BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24135_g2_i2 len=363 path=[273:0-109 383:110-235 509:236-324
598:325-362]

Length=363
                                                                      Score     E

gb|ADG96406.1|  S-locus receptor kinase-like protein                    209   7e-66   
ref|XP_009768621.1|  PREDICTED: receptor-like serine/threonine-pr...    219   3e-64   
ref|XP_009612738.1|  PREDICTED: receptor-like serine/threonine-pr...    218   9e-64   
ref|XP_010316637.1|  PREDICTED: receptor-like serine/threonine-pr...    216   3e-63   
ref|XP_009773537.1|  PREDICTED: receptor-like serine/threonine-pr...    215   1e-62   
ref|XP_009616770.1|  PREDICTED: receptor-like serine/threonine-pr...    214   1e-62   
ref|XP_008345021.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    204   2e-61   
gb|AAC23542.1|  receptor protein kinase                                 210   5e-61   Ipomoea trifida
ref|XP_007213546.1|  hypothetical protein PRUPE_ppa018740mg             201   5e-60   
ref|XP_010317517.1|  PREDICTED: uncharacterized protein LOC101252749    210   1e-59   
ref|XP_006343406.1|  PREDICTED: receptor-like serine/threonine-pr...    209   2e-59   
emb|CDO99671.1|  unnamed protein product                                201   3e-59   
ref|XP_008364109.1|  PREDICTED: receptor-like serine/threonine-pr...    202   3e-58   
ref|XP_008227125.1|  PREDICTED: receptor-like serine/threonine-pr...    200   2e-57   
ref|XP_009345819.1|  PREDICTED: receptor-like serine/threonine-pr...    199   4e-57   
emb|CBI25711.3|  unnamed protein product                                197   4e-57   
ref|XP_010240988.1|  PREDICTED: receptor-like serine/threonine-pr...    199   7e-57   
gb|KDP20852.1|  hypothetical protein JCGZ_21323                         198   9e-57   
ref|XP_011003370.1|  PREDICTED: receptor-like serine/threonine-pr...    187   1e-56   
ref|XP_010646880.1|  PREDICTED: receptor-like serine/threonine-pr...    196   5e-56   
ref|XP_007025869.1|  Receptor kinase 3                                  196   5e-56   
gb|KCW76531.1|  hypothetical protein EUGRSUZ_D00919                     185   2e-55   
ref|XP_011096222.1|  PREDICTED: uncharacterized protein LOC105175473    197   4e-55   
gb|EYU27869.1|  hypothetical protein MIMGU_mgv1a017829mg                192   7e-55   
ref|XP_010106713.1|  Receptor-like serine/threonine-protein kinas...    192   9e-55   
ref|XP_010665760.1|  PREDICTED: receptor-like serine/threonine-pr...    192   1e-54   
ref|XP_010665759.1|  PREDICTED: receptor-like serine/threonine-pr...    192   1e-54   
ref|XP_010538687.1|  PREDICTED: receptor-like serine/threonine-pr...    190   7e-54   
ref|XP_010538685.1|  PREDICTED: receptor-like serine/threonine-pr...    190   7e-54   
ref|XP_006377805.1|  hypothetical protein POPTR_0011s130601g            179   1e-53   
gb|ACN52012.1|  SRK protein                                             178   1e-53   Brassica cretica
ref|XP_010052484.1|  PREDICTED: receptor-like serine/threonine-pr...    189   2e-53   
gb|ACN52014.1|  SRK protein                                             178   2e-53   Brassica cretica
gb|KHN45740.1|  Receptor-like serine/threonine-protein kinase SD1-8     189   2e-53   
gb|ACN52011.1|  SRK protein                                             178   2e-53   Brassica cretica
gb|ACN52013.1|  SRK protein                                             178   2e-53   Brassica cretica
gb|ACN52031.1|  SRK protein                                             178   2e-53   Brassica cretica
gb|KCW76538.1|  hypothetical protein EUGRSUZ_D00925                     189   2e-53   
ref|XP_010054468.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    188   3e-53   
ref|XP_010268934.1|  PREDICTED: receptor-like serine/threonine-pr...    188   3e-53   
ref|XP_008227365.1|  PREDICTED: receptor-like serine/threonine-pr...    188   5e-53   
ref|XP_002304966.1|  Brassica self-incompatibility locus family p...    187   8e-53   Populus trichocarpa [western balsam poplar]
gb|ACN52018.1|  SRK protein                                             176   1e-52   Brassica cretica
dbj|BAB40987.1|  SRKb                                                   186   2e-52   Arabidopsis lyrata [lyrate rockcress]
ref|XP_011011561.1|  PREDICTED: receptor-like serine/threonine-pr...    186   2e-52   
gb|KDO75658.1|  hypothetical protein CISIN_1g0029692mg                  181   2e-52   
gb|KHN19083.1|  Receptor-like serine/threonine-protein kinase SD1-8     185   2e-52   
ref|XP_003541757.1|  PREDICTED: receptor-like serine/threonine-pr...    186   3e-52   
ref|XP_003608281.1|  Serine/threonine protein kinase                    186   3e-52   
gb|ACN52015.1|  SRK protein                                             175   3e-52   Brassica cretica
gb|ACN52026.1|  SRK protein                                             173   7e-52   Brassica cretica
ref|XP_002316682.1|  hypothetical protein POPTR_0011s03770g             184   8e-52   Populus trichocarpa [western balsam poplar]
gb|ACN52016.1|  SRK protein                                             173   1e-51   Brassica cretica
gb|ACN52029.1|  SRK protein                                             173   1e-51   Brassica cretica
gb|ACN52030.1|  SRK protein                                             173   1e-51   Brassica cretica
ref|XP_009398188.1|  PREDICTED: receptor-like serine/threonine-pr...    174   1e-51   
gb|AFU83022.1|  SRK protein                                             174   2e-51   
gb|ACN52028.1|  SRK protein                                             173   2e-51   Brassica cretica
ref|XP_009397154.1|  PREDICTED: receptor-like serine/threonine-pr...    183   2e-51   
gb|KDO74366.1|  hypothetical protein CISIN_1g018304mg                   177   2e-51   
ref|XP_011008151.1|  PREDICTED: receptor-like serine/threonine-pr...    183   2e-51   
ref|XP_004504969.1|  PREDICTED: uncharacterized protein LOC101504189    185   3e-51   
gb|AAS94091.1|  S-locus receptor kinase                                 174   4e-51   Raphanus sativus
gb|ACN52017.1|  SRK protein                                             171   5e-51   Brassica cretica
ref|XP_008363600.1|  PREDICTED: G-type lectin S-receptor-like ser...    171   5e-51   
ref|XP_006413786.1|  hypothetical protein EUTSA_v10025088mg             179   6e-51   
ref|XP_009370304.1|  PREDICTED: G-type lectin S-receptor-like ser...    172   6e-51   
ref|XP_006377792.1|  hypothetical protein POPTR_0011s12880g             181   7e-51   
ref|XP_009370055.1|  PREDICTED: G-type lectin S-receptor-like ser...    172   7e-51   
ref|XP_011029379.1|  PREDICTED: G-type lectin S-receptor-like ser...    182   7e-51   
ref|XP_009408779.1|  PREDICTED: receptor-like serine/threonine-pr...    182   7e-51   
gb|AFU83023.1|  SRK protein                                             172   8e-51   
gb|ACN52022.1|  SRK protein                                             171   8e-51   Brassica cretica
ref|XP_007148275.1|  hypothetical protein PHAVU_006G194600g             181   1e-50   
gb|ABY55238.1|  S-locus receptor kinase                                 171   1e-50   Diplotaxis tenuifolia
gb|KDP38990.1|  hypothetical protein JCGZ_00747                         170   1e-50   
ref|XP_010268959.1|  PREDICTED: G-type lectin S-receptor-like ser...    181   2e-50   
ref|XP_008371231.1|  PREDICTED: receptor-like serine/threonine-pr...    169   2e-50   
gb|ACN52033.1|  SRK protein                                             169   3e-50   Brassica cretica
gb|KHN33626.1|  Receptor-like serine/threonine-protein kinase SD1-8     179   3e-50   
gb|KDP34760.1|  hypothetical protein JCGZ_10540                         179   3e-50   
gb|ACN52021.1|  SRK protein                                             170   3e-50   Brassica cretica
gb|KDO74363.1|  hypothetical protein CISIN_1g0467031mg                  170   4e-50   
dbj|BAF91414.1|  S-locus receptor kinase (kinase domain)                175   5e-50   Brassica oleracea
gb|AFP33768.1|  SRK                                                     179   5e-50   
gb|AFP33767.1|  SRK                                                     179   5e-50   
gb|AFP33770.1|  SRK                                                     179   6e-50   
gb|AID21577.1|  SRKp                                                    179   6e-50   
gb|AFP33766.1|  SRK                                                     179   6e-50   
gb|AFP33769.1|  SRK                                                     179   6e-50   
gb|ACN52019.1|  SRK protein                                             169   6e-50   Brassica cretica
gb|AAL17687.1|  S-locus receptor kinase                                 171   8e-50   Raphanus sativus
gb|AFU83021.1|  SRK protein                                             169   8e-50   
dbj|BAF91399.1|  S-locus receptor kinase (kinase domain)                174   8e-50   Brassica oleracea
dbj|BAF91409.1|  S-locus receptor kinase (kinase domain)                174   9e-50   Brassica oleracea
ref|XP_008362569.1|  PREDICTED: G-type lectin S-receptor-like ser...    171   1e-49   
ref|XP_004485681.1|  PREDICTED: receptor-like serine/threonine-pr...    179   1e-49   
ref|XP_003593412.1|  Serine/threonine protein kinase                    179   1e-49   
ref|XP_008355368.1|  PREDICTED: G-type lectin S-receptor-like ser...    171   1e-49   
dbj|BAF91407.1|  S-locus receptor kinase (kinase domain)                174   1e-49   Brassica oleracea
gb|AAL17684.1|  S-locus receptor kinase                                 170   1e-49   Raphanus sativus
ref|XP_008349266.1|  PREDICTED: G-type lectin S-receptor-like ser...    174   2e-49   
ref|XP_002518601.1|  S-locus-specific glycoprotein S6 precursor, ...    178   2e-49   Ricinus communis
gb|AAA33008.1|  serine/threonine kinase receptor                        178   2e-49   Brassica napus [oilseed rape]
ref|XP_008777139.1|  PREDICTED: receptor-like serine/threonine-pr...    177   2e-49   
emb|CDY39264.1|  BnaC06g27270D                                          169   2e-49   
ref|XP_010924050.1|  PREDICTED: receptor-like serine/threonine-pr...    178   2e-49   
ref|XP_006388693.1|  hypothetical protein POPTR_0118s002202g            168   2e-49   
ref|XP_010928033.1|  PREDICTED: receptor-like serine/threonine-pr...    180   2e-49   
gb|ACN52024.1|  SRK protein                                             167   2e-49   Brassica cretica
gb|ACN52032.1|  SRK protein                                             167   2e-49   Brassica cretica
gb|AAN64451.1|  putative receptor-like kinase, 5'-partial               170   3e-49   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006452099.1|  hypothetical protein CICLE_v10009316mg             168   3e-49   
ref|XP_006452092.1|  hypothetical protein CICLE_v10010321mg             176   3e-49   
gb|ACN52036.1|  SRK protein                                             166   3e-49   Brassica cretica
ref|XP_010415123.1|  PREDICTED: receptor-like serine/threonine-pr...    175   3e-49   
gb|AAL17689.1|  S-locus receptor kinase                                 169   3e-49   Raphanus sativus
ref|XP_008369911.1|  PREDICTED: G-type lectin S-receptor-like ser...    169   3e-49   
gb|ACN52020.1|  SRK protein                                             166   3e-49   Brassica cretica
ref|XP_006452102.1|  hypothetical protein CICLE_v10007547mg             176   3e-49   
ref|XP_008363599.1|  PREDICTED: G-type lectin S-receptor-like ser...    170   3e-49   
gb|AFW84882.1|  putative S-locus receptor-like protein kinase fam...    169   3e-49   
ref|XP_006370368.1|  hypothetical protein POPTR_0001s42030g             177   4e-49   
gb|KDO74365.1|  hypothetical protein CISIN_1g043285mg                   172   4e-49   
ref|XP_008775529.1|  PREDICTED: receptor-like serine/threonine-pr...    177   4e-49   
ref|XP_007214638.1|  hypothetical protein PRUPE_ppa001615mg             176   4e-49   
ref|XP_009397155.1|  PREDICTED: receptor-like serine/threonine-pr...    177   5e-49   
ref|XP_010274341.1|  PREDICTED: uncharacterized protein LOC104609...    178   5e-49   
ref|XP_006452106.1|  hypothetical protein CICLE_v10007528mg             176   5e-49   
ref|XP_007159231.1|  hypothetical protein PHAVU_002G220200g             177   5e-49   
emb|CAN70180.1|  hypothetical protein VITISV_000005                     167   5e-49   Vitis vinifera
gb|AAL17686.1|  S-locus receptor kinase                                 169   5e-49   Raphanus sativus
ref|XP_008355367.1|  PREDICTED: G-type lectin S-receptor-like ser...    171   5e-49   
ref|XP_008813304.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    179   5e-49   
ref|XP_006598304.1|  PREDICTED: uncharacterized protein LOC100797331    179   6e-49   
gb|KDO40578.1|  hypothetical protein CISIN_1g0058031mg                  167   6e-49   
emb|CBI14789.3|  unnamed protein product                                167   6e-49   
ref|XP_009408780.1|  PREDICTED: receptor-like serine/threonine-pr...    179   7e-49   
gb|KDO74381.1|  hypothetical protein CISIN_1g0393181mg                  168   7e-49   
gb|ACN52039.1|  SRK protein                                             165   7e-49   Brassica cretica
gb|ACN52034.1|  SRK protein                                             165   8e-49   Brassica cretica
gb|AAS94090.1|  S-locus receptor kinase                                 168   8e-49   Raphanus sativus
dbj|BAF91413.1|  S-locus receptor kinase (kinase domain)                172   9e-49   Brassica oleracea
gb|ACN52027.1|  SRK protein                                             166   1e-48   Brassica cretica
gb|AIB04258.1|  S-locus receptor kinase s-haplotype 1                   176   1e-48   
ref|XP_010247744.1|  PREDICTED: G-type lectin S-receptor-like ser...    176   1e-48   
ref|XP_010924049.1|  PREDICTED: receptor-like serine/threonine-pr...    176   1e-48   
tpg|DAA57334.1|  TPA: putative S-locus receptor-like protein kina...    165   1e-48   
ref|XP_011029380.1|  PREDICTED: G-type lectin S-receptor-like ser...    176   1e-48   
ref|XP_006383979.1|  hypothetical protein POPTR_0004s02800g             170   1e-48   
ref|XP_011002479.1|  PREDICTED: G-type lectin S-receptor-like ser...    177   1e-48   
gb|KDO74350.1|  hypothetical protein CISIN_1g005933mg                   174   1e-48   
ref|XP_002316941.2|  hypothetical protein POPTR_0011s12870g             175   1e-48   Populus trichocarpa [western balsam poplar]
ref|XP_006413787.1|  hypothetical protein EUTSA_v10024419mg             175   1e-48   
gb|ACN52038.1|  SRK protein                                             164   1e-48   Brassica cretica
ref|XP_006467963.1|  PREDICTED: cysteine-rich receptor-like prote...    174   2e-48   
gb|ACN52035.1|  SRK protein                                             165   2e-48   Brassica cretica
ref|XP_008226732.1|  PREDICTED: G-type lectin S-receptor-like ser...    175   2e-48   
gb|AGC55017.1|  S-receptor kinase                                       175   2e-48   
gb|AGC55015.1|  S-receptor kinase                                       175   2e-48   
dbj|BAB40986.1|  SRKa                                                   175   2e-48   Arabidopsis lyrata [lyrate rockcress]
ref|XP_006433220.1|  hypothetical protein CICLE_v100005811mg            166   2e-48   
ref|XP_002869890.1|  predicted protein                                  175   2e-48   
gb|AAL17688.1|  S-locus receptor kinase                                 167   2e-48   Raphanus sativus
gb|KDO42697.1|  hypothetical protein CISIN_1g0091861mg                  166   3e-48   
gb|KDO74347.1|  hypothetical protein CISIN_1g003391mg                   173   3e-48   
ref|XP_003598129.1|  Serine/threonine protein kinase                    169   3e-48   
ref|XP_006475280.1|  PREDICTED: uncharacterized protein LOC102629172    177   3e-48   
gb|ACN52041.1|  SRK protein                                             164   3e-48   Brassica cretica
dbj|BAF02195.1|  putative receptor kinase                               172   3e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006475281.1|  PREDICTED: G-type lectin S-receptor-like ser...    167   3e-48   
emb|CDY39269.1|  BnaC06g27220D                                          171   3e-48   
ref|XP_007213469.1|  hypothetical protein PRUPE_ppa023906mg             174   3e-48   
dbj|BAF91402.1|  S-locus receptor kinase (kinase domain)                170   3e-48   Brassica oleracea
gb|ACN52042.1|  SRK protein                                             164   3e-48   Brassica cretica
ref|XP_006452105.1|  hypothetical protein CICLE_v10007572mg             174   3e-48   
ref|XP_007208597.1|  hypothetical protein PRUPE_ppa022413mg             172   4e-48   
ref|XP_007021213.1|  S-locus lectin protein kinase family protein...    168   4e-48   
ref|XP_006452095.1|  hypothetical protein CICLE_v10007596mg             173   4e-48   
gb|ACU29643.1|  S-locus receptor kinase 25                              174   4e-48   Arabidopsis lyrata [lyrate rockcress]
gb|AID21613.1|  SRKp                                                    174   4e-48   
gb|KCW76512.1|  hypothetical protein EUGRSUZ_D00902                     169   4e-48   
ref|XP_007021202.1|  S-locus lectin protein kinase family protein...    174   4e-48   
ref|XP_006470118.1|  PREDICTED: receptor-like serine/threonine-pr...    167   4e-48   
dbj|BAF91398.1|  S-locus receptor kinase (kinase domain)                170   5e-48   Brassica rapa
dbj|BAF91388.1|  S-locus receptor kinase (kinase domain)                170   5e-48   Brassica rapa
gb|ABY55237.1|  S-locus receptor kinase                                 164   5e-48   Diplotaxis tenuifolia
dbj|BAF91403.1|  S-locus receptor kinase (kinase domain)                170   5e-48   Brassica oleracea
ref|XP_007133617.1|  hypothetical protein PHAVU_011G194400g             163   5e-48   
ref|XP_007021132.1|  S-locus lectin protein kinase family protein...    169   5e-48   
gb|ACN52037.1|  SRK protein                                             165   5e-48   Brassica cretica
ref|XP_006452080.1|  hypothetical protein CICLE_v10007464mg             174   5e-48   
emb|CBI20456.3|  unnamed protein product                                169   6e-48   
gb|KDO74353.1|  hypothetical protein CISIN_1g003272mg                   174   6e-48   
gb|KDO56874.1|  hypothetical protein CISIN_1g0052812mg                  164   6e-48   
emb|CDY07469.1|  BnaA07g25480D                                          171   6e-48   
gb|AFP33771.1|  SRK                                                     174   6e-48   
ref|XP_009402881.1|  PREDICTED: receptor-like serine/threonine-pr...    174   6e-48   
ref|XP_010924052.1|  PREDICTED: receptor-like serine/threonine-pr...    173   6e-48   
emb|CDY07465.1|  BnaA07g25440D                                          172   6e-48   
gb|AGN12877.1|  putative S-locus receptor kinase                        174   7e-48   
ref|XP_009402882.1|  PREDICTED: receptor-like serine/threonine-pr...    174   7e-48   
ref|XP_009341704.1|  PREDICTED: cysteine-rich receptor-like prote...    169   7e-48   
ref|XP_010058873.1|  PREDICTED: cysteine-rich receptor-like prote...    166   7e-48   
ref|XP_006594797.1|  PREDICTED: G-type lectin S-receptor-like ser...    173   7e-48   
ref|XP_008225012.1|  PREDICTED: uncharacterized protein LOC103324693    176   7e-48   
ref|XP_002316940.2|  hypothetical protein POPTR_0011s13040g             173   7e-48   Populus trichocarpa [western balsam poplar]
ref|XP_006377788.1|  hypothetical protein POPTR_0011s12840g             173   7e-48   
ref|XP_009357378.1|  PREDICTED: cysteine-rich receptor-like prote...    164   8e-48   
dbj|BAF91412.1|  S-locus receptor kinase                                174   8e-48   Brassica oleracea
ref|XP_010910455.1|  PREDICTED: receptor-like serine/threonine-pr...    172   8e-48   
dbj|BAF57003.1|  S receptor kinase                                      174   8e-48   Brassica rapa
ref|XP_002867852.1|  At4g21380                                          174   8e-48   
ref|XP_008356167.1|  PREDICTED: G-type lectin S-receptor-like ser...    163   8e-48   
gb|KHN36756.1|  G-type lectin S-receptor-like serine/threonine-pr...    173   8e-48   
gb|AID21612.1|  ARK3p                                                   173   8e-48   
ref|XP_006594796.1|  PREDICTED: G-type lectin S-receptor-like ser...    173   9e-48   
gb|AFP33758.1|  SRK                                                     173   9e-48   
ref|XP_010042219.1|  PREDICTED: G-type lectin S-receptor-like ser...    166   9e-48   
gb|ADQ37383.1|  unknown                                                 173   9e-48   
gb|KFK28717.1|  hypothetical protein AALP_AA7G037900                    173   1e-47   
ref|XP_007212497.1|  hypothetical protein PRUPE_ppa017572mg             173   1e-47   
ref|XP_003559651.2|  PREDICTED: receptor-like serine/threonine-pr...    172   1e-47   
gb|KDO74346.1|  hypothetical protein CISIN_1g003391mg                   173   1e-47   
ref|XP_007021194.1|  S-locus lectin protein kinase family protein...    172   1e-47   
ref|XP_006370370.1|  hypothetical protein POPTR_0001s42050g             173   1e-47   
ref|XP_009133539.1|  PREDICTED: receptor-like serine/threonine-pr...    173   1e-47   
emb|CDY35375.1|  BnaA03g19850D                                          173   1e-47   
gb|AFU83020.1|  SRK protein                                             164   1e-47   
ref|XP_007021201.1|  S-locus lectin protein kinase family protein...    173   1e-47   
ref|XP_010910454.1|  PREDICTED: receptor-like serine/threonine-pr...    173   1e-47   
ref|XP_006284976.1|  hypothetical protein CARUB_v10006283mg             173   1e-47   
ref|XP_010910453.1|  PREDICTED: receptor-like serine/threonine-pr...    173   1e-47   
ref|XP_007149663.1|  hypothetical protein PHAVU_005G088800g             172   1e-47   
ref|XP_006452075.1|  hypothetical protein CICLE_v10007466mg             172   1e-47   
ref|XP_008383964.1|  PREDICTED: G-type lectin S-receptor-like ser...    173   1e-47   
ref|XP_003636663.1|  Cysteine-rich receptor-like protein kinase         165   1e-47   
gb|AID21587.1|  ARK3p                                                   173   1e-47   
ref|XP_006582722.1|  PREDICTED: G-type lectin S-receptor-like ser...    169   1e-47   
emb|CCI61483.1|  ARK3                                                   173   1e-47   
gb|KCW67078.1|  hypothetical protein EUGRSUZ_F00850                     167   1e-47   
gb|AID21647.1|  ARK3p                                                   173   2e-47   
ref|XP_008226734.1|  PREDICTED: G-type lectin S-receptor-like ser...    175   2e-47   
gb|AID21690.1|  ARK3p                                                   173   2e-47   
ref|XP_009105170.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    172   2e-47   
gb|ADQ37352.1|  unknown                                                 173   2e-47   
gb|AFP33761.1|  SRK                                                     173   2e-47   
dbj|BAF91393.1|  S-locus receptor kinase (kinase domain)                168   2e-47   Brassica rapa
dbj|BAF91404.1|  S-locus receptor kinase (kinase domain)                168   2e-47   Brassica oleracea
ref|XP_008226123.1|  PREDICTED: G-type lectin S-receptor-like ser...    172   2e-47   
ref|XP_011030922.1|  PREDICTED: G-type lectin S-receptor-like ser...    173   2e-47   
gb|ACO83273.1|  SRK                                                     172   2e-47   Capsella rubella
ref|XP_007021195.1|  S-locus lectin protein kinase family protein...    174   2e-47   
ref|XP_010274340.1|  PREDICTED: putative G-type lectin S-receptor...    174   2e-47   
ref|XP_010232438.1|  PREDICTED: receptor-like serine/threonine-pr...    172   2e-47   
ref|XP_006388696.1|  hypothetical protein POPTR_0118s00250g             166   2e-47   
ref|XP_007021200.1|  S-locus lectin protein kinase family protein       174   2e-47   
ref|XP_011007884.1|  PREDICTED: G-type lectin S-receptor-like ser...    161   2e-47   
ref|XP_006377282.1|  hypothetical protein POPTR_0011s03710g             164   2e-47   
ref|XP_006475273.1|  PREDICTED: uncharacterized protein LOC102626595    174   2e-47   
ref|XP_006452103.1|  hypothetical protein CICLE_v10010341mg             172   2e-47   
gb|EYU33576.1|  hypothetical protein MIMGU_mgv1a003061mg                171   2e-47   
ref|XP_003564365.1|  PREDICTED: receptor-like serine/threonine-pr...    172   2e-47   
gb|ADQ37374.1|  unknown                                                 173   2e-47   
gb|ADQ37382.1|  unknown                                                 172   2e-47   
gb|KDP30509.1|  hypothetical protein JCGZ_16689                         172   2e-47   
gb|AGN12878.1|  putative receptor kinase 3                              173   3e-47   
ref|XP_010315042.1|  PREDICTED: G-type lectin S-receptor-like ser...    166   3e-47   
dbj|BAA92836.1|  S18 S-locus receptor kinase                            172   3e-47   Brassica oleracea
ref|XP_010924051.1|  PREDICTED: receptor-like serine/threonine-pr...    165   3e-47   
ref|XP_008355366.1|  PREDICTED: G-type lectin S-receptor-like ser...    170   3e-47   
ref|XP_009361788.1|  PREDICTED: G-type lectin S-receptor-like ser...    162   3e-47   
ref|XP_006475277.1|  PREDICTED: G-type lectin S-receptor-like ser...    172   3e-47   
ref|XP_008454614.1|  PREDICTED: G-type lectin S-receptor-like ser...    172   3e-47   
ref|XP_008454615.1|  PREDICTED: G-type lectin S-receptor-like ser...    172   3e-47   
gb|AAP92126.1|  receptor-like protein kinase ARK1                       172   3e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007214096.1|  hypothetical protein PRUPE_ppa015608mg             172   3e-47   
emb|CDY62911.1|  BnaC01g41140D                                          171   3e-47   
dbj|BAD53361.1|  putative receptor-like protein kinase ARK1             172   3e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009398952.1|  PREDICTED: receptor-like serine/threonine-pr...    172   3e-47   
gb|EAZ40226.1|  hypothetical protein OsJ_24671                          167   3e-47   
ref|XP_010054462.1|  PREDICTED: G-type lectin S-receptor-like ser...    169   3e-47   
ref|NP_001044463.1|  Os01g0784700                                       172   3e-47   
ref|XP_008225015.1|  PREDICTED: receptor-like serine/threonine-pr...    174   3e-47   
gb|ABN05291.1|  ARK3 protein                                            172   3e-47   
gb|AAB33487.1|  ARK3 product/receptor-like serine/threonine prote...    172   3e-47   
ref|XP_004146866.1|  PREDICTED: receptor-like serine/threonine-pr...    171   4e-47   
gb|KCW67076.1|  hypothetical protein EUGRSUZ_F00850                     167   4e-47   
dbj|BAF91410.1|  S-locus receptor kinase (kinase domain)                167   4e-47   
gb|KDP34761.1|  hypothetical protein JCGZ_10541                         171   4e-47   
ref|XP_009398189.1|  PREDICTED: receptor-like serine/threonine-pr...    171   4e-47   
ref|NP_193869.1|  receptor kinase 3                                     172   4e-47   
ref|XP_006475274.1|  PREDICTED: uncharacterized protein LOC102626881    174   4e-47   
ref|XP_010040961.1|  PREDICTED: G-type lectin S-receptor-like ser...    160   4e-47   
gb|KDP20850.1|  hypothetical protein JCGZ_21321                         168   4e-47   
ref|XP_011012090.1|  PREDICTED: G-type lectin S-receptor-like ser...    171   4e-47   
emb|CBI33185.3|  unnamed protein product                                169   5e-47   
gb|KEH32947.1|  cysteine-rich receptor-like kinase                      169   5e-47   
ref|XP_006370567.1|  hypothetical protein POPTR_0001s438602g            161   5e-47   
ref|XP_008363596.1|  PREDICTED: G-type lectin S-receptor-like ser...    169   6e-47   
ref|XP_011030919.1|  PREDICTED: G-type lectin S-receptor-like ser...    165   6e-47   
ref|XP_011097955.1|  PREDICTED: G-type lectin S-receptor-like ser...    171   6e-47   
gb|ACN52045.1|  SRK protein                                             160   6e-47   
ref|XP_008345502.1|  PREDICTED: uncharacterized protein LOC103408424    170   6e-47   
ref|XP_007025876.1|  S-locus lectin protein kinase family protein       171   6e-47   
gb|KCW67077.1|  hypothetical protein EUGRSUZ_F00850                     167   6e-47   
ref|XP_006452072.1|  hypothetical protein CICLE_v10007451mg             171   7e-47   
gb|KCW74979.1|  hypothetical protein EUGRSUZ_E03726                     162   7e-47   
gb|ACN52043.1|  SRK protein                                             160   7e-47   
ref|XP_010060394.1|  PREDICTED: G-type lectin S-receptor-like ser...    168   8e-47   
gb|KDO74340.1|  hypothetical protein CISIN_1g003254mg                   171   8e-47   
ref|XP_010415122.1|  PREDICTED: receptor-like serine/threonine-pr...    171   8e-47   
gb|ABV21214.1|  At4g21380                                               171   8e-47   
ref|XP_009370697.1|  PREDICTED: G-type lectin S-receptor-like ser...    170   8e-47   
ref|XP_006475244.1|  PREDICTED: G-type lectin S-receptor-like ser...    171   8e-47   
ref|XP_006377227.1|  hypothetical protein POPTR_0011s021702g            164   8e-47   
gb|AID21659.1|  ARK3p                                                   171   8e-47   
ref|XP_002528889.1|  ATP binding protein, putative                      173   8e-47   
gb|KHM98850.1|  G-type lectin S-receptor-like serine/threonine-pr...    165   9e-47   
gb|ADQ37363.1|  unknown                                                 171   9e-47   
gb|KDO64309.1|  hypothetical protein CISIN_1g0073972mg                  165   9e-47   
dbj|BAG98857.1|  unnamed protein product                                160   9e-47   
ref|XP_007133116.1|  hypothetical protein PHAVU_011G152700g             170   9e-47   
ref|XP_007214693.1|  hypothetical protein PRUPE_ppa024127mg             168   1e-46   
gb|AAS94088.1|  S-locus receptor kinase                                 163   1e-46   
emb|CDY66915.1|  BnaC03g72660D                                          171   1e-46   
gb|ACN52025.1|  SRK protein                                             160   1e-46   
ref|XP_008386061.1|  PREDICTED: G-type lectin S-receptor-like ser...    170   1e-46   
ref|XP_010439485.1|  PREDICTED: receptor-like serine/threonine-pr...    171   1e-46   
gb|EYU33574.1|  hypothetical protein MIMGU_mgv1a0256212mg               169   1e-46   
ref|XP_002317551.2|  hypothetical protein POPTR_0011s13260g             170   1e-46   
gb|ACN52049.1|  SRK protein                                             160   1e-46   
emb|CAN65556.1|  hypothetical protein VITISV_021447                     159   1e-46   
ref|XP_004253524.2|  PREDICTED: G-type lectin S-receptor-like ser...    165   1e-46   
ref|NP_176756.1|  receptor-like serine/threonine-protein kinase S...    170   1e-46   
gb|AAS94092.1|  S-locus receptor kinase                                 163   1e-46   
emb|CCI61482.1|  SRK                                                    170   1e-46   
ref|XP_011007882.1|  PREDICTED: cysteine-rich receptor-like prote...    161   1e-46   
ref|XP_007133093.1|  hypothetical protein PHAVU_011G151000g             165   1e-46   
gb|AAB33486.1|  ARK2 product/receptor-like serine/threonine prote...    170   1e-46   
ref|XP_008231610.1|  PREDICTED: G-type lectin S-receptor-like ser...    165   1e-46   
emb|CAA79355.1|  S-receptor kinase-like protein                         170   1e-46   
gb|KDP36269.1|  hypothetical protein JCGZ_09834                         168   1e-46   
gb|KDO74372.1|  hypothetical protein CISIN_1g0052361mg                  169   1e-46   
ref|XP_011007883.1|  PREDICTED: cysteine-rich receptor-like prote...    161   1e-46   
ref|XP_008383136.1|  PREDICTED: cysteine-rich receptor-like prote...    164   1e-46   
ref|XP_006377794.1|  hypothetical protein POPTR_0011s12900g             167   1e-46   
gb|ADQ37372.1|  unknown                                                 170   1e-46   
gb|EYU43088.1|  hypothetical protein MIMGU_mgv1a021334mg                170   2e-46   
gb|AAS94085.1|  S-locus receptor kinase                                 162   2e-46   
gb|AAS94087.1|  S-locus receptor kinase                                 162   2e-46   
ref|XP_002886974.1|  hypothetical protein ARALYDRAFT_475686             169   2e-46   
ref|XP_004293003.1|  PREDICTED: G-type lectin S-receptor-like ser...    169   2e-46   
ref|XP_009609145.1|  PREDICTED: G-type lectin S-receptor-like ser...    170   2e-46   
ref|XP_011015991.1|  PREDICTED: G-type lectin S-receptor-like ser...    161   2e-46   
gb|AAS94089.1|  S-locus receptor kinase                                 162   2e-46   
ref|XP_006285585.1|  hypothetical protein CARUB_v10007030mg             169   2e-46   
ref|XP_006851147.1|  hypothetical protein AMTR_s00043p00100060          168   2e-46   
ref|XP_006452089.1|  hypothetical protein CICLE_v10008568mg             165   2e-46   
emb|CAA74662.1|  SFR3                                                   170   2e-46   
ref|XP_004154883.1|  PREDICTED: receptor-like serine/threonine-pr...    171   2e-46   
gb|KCW73442.1|  hypothetical protein EUGRSUZ_E01920                     168   2e-46   
ref|XP_009802016.1|  PREDICTED: G-type lectin S-receptor-like ser...    160   2e-46   
ref|XP_004970203.1|  PREDICTED: receptor-like serine/threonine-pr...    170   2e-46   
ref|XP_009788891.1|  PREDICTED: receptor-like serine/threonine-pr...    169   2e-46   
gb|KHG07104.1|  G-type lectin S-receptor-like serine/threonine-pr...    169   2e-46   
gb|EYU43089.1|  hypothetical protein MIMGU_mgv1a002648mg                168   2e-46   
ref|XP_006370367.1|  hypothetical protein POPTR_0001s42020g             169   2e-46   
emb|CDP11770.1|  unnamed protein product                                169   2e-46   
gb|EEE59347.1|  hypothetical protein OsJ_11431                          169   2e-46   
emb|CDY39268.1|  BnaC06g27230D                                          169   2e-46   
ref|XP_007021196.1|  S-locus lectin protein kinase family protein...    171   2e-46   
ref|XP_009134691.1|  PREDICTED: receptor-like serine/threonine-pr...    170   3e-46   
ref|XP_009788890.1|  PREDICTED: G-type lectin S-receptor-like ser...    169   3e-46   
dbj|BAB69683.1|  receptor kinase 5                                      169   3e-46   
gb|AAS94093.1|  S-locus receptor kinase                                 162   3e-46   
gb|ADQ37392.1|  unknown                                                 169   3e-46   
ref|XP_009788889.1|  PREDICTED: G-type lectin S-receptor-like ser...    169   3e-46   
emb|CAA67145.1|  receptor-like kinase                                   169   3e-46   
ref|XP_008226748.1|  PREDICTED: G-type lectin S-receptor-like ser...    168   3e-46   
emb|CDX79055.1|  BnaA01g11220D                                          169   3e-46   
ref|XP_003598133.1|  Serine/threonine protein kinase                    164   3e-46   
dbj|BAA23676.1|  receptor kinase 1                                      169   3e-46   
emb|CAA73133.1|  serine /threonine kinase                               169   3e-46   
emb|CDO99674.1|  unnamed protein product                                169   3e-46   
gb|ACN52047.1|  SRK protein                                             160   3e-46   
ref|XP_009788888.1|  PREDICTED: G-type lectin S-receptor-like ser...    169   3e-46   
ref|XP_010241038.1|  PREDICTED: G-type lectin S-receptor-like ser...    169   3e-46   
emb|CBI20441.3|  unnamed protein product                                160   3e-46   
ref|XP_010064363.1|  PREDICTED: G-type lectin S-receptor-like ser...    166   3e-46   
gb|KCW50905.1|  hypothetical protein EUGRSUZ_J00554                     167   3e-46   
ref|XP_008226752.1|  PREDICTED: G-type lectin S-receptor-like ser...    168   3e-46   
gb|EMS54495.1|  Receptor-like serine/threonine-protein kinase SD1-7     167   3e-46   
ref|XP_009788887.1|  PREDICTED: G-type lectin S-receptor-like ser...    169   3e-46   
ref|XP_009788886.1|  PREDICTED: G-type lectin S-receptor-like ser...    169   3e-46   
gb|KHN36765.1|  G-type lectin S-receptor-like serine/threonine-pr...    168   4e-46   
dbj|BAF91394.1|  S-locus receptor kinase                                169   4e-46   
ref|XP_010056937.1|  PREDICTED: putative receptor-like protein ki...    167   4e-46   
ref|XP_009605851.1|  PREDICTED: G-type lectin S-receptor-like ser...    164   4e-46   
ref|XP_009352927.1|  PREDICTED: G-type lectin S-receptor-like ser...    169   4e-46   
ref|XP_008789837.1|  PREDICTED: receptor-like serine/threonine-pr...    171   4e-46   
ref|XP_007212700.1|  hypothetical protein PRUPE_ppa018599mg             168   4e-46   
ref|XP_008383135.1|  PREDICTED: cysteine-rich receptor-like prote...    164   4e-46   
gb|EMS60519.1|  Receptor-like serine/threonine-protein kinase SD1-8     167   4e-46   
ref|XP_002518594.1|  Negative regulator of the PHO system, putative     171   4e-46   
gb|KCW67255.1|  hypothetical protein EUGRSUZ_F01049                     168   4e-46   
gb|AET02753.2|  cysteine-rich RLK (receptor-like kinase) protein        168   4e-46   
ref|XP_006465595.1|  PREDICTED: G-type lectin S-receptor-like ser...    168   4e-46   
ref|NP_001050479.1|  Os03g0556600                                       169   4e-46   
ref|XP_006383982.1|  hypothetical protein POPTR_0004s02820g             168   4e-46   
ref|XP_003628277.1|  Serine/threonine protein kinase                    168   4e-46   
ref|XP_008224858.1|  PREDICTED: cysteine-rich receptor-like prote...    164   5e-46   
gb|EAY90640.1|  hypothetical protein OsI_12243                          169   5e-46   
ref|XP_006370369.1|  hypothetical protein POPTR_0001s42040g             168   5e-46   
ref|XP_006426981.1|  hypothetical protein CICLE_v10024927mg             168   5e-46   
ref|XP_010105620.1|  G-type lectin S-receptor-like serine/threoni...    168   5e-46   
gb|AAF23832.1|AC007234_4  F1E22.15                                      171   5e-46   
dbj|BAF91411.1|  S-locus receptor kinase                                169   5e-46   
ref|XP_009623818.1|  PREDICTED: G-type lectin S-receptor-like ser...    162   5e-46   
gb|KCW50901.1|  hypothetical protein EUGRSUZ_J00545                     167   5e-46   
ref|XP_007022737.1|  Receptor kinase 3, putative                        167   5e-46   
ref|NP_176755.1|  receptor-like serine/threonine-protein kinase S...    169   5e-46   
ref|XP_010320281.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...    168   5e-46   
ref|XP_010320274.1|  PREDICTED: G-type lectin S-receptor-like ser...    168   5e-46   
ref|XP_004295401.1|  PREDICTED: G-type lectin S-receptor-like ser...    168   5e-46   
ref|XP_008230178.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...    162   5e-46   
gb|KDO56869.1|  hypothetical protein CISIN_1g041345mg                   162   6e-46   
ref|XP_006383983.1|  hypothetical protein POPTR_0004s02820g             168   6e-46   
emb|CBI20437.3|  unnamed protein product                                159   6e-46   
dbj|BAF91406.1|  S-locus receptor kinase (kinase domain)                164   6e-46   
gb|AID21633.1|  ARK3p                                                   168   6e-46   
gb|KDP38978.1|  hypothetical protein JCGZ_00735                         168   6e-46   
ref|XP_008778624.1|  PREDICTED: receptor-like serine/threonine-pr...    167   6e-46   
ref|XP_010034232.1|  PREDICTED: G-type lectin S-receptor-like ser...    168   6e-46   
ref|XP_008363601.1|  PREDICTED: G-type lectin S-receptor-like ser...    167   6e-46   
dbj|BAF91381.1|  S receptor kinase                                      164   6e-46   
emb|CAA82930.1|  srk29                                                  168   7e-46   
gb|ACN52051.1|  SRK protein                                             159   7e-46   
gb|ABY55235.1|  S-locus receptor kinase                                 159   7e-46   
ref|XP_008349189.1|  PREDICTED: cysteine-rich receptor-like prote...    161   7e-46   
ref|XP_008226190.1|  PREDICTED: G-type lectin S-receptor-like ser...    168   7e-46   
gb|KCW74897.1|  hypothetical protein EUGRSUZ_E03637                     166   7e-46   
ref|XP_008441853.1|  PREDICTED: G-type lectin S-receptor-like ser...    168   7e-46   
ref|XP_010247747.1|  PREDICTED: G-type lectin S-receptor-like ser...    168   7e-46   
gb|EYU36707.1|  hypothetical protein MIMGU_mgv1a001407mg                168   7e-46   
ref|XP_011013015.1|  PREDICTED: G-type lectin S-receptor-like ser...    168   7e-46   
gb|KHN11180.1|  G-type lectin S-receptor-like serine/threonine-pr...    167   7e-46   
ref|XP_004982563.1|  PREDICTED: receptor-like serine/threonine-pr...    168   7e-46   
ref|XP_007021377.1|  S-locus lectin protein kinase family protein...    168   8e-46   
ref|XP_007021380.1|  S-locus lectin protein kinase family protein       168   8e-46   
ref|XP_006373139.1|  hypothetical protein POPTR_0017s090701g            163   8e-46   
gb|ABY55236.1|  S-locus receptor kinase                                 159   8e-46   
ref|XP_002304971.2|  hypothetical protein POPTR_0004s02820g             168   8e-46   
ref|XP_010247745.1|  PREDICTED: G-type lectin S-receptor-like ser...    168   8e-46   
ref|XP_009796863.1|  PREDICTED: G-type lectin S-receptor-like ser...    159   8e-46   
ref|XP_008366279.1|  PREDICTED: G-type lectin S-receptor-like ser...    168   8e-46   
gb|KDO74352.1|  hypothetical protein CISIN_1g038934mg                   167   9e-46   
gb|EYU36706.1|  hypothetical protein MIMGU_mgv1a001937mg                167   9e-46   
ref|XP_004970201.1|  PREDICTED: receptor-like serine/threonine-pr...    168   9e-46   
sp|Q09092.2|SRK6_BRAOV  RecName: Full=Putative serine/threonine-p...    168   9e-46   
ref|XP_008337408.1|  PREDICTED: G-type lectin S-receptor-like ser...    167   9e-46   
ref|XP_010056936.1|  PREDICTED: cysteine-rich receptor-like prote...    167   9e-46   
ref|XP_008441839.1|  PREDICTED: G-type lectin S-receptor-like ser...    167   1e-45   
emb|CDO99672.1|  unnamed protein product                                164   1e-45   
ref|XP_009610105.1|  PREDICTED: G-type lectin S-receptor-like ser...    167   1e-45   
ref|XP_009340923.1|  PREDICTED: cysteine-rich receptor-like prote...    166   1e-45   
ref|XP_010449073.1|  PREDICTED: receptor-like serine/threonine-pr...    168   1e-45   
gb|KCW67084.1|  hypothetical protein EUGRSUZ_F00860                     167   1e-45   
gb|KCW67070.1|  hypothetical protein EUGRSUZ_F00845                     167   1e-45   
ref|XP_007133113.1|  hypothetical protein PHAVU_011G152400g             167   1e-45   
ref|XP_006452078.1|  hypothetical protein CICLE_v10010587mg             167   1e-45   
ref|XP_010034228.1|  PREDICTED: G-type lectin S-receptor-like ser...    167   1e-45   
ref|XP_009377332.1|  PREDICTED: uncharacterized protein LOC103965953    169   1e-45   
ref|XP_007021134.1|  S-locus lectin protein kinase family protein...    167   1e-45   
ref|NP_001183451.1|  uncharacterized LOC100501883                       161   1e-45   
ref|XP_009398951.1|  PREDICTED: receptor-like serine/threonine-pr...    166   1e-45   
gb|KEH19152.1|  Serine/Threonine kinase family protein                  157   1e-45   
ref|XP_010267891.1|  PREDICTED: cysteine-rich receptor-like prote...    166   1e-45   
ref|XP_008386060.1|  PREDICTED: G-type lectin S-receptor-like ser...    166   1e-45   
gb|AAL17690.1|  S-locus receptor kinase                                 160   1e-45   
ref|XP_004164064.1|  PREDICTED: G-type lectin S-receptor-like ser...    167   1e-45   
ref|XP_009105614.1|  PREDICTED: uncharacterized protein LOC103831486    169   1e-45   
ref|XP_008441830.1|  PREDICTED: G-type lectin S-receptor-like ser...    167   1e-45   
ref|XP_009612557.1|  PREDICTED: G-type lectin S-receptor-like ser...    167   1e-45   
ref|XP_010060391.1|  PREDICTED: G-type lectin S-receptor-like ser...    167   1e-45   
gb|ADQ37362.1|  unknown                                                 168   1e-45   
gb|KDO48493.1|  hypothetical protein CISIN_1g0460101mg                  159   1e-45   
ref|XP_006452108.1|  hypothetical protein CICLE_v10010282mg             167   1e-45   
ref|XP_007099540.1|  S-locus lectin protein kinase family protein       166   1e-45   
ref|XP_010060471.1|  PREDICTED: G-type lectin S-receptor-like ser...    167   1e-45   
ref|XP_011007881.1|  PREDICTED: cysteine-rich receptor-like prote...    160   1e-45   
ref|XP_002534316.1|  S-locus-specific glycoprotein S6 precursor, ...    167   1e-45   
gb|ACN52052.1|  SRK protein                                             158   1e-45   
ref|XP_006391517.1|  hypothetical protein EUTSA_v10018116mg             167   1e-45   
ref|XP_008353904.1|  PREDICTED: G-type lectin S-receptor-like ser...    162   1e-45   
emb|CBI33179.3|  unnamed protein product                                163   1e-45   
ref|XP_010064362.1|  PREDICTED: G-type lectin S-receptor-like ser...    167   1e-45   
ref|NP_001238568.1|  protein kinase                                     159   1e-45   
ref|XP_010060470.1|  PREDICTED: G-type lectin S-receptor-like ser...    167   1e-45   
gb|KCW74882.1|  hypothetical protein EUGRSUZ_E03622                     166   2e-45   



>gb|ADG96406.1| S-locus receptor kinase-like protein, partial [Olea europaea]
Length=209

 Score =   209 bits (533),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  EANTK+V GTYGYMSPEYAMDGLFS+KSDVFSFGVLV+EIV+G
Sbjct  29   PKISDFGMARIFGGDQTEANTKRVVGTYGYMSPEYAMDGLFSMKSDVFSFGVLVVEIVTG  88

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            KKNRGFY+ NNQ NLL HAW LWREGRG EL+D A GES+SPSEV+RCIQVGL+CVQEQA
Sbjct  89   KKNRGFYHTNNQLNLLAHAWRLWREGRGMELMDSAAGESYSPSEVLRCIQVGLLCVQEQA  148



>ref|XP_009768621.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Nicotiana sylvestris]
Length=907

 Score =   219 bits (559),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  E NTK+V GTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIV+G
Sbjct  727  PKISDFGMARIFGGDETEGNTKRVVGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVTG  786

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            KKNRGFY QNNQ NLLGHAW LW+EGRGSELLDPAVGE+FSP EVMRCIQVGL+CVQEQA
Sbjct  787  KKNRGFYYQNNQLNLLGHAWRLWKEGRGSELLDPAVGETFSPCEVMRCIQVGLLCVQEQA  846



>ref|XP_009612738.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Nicotiana tomentosiformis]
Length=858

 Score =   218 bits (555),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  E NTK+V GTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIV+G
Sbjct  678  PKISDFGMARIFGGDETEGNTKRVVGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVTG  737

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            KKNRGFY QNNQ NLLGHAW LW+EGRGSELLDP+VGE+FSP EVMRCIQVGL+CVQEQA
Sbjct  738  KKNRGFYYQNNQLNLLGHAWKLWKEGRGSELLDPSVGETFSPCEVMRCIQVGLLCVQEQA  797



>ref|XP_010316637.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Solanum lycopersicum]
Length=857

 Score =   216 bits (551),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  E NTK+V GTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIV+G
Sbjct  677  PKISDFGMARIFGGDETEGNTKRVVGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVTG  736

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            KKNRGFY QNNQ NLLGHAW LW+EG GSELLDP+ GESFSPSEVMRCIQVGL+CVQEQA
Sbjct  737  KKNRGFYYQNNQLNLLGHAWRLWKEGSGSELLDPSFGESFSPSEVMRCIQVGLLCVQEQA  796



>ref|XP_009773537.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Nicotiana sylvestris]
Length=865

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  E NTK+V GTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIV+G
Sbjct  686  PKISDFGMARIFGGDETEGNTKRVVGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVTG  745

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            KKNRGFY QNNQ+NLLGHAW LWREG  SELLD AVGESFSP EVMRCIQVGL+CVQEQA
Sbjct  746  KKNRGFYYQNNQRNLLGHAWRLWREGTASELLDTAVGESFSPCEVMRCIQVGLLCVQEQA  805



>ref|XP_009616770.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Nicotiana tomentosiformis]
Length=864

 Score =   214 bits (546),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  E NTK+V GTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIV+G
Sbjct  685  PKISDFGMARIFGGDETEGNTKRVVGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVTG  744

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            KKNRGFY QNNQ+NLLGHAW LWREG  SELLD AVGESFSP EVMRCIQVGL+CVQEQA
Sbjct  745  KKNRGFYYQNNQRNLLGHAWRLWREGTASELLDSAVGESFSPCEVMRCIQVGLLCVQEQA  804



>ref|XP_008345021.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like serine/threonine-protein 
kinase SD1-8 [Malus domestica]
Length=411

 Score =   204 bits (520),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  EANT++V GTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEI+SG
Sbjct  229  PKISDFGMARIFGNDQTEANTRRVVGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIISG  288

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            KKNRGFY  NN+ NLLGHAW LW EG+GSE++DP+VG+S+SPS V+RCIQVGL+CVQE+A
Sbjct  289  KKNRGFYYANNELNLLGHAWKLWTEGKGSEIIDPSVGDSYSPSVVLRCIQVGLLCVQERA  348



>gb|AAC23542.1| receptor protein kinase [Ipomoea trifida]
Length=853

 Score =   210 bits (535),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 110/121 (91%), Gaps = 1/121 (1%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEAN-TKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVS  179
            PKISDFG+AR+  G+  +AN TK+V GTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIV+
Sbjct  672  PKISDFGMARIFGGDETDANNTKRVVGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVT  731

Query  180  GKKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            GKKNRGFYNQNNQQNLLGHAW LWRE RGSELLD A+GES+S  EVMRCIQVGL+CVQEQ
Sbjct  732  GKKNRGFYNQNNQQNLLGHAWRLWRERRGSELLDSAIGESYSLCEVMRCIQVGLLCVQEQ  791

Query  360  A  362
            A
Sbjct  792  A  792



>ref|XP_007213546.1| hypothetical protein PRUPE_ppa018740mg [Prunus persica]
 gb|EMJ14745.1| hypothetical protein PRUPE_ppa018740mg [Prunus persica]
Length=421

 Score =   201 bits (511),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG AR+   +  EANT++V GTYGYMSPEYAMDGLFS+KSDVFSFGVLVLEI+SG
Sbjct  239  PKISDFGRARIFGRDQTEANTRRVVGTYGYMSPEYAMDGLFSIKSDVFSFGVLVLEIISG  298

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            KKNRGFY  NN+ NLLGHAW LW EG+G E++DP+VG+S+SPSEV+RC+QVGL+CVQE+A
Sbjct  299  KKNRGFYYSNNELNLLGHAWKLWTEGKGLEIIDPSVGDSYSPSEVLRCMQVGLLCVQERA  358



>ref|XP_010317517.1| PREDICTED: uncharacterized protein LOC101252749 [Solanum lycopersicum]
Length=2711

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = +3

Query  3     PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
             PKISDFG+AR+  G+  E NTK+V GTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIV+G
Sbjct  2532  PKISDFGMARIFGGDETEGNTKRVVGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVTG  2591

Query  183   KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
             KKNRGFY QNN++NLLGHAW LWREG  SELLD +VGESFSP EV+RCIQVGL+CVQEQA
Sbjct  2592  KKNRGFYFQNNERNLLGHAWKLWREGGASELLDSSVGESFSPCEVIRCIQVGLLCVQEQA  2651


 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 90/120 (75%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFGLAR        ANT ++AGT+GYMSPEYAM GLFS KSDV+SFGVL+LEIVSG
Sbjct  667  PKISDFGLARTFQVTQELANTNRIAGTFGYMSPEYAMGGLFSEKSDVYSFGVLLLEIVSG  726

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            KKN GFY+  N  NLL +AW L  E +  +L+D ++ +S S + V+RCI +GL+CVQ+ A
Sbjct  727  KKNSGFYDHENHLNLLSYAWKLQTESKELDLMDKSILDSSSSATVLRCIHIGLLCVQDHA  786



>ref|XP_006343406.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8-like 
[Solanum tuberosum]
Length=1642

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  E NTK+V GTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIV+G
Sbjct  682  PKISDFGMARIFGGDETEGNTKRVVGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVTG  741

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            KKNRGFY QNN++NLLGHAW LWREG  SELLD +VGESFSP EV+RCIQVGL+CVQEQA
Sbjct  742  KKNRGFYFQNNERNLLGHAWKLWREGGASELLDSSVGESFSPCEVIRCIQVGLLCVQEQA  801


 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 94/120 (78%), Gaps = 1/120 (1%)
 Frame = +3

Query  3     PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
             PKISDFG AR+  G+  EANT +V GTYGYMSPEYAM+G FSVKSDVFSFGVL+LEI++G
Sbjct  1464  PKISDFGTARIFGGDQIEANTNRVVGTYGYMSPEYAMEGHFSVKSDVFSFGVLLLEIITG  1523

Query  183   KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
             +KN   Y Q++  NL+G+ W  W + +  +++DP++G+ +  SEV+RCIQ+GL+CVQ  A
Sbjct  1524  RKNTTHY-QDHSLNLVGNVWDSWNDDKAIDVVDPSLGDWYESSEVLRCIQIGLLCVQSYA  1582



>emb|CDO99671.1| unnamed protein product [Coffea canephora]
Length=499

 Score =   201 bits (510),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  EANT++V GTYGYMSPEYAMDG+FS+KSDVFSFGVLVLEIVSG
Sbjct  319  PKISDFGMARIFGGDETEANTRRVVGTYGYMSPEYAMDGVFSIKSDVFSFGVLVLEIVSG  378

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            KKNRGFY+ NNQ NLL HAW LWREGRG EL+D A GE +S  +VMRCI VGL+CVQE A
Sbjct  379  KKNRGFYHMNNQLNLLAHAWKLWREGRGLELMDSAAGELYSTVDVMRCIHVGLLCVQEHA  438



>ref|XP_008364109.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Malus domestica]
Length=877

 Score =   202 bits (515),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  EANT++V GTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEI+SG
Sbjct  695  PKISDFGMARIFGNDQTEANTRRVVGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIISG  754

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            KKNRGFY  NN+ NLLGHAW LW EG+GSE++DP+VG+S+SPS V+RCIQVGL+CVQE+A
Sbjct  755  KKNRGFYYANNELNLLGHAWKLWTEGKGSEIIDPSVGDSYSPSVVLRCIQVGLLCVQERA  814



>ref|XP_008227125.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Prunus mume]
Length=865

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  EANT++V GTYGYMSPEYAMDGLFS+KSDVFSFGVLVLEI+SG
Sbjct  683  PKISDFGMARIFGRDQTEANTRRVVGTYGYMSPEYAMDGLFSIKSDVFSFGVLVLEIISG  742

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            KKNRGFY  NN+ NLLGHAW LW EG GSE++DP+VG+S+ PSEV+RC+QVGL+CVQE+A
Sbjct  743  KKNRGFYYSNNELNLLGHAWKLWTEGNGSEIIDPSVGDSYFPSEVLRCMQVGLLCVQERA  802



>ref|XP_009345819.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Pyrus x bretschneideri]
Length=850

 Score =   199 bits (506),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  EANTK+V G YGYMSPEYAMDGLFS+KSDVFSFGVLVLEI+SG
Sbjct  668  PKISDFGMARIFGNDQTEANTKRVVGKYGYMSPEYAMDGLFSIKSDVFSFGVLVLEIISG  727

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            KKNRGFY  NN+ NLLGHAW LW EG+GSE++DP+VG+S+SPS V+RC+QVGL+CVQE+A
Sbjct  728  KKNRGFYYANNELNLLGHAWKLWTEGKGSEIIDPSVGDSYSPSVVLRCMQVGLLCVQERA  787



>emb|CBI25711.3| unnamed protein product [Vitis vinifera]
Length=619

 Score =   197 bits (501),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  EANTK+V GTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEI+SG
Sbjct  439  PKISDFGMARIFGRDQTEANTKRVVGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIISG  498

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            KKNRGFY+ N++ NLLGHAW LWREG+G EL+D +V ES +P +V+RCIQVGL+CVQE A
Sbjct  499  KKNRGFYHLNDEHNLLGHAWRLWREGKGLELMDSSVSESCAPYDVLRCIQVGLLCVQEHA  558



>ref|XP_010240988.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Nelumbo nucifera]
Length=867

 Score =   199 bits (505),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  EANTK+V GTYGYMSPEYAMDGLFSVKSD FSFGVLVLEI+SG
Sbjct  686  PKISDFGMARIFGGDQTEANTKRVVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEIISG  745

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            KKNRGFY  NNQ NLLGHAW LW+EGR  EL+D +VG+S+   EV+RCIQVGL+CVQE+A
Sbjct  746  KKNRGFYYSNNQHNLLGHAWTLWKEGRALELVDTSVGDSYHTYEVLRCIQVGLLCVQERA  805



>gb|KDP20852.1| hypothetical protein JCGZ_21323 [Jatropha curcas]
Length=837

 Score =   198 bits (503),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  EANTK+V GTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIV+G
Sbjct  657  PKISDFGMARIFGGDQTEANTKRVVGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVTG  716

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
             KNRGFY+ N++ NLLGHAW LW+ G+  ELLDP+VG SFS SEV+RC+QVGL+CVQE+A
Sbjct  717  NKNRGFYHSNSELNLLGHAWRLWKAGKALELLDPSVGNSFSSSEVLRCVQVGLLCVQERA  776



>ref|XP_011003370.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Populus euphratica]
Length=254

 Score =   187 bits (476),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  +ANT+++ GTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIV G
Sbjct  74   PKISDFGMARIFGGDQTQANTRRIVGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVCG  133

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            +KNRGFY+ N++ NLLG+ W  W++G G E+LD + G S+SPSEV+RCIQVGL+CVQE+A
Sbjct  134  EKNRGFYHSNSELNLLGNVWRQWKDGNGLEVLDKSAGSSYSPSEVLRCIQVGLLCVQERA  193



>ref|XP_010646880.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Vitis vinifera]
Length=847

 Score =   196 bits (498),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  EANTK+V GTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEI+SG
Sbjct  667  PKISDFGMARIFGRDQTEANTKRVVGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIISG  726

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            KKNRGFY+ N++ NLLGHAW LWREG+G EL+D +V ES +P +V+RCIQVGL+CVQE A
Sbjct  727  KKNRGFYHLNDEHNLLGHAWRLWREGKGLELMDSSVSESCAPYDVLRCIQVGLLCVQEHA  786



>ref|XP_007025869.1| Receptor kinase 3 [Theobroma cacao]
 gb|EOY28491.1| Receptor kinase 3 [Theobroma cacao]
Length=840

 Score =   196 bits (498),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  EANTK+V GTYGYMSPEYAMDGLFS KSDVFSFGVLVLE+VSG
Sbjct  659  PKISDFGMARIFGGDQTEANTKRVVGTYGYMSPEYAMDGLFSAKSDVFSFGVLVLEVVSG  718

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            KKNRGFY+ N++ NLLGHAW LW+EG+G +L+D AVG+S++  EV+RCIQVGL+CVQE+A
Sbjct  719  KKNRGFYHSNSELNLLGHAWRLWKEGKGMDLIDSAVGDSYNAQEVLRCIQVGLLCVQERA  778



>gb|KCW76531.1| hypothetical protein EUGRSUZ_D00919 [Eucalyptus grandis]
Length=281

 Score =   185 bits (469),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = +3

Query  6    KISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSGK  185
            KISDFG+AR+   +  E NTK+V GTYGYM PEYAMDG FS KSDVFSFGVLVLEI+SGK
Sbjct  103  KISDFGMARIFGRDQVEVNTKRVVGTYGYMVPEYAMDGQFSEKSDVFSFGVLVLEIISGK  162

Query  186  KNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            KNRGFY  NN+ NLLGH+W LW+EG+G ELLD AVG+++S +EV+RCIQV L+CVQE A
Sbjct  163  KNRGFYYANNELNLLGHSWKLWKEGKGLELLDSAVGDAYSMNEVLRCIQVSLLCVQEHA  221



>ref|XP_011096222.1| PREDICTED: uncharacterized protein LOC105175473 [Sesamum indicum]
Length=1723

 Score =   197 bits (500),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = +3

Query  3     PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
             PKISDFG+AR+  G+  EANTK+V GTYGYMSPEYAMDGLFS+KSDVFSFGVLVLEIVSG
Sbjct  1543  PKISDFGMARIFGGDQTEANTKRVVGTYGYMSPEYAMDGLFSIKSDVFSFGVLVLEIVSG  1602

Query  183   KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
              KNRGFY  NN  NLL +AW L+REGRG EL+D A GES+S SEVMRCIQVGL+CVQE A
Sbjct  1603  TKNRGFYQTNNHLNLLAYAWKLYREGRGLELMDTAAGESYSASEVMRCIQVGLLCVQEHA  1662


 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 93/120 (78%), Gaps = 1/120 (1%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  GN  EANT +V GTYGYM+PEYAM+GLFS+KSDV+SFGVL+LEI+SG
Sbjct  666  PKISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSLKSDVYSFGVLLLEIISG  725

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            ++N  F       N++G+AW LW  GR  EL+DP++  S S  +V+RC+ VGL+CVQ+ A
Sbjct  726  RRNTSF-RSTKYSNIIGYAWDLWDRGRAMELVDPSISNSCSEEQVVRCVNVGLLCVQDMA  784



>gb|EYU27869.1| hypothetical protein MIMGU_mgv1a017829mg, partial [Erythranthe 
guttata]
Length=643

 Score =   192 bits (487),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  EANTK+V GTYGYMSPEYAMDGLFS+KSDVFSFGVLVLEIVSG
Sbjct  463  PKISDFGMARIFGGDQTEANTKRVVGTYGYMSPEYAMDGLFSIKSDVFSFGVLVLEIVSG  522

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
             KNRGFY  NNQ NLL +AW L+REG G ++LD A GE++S SEVMRCIQVGL+CVQE  
Sbjct  523  MKNRGFYQTNNQLNLLAYAWKLYREGEGLKILDKAAGETYSASEVMRCIQVGLLCVQEHT  582



>ref|XP_010106713.1| Receptor-like serine/threonine-protein kinase SD1-8 [Morus notabilis]
 gb|EXC11581.1| Receptor-like serine/threonine-protein kinase SD1-8 [Morus notabilis]
Length=833

 Score =   192 bits (489),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ + +  +ANT +V GTYGYMSPEYAMDGLFSVKSD FSFGVLVLEIVSG
Sbjct  652  PKISDFGMARMFSRDQTQANTIRVVGTYGYMSPEYAMDGLFSVKSDAFSFGVLVLEIVSG  711

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            KKNRGFY+ N++ NLLGHAW LW+EG+  EL+D ++GES+S SEV+RCIQVGL+CVQE+A
Sbjct  712  KKNRGFYHANSELNLLGHAWNLWKEGKALELVDSSIGESYSASEVLRCIQVGLLCVQERA  771



>ref|XP_010665760.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=864

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  E NT++V GTYGYM+PEYAMDGLFS+KSDVFSFGVLVLEI+SG
Sbjct  683  PKISDFGMARIFGGDQTEGNTRRVVGTYGYMAPEYAMDGLFSIKSDVFSFGVLVLEIISG  742

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
             KNRGFYN +++ NLLG++W LWREG+G+ELLD  +GESFS  EV+RC+QVGL+CVQE+A
Sbjct  743  TKNRGFYNADHELNLLGYSWKLWREGKGTELLDKVMGESFSIHEVLRCLQVGLLCVQERA  802



>ref|XP_010665759.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=867

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  E NT++V GTYGYM+PEYAMDGLFS+KSDVFSFGVLVLEI+SG
Sbjct  686  PKISDFGMARIFGGDQTEGNTRRVVGTYGYMAPEYAMDGLFSIKSDVFSFGVLVLEIISG  745

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
             KNRGFYN +++ NLLG++W LWREG+G+ELLD  +GESFS  EV+RC+QVGL+CVQE+A
Sbjct  746  TKNRGFYNADHELNLLGYSWKLWREGKGTELLDKVMGESFSIHEVLRCLQVGLLCVQERA  805



>ref|XP_010538687.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
isoform X2 [Tarenaya hassleriana]
Length=848

 Score =   190 bits (483),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  EANT+KV GTYGYM+PEYAMDG FSVKSDVFSFGVLVLEIVSG
Sbjct  666  PKISDFGMARIFGGDETEANTRKVVGTYGYMAPEYAMDGTFSVKSDVFSFGVLVLEIVSG  725

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            K+NRGFYN N + NLLG AW  W+EG+G E++DP +G+S+   EV+RCIQ+GL+CVQE+A
Sbjct  726  KRNRGFYNSNTELNLLGSAWRYWKEGKGIEIVDPVIGDSYPNHEVLRCIQIGLLCVQERA  785



>ref|XP_010538685.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
isoform X1 [Tarenaya hassleriana]
Length=850

 Score =   190 bits (483),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  EANT+KV GTYGYM+PEYAMDG FSVKSDVFSFGVLVLEIVSG
Sbjct  668  PKISDFGMARIFGGDETEANTRKVVGTYGYMAPEYAMDGTFSVKSDVFSFGVLVLEIVSG  727

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            K+NRGFYN N + NLLG AW  W+EG+G E++DP +G+S+   EV+RCIQ+GL+CVQE+A
Sbjct  728  KRNRGFYNSNTELNLLGSAWRYWKEGKGIEIVDPVIGDSYPNHEVLRCIQIGLLCVQERA  787



>ref|XP_006377805.1| hypothetical protein POPTR_0011s130601g, partial [Populus trichocarpa]
 gb|ERP55602.1| hypothetical protein POPTR_0011s130601g, partial [Populus trichocarpa]
Length=230

 Score =   179 bits (454),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  EANT ++ GTYGY+SPEYA+DGLFS+KSDVFSFGVLVLEIVSG
Sbjct  52   PKISDFGMARIFGGDQIEANTNRIVGTYGYISPEYAVDGLFSIKSDVFSFGVLVLEIVSG  111

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            KKNRGFY+ ++  NLLGHAW LW EGR  EL+D  + +S S SE++R IQVGL+CVQ++ 
Sbjct  112  KKNRGFYHPDHNHNLLGHAWKLWNEGRPLELMDITIDDSSSLSEILRHIQVGLLCVQQRP  171



>gb|ACN52012.1| SRK protein [Brassica cretica]
Length=200

 Score =   178 bits (451),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 101/127 (80%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+VA +  EANT KV GTYGYMSPEYAMDG FS KSDVFSFGV+VLEIVSG
Sbjct  25   PKISDFGMARIVARDETEANTMKVVGTYGYMSPEYAMDGKFSEKSDVFSFGVIVLEIVSG  84

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES-------FSPSEVMRCIQVGL  341
            KKNRGFY+ N++ NLL +AW  W+EGR  E++DP + +S       F P EV++CIQ+GL
Sbjct  85   KKNRGFYDFNSKNNLLRYAWSQWKEGRALEIIDPVILDSLPSLPSTFQPQEVLKCIQIGL  144

Query  342  VCVQEQA  362
            +CVQE A
Sbjct  145  LCVQELA  151



>ref|XP_010052484.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Eucalyptus grandis]
 gb|KCW76535.1| hypothetical protein EUGRSUZ_D00923 [Eucalyptus grandis]
Length=854

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  EANTK+V GTYGYM+PEYAMDG FS KSDVFSFGVLVLEI+SG
Sbjct  675  PKISDFGMARIFGRDQVEANTKRVVGTYGYMAPEYAMDGQFSEKSDVFSFGVLVLEIISG  734

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            KKNRGFY  NN+ NLLGH+W LW+EG+G ELLD AVG+++S +EV+RCIQVGL+CVQE 
Sbjct  735  KKNRGFYYANNELNLLGHSWKLWKEGKGLELLDTAVGDAYSMNEVLRCIQVGLLCVQEH  793



>gb|ACN52014.1| SRK protein [Brassica cretica]
Length=212

 Score =   178 bits (451),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 101/127 (80%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+VA +  EANT KV GTYGYMSPEYAMDG FS KSDVFSFGV+VLEIVSG
Sbjct  29   PKISDFGMARIVARDETEANTMKVVGTYGYMSPEYAMDGKFSEKSDVFSFGVIVLEIVSG  88

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES-------FSPSEVMRCIQVGL  341
            KKNRGFY+ N++ NLL +AW  W+EGR  E++DP + +S       F P EV++CIQ+GL
Sbjct  89   KKNRGFYDFNSKNNLLRYAWSQWKEGRALEIIDPVILDSLPSLPSTFQPQEVLKCIQIGL  148

Query  342  VCVQEQA  362
            +CVQE A
Sbjct  149  LCVQELA  155



>gb|KHN45740.1| Receptor-like serine/threonine-protein kinase SD1-8 [Glycine 
soja]
Length=853

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  EANT +V GTYGYMSPEYAMDG+FSVKSDVFSFGVLVLEI+SG
Sbjct  673  PKISDFGMARIFGTDQTEANTMRVVGTYGYMSPEYAMDGIFSVKSDVFSFGVLVLEIISG  732

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            KKNRGFY+ N + NLLGHAW LW+E    EL+DP++  S+S SEV+RCIQVGL+CVQE+A
Sbjct  733  KKNRGFYSANKELNLLGHAWKLWKEENALELIDPSIDNSYSESEVLRCIQVGLLCVQERA  792



>gb|ACN52011.1| SRK protein [Brassica cretica]
Length=209

 Score =   178 bits (451),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 101/127 (80%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+VA +  EANT KV GTYGYMSPEYAMDG FS KSDVFSFGV+VLEIVSG
Sbjct  28   PKISDFGMARIVARDETEANTMKVVGTYGYMSPEYAMDGKFSEKSDVFSFGVIVLEIVSG  87

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES-------FSPSEVMRCIQVGL  341
            KKNRGFY+ N++ NLL +AW  W+EGR  E++DP + +S       F P EV++CIQ+GL
Sbjct  88   KKNRGFYDFNSKNNLLRYAWSQWKEGRALEIIDPVILDSLPSLPSTFQPQEVLKCIQIGL  147

Query  342  VCVQEQA  362
            +CVQE A
Sbjct  148  LCVQELA  154



>gb|ACN52013.1| SRK protein [Brassica cretica]
Length=213

 Score =   178 bits (451),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 101/127 (80%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+VA +  EANT KV GTYGYMSPEYAMDG FS KSDVFSFGV+VLEIVSG
Sbjct  30   PKISDFGMARIVARDETEANTMKVVGTYGYMSPEYAMDGKFSEKSDVFSFGVIVLEIVSG  89

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES-------FSPSEVMRCIQVGL  341
            KKNRGFY+ N++ NLL +AW  W+EGR  E++DP + +S       F P EV++CIQ+GL
Sbjct  90   KKNRGFYDFNSKNNLLRYAWSQWKEGRALEIIDPVILDSLPSLPSTFQPQEVLKCIQIGL  149

Query  342  VCVQEQA  362
            +CVQE A
Sbjct  150  LCVQELA  156



>gb|ACN52031.1| SRK protein [Brassica cretica]
Length=214

 Score =   178 bits (451),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 101/127 (80%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  EANT+ V GTYGYMSPEYAMDG+FS KSDVFSFGV+VLEIV+G
Sbjct  31   PKISDFGMARIFARDETEANTRNVVGTYGYMSPEYAMDGVFSEKSDVFSFGVIVLEIVTG  90

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES-------FSPSEVMRCIQVGL  341
            K++RGFYN N++ NLL +AW  W EGR  E++DP + ES       F P EV++CIQ+GL
Sbjct  91   KRSRGFYNLNHENNLLSYAWSHWTEGRAPEIVDPVIVESLSSPPATFQPKEVLKCIQIGL  150

Query  342  VCVQEQA  362
            +CVQE+A
Sbjct  151  LCVQERA  157



>gb|KCW76538.1| hypothetical protein EUGRSUZ_D00925 [Eucalyptus grandis]
Length=831

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  EANTK+V GTYGYM+PEYAMDGLFS KSDVFSFGVLVLEI+SG
Sbjct  652  PKISDFGMARIFGRDQVEANTKRVVGTYGYMAPEYAMDGLFSEKSDVFSFGVLVLEIISG  711

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            KKNRGFY  N+++NLL H+W  W+EG+G ELLD AVG+++S +EV+RCIQVGL+CVQE+A
Sbjct  712  KKNRGFYYPNDERNLLEHSWKFWKEGKGLELLDSAVGDAYSMNEVLRCIQVGLLCVQERA  771



>ref|XP_010054468.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like serine/threonine-protein 
kinase SD1-8 [Eucalyptus grandis]
Length=846

 Score =   188 bits (478),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  EANTK+V GTYGYM+PEYAMDGLFS KSDVFSFGVLVLEI+SG
Sbjct  667  PKISDFGMARIFGRDQVEANTKRVVGTYGYMAPEYAMDGLFSEKSDVFSFGVLVLEIISG  726

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            KKNRGFY  N+++NLL H+W  W+EG+G ELLD AVG+++S +EV+RCIQVGL+CVQE+A
Sbjct  727  KKNRGFYYPNDERNLLEHSWKFWKEGKGLELLDSAVGDAYSMNEVLRCIQVGLLCVQERA  786



>ref|XP_010268934.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Nelumbo nucifera]
Length=855

 Score =   188 bits (478),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  EANT +V GT+GYMSPEYAMDGLFSVKSDVFSFGVLVLEI+SG
Sbjct  675  PKISDFGMARIFGGDQTEANTNRVVGTFGYMSPEYAMDGLFSVKSDVFSFGVLVLEIISG  734

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
             KNRGFY+ NNQ NLLGHAW LWREG   +L+D ++GE +   EV+RCIQV L+CVQE+A
Sbjct  735  MKNRGFYHTNNQYNLLGHAWALWREGTTLKLVDTSMGECYHTYEVLRCIQVALLCVQERA  794



>ref|XP_008227365.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Prunus mume]
Length=880

 Score =   188 bits (477),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+ARL   +  E NT++V GT+GYM+PEYAMDGLFS KSDVFSFGVLVLEI+SG
Sbjct  697  PKISDFGMARLFCNDQTEENTRRVVGTFGYMAPEYAMDGLFSTKSDVFSFGVLVLEIISG  756

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            K+N+GFY+ N + NLLG+AW LW EG+G E++DP VGES+S SEV+RC+QVGL+CVQE+A
Sbjct  757  KRNKGFYSSNTELNLLGNAWKLWNEGKGLEMIDPDVGESYSHSEVLRCMQVGLLCVQERA  816



>ref|XP_002304966.1| Brassica self-incompatibility locus family protein [Populus trichocarpa]
 gb|EEE85477.1| Brassica self-incompatibility locus family protein [Populus trichocarpa]
Length=834

 Score =   187 bits (475),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  +ANT+++ GTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIV G
Sbjct  654  PKISDFGMARIFGGDQTQANTRRIVGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVCG  713

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            +KNRGFY+ N++ NLLG+ W  W++G G E+LD +VG S+SPSEV+RCIQVGL+CVQE+A
Sbjct  714  EKNRGFYHSNSELNLLGNVWRQWKDGNGLEVLDISVGSSYSPSEVLRCIQVGLLCVQERA  773



>gb|ACN52018.1| SRK protein [Brassica cretica]
Length=217

 Score =   176 bits (446),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 98/127 (77%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  EANT KV GTYGYMSPEYAMDG FS KSDVFSFGV+VLEIVSG
Sbjct  33   PKISDFGMARIFARHETEANTMKVVGTYGYMSPEYAMDGKFSEKSDVFSFGVIVLEIVSG  92

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES-------FSPSEVMRCIQVGL  341
            KKNRGFYN +N+ NLL + W  W+E RG E+ DP + +S       F P EV++CIQ+GL
Sbjct  93   KKNRGFYNFDNENNLLSYVWSHWKEARGLEVADPVIIDSLSSLPSTFQPQEVLKCIQIGL  152

Query  342  VCVQEQA  362
            +CVQE A
Sbjct  153  LCVQEHA  159



>dbj|BAB40987.1| SRKb [Arabidopsis lyrata]
 gb|ADQ37349.1| unknown [Arabidopsis lyrata]
Length=853

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 103/126 (82%), Gaps = 6/126 (5%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  EANT+KV GTYGYMSPEYAMDG+FSVKSDVFSFGVLVLEIVSG
Sbjct  666  PKISDFGMARIFGRDETEANTRKVVGTYGYMSPEYAMDGIFSVKSDVFSFGVLVLEIVSG  725

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES------FSPSEVMRCIQVGLV  344
            KKNRGFYN N   NLLG+AW  W+EG+G E+LDP + +S      F P EV+RCIQ+GL+
Sbjct  726  KKNRGFYNSNQDNNLLGYAWRNWKEGKGLEILDPFIVDSSSSPSAFRPHEVLRCIQIGLL  785

Query  345  CVQEQA  362
            CVQE+A
Sbjct  786  CVQERA  791



>ref|XP_011011561.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Populus euphratica]
Length=834

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  +ANT+++ GTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIV G
Sbjct  654  PKISDFGMARIFGGDQTQANTRRIVGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVCG  713

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            +KNRGFY+ N++ NLLG+ W  W++G G E+LD + G S+SPSEV+RCIQVGL+CVQE+A
Sbjct  714  EKNRGFYHSNSELNLLGNVWRQWKDGNGLEVLDKSAGSSYSPSEVLRCIQVGLLCVQERA  773



>gb|KDO75658.1| hypothetical protein CISIN_1g0029692mg, partial [Citrus sinensis]
Length=410

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  E NTK+V GTYGYMSPEYAMDGLFSVKSDVFSFGVL+LE VSG
Sbjct  231  PKISDFGMARIFGGDQTEQNTKRVVGTYGYMSPEYAMDGLFSVKSDVFSFGVLLLETVSG  290

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            KKNRGFY+ NN+ NLLGH W LW+EG+  E++D +V +++  +EV+RCI VGL+CVQE A
Sbjct  291  KKNRGFYHSNNELNLLGHVWRLWKEGKVLEMVDSSV-DNYPANEVLRCIHVGLLCVQENA  349



>gb|KHN19083.1| Receptor-like serine/threonine-protein kinase SD1-8 [Glycine 
soja]
Length=743

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+ARL   N  EANT +V GTYGYMSPEYAMDG FSVKSDVFSFGVLVLEI++G
Sbjct  563  PKISDFGMARLFGSNQTEANTSRVVGTYGYMSPEYAMDGNFSVKSDVFSFGVLVLEIITG  622

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            KKNRGFY  N   NLLG+AW  WR+G   EL+D + G+S+SPSEV+RCI VGL+CVQE+A
Sbjct  623  KKNRGFYYSNEDMNLLGNAWRQWRDGSALELIDSSTGDSYSPSEVLRCIHVGLLCVQERA  682



>ref|XP_003541757.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8-like 
[Glycine max]
Length=850

 Score =   186 bits (471),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+ARL   N  EANT +V GTYGYMSPEYAMDG FSVKSDVFSFGVLVLEI++G
Sbjct  670  PKISDFGMARLFGSNQTEANTSRVVGTYGYMSPEYAMDGNFSVKSDVFSFGVLVLEIITG  729

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            KKNRGFY  N   NLLG+AW  WR+G   EL+D + G+S+SPSEV+RCI VGL+CVQE+A
Sbjct  730  KKNRGFYYSNEDMNLLGNAWRQWRDGSALELIDSSTGDSYSPSEVLRCIHVGLLCVQERA  789



>ref|XP_003608281.1| Serine/threonine protein kinase [Medicago truncatula]
 gb|AES90478.1| G-type lectin S-receptor-like Serine/Threonine-kinase [Medicago 
truncatula]
Length=852

 Score =   186 bits (471),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  EANT +V GTYGYMSPEYAMDG+FSVKSDVFSFGVLV+EI+SG
Sbjct  672  PKISDFGMARIFGTDQTEANTVRVVGTYGYMSPEYAMDGIFSVKSDVFSFGVLVMEIISG  731

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            KKNRGFY+ N + NLLGH+W LW EG   EL+D ++  S+SP+EV RCIQVGL+CVQE+A
Sbjct  732  KKNRGFYSANKELNLLGHSWKLWNEGNALELIDSSIVNSYSPAEVFRCIQVGLLCVQERA  791



>gb|ACN52015.1| SRK protein [Brassica cretica]
Length=208

 Score =   175 bits (443),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 99/127 (78%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  EANT KV GTYGYMSPEYAM G+FS KSDVFSFGV+VLEIVSG
Sbjct  33   PKISDFGMARIFARDETEANTMKVVGTYGYMSPEYAMHGIFSEKSDVFSFGVIVLEIVSG  92

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFS-------PSEVMRCIQVGL  341
            KKNRGFYN N + +LL +AW  W+EGR  E++DP + +S         P EV++CIQ+GL
Sbjct  93   KKNRGFYNSNCENDLLSYAWSHWKEGRALEIVDPVIVDSLPSLPLTSQPQEVLKCIQIGL  152

Query  342  VCVQEQA  362
            +CVQE+A
Sbjct  153  LCVQERA  159



>gb|ACN52026.1| SRK protein [Brassica cretica]
Length=175

 Score =   173 bits (438),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 99/127 (78%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  EANT KV GTYGYMSPEYAM+G+FS KSDVFSFGV+VLEIV+G
Sbjct  8    PKISDFGMARIFARDETEANTMKVVGTYGYMSPEYAMNGIFSEKSDVFSFGVIVLEIVTG  67

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES-------FSPSEVMRCIQVGL  341
            K+NRGFYN N + N L +AW  W+EGR  E++DP + +S       F P EV++CIQ+GL
Sbjct  68   KRNRGFYNLNYKNNFLSYAWSNWKEGRALEIVDPVIEDSLSSLPSTFQPQEVLKCIQIGL  127

Query  342  VCVQEQA  362
            +CVQE A
Sbjct  128  LCVQELA  134



>ref|XP_002316682.1| hypothetical protein POPTR_0011s03770g [Populus trichocarpa]
 gb|EEE97294.1| hypothetical protein POPTR_0011s03770g [Populus trichocarpa]
Length=831

 Score =   184 bits (468),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  +ANT +V GTYGYMSPEYAMDGLFS KSDVFSFGVLVLEIV G
Sbjct  651  PKISDFGMARMFGGDQIQANTVRVVGTYGYMSPEYAMDGLFSAKSDVFSFGVLVLEIVCG  710

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            +KNRGFY+  ++ NLLGH W  W++G+G E+LD +VG S+SP EV+RCIQVGL+CVQE+A
Sbjct  711  EKNRGFYHSFSELNLLGHVWRQWKDGKGLEVLDTSVGNSYSPCEVLRCIQVGLLCVQEKA  770



>gb|ACN52016.1| SRK protein [Brassica cretica]
Length=210

 Score =   173 bits (439),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 99/127 (78%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  EANT KV GTYGYMSPEYAM G+FS KSDVFSFGV+VLEIVSG
Sbjct  29   PKISDFGMARIFARDETEANTMKVVGTYGYMSPEYAMHGIFSEKSDVFSFGVIVLEIVSG  88

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES-------FSPSEVMRCIQVGL  341
            KKN GFYN N + +LL +AW  W+EGR  E++DP + +S       F P EV++CIQ+GL
Sbjct  89   KKNSGFYNLNCENDLLSYAWSHWKEGRALEIVDPVIVDSLPSLPSTFQPQEVLKCIQIGL  148

Query  342  VCVQEQA  362
            +CVQE+A
Sbjct  149  LCVQERA  155



>gb|ACN52029.1| SRK protein [Brassica cretica]
Length=213

 Score =   173 bits (439),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 99/127 (78%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  EANT KV GTYGYMSPEYAM+G+FS KSDVFSFGV+VLEIV+G
Sbjct  30   PKISDFGMARIFARDETEANTMKVVGTYGYMSPEYAMNGIFSEKSDVFSFGVIVLEIVTG  89

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES-------FSPSEVMRCIQVGL  341
            K+NRGFYN N + N L +AW  W+EGR  E++DP + +S       F P EV++CIQ+GL
Sbjct  90   KRNRGFYNLNYKNNFLSYAWSNWKEGRALEIVDPVIVDSLSPLSSTFQPQEVLKCIQIGL  149

Query  342  VCVQEQA  362
            +CVQE A
Sbjct  150  LCVQELA  156



>gb|ACN52030.1| SRK protein [Brassica cretica]
Length=206

 Score =   173 bits (438),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 99/127 (78%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  EANT KV GTYGYMSPEYAM+G+FS KSDVFSFGV+VLEIV+G
Sbjct  31   PKISDFGMARIFARDETEANTMKVVGTYGYMSPEYAMNGIFSEKSDVFSFGVIVLEIVTG  90

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES-------FSPSEVMRCIQVGL  341
            K+NRGFYN N + N L +AW  W+EGR  E++DP + +S       F P EV++CIQ+GL
Sbjct  91   KRNRGFYNLNYKNNFLSYAWSNWKEGRALEIVDPVIVDSLSPLSSTFQPQEVLKCIQIGL  150

Query  342  VCVQEQA  362
            +CVQE A
Sbjct  151  LCVQELA  157



>ref|XP_009398188.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-6 
[Musa acuminata subsp. malaccensis]
Length=249

 Score =   174 bits (442),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 98/120 (82%), Gaps = 1/120 (1%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  +A T++V GTYGYMSPEYAMDG+FSVKSDVFSFGVLVLEIVSG
Sbjct  70   PKISDFGMARMFGGDETDARTRRVVGTYGYMSPEYAMDGIFSVKSDVFSFGVLVLEIVSG  129

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSP-SEVMRCIQVGLVCVQEQ  359
            KKNRG Y  ++  NLL H W LW EG+G EL D ++G S  P +EVM+CI+VGL+CVQ++
Sbjct  130  KKNRGVYQSSHHLNLLAHVWSLWNEGKGLELADASMGPSSLPVAEVMKCIKVGLLCVQDR  189



>gb|AFU83022.1| SRK protein, partial [Brassica oleracea var. italica]
Length=234

 Score =   174 bits (440),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 98/127 (77%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  EANTKKV GTYGYMSPEYAM G+FS KSDVFSFGV+VLEIVSG
Sbjct  44   PKISDFGMARIFARDETEANTKKVVGTYGYMSPEYAMHGIFSEKSDVFSFGVIVLEIVSG  103

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES-------FSPSEVMRCIQVGL  341
            KKNRG YN + + NLL + W  W+EGR  E++DP + +S       F P EV++CIQ+GL
Sbjct  104  KKNRGLYNLSFENNLLSYVWSQWKEGRALEIVDPVIIDSLSSLPSTFQPQEVLKCIQIGL  163

Query  342  VCVQEQA  362
            +CVQE A
Sbjct  164  LCVQEHA  170



>gb|ACN52028.1| SRK protein [Brassica cretica]
Length=213

 Score =   173 bits (439),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 99/127 (78%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  EANT KV GTYGYMSPEYAM+G+FS KSDVFSFGV+VLEIV+G
Sbjct  30   PKISDFGMARIFARDETEANTMKVVGTYGYMSPEYAMNGIFSEKSDVFSFGVIVLEIVTG  89

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES-------FSPSEVMRCIQVGL  341
            K+NRGFYN N + N L +AW  W+EGR  E++DP + +S       F P EV++CIQ+GL
Sbjct  90   KRNRGFYNLNYKNNFLSYAWSNWKEGRALEIVDPVIVDSLSPLSSTFQPQEVLKCIQIGL  149

Query  342  VCVQEQA  362
            +CVQE A
Sbjct  150  LCVQELA  156



>ref|XP_009397154.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Musa acuminata subsp. malaccensis]
Length=823

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  EANT++V GTYGYMSPEYAMDG+FSVKSDVFSFGVLVLEIVSG
Sbjct  644  PKISDFGMARIFGGDETEANTRRVVGTYGYMSPEYAMDGIFSVKSDVFSFGVLVLEIVSG  703

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            K+NRG Y+   Q NLLG+AW LW+EGR SEL+D ++G+SF  +E +RCI+VGL+CVQ++
Sbjct  704  KRNRGVYHSAPQLNLLGYAWSLWKEGRTSELVDESMGDSFPMAEALRCIKVGLLCVQDR  762



>gb|KDO74366.1| hypothetical protein CISIN_1g018304mg [Citrus sinensis]
Length=358

 Score =   177 bits (449),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFGLAR   G+  E NTK+V GTYGYM+PEYA DG FSVKSDVFSFG+L+LEI+SG
Sbjct  180  PKISDFGLARAFGGDETEGNTKRVIGTYGYMAPEYASDGQFSVKSDVFSFGILLLEIISG  239

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            KKNRGFY+ +N  NL+GHAW LW EG  S+L+DP +  SF+ +EV+RCI +GL+CVQ+ 
Sbjct  240  KKNRGFYHSDNNLNLIGHAWKLWNEGMPSQLIDPCIQGSFNLAEVIRCIHIGLLCVQQH  298



>ref|XP_011008151.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Populus euphratica]
Length=839

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ AG+  +ANT +V GTYGYMSPEYAMDG FS KSDVFSFGVLVLEIV G
Sbjct  659  PKISDFGMARIFAGDQIQANTVRVVGTYGYMSPEYAMDGRFSAKSDVFSFGVLVLEIVCG  718

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            +KNRGFY+  ++ NLLGH W  W++G+G E+LD +VG S+SP EV+RCIQVGL+CVQE+A
Sbjct  719  EKNRGFYHSFSELNLLGHVWRQWKDGKGLEVLDTSVGNSYSPCEVLRCIQVGLLCVQEKA  778



>ref|XP_004504969.1| PREDICTED: uncharacterized protein LOC101504189 [Cicer arietinum]
Length=1717

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +3

Query  3     PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
             PKISDFG+AR+   +  EANT +V GTYGYMSPEYAMDG+FSVKSDVFSFGVLV+EI+SG
Sbjct  1537  PKISDFGMARIFGTDQTEANTVRVVGTYGYMSPEYAMDGIFSVKSDVFSFGVLVMEIISG  1596

Query  183   KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
             KKNRGFY+ N + NLLGH W LW EG+  EL+D ++  S+S SEV+RCIQVGL+CVQE+A
Sbjct  1597  KKNRGFYSANKELNLLGHGWNLWTEGKALELIDSSIDNSYSQSEVLRCIQVGLLCVQERA  1656


 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 93/120 (78%), Gaps = 1/120 (1%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFGLAR+  GN  EANT +V GTYGYMSPEYAM+GLFS+KSDV+SFGVL+LEIVSG
Sbjct  675  PKISDFGLARIFGGNQNEANTARVVGTYGYMSPEYAMEGLFSIKSDVYSFGVLLLEIVSG  734

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            +KN  F   +   +L+G+AW LW E R  EL+DP + +S   S+ MRCI +G++CVQ+ A
Sbjct  735  RKNTSF-RHSYDPSLIGYAWRLWSEERVMELVDPLIRDSSPKSKAMRCIHIGMLCVQDSA  793



>gb|AAS94091.1| S-locus receptor kinase [Raphanus sativus]
Length=290

 Score =   174 bits (442),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 97/127 (76%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  EA T+KV GTYGYMSPEY MDG+FS KSDVFSFGV+VLEIVSG
Sbjct  100  PKISDFGMARIFERDETEAKTRKVVGTYGYMSPEYVMDGIFSEKSDVFSFGVIVLEIVSG  159

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES-------FSPSEVMRCIQVGL  341
            KKNRGFYN +N+ NLL + W  W+EGR  E++DP + +S       + P EV+ CIQ+GL
Sbjct  160  KKNRGFYNMSNENNLLSYVWSHWKEGRALEIVDPVILDSLLSLPSTYQPQEVLHCIQIGL  219

Query  342  VCVQEQA  362
            +CVQE A
Sbjct  220  LCVQEHA  226



>gb|ACN52017.1| SRK protein [Brassica cretica]
Length=192

 Score =   171 bits (434),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 98/127 (77%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  EANT KV GTYGYMSPEYAM G+FS KSDVFSFGV+VLEIVSG
Sbjct  25   PKISDFGMARIFARDETEANTMKVVGTYGYMSPEYAMHGIFSEKSDVFSFGVIVLEIVSG  84

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES-------FSPSEVMRCIQVGL  341
            KKN GFYN N + +LL +AW  W+EGR  E++DP + +S       F P EV++C Q+GL
Sbjct  85   KKNSGFYNLNCENDLLSYAWSHWKEGRALEIVDPVIVDSLPSLPSTFQPQEVLKCXQIGL  144

Query  342  VCVQEQA  362
            +CVQE+A
Sbjct  145  LCVQERA  151



>ref|XP_008363600.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1 [Malus domestica]
Length=191

 Score =   171 bits (433),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+ARL  G+  EA TK+V GTYGYM+PEYA+DG FS+KSDVFSFG+L+LE +SG
Sbjct  3    PKISDFGMARLFGGDQTEAVTKRVVGTYGYMAPEYAIDGHFSIKSDVFSFGILLLETLSG  62

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQE  356
            K++RGFY+ N+  NL+GHAW LW+EGR  EL+D  + +S S SEV+RCI V L+CVQ+
Sbjct  63   KRSRGFYDPNHNHNLIGHAWRLWKEGRSLELIDEYLTDSCSLSEVLRCIHVSLLCVQQ  120



>ref|XP_006413786.1| hypothetical protein EUTSA_v10025088mg [Eutrema salsugineum]
 gb|ESQ55239.1| hypothetical protein EUTSA_v10025088mg [Eutrema salsugineum]
Length=476

 Score =   179 bits (453),  Expect = 6e-51, Method: Composition-based stats.
 Identities = 80/123 (65%), Positives = 99/123 (80%), Gaps = 3/123 (2%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  EA T+KV GTYGYMSPEYAMDG+FSVKSDVFSFGVL+LEI+SG
Sbjct  291  PKISDFGMARIFGRDETEAITRKVVGTYGYMSPEYAMDGIFSVKSDVFSFGVLLLEIISG  350

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES---FSPSEVMRCIQVGLVCVQ  353
            K+N+GFYN N   NLLG  W  W+EG+G E++DP   +S   F P E++RCIQ+GL+CVQ
Sbjct  351  KRNKGFYNANRDLNLLGCVWRNWKEGKGVEIVDPITVDSSSTFRPHEILRCIQIGLLCVQ  410

Query  354  EQA  362
            E+A
Sbjct  411  ERA  413



>ref|XP_009370304.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11410 [Pyrus x bretschneideri]
Length=247

 Score =   172 bits (437),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+      EANT +V GTYGYMSPEYAM+GLFSVKSDV+SFGVL+LEIV+G
Sbjct  68   PKISDFGMARIFGAEQIEANTNRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVTG  127

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            +KN G+Y+ +   NL+GH W LW+E R  E++D ++GES+  +EV+RCI + L+CVQEQA
Sbjct  128  RKNTGYYHDSPYSNLVGHVWDLWKENRALEIIDSSLGESYPVNEVLRCIHIALLCVQEQA  187



>ref|XP_006377792.1| hypothetical protein POPTR_0011s12880g [Populus trichocarpa]
 gb|ERP55589.1| hypothetical protein POPTR_0011s12880g [Populus trichocarpa]
Length=750

 Score =   181 bits (460),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFGLAR+  G+  EANTKKV GTYGYMSPEYA+DGLFSVKSDVFSFGVLVLEIVSG
Sbjct  572  PKISDFGLARMFGGDETEANTKKVVGTYGYMSPEYAIDGLFSVKSDVFSFGVLVLEIVSG  631

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            +KNRGF + ++Q NLLGHAW LW E R  EL+D  +GES + SEV+RCI V L+CVQ++
Sbjct  632  RKNRGFNHPDHQHNLLGHAWRLWMEERPLELIDDILGESCALSEVLRCIHVALLCVQQR  690



>ref|XP_009370055.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11410 [Pyrus x bretschneideri]
Length=247

 Score =   172 bits (437),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+      EANT +V GTYGYMSPEYAM+GLFSVKSDV+SFGVL+LEIV+G
Sbjct  68   PKISDFGMARIFGAEQIEANTNRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVTG  127

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            +KN G+Y+ +   NL+GH W LW+E R  E++D ++GES+  +EV+RCI + L+CVQEQA
Sbjct  128  RKNTGYYHDSPYSNLVGHVWDLWKENRALEIIDSSLGESYPVNEVLRCIHIALLCVQEQA  187



>ref|XP_011029379.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Populus euphratica]
Length=824

 Score =   182 bits (461),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFGLAR+  G+  EANTKKV GTYGYMSPEYA+DGLFSVKSDVFSFGVLVLEIVSG
Sbjct  646  PKISDFGLARMCGGDETEANTKKVVGTYGYMSPEYAIDGLFSVKSDVFSFGVLVLEIVSG  705

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            +KNRGF + ++Q NLLGHAW LW E R  EL+D  +GES + SEV+RCI V L+CVQ++
Sbjct  706  RKNRGFNHPDHQHNLLGHAWRLWMEERPLELIDDILGESCALSEVLRCIHVALLCVQQR  764



>ref|XP_009408779.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Musa acuminata subsp. malaccensis]
Length=824

 Score =   182 bits (461),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  E NTK+V GTYGYMSPEYAMDG+FSVKSDVFSFGVL+LEI+SG
Sbjct  645  PKISDFGMARIFGGDESEVNTKRVVGTYGYMSPEYAMDGIFSVKSDVFSFGVLILEIISG  704

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            KKNRG Y+ +   NLLG+ W LWREG+G +L+D A+G+S+  +EV+RC++VGL+CVQE+
Sbjct  705  KKNRGIYDSSRSLNLLGYTWSLWREGKGLDLVDEAIGDSYPKAEVLRCMKVGLLCVQER  763



>gb|AFU83023.1| SRK protein, partial [Brassica oleracea var. italica]
Length=234

 Score =   172 bits (435),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 98/127 (77%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  EANT KV GTYGYMSPEYAM+G+FS KSDVFSFGV+VLEIV+G
Sbjct  44   PKISDFGMARIFARDETEANTMKVVGTYGYMSPEYAMNGIFSEKSDVFSFGVIVLEIVTG  103

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES-------FSPSEVMRCIQVGL  341
            K+NRGFYN N + N L +AW  W+EGR  E++DP + +S       F P EV+ CIQ+GL
Sbjct  104  KRNRGFYNLNYKNNFLSYAWSNWKEGRALEIVDPVIVDSLSPLSSTFQPQEVLECIQIGL  163

Query  342  VCVQEQA  362
            +CVQE A
Sbjct  164  LCVQELA  170



>gb|ACN52022.1| SRK protein [Brassica cretica]
Length=196

 Score =   171 bits (432),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 98/127 (77%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A    EANT KV GTYGYMSPEYAM G+FS KSDVFSFGV+VLEIV+G
Sbjct  21   PKISDFGMARIFAREETEANTMKVVGTYGYMSPEYAMHGIFSEKSDVFSFGVIVLEIVTG  80

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES-------FSPSEVMRCIQVGL  341
            K+NR FYN N + NLL +AW  W+EGR  E++DPA+ +S       F P +V++CIQ+GL
Sbjct  81   KRNRVFYNLNYEDNLLNYAWNNWKEGRALEIVDPAILDSLSSLPSTFQPQDVLKCIQIGL  140

Query  342  VCVQEQA  362
            +CVQE A
Sbjct  141  LCVQELA  147



>ref|XP_007148275.1| hypothetical protein PHAVU_006G194600g [Phaseolus vulgaris]
 gb|ESW20269.1| hypothetical protein PHAVU_006G194600g [Phaseolus vulgaris]
Length=841

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+ARL   N  E NT +V GTYGYMSPEYAMDG FSVKSDVFSFGVL LEI++G
Sbjct  661  PKISDFGMARLFGANQTEGNTLRVVGTYGYMSPEYAMDGTFSVKSDVFSFGVLALEIITG  720

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            KKNRGFY  N+  NLLG+AW  WR+G   EL+D ++G S+SP+EV+RCI VGL+CVQE+A
Sbjct  721  KKNRGFYYSNDDMNLLGNAWRQWRDGSALELVDSSLGNSYSPAEVLRCIHVGLLCVQERA  780



>gb|ABY55238.1| S-locus receptor kinase [Diplotaxis tenuifolia]
Length=200

 Score =   171 bits (432),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 97/127 (76%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  EANT KV GTYGYMSPEYAM G+FS KSDVFSFGV+VLEIV G
Sbjct  27   PKISDFGMARIFARDETEANTMKVVGTYGYMSPEYAMHGIFSEKSDVFSFGVIVLEIVCG  86

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES-------FSPSEVMRCIQVGL  341
            K+NR FYN N + NLL +AW  W+EGR  E++DP + +S       F P EV++CIQ+GL
Sbjct  87   KRNRVFYNLNYEHNLLNYAWIQWKEGRALEIIDPVIIDSLSSLPSTFQPKEVLKCIQIGL  146

Query  342  VCVQEQA  362
            +CVQE A
Sbjct  147  LCVQELA  153



>gb|KDP38990.1| hypothetical protein JCGZ_00747 [Jatropha curcas]
Length=181

 Score =   170 bits (430),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR   G+  E NT +V GTYGYM+PEYA DGLFSVKSDVFSFGVL+LEI+SG
Sbjct  3    PKISDFGMARTFGGDQTEGNTNRVVGTYGYMAPEYATDGLFSVKSDVFSFGVLLLEIISG  62

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            KK+RGFY+ +   NL+GHAW LW+EG+  EL+D  +GES + +EV+RCIQ+ L+CVQ+ 
Sbjct  63   KKSRGFYHPSRGLNLIGHAWKLWKEGKPLELIDVNLGESCNLTEVIRCIQISLLCVQQH  121



>ref|XP_010268959.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Nelumbo nucifera]
Length=848

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 100/120 (83%), Gaps = 1/120 (1%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  EANT+++ GTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEI+SG
Sbjct  670  PKISDFGMARIFGEDQTEANTRRIVGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIISG  729

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
             KN GFY   +Q NLLGHAW LWREG+  EL+D ++G S++ +EV RCI+VGL+CVQE A
Sbjct  730  NKNTGFYTH-SQHNLLGHAWRLWREGKALELVDSSIGHSYNANEVFRCIKVGLLCVQEHA  788



>ref|XP_008371231.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-7 
[Malus domestica]
Length=182

 Score =   169 bits (429),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+      EANT +V GTYGYMSPEYAM+G FSVKSDV+SFGVL+LEIV+G
Sbjct  3    PKISDFGMARIFGAEQIEANTNRVVGTYGYMSPEYAMEGFFSVKSDVYSFGVLLLEIVTG  62

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            +KN G+Y+ +   N++GH W LW+E R  E++D ++GES+  +EV+RCI + L+CVQEQA
Sbjct  63   RKNTGYYHDSPYSNIVGHVWDLWKENRALEIIDSSLGESYPVNEVLRCIHIALLCVQEQA  122



>gb|ACN52033.1| SRK protein [Brassica cretica]
Length=182

 Score =   169 bits (428),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 97/127 (76%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  EA+T    GTYGYMSPEYAMDG+ S K+DVFSFGV+VLEIVSG
Sbjct  12   PKISDFGMARIFARDETEASTDNAVGTYGYMSPEYAMDGVISEKTDVFSFGVIVLEIVSG  71

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFS-------PSEVMRCIQVGL  341
            K+NRGFY  N + NLL +AW  W EGR  E++DP + +SFS       P EV++CIQ+GL
Sbjct  72   KRNRGFYQVNPENNLLSYAWSHWAEGRALEIVDPVIVDSFSSLPSTFQPKEVLKCIQIGL  131

Query  342  VCVQEQA  362
            +C+QE+A
Sbjct  132  LCIQERA  138



>gb|KHN33626.1| Receptor-like serine/threonine-protein kinase SD1-8 [Glycine 
soja]
Length=685

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+ARL   N  EANT +V GTYGYMSPEYAMDG FSVKSDVFSFGVLVLEI++G
Sbjct  505  PKISDFGMARLFGTNQTEANTLRVVGTYGYMSPEYAMDGNFSVKSDVFSFGVLVLEIITG  564

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            KKNRGFY  N   NLLG+AW  WR+G   EL+D ++G+S S SEV+RCI VGL+CVQE+A
Sbjct  565  KKNRGFYYSNEDMNLLGNAWRQWRDGSTLELIDSSIGDSCSQSEVLRCIHVGLLCVQERA  624



>gb|KDP34760.1| hypothetical protein JCGZ_10540 [Jatropha curcas]
Length=655

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 101/119 (85%), Gaps = 1/119 (1%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFGLAR+  G+  EANT +VAGTYGYMSPEYA+DGLFS+KSDVFSFGVL+LEIVSG
Sbjct  478  PKISDFGLARIFGGDQTEANTNRVAGTYGYMSPEYAVDGLFSMKSDVFSFGVLILEIVSG  537

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            KKNRGF++Q +  NLLGHAW LW E R  EL+D  + ES + SEV+RCIQVGL+CVQ++
Sbjct  538  KKNRGFFHQEHNHNLLGHAWKLWIEERSMELVDRKL-ESLAMSEVLRCIQVGLLCVQQR  595



>gb|ACN52021.1| SRK protein [Brassica cretica]
Length=212

 Score =   170 bits (430),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 97/127 (76%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A    EANT KV GTYGYMSPEYAM G+FS KSDVFSFGV+VLEIV+G
Sbjct  29   PKISDFGMARIFAREETEANTMKVVGTYGYMSPEYAMHGIFSEKSDVFSFGVIVLEIVTG  88

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES-------FSPSEVMRCIQVGL  341
            K+NR FYN N + NLL +AW  W+EGR  E++DP + +S       F P EV++CIQ+GL
Sbjct  89   KRNRVFYNLNYEDNLLNYAWSNWKEGRALEIVDPDIVDSLSPLSSTFRPQEVLKCIQIGL  148

Query  342  VCVQEQA  362
            +CVQE A
Sbjct  149  LCVQELA  155



>gb|KDO74363.1| hypothetical protein CISIN_1g0467031mg, partial [Citrus sinensis]
Length=230

 Score =   170 bits (430),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFGLAR   G+  E NT +V GTYGYM+PEYA DG FSVKSDVFSFG+L+LEIVSG
Sbjct  52   PKISDFGLARTFGGDETEGNTTRVVGTYGYMAPEYASDGQFSVKSDVFSFGILLLEIVSG  111

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            KKNRGFY+ +N+ NL+GHAW LW +G  SE++DP   ES + +EV+RCI + L+CVQ+  
Sbjct  112  KKNRGFYHLDNKLNLIGHAWKLWNKGMPSEMIDPCYQESCNLTEVIRCIHISLLCVQQHP  171



>dbj|BAF91414.1| S-locus receptor kinase (kinase domain) [Brassica oleracea]
Length=424

 Score =   175 bits (443),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 99/127 (78%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+VA +  EANT KV GTYGYMSPEYAM G+FS KSDVFSFGV+VLEIVSG
Sbjct  234  PKISDFGMARIVARDETEANTMKVVGTYGYMSPEYAMHGIFSEKSDVFSFGVIVLEIVSG  293

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES-------FSPSEVMRCIQVGL  341
            KKNRGFYN N + +LL + W  W+EGR  E++DP + +S       F P EV++CIQ+GL
Sbjct  294  KKNRGFYNLNCENDLLSYVWSHWKEGRALEIVDPVIVDSLSSLPLTFQPEEVLKCIQIGL  353

Query  342  VCVQEQA  362
            +CVQE A
Sbjct  354  LCVQEFA  360



>gb|AFP33768.1| SRK [Arabidopsis kamchatica subsp. kamchatica]
Length=849

 Score =   179 bits (455),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 101/123 (82%), Gaps = 3/123 (2%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  EANT+KV GTYGYMSPEYAMDG+FS+KSDVFSFGVL+LEI+SG
Sbjct  664  PKISDFGMARIFARDETEANTRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISG  723

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES---FSPSEVMRCIQVGLVCVQ  353
            K+N+GFYN N   NLLG  W  W+EG+G E++DP + +S   F P E++RCIQ+GL+CVQ
Sbjct  724  KRNKGFYNSNRDLNLLGCVWRNWKEGKGLEIVDPIIIDSSTTFRPKEILRCIQIGLLCVQ  783

Query  354  EQA  362
            E A
Sbjct  784  EHA  786



>gb|AFP33767.1| SRK [Arabidopsis kamchatica subsp. kawasakiana]
Length=849

 Score =   179 bits (455),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 101/123 (82%), Gaps = 3/123 (2%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  EANT+KV GTYGYMSPEYAMDG+FS+KSDVFSFGVL+LEI+SG
Sbjct  664  PKISDFGMARIFARDETEANTRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISG  723

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES---FSPSEVMRCIQVGLVCVQ  353
            K+N+GFYN N   NLLG  W  W+EG+G E++DP + +S   F P E++RCIQ+GL+CVQ
Sbjct  724  KRNKGFYNSNRDLNLLGCVWRNWKEGKGLEIVDPIIIDSSTTFRPKEILRCIQIGLLCVQ  783

Query  354  EQA  362
            E A
Sbjct  784  EHA  786



>gb|AFP33770.1| SRK [Arabidopsis kamchatica subsp. kamchatica]
Length=849

 Score =   179 bits (455),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 101/123 (82%), Gaps = 3/123 (2%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  EANT+KV GTYGYMSPEYAMDG+FS+KSDVFSFGVL+LEI+SG
Sbjct  664  PKISDFGMARIFARDETEANTRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISG  723

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES---FSPSEVMRCIQVGLVCVQ  353
            K+N+GFYN N   NLLG  W  W+EG+G E++DP + +S   F P E++RCIQ+GL+CVQ
Sbjct  724  KRNKGFYNSNRDLNLLGCVWRNWKEGKGLEIVDPIIIDSSTTFRPKEILRCIQIGLLCVQ  783

Query  354  EQA  362
            E A
Sbjct  784  EHA  786



>gb|AID21577.1| SRKp [Arabidopsis halleri]
Length=849

 Score =   179 bits (455),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 101/123 (82%), Gaps = 3/123 (2%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  EANT+KV GTYGYMSPEYAMDG+FS+KSDVFSFGVL+LEI+SG
Sbjct  664  PKISDFGMARIFARDETEANTRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISG  723

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES---FSPSEVMRCIQVGLVCVQ  353
            K+N+GFYN N   NLLG  W  W+EG+G E++DP + +S   F P E++RCIQ+GL+CVQ
Sbjct  724  KRNKGFYNSNRDLNLLGCVWRNWKEGKGLEIVDPIIIDSSTTFRPQEILRCIQIGLLCVQ  783

Query  354  EQA  362
            E A
Sbjct  784  EHA  786



>gb|AFP33766.1| SRK [Arabidopsis kamchatica subsp. kamchatica]
Length=849

 Score =   179 bits (455),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 101/123 (82%), Gaps = 3/123 (2%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  EANT+KV GTYGYMSPEYAMDG+FS+KSDVFSFGVL+LEI+SG
Sbjct  664  PKISDFGMARIFARDETEANTRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISG  723

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES---FSPSEVMRCIQVGLVCVQ  353
            K+N+GFYN N   NLLG  W  W+EG+G E++DP + +S   F P E++RCIQ+GL+CVQ
Sbjct  724  KRNKGFYNSNRDLNLLGCVWRNWKEGKGLEIVDPIIIDSSTTFRPKEILRCIQIGLLCVQ  783

Query  354  EQA  362
            E A
Sbjct  784  EHA  786



>gb|AFP33769.1| SRK [Arabidopsis kamchatica subsp. kamchatica]
Length=834

 Score =   179 bits (454),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 101/123 (82%), Gaps = 3/123 (2%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  EANT+KV GTYGYMSPEYAMDG+FS+KSDVFSFGVL+LEI+SG
Sbjct  649  PKISDFGMARIFARDETEANTRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISG  708

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES---FSPSEVMRCIQVGLVCVQ  353
            K+N+GFYN N   NLLG  W  W+EG+G E++DP + +S   F P E++RCIQ+GL+CVQ
Sbjct  709  KRNKGFYNSNRDLNLLGCVWRNWKEGKGLEIVDPIIIDSSTTFRPKEILRCIQIGLLCVQ  768

Query  354  EQA  362
            E A
Sbjct  769  EHA  771



>gb|ACN52019.1| SRK protein [Brassica cretica]
Length=208

 Score =   169 bits (427),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 97/127 (76%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  EANT KV GTYGYMSPEYAM G+FS KSDVFSFGV+VLEIVSG
Sbjct  29   PKISDFGMARIFERDETEANTMKVVGTYGYMSPEYAMYGIFSEKSDVFSFGVIVLEIVSG  88

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES-------FSPSEVMRCIQVGL  341
            KKNRGFYN + + +LL + W  W+EGR  E++DP + +S       F P EV++CIQ+GL
Sbjct  89   KKNRGFYNLDYENDLLSYVWSRWKEGRALEIVDPVIVDSLSSQPSIFQPQEVLKCIQIGL  148

Query  342  VCVQEQA  362
            +CVQE A
Sbjct  149  LCVQELA  155



>gb|AAL17687.1| S-locus receptor kinase [Raphanus sativus]
Length=291

 Score =   171 bits (433),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 99/127 (78%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A    EANT KV GTYGYMSPEYAM G+FS KSDVFSFGV++LEI++G
Sbjct  101  PKISDFGMARIFAREETEANTMKVVGTYGYMSPEYAMHGIFSEKSDVFSFGVIILEIITG  160

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFS-------PSEVMRCIQVGL  341
            K+NRGFYN N + +LL +AW  W+EGR  E++DP + +SFS       P EV++CIQ+GL
Sbjct  161  KRNRGFYNLNYENDLLSYAWSNWKEGRALEIVDPVIIDSFSPLSSTYQPQEVLKCIQIGL  220

Query  342  VCVQEQA  362
            +CVQ+ A
Sbjct  221  LCVQDLA  227



>gb|AFU83021.1| SRK protein, partial [Brassica oleracea var. italica]
Length=234

 Score =   169 bits (429),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 98/127 (77%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  EANT KV GTYGYMSPEYAM+G+FS KSDVFSFGV+VLEIV+G
Sbjct  44   PKISDFGMARIFARDETEANTMKVVGTYGYMSPEYAMNGIFSEKSDVFSFGVIVLEIVTG  103

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES-------FSPSEVMRCIQVGL  341
            K+NRG YN N + N L +AW  W+EGR  E++DP + +S       F P EV++CIQ+GL
Sbjct  104  KRNRGSYNLNYKNNFLSYAWSNWKEGRALEIVDPVIVDSLSPLSSTFQPQEVLKCIQIGL  163

Query  342  VCVQEQA  362
            +CVQE A
Sbjct  164  LCVQELA  170



>dbj|BAF91399.1| S-locus receptor kinase (kinase domain) [Brassica oleracea]
Length=429

 Score =   174 bits (442),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 99/127 (78%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  EANT KV GT GYMSPEYAMDG+FS KSDVFSFGV+VLEI+SG
Sbjct  239  PKISDFGMARIFARDETEANTMKVVGTCGYMSPEYAMDGIFSEKSDVFSFGVIVLEIISG  298

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFS-------PSEVMRCIQVGL  341
            K+NRGFYN N + NLL +AW  W+EGR  E++DP +  SFS       P EV++CIQ+GL
Sbjct  299  KRNRGFYNLNYKNNLLSYAWSNWKEGRALEIVDPVIVNSFSPLSSTSQPQEVLKCIQIGL  358

Query  342  VCVQEQA  362
            +CVQE A
Sbjct  359  LCVQEFA  365



>dbj|BAF91409.1| S-locus receptor kinase (kinase domain) [Brassica oleracea]
Length=424

 Score =   174 bits (442),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 98/127 (77%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  EANTKKV GTYGYMSPEYAM G+FS KSDVFSFGV+VLEIVSG
Sbjct  234  PKISDFGMARIFARDETEANTKKVVGTYGYMSPEYAMHGIFSEKSDVFSFGVIVLEIVSG  293

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES-------FSPSEVMRCIQVGL  341
            KKNRG YN + + NLL + W  W+EGR  E++DP + +S       F P EV++CIQ+GL
Sbjct  294  KKNRGLYNLSFENNLLSYVWSQWKEGRALEIVDPVIIDSLSSLPSTFQPQEVLKCIQIGL  353

Query  342  VCVQEQA  362
            +CVQE A
Sbjct  354  LCVQEHA  360



>ref|XP_008362569.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11410 [Malus domestica]
 ref|XP_008363898.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11410 [Malus domestica]
Length=300

 Score =   171 bits (433),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+      EANT +V GTYGYMSPEYAM+G FSVKSDV+SFGVL+LEIV+G
Sbjct  126  PKISDFGMARIFGAEQIEANTNRVVGTYGYMSPEYAMEGFFSVKSDVYSFGVLLLEIVTG  185

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            +KN  +Y+ ++  NL+GH W LW+E R  E++D ++GES+  +EV+RCI + L+CVQEQA
Sbjct  186  RKNTSYYHDSSYSNLVGHVWDLWKESRALEIIDSSLGESYHVNEVLRCIHIALLCVQEQA  245



>ref|XP_004485681.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8-like 
[Cicer arietinum]
Length=851

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  EANT +V GTYGYMSPEYAMDG FSVKSDVFSFGVLVLEI++G
Sbjct  669  PKISDFGMARIFGKDQTEANTLRVVGTYGYMSPEYAMDGNFSVKSDVFSFGVLVLEIITG  728

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
             KNRGFY  N+  NLL +AW  WREG   EL+D ++ +S++PSEV+RCI VGL+CVQE+A
Sbjct  729  NKNRGFYYANDDMNLLKNAWSQWREGNALELIDSSISDSYTPSEVLRCIHVGLLCVQERA  788



>ref|XP_003593412.1| Serine/threonine protein kinase [Medicago truncatula]
 gb|AES63663.1| G-type lectin S-receptor-like Serine/Threonine-kinase [Medicago 
truncatula]
Length=852

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  EANT +V GTYGYMSPEYAMDG FSVKSDVFSFGVLVLEI+SG
Sbjct  670  PKISDFGMARIFGRDQTEANTLRVVGTYGYMSPEYAMDGNFSVKSDVFSFGVLVLEIISG  729

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            KKNRGFY  ++  NLL +AWG WREG   EL+D ++G S++ SEV+RCI VGL+CVQE+A
Sbjct  730  KKNRGFYYADDDMNLLRNAWGQWREGNALELIDSSIGNSYTESEVLRCIHVGLLCVQERA  789



>ref|XP_008355368.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1 isoform X3 [Malus domestica]
Length=303

 Score =   171 bits (433),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+ARL  G+  EA TK+V GTYGYM+PEYA+DG FS+KSDVFSFG+L+LE +SG
Sbjct  115  PKISDFGMARLFGGDQTEAVTKRVVGTYGYMAPEYAIDGHFSIKSDVFSFGILLLETLSG  174

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQE  356
            K++RGFY+ N+  NL+GHAW LW+EGR  EL+D  + +S S SEV+RCI V L+CVQ+
Sbjct  175  KRSRGFYDPNHNXNLIGHAWRLWKEGRSLELIDEYLTDSCSLSEVLRCIHVSLLCVQQ  232



>dbj|BAF91407.1| S-locus receptor kinase (kinase domain) [Brassica oleracea]
Length=424

 Score =   174 bits (440),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 99/127 (78%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  EANT KV GTYGYMSPEYAM+G+FS KSDVFSFGV+VLEIV+G
Sbjct  234  PKISDFGMARIFARDETEANTMKVVGTYGYMSPEYAMNGIFSEKSDVFSFGVIVLEIVTG  293

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES-------FSPSEVMRCIQVGL  341
            K+NRGFYN N + N L +AW  W+EGR  E++DP + +S       F P EV++CIQ+GL
Sbjct  294  KRNRGFYNLNYKNNFLSYAWSNWKEGRALEIVDPVIEDSLSSLPSTFQPQEVLKCIQIGL  353

Query  342  VCVQEQA  362
            +CVQE A
Sbjct  354  LCVQELA  360



>gb|AAL17684.1| S-locus receptor kinase [Raphanus sativus]
Length=288

 Score =   170 bits (431),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 98/127 (77%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  EA+T KV GTYGYMSPEYAM+G+FS KSDVFSFGV+VLEIV+G
Sbjct  101  PKISDFGMARIFARDETEASTMKVVGTYGYMSPEYAMNGIFSEKSDVFSFGVIVLEIVTG  160

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSP-------SEVMRCIQVGL  341
             +NRGFYN N + N L +AW  WREGR  E++DP + +S SP        EV++CIQ+GL
Sbjct  161  TRNRGFYNLNYKNNFLSYAWSNWREGRALEIVDPVILDSLSPLTLTFQRQEVLKCIQIGL  220

Query  342  VCVQEQA  362
            +CVQE A
Sbjct  221  LCVQELA  227



>ref|XP_008349266.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11410 [Malus domestica]
Length=457

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+      EANT +V GTYGYMSPEYAM+GLFSVKSDV+SFGVL+LEIVSG
Sbjct  278  PKISDFGMARIFGAEQIEANTNRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSG  337

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            +KN G+Y+ N   NL+GH W LW+E    E++D ++GES+  SEV+RCIQ+ L+CVQE A
Sbjct  338  RKNTGYYHDNPDSNLVGHVWDLWKESSALEIIDSSLGESYPVSEVLRCIQIALLCVQEHA  397



>ref|XP_002518601.1| S-locus-specific glycoprotein S6 precursor, putative [Ricinus 
communis]
 gb|EEF43988.1| S-locus-specific glycoprotein S6 precursor, putative [Ricinus 
communis]
Length=834

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  EA+TK+V GTYGYMSPEYAMDG FSVKSDVFSFGVLVLEIVSG
Sbjct  654  PKISDFGMARIFGGDQTEASTKRVVGTYGYMSPEYAMDGHFSVKSDVFSFGVLVLEIVSG  713

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
             KNRGFY+ N++ NLLGHAW LW+E +G E+LD +VG SFSPSEV+RCIQVGL+CVQE+A
Sbjct  714  NKNRGFYHSNSELNLLGHAWRLWKEEKGLEILDSSVGSSFSPSEVLRCIQVGLLCVQERA  773



>gb|AAA33008.1| serine/threonine kinase receptor [Brassica napus]
 emb|CAB89179.1| S-locus receptor kinase [Brassica napus var. napus]
Length=858

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 101/127 (80%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  EANT+KV GTYGYMSPEYAMDG+FS KSDVFSFGV+VLEIVSG
Sbjct  668  PKISDFGMARIFARDETEANTRKVVGTYGYMSPEYAMDGVFSEKSDVFSFGVIVLEIVSG  727

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES-------FSPSEVMRCIQVGL  341
            K+NRGFYN N++ NLL + W  W EGR  E++DP + +S       F P EV++CIQ+GL
Sbjct  728  KRNRGFYNLNHENNLLSYVWSHWTEGRALEIVDPVIVDSLSSLPATFQPKEVLKCIQIGL  787

Query  342  VCVQEQA  362
            +CVQE+A
Sbjct  788  LCVQERA  794



>ref|XP_008777139.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Phoenix dactylifera]
Length=784

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  E NT++V GTYGYMSPEY MDG+FSVKSDVFSFGVLVLEI+SG
Sbjct  605  PKISDFGMARIFGGDETEVNTRRVVGTYGYMSPEYVMDGIFSVKSDVFSFGVLVLEIISG  664

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            KKNRG Y  +++ NLLGHAW LW+EG G EL+D ++  SF   E +RCI+VGL+CVQE 
Sbjct  665  KKNRGVYTSHHRVNLLGHAWSLWKEGNGLELVDESIVHSFPMGEALRCIKVGLLCVQEH  723



>emb|CDY39264.1| BnaC06g27270D [Brassica napus]
Length=233

 Score =   169 bits (427),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 97/125 (78%), Gaps = 5/125 (4%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+      EANT+KV GTYGYMSPEYA+DG+FS+KSDVFSFGVL+LEI+SG
Sbjct  47   PKISDFGMARIFGREETEANTRKVVGTYGYMSPEYAVDGIFSMKSDVFSFGVLLLEIISG  106

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPS-----EVMRCIQVGLVC  347
            KKN GFYN N   NLLG  W  W+EG+G E +DP + +  S +     E++RCIQ+GL+C
Sbjct  107  KKNNGFYNSNRDLNLLGFVWRYWKEGKGIESVDPIIIDDSSSALLRTHEILRCIQIGLLC  166

Query  348  VQEQA  362
            VQE+A
Sbjct  167  VQERA  171



>ref|XP_010924050.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Elaeis guineensis]
Length=828

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  +A T++V GTYGYMSPEYAMDG+FSVKSDVFSFGVLVLEI+SG
Sbjct  653  PKISDFGVARIFGGDQSDAYTQRVVGTYGYMSPEYAMDGVFSVKSDVFSFGVLVLEIISG  712

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            KKNRG YN     +LL HAW LW+EG+  ELLD ++G S+S SEV+RCIQVGL+CVQ++A
Sbjct  713  KKNRGIYNAEPNLSLLNHAWKLWKEGKSLELLDKSMGCSYSISEVLRCIQVGLLCVQDRA  772



>ref|XP_006388693.1| hypothetical protein POPTR_0118s002202g, partial [Populus trichocarpa]
 gb|ERP47607.1| hypothetical protein POPTR_0118s002202g, partial [Populus trichocarpa]
Length=219

 Score =   168 bits (425),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 95/119 (80%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFGLARL  G+  EANT +V GTYGYMSPEYA+DG FSVKSDVFSFGVLVLEIVSG
Sbjct  41   PKISDFGLARLFGGDQVEANTNRVVGTYGYMSPEYALDGHFSVKSDVFSFGVLVLEIVSG  100

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            KKNRGF + +   NLLGHAW LW EG   +L+D  + +S + +E++RCI V L+CVQ++
Sbjct  101  KKNRGFCHPDQNLNLLGHAWILWTEGTPLDLIDEGLSDSRNLAELLRCIHVALLCVQQR  159



>ref|XP_010928033.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Elaeis guineensis]
Length=1213

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +3

Query  3     PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
             PKISDFG+AR+  G+  E NT +V GTYGYMSPEYAMDG+FSVKSDVFSFGVLVLEI SG
Sbjct  1034  PKISDFGMARIFGGDEAEVNTHRVVGTYGYMSPEYAMDGIFSVKSDVFSFGVLVLEITSG  1093

Query  183   KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
             KKNRG Y  N   NLLGHAW LW+EG G EL+D ++G SF  +EV+RCI+V L+CVQE 
Sbjct  1094  KKNRGVYYSNRHTNLLGHAWYLWKEGNGLELVDESIGYSFPMAEVLRCIKVALLCVQEH  1152


 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFGLAR+  G+    NT++V GTYGYMSPEYAMDG+FSVKSDVFSFGVLVLEI+SG
Sbjct  219  PKISDFGLARIFRGDEIAINTRRVVGTYGYMSPEYAMDGVFSVKSDVFSFGVLVLEIISG  278

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQE  356
            KKNRG     ++ NLL HAW LW EG  SEL+D ++  S S  E + CI+VGL+CVQE
Sbjct  279  KKNRGVSVSEHEGNLLAHAWSLWTEGNASELIDKSISNSTSMVEAVNCIKVGLLCVQE  336



>gb|ACN52024.1| SRK protein [Brassica cretica]
Length=203

 Score =   167 bits (423),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 98/124 (79%), Gaps = 4/124 (3%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  EANT  V GTYGYMSPEYAM G+FS KSDVFSFGV++LEIV+G
Sbjct  30   PKISDFGMARIFARDETEANTMTVVGTYGYMSPEYAMHGIFSEKSDVFSFGVIILEIVTG  89

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES----FSPSEVMRCIQVGLVCV  350
            K+NR FYN N + +LL +AW  W+EGR  E++DP + +S    F P EV++CIQ+GL+CV
Sbjct  90   KRNRVFYNLNYEDSLLNYAWINWKEGRALEIVDPDIVDSLSSTFQPQEVLKCIQIGLLCV  149

Query  351  QEQA  362
            QE+A
Sbjct  150  QERA  153



>gb|ACN52032.1| SRK protein [Brassica cretica]
Length=208

 Score =   167 bits (423),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 97/127 (76%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  EA+T+   GTYGYMSPEYAMDG+ S K+DVFSFGV+VLEIVSG
Sbjct  25   PKISDFGMARIFARDETEASTENAVGTYGYMSPEYAMDGVISEKTDVFSFGVIVLEIVSG  84

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES-------FSPSEVMRCIQVGL  341
            K+NRGFY  N + NLL +AW  W EGR  E++DP + +S       F P EV++CIQ+GL
Sbjct  85   KRNRGFYQVNPENNLLSYAWSHWAEGRALEIVDPVILDSLSSLPSTFQPKEVLKCIQIGL  144

Query  342  VCVQEQA  362
            +C+QE+A
Sbjct  145  LCIQERA  151



>gb|AAN64451.1| putative receptor-like kinase, 5'-partial [Oryza sativa Japonica 
Group]
Length=312

 Score =   170 bits (431),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 97/120 (81%), Gaps = 1/120 (1%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +   A TKKV GTYGYMSPEYAMDG+FS+KSDVFSFGVLVLEIVSG
Sbjct  135  PKISDFGVARIFGTDQTSAYTKKVVGTYGYMSPEYAMDGVFSMKSDVFSFGVLVLEIVSG  194

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAV-GESFSPSEVMRCIQVGLVCVQEQ  359
            KKNRGFY+     NLL +AW LW+EGR  E LD ++ G S + +EV+RCIQ+GL+CVQEQ
Sbjct  195  KKNRGFYHNELDLNLLRYAWRLWKEGRSLEFLDQSIAGTSSNVTEVLRCIQIGLLCVQEQ  254



>ref|XP_006452099.1| hypothetical protein CICLE_v10009316mg [Citrus clementina]
 gb|ESR65339.1| hypothetical protein CICLE_v10009316mg [Citrus clementina]
Length=242

 Score =   168 bits (426),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFGLAR  A +  E NT +V GTYGYM+PEYA DG FSVKSDVFSFGVL+LEIVSG
Sbjct  64   PKISDFGLARTFARDETEGNTNRVVGTYGYMAPEYASDGQFSVKSDVFSFGVLLLEIVSG  123

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            K+NRGFY+ +N+ NL+GHAW LW +G  S+L+D  + +S + +EV+RCI +GL+CVQ+ 
Sbjct  124  KRNRGFYHSDNKLNLIGHAWKLWNKGMPSQLIDACIQDSCNFAEVIRCIHIGLLCVQQH  182



>ref|XP_006452092.1| hypothetical protein CICLE_v10010321mg, partial [Citrus clementina]
 gb|ESR65332.1| hypothetical protein CICLE_v10010321mg, partial [Citrus clementina]
Length=622

 Score =   176 bits (446),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFGLAR   G+  E NTK+V GTYGYM+PEYA DG FSVKSDVFSFG+L+LEI+SG
Sbjct  444  PKISDFGLARAFGGDETEGNTKRVIGTYGYMAPEYASDGKFSVKSDVFSFGILLLEIISG  503

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            KKNRGFY+ +N+ NL+GHAW LW EG  S+L+DP +  SF+ +EV+RCI +GL+CVQ+ 
Sbjct  504  KKNRGFYHSDNKLNLIGHAWKLWNEGMPSQLIDPCIQGSFNLAEVIRCIHIGLLCVQQH  562



>gb|ACN52036.1| SRK protein [Brassica cretica]
Length=156

 Score =   166 bits (419),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 95/127 (75%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  +A T    GTYGYMSPEYAMDG+ S K+DVFSFGV+VLEIVSG
Sbjct  8    PKISDFGMARIFARDETQARTDNAVGTYGYMSPEYAMDGVISEKTDVFSFGVIVLEIVSG  67

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES-------FSPSEVMRCIQVGL  341
            K+NRGFY  N + NLL +AW  W EGR  E++DP + +S       F P EV++CIQ+GL
Sbjct  68   KRNRGFYQVNPENNLLSYAWSHWAEGRALEIVDPVIVDSLSSLPSTFQPKEVLKCIQIGL  127

Query  342  VCVQEQA  362
            +C+QE+A
Sbjct  128  LCIQERA  134



>ref|XP_010415123.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-7 
isoform X2 [Camelina sativa]
Length=525

 Score =   175 bits (443),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 79/124 (64%), Positives = 98/124 (79%), Gaps = 4/124 (3%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFGLAR+      EANT+KV GTYGYMSPEYAMDG+FS+KSDVFSFGVL+LEI+ G
Sbjct  340  PKISDFGLARIFGREEIEANTRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIICG  399

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPS----EVMRCIQVGLVCV  350
            K+N+GFYN N   NLLG  W  W+EG+G E++DP   +S S +    E++RCIQ+GL+CV
Sbjct  400  KRNKGFYNSNRDLNLLGFVWRHWKEGKGLEIVDPTNIDSSSSTSQTHEILRCIQIGLLCV  459

Query  351  QEQA  362
            QE+A
Sbjct  460  QERA  463



>gb|AAL17689.1| S-locus receptor kinase [Raphanus sativus]
Length=291

 Score =   169 bits (429),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 98/127 (77%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +T EA+T+ V GTYGYMSPEYAM G+FS KSDVFSFGV+VLEIVSG
Sbjct  101  PKISDFGMARIFGRDTSEASTRNVVGTYGYMSPEYAMYGVFSEKSDVFSFGVIVLEIVSG  160

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFS-------PSEVMRCIQVGL  341
            K++RGFY  NN  NLL +AW  W EGR  E++DP + +S S       P EV++CIQ+GL
Sbjct  161  KRSRGFYQLNNDNNLLSYAWSHWTEGRALEIVDPVIVDSLSSLPSTSQPKEVLKCIQIGL  220

Query  342  VCVQEQA  362
            +CVQE+A
Sbjct  221  LCVQERA  227



>ref|XP_008369911.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RKS1 [Malus domestica]
Length=257

 Score =   169 bits (427),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+      EANT +V GTYGYMSPEYAM+GLFSVKSDV+SFGVL+LEIV+G
Sbjct  78   PKISDFGMARIFGAEQIEANTNRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVTG  137

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            +KN G+++ +   NL+GH W LW+E R  E++D ++GES+  ++V+RCI + L+CVQEQA
Sbjct  138  RKNXGYHHDSPYSNLVGHVWDLWKENRALEIIDSSLGESYPVNKVLRCIHIALLCVQEQA  197



>gb|ACN52020.1| SRK protein [Brassica cretica]
Length=167

 Score =   166 bits (419),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 98/127 (77%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  EANT KV GTYGYMSPEYAM G+FS KSDVFSFGV+VLEIV+G
Sbjct  24   PKISDFGMARIXARDETEANTMKVVGTYGYMSPEYAMGGIFSEKSDVFSFGVIVLEIVTG  83

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES-------FSPSEVMRCIQVGL  341
            K+NRGFYN + + +LL +AW  W+EGR  E++D  + +S       F P EV++CIQ+GL
Sbjct  84   KRNRGFYNLSYEYSLLSYAWSNWKEGRALEIVDSVLVDSLSPLSSTFQPQEVLKCIQIGL  143

Query  342  VCVQEQA  362
            +CVQE A
Sbjct  144  LCVQELA  150



>ref|XP_006452102.1| hypothetical protein CICLE_v10007547mg [Citrus clementina]
 gb|ESR65342.1| hypothetical protein CICLE_v10007547mg [Citrus clementina]
Length=757

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFGLAR   G+  E NTK+V GTYGYM+PEYA DG FSVKSDVFSFG+L+LEIVSG
Sbjct  579  PKISDFGLARAFGGDETEGNTKRVIGTYGYMAPEYASDGQFSVKSDVFSFGILLLEIVSG  638

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            KKNRGFY+ +N+ NL+GHAW LW EG  S+L+DP +  SF+ +EV+RCI +GL+CVQ+ 
Sbjct  639  KKNRGFYHSDNKLNLIGHAWKLWNEGMPSQLIDPCIQGSFNLAEVIRCIHIGLLCVQQH  697



>ref|XP_008363599.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1 isoform X2 [Malus domestica]
Length=303

 Score =   170 bits (430),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+ARL  G+  EA TK+V GTYGYM+PEYA+DG FS+KSDVFSFG+L+LE +SG
Sbjct  115  PKISDFGMARLFGGDQTEAVTKRVVGTYGYMAPEYAIDGHFSIKSDVFSFGILLLETLSG  174

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQE  356
            K++RGFY+ N+  NL+GHAW LW+EGR  EL+D  + +S S SEV+RCI V L+CVQ 
Sbjct  175  KRSRGFYDPNHNLNLIGHAWRLWKEGRSLELIDEYLTDSCSLSEVLRCIHVSLLCVQH  232



>gb|AFW84882.1| putative S-locus receptor-like protein kinase family protein 
[Zea mays]
Length=296

 Score =   169 bits (429),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+      E NT+KV GTYGYMSPEYAMDG+FSVKSDVFS+GVL+LEIVSG
Sbjct  116  PKISDFGMARIFGNEETEINTRKVVGTYGYMSPEYAMDGIFSVKSDVFSYGVLLLEIVSG  175

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQE  356
            ++NRG Y+ +N Q+LLGHAW LW E +  EL D  +  SF+  EV +CI+VGL+CVQE
Sbjct  176  RRNRGVYSYSNNQSLLGHAWSLWNEEKSIELADERMNGSFNSDEVHKCIRVGLLCVQE  233



>ref|XP_006370368.1| hypothetical protein POPTR_0001s42030g [Populus trichocarpa]
 gb|ERP66937.1| hypothetical protein POPTR_0001s42030g [Populus trichocarpa]
Length=800

 Score =   177 bits (448),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR   G+  EANT ++ GTYGYMSPEYA+DGLFS+KSDVFSFGVLVLEIVS 
Sbjct  622  PKISDFGMARTFGGDQIEANTSRIVGTYGYMSPEYAVDGLFSIKSDVFSFGVLVLEIVSA  681

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            KKNRGF++ ++  NLLGHAW LW EGR  EL++  + +S S SEV+RCIQVGL+CVQ++
Sbjct  682  KKNRGFFHPDHNHNLLGHAWRLWNEGRPLELMNKKIDDSSSLSEVIRCIQVGLLCVQQR  740



>gb|KDO74365.1| hypothetical protein CISIN_1g043285mg [Citrus sinensis]
Length=414

 Score =   172 bits (436),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 95/119 (80%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFGLAR   G+  E NT +V GTYGYM+PEYA DG FSVKSDVFSFG+L+LEIVSG
Sbjct  236  PKISDFGLARAFGGDETEGNTNRVVGTYGYMAPEYASDGQFSVKSDVFSFGILLLEIVSG  295

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            KKNRGFY+ +N  NL+GHAW LW EG  S+L+D    +SF+ +EV+RCI +GL+CVQ+ 
Sbjct  296  KKNRGFYHSDNNLNLIGHAWKLWNEGMPSQLIDSCFQDSFNLAEVIRCIHIGLLCVQQH  354



>ref|XP_008775529.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Phoenix dactylifera]
Length=822

 Score =   177 bits (448),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  E NT +V GTYGYMSPEYAMDG+FSVKSDVFSFGVLVLEI+SG
Sbjct  643  PKISDFGMARIFGGDETEVNTCRVVGTYGYMSPEYAMDGIFSVKSDVFSFGVLVLEIISG  702

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            KKNRG Y  + + NLLGHAW LW+EG G EL+D ++  SF  +E +RCI+VGL+CVQE 
Sbjct  703  KKNRGVYLSHQRMNLLGHAWSLWKEGNGLELVDESIIHSFPMAEALRCIKVGLLCVQEH  761



>ref|XP_007214638.1| hypothetical protein PRUPE_ppa001615mg [Prunus persica]
 gb|EMJ15837.1| hypothetical protein PRUPE_ppa001615mg [Prunus persica]
Length=792

 Score =   176 bits (447),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+      EANT +V GTYGYMSPEYAM+GLFSVKSDV+SFGVL+LEIV G
Sbjct  613  PKISDFGMARIFGAEQIEANTNRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVCG  672

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            +KN G+Y+ N   NL+GH W LW+EGR SE++D  +GES+   EV+RCIQ+ L+CVQE A
Sbjct  673  RKNTGYYHDNPDSNLVGHVWDLWKEGRASEIIDSTLGESYPVDEVVRCIQIALLCVQEHA  732



>ref|XP_009397155.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Musa acuminata subsp. malaccensis]
 ref|XP_009397156.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Musa acuminata subsp. malaccensis]
 ref|XP_009397157.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Musa acuminata subsp. malaccensis]
Length=820

 Score =   177 bits (448),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 102/120 (85%), Gaps = 1/120 (1%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  EANT++V GTYGYMSPEYAMDG+FSVKSDVFSFGVL+LEIVSG
Sbjct  640  PKISDFGMARVFGGDETEANTRRVVGTYGYMSPEYAMDGIFSVKSDVFSFGVLLLEIVSG  699

Query  183  KKNRG-FYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            KKNRG  Y+  +  NLLG+ W LW+EG+GSEL+D ++G S S +EV+RCI VGL+CVQE+
Sbjct  700  KKNRGVIYHSASHLNLLGYIWSLWKEGKGSELVDGSIGHSCSLAEVLRCITVGLLCVQER  759



>ref|XP_010274341.1| PREDICTED: uncharacterized protein LOC104609670 isoform X2 [Nelumbo 
nucifera]
Length=975

 Score =   178 bits (451),  Expect = 5e-49, Method: Composition-based stats.
 Identities = 78/120 (65%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  GN  +ANT +V GTYGYMSPEYA+DG FSVKSDVFSFGVL+LEI+SG
Sbjct  796  PKISDFGMARIFGGNQIQANTNRVVGTYGYMSPEYALDGTFSVKSDVFSFGVLLLEIISG  855

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            KKN GFY   +   LLGHAW LW+E +G EL+DP + ++ +  E+++CI VGLVCVQE A
Sbjct  856  KKNTGFYKSEHTLTLLGHAWRLWKENKGLELMDPQLNKASNVEEILKCIHVGLVCVQEDA  915



>ref|XP_006452106.1| hypothetical protein CICLE_v10007528mg [Citrus clementina]
 gb|ESR65346.1| hypothetical protein CICLE_v10007528mg [Citrus clementina]
Length=769

 Score =   176 bits (447),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFGLAR   G+  E NT +V GTYGYM+PEYA DG FSVKSDVFSFG+L+LEI+SG
Sbjct  591  PKISDFGLARAFGGDETEGNTNRVIGTYGYMAPEYASDGQFSVKSDVFSFGILLLEIISG  650

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            KKNRGFY+ NN+ NL+GHAW LW EG  S+L+DP + +SF+ +EV+RC  +GL+CVQ+ 
Sbjct  651  KKNRGFYHSNNKLNLIGHAWKLWNEGMPSQLIDPCIQDSFNLAEVIRCFHIGLLCVQQH  709



>ref|XP_007159231.1| hypothetical protein PHAVU_002G220200g [Phaseolus vulgaris]
 gb|ESW31225.1| hypothetical protein PHAVU_002G220200g [Phaseolus vulgaris]
Length=843

 Score =   177 bits (448),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  EANT ++ GTYGYMSPEYAMDG+FSVKSDVFSFGVLVLEIVSG
Sbjct  663  PKISDFGMARIFGTDQIEANTMRIVGTYGYMSPEYAMDGIFSVKSDVFSFGVLVLEIVSG  722

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            KKNRGFY  N + NLLGHAW LW EG   EL D ++    S SEV RCIQVGL+CVQE+A
Sbjct  723  KKNRGFYLANKELNLLGHAWKLWIEGNAWELSDSSIDTLNSASEVQRCIQVGLLCVQERA  782



>emb|CAN70180.1| hypothetical protein VITISV_000005 [Vitis vinifera]
Length=229

 Score =   167 bits (423),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFGLAR   GN  EANT +VAGT GYMSPEYA +GL+S KSDVFSFGVLVLEIV+G
Sbjct  51   PKISDFGLARSFGGNETEANTTRVAGTLGYMSPEYATEGLYSTKSDVFSFGVLVLEIVTG  110

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQ  353
            K+NRGF++ ++  NLLGHAW L+ EGR  EL+DP++G++ + SEV+R I +GL+CVQ
Sbjct  111  KRNRGFFHPDHGYNLLGHAWTLYMEGRSLELIDPSMGDTSNLSEVLRTINMGLLCVQ  167



>gb|AAL17686.1| S-locus receptor kinase [Raphanus sativus]
Length=291

 Score =   169 bits (428),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 98/127 (77%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A    EANTKKV GTYGYMSPEYAM+G+FS KSDVFSFGV+VLEIVSG
Sbjct  101  PKISDFGMARIFAREETEANTKKVVGTYGYMSPEYAMNGIFSEKSDVFSFGVIVLEIVSG  160

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES-------FSPSEVMRCIQVGL  341
            K++RGFYN N++ NLL +AW  W EG   E++DP + +S       F   E ++CIQ+GL
Sbjct  161  KRSRGFYNLNHENNLLSYAWSHWTEGTALEIVDPIIIDSSSSLPSTFQKKEALKCIQIGL  220

Query  342  VCVQEQA  362
            +CVQE+A
Sbjct  221  LCVQERA  227



>ref|XP_008355367.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1 isoform X2 [Malus domestica]
Length=357

 Score =   171 bits (432),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+ARL  G+  EA TK+V GTYGYM+PEYA+DG FS+KSDVFSFG+L+LE +SG
Sbjct  169  PKISDFGMARLFGGDQTEAVTKRVVGTYGYMAPEYAIDGHFSIKSDVFSFGILLLETLSG  228

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQE  356
            K++RGFY+ N+  NL+GHAW LW+EGR  EL+D  + +S S SEV+RCI V L+CVQ+
Sbjct  229  KRSRGFYDPNHNXNLIGHAWRLWKEGRSLELIDEYLTDSCSLSEVLRCIHVSLLCVQQ  286



>ref|XP_008813304.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like serine/threonine-protein 
kinase SD1-8, partial [Phoenix dactylifera]
Length=1592

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  +A TK+V GTYGYMSPEYAMDG+FSVKSDVFSFGVLVLEI+SG
Sbjct  668  PKISDFGVARIFGGDQSDAYTKRVVGTYGYMSPEYAMDGIFSVKSDVFSFGVLVLEIISG  727

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            KKNRG Y+     NLL HAW LW+EG   ELLD +VG S+S +EV+RCIQVGL+CVQ++A
Sbjct  728  KKNRGIYSTEPNLNLLSHAWKLWKEGNSLELLDKSVGCSYSINEVLRCIQVGLLCVQDRA  787



>ref|XP_006598304.1| PREDICTED: uncharacterized protein LOC100797331 [Glycine max]
Length=1803

 Score =   179 bits (454),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +3

Query  3     PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
             PKISDFG+ARL   N  EANT +V GTYGYMSPEYAMDG FSVKSDVFSFGVLVLEI++G
Sbjct  1623  PKISDFGMARLFGTNQTEANTLRVVGTYGYMSPEYAMDGNFSVKSDVFSFGVLVLEIITG  1682

Query  183   KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
             KKNRGFY  N   NLLG+AW  WR+G   EL+D ++G+S S SEV+RCI VGL+CVQE+A
Sbjct  1683  KKNRGFYYSNEDMNLLGNAWRQWRDGSTLELIDSSIGDSCSQSEVLRCIHVGLLCVQERA  1742


 Score =   156 bits (394),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 94/120 (78%), Gaps = 1/120 (1%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFGLAR+  GN  EANT +V GTYGYM+PEYAM+GLFSVKSDV+SFGVL+LEI+SG
Sbjct  680  PKISDFGLARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVYSFGVLLLEILSG  739

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            ++N  F   ++  +L+G+AW LW E +  ELLDP + +S   ++ +RCI +G++CVQ+ A
Sbjct  740  RRNTSF-RHSDDSSLIGYAWHLWNEHKAMELLDPCIRDSSPRNKALRCIHIGMLCVQDSA  798



>gb|KDO40578.1| hypothetical protein CISIN_1g0058031mg, partial [Citrus sinensis]
Length=235

 Score =   167 bits (423),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR  A N  EANT ++ GT+GYMSPEY M+G+ S+KSDV+SFGVLVLEIVS 
Sbjct  54   PKISDFGMARTYAMNELEANTNRIVGTHGYMSPEYVMNGIVSMKSDVYSFGVLVLEIVSS  113

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            KKN G Y+     NL+G+AW LW EG+  EL+DP + ES S  EVMRCI VGL+CVQ++A
Sbjct  114  KKNNGSYDTERPLNLVGYAWQLWNEGKALELMDPTLDESCSSDEVMRCIHVGLLCVQDRA  173



>emb|CBI14789.3| unnamed protein product [Vitis vinifera]
Length=227

 Score =   167 bits (422),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFGLAR   GN  EANT +VAGT GYMSPEYA +GL+S KSDVFSFGVLVLEIV+G
Sbjct  70   PKISDFGLARSFGGNETEANTTRVAGTLGYMSPEYATEGLYSTKSDVFSFGVLVLEIVTG  129

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQE  356
            K+NRGF++ ++  NLLGHAW L+ EGR  EL+DP++G++ + SEV+R I +GL+CVQ 
Sbjct  130  KRNRGFFHPDHGYNLLGHAWTLYMEGRSLELIDPSMGDTSNLSEVLRTINMGLLCVQR  187



>ref|XP_009408780.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Musa acuminata subsp. malaccensis]
Length=1498

 Score =   179 bits (453),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +3

Query  3     PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
             PKISDFG+AR+  G+  E NTK+V GTYGYMSPEYAMDG+FSVKSDVFSFGVLVLEI+ G
Sbjct  1320  PKISDFGMARIFGGDETEVNTKRVVGTYGYMSPEYAMDGIFSVKSDVFSFGVLVLEIICG  1379

Query  183   KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
             KKNRG Y+ + + NLLG+ W LW+EG+G +L+D A+G+S+  +EV+RC++VGL+CVQE+
Sbjct  1380  KKNRGIYDSSRRLNLLGYTWRLWKEGKGLDLVDEAIGDSYPQAEVLRCMKVGLLCVQER  1438


 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  E NTK+V GTYGYMSPEYAMDG+FSVKSDVFSFGVL+LEI+SG
Sbjct  537  PKISDFGMARIFGGDETEVNTKRVVGTYGYMSPEYAMDGIFSVKSDVFSFGVLILEIISG  596

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            KKNRG Y+ +   NLLG+ W LWREG+G  L+D  +G+S+  +EV+RC +VGL+CVQE+
Sbjct  597  KKNRGIYDSSRSLNLLGYTWSLWREGKGLILVDEVIGDSYPKAEVLRCTKVGLLCVQER  655



>gb|KDO74381.1| hypothetical protein CISIN_1g0393181mg, partial [Citrus sinensis]
Length=265

 Score =   168 bits (425),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 93/119 (78%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFGLAR   G+  E +TK+V GTYGYM+PEYA DGLFSVKSDVFSFG+L+LEIVSG
Sbjct  87   PKISDFGLARTFVGDEIEGSTKRVVGTYGYMAPEYASDGLFSVKSDVFSFGILLLEIVSG  146

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            KKNRGFY+ +   NL+GHAW LW  G  S+L+D    ES + +EV+RCI VGL+CVQ  
Sbjct  147  KKNRGFYHSDKNLNLIGHAWKLWNNGMPSQLIDAYYQESCNLAEVIRCIHVGLLCVQHH  205



>gb|ACN52039.1| SRK protein [Brassica cretica]
Length=174

 Score =   165 bits (418),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 97/127 (76%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  +A+T+   GTYGYMSPEYAMDG+ S K+DVFSFGV+VLEIVSG
Sbjct  8    PKISDFGMARIFARDETQASTENAVGTYGYMSPEYAMDGVISEKTDVFSFGVIVLEIVSG  67

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGE-------SFSPSEVMRCIQVGL  341
            K+NRGFY  N + NLL +AW  W EGR  E++DP + +       +F P EV++CIQ+GL
Sbjct  68   KRNRGFYQVNPENNLLSYAWSHWAEGRALEIVDPVIVDPLASLPSTFQPKEVLKCIQIGL  127

Query  342  VCVQEQA  362
            +C+QE+A
Sbjct  128  LCIQERA  134



>gb|ACN52034.1| SRK protein [Brassica cretica]
Length=184

 Score =   165 bits (418),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 95/127 (75%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  +A T    GTYGYMSPEYAMDG+ S K+DVFSFGV+VLEIVSG
Sbjct  9    PKISDFGMARIFARDETQARTDNAVGTYGYMSPEYAMDGVISEKTDVFSFGVIVLEIVSG  68

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES-------FSPSEVMRCIQVGL  341
            K+NRGFY  N + NLL +AW  W EGR  E++DP + +S       F P EV++CIQ+GL
Sbjct  69   KRNRGFYQVNPENNLLSYAWSHWAEGRALEIVDPVIIDSLSSLPSTFQPKEVLKCIQIGL  128

Query  342  VCVQEQA  362
            +C+QE+A
Sbjct  129  LCIQERA  135



>gb|AAS94090.1| S-locus receptor kinase [Raphanus sativus]
Length=290

 Score =   168 bits (426),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 99/127 (78%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+A + A    EANT+ V GTYGYMSPEYA+DG+FS KSDVFSFGV+VLEIVSG
Sbjct  100  PKISDFGMAIIFAREETEANTRNVVGTYGYMSPEYALDGVFSEKSDVFSFGVIVLEIVSG  159

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES-------FSPSEVMRCIQVGL  341
            K++RGFY+ N++ NLL +AW  W EG+  E++DP + +S       F P EV++CIQ+GL
Sbjct  160  KRSRGFYSLNHENNLLSYAWSHWTEGKALEIVDPVITDSLSSLPSTFQPKEVLKCIQIGL  219

Query  342  VCVQEQA  362
            +CVQE+A
Sbjct  220  LCVQERA  226



>dbj|BAF91413.1| S-locus receptor kinase (kinase domain) [Brassica oleracea]
Length=423

 Score =   172 bits (435),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 98/127 (77%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  EANT+   GTYGYMSPEYAMDG+ S K+DVFSFGV+VLEIVSG
Sbjct  233  PKISDFGMARIFARDETEANTENAVGTYGYMSPEYAMDGVISEKTDVFSFGVIVLEIVSG  292

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFS-------PSEVMRCIQVGL  341
            K+NRGFY  N + NLL +AW  W EGR  E++DP + +SFS       P EV++CIQ+GL
Sbjct  293  KRNRGFYQLNPENNLLSYAWSHWAEGRALEIVDPVIVDSFSSLPSTFQPKEVLKCIQIGL  352

Query  342  VCVQEQA  362
            +C+QE+A
Sbjct  353  LCIQERA  359



>gb|ACN52027.1| SRK protein [Brassica cretica]
Length=199

 Score =   166 bits (419),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 97/127 (76%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  EANT KV GTYGYMSPEYAM+G+FS KSDVFSFGV+VLEIV+G
Sbjct  24   PKISDFGMARIFPRDETEANTMKVVGTYGYMSPEYAMNGIFSEKSDVFSFGVIVLEIVTG  83

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFS-------PSEVMRCIQVGL  341
             +NRGF N N + N L +AW  W++GR  E++DP + +SFS       P EV++CIQ+GL
Sbjct  84   TRNRGFCNLNYKNNFLSYAWSNWKDGRALEIVDPVIIDSFSSLPSTFQPQEVLKCIQIGL  143

Query  342  VCVQEQA  362
            +CVQE A
Sbjct  144  LCVQELA  150



>gb|AIB04258.1| S-locus receptor kinase s-haplotype 1 [Arabidopsis lyrata subsp. 
petraea]
Length=851

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 100/127 (79%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  EANT+KV GTYGYMSPEYAMDG+FSVKSDVFSFGVL+LEIVSG
Sbjct  662  PKISDFGMARIFERDETEANTRKVVGTYGYMSPEYAMDGIFSVKSDVFSFGVLLLEIVSG  721

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES-------FSPSEVMRCIQVGL  341
            K+NRGFYN +   NLL +AW  W+EG G ++ DP + +S       F P EV+RCIQ+GL
Sbjct  722  KRNRGFYNSDQNSNLLSYAWENWKEGTGLKIADPVIVDSTSSSLSTFRPHEVLRCIQIGL  781

Query  342  VCVQEQA  362
            +CVQE+A
Sbjct  782  LCVQERA  788



>ref|XP_010247744.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Nelumbo nucifera]
Length=814

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFGLAR+  G+  + NTK+V GTYGYM PEYA+DGLFSVKSDVFSFGV+VLEI+SG
Sbjct  635  PKISDFGLARIFGGDQIQENTKRVMGTYGYMPPEYAIDGLFSVKSDVFSFGVIVLEIISG  694

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            KKNRGFY+ ++  NLLGH W LW E R  EL+DP +   FS  E++RCIQVGL+CVQ++
Sbjct  695  KKNRGFYHPDHDLNLLGHTWILWNEDRALELVDPLMERPFSLPEMLRCIQVGLLCVQQR  753



>ref|XP_010924049.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Elaeis guineensis]
Length=835

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  EANT++V GTYGYMSPEYAMDG+FSVKSDVFSFGVLVLEI+SG
Sbjct  656  PKISDFGMARIFGGDETEANTRRVVGTYGYMSPEYAMDGIFSVKSDVFSFGVLVLEIISG  715

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            KKNRG Y  ++  NL GHAW  W+EG G +L+D ++  SF  SE +RCI+VGL+CVQE 
Sbjct  716  KKNRGIYLSHHHVNLPGHAWSSWKEGNGLDLVDDSIVHSFPVSEALRCIKVGLLCVQEH  774



>tpg|DAA57334.1| TPA: putative S-locus receptor-like protein kinase family protein 
[Zea mays]
Length=183

 Score =   165 bits (417),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+      E NT KV GTYGYMSPEYAMDG+FSVKSDVFS+GVL+LEIVSG
Sbjct  3    PKISDFGMARIFGNEETEINTLKVVGTYGYMSPEYAMDGIFSVKSDVFSYGVLLLEIVSG  62

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQE  356
            ++NRG Y+ +N Q+LLGHAW LW E +  EL D  +   F+  EV +C++VGL+CVQE
Sbjct  63   RRNRGVYSSSNNQSLLGHAWSLWNEEKSIELADERMNGQFNSDEVQKCVRVGLLCVQE  120



>ref|XP_011029380.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Populus euphratica]
Length=823

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  EANT ++ GTYGY+SPEYA+DGLFS+KSDVFSFGVLVLEIVSG
Sbjct  645  PKISDFGMARIFGGDQIEANTSRIVGTYGYISPEYAVDGLFSIKSDVFSFGVLVLEIVSG  704

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            KKNRGFY+ ++  NLLGHAW LW EGR  EL++  + +S S SE++R IQVGL+CVQ++
Sbjct  705  KKNRGFYHPDHNHNLLGHAWKLWNEGRPVELMNITIDDSSSLSEILRHIQVGLLCVQQR  763



>ref|XP_006383979.1| hypothetical protein POPTR_0004s02800g [Populus trichocarpa]
 gb|ERP61776.1| hypothetical protein POPTR_0004s02800g [Populus trichocarpa]
Length=371

 Score =   170 bits (431),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  EANT +V GTYGYMSPEYAM GLFSVKSDV+SFGVL+LE+++G
Sbjct  194  PKISDFGMARIFGVDQIEANTNRVVGTYGYMSPEYAMQGLFSVKSDVYSFGVLLLEVITG  253

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            +KN  FY+++N  NL+G+ W LW EGR  EL+D  +G+S+   +V+RCIQ+GL+CVQE A
Sbjct  254  RKNINFYDESNSSNLVGYVWDLWSEGRALELVDTLMGDSYPEDQVLRCIQIGLLCVQESA  313



>ref|XP_011002479.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Populus euphratica]
Length=1180

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +3

Query  3     PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
             PKISDFG+AR   G+  EANT ++ GTYGYMSPEYA+DGLFS+KSDVFSFGVLVLEIVS 
Sbjct  1002  PKISDFGMARTFGGDQIEANTSRIVGTYGYMSPEYAVDGLFSIKSDVFSFGVLVLEIVSA  1061

Query  183   KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
             KKNRGF++ ++  NLLGHAW LW EGR  EL++  + +S S SEV+RCIQVGL+CVQ++
Sbjct  1062  KKNRGFFHPDHSHNLLGHAWKLWNEGRPLELMNKKIDDSSSLSEVIRCIQVGLLCVQQR  1120


 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR   G+  EANT K+ GTYGYMSPEYA+DGLFSVKSDVFSFGVLVLEIVSG
Sbjct  174  PKISDFGMARTFGGDQTEANTNKIVGTYGYMSPEYAVDGLFSVKSDVFSFGVLVLEIVSG  233

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            KKNRGF + ++  NLLGHAW +W EGR  EL++    +S + SE++RCI VGL+CVQ++
Sbjct  234  KKNRGFNHPDHHHNLLGHAWRVWNEGRPLELINEPEQDSCTLSEILRCIHVGLLCVQKR  292



>gb|KDO74350.1| hypothetical protein CISIN_1g005933mg [Citrus sinensis]
Length=669

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR    +  EANT +V GTYGYMSPEYA+DGLFSVKSDVFSFGVLVLEIV G
Sbjct  491  PKISDFGMARAFGVDQTEANTDRVVGTYGYMSPEYAIDGLFSVKSDVFSFGVLVLEIVCG  550

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            K+NRGFY+ ++  NLLGHAW LW E R  EL+D ++  S+S SE +RCIQVGL+CVQ++
Sbjct  551  KRNRGFYHADHHHNLLGHAWRLWTEDRSLELIDKSLDGSYSLSEALRCIQVGLLCVQQR  609



>ref|XP_002316941.2| hypothetical protein POPTR_0011s12870g [Populus trichocarpa]
 gb|EEE97553.2| hypothetical protein POPTR_0011s12870g [Populus trichocarpa]
Length=765

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  EANT ++ GTYGY+SPEYA+DGLFS+KSDVFSFGVLVLEIVSG
Sbjct  587  PKISDFGMARIFGGDQIEANTNRIVGTYGYISPEYAVDGLFSIKSDVFSFGVLVLEIVSG  646

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            KKNRGFY+ ++  NLLGHAW LW EGR  EL++  + +S S SE++R IQVGL+CVQ++
Sbjct  647  KKNRGFYHPDHNHNLLGHAWKLWNEGRPLELMNITIDDSSSLSEILRHIQVGLLCVQQR  705



>ref|XP_006413787.1| hypothetical protein EUTSA_v10024419mg [Eutrema salsugineum]
 gb|ESQ55240.1| hypothetical protein EUTSA_v10024419mg [Eutrema salsugineum]
Length=820

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 101/123 (82%), Gaps = 3/123 (2%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  EANT+KV GTYGYMSPEYAMDG+FS+KSDVFSFGVL+LEI+SG
Sbjct  635  PKISDFGMARIFGRDETEANTRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISG  694

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGE---SFSPSEVMRCIQVGLVCVQ  353
            K+N+GFYN +   NLLG  W  W+EGRG E++DP + +   +F P E++RCIQ+GL+CVQ
Sbjct  695  KRNKGFYNLDRDLNLLGCVWRNWKEGRGLEIVDPVIRDFSPTFIPYEILRCIQIGLLCVQ  754

Query  354  EQA  362
            E+A
Sbjct  755  ERA  757



>gb|ACN52038.1| SRK protein [Brassica cretica]
Length=179

 Score =   164 bits (416),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 95/127 (75%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  +A T    GTYGYMSPEYAMDG+ S K+DVFSFGV+VLEIVSG
Sbjct  31   PKISDFGMARIFARDETQAMTDNAVGTYGYMSPEYAMDGVISEKTDVFSFGVIVLEIVSG  90

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES-------FSPSEVMRCIQVGL  341
            K+NRGFY  N + NLL +AW  W EGR  E++DP + +S       F P EV++CIQ+GL
Sbjct  91   KRNRGFYQVNPENNLLSYAWSHWAEGRALEIVDPVIVDSLSSLPSTFQPKEVLKCIQIGL  150

Query  342  VCVQEQA  362
            +C+QE+A
Sbjct  151  LCIQERA  157



>ref|XP_006467963.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
[Citrus sinensis]
Length=673

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  GN  EANT +V GTYGYM+PEYAM+GLFSVKSDVFSFGVL+LEI+SG
Sbjct  494  PKISDFGMARIFGGNQNEANTNRVVGTYGYMAPEYAMEGLFSVKSDVFSFGVLLLEIISG  553

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQ  353
            KKN  FY     ++LL HAW LW EG   EL+DP + +SF+P EV++CI +GL+CVQ
Sbjct  554  KKNSSFYLSEESRSLLAHAWKLWCEGNALELMDPVLKQSFNPDEVLKCIHIGLLCVQ  610



>gb|ACN52035.1| SRK protein [Brassica cretica]
Length=210

 Score =   165 bits (418),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 95/127 (75%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  +A T    GTYGYMSPEYAMDG+ S K+DVFSFGV+VLEIVSG
Sbjct  30   PKISDFGMARIFARDETQARTDNAVGTYGYMSPEYAMDGVISEKTDVFSFGVIVLEIVSG  89

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES-------FSPSEVMRCIQVGL  341
            K+NRGFY  N + NLL +AW  W EGR  E++DP + +S       F P EV++CIQ+GL
Sbjct  90   KRNRGFYQVNPENNLLSYAWSHWAEGRALEIVDPVIIDSLASLPSTFQPKEVLKCIQIGL  149

Query  342  VCVQEQA  362
            +C+QE+A
Sbjct  150  LCIQERA  156



>ref|XP_008226732.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Prunus mume]
Length=800

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   N  EA TK+V GTYGYMSPEYA+DG FSVKSDVFSFGVL+LEIVSG
Sbjct  621  PKISDFGIARIFGRNQTEAKTKRVIGTYGYMSPEYAIDGKFSVKSDVFSFGVLLLEIVSG  680

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQ  353
            +KNRGF++ N+  +LLGHAW LW E +G EL+DP +G S+   EV+RCIQVGL+CVQ
Sbjct  681  RKNRGFHHPNHHHSLLGHAWLLWNEVKGLELIDPCLGYSYIEFEVLRCIQVGLLCVQ  737



>gb|AGC55017.1| S-receptor kinase, partial [Arabidopsis lyrata]
Length=832

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 101/127 (80%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  EANT+KV GTYGYMSPEYAMDG+FS+KSDVFSFGVL+LEI+ G
Sbjct  656  PKISDFGMARIFGRDETEANTRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIICG  715

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGE-------SFSPSEVMRCIQVGL  341
            K+NRGFYN N+  NLLG  W  W+EG+G E++DP V +       +F P E++RCIQ+GL
Sbjct  716  KRNRGFYNVNHDLNLLGCVWRNWKEGKGLEIVDPVVIDSSSSSSSTFRPHEILRCIQIGL  775

Query  342  VCVQEQA  362
            +CVQE+A
Sbjct  776  LCVQERA  782



>gb|AGC55015.1| S-receptor kinase [Arabidopsis thaliana]
Length=854

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 101/127 (80%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  EANT+ V GTYGYMSPEYAMDG+FS+KSDVFSFGVL+LEI+SG
Sbjct  666  PKISDFGMARIFGRDETEANTRTVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISG  725

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGE-------SFSPSEVMRCIQVGL  341
            K+NRGFYN N+  NLLG  W  W+EG+G E++DP V +       +F P E++RCIQ+GL
Sbjct  726  KRNRGFYNVNHDLNLLGCVWRNWKEGKGLEIVDPVVKDSSPSSSSNFQPHEILRCIQIGL  785

Query  342  VCVQEQA  362
            +CVQE+A
Sbjct  786  LCVQERA  792



>dbj|BAB40986.1| SRKa [Arabidopsis lyrata]
Length=847

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 97/126 (77%), Gaps = 6/126 (5%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+      EA+TKKV GTYGYMSPEYAMDG+FSVKSDVFSFGVLVLEIVSG
Sbjct  660  PKISDFGMARIFEREETEASTKKVVGTYGYMSPEYAMDGIFSVKSDVFSFGVLVLEIVSG  719

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAV------GESFSPSEVMRCIQVGLV  344
            K+NRGFYN N   NLL + W  W+EG+  E+ DP +        +F P EV+RC+Q+GL+
Sbjct  720  KRNRGFYNSNQDNNLLSYTWDHWKEGKWLEIADPIIVGTSSSSSTFRPHEVLRCLQIGLL  779

Query  345  CVQEQA  362
            CVQE+A
Sbjct  780  CVQERA  785



>ref|XP_006433220.1| hypothetical protein CICLE_v100005811mg, partial [Citrus clementina]
 gb|ESR46460.1| hypothetical protein CICLE_v100005811mg, partial [Citrus clementina]
Length=232

 Score =   166 bits (419),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ +GN  EANT +VAGTYGYM+PEYAM+G+FSVKSDVFSFGVL+LEI+SG
Sbjct  52   PKISDFGMARIFSGNQNEANTNRVAGTYGYMAPEYAMEGVFSVKSDVFSFGVLLLEIISG  111

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            K+N GFY   + Q+LL +AW LW +G   EL+DP + ++   +E+++CI +GL+CVQE 
Sbjct  112  KRNSGFYLSEHGQSLLTYAWKLWCKGEALELMDPVLKQTCVDAELLKCIHIGLLCVQED  170



>ref|XP_002869890.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46149.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=852

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 97/126 (77%), Gaps = 6/126 (5%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+      EA+TKKV GTYGYMSPEYAMDG+FSVKSDVFSFGVLVLEIVSG
Sbjct  665  PKISDFGMARIFEREETEASTKKVVGTYGYMSPEYAMDGIFSVKSDVFSFGVLVLEIVSG  724

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAV------GESFSPSEVMRCIQVGLV  344
            K+NRGFYN N   NLL + W  W+EG+  E+ DP +        +F P EV+RC+Q+GL+
Sbjct  725  KRNRGFYNSNQDNNLLSYTWDHWKEGKWLEIADPIIVGTSSSSSTFRPHEVLRCLQIGLL  784

Query  345  CVQEQA  362
            CVQE+A
Sbjct  785  CVQERA  790



>gb|AAL17688.1| S-locus receptor kinase [Raphanus sativus]
Length=289

 Score =   167 bits (423),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 97/126 (77%), Gaps = 6/126 (5%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A    EANT  V GTYGYMSPEYAM G+FS KSDVFSFGV+VLEIV+G
Sbjct  101  PKISDFGMARIFAREETEANTMNVVGTYGYMSPEYAMHGIFSEKSDVFSFGVIVLEIVTG  160

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSP------SEVMRCIQVGLV  344
            K+NRGF N N + NLL +AW  W+EGR  E++DP + +S SP       +V++CIQ+GL+
Sbjct  161  KRNRGFNNLNYEHNLLNYAWSNWKEGRAIEIVDPDIVDSLSPLSSTFQPQVIKCIQIGLL  220

Query  345  CVQEQA  362
            CVQE+A
Sbjct  221  CVQERA  226



>gb|KDO42697.1| hypothetical protein CISIN_1g0091861mg, partial [Citrus sinensis]
Length=232

 Score =   166 bits (419),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ +GN  EANT +VAGTYGYM+PEYAM+G+FSVKSDVFSFGVL+LEI+SG
Sbjct  52   PKISDFGMARIFSGNQNEANTNRVAGTYGYMAPEYAMEGVFSVKSDVFSFGVLLLEIISG  111

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            K+N GFY   + Q+LL +AW LW +G   EL+DP + ++   +E+++CI +GL+CVQE 
Sbjct  112  KRNSGFYLSEHGQSLLTYAWKLWCKGEALELMDPVLKQTCVDAELLKCIHIGLLCVQED  170



>gb|KDO74347.1| hypothetical protein CISIN_1g003391mg [Citrus sinensis]
 gb|KDO74348.1| hypothetical protein CISIN_1g003391mg [Citrus sinensis]
Length=606

 Score =   173 bits (439),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR    +  EANT +V GTYGYM PEYA+DGLFSVKSDVFSFGVLVLEIV G
Sbjct  428  PKISDFGMARAFGIDQTEANTNRVVGTYGYMPPEYAIDGLFSVKSDVFSFGVLVLEIVCG  487

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            K+NRGFY+ ++  NLLGHAW LW E R  EL++ ++G S+S SEV+RCIQVGL+CVQ++
Sbjct  488  KRNRGFYHADHHHNLLGHAWRLWIEERPVELINKSLGGSYSLSEVLRCIQVGLLCVQQR  546



>ref|XP_003598129.1| Serine/threonine protein kinase [Medicago truncatula]
 gb|AES68380.1| cysteine-rich RLK (receptor-like kinase) protein [Medicago truncatula]
Length=353

 Score =   169 bits (427),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 93/117 (79%), Gaps = 0/117 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFGLA++   +  E NT +V GT+GYM+PEYA+DGLFS KSDVFSFGVL+LEIVSG
Sbjct  178  PKISDFGLAKICGDDQVEGNTNRVVGTHGYMAPEYAIDGLFSTKSDVFSFGVLLLEIVSG  237

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQ  353
             KN+G   QNN  NL+GHAW LW+EG   EL+D  + +S+ PSE +RCIQVGL+C+Q
Sbjct  238  HKNKGLTFQNNNYNLVGHAWRLWKEGNSKELIDDCLKDSYIPSEALRCIQVGLLCLQ  294



>ref|XP_006475280.1| PREDICTED: uncharacterized protein LOC102629172 [Citrus sinensis]
Length=1625

 Score =   177 bits (448),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFGLAR   G+  E NT +V GTYGYM+PEYA DG FSVKSDVFSFG+L+LEI+SG
Sbjct  634  PKISDFGLARAFGGDETEGNTNRVIGTYGYMAPEYASDGQFSVKSDVFSFGILLLEIISG  693

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            KKNRGFY+ +N+ NL+GHAW LW EG  S+L+DP V +SF+ +EV+RCI +GL+CVQ+ 
Sbjct  694  KKNRGFYHSDNKLNLIGHAWKLWNEGMPSQLIDPCVQDSFNLAEVIRCIHIGLLCVQQH  752


 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 92/119 (77%), Gaps = 0/119 (0%)
 Frame = +3

Query  3     PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
             PKISDFGLAR   G+  E +TK+V GTYGYM+PEYA DGLFSVKSDVFSFG+L+LEIVSG
Sbjct  1447  PKISDFGLARTFVGDEIEGSTKRVVGTYGYMAPEYASDGLFSVKSDVFSFGILLLEIVSG  1506

Query  183   KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
             KKNRGFY+ +   NL+GHAW LW     S+L+D    ES + +EV+RCI VGL+CVQ  
Sbjct  1507  KKNRGFYHSDKNLNLIGHAWKLWNNSMPSQLIDACYQESCNLAEVIRCIHVGLLCVQHH  1565



>gb|ACN52041.1| SRK protein [Brassica cretica]
Length=201

 Score =   164 bits (416),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 95/127 (75%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  +A T    GTYGYMSPEYAMDG+ S K+DVFSFGV+VLEIVSG
Sbjct  27   PKISDFGMARIFARDETQARTDNAVGTYGYMSPEYAMDGVISEKTDVFSFGVIVLEIVSG  86

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGE-------SFSPSEVMRCIQVGL  341
            K+NRGFY  N + NLL +AW  W EGR  E++DP + +       +F P EV++CIQ+GL
Sbjct  87   KRNRGFYQVNPENNLLSYAWSHWAEGRALEIVDPVIVDPLASLPSTFQPKEVLKCIQIGL  146

Query  342  VCVQEQA  362
            +C+QE+A
Sbjct  147  LCIQERA  153



>dbj|BAF02195.1| putative receptor kinase [Arabidopsis thaliana]
Length=494

 Score =   172 bits (435),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 97/124 (78%), Gaps = 4/124 (3%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+      EANT++V GTYGYMSPEYAMDG+FS+KSDVFSFGVL+LEI+SG
Sbjct  309  PKISDFGMARIFGREETEANTRRVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISG  368

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDP----AVGESFSPSEVMRCIQVGLVCV  350
            K+N+GFYN N   NLLG  W  W+EG+  E++DP    A+   F   E++RCIQ+GL+CV
Sbjct  369  KRNKGFYNSNRDLNLLGFVWRHWKEGKELEIVDPINIDALSSEFPTHEILRCIQIGLLCV  428

Query  351  QEQA  362
            QE+A
Sbjct  429  QERA  432



>ref|XP_006475281.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1-like [Citrus sinensis]
Length=303

 Score =   167 bits (424),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 92/119 (77%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFGLAR   G+  E +TK+V GTYGYM+PEYA DGLFSVKSDVFSFG+L+LEIVSG
Sbjct  125  PKISDFGLARTFVGDEIEGSTKRVVGTYGYMAPEYASDGLFSVKSDVFSFGILLLEIVSG  184

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            KKNRGFY+ +   NL+GHAW LW     S+L+D    ES + +EV+RCI VGL+CVQ  
Sbjct  185  KKNRGFYHSDKNLNLIGHAWKLWNNSMPSQLIDACYQESCNLAEVIRCIHVGLLCVQHH  243



>emb|CDY39269.1| BnaC06g27220D [Brassica napus]
Length=479

 Score =   171 bits (434),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 99/124 (80%), Gaps = 4/124 (3%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  EANT+KV GTYGYM+PEYAMDG+FS+KSDVFSFGVL+LEI++G
Sbjct  294  PKISDFGMARIFGPDETEANTRKVVGTYGYMAPEYAMDGIFSMKSDVFSFGVLLLEIITG  353

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGE----SFSPSEVMRCIQVGLVCV  350
            K+++GFYN N   NLLG  W  W+EG+G E++DP + +    +    E++RCIQ+GL+CV
Sbjct  354  KRSKGFYNSNRDHNLLGFVWRYWKEGKGIEIVDPIIMDYSSSALRTHEILRCIQIGLLCV  413

Query  351  QEQA  362
            QE+A
Sbjct  414  QERA  417



>ref|XP_007213469.1| hypothetical protein PRUPE_ppa023906mg [Prunus persica]
 gb|EMJ14668.1| hypothetical protein PRUPE_ppa023906mg [Prunus persica]
Length=794

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+      EANT +V GTYGYMSPEYAM GLFSVKSDV+SFGVL+LEIVSG
Sbjct  615  PKISDFGMARIFGAEQIEANTNRVVGTYGYMSPEYAMQGLFSVKSDVYSFGVLLLEIVSG  674

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            +KN  +Y+ N   NL+GH W LW+EGR SE++D  +GES+   EV+RCIQ+ L+CVQE A
Sbjct  675  RKNTRYYHDNPDSNLVGHVWHLWKEGRASEIIDSTLGESYPVDEVVRCIQIALLCVQEHA  734



>dbj|BAF91402.1| S-locus receptor kinase (kinase domain) [Brassica oleracea]
Length=424

 Score =   170 bits (431),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 97/127 (76%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A    EANT KV GTYGYMSPEYAM G+FS KSDVFSFGV+VLEIV+G
Sbjct  234  PKISDFGMARIFAREETEANTMKVVGTYGYMSPEYAMHGIFSEKSDVFSFGVIVLEIVTG  293

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES-------FSPSEVMRCIQVGL  341
            K+NR FYN N + NLL +AW  W+EGR  E++DP + +S       F P EV++CIQ+GL
Sbjct  294  KRNRVFYNLNYEDNLLNYAWSNWKEGRALEIVDPDIVDSLSPLSSTFRPQEVLKCIQIGL  353

Query  342  VCVQEQA  362
            +CVQE A
Sbjct  354  LCVQELA  360



>gb|ACN52042.1| SRK protein [Brassica cretica]
Length=206

 Score =   164 bits (416),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 95/127 (75%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  +A T    GTYGYMSPEYAMDG+ S K+DVFSFGV+VLEIVSG
Sbjct  23   PKISDFGMARIFARDETQARTDNAVGTYGYMSPEYAMDGVISEKTDVFSFGVIVLEIVSG  82

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGE-------SFSPSEVMRCIQVGL  341
            K+NRGFY  N + NLL +AW  W EGR  E++DP + +       +F P EV++CIQ+GL
Sbjct  83   KRNRGFYQVNPENNLLSYAWSHWAEGRALEIVDPVIVDPLASLPSTFQPKEVLKCIQIGL  142

Query  342  VCVQEQA  362
            +C+QE+A
Sbjct  143  LCIQERA  149



>ref|XP_006452105.1| hypothetical protein CICLE_v10007572mg [Citrus clementina]
 gb|ESR65345.1| hypothetical protein CICLE_v10007572mg [Citrus clementina]
Length=740

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFGLAR   G+  E NT +V GTYGYM+PEYA DG FSVKSDVFSFG+L+LEI+SG
Sbjct  562  PKISDFGLARAFGGDETEGNTNRVVGTYGYMAPEYASDGQFSVKSDVFSFGILLLEIISG  621

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            KKNRGFY+ +N+ NL+G+AW LW EG  S+L+DP + +SF+ +EV+RCI +GL+CVQ+ 
Sbjct  622  KKNRGFYHSDNKLNLIGNAWKLWNEGMPSQLIDPCIQDSFNLAEVIRCIHIGLLCVQQH  680



>ref|XP_007208597.1| hypothetical protein PRUPE_ppa022413mg [Prunus persica]
 gb|EMJ09796.1| hypothetical protein PRUPE_ppa022413mg [Prunus persica]
Length=591

 Score =   172 bits (437),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 73/120 (61%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFGLAR+   N  EANT ++ GTYGYMSPEYAM+G+FS+KSDV+SFGVLVLEI+SG
Sbjct  410  PKISDFGLARIFTHNELEANTNRIVGTYGYMSPEYAMEGIFSIKSDVYSFGVLVLEIISG  469

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            ++N  FY  ++  N++G+AW LW+EGRG EL+DP + +S +  +++RC QVGL+CV+E A
Sbjct  470  RRNSSFYIADHVLNIVGYAWELWKEGRGLELMDPTLKDSCTEDQLLRCFQVGLLCVEENA  529



>ref|XP_007021213.1| S-locus lectin protein kinase family protein, putative [Theobroma 
cacao]
 gb|EOY12738.1| S-locus lectin protein kinase family protein, putative [Theobroma 
cacao]
Length=336

 Score =   168 bits (425),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+A++V G+  EA TK+VAGT GYMSPEYA++G FSVKSDVF FGVL+LEIVSG
Sbjct  157  PKISDFGIAKIVEGDQLEAETKQVAGTCGYMSPEYAINGKFSVKSDVFGFGVLLLEIVSG  216

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            K NR F +Q++Q NLLGHAW LW + R  ELLDP +  S   S+V+RCIQVGL+C Q+ A
Sbjct  217  KCNRRFNHQDHQHNLLGHAWLLWNDNRALELLDPCLRHSCVESQVLRCIQVGLLCAQKLA  276



>ref|XP_006452095.1| hypothetical protein CICLE_v10007596mg [Citrus clementina]
 gb|ESR65335.1| hypothetical protein CICLE_v10007596mg [Citrus clementina]
Length=721

 Score =   173 bits (439),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFGLAR   G+  E NT +V GTYGYM+PEYA DG FSVKSDVFSFG+L+LEI+SG
Sbjct  543  PKISDFGLARAFGGDEIEGNTNRVIGTYGYMAPEYASDGKFSVKSDVFSFGILLLEIISG  602

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            KKNRGFY+ +N+ NL+GHAW LW EG  S+L+DP +  SF+  EV+RCI +GL+CVQ+ 
Sbjct  603  KKNRGFYHSDNKLNLIGHAWKLWNEGMPSQLIDPCIQGSFNLVEVIRCIHIGLLCVQQH  661



>gb|ACU29643.1| S-locus receptor kinase 25 [Arabidopsis lyrata]
Length=850

 Score =   174 bits (442),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 100/126 (79%), Gaps = 6/126 (5%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  EANT+KV GTYGYMSPEYAMDG+FSVKSDVFSFGVLVLEI+SG
Sbjct  662  PKISDFGMARIFERDETEANTRKVVGTYGYMSPEYAMDGIFSVKSDVFSFGVLVLEIISG  721

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES------FSPSEVMRCIQVGLV  344
            K+NRGFYN N   NLL + W  W+EG G +++DP + +S      F P EV+RCIQ+GL+
Sbjct  722  KRNRGFYNSNQDNNLLSYTWDNWKEGEGLKIVDPIIIDSSSSFSMFRPYEVLRCIQIGLL  781

Query  345  CVQEQA  362
            CVQE+A
Sbjct  782  CVQERA  787



>gb|AID21613.1| SRKp [Arabidopsis halleri]
Length=857

 Score =   174 bits (442),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 100/127 (79%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  EA T+++ GTYGYMSPEYAMDG++SVKSDVFSFGVLVLEIVSG
Sbjct  676  PKISDFGMARIFARDEEEATTRRIVGTYGYMSPEYAMDGIYSVKSDVFSFGVLVLEIVSG  735

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAV-------GESFSPSEVMRCIQVGL  341
            ++NRGFY  N + NLLG+ W  W+EG+G E++DP V         +F P +V+RCIQ+GL
Sbjct  736  QRNRGFYISNEENNLLGYVWRNWKEGKGPEIIDPTVVNSSSSSPSTFRPEDVLRCIQIGL  795

Query  342  VCVQEQA  362
            +CVQE A
Sbjct  796  LCVQEHA  802



>gb|KCW76512.1| hypothetical protein EUGRSUZ_D00902 [Eucalyptus grandis]
Length=364

 Score =   169 bits (427),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  + NT +V GTYGYMSPEYAM+G+FS+KSDV+SFGVL+LEI+SG
Sbjct  186  PKISDFGMARICGADQIQGNTNRVVGTYGYMSPEYAMEGIFSIKSDVYSFGVLLLEIISG  245

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            K+N  +Y++N   NL+GHAW LW+EG   +++D ++G+S+S  E +RCIQ+GL+CVQE A
Sbjct  246  KRNSAYYHENPSSNLVGHAWELWKEGNCKDVIDESMGDSWSKEEALRCIQIGLLCVQEFA  305



>ref|XP_007021202.1| S-locus lectin protein kinase family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY12727.1| S-locus lectin protein kinase family protein, putative isoform 
1 [Theobroma cacao]
Length=825

 Score =   174 bits (441),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR V G+  EANT KV GTYGYM PEYA+DGLFS+KSDVFSFGVLVLEI+SG
Sbjct  646  PKISDFGMARTVWGDQTEANTNKVVGTYGYMPPEYAVDGLFSIKSDVFSFGVLVLEIISG  705

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            KKNRGF++ ++  NLLGHAW LW E R  +L+D  +G+ F+ SEV+RCI V L+CVQ +
Sbjct  706  KKNRGFFHPDHSHNLLGHAWKLWTEERPLQLIDSNLGDCFAVSEVLRCIHVALLCVQTR  764



>ref|XP_006470118.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-6-like 
[Citrus sinensis]
Length=298

 Score =   167 bits (422),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR  A N  EANT ++ GT+GYMSPEY M+G+ S+KSDV+SFGVLVLEIVS 
Sbjct  117  PKISDFGMARTYAMNELEANTNRIVGTHGYMSPEYVMNGIVSMKSDVYSFGVLVLEIVSS  176

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            KKN G Y+     NL+G+AW LW EG+  EL+DP + ES S  EVMRCI VGL+CVQ++A
Sbjct  177  KKNNGSYDTERPLNLVGYAWQLWNEGKALELMDPTLDESCSSDEVMRCIHVGLLCVQDRA  236



>dbj|BAF91398.1| S-locus receptor kinase (kinase domain) [Brassica rapa]
Length=424

 Score =   170 bits (430),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 98/127 (77%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  EANT KV GTYGYMSPEYAMDG+FS KSDVFSFGV+VLEIV+G
Sbjct  234  PKISDFGMARIFARDETEANTMKVVGTYGYMSPEYAMDGIFSEKSDVFSFGVIVLEIVTG  293

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES-------FSPSEVMRCIQVGL  341
            K++R  YN N++ NLL + W  W EGR  E++DP + +S       F P EV++CIQ+GL
Sbjct  294  KRSRTLYNLNHENNLLSYVWSHWTEGRAQEIVDPIIIDSLSSPPSTFQPKEVLKCIQIGL  353

Query  342  VCVQEQA  362
            +CVQ++A
Sbjct  354  LCVQDRA  360



>dbj|BAF91388.1| S-locus receptor kinase (kinase domain) [Brassica rapa]
Length=438

 Score =   170 bits (431),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 98/127 (77%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  EANT+KV GTYGYMSPEYAM G FS KSDVFSFGV+VLEIV+G
Sbjct  248  PKISDFGMARIFARDETEANTRKVVGTYGYMSPEYAMYGKFSEKSDVFSFGVIVLEIVTG  307

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFS-------PSEVMRCIQVGL  341
            K+NRG +N N + NLL +AW  W+EGR  E++DP + +S S       P EV+RCIQ+GL
Sbjct  308  KRNRGLHNLNYENNLLSYAWSNWKEGRALEIVDPVIIDSLSPLSSTLQPQEVLRCIQIGL  367

Query  342  VCVQEQA  362
            +CVQE A
Sbjct  368  LCVQELA  374



>gb|ABY55237.1| S-locus receptor kinase [Diplotaxis tenuifolia]
Length=198

 Score =   164 bits (414),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 95/124 (77%), Gaps = 4/124 (3%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFGLAR+ AG+  EA+TK V GTYGYMSPEYAM G+FS K+DVFSFGV+VLEIV G
Sbjct  27   PKISDFGLARIFAGDETEADTKAVVGTYGYMSPEYAMFGVFSEKTDVFSFGVIVLEIVCG  86

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFS----PSEVMRCIQVGLVCV  350
            K+N+GFY  N + NLL +AW  W EG   E++DP + +S      P EV++CIQ+GL+CV
Sbjct  87   KRNKGFYQLNPENNLLCYAWSHWDEGTPLEMVDPVILDSLPSTLEPKEVLKCIQIGLLCV  146

Query  351  QEQA  362
            QE+ 
Sbjct  147  QERP  150



>dbj|BAF91403.1| S-locus receptor kinase (kinase domain) [Brassica oleracea]
Length=424

 Score =   170 bits (430),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 97/127 (76%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A    EANT KV GTYGYMSPEYAM G+FS KSDVFSFGV+VLEIV+G
Sbjct  234  PKISDFGMARIFAREETEANTMKVVGTYGYMSPEYAMHGIFSEKSDVFSFGVIVLEIVTG  293

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES-------FSPSEVMRCIQVGL  341
            K+NR FYN N + NLL +AW  W+EGR  E++DP + +S       F P EV++CIQ+GL
Sbjct  294  KRNRVFYNLNYEDNLLNYAWSNWKEGRALEIVDPDIVDSLSPLSSTFRPQEVLKCIQIGL  353

Query  342  VCVQEQA  362
            +CVQE A
Sbjct  354  LCVQELA  360



>ref|XP_007133617.1| hypothetical protein PHAVU_011G194400g [Phaseolus vulgaris]
 gb|ESW05611.1| hypothetical protein PHAVU_011G194400g [Phaseolus vulgaris]
Length=180

 Score =   163 bits (413),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 95/120 (79%), Gaps = 1/120 (1%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFGLAR   G   +ANTK+V GTYGYM+PEYAM+GLFSVKSDVFSFGVLVLEI+ G
Sbjct  3    PKISDFGLARAFEGGQNQANTKRVMGTYGYMAPEYAMEGLFSVKSDVFSFGVLVLEIICG  62

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            +KN GFY  ++ Q LL +AW +W EG+  EL+DP + +SF   EV RCIQ+GL+CVQE A
Sbjct  63   RKNGGFY-MSDGQTLLVYAWRIWYEGKCLELMDPVLEKSFIGDEVERCIQIGLLCVQEDA  121



>ref|XP_007021132.1| S-locus lectin protein kinase family protein, putative [Theobroma 
cacao]
 gb|EOY12657.1| S-locus lectin protein kinase family protein, putative [Theobroma 
cacao]
Length=381

 Score =   169 bits (427),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 95/119 (80%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR   G+ +E NT +V GTYGYM+PEYA+DG FSVKSDVFSFG+LVLEI+SG
Sbjct  70   PKISDFGMARSFGGDQFEGNTNRVVGTYGYMAPEYAIDGQFSVKSDVFSFGILVLEIISG  129

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            KKNRGFYN  N  NL+GHAW LW+E +  +L+DP + ES + SEV R I +GL+C+Q+ 
Sbjct  130  KKNRGFYNPGNGLNLIGHAWDLWKEEKAVQLIDPLLKESCNLSEVARGIHIGLLCLQQH  188



>gb|ACN52037.1| SRK protein [Brassica cretica]
Length=238

 Score =   165 bits (417),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 95/127 (75%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  +A T    GTYGYMSPEYAMDG+ S K+DVFSFGV+VLEIVSG
Sbjct  44   PKISDFGMARIFARDETQARTDNAVGTYGYMSPEYAMDGVISEKTDVFSFGVIVLEIVSG  103

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES-------FSPSEVMRCIQVGL  341
            K+NRGFY  N + NLL +AW  W EGR  E++DP + +S       F P EV++CIQ+GL
Sbjct  104  KRNRGFYQVNPENNLLSYAWSHWAEGRALEIVDPVIVDSLSSLPSTFQPKEVLKCIQIGL  163

Query  342  VCVQEQA  362
            +C+QE+A
Sbjct  164  LCIQERA  170



>ref|XP_006452080.1| hypothetical protein CICLE_v10007464mg [Citrus clementina]
 gb|ESR65320.1| hypothetical protein CICLE_v10007464mg [Citrus clementina]
Length=822

 Score =   174 bits (440),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR    +  EANT +V GTYGYMSPEYA+DGLFSVKSDVFSFGVLVLEIVSG
Sbjct  644  PKISDFGMARAFGLDQTEANTNRVVGTYGYMSPEYAIDGLFSVKSDVFSFGVLVLEIVSG  703

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQE  356
            K+NRGFY+ +++ NLLGHAW LW + R +EL+D ++ +S S SE +RCIQVGL+CVQ+
Sbjct  704  KRNRGFYHADHRHNLLGHAWQLWIQDRPAELIDKSLYDSCSLSEAIRCIQVGLLCVQQ  761



>emb|CBI20456.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   169 bits (428),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 95/117 (81%), Gaps = 0/117 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR   GN  EANTK+V GTYGYMSPEYA+DGL+S KSDVFSFGVLVLEIVSG
Sbjct  229  PKISDFGMARSFRGNETEANTKRVVGTYGYMSPEYAIDGLYSTKSDVFSFGVLVLEIVSG  288

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQ  353
            K+NRGF + ++  NLLGHAW L+ EGR  EL+D +VG+    S+V+R I VGL+CVQ
Sbjct  289  KRNRGFSHPDHSFNLLGHAWTLYMEGRSMELIDTSVGDMHDLSQVLRSINVGLLCVQ  345



>gb|KDO74353.1| hypothetical protein CISIN_1g003272mg [Citrus sinensis]
Length=834

 Score =   174 bits (440),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR    +  EANT +V GTYGYMSPEYA+DGLFSVKSDVFSFGVLVLEIVSG
Sbjct  656  PKISDFGMARAFGLDQTEANTNRVVGTYGYMSPEYAIDGLFSVKSDVFSFGVLVLEIVSG  715

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQE  356
            K+NRGFY+ +++ NLLGHAW LW + R +EL+D ++ +S S SE +RCIQVGL+CVQ+
Sbjct  716  KRNRGFYHADHRHNLLGHAWQLWIQDRPAELIDKSLYDSCSLSEAIRCIQVGLLCVQQ  773



>gb|KDO56874.1| hypothetical protein CISIN_1g0052812mg, partial [Citrus sinensis]
Length=201

 Score =   164 bits (414),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 96/129 (74%), Gaps = 9/129 (7%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGT---------YGYMSPEYAMDGLFSVKSDVFSFG  155
            PKISDFG+AR  A N  EANT ++ GT         YGYMSPEY M+G+ S+KSDV+SFG
Sbjct  11   PKISDFGMARTFAMNELEANTNRIVGTQYVYKTHLLYGYMSPEYVMNGVVSLKSDVYSFG  70

Query  156  VLVLEIVSGKKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQV  335
            VLVLEI+S KKN G Y+     NL+G+AW LW EG+G EL+DP++ ES SP EV+RCI V
Sbjct  71   VLVLEIISSKKNNGCYDTERPLNLVGYAWQLWNEGKGLELIDPSLDESCSPEEVIRCIHV  130

Query  336  GLVCVQEQA  362
            GL+CVQ++A
Sbjct  131  GLLCVQDKA  139



>emb|CDY07469.1| BnaA07g25480D [Brassica napus]
Length=492

 Score =   171 bits (432),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 97/125 (78%), Gaps = 5/125 (4%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+      EANT+KV GTYGYMSPEYAMDG+FS+KSDVFSFGVL+LEI+SG
Sbjct  306  PKISDFGMARIFGREETEANTRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISG  365

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPS-----EVMRCIQVGLVC  347
            KK  GFYN N   NLLG  W  W+EG+G E++DP + +  S +     E++RCIQ+GL+C
Sbjct  366  KKTNGFYNSNRDLNLLGFVWRYWKEGKGIEIVDPIIIDDSSSAVLRTHEILRCIQIGLLC  425

Query  348  VQEQA  362
            VQE+A
Sbjct  426  VQERA  430



>gb|AFP33771.1| SRK [Arabidopsis kamchatica subsp. kamchatica]
Length=858

 Score =   174 bits (441),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 99/127 (78%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   N  EANT+KV GTYGYMSPEYAMDG+FS KSDVFSFGVLVLEIVSG
Sbjct  669  PKISDFGMARIFERNETEANTRKVVGTYGYMSPEYAMDGIFSEKSDVFSFGVLVLEIVSG  728

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGE-------SFSPSEVMRCIQVGL  341
            K+NRGFYN N+  NLL + W  W++G G ++ DP + +       +F P EV+RCIQ+GL
Sbjct  729  KRNRGFYNSNHDSNLLSYTWENWKDGIGLQIADPIIIDCPSSSFSTFKPQEVLRCIQIGL  788

Query  342  VCVQEQA  362
            +CVQE+A
Sbjct  789  LCVQERA  795



>ref|XP_009402881.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=831

 Score =   174 bits (440),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  E NT +V GTYGYMSPEYAMDG+FSVKSDVFSFGVLVLEIVSG
Sbjct  652  PKISDFGMARIFGGDETEVNTMRVVGTYGYMSPEYAMDGIFSVKSDVFSFGVLVLEIVSG  711

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQE  356
            KKNRG Y      NLL + W LW+E R  E++D ++GESF   EV+RCI+VGL+CVQE
Sbjct  712  KKNRGVYYSGRHLNLLAYTWSLWKEDRVLEMVDESIGESFPTDEVLRCIKVGLLCVQE  769



>ref|XP_010924052.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Elaeis guineensis]
Length=804

 Score =   173 bits (439),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  +A TK+V GTYGYMSPEYAMDG+FSVKSDVFSFGVLVLEI+SG
Sbjct  629  PKISDFGMARIFGGDQSDAYTKRVVGTYGYMSPEYAMDGVFSVKSDVFSFGVLVLEIISG  688

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            KKNRG YN     +LL HAW LW EG   ELLD ++G S+S +EV++CIQVGL+CVQ++
Sbjct  689  KKNRGIYNTEPNLSLLSHAWKLWNEGNSLELLDKSMGCSYSINEVLKCIQVGLLCVQDR  747



>emb|CDY07465.1| BnaA07g25440D [Brassica napus]
Length=619

 Score =   172 bits (436),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 101/124 (81%), Gaps = 4/124 (3%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  EANT+KV GTYGYM+PEYAMDG+FS+KSDVFSFGVL+LEI++G
Sbjct  434  PKISDFGMARIFGRDETEANTRKVVGTYGYMAPEYAMDGIFSMKSDVFSFGVLLLEIITG  493

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPS----EVMRCIQVGLVCV  350
            K+++GFYN N   NLLG  W  W+EG+G E++DP + +S S +    E++RCIQ+GL+CV
Sbjct  494  KRSKGFYNSNRDNNLLGFVWRYWKEGKGIEIVDPIIMDSSSSALRTHEILRCIQIGLLCV  553

Query  351  QEQA  362
            QE+A
Sbjct  554  QERA  557



>gb|AGN12877.1| putative S-locus receptor kinase [Sisymbrium irio]
Length=858

 Score =   174 bits (440),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 101/127 (80%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  EA T+++ GTYGYMSPEYAM G+FS KSDVFSFGVLVLEIVSG
Sbjct  669  PKISDFGMARIFARDETEAITRRIVGTYGYMSPEYAMGGIFSTKSDVFSFGVLVLEIVSG  728

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGE-------SFSPSEVMRCIQVGL  341
            K+NRGFYN N++ NLLG+AW  W+E +G E++DP + +       +F P EV+RCIQ+GL
Sbjct  729  KRNRGFYNFNHENNLLGYAWRNWKEAKGLEIVDPTIVDSSSSSLSTFRPQEVLRCIQIGL  788

Query  342  VCVQEQA  362
            +CVQE A
Sbjct  789  LCVQELA  795



>ref|XP_009402882.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=830

 Score =   174 bits (440),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  E NT +V GTYGYMSPEYAMDG+FSVKSDVFSFGVLVLEIVSG
Sbjct  652  PKISDFGMARIFGGDETEVNTMRVVGTYGYMSPEYAMDGIFSVKSDVFSFGVLVLEIVSG  711

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQE  356
            KKNRG Y      NLL + W LW+E R  E++D ++GESF   EV+RCI+VGL+CVQE
Sbjct  712  KKNRGVYYSGRHLNLLAYTWSLWKEDRVLEMVDESIGESFPTDEVLRCIKVGLLCVQE  769



>ref|XP_009341704.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=388

 Score =   169 bits (427),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   N  EANT +V GTYGYMSPEYAM+GLFS+KSDV+SFGVL+LEIVSG
Sbjct  209  PKISDFGMARIFKHNELEANTNRVVGTYGYMSPEYAMEGLFSIKSDVYSFGVLMLEIVSG  268

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            ++N  FYN +   N++G+AW LW+EG   EL+DPA+G+S    +++RC+ VGL+CV+E A
Sbjct  269  RRNNSFYNADRLLNIVGYAWELWKEGTVLELMDPALGDSCIKDQLLRCVHVGLLCVEENA  328



>ref|XP_010058873.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Eucalyptus 
grandis]
Length=307

 Score =   166 bits (421),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 93/119 (78%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ + N  +ANT +V GTYGYM+PEYAM GLFSVKSDVFSFGVL+LEIVSG
Sbjct  134  PKISDFGMARIFSVNQDKANTNRVVGTYGYMAPEYAMQGLFSVKSDVFSFGVLLLEIVSG  193

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            +KN GF+ Q   ++LL  AW LW EGR  EL+DP + ES    EV++CI +GL+CVQE 
Sbjct  194  RKNNGFHRQVKGESLLTFAWKLWSEGRALELIDPLIDESCDEVEVLKCIHIGLLCVQED  252



>ref|XP_006594797.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like isoform X2 [Glycine max]
Length=809

 Score =   173 bits (439),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  E NTK++ GTYGYM+PEYA DGLFSVKSDVFSFGVL+LEI+SG
Sbjct  632  PKISDFGMARIFGVDQQEGNTKRIVGTYGYMAPEYATDGLFSVKSDVFSFGVLLLEIISG  691

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQE  356
            K++RG+YNQN+ QNL+GHAW LW+EGR  EL+D ++ +S S S+++ CI V L+CVQ+
Sbjct  692  KRSRGYYNQNHSQNLIGHAWKLWKEGRPLELIDKSIEDSSSLSQMLHCIHVSLLCVQQ  749



>ref|XP_008225012.1| PREDICTED: uncharacterized protein LOC103324693 [Prunus mume]
Length=1832

 Score =   176 bits (446),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PK+SDFG+AR+      EANT +V GTYGYMSPEYAM+GLFSVKSDV+SFGVL+LEIVSG
Sbjct  665  PKLSDFGMARIFGAEQIEANTNRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSG  724

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            +KN G+Y+ N   NL+GH W LW+EGR SE++D  +GES+   EV+RCIQ+ L+C+QE A
Sbjct  725  RKNTGYYHDNPDSNLVGHVWDLWKEGRASEIIDSTLGESYPVDEVVRCIQIALLCLQEHA  784


 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = +3

Query  3     PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
             PKISDFG+AR+      EANT +V GTYGYMSPEYAM GLFS+KSDV+SFGVL+LEIVSG
Sbjct  1653  PKISDFGMARIFGAEQIEANTNRVVGTYGYMSPEYAMQGLFSIKSDVYSFGVLLLEIVSG  1712

Query  183   KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
             +KN  +Y+ N   NL+GH W LW+EGR SE++D  +G+S+   EV+RCIQ+ L+CVQE A
Sbjct  1713  RKNTRYYHDNPDSNLVGHVWDLWKEGRASEIIDSTLGKSYPVDEVVRCIQIALLCVQEHA  1772



>ref|XP_002316940.2| hypothetical protein POPTR_0011s13040g [Populus trichocarpa]
 gb|EEE97552.2| hypothetical protein POPTR_0011s13040g [Populus trichocarpa]
Length=784

 Score =   173 bits (438),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  GN  EANTK+V GTYGYM+PEYA++GLFSVKSD+FSFGVLVLEIVSG
Sbjct  606  PKISDFGMARIFGGNQTEANTKRVVGTYGYMAPEYAVEGLFSVKSDIFSFGVLVLEIVSG  665

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            +KNRGF++ N+  NL+GHAW LW E R  EL D  +G S + SE++R I VGL+CVQ+Q
Sbjct  666  RKNRGFFSHNHHLNLVGHAWKLWMEERSLELTDNTLGASHALSEIIRYIHVGLLCVQQQ  724



>ref|XP_006377788.1| hypothetical protein POPTR_0011s12840g [Populus trichocarpa]
 gb|ERP55585.1| hypothetical protein POPTR_0011s12840g [Populus trichocarpa]
Length=816

 Score =   173 bits (439),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  GN  EANTK+V GTYGYM+PEYA++GLFSVKSD+FSFGVLVLEIVSG
Sbjct  638  PKISDFGMARIFGGNQTEANTKRVVGTYGYMAPEYAVEGLFSVKSDIFSFGVLVLEIVSG  697

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            +KNRGF++ N+  NL+GHAW LW E R  EL D  +G S + SE++R I VGL+CVQ+Q
Sbjct  698  RKNRGFFSHNHHLNLVGHAWKLWMEERSLELTDNTLGASHALSEIIRYIHVGLLCVQQQ  756



>ref|XP_009357378.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=215

 Score =   164 bits (414),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  +A+T ++ GTYGYMSPEYAM G FSVKSD++SFGVLVLEI+SG
Sbjct  29   PKISDFGMARIFGVDQTQASTNRIVGTYGYMSPEYAMHGHFSVKSDLYSFGVLVLEIISG  88

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQE  356
            KKN  F+  +  ++L+ HAW LWR+G   ELLDP +  S+S +EV+RCI +GL+CVQE
Sbjct  89   KKNSSFFQTDAAEDLMSHAWKLWRDGAPLELLDPCLRNSYSRTEVIRCIHIGLLCVQE  146



>dbj|BAF91412.1| S-locus receptor kinase [Brassica oleracea]
Length=847

 Score =   174 bits (440),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 100/127 (79%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  EANT KV GTYGYMSPEYAM G+FS KSDVFSFGV+VLEIVSG
Sbjct  657  PKISDFGMARIFARDETEANTMKVVGTYGYMSPEYAMAGIFSEKSDVFSFGVIVLEIVSG  716

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES-------FSPSEVMRCIQVGL  341
            KKNRGFYN +N+ +LL +AW  W+EGR  E++DP + +S       F P EV++CIQ+GL
Sbjct  717  KKNRGFYNLDNENDLLRYAWSHWKEGRALEIVDPVIVDSSSSLPSTFQPQEVLKCIQIGL  776

Query  342  VCVQEQA  362
            +CVQE A
Sbjct  777  LCVQEFA  783



>ref|XP_010910455.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
isoform X3 [Elaeis guineensis]
Length=666

 Score =   172 bits (436),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  E NT++V GTYGYMSPEYAMDG+FSVKSDVFSFGVLVLEI+SG
Sbjct  487  PKISDFGMARIFGGDETEVNTRRVVGTYGYMSPEYAMDGVFSVKSDVFSFGVLVLEIISG  546

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            KKNRG Y  ++  NLL HAW LW E +  +L+D ++G SF  +EV++CI+VGL+CVQE+
Sbjct  547  KKNRGVYAHSSHLNLLAHAWSLWNEEKSLQLVDESLGYSFPANEVIKCIKVGLLCVQER  605



>dbj|BAF57003.1| S receptor kinase [Brassica rapa]
Length=858

 Score =   174 bits (440),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 101/127 (80%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+VA +  EANT+ V GTYGYMSPEYAMDG+FS KSDVFSFGV+VLEI+SG
Sbjct  668  PKISDFGMARIVARDETEANTRNVVGTYGYMSPEYAMDGVFSEKSDVFSFGVIVLEIISG  727

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES-------FSPSEVMRCIQVGL  341
            K++RGFY+ N++ NLL + W  W EGR  E++DP + +S       F P EV++CIQ+GL
Sbjct  728  KRSRGFYHLNHENNLLSYVWSHWTEGRALEIVDPVIVDSLSSLAATFQPKEVLKCIQIGL  787

Query  342  VCVQEQA  362
            +CVQE+A
Sbjct  788  LCVQERA  794



>ref|XP_002867852.1| At4g21380 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44111.1| At4g21380 [Arabidopsis lyrata subsp. lyrata]
Length=852

 Score =   174 bits (440),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 101/123 (82%), Gaps = 3/123 (2%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  EA+T+KV GTYGYMSPEYAMDG+FS+KSDVFSFGVL+LEI+SG
Sbjct  667  PKISDFGMARIFGRDETEASTRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISG  726

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSP---SEVMRCIQVGLVCVQ  353
            K+N+GFYN +   NLLG  W  W+EG+G E++DP + +S SP    E++RCIQ+GL+CVQ
Sbjct  727  KRNKGFYNSDRDLNLLGCVWRNWKEGKGLEIIDPIITDSSSPFMQHEILRCIQIGLLCVQ  786

Query  354  EQA  362
            E+A
Sbjct  787  ERA  789



>ref|XP_008356167.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290, partial [Malus domestica]
Length=193

 Score =   163 bits (412),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 92/117 (79%), Gaps = 0/117 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFGLAR   GN  +A TKKV GTYGYMSPEYA+DG +S KSDV+SFGVLVLEIVSG
Sbjct  16   PKISDFGLARSFGGNETKAETKKVVGTYGYMSPEYAIDGFYSTKSDVYSFGVLVLEIVSG  75

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQ  353
             +NRGF + N++ NLLGHAW L  EGR  ELLD +V +S +  EV+R I VGL+CVQ
Sbjct  76   XRNRGFSHPNHKLNLLGHAWMLHTEGRPLELLDTSVEDSITLLEVVRTIHVGLLCVQ  132



>gb|KHN36756.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
[Glycine soja]
Length=833

 Score =   173 bits (439),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  E NTK++ GTYGYM+PEYA DGLFSVKSDVFSFGVL+LEI+SG
Sbjct  656  PKISDFGMARIFGVDQQEGNTKRIVGTYGYMAPEYATDGLFSVKSDVFSFGVLLLEIISG  715

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQE  356
            K++RG+YNQN+ QNL+GHAW LW+EGR  EL+D ++ +S S S+++ CI V L+CVQ+
Sbjct  716  KRSRGYYNQNHSQNLIGHAWKLWKEGRPLELIDKSIEDSSSLSQMLHCIHVSLLCVQQ  773



>gb|AID21612.1| ARK3p [Arabidopsis halleri]
Length=846

 Score =   173 bits (439),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 100/123 (81%), Gaps = 3/123 (2%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  EANT+KV GTYGYMSPEYAMDG+FS+KSDVFSFGVL+LE++SG
Sbjct  661  PKISDFGMARIFGRDETEANTRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEVISG  720

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAV---GESFSPSEVMRCIQVGLVCVQ  353
            K+N+GFYN +   NLLG AW  W+EG+G E++DP +     SF   E++RCIQ+GL+CVQ
Sbjct  721  KRNKGFYNSDRDLNLLGCAWRNWKEGKGLEIVDPIIIDSSSSFRQHEILRCIQIGLLCVQ  780

Query  354  EQA  362
            E+A
Sbjct  781  ERA  783



>ref|XP_006594796.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like isoform X1 [Glycine max]
Length=833

 Score =   173 bits (439),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  E NTK++ GTYGYM+PEYA DGLFSVKSDVFSFGVL+LEI+SG
Sbjct  656  PKISDFGMARIFGVDQQEGNTKRIVGTYGYMAPEYATDGLFSVKSDVFSFGVLLLEIISG  715

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQE  356
            K++RG+YNQN+ QNL+GHAW LW+EGR  EL+D ++ +S S S+++ CI V L+CVQ+
Sbjct  716  KRSRGYYNQNHSQNLIGHAWKLWKEGRPLELIDKSIEDSSSLSQMLHCIHVSLLCVQQ  773



>gb|AFP33758.1| SRK [Arabidopsis kamchatica subsp. kamchatica]
 gb|AFP33759.1| SRK [Arabidopsis kamchatica subsp. kamchatica]
 gb|AFP33760.1| SRK [Arabidopsis halleri subsp. gemmifera]
Length=840

 Score =   173 bits (439),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 99/124 (80%), Gaps = 4/124 (3%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  EANT++V GTYGYMSPEYAMDG+FS KSDVFSFGVL+LEI+SG
Sbjct  663  PKISDFGMARIFGRDETEANTRRVVGTYGYMSPEYAMDGIFSTKSDVFSFGVLLLEIISG  722

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES----FSPSEVMRCIQVGLVCV  350
            K+N+GFYN N+  NLL   W  W+EG+G E++DP + +S    F P E++RCIQ+GL+CV
Sbjct  723  KRNKGFYNSNHDLNLLDCVWRNWKEGKGLEVVDPIIKDSSSSTFRPHEILRCIQIGLLCV  782

Query  351  QEQA  362
            QE A
Sbjct  783  QEYA  786



>ref|XP_010042219.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Eucalyptus grandis]
Length=283

 Score =   166 bits (419),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 92/117 (79%), Gaps = 0/117 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFGLA+   GN   ANT +V GTYGYMSPEYA+DG+FS KSDVFS+GVLVLEI+SG
Sbjct  110  PKISDFGLAKSFTGNETRANTNRVVGTYGYMSPEYALDGVFSTKSDVFSYGVLVLEIISG  169

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQ  353
            K+NRGF + ++  NLLGHAW L+ EGR ++LLD  V  S S SE +R I +GL+CVQ
Sbjct  170  KRNRGFRHPDHHHNLLGHAWRLFTEGRSTQLLDKLVENSCSTSEALRSIHIGLLCVQ  226



>gb|ADQ37383.1| unknown [Arabidopsis lyrata]
Length=850

 Score =   173 bits (439),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 100/123 (81%), Gaps = 3/123 (2%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  EANT+KV GTYGYMSPEYAMDG+FS+KSDVFSFGVL+LEI+SG
Sbjct  665  PKISDFGMARIFGRDETEANTRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISG  724

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES---FSPSEVMRCIQVGLVCVQ  353
            K+N+GFYN +   NLLG  W  W+EG+G E++DP + +S   F   E++RCIQ+GL+CVQ
Sbjct  725  KRNKGFYNSDRDLNLLGCVWRNWKEGKGLEIIDPIITDSSSTFRQHEILRCIQIGLLCVQ  784

Query  354  EQA  362
            E+A
Sbjct  785  ERA  787



>gb|KFK28717.1| hypothetical protein AALP_AA7G037900 [Arabis alpina]
Length=848

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 99/124 (80%), Gaps = 4/124 (3%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  EANT+KV GTYGYMSPEYAMDG+FSVKSDVFSFGVL+LEI+SG
Sbjct  664  PKISDFGMARIFGRDETEANTRKVVGTYGYMSPEYAMDGIFSVKSDVFSFGVLLLEIISG  723

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES----FSPSEVMRCIQVGLVCV  350
            K+N GFYN +   NLL   W  W++GRG E++DP + +S    F P EV+RCIQ+GL+CV
Sbjct  724  KRNTGFYNLDRDLNLLACVWRYWKKGRGLEIVDPIIIDSSPSTFRPPEVLRCIQIGLLCV  783

Query  351  QEQA  362
            QE+A
Sbjct  784  QERA  787



>ref|XP_007212497.1| hypothetical protein PRUPE_ppa017572mg [Prunus persica]
 gb|EMJ13696.1| hypothetical protein PRUPE_ppa017572mg [Prunus persica]
Length=815

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   N  EA TK+V GTYGYMSPEYA+DG FSVKSDVFS+GVL+LEIVSG
Sbjct  636  PKISDFGIARIFGRNQTEAKTKRVIGTYGYMSPEYAIDGKFSVKSDVFSYGVLLLEIVSG  695

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQ  353
            +KNRGF++ ++   LLGHAW LW E +G EL+DP +G S+   EV+RCIQVGL+CVQ
Sbjct  696  RKNRGFHHPDHHHTLLGHAWLLWNENKGLELIDPCLGYSYVEFEVLRCIQVGLLCVQ  752



>ref|XP_003559651.2| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Brachypodium distachyon]
Length=699

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +   A+TKK+ GTYGYMSPEYAMDG+FS KSDVFSFGVLVLEIVSG
Sbjct  520  PKISDFGVARIFGTDQTAAHTKKIVGTYGYMSPEYAMDGVFSTKSDVFSFGVLVLEIVSG  579

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            KKNRGFY+     NLL +AW LW+EGR  E LD ++ E+ + +EV+RCIQ+GL+CVQEQ
Sbjct  580  KKNRGFYHSELDLNLLRYAWRLWKEGRNLEFLDQSIAETSNVTEVVRCIQIGLLCVQEQ  638



>gb|KDO74346.1| hypothetical protein CISIN_1g003391mg [Citrus sinensis]
Length=823

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR    +  EANT +V GTYGYM PEYA+DGLFSVKSDVFSFGVLVLEIV G
Sbjct  645  PKISDFGMARAFGIDQTEANTNRVVGTYGYMPPEYAIDGLFSVKSDVFSFGVLVLEIVCG  704

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            K+NRGFY+ ++  NLLGHAW LW E R  EL++ ++G S+S SEV+RCIQVGL+CVQ++
Sbjct  705  KRNRGFYHADHHHNLLGHAWRLWIEERPVELINKSLGGSYSLSEVLRCIQVGLLCVQQR  763



>ref|XP_007021194.1| S-locus lectin protein kinase family protein, putative [Theobroma 
cacao]
 gb|EOY12719.1| S-locus lectin protein kinase family protein, putative [Theobroma 
cacao]
Length=695

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFGLA+   G   EANT KV GTYGYMSPEYA+DG+FS+KSDVFSFGVLVLEIVSG
Sbjct  517  PKISDFGLAKTFWGEQTEANTNKVVGTYGYMSPEYAIDGVFSMKSDVFSFGVLVLEIVSG  576

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            KKNRGF++ ++  NLLGHAW LW + R  EL+D A+ +   PSEV RCI VGL+CVQ++
Sbjct  577  KKNRGFFHPDHDHNLLGHAWRLWTKKRPMELIDDALKDFCLPSEVQRCIHVGLLCVQQR  635



>ref|XP_006370370.1| hypothetical protein POPTR_0001s42050g [Populus trichocarpa]
 gb|ERP66939.1| hypothetical protein POPTR_0001s42050g [Populus trichocarpa]
Length=799

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 95/119 (80%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFGLAR+  G+  EANTK+V GTYGYMSPEYA+DG FSVKSDVFSFGVLVLEIVSG
Sbjct  621  PKISDFGLARMFGGDQTEANTKRVVGTYGYMSPEYALDGHFSVKSDVFSFGVLVLEIVSG  680

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            KKNRGF + +  QNLLGHAW LW  G   EL+D    +S +PSE +RCI V L+CVQ++
Sbjct  681  KKNRGFCHPDYNQNLLGHAWMLWFNGIPLELIDECFADSCTPSEALRCIHVALLCVQQR  739



>ref|XP_009133539.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-6 
[Brassica rapa]
Length=842

 Score =   173 bits (439),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 79/124 (64%), Positives = 99/124 (80%), Gaps = 4/124 (3%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  EANT+KV GTYGYMSPEYAMDG+FS+KSDVFSFGVL+LEI+SG
Sbjct  657  PKISDFGMARIFGRDDAEANTRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISG  716

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPS----EVMRCIQVGLVCV  350
            KKN GFYN N+  NLL   W  W+EG+  E+LDP + +S S +    E++RCIQ+GL+CV
Sbjct  717  KKNNGFYNSNHDLNLLAFVWRKWKEGKWLEILDPIIIDSSSSTCQAHEILRCIQIGLLCV  776

Query  351  QEQA  362
            QE+A
Sbjct  777  QERA  780



>emb|CDY35375.1| BnaA03g19850D [Brassica napus]
Length=842

 Score =   173 bits (438),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 79/124 (64%), Positives = 99/124 (80%), Gaps = 4/124 (3%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  EANT+KV GTYGYMSPEYAMDG+FS+KSDVFSFGVL+LEI+SG
Sbjct  657  PKISDFGMARIFGRDDAEANTRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISG  716

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPS----EVMRCIQVGLVCV  350
            KKN GFYN N+  NLL   W  W+EG+  E+LDP + +S S +    E++RCIQ+GL+CV
Sbjct  717  KKNNGFYNSNHDLNLLAFVWRKWKEGKWLEILDPIIIDSSSSTCQAHEILRCIQIGLLCV  776

Query  351  QEQA  362
            QE+A
Sbjct  777  QERA  780



>gb|AFU83020.1| SRK protein, partial [Brassica oleracea var. italica]
Length=234

 Score =   164 bits (414),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 95/127 (75%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  +A T    GTYGYMSPEYAMDG+ S K+DVFSFGV+VLEIVSG
Sbjct  44   PKISDFGMARIFARDETQARTDNAVGTYGYMSPEYAMDGVISEKTDVFSFGVIVLEIVSG  103

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGE-------SFSPSEVMRCIQVGL  341
            K+NRGFY  N + NLL +AW  W EGR  E++DP + +       +F P EV++CIQ+GL
Sbjct  104  KRNRGFYQVNPENNLLSYAWSHWAEGRALEIVDPVIVDPLASLPSTFQPKEVLKCIQIGL  163

Query  342  VCVQEQA  362
            +C+QE+A
Sbjct  164  LCIQERA  170



>ref|XP_007021201.1| S-locus lectin protein kinase family protein, putative [Theobroma 
cacao]
 gb|EOY12726.1| S-locus lectin protein kinase family protein, putative [Theobroma 
cacao]
Length=823

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFGLAR   G   EA T ++ GTYGYMSPEYA+DG+FS+KSDVFSFGVLVLEIVSG
Sbjct  645  PKISDFGLARTFWGEQTEAKTNRLVGTYGYMSPEYAIDGVFSMKSDVFSFGVLVLEIVSG  704

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            KKNRGF + +++ NLLGHAW LW E R  EL+D A+G+   PSEV+RCI VGL+CVQ++
Sbjct  705  KKNRGFSHPDHEHNLLGHAWRLWTEKRPMELIDDALGDFRLPSEVLRCIHVGLLCVQQR  763



>ref|XP_010910454.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
isoform X2 [Elaeis guineensis]
Length=824

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  E NT++V GTYGYMSPEYAMDG+FSVKSDVFSFGVLVLEI+SG
Sbjct  645  PKISDFGMARIFGGDETEVNTRRVVGTYGYMSPEYAMDGVFSVKSDVFSFGVLVLEIISG  704

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            KKNRG Y  ++  NLL HAW LW E +  +L+D ++G SF  +EV++CI+VGL+CVQE+
Sbjct  705  KKNRGVYAHSSHLNLLAHAWSLWNEEKSLQLVDESLGYSFPANEVIKCIKVGLLCVQER  763



>ref|XP_006284976.1| hypothetical protein CARUB_v10006283mg [Capsella rubella]
 gb|EOA17874.1| hypothetical protein CARUB_v10006283mg [Capsella rubella]
Length=824

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 99/124 (80%), Gaps = 4/124 (3%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  EANT+KV GTYGYMSPEYAMDG+FS+KSDVFSFGVL+LEI+SG
Sbjct  638  PKISDFGMARIFGRDETEANTRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISG  697

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES----FSPSEVMRCIQVGLVCV  350
            ++N+GFYN +   NLLG  W  W EG+G E++DP + +S    F P E++RCIQ+GL+CV
Sbjct  698  RRNKGFYNSHRDLNLLGCVWRHWEEGKGLEIVDPIIIDSSSSTFQPQEILRCIQIGLLCV  757

Query  351  QEQA  362
            QE A
Sbjct  758  QEGA  761



>ref|XP_010910453.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
isoform X1 [Elaeis guineensis]
Length=825

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  E NT++V GTYGYMSPEYAMDG+FSVKSDVFSFGVLVLEI+SG
Sbjct  646  PKISDFGMARIFGGDETEVNTRRVVGTYGYMSPEYAMDGVFSVKSDVFSFGVLVLEIISG  705

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            KKNRG Y  ++  NLL HAW LW E +  +L+D ++G SF  +EV++CI+VGL+CVQE+
Sbjct  706  KKNRGVYAHSSHLNLLAHAWSLWNEEKSLQLVDESLGYSFPANEVIKCIKVGLLCVQER  764



>ref|XP_007149663.1| hypothetical protein PHAVU_005G088800g [Phaseolus vulgaris]
 gb|ESW21657.1| hypothetical protein PHAVU_005G088800g [Phaseolus vulgaris]
Length=736

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+  G+  E NT+++ GTYGYM+PEYA DGLFSVKSDVFSFGVL++EI+SG
Sbjct  559  PKISDFGMARIFGGDQKEGNTRRIVGTYGYMAPEYATDGLFSVKSDVFSFGVLLMEIISG  618

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQE  356
            K++RG+YNQN+ QNL+GHAW LW++GR  EL+D ++  S   S+++ CI V L+CVQ+
Sbjct  619  KRSRGYYNQNHSQNLIGHAWDLWKKGRPLELVDKSIENSLFQSQILHCIHVSLLCVQQ  676



>ref|XP_006452075.1| hypothetical protein CICLE_v10007466mg [Citrus clementina]
 gb|ESR65315.1| hypothetical protein CICLE_v10007466mg [Citrus clementina]
Length=822

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR    +  EANT +V GTYGYM PEYA+DGLFSVKSDVFSFGVLVLEIV G
Sbjct  644  PKISDFGMARAFGIDQTEANTNRVVGTYGYMPPEYAIDGLFSVKSDVFSFGVLVLEIVCG  703

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            K+NRGFY+ ++  NLLGHAW LW E R  EL++ ++G S+S SEV+RCIQVGL+CVQ++
Sbjct  704  KRNRGFYHADHHHNLLGHAWRLWIEERPVELINKSLGGSYSLSEVLRCIQVGLLCVQQR  762



>ref|XP_008383964.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11410 [Malus domestica]
Length=844

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+      EANT +V GTYGYMSPEYAM+GLFSVKSDV+SFGVL+LEIVSG
Sbjct  665  PKISDFGMARIFGAEQIEANTNRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSG  724

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            +KN G+Y+ N   NL+GH W LW+E    E++D ++GES+  SEV+RCIQ+ L+CVQE A
Sbjct  725  RKNTGYYHDNPDSNLVGHVWDLWKESSALEIIDSSLGESYPVSEVLRCIQIALLCVQEHA  784



>ref|XP_003636663.1| Cysteine-rich receptor-like protein kinase, partial [Medicago 
truncatula]
Length=279

 Score =   165 bits (417),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+      +ANT ++ GTYGYMSPEYAM+G+FS KSDV+SFGVL+LEI++G
Sbjct  88   PKISDFGVARMFTRQETKANTNRIVGTYGYMSPEYAMEGVFSTKSDVYSFGVLLLEIING  147

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            +KN  FY ++   NL+GHAW LW+EG   EL+DP + ESFS  EV+RC+  GL+CV+E A
Sbjct  148  EKNNSFYCEDRPLNLVGHAWELWKEGVVLELVDPLLNESFSEDEVLRCVHAGLLCVEENA  207



>gb|AID21587.1| ARK3p [Arabidopsis halleri]
Length=851

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 100/123 (81%), Gaps = 3/123 (2%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  EA+T+KV GTYGYMSPEYAMDG+FS+KSDVFSFGVL+LEI+SG
Sbjct  666  PKISDFGMARIFGRDETEASTRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISG  725

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES---FSPSEVMRCIQVGLVCVQ  353
            K+N+GFYN +   NLLG  W  W+EG+G E++DP + ES   F   E++RCIQ+GL+CVQ
Sbjct  726  KRNKGFYNSDRDLNLLGCVWRNWKEGKGLEIIDPIITESSSTFRQHEILRCIQIGLLCVQ  785

Query  354  EQA  362
            E+A
Sbjct  786  ERA  788



>ref|XP_006582722.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1-like [Glycine max]
Length=453

 Score =   169 bits (428),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFGLARL  G+  EANT +VAGTYGY+ PEYA  G FSVKSDV+S+GV++LEIVSG
Sbjct  274  PKISDFGLARLFLGDQVEANTNRVAGTYGYIPPEYAARGHFSVKSDVYSYGVIILEIVSG  333

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQ  359
            KKNR F +  +  NLLGHAW LW E R  ELLD  +GE   P+EV+RCIQVGL+CVQ++
Sbjct  334  KKNREFSDPEHYNNLLGHAWRLWSEERALELLDEVLGEQCEPAEVIRCIQVGLLCVQQR  392



>emb|CCI61483.1| ARK3 [Arabidopsis halleri]
 gb|AID21598.1| ARK3p [Arabidopsis halleri]
Length=851

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 100/123 (81%), Gaps = 3/123 (2%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  EA+T+KV GTYGYMSPEYAMDG+FS+KSDVFSFGVL+LEI+SG
Sbjct  666  PKISDFGMARIFGRDETEASTRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISG  725

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES---FSPSEVMRCIQVGLVCVQ  353
            K+N+GFYN +   NLLG  W  W+EG+G E++DP + ES   F   E++RCIQ+GL+CVQ
Sbjct  726  KRNKGFYNSDRDLNLLGCVWRNWKEGKGLEIIDPIITESSSTFRQHEILRCIQIGLLCVQ  785

Query  354  EQA  362
            E+A
Sbjct  786  ERA  788



>gb|KCW67078.1| hypothetical protein EUGRSUZ_F00850 [Eucalyptus grandis]
Length=343

 Score =   167 bits (422),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFGLAR+  GN  EA+T+++ GTYGYMSPEYA DG FSVKSDVFS GV++LEIVSG
Sbjct  169  PKISDFGLARIFGGNEREASTRRIIGTYGYMSPEYAFDGKFSVKSDVFSLGVVLLEIVSG  228

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQE  356
            KKNRGF + ++Q NLLGHAW LW   R  ELL  ++ +SF  S+V RCI VGL+CVQ+
Sbjct  229  KKNRGFCHPDHQHNLLGHAWLLWSVSRSLELLHESLCDSFIASQVERCIHVGLLCVQK  286



>gb|AID21647.1| ARK3p [Arabidopsis lyrata]
Length=851

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 100/123 (81%), Gaps = 3/123 (2%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  EA+T+KV GTYGYMSPEYAMDG+FS+KSDVFSFGVL+LEI+SG
Sbjct  666  PKISDFGMARIFGRDETEASTRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISG  725

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES---FSPSEVMRCIQVGLVCVQ  353
            K+N+GFYN +   NLLG  W  W+EG+G E++DP + ES   F   E++RCIQ+GL+CVQ
Sbjct  726  KRNKGFYNSDRDLNLLGCVWRNWKEGKGLEIIDPIITESSSTFRQHEILRCIQIGLLCVQ  785

Query  354  EQA  362
            E+A
Sbjct  786  ERA  788



>ref|XP_008226734.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1 isoform X3 [Prunus mume]
Length=1583

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   N  EA TK+V GTYGYMSPEYA+DG FSVKSDVFSFGVL+LEIVSG
Sbjct  639  PKISDFGIARIFGRNQTEAKTKRVIGTYGYMSPEYAIDGKFSVKSDVFSFGVLLLEIVSG  698

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQ  353
            +KNRGF++ N+  +LLGHAW LW E +G EL+DP +G S+   EV+RCIQVGL+CVQ
Sbjct  699  RKNRGFHHPNHHHSLLGHAWLLWNEVKGLELIDPCLGYSYIEFEVLRCIQVGLLCVQ  755


 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = +3

Query  3     PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
             PKISDFG+AR+   N  EA TK+V GTYGYMSPEYA+DG FS KSDVFSFGVL+LEIVSG
Sbjct  1404  PKISDFGIARIFGRNQTEAKTKRVIGTYGYMSPEYAIDGKFSEKSDVFSFGVLLLEIVSG  1463

Query  183   KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQ  353
             +KNRGF++ ++  +LLGHAW LW E +G EL+DP +G S+   EV+RCIQVGL+CVQ
Sbjct  1464  RKNRGFHHPDHHHSLLGHAWLLWNENKGLELIDPCLGYSYVEFEVLRCIQVGLLCVQ  1520



>gb|AID21690.1| ARK3p [Arabidopsis lyrata]
Length=852

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 100/123 (81%), Gaps = 3/123 (2%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  EA+T+KV GTYGYMSPEYAMDG+FS+KSDVFSFGVL+LEI+SG
Sbjct  667  PKISDFGMARIFGRDETEASTRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISG  726

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES---FSPSEVMRCIQVGLVCVQ  353
            K+N+GFYN +   NLLG  W  W+EG+G E++DP + ES   F   E++RCIQ+GL+CVQ
Sbjct  727  KRNKGFYNSDRDLNLLGCVWRNWKEGKGLEIIDPIITESSSTFRQHEILRCIQIGLLCVQ  786

Query  354  EQA  362
            E+A
Sbjct  787  ERA  789



>ref|XP_009105170.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like serine/threonine-protein 
kinase SD1-7 [Brassica rapa]
Length=845

 Score =   172 bits (437),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 77/125 (62%), Positives = 97/125 (78%), Gaps = 5/125 (4%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+      EANT+KV GTYGYMSPEYAMDG+FS+KSDVFSFG+L+LEI+SG
Sbjct  659  PKISDFGMARIFGREETEANTRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGILLLEIISG  718

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPS-----EVMRCIQVGLVC  347
            KK  GFYN N   NLLG  W  W+EG+G E++DP + +  S +     E++RCIQ+GL+C
Sbjct  719  KKTNGFYNSNRDLNLLGFVWRYWKEGKGIEIVDPIIIDDSSSAVLRTHEILRCIQIGLLC  778

Query  348  VQEQA  362
            VQE+A
Sbjct  779  VQERA  783



>gb|ADQ37352.1| unknown [Arabidopsis lyrata]
Length=852

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 100/123 (81%), Gaps = 3/123 (2%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  EA+T+KV GTYGYMSPEYAMDG+FS+KSDVFSFGVL+LEI+SG
Sbjct  667  PKISDFGMARIFGRDETEASTRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISG  726

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES---FSPSEVMRCIQVGLVCVQ  353
            K+N+GFYN +   NLLG  W  W+EG+G E++DP + ES   F   E++RCIQ+GL+CVQ
Sbjct  727  KRNKGFYNSDRDLNLLGCVWRNWKEGKGIEIIDPIITESSSTFKQHEILRCIQIGLLCVQ  786

Query  354  EQA  362
            E+A
Sbjct  787  ERA  789



>gb|AFP33761.1| SRK, partial [Arabidopsis kamchatica subsp. kamchatica]
 gb|AFP33762.1| SRK, partial [Arabidopsis kamchatica subsp. kamchatica]
 gb|AFP33763.1| SRK, partial [Arabidopsis kamchatica subsp. kamchatica]
 gb|AFP33764.1| SRK, partial [Arabidopsis halleri subsp. gemmifera]
Length=857

 Score =   173 bits (438),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 79/128 (62%), Positives = 98/128 (77%), Gaps = 8/128 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+   +  EANT+KV GTYGYMSPEYAMDG+FS+KSDVFSFGVL+LEI+SG
Sbjct  667  PKISDFGMARIFGRDETEANTRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISG  726

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES--------FSPSEVMRCIQVG  338
            K+N+GFYN N   NLLG AW  W++G   E++DP + +S        F P EV+RCI +G
Sbjct  727  KRNKGFYNSNRDLNLLGCAWRNWKDGNRLEIVDPIIMDSSPSFASTTFRPDEVLRCIHIG  786

Query  339  LVCVQEQA  362
            L+CVQE A
Sbjct  787  LLCVQEHA  794



>dbj|BAF91393.1| S-locus receptor kinase (kinase domain) [Brassica rapa]
Length=425

 Score =   168 bits (426),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 98/127 (77%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  EA+T KV GTYGYMSPEYAM G+FS KSDVFSFGV+VLEIVSG
Sbjct  234  PKISDFGMARIFARDEIEASTMKVVGTYGYMSPEYAMQGIFSEKSDVFSFGVIVLEIVSG  293

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGES-------FSPSEVMRCIQVGL  341
            KKNR FYN N + +LL +AW  W+EGR  E++DP + +S       F   EV++CIQ+GL
Sbjct  294  KKNREFYNLNCENDLLSYAWSHWKEGRALEIVDPVIVDSLPSLPSTFQQQEVLKCIQIGL  353

Query  342  VCVQEQA  362
            +CVQE+A
Sbjct  354  LCVQERA  360



>dbj|BAF91404.1| S-locus receptor kinase (kinase domain) [Brassica oleracea]
Length=428

 Score =   168 bits (426),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 97/127 (76%), Gaps = 7/127 (6%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFG+AR+ A +  EANT+KV GTYGYMSPEYAM G FS KSDVFSFGV+VLEIV+G
Sbjct  238  PKISDFGMARIFARDETEANTRKVVGTYGYMSPEYAMYGKFSEKSDVFSFGVIVLEIVTG  297

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFS-------PSEVMRCIQVGL  341
            KKNRG +N N + NLL + W  W+EGR  E++DP + +S S       P EV+RCIQ+GL
Sbjct  298  KKNRGVHNLNYENNLLSYVWSNWKEGRALEIVDPVIIDSLSPQSSTLQPQEVLRCIQIGL  357

Query  342  VCVQEQA  362
            +CVQE A
Sbjct  358  LCVQELA  364



>ref|XP_008226123.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 [Prunus mume]
Length=809

 Score =   172 bits (436),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 74/120 (62%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = +3

Query  3    PKISDFGLARLVAGNTYEANTKKVAGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVSG  182
            PKISDFGLAR+   N  EANT KV GTYGYMSPEYAM+G+FS+KSDV+SFGVL+LEI+SG
Sbjct  630  PKISDFGLARIFTHNELEANTNKVVGTYGYMSPEYAMEGIFSIKSDVYSFGVLMLEIISG  689

Query  183  KKNRGFYNQNNQQNLLGHAWGLWREGRGSELLDPAVGESFSPSEVMRCIQVGLVCVQEQA  362
            ++N  FYN +   N++G+AW LW+EGRG EL+DP + +S +  +++RC  VGL+CV+E A
Sbjct  690  RRNSSFYNADRVLNIVGYAWELWKEGRGLELMDPTLKDSCTEDQLLRCFHVGLLCVEENA  749



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 516420797772