3%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S +G+  QA EG  EKKCLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV A+TN
Sbjct  1     MKLSTSGLGQQAHEG--EKKCLNSELWHACAGPLVSLPTVGSRVVYFPQGHSEQVAATTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP LPAQLICQLHNVTMHAD ETDEVYAQMTLQPL+ QEQKD   LP ELG
Sbjct  59    KEVDAHIPNYPSLPAQLICQLHNVTMHADVETDEVYAQMTLQPLTPQEQKDT-YLPVELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PS+QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD++Q PPAQELIA+DLH  EW
Sbjct  118   TPSRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFTQTPPAQELIARDLHDVEW  177

Query  1108  KFRHVFRG--------QPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRAN  1263
             KFRH+FRG        QPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA 
Sbjct  178   KFRHIFRGKFGFLLFGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRAT  237

Query  1264  RPQTVMPSSVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYH  1443
             RPQTVMPSSVLSSDSMHIGLLAAAAHAAATNS FTIFYNPRASPS+FVIPL+KY KAVYH
Sbjct  238   RPQTVMPSSVLSSDSMHIGLLAAAAHAAATNSCFTIFYNPRASPSEFVIPLSKYFKAVYH  297

Query  1444  TRVSVGMRFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQP  1623
             TRVSVGMRFRMLFETEESSVRRYMGTITGI DLDPVRWPNSHWRSVKVGWDESTAGERQP
Sbjct  298   TRVSVGMRFRMLFETEESSVRRYMGTITGIGDLDPVRWPNSHWRSVKVGWDESTAGERQP  357

Query  1624  RVSLWEIEPLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQG  1803
             RVSLWEIEPLTTFPMYPS F LRLKRPW  G  SF    N  ++    ++WLRG  G+QG
Sbjct  358   RVSLWEIEPLTTFPMYPSLFPLRLKRPWYPGASSFQDAGNEAVN---GMTWLRGETGEQG  414

Query  1804  IQSLNFQGYGITPFMQPRLDASML  1875
             + SLNF   G+ P+MQ R+D SML
Sbjct  415   LHSLNFPSVGMLPWMQQRIDPSML  438


 Score =   195 bits (496),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 132/298 (44%), Positives = 169/298 (57%), Gaps = 35/298 (12%)
 Frame = +1

Query  2242  QALSSTVPQQSFS--DLVGNHVMTSNN---SSTQSLPRSFSHDEASQLLNMHETNPLATL  2406
             Q  SS +P  SFS  D   ++   S +   SS Q++  S   + ++ LLN   T    T+
Sbjct  545   QRQSSNIPSPSFSKTDFADSNTKFSASIAPSSMQNVLGSLCSEGSTSLLNFSRTT--QTM  602

Query  2407  PSKRIALESQVSSRATPYVVSQADMISPNSKVSDLPTFLPPFPGKEFPEYQ-GVAYSQGN  2583
              +++   +S VS     Y   Q +  S  +        LPP+PGK+ P  Q        N
Sbjct  603   LNEQPPQQSWVSK----YSHGQVNTCSSAAS-------LPPYPGKDGPSGQEACGLDAQN  651

Query  2584  NALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSC  2760
              AL G N DS+ +LL   +S++  S  + G  +MP     F          NP  G    
Sbjct  652   QALFGANIDSAALLLPTTVSSVGTSSIDAGVSSMPLGDSGFQ---------NPLYGF--V  700

Query  2761  VDESGFLQSSENVDQANPPN-RTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEG  2937
              D S  L  +    Q +P   RTFVKVHK G  GRSLDIS+F+SYHELR EL +M+G+EG
Sbjct  701   HDSSELLHGT---GQDSPTRARTFVKVHKLGCVGRSLDISRFNSYHELRQELGQMYGIEG  757

Query  2938  LLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDL  3111
             LLEDP+RSGWQLVFVDRENDVLLLGDDPW+ FVNNVWYIKILSP EV ++GK+EG  L
Sbjct  758   LLEDPQRSGWQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPEEVQKLGKQEGESL  815



>ref|XP_007032138.1| Auxin response factor 8-1 [Theobroma cacao]
 gb|EOY03064.1| Auxin response factor 8-1 [Theobroma cacao]
Length=838

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/447 (81%), Positives = 388/447 (87%), Gaps = 7/447 (2%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S +G+     EG  E KCLNSELWHACAGPLV LP +GSRVVYFPQGHSEQV A+TN
Sbjct  1     MKLSASGLGQHGHEG--ENKCLNSELWHACAGPLVCLPTVGSRVVYFPQGHSEQVAATTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPL+ +EQKD   LP ELG
Sbjct  59    KEVDAHIPNYPNLPPQLICQLHNVTMHADVETDEVYAQMTLQPLTPEEQKDT-FLPMELG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH  EW
Sbjct  118   IPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDAEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA RPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRATRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNS FTIFYNPRASPS+FVIPL+KY KAV+HTRVSVGMR
Sbjct  238   SVLSSDSMHIGLLAAAAHAAATNSCFTIFYNPRASPSEFVIPLSKYVKAVFHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLD VRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGISDLDSVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LRLKRPW  G  S   L +    +++ L WLRG  GDQG+ SLNFQ 
Sbjct  358   PLTTFPMYPSLFPLRLKRPWHPGSSS---LHDNRDDVANGLMWLRGGSGDQGLHSLNFQS  414

Query  1828  YGITPFMQPRLDASMLGLQPDI-YQTM  1905
             +G  P+MQ RLD S  G    + YQ M
Sbjct  415   FGSFPWMQQRLDLSFPGNDHTLQYQAM  441


 Score =   186 bits (471),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 120/244 (49%), Positives = 148/244 (61%), Gaps = 30/244 (12%)
 Frame = +1

Query  2515  TFLPP-FPGKEF---PEYQGVAYSQGNNALLGVNTDS-SILLQNGISNLKNSGGENGFLN  2679
             T LPP F GK+    PE  G + +Q N+AL G N DS  +LL   +     S  E    +
Sbjct  620   TSLPPVFHGKDAIIEPEI-GSSDAQ-NSALFGGNNDSYGLLLPTTMPGFATSSSEADVPS  677

Query  2680  MPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFG  2859
             +P    +F          NP  G   C+ +S  LQS+  VD   P  RTFVKV+KSGS G
Sbjct  678   IPLGDPSFQ---------NPLFG---CMQDSSELQSTGQVDPPTP-TRTFVKVYKSGSVG  724

Query  2860  RSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVN  3039
             RSLDIS+FSSYHELR ELA+MFG+EG LEDP RSGWQLVFVDREND+LLLGDDPW  FVN
Sbjct  725   RSLDISRFSSYHELREELAQMFGIEGKLEDPLRSGWQLVFVDRENDILLLGDDPWDAFVN  784

Query  3040  NVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMNGIPLG  3219
             NVWYIKILSP +V +MG++    +    P   QR+ + G+     VS   +       +G
Sbjct  785   NVWYIKILSPEDVQKMGEQR---VEPFSPTPGQRMNSSGTGARDRVSGLSS-------VG  834

Query  3220  SLDY  3231
             SL+Y
Sbjct  835   SLEY  838



>ref|XP_004288583.1| PREDICTED: auxin response factor 8-like isoform 2 [Fragaria vesca 
subsp. vesca]
Length=776

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/447 (80%), Positives = 393/447 (88%), Gaps = 9/447 (2%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S +G   Q  EG  EKKCLNSELWHACAGPLVSLP  G+RVVYFPQGHS+QV A+TN
Sbjct  1     MKLSTSGFGQQ--EG-AEKKCLNSELWHACAGPLVSLPTSGTRVVYFPQGHSDQVAATTN  57

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             K++DAHIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPL+ QEQK+   LP ELG
Sbjct  58    KQVDAHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLTPQEQKET-FLPMELG  116

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+S QPPAQELIA+DLH  EW
Sbjct  117   VPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSLQPPAQELIARDLHDVEW  176

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA RPQTVMPS
Sbjct  177   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRATRPQTVMPS  236

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHA++TNS FT+FYNPRASPS+FVIPL+KY KAV+HTRVSVGMR
Sbjct  237   SVLSSDSMHIGLLAAAAHASSTNSCFTVFYNPRASPSEFVIPLSKYIKAVFHTRVSVGMR  296

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  297   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  356

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LRLKRPW  G  S     + +   ++ L WLRG  G+QG+QS+NFQ 
Sbjct  357   PLTTFPMYPSLFPLRLKRPWHPGASSM----HDNRDEAANLMWLRGATGEQGLQSMNFQA  412

Query  1828  YGITPFMQPRLDASMLGLQPD-IYQTM  1905
              G+ P+MQ RLD++++G  P+  YQ M
Sbjct  413   VGMFPWMQQRLDSTLMGNDPNQQYQAM  439


 Score =   129 bits (324),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 100/175 (57%), Gaps = 17/175 (10%)
 Frame = +1

Query  2512  PTFLPPFPGKEFPEYQGVAYSQGNN-ALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMP  2685
             P    PF  K+    Q    S   N  L GVN +SS ++    + N   S  +   + MP
Sbjct  616   PMSFAPFNEKDNAVEQENCNSDSQNPTLFGVNIESSGLVFPTTVPNFATSSNDAD-MPMP  674

Query  2686  FSTCNFTSGVGTDYPLNPDMGTSSCV-DESGFLQSSENVDQANPPNRTFVKVHKSGSFGR  2862
                  F S +              C+ D +  L  +  VD   P N TFVKV+KSGS GR
Sbjct  675   LGDSGFQSSL------------YGCIQDSTELLHGAGQVDPPTP-NCTFVKVYKSGSVGR  721

Query  2863  SLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQ  3027
             SLDIS+FSSY++LR ELA+MFG+EG LED  RSGWQLVFVDRE+DVLLLGDDPW+
Sbjct  722   SLDISRFSSYNQLREELAQMFGIEGKLEDCLRSGWQLVFVDREDDVLLLGDDPWE  776



>gb|ADG43143.1| auxin response factor 9 [Zea mays]
Length=881

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/435 (82%), Positives = 383/435 (88%), Gaps = 3/435 (1%)
 Frame = +1

Query  607   EGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAHIPSYPGL  786
             E  GE++CLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTNKE+DA IP+YP L
Sbjct  7     ESDGEQRCLNSELWHACAGPLVSLPVVGSRVVYFPQGHSEQVAASTNKEVDAQIPNYPNL  66

Query  787   PAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPTNYFCKT  966
             P QLICQLHNVTMHAD ET EVYAQMTLQPLS +EQK+   LP ELG  S QPTNYFCKT
Sbjct  67    PPQLICQLHNVTMHADAETGEVYAQMTLQPLSPEEQKEP-FLPIELGAGSNQPTNYFCKT  125

Query  967   LTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFRGQPKRH  1146
             LTASDTSTHGGFSVPRRAAEKVFPPLD+SQ PP QEL+A+DLH NEWKFRH+FRGQPKRH
Sbjct  126   LTASDTSTHGGFSVPRRAAEKVFPPLDFSQHPPVQELVARDLHDNEWKFRHIFRGQPKRH  185

Query  1147  LLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLL  1326
             LLTTGWSVFVSAKRLVAGD++IFIWN+NNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLL
Sbjct  186   LLTTGWSVFVSAKRLVAGDSIIFIWNDNNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLL  245

Query  1327  aaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFETEESSVR  1506
             AAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMRFRMLFETEESSVR
Sbjct  246   AAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMRFRMLFETEESSVR  305

Query  1507  RYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFS  1686
             RYMGTIT ISDLD  RWPNSHWRSVKVGWDESTAG++QPRVSLWEIEPL  FPMYP+ F 
Sbjct  306   RYMGTITCISDLDSERWPNSHWRSVKVGWDESTAGDKQPRVSLWEIEPLMAFPMYPTAFP  365

Query  1687  LRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPFMQPRLDA  1866
             LRLKRPW SGLP F G  + +    S L WLR   G++G QSLNFQG G +P++QPR+D 
Sbjct  366   LRLKRPWASGLPMFNGGRSDEFARYSSLMWLRD--GNRGAQSLNFQGLGASPWLQPRIDY  423

Query  1867  SMLGLQPDIYQTMAT  1911
              +LGL+ D YQ MA 
Sbjct  424   PLLGLKLDTYQQMAA  438


 Score =   191 bits (486),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 125/301 (42%), Positives = 174/301 (58%), Gaps = 20/301 (7%)
 Frame = +1

Query  2347  SHDEASQLLNMHETNPLAT---LPSKRIALESQVSSRATPYVVSQADMISPNSKVSDLPT  2517
             S  E+S LLN+  +         P KR+A+ES       P V  + + ++  S VS + +
Sbjct  595   SSQESSNLLNLSRSGQFMASEGWPLKRLAVESLSGHELQP-VQHKFEKVNHQSNVSHISS  653

Query  2518  FLPPFPGKEFPEYQGVAYSQGNNALLGVNTDSSILLQNGISNLKNSGGENGFLNMPFSTC  2697
              LPP   ++    Q    +  ++ L      SS  + +G++ +++ G  +G   +  ++ 
Sbjct  654   TLPPLSARDSYSAQASGTNDQSHLL-----SSSFAIHDGLTAVRSGGVGSGTDAITIASL  708

Query  2698  NFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPP-NRTFVKVHKSGSFGRSLDI  2874
              +        P NP + TSSC+ ESG   S ++V   NP    TFVKV+KSGS GRSLDI
Sbjct  709   RYNDM--NLLPENP-IATSSCLGESGTFNSLDDVCGVNPSQGGTFVKVYKSGSPGRSLDI  765

Query  2875  SKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYI  3054
             ++FSSY+ELRSEL R+FGLEG LEDP RSGWQLVFVDREND+LL+GDDPWQEFVN+VW I
Sbjct  766   TRFSSYYELRSELERLFGLEGQLEDPVRSGWQLVFVDRENDILLVGDDPWQEFVNSVWCI  825

Query  3055  KILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMNG--IPLGSLD  3228
             KILSP +V QM +  G  L        Q     GS C+ + +  + +N+ G   P+  LD
Sbjct  826   KILSPQDVQQMVRGGGDLLSTTGVRTLQ-----GSVCDDYSAGHDMQNLTGSIAPVVPLD  880

Query  3229  Y  3231
             Y
Sbjct  881   Y  881



>ref|NP_001146279.1| uncharacterized protein LOC100279854 [Zea mays]
 gb|ACL53622.1| unknown [Zea mays]
 gb|AFT82690.1| ARF9 ARF type transcription factor, partial [Zea mays subsp. 
mays]
 tpg|DAA55141.1| TPA: hypothetical protein ZEAMMB73_057592 [Zea mays]
Length=888

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/435 (82%), Positives = 383/435 (88%), Gaps = 3/435 (1%)
 Frame = +1

Query  607   EGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAHIPSYPGL  786
             E  GE++CLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTNKE+DA IP+YP L
Sbjct  14    ESDGEQRCLNSELWHACAGPLVSLPVVGSRVVYFPQGHSEQVAASTNKEVDAQIPNYPNL  73

Query  787   PAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPTNYFCKT  966
             P QLICQLHNVTMHAD ET EVYAQMTLQPLS +EQK+   LP ELG  S QPTNYFCKT
Sbjct  74    PPQLICQLHNVTMHADAETGEVYAQMTLQPLSPEEQKEP-FLPIELGAGSNQPTNYFCKT  132

Query  967   LTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFRGQPKRH  1146
             LTASDTSTHGGFSVPRRAAEKVFPPLD+SQ PP QEL+A+DLH NEWKFRH+FRGQPKRH
Sbjct  133   LTASDTSTHGGFSVPRRAAEKVFPPLDFSQHPPVQELVARDLHDNEWKFRHIFRGQPKRH  192

Query  1147  LLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLL  1326
             LLTTGWSVFVSAKRLVAGD++IFIWN+NNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLL
Sbjct  193   LLTTGWSVFVSAKRLVAGDSIIFIWNDNNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLL  252

Query  1327  aaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFETEESSVR  1506
             AAAAHAAATNSRFTIFYNPRASPS+FVIPLAKY KAVYHTRVSVGMRFRMLFETEESSVR
Sbjct  253   AAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMRFRMLFETEESSVR  312

Query  1507  RYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFS  1686
             RYMGTIT ISDLD  RWPNSHWRSVKVGWDESTAG++QPRVSLWEIEPL  FPMYP+ F 
Sbjct  313   RYMGTITCISDLDSERWPNSHWRSVKVGWDESTAGDKQPRVSLWEIEPLMAFPMYPTAFP  372

Query  1687  LRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQGYGITPFMQPRLDA  1866
             LRLKRPW SGLP F G  + +    S L WLR   G++G QSLNFQG G +P++QPR+D 
Sbjct  373   LRLKRPWASGLPMFNGGRSDEFARYSSLMWLRD--GNRGAQSLNFQGLGASPWLQPRIDY  430

Query  1867  SMLGLQPDIYQTMAT  1911
              +LGL+ D YQ MA 
Sbjct  431   PLLGLKLDTYQQMAA  445


 Score =   191 bits (486),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 125/301 (42%), Positives = 174/301 (58%), Gaps = 20/301 (7%)
 Frame = +1

Query  2347  SHDEASQLLNMHETNPLAT---LPSKRIALESQVSSRATPYVVSQADMISPNSKVSDLPT  2517
             S  E+S LLN+  +         P KR+A+ES       P V  + + ++  S VS + +
Sbjct  602   SSQESSNLLNLSRSGQFMASEGWPLKRLAVESLSGHELQP-VQHKFEKVNHQSNVSHISS  660

Query  2518  FLPPFPGKEFPEYQGVAYSQGNNALLGVNTDSSILLQNGISNLKNSGGENGFLNMPFSTC  2697
              LPP   ++    Q    +  ++ L      SS  + +G++ +++ G  +G   +  ++ 
Sbjct  661   TLPPLSARDSYSAQASGTNDQSHLL-----SSSFAIHDGLTAVRSGGVGSGTDAITIASL  715

Query  2698  NFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPP-NRTFVKVHKSGSFGRSLDI  2874
              +        P NP + TSSC+ ESG   S ++V   NP    TFVKV+KSGS GRSLDI
Sbjct  716   RYNDM--NLLPENP-IATSSCLGESGTFNSLDDVCGVNPSQGGTFVKVYKSGSPGRSLDI  772

Query  2875  SKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYI  3054
             ++FSSY+ELRSEL R+FGLEG LEDP RSGWQLVFVDREND+LL+GDDPWQEFVN+VW I
Sbjct  773   TRFSSYYELRSELERLFGLEGQLEDPVRSGWQLVFVDRENDILLVGDDPWQEFVNSVWCI  832

Query  3055  KILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMNG--IPLGSLD  3228
             KILSP +V QM +  G  L        Q     GS C+ + +  + +N+ G   P+  LD
Sbjct  833   KILSPQDVQQMVRGGGDLLSTTGVRTLQ-----GSVCDDYSAGHDMQNLTGSIAPVVPLD  887

Query  3229  Y  3231
             Y
Sbjct  888   Y  888



>ref|XP_011048868.1| PREDICTED: auxin response factor 8-like [Populus euphratica]
Length=831

 Score =   716 bits (1847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/437 (82%), Positives = 386/437 (88%), Gaps = 5/437 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S +G+  Q     GEKKCLNSELWHACAGPLVSLP  GSRVVYFPQGHSEQV A+TN
Sbjct  1     MKLSTSGLGGQQAGQEGEKKCLNSELWHACAGPLVSLPTAGSRVVYFPQGHSEQVAATTN  60

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPL+ QEQK+  LLP +LG
Sbjct  61    KEVDAHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLTPQEQKET-LLPMDLG  119

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD++QQPPAQELIA+DLH  EW
Sbjct  120   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFTQQPPAQELIARDLHDVEW  179

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA RPQTVMPS
Sbjct  180   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRATRPQTVMPS  239

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNS FT+FYNPRASPS+FVIPL+KY KAV+HTR+SVGMR
Sbjct  240   SVLSSDSMHIGLLAAAAHAAATNSCFTVFYNPRASPSEFVIPLSKYVKAVFHTRISVGMR  299

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  300   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  359

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LRLKRPW  G  S   L + D   S+ L WLRG  G+ G+ SLNFQ 
Sbjct  360   PLTTFPMYPSLFPLRLKRPWQHGSSSV--LDSRD-EASNGLMWLRGGSGEPGLPSLNFQA  416

Query  1828  YGITPFMQPRLDASMLG  1878
               + P+MQ RLD  MLG
Sbjct  417   -NMLPWMQQRLDPMMLG  432


 Score =   167 bits (423),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 100/204 (49%), Positives = 126/204 (62%), Gaps = 21/204 (10%)
 Frame = +1

Query  2551  EYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDY  2727
             E +  +    N  L G N DSS +LL   +     S  +    +MP     F + +    
Sbjct  644   EAENCSSDAQNPTLFGANIDSSGLLLPTTVPRYSTSSIDADVSSMPLGDSGFQNSL----  699

Query  2728  PLNPDMGTSSCVDESGFLQSSENVDQANPP--NRTFVKVHKSGSFGRSLDISKFSSYHEL  2901
                       CV +S  L S  N  Q +PP  + TFVKV+KSGS GRSLDIS+  SYHEL
Sbjct  700   --------YGCVQDSSELLS--NAGQMDPPTPSGTFVKVYKSGSVGRSLDISR--SYHEL  747

Query  2902  RSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVH  3081
             R ELA+MFG+EG LE+P RSGWQLVFVDRENDVLLLGDDPW+ FVNNVWYIKILSP +V 
Sbjct  748   RGELAQMFGIEGKLENPHRSGWQLVFVDRENDVLLLGDDPWELFVNNVWYIKILSPEDVL  807

Query  3082  QMGKEEGIDLPNNLPAANQRLPNG  3153
             ++G++ G++ P+  P A  R+  G
Sbjct  808   KLGEQGGVE-PSG-PNAVHRMSGG  829



>ref|XP_002305917.2| hypothetical protein POPTR_0004s07640g [Populus trichocarpa]
 gb|EEE86428.2| hypothetical protein POPTR_0004s07640g [Populus trichocarpa]
Length=827

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/437 (82%), Positives = 387/437 (89%), Gaps = 8/437 (2%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S +G+  Q     GEKKCLNSELWHACAGPLVSLP  GSRVVYFPQGHSEQV A+TN
Sbjct  1     MKLSTSGLGGQQ---AGEKKCLNSELWHACAGPLVSLPTAGSRVVYFPQGHSEQVAATTN  57

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPL+ QEQK+   LP +LG
Sbjct  58    KEVDAHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLTPQEQKET-FLPMDLG  116

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD++QQPPAQELIA+DLH  EW
Sbjct  117   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFTQQPPAQELIARDLHDVEW  176

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA RPQTVMPS
Sbjct  177   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRATRPQTVMPS  236

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNS FT+FYNPRASPS+FVIPL+KY KAV+HTR+SVGMR
Sbjct  237   SVLSSDSMHIGLLAAAAHAAATNSCFTVFYNPRASPSEFVIPLSKYVKAVFHTRISVGMR  296

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  297   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  356

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LRLKRPW  G PS   L + D   S+ L WLRG  G+ G+ SLNFQ 
Sbjct  357   PLTTFPMYPSLFPLRLKRPWHPGSPSL--LDSRD-EASNGLMWLRGGSGEPGLPSLNFQA  413

Query  1828  YGITPFMQPRLDASMLG  1878
               + P+MQ RLD +MLG
Sbjct  414   -NMLPWMQQRLDPTMLG  429


 Score =   174 bits (440),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 128/204 (63%), Gaps = 20/204 (10%)
 Frame = +1

Query  2551  EYQGVAYSQGNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDY  2727
             E +  +    N  L G N DSS +LL   +     S  +    +MP     F + +    
Sbjct  639   EAENCSSDAQNPTLFGANIDSSGLLLPTTVPRYSTSSIDADVSSMPLGDSGFQNSL----  694

Query  2728  PLNPDMGTSSCVDESGFLQSSENVDQANPP--NRTFVKVHKSGSFGRSLDISKFSSYHEL  2901
                       CV +S  L S  N  Q +PP  + TFVKV+KSGS GRSLDIS+FSSYHEL
Sbjct  695   --------YGCVQDSSELLS--NAGQMDPPTPSGTFVKVYKSGSVGRSLDISRFSSYHEL  744

Query  2902  RSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVH  3081
             R ELA+MFG+EG LE+P RSGWQLVFVDRENDVLLLGDDPW+ FVNNVWYIKILSP +V 
Sbjct  745   RGELAQMFGIEGKLENPHRSGWQLVFVDRENDVLLLGDDPWELFVNNVWYIKILSPEDVL  804

Query  3082  QMGKEEGIDLPNNLPAANQRLPNG  3153
             ++G E+G++ P+  P A  R+  G
Sbjct  805   KLG-EQGVE-PSG-PNAVHRMSGG  825



>ref|XP_010935427.1| PREDICTED: auxin response factor 12-like isoform X1 [Elaeis guineensis]
 ref|XP_010935429.1| PREDICTED: auxin response factor 12-like isoform X1 [Elaeis guineensis]
 ref|XP_010935430.1| PREDICTED: auxin response factor 12-like isoform X1 [Elaeis guineensis]
Length=804

 Score =   714 bits (1844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/448 (79%), Positives = 391/448 (87%), Gaps = 9/448 (2%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S AG+  QA+EG GEK+CLNSELWHACAGPLV LP +G+RVVYFPQGHSEQV ASTN
Sbjct  1     MKLSTAGLGQQAQEG-GEKRCLNSELWHACAGPLVCLPTVGTRVVYFPQGHSEQVAASTN  59

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE++  IP+YP LP QLICQLH+VTMHAD ETDEVYAQMTLQPL+ QE  D   LPAE+G
Sbjct  60    KEVEGQIPNYPNLPPQLICQLHDVTMHADVETDEVYAQMTLQPLNPQELND-AYLPAEMG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             + SKQPTNYFCK LTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQEL+A+DLH  EW
Sbjct  119   IISKQPTNYFCKILTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELVARDLHDVEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRL+AGD+V+FIWNE NQLLLGIRRA+RPQTVMPS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSVFVSAKRLLAGDSVLFIWNEKNQLLLGIRRASRPQTVMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPL+KY KAV+HTR+SVGMR
Sbjct  239   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLSKYVKAVFHTRISVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTIT ISDLDPVRWP+SHWRSVKVGWDESTAGER PRVSLWEIE
Sbjct  299   FRMLFETEESSVRRYMGTITEISDLDPVRWPHSHWRSVKVGWDESTAGERPPRVSLWEIE  358

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LRLKRPW  G+PSF    N        L WLRG   D+G+QSLNFQ 
Sbjct  359   PLTTFPMYPSLFPLRLKRPWYPGIPSFHDDGNA-------LMWLRGGAADRGLQSLNFQS  411

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMAT  1911
              G+ P++Q R+++++LG   D Y  MA 
Sbjct  412   PGMGPWVQQRMESTLLGHDHDQYSAMAA  439


 Score =   187 bits (475),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 130/195 (67%), Gaps = 17/195 (9%)
 Frame = +1

Query  2515  TFLPPFPGKE--FPEYQGVAYSQGNNALLGVNTDSSILLQNGISNLKNSGGENGFLNMPF  2688
               LP F GK+       G A  Q N+ L GVN DSS LL + + +L+ +  ++    MP+
Sbjct  619   VLLPSFHGKDGSVGTENGSADMQ-NHTLFGVNIDSSSLLSHAVPSLRANSIDDNISTMPY  677

Query  2689  STCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSL  2868
             ++ +  + +             S  + SG LQ   N  +A+P  +TFVKV+KSGS GRSL
Sbjct  678   ASSSLQNSI-----------YGSLEESSGVLQ---NAGEADPTTKTFVKVYKSGSVGRSL  723

Query  2869  DISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVW  3048
             DI++F++Y ELR EL +MFG++G LEDP RSGWQLVFVDRENDVLLLGDDPW+ FVNNVW
Sbjct  724   DITRFNNYDELREELGQMFGIKGQLEDPLRSGWQLVFVDRENDVLLLGDDPWESFVNNVW  783

Query  3049  YIKILSPFEVHQMGK  3093
             YIKILSP +VH+MGK
Sbjct  784   YIKILSPEDVHKMGK  798



>ref|XP_009341867.1| PREDICTED: auxin response factor 8-like isoform X2 [Pyrus x bretschneideri]
Length=841

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/439 (80%), Positives = 389/439 (89%), Gaps = 7/439 (2%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTG--EKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTAS  741
             M++S +G+  Q  EG G  EKKCLNSELWHACAGPLVSLP  G+RVVYFPQGHS+QV A+
Sbjct  1     MKLSTSGLGQQDHEGGGGLEKKCLNSELWHACAGPLVSLPTPGTRVVYFPQGHSDQVAAT  60

Query  742   TNKEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAE  921
             TNK++DAHIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPL+ QEQK+   LP E
Sbjct  61    TNKQVDAHIPNYPNLPPQLICQLHNVTMHADVETDEVYAQMTLQPLTPQEQKET-FLPME  119

Query  922   LGMPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGN  1101
             LG+PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+S QPPAQELIA+DLH  
Sbjct  120   LGLPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSLQPPAQELIARDLHDV  179

Query  1102  EWKFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVM  1281
             EWKFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIR A RPQTVM
Sbjct  180   EWKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRHATRPQTVM  239

Query  1282  PSSVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVG  1461
             PSSVLSSDSMHIGLLAAAAHAA+TNS FT+FYNPRASPS+FVIPL+KY KAV+HTRVSVG
Sbjct  240   PSSVLSSDSMHIGLLAAAAHAASTNSCFTVFYNPRASPSEFVIPLSKYIKAVFHTRVSVG  299

Query  1462  MRFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWE  1641
             MRFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDEST+GERQPRVSLWE
Sbjct  300   MRFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTSGERQPRVSLWE  359

Query  1642  IEPLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNF  1821
             IEPLTTFPMYPS F LRLKRPW  G  S     + +   ++ L WLRG  G+QG+QS+NF
Sbjct  360   IEPLTTFPMYPSLFPLRLKRPWIPGASSL----HDNRDEANSLMWLRGGAGEQGLQSMNF  415

Query  1822  QGYGITPFMQPRLDASMLG  1878
             Q  G+ P+MQ RLD++++G
Sbjct  416   QSVGMFPWMQQRLDSTLIG  434


 Score =   179 bits (453),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 111/240 (46%), Positives = 142/240 (59%), Gaps = 27/240 (11%)
 Frame = +1

Query  2521  LPPFPGKEFP-EYQGVAYSQGNNALLGVNTDSSILLQNGISNLKNSGGENGFLNMPFSTC  2697
              PPF  K+   E + +     N  L GVN +SS LL    +    +   +  ++MP    
Sbjct  626   FPPFNEKDNAVEQENLNSDTHNPTLFGVNIESSGLLFPNTAPSFATSSNDADISMPLGNS  685

Query  2698  NFTSGVGTDYPLNPDMGTSSCV-DESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDI  2874
              F S +              C+ D S  L  +  VD   P N TFVKV+KSGS GRS+DI
Sbjct  686   GFQSSL------------YGCMQDSSELLHGAGQVDPPTPNNCTFVKVYKSGSVGRSIDI  733

Query  2875  SKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYI  3054
             S+FSSYHELR EL +MFG+EG LE   RSGWQLVFVDRE+DVLLLGDDPW+ FVNNVWYI
Sbjct  734   SRFSSYHELREELGQMFGIEGKLEYRLRSGWQLVFVDREDDVLLLGDDPWESFVNNVWYI  793

Query  3055  KILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMNGIP-LGSLDY  3231
             KILSP +VH+MG +    + +  P   QRL + G  C       E ++++G+P LGSL+Y
Sbjct  794   KILSPEDVHKMGHQA---VESFSPNTGQRLNSSG--C-------EGQDVSGLPSLGSLEY  841



>ref|XP_006847975.1| hypothetical protein AMTR_s00029p00157690 [Amborella trichopoda]
 emb|CBA11995.1| putative auxin response factor 8 [Amborella trichopoda]
 gb|ERN09556.1| hypothetical protein AMTR_s00029p00157690 [Amborella trichopoda]
Length=838

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/450 (80%), Positives = 393/450 (87%), Gaps = 9/450 (2%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S +G NP+  EG  EK+CLNSELWHACAGPLVSLP +GSRVVY PQGHSEQV ASTN
Sbjct  1     MKLSSSGSNPRGLEG--EKRCLNSELWHACAGPLVSLPAVGSRVVYLPQGHSEQVAASTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KEIDAHIP+YP LP QLICQLH+VTMHAD ETDEVYAQMTLQPL+ QEQKD   +P  LG
Sbjct  59    KEIDAHIPNYPSLPPQLICQLHDVTMHADVETDEVYAQMTLQPLTQQEQKD-AYVPTVLG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
              PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD++QQPPAQELIA+DLH  EW
Sbjct  118   FPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFTQQPPAQELIARDLHDVEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+VIFIWN+ NQLLLGIRRA RPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVIFIWNDKNQLLLGIRRATRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIP AK+AKAVYHTR+SVGMR
Sbjct  238   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPFAKFAKAVYHTRISVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEES VRRYMGTITG  DLDPVRW NSHWRSVKVGWDESTAGERQPRVSLW+IE
Sbjct  298   FRMLFETEESGVRRYMGTITGKCDLDPVRWSNSHWRSVKVGWDESTAGERQPRVSLWDIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQ--GIQSLNF  1821
             PLTTFPMYPSPF+LRLKRPW  GLPS   L +      +P+ WLRG+ G++   +QS + 
Sbjct  358   PLTTFPMYPSPFALRLKRPWQPGLPS---LYDDKDDEGNPVMWLRGDNGERIPALQSPSC  414

Query  1822  QGYGI-TPFMQPRLDASMLGLQPDIYQTMA  1908
             Q  GI  P+MQPR D S+ G++ + YQ +A
Sbjct  415   QNLGIGNPWMQPRPDLSLQGMESNFYQALA  444


 Score =   164 bits (415),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 101/229 (44%), Positives = 133/229 (58%), Gaps = 26/229 (11%)
 Frame = +1

Query  2560  GVAYSQGNNALLGVNTDSS-ILLQNGISNLK----NSGGENGFLNMPFSTCNFTSGVGTD  2724
             G + +QG   L GVN DSS ++L N  S L+        ++G L   FS   F +     
Sbjct  631   GTSDTQGP-LLFGVNIDSSSLILPNSDSTLRLRTMEGSADSGLLQ--FSAQGFQAA----  683

Query  2725  YPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELR  2904
                   +G   C ++SG L    N++Q  P N   VK++K+G  GR+LDIS+FSSY ELR
Sbjct  684   -----SIGAFGCPNDSGLLH---NMEQRKPHNPILVKIYKTGCVGRTLDISQFSSYEELR  735

Query  2905  SELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQ  3084
              ++A MFGLEG L+DP RSGWQLVFVDREND LLLGD PW+ FVNNVWYIKILSP ++  
Sbjct  736   GKVADMFGLEGQLDDPLRSGWQLVFVDRENDALLLGDGPWEAFVNNVWYIKILSPHDIQM  795

Query  3085  MGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMNGIPLGSLDY  3231
             MG   G+D  +     N R     ++   H S   +  +  +  G+LDY
Sbjct  796   MGT-NGVDQLHRQSNGNHR---DYTTSHDHESLNPSTGVTSV--GTLDY  838



>gb|KHN41019.1| Auxin response factor 8 [Glycine soja]
Length=846

 Score =   714 bits (1844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/437 (81%), Positives = 385/437 (88%), Gaps = 6/437 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S +G+  Q  EG GEKKCLNSELWHACAGPLVSLP  G+RV YFPQGHSEQV A+TN
Sbjct  1     MKLSTSGLGQQGHEG-GEKKCLNSELWHACAGPLVSLPTAGTRVAYFPQGHSEQVAATTN  59

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             +E+D HIP+YP LP QLICQLHNVTMH D ETDEVYAQMTLQPL+ QEQKD   LP ELG
Sbjct  60    REVDGHIPNYPSLPPQLICQLHNVTMHVDVETDEVYAQMTLQPLTPQEQKDT-FLPMELG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PSKQP+NYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQQPPAQELIA+DLH  EW
Sbjct  119   VPSKQPSNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDVEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRANRPQTVMPS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNS FT+FYNPRASPS+FVIPL+KY KAVYHTRVSVGMR
Sbjct  239   SVLSSDSMHIGLLAAAAHAAATNSCFTVFYNPRASPSEFVIPLSKYIKAVYHTRVSVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKV  DESTAGERQPRVSLWEIE
Sbjct  299   FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVK-DESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LRLKRPW  G  SF    +G    ++ L WLRG  GDQ + SLNFQG
Sbjct  358   PLTTFPMYPSLFPLRLKRPWHPGTSSF---HDGRDEATNGLMWLRGGPGDQALNSLNFQG  414

Query  1828  YGITPFMQPRLDASMLG  1878
              G+ P+MQ R+D ++L 
Sbjct  415   SGLLPWMQQRMDPTLLA  431


 Score =   189 bits (479),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 138/219 (63%), Gaps = 25/219 (11%)
 Frame = +1

Query  2581  NNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSS  2757
             N  L GVN DSS +LL   +     +  ++    MP     F S      PL P      
Sbjct  651   NPILFGVNIDSSGLLLPTTVPRYTTASADSDASAMPLGESGFQS------PLYP-----C  699

Query  2758  CVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEG  2937
               D S  +QS+  VD  N   RTFVKV+KSGS GRSLDIS+FSSYHELR ELA+MFG+EG
Sbjct  700   GQDSSELVQSAGQVDPQNQ-TRTFVKVYKSGSVGRSLDISRFSSYHELREELAQMFGIEG  758

Query  2938  LLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPN  3117
              LEDP RSGWQLVFVDRENDVLLLGDDPW+ FVNNVWYIKILSP ++H+MG++    L +
Sbjct  759   KLEDPLRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDIHKMGEQA---LES  815

Query  3118  NLPAANQRLPNGGSSCEVHVSQKETRNMNGIP-LGSLDY  3231
               P+  QRL + G+     VS        G+P +GSL+Y
Sbjct  816   LGPSPGQRLNSTGADSHEIVS--------GLPSIGSLEY  846



>ref|XP_008227867.1| PREDICTED: LOW QUALITY PROTEIN: auxin response factor 8 [Prunus 
mume]
Length=838

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/440 (80%), Positives = 387/440 (88%), Gaps = 8/440 (2%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTG---EKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTA  738
             M++S +G+  Q  E  G   EKKCLNSELWHACAGPLVSLP  G+RVVYFPQGHS+QV A
Sbjct  1     MKLSTSGLGQQDHEAAGGGAEKKCLNSELWHACAGPLVSLPTPGTRVVYFPQGHSDQVAA  60

Query  739   STNKEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPA  918
             +TNK++DAHIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPL+ QEQK+   LP 
Sbjct  61    TTNKQVDAHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLTPQEQKET-FLPM  119

Query  919   ELGMPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHG  1098
             ELG+PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+S QPPAQELIA+DLH 
Sbjct  120   ELGIPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSLQPPAQELIARDLHD  179

Query  1099  NEWKFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTV  1278
              EWKFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA RPQTV
Sbjct  180   VEWKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRATRPQTV  239

Query  1279  MPSSVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSV  1458
             MPSSVLSSDSMHIGLLAAAAHAA+TNS FT+FYNPRASPS+FVIPL+KY KAV+HTRVSV
Sbjct  240   MPSSVLSSDSMHIGLLAAAAHAASTNSCFTVFYNPRASPSEFVIPLSKYIKAVFHTRVSV  299

Query  1459  GMRFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLW  1638
             GMRFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLW
Sbjct  300   GMRFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLW  359

Query  1639  EIEPLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLN  1818
             EIEPLTTFPMYPS F LRLKRPW  G  S       +   ++ L WLRG  G+QG+ S+N
Sbjct  360   EIEPLTTFPMYPSLFPLRLKRPWHPGASSM----QDNRDDANSLMWLRGGTGEQGLHSMN  415

Query  1819  FQGYGITPFMQPRLDASMLG  1878
             FQ  G+ P+MQ RLD++++G
Sbjct  416   FQPVGMFPWMQQRLDSTLIG  435


 Score =   156 bits (394),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 108/240 (45%), Positives = 132/240 (55%), Gaps = 33/240 (14%)
 Frame = +1

Query  2521  LPPFPGKEFPEYQGVAYSQGNN-ALLGVNTDSSILLQNGISNLKNSGGENGFLNMPFSTC  2697
              PPF  K+    Q    S   N  L GVN +SS LL    +    +   +  ++MP    
Sbjct  629   FPPFNEKDNAVEQENCNSDSQNPTLFGVNIESSGLLFPTTAPSFATSSNDADMSMPLGDS  688

Query  2698  NFTSGVGTDYPLNPDMGTSSCV-DESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDI  2874
              F S +              C+ D S  L S+  VD   P N TFVKV+KSGS GRSLDI
Sbjct  689   GFQSSL------------YGCMQDSSELLHSAGQVDPPTP-NCTFVKVYKSGSVGRSLDI  735

Query  2875  SKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYI  3054
             S+F            MFG+EG LED  RSGWQLVFVDRENDVLLLGDDPW+ FVNNVWYI
Sbjct  736   SRFXX------XXXXMFGIEGKLEDRLRSGWQLVFVDRENDVLLLGDDPWESFVNNVWYI  789

Query  3055  KILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMNGIP-LGSLDY  3231
             KILSP +VH+MG ++ ++  N  P   QRL + G   +  VS        G+P LGSL+Y
Sbjct  790   KILSPEDVHKMG-DQAVEPFN--PNTGQRLNSSGGEAQDIVS--------GLPSLGSLEY  838



>dbj|BAB85914.1| auxin response factor 6a [Oryza sativa]
Length=396

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/399 (87%), Positives = 368/399 (92%), Gaps = 4/399 (1%)
 Frame = +1

Query  619   EKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTNKEIDAHIPSYPGLPAQL  798
             E+KCLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV ASTNKE+++ IP+YP LP QL
Sbjct  2     EQKCLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTNKEMESQIPNYPNLPPQL  61

Query  799   ICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELGMPSKQPTNYFCKTLTAS  978
             ICQLHNVTMHAD ETDEVYAQMTLQPLS QE KD   LPAELG  SKQPTNYFCKTLTAS
Sbjct  62    ICQLHNVTMHADAETDEVYAQMTLQPLSPQELKD-PFLPAELGTASKQPTNYFCKTLTAS  120

Query  979   DTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEWKFRHVFRGQPKRHLLTT  1158
             DTSTHGGFSVPRRAAEKVFPPLD++QQPPAQEL+AKDLHGNEWKFRH+FRGQPKRHLLTT
Sbjct  121   DTSTHGGFSVPRRAAEKVFPPLDFTQQPPAQELMAKDLHGNEWKFRHIFRGQPKRHLLTT  180

Query  1159  GWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLLaaaa  1338
             GWSVFVSAKRLVAGD+V+FIWN++NQLLLGIRRANRPQTVMPSSVLSSDSMHIGLLAAAA
Sbjct  181   GWSVFVSAKRLVAGDSVLFIWNDSNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLLAAAA  240

Query  1339  haaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMRFRMLFETEESSVRRYMG  1518
             HAA+TNSRFTIFYNPRASPS+FVIPLAKY KAVYHTR+SVGMRFRMLFETEESSVRRYMG
Sbjct  241   HAASTNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRISVGMRFRMLFETEESSVRRYMG  300

Query  1519  TITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFSLRLK  1698
             TITGISDLDPVRW NSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPF LRLK
Sbjct  301   TITGISDLDPVRWMNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFPLRLK  360

Query  1699  RPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSL  1815
             RPWP+GLPS  G    D+  +S L WLR +  + G QSL
Sbjct  361   RPWPTGLPSLYGGKEDDL--ASSLMWLRDSQ-NTGFQSL  396



>ref|XP_008348621.1| PREDICTED: auxin response factor 8-like [Malus domestica]
Length=841

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/439 (80%), Positives = 389/439 (89%), Gaps = 7/439 (2%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTG--EKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTAS  741
             M++S +G+  Q  EG G  EKKCLNSELWHACAGPLVSLP  G+RVVYFPQGHS+QV A+
Sbjct  1     MKLSTSGLGQQDHEGGGGLEKKCLNSELWHACAGPLVSLPTPGTRVVYFPQGHSDQVAAT  60

Query  742   TNKEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAE  921
             TNK++DAHIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPL+ QEQK+   LP E
Sbjct  61    TNKQVDAHIPNYPNLPPQLICQLHNVTMHADVETDEVYAQMTLQPLTPQEQKET-FLPME  119

Query  922   LGMPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGN  1101
             LG+PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+S QPPAQELIA+DLH  
Sbjct  120   LGLPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSLQPPAQELIARDLHDV  179

Query  1102  EWKFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVM  1281
             EWKFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIR A RPQTVM
Sbjct  180   EWKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRHATRPQTVM  239

Query  1282  PSSVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVG  1461
             PSSVLSSDSMHIGLLAAAAHAA+TNS FT+FYNPRASPS+FVIPL+KY KAV+HTRVSVG
Sbjct  240   PSSVLSSDSMHIGLLAAAAHAASTNSCFTVFYNPRASPSEFVIPLSKYIKAVFHTRVSVG  299

Query  1462  MRFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWE  1641
             MRFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDEST+GERQPRVSLWE
Sbjct  300   MRFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTSGERQPRVSLWE  359

Query  1642  IEPLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNF  1821
             IEPLTTFPMYPS F LRLKRPW  G  S     + +   ++ L WLRG  G+QG+QS+NF
Sbjct  360   IEPLTTFPMYPSLFPLRLKRPWIPGASSM----HDNRDEANSLMWLRGGAGEQGLQSMNF  415

Query  1822  QGYGITPFMQPRLDASMLG  1878
             Q  G+ P+MQ RLD++++G
Sbjct  416   QNVGMFPWMQQRLDSTLIG  434


 Score =   176 bits (447),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 112/240 (47%), Positives = 137/240 (57%), Gaps = 26/240 (11%)
 Frame = +1

Query  2521  LPPFPGKEFP-EYQGVAYSQGNNALLGVNTDSSILLQNGISNLKNSGGENGFLNMPFSTC  2697
              PPF GK+   E + +     N  L GVN +SS LL             +  ++MP    
Sbjct  625   FPPFNGKDNAVEQENLNSDTHNPTLFGVNIESSGLLFPNTXPSFAXSSNDADISMPLGNT  684

Query  2698  NFTSGVGTDYPLNPDMGTSSCV-DESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDI  2874
              F S +              C+ D S  L  +  VD   P N TFVKV+KSGS GRS+DI
Sbjct  685   GFQSSL------------YGCMQDSSELLHGAGQVDPPTPNNCTFVKVYKSGSVGRSIDI  732

Query  2875  SKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYI  3054
             S+FSSYHELR EL +MFG+EG LE   RSGWQLVFVDRE+DVLLLGDDPW+ FVNNVWYI
Sbjct  733   SRFSSYHELREELGQMFGIEGKLEYRLRSGWQLVFVDREDDVLLLGDDPWESFVNNVWYI  792

Query  3055  KILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMNGIP-LGSLDY  3231
             KILSP +VH+MG +    + +  P   QRL + G   +  VS        G P LGSL+Y
Sbjct  793   KILSPEDVHKMGHQA---VESFSPNTGQRLNSSGCEGQDIVS--------GPPSLGSLEY  841



>gb|EPS62844.1| auxin response factor 8-1, partial [Genlisea aurea]
Length=480

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/447 (78%), Positives = 384/447 (86%), Gaps = 6/447 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S +  + Q  EG  EKKCLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV A+TN
Sbjct  8     MKLSTSATSQQVHEG--EKKCLNSELWHACAGPLVSLPSVGSRVVYFPQGHSEQVAATTN  65

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             +E+DA +P+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPL+  E+KD   LP E G
Sbjct  66    REVDAQLPNYPTLPPQLICQLHNVTMHADVETDEVYAQMTLQPLAPVEEKDT-YLPVEFG  124

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PS+QPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQ PPAQELIA+DLH  EW
Sbjct  125   IPSRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQTPPAQELIARDLHDVEW  184

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWN+ NQLLLGIRRA+RPQTVMPS
Sbjct  185   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDKNQLLLGIRRASRPQTVMPS  244

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNS FT+FYNPRASPS+FVIPL+KYAKAVYHTRVSVGMR
Sbjct  245   SVLSSDSMHIGLLAAAAHAAATNSCFTVFYNPRASPSEFVIPLSKYAKAVYHTRVSVGMR  304

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGI +LDPVRWPNSHWRSVKVGWDESTAG+RQPRVSLWEIE
Sbjct  305   FRMLFETEESSVRRYMGTITGIGELDPVRWPNSHWRSVKVGWDESTAGDRQPRVSLWEIE  364

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGD-QGIQSLNFQ  1824
             PLTTFPMYPS F LRLKRPW  G  SF    N  M+  S ++WLRG  G+  G  +LNFQ
Sbjct  365   PLTTFPMYPSLFPLRLKRPWYPGASSFQDAGNEAMN--SSMAWLRGESGEPGGFNALNFQ  422

Query  1825  GYGITPFMQPRLDASMLGLQPDIYQTM  1905
               G+ P +Q R D + +      YQ M
Sbjct  423   SVGMFPVVQQRFDPTAMRNDVGQYQAM  449



>ref|XP_008804149.1| PREDICTED: auxin response factor 12-like [Phoenix dactylifera]
 ref|XP_008804156.1| PREDICTED: auxin response factor 12-like [Phoenix dactylifera]
 ref|XP_008804164.1| PREDICTED: auxin response factor 12-like [Phoenix dactylifera]
Length=804

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/447 (79%), Positives = 389/447 (87%), Gaps = 9/447 (2%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S AG+  QA+EG GEK+CLNSELWHACAGPLV LP +G+RVVYFPQGHSEQV ASTN
Sbjct  1     MKLSTAGLGQQAQEG-GEKRCLNSELWHACAGPLVCLPTVGTRVVYFPQGHSEQVAASTN  59

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE++  IP+YP LP QLICQLH+VTMHAD ETDEVYAQMTLQPL+ QE  D   LPAE+G
Sbjct  60    KEVEGQIPNYPNLPPQLICQLHDVTMHADVETDEVYAQMTLQPLNPQELND-AYLPAEMG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             + SKQPTNYFCK LTASDTSTHGGFSVPRR+AEKVFPPLD+SQQPPAQELIA+DLH  EW
Sbjct  119   IISKQPTNYFCKILTASDTSTHGGFSVPRRSAEKVFPPLDFSQQPPAQELIARDLHDVEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA+RPQTVMPS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRASRPQTVMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPS+FVIPL+KY KAV+HTR+SVGMR
Sbjct  239   SVLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLSKYVKAVFHTRISVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRR MGTIT ISDLDPVRWPNSHWRSVKVGWDESTAGER PRVSLWEIE
Sbjct  299   FRMLFETEESSVRRNMGTITEISDLDPVRWPNSHWRSVKVGWDESTAGERSPRVSLWEIE  358

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LRLKRPW  G+PSF    N        L WLRG   D+G+ SLNFQ 
Sbjct  359   PLTTFPMYPSLFPLRLKRPWYPGVPSFHDEGNA-------LMWLRGGASDRGLPSLNFQS  411

Query  1828  YGITPFMQPRLDASMLGLQPDIYQTMA  1908
              G+ P++Q R+++++LG   D Y  MA
Sbjct  412   PGVGPWVQQRMESTLLGHDHDRYPAMA  438


 Score =   181 bits (459),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 127/198 (64%), Gaps = 23/198 (12%)
 Frame = +1

Query  2515  TFLPPFPGKEFPEYQGVAYSQG-----NNALLGVNTDSSILLQNGISNLKNSGGENGFLN  2679
               LP FPGK+      V    G     N+ L GVN DSS LL + + +++ +  ++    
Sbjct  619   VLLPSFPGKD----GSVGTENGSTDMQNHTLFGVNIDSSSLLSHAVPSIRANSIDDSIST  674

Query  2680  MPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFG  2859
             MP+++ +  + +             S  +  G LQ   N  +++P  +TFVKV+KSGS G
Sbjct  675   MPYASSSLQNSI-----------YGSLEESPGVLQ---NAGESDPTTKTFVKVYKSGSVG  720

Query  2860  RSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVN  3039
             RSLDI++F++Y ELR EL  MFG++G LEDP RSGWQLVFVDRENDVLLLGDDPW+ FVN
Sbjct  721   RSLDITRFNNYGELREELGLMFGIKGQLEDPLRSGWQLVFVDRENDVLLLGDDPWESFVN  780

Query  3040  NVWYIKILSPFEVHQMGK  3093
             NVWYIKILSP +V +MGK
Sbjct  781   NVWYIKILSPEDVQKMGK  798



>ref|XP_004231633.1| PREDICTED: auxin response factor 8 [Solanum lycopersicum]
Length=842

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/436 (80%), Positives = 385/436 (88%), Gaps = 5/436 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S +G+  QA EG GEKKCLNSELWHACAGPLV LP +GSRVVYFPQGHSEQV A+TN
Sbjct  1     MKLSTSGMGQQAHEG-GEKKCLNSELWHACAGPLVCLPTVGSRVVYFPQGHSEQVAATTN  59

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP L  QLICQLHNVTMHAD ETDEVYAQMTLQPL+ +EQKD   LP E G
Sbjct  60    KEVDAHIPNYPNLSPQLICQLHNVTMHADVETDEVYAQMTLQPLTPEEQKDT-YLPVEFG  118

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQ PPAQELIA+DLH  EW
Sbjct  119   IPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQTPPAQELIARDLHDVEW  178

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA RPQTVMPS
Sbjct  179   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRAVRPQTVMPS  238

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNS F +F+NPRASPS+FVIPL+KY KAVYHTRVSVGMR
Sbjct  239   SVLSSDSMHIGLLAAAAHAAATNSCFNVFFNPRASPSEFVIPLSKYIKAVYHTRVSVGMR  298

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGI DLDPVRW NSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  299   FRMLFETEESSVRRYMGTITGIGDLDPVRWANSHWRSVKVGWDESTAGERQPRVSLWEIE  358

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LRLKRP+  G  S+   +N  +   + +SWLRGN G+ G  S+N Q 
Sbjct  359   PLTTFPMYPSLFPLRLKRPFYQGTSSYQDSNNEAI---NRMSWLRGNAGELGHHSMNLQS  415

Query  1828  YGITPFMQPRLDASML  1875
             +G+ P+MQ R+D+++L
Sbjct  416   FGMLPWMQQRVDSTIL  431


 Score =   183 bits (464),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 132/347 (38%), Positives = 181/347 (52%), Gaps = 58/347 (17%)
 Frame = +1

Query  2227  QLSHFQALSSTVP--QQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMHETNPLA  2400
             QL   Q  + T P  +  F+DL      +   S  Q++  S   + ++  LN++ T    
Sbjct  542   QLQQRQPSNVTSPFLKADFADLTSKFSASVAPSGVQNMLGSLCSEGSNNSLNINRTG---  598

Query  2401  TLPSKRIALESQVSSRATPYVVSQADMISPNSKVSDLPTFLPPFPGKEFPEYQG-VAYSQ  2577
                   I  +S   S  + +  SQ +  S     S LPT+     GK+    +G  +   
Sbjct  599   ---QSVIIEQSPQQSWMSKFTESQLNTCS---NSSSLPTY-----GKDTSNPRGNCSLDS  647

Query  2578  GNNALLGVNTDSS-ILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTS  2754
              N AL G N DSS  LL   +SN+  +  +     MP     + + +             
Sbjct  648   QNQALFGANIDSSGHLLPTTVSNVTTTCADMSL--MPLGASGYQNSL-------------  692

Query  2755  SCVDESGFLQSS----ENVDQANPPN--RTFVKVHKSGSFGRSLDISKFSSYHELRSELA  2916
                   G++Q S     N  Q +PPN   TFVKV+KSG  GRSLDI++F SYHELR EL 
Sbjct  693   -----YGYVQDSSELLHNAGQIDPPNATHTFVKVYKSGCVGRSLDITQFHSYHELRRELG  747

Query  2917  RMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKE  3096
             +MFG+EG LEDP+RSGWQLVFVDREND+LLLGDDPW+ FVNNVWYIKILSP +V ++GKE
Sbjct  748   QMFGIEGFLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQKLGKE  807

Query  3097  EGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNM-NGIP-LGSLDY  3231
             E   L            N G+   +  +  + R++ +G+P LGSL+Y
Sbjct  808   EAESL------------NRGAVERMSSTNADDRDLISGMPSLGSLEY  842



>ref|XP_011038345.1| PREDICTED: auxin response factor 8-like [Populus euphratica]
Length=815

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/437 (81%), Positives = 382/437 (87%), Gaps = 5/437 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S +G+  Q     GEKKCLNSELWHACAGPLVSLP +GSRVVYFPQGHSEQV A+TN
Sbjct  1     MKLSTSGLGGQQAGQEGEKKCLNSELWHACAGPLVSLPTVGSRVVYFPQGHSEQVAATTN  60

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPL+ QEQK+   LP +LG
Sbjct  61    KEVDAHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLTLQEQKET-FLPLDLG  119

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD++QQPPAQELIA+DLH  EW
Sbjct  120   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFTQQPPAQELIARDLHDVEW  179

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA RPQTVMPS
Sbjct  180   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRATRPQTVMPS  239

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNS FT+FYNPRASPS+FVIPL+KY KAV+H RVSVGMR
Sbjct  240   SVLSSDSMHIGLLAAAAHAAATNSCFTVFYNPRASPSEFVIPLSKYVKAVFHIRVSVGMR  299

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITG SDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  300   FRMLFETEESSVRRYMGTITGTSDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  359

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LRLKRPW    P    L +     S+ L WLRG  G+QG  SLNFQ 
Sbjct  360   PLTTFPMYPSLFPLRLKRPW---HPESSSLLDSRDEASNGLIWLRGGSGEQGHPSLNFQA  416

Query  1828  YGITPFMQPRLDASMLG  1878
               + P+MQ RLD  MLG
Sbjct  417   -NMLPWMQQRLDPMMLG  432


 Score =   168 bits (425),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 105/140 (75%), Gaps = 12/140 (9%)
 Frame = +1

Query  2704  TSGVGTDYPLNPDMGTSS-------CVDESGFLQSSENVDQANPP--NRTFVKVHKSGSF  2856
             TS V TD    P +G S        CV +S  L    N  Q +PP  +RTFVKV+KSGS 
Sbjct  667   TSTVDTDVSSMP-LGDSGFQNSLYGCVQDSSELLP--NAGQMDPPTSSRTFVKVYKSGSV  723

Query  2857  GRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFV  3036
             GRSLDIS+FSSYHELR ELA+MFG+EG LE+P RSGWQLVFVDRENDVLLLGDDPW+ FV
Sbjct  724   GRSLDISRFSSYHELREELAQMFGIEGKLENPHRSGWQLVFVDRENDVLLLGDDPWELFV  783

Query  3037  NNVWYIKILSPFEVHQMGKE  3096
             NNVWYIKILSP +V +MG++
Sbjct  784   NNVWYIKILSPEDVLKMGEQ  803



>ref|XP_009631564.1| PREDICTED: auxin response factor 8-like isoform X2 [Nicotiana 
tomentosiformis]
Length=839

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/436 (81%), Positives = 386/436 (89%), Gaps = 6/436 (1%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTGEKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVTASTN  747
             M++S +G+  QA EG  EKKCLNSELWHACAGPLV LP +GSRVVYFPQGHSEQV A+TN
Sbjct  1     MKLSTSGMGQQAHEG--EKKCLNSELWHACAGPLVCLPTVGSRVVYFPQGHSEQVAATTN  58

Query  748   KEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLPAELG  927
             KE+DAHIP+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPL+ +EQKD   LP E G
Sbjct  59    KEVDAHIPNYPNLPPQLICQLHNVTMHADVETDEVYAQMTLQPLTPEEQKDT-YLPVEFG  117

Query  928   MPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLHGNEW  1107
             +PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD+SQ PPAQELIA+DLH  EW
Sbjct  118   IPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQTPPAQELIARDLHDVEW  177

Query  1108  KFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQTVMPS  1287
             KFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQLLLGIRRA RPQTVMPS
Sbjct  178   KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRAIRPQTVMPS  237

Query  1288  SVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVSVGMR  1467
             SVLSSDSMHIGLLAAAAHAAATNS FT+F+NPRASPS+FVIPL+KY KAVYHTRVSVGMR
Sbjct  238   SVLSSDSMHIGLLAAAAHAAATNSCFTVFFNPRASPSEFVIPLSKYIKAVYHTRVSVGMR  297

Query  1468  FRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  1647
             FRMLFETEESSVRRYMGTITGI DLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
Sbjct  298   FRMLFETEESSVRRYMGTITGIGDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE  357

Query  1648  PLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSLNFQG  1827
             PLTTFPMYPS F LRLKRP   G  S+   +N  ++    ++WLRGN G+ G  S+N Q 
Sbjct  358   PLTTFPMYPSLFPLRLKRPLYPGTSSYQDSNNEAIN---RMAWLRGNSGELGPHSVNLQS  414

Query  1828  YGITPFMQPRLDASML  1875
             +G+ P+MQ R+D+++L
Sbjct  415   FGMLPWMQQRVDSTIL  430


 Score =   181 bits (458),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 128/340 (38%), Positives = 186/340 (55%), Gaps = 58/340 (17%)
 Frame = +1

Query  2248  LSSTVPQQSFSDLVGNHVMTSNNSSTQSLPRSFSHDEASQLLNMHETNPLATL--PSKRI  2421
             + S+  ++ F+DL      +   S  Q++  SF  + +S  LN++ T     +  PS++ 
Sbjct  546   IPSSFSKEDFADLNSKFSASVAPSGVQNMLGSFCSEGSSNSLNINRTGQSVVIEQPSQQ-  604

Query  2422  ALESQVSSRATPYVVSQADMISPNSKVSDLPTFLPPFPGKE-FPEYQGVAYSQGNNALLG  2598
                    S  + ++ SQ +  S +S    LPT+     GK+     +  +    N AL G
Sbjct  605   -------SWISKFMQSQLNTCSNSSP---LPTY-----GKDTLNSRENCSLDTQNQALFG  649

Query  2599  VNTDSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVG--TDYPLNPDMGTSSCVDES  2772
              + DSS LL                  +P +  N T+     +  PL  + G  + +   
Sbjct  650   ASIDSSGLL------------------LPITVSNVTTTCADISSMPLGMNSGYQNSL--Y  689

Query  2773  GFLQSS----ENVDQANPPN--RTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLE  2934
             G++Q S     N  Q +PPN   +FVKV+KSG  GRSLDI++F SYHELR EL +MFG+E
Sbjct  690   GYVQDSSELLHNAGQNDPPNASHSFVKVYKSGCVGRSLDITQFHSYHELRRELGQMFGIE  749

Query  2935  GLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLP  3114
             G LEDP+RSGWQLVFVDREND+LLLGDDPW+ FVNNVWYIKILSP +V ++GKEE   L 
Sbjct  750   GFLEDPQRSGWQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQKLGKEEAKSLN  809

Query  3115  NNLPAANQRLPNGGSSCEVHVSQKETRNMNGIP-LGSLDY  3231
               +    +R+ +  S+ +  +       ++G+P LGSL+Y
Sbjct  810   RGVV---ERMSSSTSADDRDL-------VSGMPSLGSLEY  839



>ref|XP_008343154.1| PREDICTED: auxin response factor 8 isoform X2 [Malus domestica]
Length=793

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/441 (80%), Positives = 388/441 (88%), Gaps = 9/441 (2%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTG----EKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQVT  735
             M++S +G+  Q  EG G    EKKCLNSELWHACAGPLVSLP  G+RVVYFPQGHS+QV 
Sbjct  1     MKLSASGLGQQDHEGGGGGGVEKKCLNSELWHACAGPLVSLPTRGTRVVYFPQGHSDQVA  60

Query  736   ASTNKEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLLP  915
             A+TNK+IDAH+P+YP LP QLICQLHN+TMHAD ETDEVYAQMTLQPL+ QEQK+   LP
Sbjct  61    ATTNKQIDAHLPNYPSLPPQLICQLHNITMHADVETDEVYAQMTLQPLTPQEQKET-FLP  119

Query  916   AELGMPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDLH  1095
              ELG+PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD++ QPPAQELIA+DLH
Sbjct  120   MELGLPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFTLQPPAQELIARDLH  179

Query  1096  GNEWKFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQT  1275
               EWKFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQL LGIRRA RPQT
Sbjct  180   DVEWKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLFLGIRRATRPQT  239

Query  1276  VMPSSVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRVS  1455
             VMPSSVLSSDSMHIGLLAAAAHAA+TNS FT+FYNPRASPS+FVIPL+KY KAV+HTRVS
Sbjct  240   VMPSSVLSSDSMHIGLLAAAAHAASTNSCFTVFYNPRASPSEFVIPLSKYIKAVFHTRVS  299

Query  1456  VGMRFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSL  1635
             VGMRFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSL
Sbjct  300   VGMRFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSL  359

Query  1636  WEIEPLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHISSPLSWLRGNMGDQGIQSL  1815
             WEIEPLTTFPMYPS F LRLKRPW  G  S     + +   S+ L WLRG   +QG+QS+
Sbjct  360   WEIEPLTTFPMYPSLFPLRLKRPWHPGASSM----HDNRDESNSLMWLRGGAVEQGLQSM  415

Query  1816  NFQGYGITPFMQPRLDASMLG  1878
             NFQ  G+ P+MQ RLD++++G
Sbjct  416   NFQNVGMFPWMQQRLDSTLIG  436


 Score =   178 bits (451),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 112/157 (71%), Gaps = 12/157 (8%)
 Frame = +1

Query  2764  DESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLL  2943
             D S  L S+  VD   P N TFVKV+KSGS GRSLDIS+FSSYHELR EL +MFG+EG L
Sbjct  648   DSSELLHSAGQVDPPTPNNCTFVKVYKSGSVGRSLDISRFSSYHELREELGQMFGIEGKL  707

Query  2944  EDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNL  3123
             ED  RSGWQLVFVDRE+DVLLLGDDPW+ FVNNVWYIKILSP +VH+MG +    + +  
Sbjct  708   EDRLRSGWQLVFVDREDDVLLLGDDPWESFVNNVWYIKILSPEDVHKMGHQA---VESFS  764

Query  3124  PAANQRLPNGGSSCEVHVSQKETRNMNGIP-LGSLDY  3231
             P   QRL +GG   +  VS        G+P LGSL+Y
Sbjct  765   PNTGQRLNSGGGEGQDIVS--------GLPSLGSLEY  793



>ref|XP_009370590.1| PREDICTED: auxin response factor 8-like isoform X2 [Pyrus x bretschneideri]
Length=794

 Score =   708 bits (1827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/446 (79%), Positives = 391/446 (88%), Gaps = 18/446 (4%)
 Frame = +1

Query  568   MRVSLAGVNPQAEEGTG-----EKKCLNSELWHACAGPLVSLPPLGSRVVYFPQGHSEQV  732
             M++S +G+  Q  EG G     EKKCLNSELWHACAGPLVSLP  G+RVVYFPQGHS+QV
Sbjct  1     MKLSASGLGQQDHEGGGGGGGVEKKCLNSELWHACAGPLVSLPTRGTRVVYFPQGHSDQV  60

Query  733   TASTNKEIDAHIPSYPGLPAQLICQLHNVTMHADNETDEVYAQMTLQPLSAQEQKDVCLL  912
              A+TNK++DAH+P+YP LP QLICQLHNVTMHAD ETDEVYAQMTLQPL+ QEQK+   L
Sbjct  61    AATTNKQVDAHLPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLTPQEQKET-FL  119

Query  913   PAELGMPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIAKDL  1092
             P ELG+PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLD++ QPPAQELIA+DL
Sbjct  120   PMELGLPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFTLQPPAQELIARDL  179

Query  1093  HGNEWKFRHVFRGQPKRHLLTTGWSVFVSAKRLVAGDAVIFIWNENNQLLLGIRRANRPQ  1272
             H  EWKFRH+FRGQPKRHLLTTGWSVFVSAKRLVAGD+V+FIWNE NQL LGIRRA RPQ
Sbjct  180   HDVEWKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLFLGIRRATRPQ  239

Query  1273  TVMPSSVLSSDSMHIGLLaaaahaaaTNSRFTIFYNPRASPSDFVIPLAKYAKAVYHTRV  1452
             TVMPSSVLSSDSMHIGLLAAAAHAA+TNS FT+FYNPRASPS+FVIPL+KY KAV+HTRV
Sbjct  240   TVMPSSVLSSDSMHIGLLAAAAHAASTNSCFTVFYNPRASPSEFVIPLSKYIKAVFHTRV  299

Query  1453  SVGMRFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVS  1632
             SVGMRFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVS
Sbjct  300   SVGMRFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVS  359

Query  1633  LWEIEPLTTFPMYPSPFSLRLKRPWPSGLPSFPGLSNGDMHI----SSPLSWLRGNMGDQ  1800
             LWEIEPLTTFPMYPS F LRLKRPW      +PG S+  MH     S+ L WLRG   +Q
Sbjct  360   LWEIEPLTTFPMYPSLFPLRLKRPW------YPGASS--MHDNRDESNSLMWLRGGAVEQ  411

Query  1801  GIQSLNFQGYGITPFMQPRLDASMLG  1878
             G+QS+NFQ  G+ P+MQ RLD++++G
Sbjct  412   GLQSMNFQNVGMFPWMQQRLDSTLIG  437


 Score =   172 bits (437),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 110/157 (70%), Gaps = 12/157 (8%)
 Frame = +1

Query  2764  DESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLL  2943
             D S  L S+  VD   P N TFVKV+KSGS GRSLDIS+ SSYHELR EL +MFG+EG L
Sbjct  649   DSSELLHSAGQVDPPTPNNCTFVKVYKSGSVGRSLDISRVSSYHELREELGQMFGIEGKL  708

Query  2944  EDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNL  3123
             ED  RSGWQLVFVDRE+DVLLLGDDPW+ FVNNVWYIKILSP +VH+MG +    + +  
Sbjct  709   EDRLRSGWQLVFVDREDDVLLLGDDPWESFVNNVWYIKILSPEDVHKMGHQA---VESFS  765

Query  3124  PAANQRLPNGGSSCEVHVSQKETRNMNGIP-LGSLDY  3231
             P   QRL + G   +  VS        G+P LGSL+Y
Sbjct  766   PNTGQRLNSSGGEGQDIVS--------GLPSLGSLEY  794



>