BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24135_g1_i1 len=187 path=[3853:0-186]

Length=187
                                                                      Score     E

gb|AAC23542.1|  receptor protein kinase                                 133   4e-34   Ipomoea trifida
emb|CDO99671.1|  unnamed protein product                                124   4e-32   
ref|XP_010924049.1|  PREDICTED: receptor-like serine/threonine-pr...    127   5e-32   
ref|XP_009616770.1|  PREDICTED: receptor-like serine/threonine-pr...    127   6e-32   
ref|XP_009773537.1|  PREDICTED: receptor-like serine/threonine-pr...    126   7e-32   
gb|EYU27869.1|  hypothetical protein MIMGU_mgv1a017829mg                125   9e-32   
ref|XP_009397155.1|  PREDICTED: receptor-like serine/threonine-pr...    125   1e-31   
ref|XP_008777139.1|  PREDICTED: receptor-like serine/threonine-pr...    125   2e-31   
ref|XP_011096222.1|  PREDICTED: uncharacterized protein LOC105175473    126   2e-31   
ref|XP_010910455.1|  PREDICTED: receptor-like serine/threonine-pr...    124   2e-31   
ref|XP_010910454.1|  PREDICTED: receptor-like serine/threonine-pr...    124   4e-31   
ref|XP_010910453.1|  PREDICTED: receptor-like serine/threonine-pr...    124   4e-31   
ref|XP_008789837.1|  PREDICTED: receptor-like serine/threonine-pr...    124   6e-31   
ref|XP_007025869.1|  Receptor kinase 3                                  123   8e-31   
ref|XP_008775529.1|  PREDICTED: receptor-like serine/threonine-pr...    123   1e-30   
gb|KDO75658.1|  hypothetical protein CISIN_1g0029692mg                  120   1e-30   
ref|XP_010317517.1|  PREDICTED: uncharacterized protein LOC101252749    123   2e-30   
ref|XP_010538687.1|  PREDICTED: receptor-like serine/threonine-pr...    122   2e-30   
ref|XP_010538685.1|  PREDICTED: receptor-like serine/threonine-pr...    122   2e-30   
ref|XP_006449173.1|  hypothetical protein CICLE_v100142551mg            122   2e-30   
ref|XP_009612738.1|  PREDICTED: receptor-like serine/threonine-pr...    122   3e-30   
ref|XP_009768621.1|  PREDICTED: receptor-like serine/threonine-pr...    122   4e-30   
ref|XP_006343406.1|  PREDICTED: receptor-like serine/threonine-pr...    122   4e-30   
ref|XP_010240988.1|  PREDICTED: receptor-like serine/threonine-pr...    121   4e-30   
gb|KDP20852.1|  hypothetical protein JCGZ_21323                         121   4e-30   
ref|XP_010316637.1|  PREDICTED: receptor-like serine/threonine-pr...    121   5e-30   
emb|CBI25711.3|  unnamed protein product                                119   7e-30   
gb|KHN45740.1|  Receptor-like serine/threonine-protein kinase SD1-8     120   7e-30   
ref|XP_011003370.1|  PREDICTED: receptor-like serine/threonine-pr...    115   9e-30   
ref|XP_010646880.1|  PREDICTED: receptor-like serine/threonine-pr...    120   1e-29   
ref|XP_009398188.1|  PREDICTED: receptor-like serine/threonine-pr...    115   1e-29   
ref|XP_010928033.1|  PREDICTED: receptor-like serine/threonine-pr...    120   2e-29   
ref|XP_009398951.1|  PREDICTED: receptor-like serine/threonine-pr...    119   2e-29   
ref|XP_009397154.1|  PREDICTED: receptor-like serine/threonine-pr...    119   2e-29   
gb|ACN52053.1|  SRK protein                                             112   2e-29   Brassica cretica
gb|ACN52052.1|  SRK protein                                             114   2e-29   Brassica cretica
gb|KCW67068.1|  hypothetical protein EUGRSUZ_F008421                    115   2e-29   
gb|AFU83022.1|  SRK protein                                             114   2e-29   
gb|ACN52050.1|  SRK protein                                             112   2e-29   Brassica cretica
ref|XP_009408780.1|  PREDICTED: receptor-like serine/threonine-pr...    120   2e-29   
ref|XP_009402882.1|  PREDICTED: receptor-like serine/threonine-pr...    119   2e-29   
ref|XP_009402881.1|  PREDICTED: receptor-like serine/threonine-pr...    119   2e-29   
gb|ACN52046.1|  SRK protein                                             112   2e-29   Brassica cretica
gb|ACN52045.1|  SRK protein                                             113   2e-29   Brassica cretica
ref|XP_010924052.1|  PREDICTED: receptor-like serine/threonine-pr...    119   2e-29   
gb|ACN52047.1|  SRK protein                                             114   2e-29   Brassica cretica
gb|ACN52055.1|  SRK protein                                             112   2e-29   Brassica cretica
gb|AAS94086.1|  S-locus receptor kinase                                 115   3e-29   Raphanus sativus
ref|XP_004504969.1|  PREDICTED: uncharacterized protein LOC101504189    120   3e-29   
gb|ACN52043.1|  SRK protein                                             112   3e-29   Brassica cretica
gb|ACN52044.1|  SRK protein                                             112   3e-29   Brassica cretica
gb|ACN52051.1|  SRK protein                                             114   3e-29   Brassica cretica
gb|KDP38994.1|  hypothetical protein JCGZ_00751                         118   3e-29   
gb|ACN52048.1|  SRK protein                                             112   4e-29   Brassica cretica
gb|ACN52056.1|  SRK protein                                             114   4e-29   Brassica cretica
ref|XP_010064357.1|  PREDICTED: receptor-like serine/threonine-pr...    118   4e-29   
gb|ACN52049.1|  SRK protein                                             112   5e-29   Brassica cretica
gb|ABY55236.1|  S-locus receptor kinase                                 113   5e-29   Diplotaxis muralis [annual wallrocket]
ref|XP_007159231.1|  hypothetical protein PHAVU_002G220200g             118   5e-29   
ref|XP_011011561.1|  PREDICTED: receptor-like serine/threonine-pr...    118   6e-29   
ref|XP_010268934.1|  PREDICTED: receptor-like serine/threonine-pr...    118   6e-29   
ref|XP_010060465.1|  PREDICTED: G-type lectin S-receptor-like ser...    118   6e-29   
gb|AFU83019.1|  SRK protein                                             113   6e-29   
ref|XP_007214693.1|  hypothetical protein PRUPE_ppa024127mg             116   6e-29   
gb|KCW67236.1|  hypothetical protein EUGRSUZ_F01024                     118   6e-29   
gb|KDO74363.1|  hypothetical protein CISIN_1g0467031mg                  112   7e-29   
ref|XP_008355368.1|  PREDICTED: G-type lectin S-receptor-like ser...    114   8e-29   
gb|KDO74291.1|  hypothetical protein CISIN_1g0453151mg                  112   8e-29   
ref|XP_008345021.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    115   9e-29   
ref|XP_009398952.1|  PREDICTED: receptor-like serine/threonine-pr...    117   9e-29   
ref|XP_006370370.1|  hypothetical protein POPTR_0001s42050g             117   1e-28   
gb|ACN52015.1|  SRK protein                                             112   1e-28   Brassica cretica
ref|XP_008363599.1|  PREDICTED: G-type lectin S-receptor-like ser...    114   1e-28   
gb|AGC54823.1|  S-locus receptor kinase 13-15                           117   1e-28   
emb|CAA73133.1|  serine /threonine kinase                               117   1e-28   Brassica oleracea
dbj|BAB40987.1|  SRKb                                                   117   1e-28   Arabidopsis lyrata [lyrate rockcress]
gb|ADQ37372.1|  unknown                                                 117   1e-28   
emb|CAA67145.1|  receptor-like kinase                                   117   1e-28   Brassica oleracea
gb|KDP30509.1|  hypothetical protein JCGZ_16689                         117   1e-28   
dbj|BAB69683.1|  receptor kinase 5                                      117   1e-28   Brassica rapa
emb|CDX79055.1|  BnaA01g11220D                                          117   1e-28   
ref|XP_002518601.1|  S-locus-specific glycoprotein S6 precursor, ...    117   1e-28   Ricinus communis
ref|XP_009408779.1|  PREDICTED: receptor-like serine/threonine-pr...    117   1e-28   
emb|CDY39264.1|  BnaC06g27270D                                          112   1e-28   
gb|KDP34761.1|  hypothetical protein JCGZ_10541                         117   1e-28   
ref|XP_003608281.1|  Serine/threonine protein kinase                    117   1e-28   
ref|XP_007021380.1|  S-locus lectin protein kinase family protein       117   1e-28   
ref|XP_008226752.1|  PREDICTED: G-type lectin S-receptor-like ser...    116   2e-28   
ref|XP_010268959.1|  PREDICTED: G-type lectin S-receptor-like ser...    117   2e-28   
gb|ABY55235.1|  S-locus receptor kinase                                 112   2e-28   Diplotaxis tenuifolia
ref|XP_008226748.1|  PREDICTED: G-type lectin S-receptor-like ser...    116   2e-28   
gb|ACN52028.1|  SRK protein                                             111   2e-28   Brassica cretica
ref|XP_008355367.1|  PREDICTED: G-type lectin S-receptor-like ser...    114   2e-28   
ref|XP_008363596.1|  PREDICTED: G-type lectin S-receptor-like ser...    115   2e-28   
ref|XP_002317551.2|  hypothetical protein POPTR_0011s13260g             117   2e-28   Populus trichocarpa [western balsam poplar]
ref|XP_010646879.1|  PREDICTED: G-type lectin S-receptor-like ser...    117   2e-28   
emb|CBI33185.3|  unnamed protein product                                115   2e-28   
ref|XP_006391514.1|  hypothetical protein EUTSA_v10018117mg             117   2e-28   
dbj|BAF91390.1|  S-locus receptor kinase                                114   2e-28   Brassica rapa
ref|XP_002304966.1|  Brassica self-incompatibility locus family p...    116   2e-28   Populus trichocarpa [western balsam poplar]
ref|XP_008355366.1|  PREDICTED: G-type lectin S-receptor-like ser...    115   2e-28   
ref|XP_009398189.1|  PREDICTED: receptor-like serine/threonine-pr...    116   2e-28   
ref|XP_004159218.1|  PREDICTED: G-type lectin S-receptor-like ser...    117   2e-28   
ref|XP_010052484.1|  PREDICTED: receptor-like serine/threonine-pr...    116   2e-28   
gb|AFU83023.1|  SRK protein                                             111   2e-28   
ref|XP_006370567.1|  hypothetical protein POPTR_0001s438602g            111   2e-28   
gb|AFU83021.1|  SRK protein                                             111   2e-28   
dbj|BAF91392.1|  S-locus receptor kinase (kinase domain)                114   2e-28   Brassica rapa
gb|ACN52029.1|  SRK protein                                             111   2e-28   Brassica cretica
ref|XP_006449083.1|  hypothetical protein CICLE_v10016609mg             111   2e-28   
ref|XP_008364109.1|  PREDICTED: receptor-like serine/threonine-pr...    116   2e-28   
ref|XP_004144482.1|  PREDICTED: G-type lectin S-receptor-like ser...    117   2e-28   
ref|XP_009134691.1|  PREDICTED: receptor-like serine/threonine-pr...    116   3e-28   
ref|XP_006452097.1|  hypothetical protein CICLE_v10010721mg             112   3e-28   
gb|ABN05291.1|  ARK3 protein                                            116   3e-28   Arabidopsis thaliana [mouse-ear cress]
gb|KCW76538.1|  hypothetical protein EUGRSUZ_D00925                     116   3e-28   
ref|XP_007021379.1|  S-locus lectin protein kinase family protein       116   3e-28   
ref|XP_008455381.1|  PREDICTED: G-type lectin S-receptor-like ser...    116   3e-28   
gb|ACN52030.1|  SRK protein                                             110   3e-28   Brassica cretica
emb|CDY07074.1|  BnaA04g22410D                                          108   3e-28   
ref|XP_008813304.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    117   3e-28   
gb|ACN52031.1|  SRK protein                                             110   3e-28   Brassica cretica
ref|XP_010054468.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    116   3e-28   
emb|CDY39269.1|  BnaC06g27220D                                          114   3e-28   
ref|XP_007025879.1|  S-locus lectin protein kinase family protein...    116   3e-28   
gb|KDP38993.1|  hypothetical protein JCGZ_00750                         114   3e-28   
emb|CDY62911.1|  BnaC01g41140D                                          115   3e-28   
ref|XP_008455380.1|  PREDICTED: G-type lectin S-receptor-like ser...    116   3e-28   
gb|EEC71606.1|  hypothetical protein OsI_04006                          111   3e-28   Oryza sativa Indica Group [Indian rice]
gb|KCW72107.1|  hypothetical protein EUGRSUZ_E00547                     116   3e-28   
gb|KCW72108.1|  hypothetical protein EUGRSUZ_E00547                     116   4e-28   
ref|XP_010924050.1|  PREDICTED: receptor-like serine/threonine-pr...    116   4e-28   
ref|XP_008227125.1|  PREDICTED: receptor-like serine/threonine-pr...    116   4e-28   
gb|EPS70219.1|  hypothetical protein M569_04543                         115   4e-28   
ref|XP_006377788.1|  hypothetical protein POPTR_0011s12840g             115   4e-28   
gb|AFP33761.1|  SRK                                                     116   4e-28   
gb|KFK28717.1|  hypothetical protein AALP_AA7G037900                    116   4e-28   
gb|AGC55017.1|  S-receptor kinase                                       115   4e-28   
ref|XP_006391517.1|  hypothetical protein EUTSA_v10018116mg             115   4e-28   
gb|KDP20850.1|  hypothetical protein JCGZ_21321                         113   4e-28   
ref|XP_009611412.1|  PREDICTED: G-type lectin S-receptor-like ser...    115   4e-28   
ref|XP_009377332.1|  PREDICTED: uncharacterized protein LOC103965953    116   4e-28   
dbj|BAE93137.1|  S-receptor kinase                                      115   4e-28   Brassica rapa
gb|ACN52016.1|  SRK protein                                             110   4e-28   Brassica cretica
ref|XP_009411995.1|  PREDICTED: G-type lectin S-receptor-like ser...    115   4e-28   
gb|ACO83273.1|  SRK                                                     115   4e-28   Capsella rubella
ref|XP_006388693.1|  hypothetical protein POPTR_0118s002202g            110   4e-28   
dbj|BAF91409.1|  S-locus receptor kinase (kinase domain)                113   4e-28   Brassica oleracea
emb|CAB41878.1|  SRK5 protein                                           115   4e-28   Brassica oleracea
ref|XP_010907385.1|  PREDICTED: G-type lectin S-receptor-like ser...    115   4e-28   
ref|XP_002316940.2|  hypothetical protein POPTR_0011s13040g             115   4e-28   Populus trichocarpa [western balsam poplar]
ref|NP_193869.1|  receptor kinase 3                                     115   4e-28   Arabidopsis thaliana [mouse-ear cress]
gb|AAB33487.1|  ARK3 product/receptor-like serine/threonine prote...    115   4e-28   
ref|XP_006388050.1|  hypothetical protein POPTR_0379s00200g             114   5e-28   
gb|AID21612.1|  ARK3p                                                   115   5e-28   
gb|ABV21214.1|  At4g21380                                               115   5e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008446571.1|  PREDICTED: uncharacterized protein LOC103489262    116   5e-28   
ref|XP_004295386.1|  PREDICTED: uncharacterized protein LOC101313198    116   5e-28   
ref|XP_011029382.1|  PREDICTED: G-type lectin S-receptor-like ser...    115   5e-28   
dbj|BAF91404.1|  S-locus receptor kinase (kinase domain)                113   5e-28   Brassica oleracea
ref|XP_007021377.1|  S-locus lectin protein kinase family protein...    115   5e-28   
gb|ADQ37383.1|  unknown                                                 115   5e-28   
dbj|BAA31252.1|  SRK29                                                  115   5e-28   Brassica rapa
ref|XP_006594644.1|  PREDICTED: G-type lectin S-receptor-like ser...    115   5e-28   
dbj|BAA83746.1|  SRK2-b                                                 115   5e-28   Brassica oleracea
emb|CDY52920.1|  BnaA04g29270D                                          110   5e-28   
ref|XP_009385294.1|  PREDICTED: G-type lectin S-receptor-like ser...    115   5e-28   
ref|XP_003541760.1|  PREDICTED: G-type lectin S-receptor-like ser...    115   6e-28   
gb|KDP20856.1|  hypothetical protein JCGZ_21327                         115   6e-28   
ref|XP_007021378.1|  S-locus lectin protein kinase family protein...    115   6e-28   
gb|KDP34760.1|  hypothetical protein JCGZ_10540                         114   6e-28   
ref|XP_007021381.1|  S-locus lectin protein kinase family protein       116   6e-28   
gb|AFW84882.1|  putative S-locus receptor-like protein kinase fam...    111   6e-28   
ref|XP_010247456.1|  PREDICTED: G-type lectin S-receptor-like ser...    115   6e-28   
ref|XP_007022738.1|  S-locus lectin protein kinase family protein       112   6e-28   
ref|XP_009345819.1|  PREDICTED: receptor-like serine/threonine-pr...    115   6e-28   
gb|KHN19079.1|  G-type lectin S-receptor-like serine/threonine-pr...    114   6e-28   
ref|XP_009105220.1|  PREDICTED: receptor-like serine/threonine-pr...    115   6e-28   
dbj|BAE93138.1|  S-receptor kinase                                      115   6e-28   Brassica rapa
gb|EYU33574.1|  hypothetical protein MIMGU_mgv1a0256212mg               114   6e-28   
ref|XP_006370566.1|  hypothetical protein POPTR_0001s43850g             115   6e-28   
dbj|BAF91388.1|  S-locus receptor kinase (kinase domain)                112   6e-28   Brassica rapa
ref|XP_009611413.1|  PREDICTED: G-type lectin S-receptor-like ser...    115   6e-28   
gb|AGN12871.1|  putative receptor kinase 3                              115   6e-28   
ref|XP_009388065.1|  PREDICTED: putative G-type lectin S-receptor...    114   6e-28   
ref|XP_006370573.1|  hypothetical protein POPTR_0001s43900g             113   7e-28   
gb|AFP33758.1|  SRK                                                     115   7e-28   
gb|AFN53707.1|  hypothetical protein                                    115   7e-28   
ref|XP_006370405.1|  hypothetical protein POPTR_0001s42300g             115   7e-28   
ref|XP_004295873.1|  PREDICTED: uncharacterized protein LOC101296759    116   7e-28   
dbj|BAF56998.1|  S receptor kinase                                      115   8e-28   Brassica napus [oilseed rape]
ref|XP_004295782.1|  PREDICTED: G-type lectin S-receptor-like ser...    115   8e-28   
ref|XP_010240981.1|  PREDICTED: G-type lectin S-receptor-like ser...    115   8e-28   
ref|XP_006391515.1|  hypothetical protein EUTSA_v10018118mg             115   8e-28   
gb|AAS94095.1|  S-locus receptor kinase                                 111   8e-28   Raphanus sativus
emb|CAB41879.1|  SRK15 protein                                          115   8e-28   Brassica oleracea
ref|XP_010456965.1|  PREDICTED: G-type lectin S-receptor-like ser...    115   8e-28   
emb|CDY07469.1|  BnaA07g25480D                                          112   8e-28   
ref|XP_010422487.1|  PREDICTED: G-type lectin S-receptor-like ser...    115   8e-28   
ref|XP_010422486.1|  PREDICTED: G-type lectin S-receptor-like ser...    115   8e-28   
ref|NP_192232.5|  G-type lectin S-receptor-like serine/threonine-...    115   9e-28   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF57002.1|  S receptor kinase                                      115   9e-28   Brassica napus [oilseed rape]
dbj|BAE95187.1|  S-locus receptor kinase                                115   9e-28   Brassica oleracea
ref|XP_010422485.1|  PREDICTED: G-type lectin S-receptor-like ser...    115   9e-28   
gb|EYU27870.1|  hypothetical protein MIMGU_mgv1a002421mg                114   9e-28   
emb|CDY39268.1|  BnaC06g27230D                                          115   9e-28   
gb|ABS53282.1|  S-locus lectin protein kinase family protein            108   9e-28   Arabidopsis lyrata subsp. lyrata
gb|KDO37835.1|  hypothetical protein CISIN_1g043872mg                   109   9e-28   
ref|XP_006433098.1|  hypothetical protein CICLE_v10000574mg             114   9e-28   
ref|XP_010927549.1|  PREDICTED: G-type lectin S-receptor-like ser...    114   1e-27   
ref|XP_006377805.1|  hypothetical protein POPTR_0011s130601g            109   1e-27   
gb|ACN52024.1|  SRK protein                                             109   1e-27   Brassica cretica
ref|XP_006391306.1|  hypothetical protein EUTSA_v10018108mg             115   1e-27   
ref|XP_010522657.1|  PREDICTED: G-type lectin S-receptor-like ser...    114   1e-27   
ref|XP_010927531.1|  PREDICTED: G-type lectin S-receptor-like ser...    114   1e-27   
ref|XP_007148276.1|  hypothetical protein PHAVU_006G194700g             114   1e-27   
gb|AIZ68213.1|  receptor-like serine/threonine-protein kinase SD1-8     114   1e-27   
ref|XP_006452092.1|  hypothetical protein CICLE_v10010321mg             114   1e-27   
ref|XP_006370627.1|  hypothetical protein POPTR_0001s44380g             114   1e-27   
ref|XP_010665760.1|  PREDICTED: receptor-like serine/threonine-pr...    114   1e-27   
ref|XP_010665759.1|  PREDICTED: receptor-like serine/threonine-pr...    114   1e-27   
sp|Q9ZR08.3|Y4230_ARATH  RecName: Full=G-type lectin S-receptor-l...    114   1e-27   Arabidopsis thaliana [mouse-ear cress]
gb|ABS53280.1|  S-locus lectin protein kinase family protein            108   1e-27   Arabidopsis lyrata subsp. lyrata
ref|XP_010522656.1|  PREDICTED: G-type lectin S-receptor-like ser...    114   1e-27   
ref|XP_006370371.1|  S-locus protein kinase                             114   1e-27   
ref|XP_011030922.1|  PREDICTED: G-type lectin S-receptor-like ser...    114   1e-27   
ref|XP_006646397.1|  PREDICTED: G-type lectin S-receptor-like ser...    114   1e-27   
ref|XP_009402802.1|  PREDICTED: G-type lectin S-receptor-like ser...    114   1e-27   
ref|XP_006377792.1|  hypothetical protein POPTR_0011s12880g             114   1e-27   
ref|XP_010907389.1|  PREDICTED: G-type lectin S-receptor-like ser...    114   1e-27   
ref|XP_006452085.1|  hypothetical protein CICLE_v10010368mg             114   1e-27   
gb|AAP92126.1|  receptor-like protein kinase ARK1                       114   1e-27   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001044463.1|  Os01g0784700                                       114   1e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010522655.1|  PREDICTED: G-type lectin S-receptor-like ser...    114   1e-27   
ref|XP_010522654.1|  PREDICTED: G-type lectin S-receptor-like ser...    114   1e-27   
dbj|BAD53361.1|  putative receptor-like protein kinase ARK1             114   1e-27   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001288457.1|  receptor-like serine/threonine-protein kinas...    114   1e-27   
ref|XP_010522653.1|  PREDICTED: G-type lectin S-receptor-like ser...    114   1e-27   
ref|XP_009115144.1|  PREDICTED: receptor-like serine/threonine-pr...    114   1e-27   
ref|XP_010522650.1|  PREDICTED: G-type lectin S-receptor-like ser...    114   1e-27   
ref|XP_006413786.1|  hypothetical protein EUTSA_v10025088mg             112   1e-27   
ref|XP_008657161.1|  PREDICTED: receptor-like serine/threonine-pr...    114   1e-27   
ref|XP_009115145.1|  PREDICTED: receptor-like serine/threonine-pr...    114   1e-27   
ref|XP_004970203.1|  PREDICTED: receptor-like serine/threonine-pr...    114   1e-27   
ref|XP_002872790.1|  S-locus lectin protein kinase family protein       114   1e-27   
gb|AAS94091.1|  S-locus receptor kinase                                 110   1e-27   Raphanus sativus
ref|XP_004487639.1|  PREDICTED: G-type lectin S-receptor-like ser...    114   1e-27   
ref|XP_006471786.1|  PREDICTED: cysteine-rich receptor-like prote...    114   1e-27   
gb|AFW84881.1|  putative S-locus receptor-like protein kinase fam...    114   1e-27   
ref|XP_002528889.1|  ATP binding protein, putative                      115   1e-27   Ricinus communis
ref|XP_006352641.1|  PREDICTED: G-type lectin S-receptor-like ser...    114   2e-27   
gb|ACN52018.1|  SRK protein                                             108   2e-27   Brassica cretica
gb|KDO53352.1|  hypothetical protein CISIN_1g021771mg                   110   2e-27   
ref|XP_007043396.1|  S-locus lectin protein kinase family protein...    114   2e-27   
gb|KHN28393.1|  G-type lectin S-receptor-like serine/threonine-pr...    113   2e-27   
gb|ADQ37374.1|  unknown                                                 114   2e-27   
ref|XP_009589083.1|  PREDICTED: uncharacterized protein LOC104086517    115   2e-27   
gb|ABZ02475.1|  S-locus lectin protein kinase family protein            108   2e-27   Arabidopsis halleri
ref|XP_009141883.1|  PREDICTED: receptor-like serine/threonine-pr...    114   2e-27   
dbj|BAB69684.1|  receptor kinase 6                                      114   2e-27   Brassica rapa
ref|XP_011048295.1|  PREDICTED: G-type lectin S-receptor-like ser...    114   2e-27   
ref|XP_007021182.1|  S-locus lectin protein kinase family protein       114   2e-27   
gb|AAL17685.1|  S-locus receptor kinase                                 110   2e-27   Raphanus sativus
ref|XP_008369911.1|  PREDICTED: G-type lectin S-receptor-like ser...    109   2e-27   
gb|AID21659.1|  ARK3p                                                   114   2e-27   
ref|XP_006464653.1|  PREDICTED: receptor-like serine/threonine-pr...    114   2e-27   
emb|CDY07465.1|  BnaA07g25440D                                          113   2e-27   
ref|XP_006370411.1|  hypothetical protein POPTR_0001s42340g             113   2e-27   
ref|XP_006452102.1|  hypothetical protein CICLE_v10007547mg             114   2e-27   
ref|XP_006360116.1|  PREDICTED: G-type lectin S-receptor-like ser...    114   2e-27   
ref|XP_011014317.1|  PREDICTED: G-type lectin S-receptor-like ser...    114   2e-27   
gb|AGC55015.1|  S-receptor kinase                                       114   2e-27   
gb|KHG16273.1|  G-type lectin S-receptor-like serine/threonine-pr...    114   2e-27   
ref|XP_006433216.1|  hypothetical protein CICLE_v10003350mg             111   2e-27   
ref|XP_009782161.1|  PREDICTED: G-type lectin S-receptor-like ser...    114   2e-27   
ref|XP_008803875.1|  PREDICTED: uncharacterized protein LOC103717326    114   2e-27   
ref|XP_007149663.1|  hypothetical protein PHAVU_005G088800g             113   2e-27   
gb|EYU36706.1|  hypothetical protein MIMGU_mgv1a001937mg                113   2e-27   
gb|AID21647.1|  ARK3p                                                   114   2e-27   
gb|AFP33770.1|  SRK                                                     114   2e-27   
gb|AFP33766.1|  SRK                                                     114   2e-27   
ref|XP_011016742.1|  PREDICTED: G-type lectin S-receptor-like ser...    110   2e-27   
emb|CDY07467.1|  BnaA07g25460D                                          113   2e-27   
ref|XP_006464652.1|  PREDICTED: receptor-like serine/threonine-pr...    114   2e-27   
gb|AFP33769.1|  SRK                                                     114   2e-27   
ref|XP_011097955.1|  PREDICTED: G-type lectin S-receptor-like ser...    114   2e-27   
gb|AFP33768.1|  SRK                                                     114   2e-27   
gb|AFP33767.1|  SRK                                                     114   2e-27   
dbj|BAF91394.1|  S-locus receptor kinase                                114   2e-27   
gb|KCW74348.1|  hypothetical protein EUGRSUZ_E030241                    106   2e-27   
ref|XP_006452033.1|  hypothetical protein CICLE_v10007471mg             114   2e-27   
dbj|BAJ99098.1|  predicted protein                                      114   2e-27   
ref|XP_009769146.1|  PREDICTED: G-type lectin S-receptor-like ser...    114   2e-27   
gb|KHG07568.1|  G-type lectin S-receptor-like serine/threonine-pr...    114   2e-27   
ref|XP_006468233.1|  PREDICTED: cysteine-rich receptor-like prote...    113   2e-27   
gb|KDO43801.1|  hypothetical protein CISIN_1g026939mg                   108   2e-27   
gb|AID21577.1|  SRKp                                                    114   2e-27   
ref|XP_006388695.1|  hypothetical protein POPTR_0118s00240g             110   2e-27   
ref|XP_006469788.1|  PREDICTED: G-type lectin S-receptor-like ser...    114   2e-27   
ref|XP_010268952.1|  PREDICTED: uncharacterized protein LOC104605764    114   2e-27   
gb|KCW67237.1|  hypothetical protein EUGRSUZ_F01025                     113   2e-27   
gb|KDO74366.1|  hypothetical protein CISIN_1g018304mg                   110   2e-27   
ref|XP_006370409.1|  hypothetical protein POPTR_0001s42330g             113   2e-27   
ref|XP_010273262.1|  PREDICTED: G-type lectin S-receptor-like ser...    114   2e-27   
ref|XP_006370410.1|  hypothetical protein POPTR_0001s42330g             113   2e-27   
ref|XP_006428541.1|  hypothetical protein CICLE_v10011237mg             113   2e-27   
ref|XP_007021383.1|  S-locus lectin protein kinase family protein       113   2e-27   
ref|XP_006413787.1|  hypothetical protein EUTSA_v10024419mg             113   2e-27   
ref|XP_010106350.1|  G-type lectin S-receptor-like serine/threoni...    111   2e-27   
gb|KDO74365.1|  hypothetical protein CISIN_1g043285mg                   110   2e-27   
gb|KCW67069.1|  hypothetical protein EUGRSUZ_F00843                     113   2e-27   
emb|CCI61482.1|  SRK                                                    113   3e-27   
gb|ADQ37363.1|  unknown                                                 113   3e-27   
ref|XP_010106348.1|  G-type lectin S-receptor-like serine/threoni...    113   3e-27   
gb|KCW74912.1|  hypothetical protein EUGRSUZ_E03659                     113   3e-27   
emb|CDP11770.1|  unnamed protein product                                113   3e-27   
gb|KDP38992.1|  hypothetical protein JCGZ_00749                         113   3e-27   
ref|XP_010327269.1|  PREDICTED: G-type lectin S-receptor-like ser...    113   3e-27   
ref|XP_003541757.1|  PREDICTED: receptor-like serine/threonine-pr...    113   3e-27   
ref|XP_010059466.1|  PREDICTED: G-type lectin S-receptor-like ser...    113   3e-27   
emb|CDY02294.1|  BnaA09g26080D                                          114   3e-27   
emb|CBI17984.3|  unnamed protein product                                114   3e-27   
ref|XP_010268928.1|  PREDICTED: G-type lectin S-receptor-like ser...    113   3e-27   
ref|XP_004295399.1|  PREDICTED: G-type lectin S-receptor-like ser...    113   3e-27   
ref|XP_006284976.1|  hypothetical protein CARUB_v10006283mg             113   3e-27   
dbj|BAF02195.1|  putative receptor kinase                               111   3e-27   
ref|XP_010060466.1|  PREDICTED: G-type lectin S-receptor-like ser...    113   3e-27   
ref|XP_010268933.1|  PREDICTED: G-type lectin S-receptor-like ser...    113   3e-27   
gb|EYU19178.1|  hypothetical protein MIMGU_mgv1a020642mg                113   3e-27   
ref|XP_002867852.1|  At4g21380                                          113   3e-27   
ref|XP_010052425.1|  PREDICTED: G-type lectin S-receptor-like ser...    110   3e-27   
ref|XP_006582220.1|  PREDICTED: G-type lectin S-receptor-like ser...    113   3e-27   
ref|XP_010909793.1|  PREDICTED: G-type lectin S-receptor-like ser...    113   3e-27   
emb|CCI61483.1|  ARK3                                                   113   3e-27   
ref|XP_006475277.1|  PREDICTED: G-type lectin S-receptor-like ser...    113   3e-27   
ref|XP_006475278.1|  PREDICTED: G-type lectin S-receptor-like ser...    113   3e-27   
ref|XP_010273261.1|  PREDICTED: G-type lectin S-receptor-like ser...    113   3e-27   
gb|AAL17687.1|  S-locus receptor kinase                                 109   3e-27   
gb|AID21690.1|  ARK3p                                                   113   3e-27   
ref|XP_010273260.1|  PREDICTED: G-type lectin S-receptor-like ser...    113   3e-27   
gb|ABZ02455.1|  S-locus lectin protein kinase family protein            108   3e-27   
ref|XP_010062926.1|  PREDICTED: G-type lectin S-receptor-like ser...    113   3e-27   
gb|KCW70077.1|  hypothetical protein EUGRSUZ_F03382                     113   3e-27   
ref|XP_006471858.1|  PREDICTED: G-type lectin S-receptor-like ser...    110   3e-27   
emb|CAN70165.1|  hypothetical protein VITISV_024701                     114   3e-27   
gb|EYU33934.1|  hypothetical protein MIMGU_mgv1a020982mg                109   3e-27   
ref|XP_002304965.2|  hypothetical protein POPTR_0004s02700g             113   3e-27   
gb|KFK29234.1|  hypothetical protein AALP_AA7G107000                    113   3e-27   
ref|XP_011011557.1|  PREDICTED: G-type lectin S-receptor-like ser...    113   3e-27   
gb|KCW70065.1|  hypothetical protein EUGRSUZ_F03369                     112   3e-27   
gb|ABZ02460.1|  S-locus lectin protein kinase family protein            108   3e-27   
gb|ABZ02453.1|  S-locus lectin protein kinase family protein            108   3e-27   
gb|ADQ37352.1|  unknown                                                 113   3e-27   
ref|XP_007025881.1|  S-locus lectin protein kinase family protein...    113   3e-27   
dbj|BAF91391.1|  S-locus receptor kinase (kinase domain)                110   3e-27   
gb|ABZ02503.1|  S-locus lectin protein kinase family protein            108   3e-27   
gb|ABZ02493.1|  S-locus lectin protein kinase family protein            108   3e-27   
gb|ABZ02480.1|  S-locus lectin protein kinase family protein            108   3e-27   
gb|ABZ02479.1|  S-locus lectin protein kinase family protein            108   3e-27   
gb|KDO74372.1|  hypothetical protein CISIN_1g0052361mg                  112   3e-27   
ref|XP_004146628.1|  PREDICTED: uncharacterized protein LOC101215940    114   3e-27   
ref|XP_006452106.1|  hypothetical protein CICLE_v10007528mg             113   3e-27   
gb|KEH22742.1|  S-locus lectin kinase family protein                    106   3e-27   
gb|ABZ02452.1|  S-locus lectin protein kinase family protein            108   3e-27   
gb|ABZ02477.1|  S-locus lectin protein kinase family protein            108   3e-27   
ref|XP_007213546.1|  hypothetical protein PRUPE_ppa018740mg             110   3e-27   
gb|ABZ02457.1|  S-locus lectin protein kinase family protein            108   4e-27   
ref|XP_008439932.1|  PREDICTED: G-type lectin S-receptor-like ser...    113   4e-27   
ref|XP_010064358.1|  PREDICTED: G-type lectin S-receptor-like ser...    113   4e-27   
gb|KDO74347.1|  hypothetical protein CISIN_1g003391mg                   112   4e-27   
ref|XP_010924053.1|  PREDICTED: receptor-like serine/threonine-pr...    113   4e-27   
gb|ABD59321.1|  S locus receptor kinase                                 113   4e-27   
ref|XP_006433214.1|  hypothetical protein CICLE_v10000653mg             112   4e-27   
gb|AID21587.1|  ARK3p                                                   113   4e-27   
gb|KDP20854.1|  hypothetical protein JCGZ_21325                         113   4e-27   
ref|XP_006452071.1|  hypothetical protein CICLE_v10007645mg             112   4e-27   
ref|XP_002304962.2|  S-locus lectin protein kinase                      113   4e-27   
ref|XP_008439931.1|  PREDICTED: G-type lectin S-receptor-like ser...    113   4e-27   
ref|XP_004158053.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    114   4e-27   
dbj|BAA23676.1|  receptor kinase 1                                      113   4e-27   
gb|KHN28390.1|  Receptor-like serine/threonine-protein kinase SD1-8     113   4e-27   
ref|XP_003526165.1|  PREDICTED: G-type lectin S-receptor-like ser...    113   4e-27   
gb|KHN07687.1|  G-type lectin S-receptor-like serine/threonine-pr...    113   4e-27   
ref|XP_003528424.1|  PREDICTED: G-type lectin S-receptor-like ser...    113   4e-27   
ref|XP_011011560.1|  PREDICTED: G-type lectin S-receptor-like ser...    113   4e-27   
emb|CAN70167.1|  hypothetical protein VITISV_024703                     113   4e-27   
gb|EMS56713.1|  Receptor-like serine/threonine-protein kinase SD1-6     112   4e-27   
ref|XP_011030936.1|  PREDICTED: G-type lectin S-receptor-like ser...    112   4e-27   
ref|XP_010657377.1|  PREDICTED: uncharacterized protein LOC100267196    114   4e-27   
ref|XP_006370399.1|  hypothetical protein POPTR_0001s42260g             112   4e-27   
ref|NP_001238568.1|  protein kinase                                     108   4e-27   
ref|XP_006413784.1|  hypothetical protein EUTSA_v100253570mg            110   4e-27   
ref|XP_007133116.1|  hypothetical protein PHAVU_011G152700g             112   4e-27   
gb|KDO37968.1|  hypothetical protein CISIN_1g041793mg                   108   4e-27   
ref|XP_006475269.1|  PREDICTED: G-type lectin S-receptor-like ser...    107   4e-27   
ref|XP_011030935.1|  PREDICTED: G-type lectin S-receptor-like ser...    112   4e-27   
ref|XP_004169144.1|  PREDICTED: G-type lectin S-receptor-like ser...    113   4e-27   
ref|XP_010273263.1|  PREDICTED: G-type lectin S-receptor-like ser...    113   4e-27   
ref|XP_011029379.1|  PREDICTED: G-type lectin S-receptor-like ser...    112   4e-27   
ref|XP_010062923.1|  PREDICTED: G-type lectin S-receptor-like ser...    113   4e-27   
ref|XP_008777589.1|  PREDICTED: receptor-like serine/threonine-pr...    113   4e-27   
emb|CDO99664.1|  unnamed protein product                                113   5e-27   
ref|XP_010928191.1|  PREDICTED: G-type lectin S-receptor-like ser...    112   5e-27   
ref|XP_006452070.1|  hypothetical protein CICLE_v10007645mg             112   5e-27   
ref|XP_007025862.1|  S-locus lectin protein kinase family protein...    112   5e-27   
gb|KDP36269.1|  hypothetical protein JCGZ_09834                         111   5e-27   
ref|XP_011048518.1|  PREDICTED: G-type lectin S-receptor-like ser...    113   5e-27   
ref|XP_006370400.1|  hypothetical protein POPTR_0001s42260g             112   5e-27   
ref|XP_011048516.1|  PREDICTED: G-type lectin S-receptor-like ser...    113   5e-27   
ref|XP_006452063.1|  hypothetical protein CICLE_v10007685mg             112   5e-27   
ref|XP_010106713.1|  Receptor-like serine/threonine-protein kinas...    112   5e-27   
ref|XP_006449082.1|  hypothetical protein CICLE_v10017560mg             112   5e-27   
ref|XP_006471860.1|  PREDICTED: cysteine-rich receptor-like prote...    112   5e-27   
ref|XP_009105170.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    112   5e-27   
ref|XP_011013386.1|  PREDICTED: G-type lectin S-receptor-like ser...    112   5e-27   
gb|KHN38600.1|  G-type lectin S-receptor-like serine/threonine-pr...    112   5e-27   
gb|KDO74333.1|  hypothetical protein CISIN_1g003832mg                   112   5e-27   
ref|XP_006370368.1|  hypothetical protein POPTR_0001s42030g             112   5e-27   
ref|XP_006475243.1|  PREDICTED: G-type lectin S-receptor-like ser...    112   5e-27   
ref|XP_010644281.1|  PREDICTED: uncharacterized protein LOC100246941    113   5e-27   
gb|ACN52021.1|  SRK protein                                             107   5e-27   
emb|CBI20427.3|  unnamed protein product                                113   5e-27   
dbj|BAA06285.1|  S-receptor kinase SRK9                                 112   5e-27   
gb|KCW76395.1|  hypothetical protein EUGRSUZ_D00778                     112   6e-27   
ref|XP_006475280.1|  PREDICTED: uncharacterized protein LOC102629172    113   6e-27   
ref|XP_004244166.2|  PREDICTED: uncharacterized protein LOC101262029    113   6e-27   
gb|EYU33576.1|  hypothetical protein MIMGU_mgv1a003061mg                112   6e-27   
gb|AAL17686.1|  S-locus receptor kinase                                 108   6e-27   
ref|XP_006377794.1|  hypothetical protein POPTR_0011s12900g             110   6e-27   
emb|CAN70179.1|  hypothetical protein VITISV_000004                     112   6e-27   
dbj|BAA21132.1|  S-receptor kinase                                      112   6e-27   
gb|EYU27867.1|  hypothetical protein MIMGU_mgv1a020672mg                112   6e-27   
ref|XP_009350320.1|  PREDICTED: G-type lectin S-receptor-like ser...    112   6e-27   
ref|XP_009350313.1|  PREDICTED: G-type lectin S-receptor-like ser...    112   6e-27   
ref|XP_008341948.1|  PREDICTED: G-type lectin S-receptor-like ser...    112   6e-27   
ref|XP_002518599.1|  S-locus-specific glycoprotein S6 precursor, ...    112   6e-27   
emb|CAN77363.1|  hypothetical protein VITISV_005347                     106   6e-27   
gb|KCW76394.1|  hypothetical protein EUGRSUZ_D00776                     112   6e-27   
ref|XP_006373139.1|  hypothetical protein POPTR_0017s090701g            109   6e-27   
gb|KCW76404.1|  hypothetical protein EUGRSUZ_D007922                    112   6e-27   
ref|XP_009778629.1|  PREDICTED: uncharacterized protein LOC104227947    113   6e-27   
ref|XP_006464879.1|  PREDICTED: receptor-like serine/threonine-pr...    112   6e-27   
ref|XP_004485681.1|  PREDICTED: receptor-like serine/threonine-pr...    112   6e-27   
gb|EYU36707.1|  hypothetical protein MIMGU_mgv1a001407mg                112   6e-27   
gb|KDO38189.1|  hypothetical protein CISIN_1g027162mg                   107   6e-27   
ref|XP_006598304.1|  PREDICTED: uncharacterized protein LOC100797331    113   6e-27   
ref|XP_002524721.1|  S-locus-specific glycoprotein S6 precursor, ...    112   6e-27   
ref|NP_001168535.1|  uncharacterized LOC100382315 precursor             112   6e-27   
gb|KHN19083.1|  Receptor-like serine/threonine-protein kinase SD1-8     112   6e-27   
ref|XP_006388696.1|  hypothetical protein POPTR_0118s00250g             109   6e-27   
ref|XP_011029380.1|  PREDICTED: G-type lectin S-receptor-like ser...    112   6e-27   
gb|KDO75659.1|  hypothetical protein CISIN_1g0029692mg                  108   6e-27   
ref|XP_004295364.1|  PREDICTED: uncharacterized protein LOC101303888    113   6e-27   
gb|KDO48493.1|  hypothetical protein CISIN_1g0460101mg                  107   7e-27   
ref|XP_006452035.1|  hypothetical protein CICLE_v10010175mg             112   7e-27   
gb|KDO74307.1|  hypothetical protein CISIN_1g003288mg                   112   7e-27   
emb|CAL25338.1|  putative serine/threonine kinase                       106   7e-27   
ref|XP_009355548.1|  PREDICTED: G-type lectin S-receptor-like ser...    112   7e-27   
dbj|BAJ93922.1|  predicted protein                                      112   7e-27   
ref|XP_006433220.1|  hypothetical protein CICLE_v100005811mg            107   7e-27   
ref|XP_006377796.1|  hypothetical protein POPTR_0011s12920g             112   7e-27   
gb|KDO74350.1|  hypothetical protein CISIN_1g005933mg                   112   7e-27   
ref|XP_007140613.1|  hypothetical protein PHAVU_008G126800g             112   7e-27   
gb|EMT12229.1|  Putative serine/threonine-protein kinase receptor       112   7e-27   
ref|XP_006388692.1|  hypothetical protein POPTR_0118s00210g             112   7e-27   
ref|XP_011012851.1|  PREDICTED: G-type lectin S-receptor-like ser...    112   7e-27   
gb|KHN11004.1|  G-type lectin S-receptor-like serine/threonine-pr...    112   7e-27   
gb|KCW76402.1|  hypothetical protein EUGRSUZ_D007851                    112   7e-27   
gb|KDO42697.1|  hypothetical protein CISIN_1g0091861mg                  107   7e-27   
gb|ACN52011.1|  SRK protein                                             107   7e-27   
gb|KDO74334.1|  hypothetical protein CISIN_1g003832mg                   112   7e-27   
ref|XP_010052421.1|  PREDICTED: G-type lectin S-receptor-like ser...    112   7e-27   
gb|KEH22737.1|  G-type lectin S-receptor-like Serine/Threonine-ki...    112   7e-27   
ref|XP_009387766.1|  PREDICTED: G-type lectin S-receptor-like ser...    112   7e-27   
ref|XP_006475279.1|  PREDICTED: G-type lectin S-receptor-like ser...    112   7e-27   
ref|XP_002458611.1|  hypothetical protein SORBIDRAFT_03g036650          112   7e-27   
gb|KDO74308.1|  hypothetical protein CISIN_1g003288mg                   112   7e-27   
ref|XP_011097953.1|  PREDICTED: G-type lectin S-receptor-like ser...    112   7e-27   
ref|XP_010052422.1|  PREDICTED: G-type lectin S-receptor-like ser...    112   7e-27   
ref|XP_002316941.2|  hypothetical protein POPTR_0011s12870g             112   7e-27   
ref|XP_011030938.1|  PREDICTED: G-type lectin S-receptor-like ser...    112   7e-27   
ref|XP_006582737.1|  PREDICTED: uncharacterized protein LOC100812022    113   8e-27   
ref|XP_010065691.1|  PREDICTED: G-type lectin S-receptor-like ser...    108   8e-27   
ref|XP_006471859.1|  PREDICTED: cysteine-rich receptor-like prote...    112   8e-27   
ref|XP_006447431.1|  hypothetical protein CICLE_v10014273mg             112   8e-27   
gb|AAL17684.1|  S-locus receptor kinase                                 108   8e-27   
ref|XP_007025959.1|  Cysteine-rich RLK 10                               112   8e-27   
ref|XP_010232438.1|  PREDICTED: receptor-like serine/threonine-pr...    112   8e-27   
ref|XP_010267891.1|  PREDICTED: cysteine-rich receptor-like prote...    111   8e-27   
gb|EEE64266.1|  hypothetical protein OsJ_19099                          112   8e-27   
ref|NP_001055970.1|  Os05g0501400                                       112   8e-27   
gb|EMT01195.1|  Putative serine/threonine-protein kinase receptor       112   8e-27   
ref|XP_006452103.1|  hypothetical protein CICLE_v10010341mg             112   8e-27   
ref|XP_010059143.1|  PREDICTED: putative cysteine-rich receptor-l...    111   8e-27   
emb|CDY06994.1|  BnaA04g23210D                                          112   8e-27   
gb|KDO74352.1|  hypothetical protein CISIN_1g038934mg                   112   8e-27   
gb|KHN38599.1|  G-type lectin S-receptor-like serine/threonine-pr...    112   8e-27   
gb|KDO74305.1|  hypothetical protein CISIN_1g003288mg                   112   8e-27   
ref|XP_006452045.1|  hypothetical protein CICLE_v10007453mg             112   8e-27   
emb|CDY43561.1|  BnaC02g16580D                                          109   8e-27   



>gb|AAC23542.1| receptor protein kinase [Ipomoea trifida]
Length=853

 Score =   133 bits (334),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 61/62 (98%), Positives = 62/62 (100%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDET+ANNTKRVVGTYGY
Sbjct  643  LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETDANNTKRVVGTYGY  702

Query  182  MS  187
            MS
Sbjct  703  MS  704



>emb|CDO99671.1| unnamed protein product [Coffea canephora]
Length=499

 Score =   124 bits (312),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/62 (97%), Positives = 61/62 (98%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEA NT+RVVGTYGY
Sbjct  290  LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEA-NTRRVVGTYGY  348

Query  182  MS  187
            MS
Sbjct  349  MS  350



>ref|XP_010924049.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Elaeis guineensis]
Length=835

 Score =   127 bits (318),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 59/62 (95%), Positives = 61/62 (98%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            +LYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEA NT+RVVGTYGY
Sbjct  627  ILYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEA-NTRRVVGTYGY  685

Query  182  MS  187
            MS
Sbjct  686  MS  687



>ref|XP_009616770.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Nicotiana tomentosiformis]
Length=864

 Score =   127 bits (318),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 60/62 (97%), Positives = 60/62 (97%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETE  NTKRVVGTYGY
Sbjct  656  LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEG-NTKRVVGTYGY  714

Query  182  MS  187
            MS
Sbjct  715  MS  716



>ref|XP_009773537.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Nicotiana sylvestris]
Length=865

 Score =   126 bits (317),  Expect = 7e-32, Method: Composition-based stats.
 Identities = 60/62 (97%), Positives = 60/62 (97%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETE  NTKRVVGTYGY
Sbjct  657  LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEG-NTKRVVGTYGY  715

Query  182  MS  187
            MS
Sbjct  716  MS  717



>gb|EYU27869.1| hypothetical protein MIMGU_mgv1a017829mg, partial [Erythranthe 
guttata]
Length=643

 Score =   125 bits (314),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 60/62 (97%), Positives = 61/62 (98%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGD+TEA NTKRVVGTYGY
Sbjct  434  LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDQTEA-NTKRVVGTYGY  492

Query  182  MS  187
            MS
Sbjct  493  MS  494



>ref|XP_009397155.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Musa acuminata subsp. malaccensis]
 ref|XP_009397156.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Musa acuminata subsp. malaccensis]
 ref|XP_009397157.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Musa acuminata subsp. malaccensis]
Length=820

 Score =   125 bits (315),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 58/62 (94%), Positives = 61/62 (98%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASNILLDK+MNPKISDFGMAR+FGGDETEA NT+RVVGTYGY
Sbjct  611  LLYLHQDSRFRIIHRDLKASNILLDKDMNPKISDFGMARVFGGDETEA-NTRRVVGTYGY  669

Query  182  MS  187
            MS
Sbjct  670  MS  671



>ref|XP_008777139.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Phoenix dactylifera]
Length=784

 Score =   125 bits (313),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 58/62 (94%), Positives = 60/62 (97%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            +LYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETE  NT+RVVGTYGY
Sbjct  576  ILYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEV-NTRRVVGTYGY  634

Query  182  MS  187
            MS
Sbjct  635  MS  636



>ref|XP_011096222.1| PREDICTED: uncharacterized protein LOC105175473 [Sesamum indicum]
Length=1723

 Score =   126 bits (316),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 60/62 (97%), Positives = 61/62 (98%), Gaps = 1/62 (2%)
 Frame = +2

Query  2     LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
             LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGD+TEA NTKRVVGTYGY
Sbjct  1514  LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDQTEA-NTKRVVGTYGY  1572

Query  182   MS  187
             MS
Sbjct  1573  MS  1574


 Score =   112 bits (280),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            L+YLH+DSR RIIHRDLKASNILLD+EMNPKISDFGMARIFGG++ EA NT RVVGTYGY
Sbjct  637  LVYLHRDSRLRIIHRDLKASNILLDEEMNPKISDFGMARIFGGNQNEA-NTNRVVGTYGY  695

Query  182  MS  187
            M+
Sbjct  696  MA  697



>ref|XP_010910455.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
isoform X3 [Elaeis guineensis]
Length=666

 Score =   124 bits (311),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 57/62 (92%), Positives = 60/62 (97%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            L+YLHQDSRFRIIHRDLKASN+LLDKEMNPKISDFGMARIFGGDETE  NT+RVVGTYGY
Sbjct  458  LVYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARIFGGDETEV-NTRRVVGTYGY  516

Query  182  MS  187
            MS
Sbjct  517  MS  518



>ref|XP_010910454.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
isoform X2 [Elaeis guineensis]
Length=824

 Score =   124 bits (311),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 57/62 (92%), Positives = 60/62 (97%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            L+YLHQDSRFRIIHRDLKASN+LLDKEMNPKISDFGMARIFGGDETE  NT+RVVGTYGY
Sbjct  616  LVYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARIFGGDETEV-NTRRVVGTYGY  674

Query  182  MS  187
            MS
Sbjct  675  MS  676



>ref|XP_010910453.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
isoform X1 [Elaeis guineensis]
Length=825

 Score =   124 bits (311),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 57/62 (92%), Positives = 60/62 (97%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            L+YLHQDSRFRIIHRDLKASN+LLDKEMNPKISDFGMARIFGGDETE  NT+RVVGTYGY
Sbjct  617  LVYLHQDSRFRIIHRDLKASNVLLDKEMNPKISDFGMARIFGGDETEV-NTRRVVGTYGY  675

Query  182  MS  187
            MS
Sbjct  676  MS  677



>ref|XP_008789837.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-7 
[Phoenix dactylifera]
Length=1551

 Score =   124 bits (312),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 58/62 (94%), Positives = 60/62 (97%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            L+YLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETE  NT+RVVGTYGY
Sbjct  613  LVYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEV-NTRRVVGTYGY  671

Query  182  MS  187
            MS
Sbjct  672  MS  673


 Score =   110 bits (276),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 53/62 (85%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  2     LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
             LLYLH+DSR RIIHRDLKASNILLDK+MNPKISDFG+ARIF  DET A NT+RVVGTYGY
Sbjct  1343  LLYLHRDSRLRIIHRDLKASNILLDKDMNPKISDFGLARIFREDET-ALNTRRVVGTYGY  1401

Query  182   MS  187
             MS
Sbjct  1402  MS  1403



>ref|XP_007025869.1| Receptor kinase 3 [Theobroma cacao]
 gb|EOY28491.1| Receptor kinase 3 [Theobroma cacao]
Length=840

 Score =   123 bits (309),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 59/62 (95%), Positives = 60/62 (97%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASNILLD EMNPKISDFGMARIFGGD+TEA NTKRVVGTYGY
Sbjct  630  LLYLHQDSRFRIIHRDLKASNILLDGEMNPKISDFGMARIFGGDQTEA-NTKRVVGTYGY  688

Query  182  MS  187
            MS
Sbjct  689  MS  690



>ref|XP_008775529.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Phoenix dactylifera]
Length=822

 Score =   123 bits (308),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            +LYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETE  NT RVVGTYGY
Sbjct  614  ILYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEV-NTCRVVGTYGY  672

Query  182  MS  187
            MS
Sbjct  673  MS  674



>gb|KDO75658.1| hypothetical protein CISIN_1g0029692mg, partial [Citrus sinensis]
Length=410

 Score =   120 bits (300),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASNILLDKEM PKISDFGMARIFGGD+TE  NTKRVVGTYGY
Sbjct  202  LLYLHQDSRFRIIHRDLKASNILLDKEMTPKISDFGMARIFGGDQTE-QNTKRVVGTYGY  260

Query  182  MS  187
            MS
Sbjct  261  MS  262



>ref|XP_010317517.1| PREDICTED: uncharacterized protein LOC101252749 [Solanum lycopersicum]
Length=2711

 Score =   123 bits (309),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 59/62 (95%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2     LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
             LLYLHQDSRFRIIHRDLKASNILLDKEM PKISDFGMARIFGGDETE  NTKRVVGTYGY
Sbjct  2503  LLYLHQDSRFRIIHRDLKASNILLDKEMIPKISDFGMARIFGGDETEG-NTKRVVGTYGY  2561

Query  182   MS  187
             MS
Sbjct  2562  MS  2563


 Score = 92.8 bits (229),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLH+DS  R+IHRDLKASN+LLD EMNPKISDFG+AR F   + E  NT R+ GT+GY
Sbjct  638  LLYLHRDSCLRVIHRDLKASNVLLDDEMNPKISDFGLARTFQVTQ-ELANTNRIAGTFGY  696

Query  182  MS  187
            MS
Sbjct  697  MS  698



>ref|XP_010538687.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
isoform X2 [Tarenaya hassleriana]
Length=848

 Score =   122 bits (306),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 56/62 (90%), Positives = 61/62 (98%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLD+EMNPKISDFGMARIFGGDETEA NT++VVGTYGY
Sbjct  637  LLYLHQDSRFRIIHRDLKASNVLLDREMNPKISDFGMARIFGGDETEA-NTRKVVGTYGY  695

Query  182  MS  187
            M+
Sbjct  696  MA  697



>ref|XP_010538685.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
isoform X1 [Tarenaya hassleriana]
Length=850

 Score =   122 bits (306),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 56/62 (90%), Positives = 61/62 (98%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLD+EMNPKISDFGMARIFGGDETEA NT++VVGTYGY
Sbjct  639  LLYLHQDSRFRIIHRDLKASNVLLDREMNPKISDFGMARIFGGDETEA-NTRKVVGTYGY  697

Query  182  MS  187
            M+
Sbjct  698  MA  699



>ref|XP_006449173.1| hypothetical protein CICLE_v100142551mg, partial [Citrus clementina]
 gb|ESR62413.1| hypothetical protein CICLE_v100142551mg, partial [Citrus clementina]
Length=761

 Score =   122 bits (305),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASNILLDKEM PKISDFGMARIFGGD+TE  NTKRVVGTYGY
Sbjct  654  LLYLHQDSRFRIIHRDLKASNILLDKEMTPKISDFGMARIFGGDQTE-QNTKRVVGTYGY  712

Query  182  MS  187
            MS
Sbjct  713  MS  714



>ref|XP_009612738.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Nicotiana tomentosiformis]
Length=858

 Score =   122 bits (305),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 57/62 (92%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASNILLDK++ PKISDFGMARIFGGDETE  NTKRVVGTYGY
Sbjct  649  LLYLHQDSRFRIIHRDLKASNILLDKDLTPKISDFGMARIFGGDETEG-NTKRVVGTYGY  707

Query  182  MS  187
            MS
Sbjct  708  MS  709



>ref|XP_009768621.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Nicotiana sylvestris]
Length=907

 Score =   122 bits (305),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 57/62 (92%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASNILLDK++ PKISDFGMARIFGGDETE  NTKRVVGTYGY
Sbjct  698  LLYLHQDSRFRIIHRDLKASNILLDKDLTPKISDFGMARIFGGDETEG-NTKRVVGTYGY  756

Query  182  MS  187
            MS
Sbjct  757  MS  758



>ref|XP_006343406.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8-like 
[Solanum tuberosum]
Length=1642

 Score =   122 bits (306),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 59/62 (95%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASNILLDKEM PKISDFGMARIFGGDETE  NTKRVVGTYGY
Sbjct  653  LLYLHQDSRFRIIHRDLKASNILLDKEMIPKISDFGMARIFGGDETEG-NTKRVVGTYGY  711

Query  182  MS  187
            MS
Sbjct  712  MS  713


 Score =   105 bits (261),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 50/62 (81%), Positives = 53/62 (85%), Gaps = 1/62 (2%)
 Frame = +2

Query  2     LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
             L YLH DSR RIIHRDLKASN+LLD  M+PKISDFG ARIFGGD+ EA NT RVVGTYGY
Sbjct  1435  LSYLHHDSRVRIIHRDLKASNVLLDASMHPKISDFGTARIFGGDQIEA-NTNRVVGTYGY  1493

Query  182   MS  187
             MS
Sbjct  1494  MS  1495



>ref|XP_010240988.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Nelumbo nucifera]
Length=867

 Score =   121 bits (304),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 57/62 (92%), Positives = 60/62 (97%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRI+HRDLKASNILLD +MNPKISDFGMARIFGGD+TEA NTKRVVGTYGY
Sbjct  657  LLYLHQDSRFRIVHRDLKASNILLDGDMNPKISDFGMARIFGGDQTEA-NTKRVVGTYGY  715

Query  182  MS  187
            MS
Sbjct  716  MS  717



>gb|KDP20852.1| hypothetical protein JCGZ_21323 [Jatropha curcas]
Length=837

 Score =   121 bits (304),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 57/62 (92%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLD E NPKISDFGMARIFGGD+TEA NTKRVVGTYGY
Sbjct  628  LLYLHQDSRFRIIHRDLKASNVLLDAEWNPKISDFGMARIFGGDQTEA-NTKRVVGTYGY  686

Query  182  MS  187
            MS
Sbjct  687  MS  688



>ref|XP_010316637.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Solanum lycopersicum]
Length=857

 Score =   121 bits (303),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 57/62 (92%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASNILLDK++ PKISDFGMARIFGGDETE  NTKRVVGTYGY
Sbjct  648  LLYLHQDSRFRIIHRDLKASNILLDKDLTPKISDFGMARIFGGDETEG-NTKRVVGTYGY  706

Query  182  MS  187
            MS
Sbjct  707  MS  708



>emb|CBI25711.3| unnamed protein product [Vitis vinifera]
Length=619

 Score =   119 bits (299),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 57/62 (92%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLD EMNPKISDFGMARIFG D+TEA NTKRVVGTYGY
Sbjct  410  LLYLHQDSRFRIIHRDLKASNVLLDGEMNPKISDFGMARIFGRDQTEA-NTKRVVGTYGY  468

Query  182  MS  187
            MS
Sbjct  469  MS  470



>gb|KHN45740.1| Receptor-like serine/threonine-protein kinase SD1-8 [Glycine 
soja]
Length=853

 Score =   120 bits (302),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFG D+TEA NT RVVGTYGY
Sbjct  644  LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGTDQTEA-NTMRVVGTYGY  702

Query  182  MS  187
            MS
Sbjct  703  MS  704



>ref|XP_011003370.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Populus euphratica]
Length=254

 Score =   115 bits (289),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASNILLD+E  PKISDFGMARIFGGD+T+A NT+R+VGTYGY
Sbjct  45   LLYLHQDSRFRIIHRDLKASNILLDREWTPKISDFGMARIFGGDQTQA-NTRRIVGTYGY  103

Query  182  MS  187
            MS
Sbjct  104  MS  105



>ref|XP_010646880.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Vitis vinifera]
Length=847

 Score =   120 bits (301),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 57/62 (92%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLD EMNPKISDFGMARIFG D+TEA NTKRVVGTYGY
Sbjct  638  LLYLHQDSRFRIIHRDLKASNVLLDGEMNPKISDFGMARIFGRDQTEA-NTKRVVGTYGY  696

Query  182  MS  187
            MS
Sbjct  697  MS  698



>ref|XP_009398188.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-6 
[Musa acuminata subsp. malaccensis]
Length=249

 Score =   115 bits (287),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 60/62 (97%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLH+DSRFRIIHRDLKASNILLDK+MNPKISDFGMAR+FGGDET+A  T+RVVGTYGY
Sbjct  41   LLYLHRDSRFRIIHRDLKASNILLDKDMNPKISDFGMARMFGGDETDA-RTRRVVGTYGY  99

Query  182  MS  187
            MS
Sbjct  100  MS  101



>ref|XP_010928033.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Elaeis guineensis]
Length=1213

 Score =   120 bits (301),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 57/62 (92%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  2     LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
             LLYLHQDSR RIIHRDLKASNILLDKEMNPKISDFGMARIFGGDE E  NT RVVGTYGY
Sbjct  1005  LLYLHQDSRLRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDEAEV-NTHRVVGTYGY  1063

Query  182   MS  187
             MS
Sbjct  1064  MS  1065


 Score =   111 bits (277),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLH+DSR RIIHRDLKASN+LLDK+MNPKISDFG+ARIF GDE  A NT+RVVGTYGY
Sbjct  190  LLYLHRDSRLRIIHRDLKASNVLLDKDMNPKISDFGLARIFRGDEI-AINTRRVVGTYGY  248

Query  182  MS  187
            MS
Sbjct  249  MS  250



>ref|XP_009398951.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Musa acuminata subsp. malaccensis]
Length=709

 Score =   119 bits (298),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 60/62 (97%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLH+DSRFRIIHRDLKASNILLDK+MNPKISDFGMAR+FGGDET+A  T+RVVGTYGY
Sbjct  503  LLYLHRDSRFRIIHRDLKASNILLDKDMNPKISDFGMARMFGGDETDA-RTRRVVGTYGY  561

Query  182  MS  187
            MS
Sbjct  562  MS  563



>ref|XP_009397154.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Musa acuminata subsp. malaccensis]
Length=823

 Score =   119 bits (299),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 56/62 (90%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRD+KA NILLDK+M PKISDFGMARIFGGDETEA NT+RVVGTYGY
Sbjct  615  LLYLHQDSRFRIIHRDMKAGNILLDKDMCPKISDFGMARIFGGDETEA-NTRRVVGTYGY  673

Query  182  MS  187
            MS
Sbjct  674  MS  675



>gb|ACN52053.1| SRK protein [Brassica cretica]
Length=153

 Score =   112 bits (280),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMARIFG DETEA +T++VVGTYGY
Sbjct  45   LLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-DTRKVVGTYGY  103

Query  182  MS  187
            MS
Sbjct  104  MS  105



>gb|ACN52052.1| SRK protein [Brassica cretica]
Length=211

 Score =   114 bits (284),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMARIFG DETEA +T++VVGTYGY
Sbjct  32   LLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-DTRKVVGTYGY  90

Query  182  MS  187
            MS
Sbjct  91   MS  92



>gb|KCW67068.1| hypothetical protein EUGRSUZ_F008421, partial [Eucalyptus grandis]
Length=287

 Score =   115 bits (288),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLKASN+LLD EMNPKISDFGMARIFGGDETE  NT RVVGTYGY
Sbjct  85   LLYLHQDSRLRIIHRDLKASNVLLDNEMNPKISDFGMARIFGGDETEG-NTNRVVGTYGY  143

Query  182  MS  187
            M+
Sbjct  144  MA  145



>gb|AFU83022.1| SRK protein, partial [Brassica oleracea var. italica]
Length=234

 Score =   114 bits (285),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLK SNILLDK M PKISDFGMARIF  DETEA NTK+VVGTYGY
Sbjct  15   LLYLHQDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFARDETEA-NTKKVVGTYGY  73

Query  182  MS  187
            MS
Sbjct  74   MS  75



>gb|ACN52050.1| SRK protein [Brassica cretica]
Length=155

 Score =   112 bits (280),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMARIFG DETEA +T++VVGTYGY
Sbjct  45   LLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-DTRKVVGTYGY  103

Query  182  MS  187
            MS
Sbjct  104  MS  105



>ref|XP_009408780.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Musa acuminata subsp. malaccensis]
Length=1498

 Score =   120 bits (301),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 57/62 (92%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLKASNILLD  MNPKISDFGMARIFGGDETE  NTKRVVGTYGY
Sbjct  508  LLYLHQDSRLRIIHRDLKASNILLDMHMNPKISDFGMARIFGGDETEV-NTKRVVGTYGY  566

Query  182  MS  187
            MS
Sbjct  567  MS  568


 Score =   118 bits (296),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 56/62 (90%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = +2

Query  2     LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
             LLYLHQDSR RIIHRDLKA NILLD  MNPKISDFGMARIFGGDETE  NTKRVVGTYGY
Sbjct  1291  LLYLHQDSRLRIIHRDLKAGNILLDMHMNPKISDFGMARIFGGDETEV-NTKRVVGTYGY  1349

Query  182   MS  187
             MS
Sbjct  1350  MS  1351



>ref|XP_009402882.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=830

 Score =   119 bits (299),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 56/62 (90%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLH+DSR RIIHRDLKASNILLDK+MNPKISDFGMARIFGGDETE  NT RVVGTYGY
Sbjct  623  LLYLHEDSRLRIIHRDLKASNILLDKDMNPKISDFGMARIFGGDETEV-NTMRVVGTYGY  681

Query  182  MS  187
            MS
Sbjct  682  MS  683



>ref|XP_009402881.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=831

 Score =   119 bits (299),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 56/62 (90%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLH+DSR RIIHRDLKASNILLDK+MNPKISDFGMARIFGGDETE  NT RVVGTYGY
Sbjct  623  LLYLHEDSRLRIIHRDLKASNILLDKDMNPKISDFGMARIFGGDETEV-NTMRVVGTYGY  681

Query  182  MS  187
            MS
Sbjct  682  MS  683



>gb|ACN52046.1| SRK protein [Brassica cretica]
Length=151

 Score =   112 bits (279),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMARIFG DETEA +T++VVGTYGY
Sbjct  45   LLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-DTRKVVGTYGY  103

Query  182  MS  187
            MS
Sbjct  104  MS  105



>gb|ACN52045.1| SRK protein [Brassica cretica]
Length=190

 Score =   113 bits (282),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMARIFG DETEA +T++VVGTYGY
Sbjct  23   LLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-DTRKVVGTYGY  81

Query  182  MS  187
            MS
Sbjct  82   MS  83



>ref|XP_010924052.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Elaeis guineensis]
Length=804

 Score =   119 bits (298),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 60/62 (97%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK+MNPKISDFGMARIFGGD+++A  TKRVVGTYGY
Sbjct  600  LLYLHQDSRFRIIHRDLKASNVLLDKDMNPKISDFGMARIFGGDQSDA-YTKRVVGTYGY  658

Query  182  MS  187
            MS
Sbjct  659  MS  660



>gb|ACN52047.1| SRK protein [Brassica cretica]
Length=235

 Score =   114 bits (285),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMARIFG DETEA +T++VVGTYGY
Sbjct  32   LLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-DTRKVVGTYGY  90

Query  182  MS  187
            MS
Sbjct  91   MS  92



>gb|ACN52055.1| SRK protein [Brassica cretica]
Length=170

 Score =   112 bits (280),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMARIFG DETEA +T++VVGTYGY
Sbjct  45   LLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-DTRKVVGTYGY  103

Query  182  MS  187
            MS
Sbjct  104  MS  105



>gb|AAS94086.1| S-locus receptor kinase [Raphanus sativus]
Length=290

 Score =   115 bits (287),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 56/62 (90%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLK SNILLDK M PKISDFGMARIF  DETEA NTKRVVGTYGY
Sbjct  71   LLYLHQDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFARDETEA-NTKRVVGTYGY  129

Query  182  MS  187
            MS
Sbjct  130  MS  131



>ref|XP_004504969.1| PREDICTED: uncharacterized protein LOC101504189 [Cicer arietinum]
Length=1717

 Score =   120 bits (300),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 58/62 (94%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2     LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
             LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFG D+TEA NT RVVGTYGY
Sbjct  1508  LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGTDQTEA-NTVRVVGTYGY  1566

Query  182   MS  187
             MS
Sbjct  1567  MS  1568


 Score =   110 bits (275),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLH+DSR RIIHRDLKASNILLD+ MNPKISDFG+ARIFGG++ EA NT RVVGTYGY
Sbjct  646  LLYLHRDSRLRIIHRDLKASNILLDENMNPKISDFGLARIFGGNQNEA-NTARVVGTYGY  704

Query  182  MS  187
            MS
Sbjct  705  MS  706



>gb|ACN52043.1| SRK protein [Brassica cretica]
Length=194

 Score =   112 bits (281),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMARIFG DETEA +T++VVGTYGY
Sbjct  32   LLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-DTRKVVGTYGY  90

Query  182  MS  187
            MS
Sbjct  91   MS  92



>gb|ACN52044.1| SRK protein [Brassica cretica]
Length=174

 Score =   112 bits (280),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMARIFG DETEA +T++VVGTYGY
Sbjct  30   LLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-DTRKVVGTYGY  88

Query  182  MS  187
            MS
Sbjct  89   MS  90



>gb|ACN52051.1| SRK protein [Brassica cretica]
 gb|ACN52054.1| SRK protein [Brassica cretica]
Length=238

 Score =   114 bits (284),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMARIFG DETEA +T++VVGTYGY
Sbjct  32   LLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-DTRKVVGTYGY  90

Query  182  MS  187
            MS
Sbjct  91   MS  92



>gb|KDP38994.1| hypothetical protein JCGZ_00751 [Jatropha curcas]
Length=728

 Score =   118 bits (296),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLKASN+LLD EMNPKISDFGMARIFGGD+TE  NTKRVVGTYGY
Sbjct  521  LLYLHQDSRLRIIHRDLKASNVLLDNEMNPKISDFGMARIFGGDQTEG-NTKRVVGTYGY  579

Query  182  MS  187
            M+
Sbjct  580  MA  581



>gb|ACN52048.1| SRK protein [Brassica cretica]
Length=179

 Score =   112 bits (280),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMARIFG DETEA +T++VVGTYGY
Sbjct  45   LLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-DTRKVVGTYGY  103

Query  182  MS  187
            MS
Sbjct  104  MS  105



>gb|ACN52056.1| SRK protein [Brassica cretica]
Length=238

 Score =   114 bits (284),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMARIFG DETEA +T++VVGTYGY
Sbjct  32   LLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-DTRKVVGTYGY  90

Query  182  MS  187
            MS
Sbjct  91   MS  92



>ref|XP_010064357.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Eucalyptus grandis]
Length=776

 Score =   118 bits (296),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLKASN+LLD EMNPKISDFGMARIFGGDETE  NT RVVGTYGY
Sbjct  574  LLYLHQDSRLRIIHRDLKASNVLLDNEMNPKISDFGMARIFGGDETEG-NTNRVVGTYGY  632

Query  182  MS  187
            M+
Sbjct  633  MA  634



>gb|ACN52049.1| SRK protein [Brassica cretica]
Length=201

 Score =   112 bits (281),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMARIFG DETEA +T++VVGTYGY
Sbjct  45   LLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-DTRKVVGTYGY  103

Query  182  MS  187
            MS
Sbjct  104  MS  105



>gb|ABY55236.1| S-locus receptor kinase [Diplotaxis muralis]
Length=229

 Score =   113 bits (282),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK M PKISDFGMARIFG DETEA +T++VVGTYGY
Sbjct  31   LLYLHQDSRFRIIHRDLKASNVLLDKNMTPKISDFGMARIFGHDETEA-DTRKVVGTYGY  89

Query  182  MS  187
            MS
Sbjct  90   MS  91



>ref|XP_007159231.1| hypothetical protein PHAVU_002G220200g [Phaseolus vulgaris]
 gb|ESW31225.1| hypothetical protein PHAVU_002G220200g [Phaseolus vulgaris]
Length=843

 Score =   118 bits (296),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 56/62 (90%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFG D+ EA NT R+VGTYGY
Sbjct  634  LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGTDQIEA-NTMRIVGTYGY  692

Query  182  MS  187
            MS
Sbjct  693  MS  694



>ref|XP_011011561.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Populus euphratica]
Length=834

 Score =   118 bits (296),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASNILLD+E  PKISDFGMARIFGGD+T+A NT+R+VGTYGY
Sbjct  625  LLYLHQDSRFRIIHRDLKASNILLDREWTPKISDFGMARIFGGDQTQA-NTRRIVGTYGY  683

Query  182  MS  187
            MS
Sbjct  684  MS  685



>ref|XP_010268934.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Nelumbo nucifera]
Length=855

 Score =   118 bits (296),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            +LYLHQDSRFRI+HRDLKASNILLD EMNPKISDFGMARIFGGD+TEA NT RVVGT+GY
Sbjct  646  VLYLHQDSRFRIVHRDLKASNILLDGEMNPKISDFGMARIFGGDQTEA-NTNRVVGTFGY  704

Query  182  MS  187
            MS
Sbjct  705  MS  706



>ref|XP_010060465.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Eucalyptus grandis]
Length=815

 Score =   118 bits (295),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLKASN+LLD EMNPKISDFGMARIFGGDETE  NT RVVGTYGY
Sbjct  611  LLYLHQDSRLRIIHRDLKASNVLLDNEMNPKISDFGMARIFGGDETEG-NTNRVVGTYGY  669

Query  182  MS  187
            M+
Sbjct  670  MA  671



>gb|AFU83019.1| SRK protein, partial [Brassica oleracea var. italica]
Length=256

 Score =   113 bits (283),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMARIFG DETEA +T++VVGTYGY
Sbjct  45   LLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-DTRKVVGTYGY  103

Query  182  MS  187
            MS
Sbjct  104  MS  105



>ref|XP_007214693.1| hypothetical protein PRUPE_ppa024127mg [Prunus persica]
 gb|EMJ15892.1| hypothetical protein PRUPE_ppa024127mg [Prunus persica]
Length=533

 Score =   116 bits (291),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLKASN+LLDKEMNPKISDFGMARIFGGD+TE   TK+VVGTYGY
Sbjct  315  LLYLHQDSRLRIIHRDLKASNVLLDKEMNPKISDFGMARIFGGDQTEG-VTKKVVGTYGY  373

Query  182  MS  187
            M+
Sbjct  374  MA  375



>gb|KCW67236.1| hypothetical protein EUGRSUZ_F01024 [Eucalyptus grandis]
Length=766

 Score =   118 bits (295),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLKASN+LLD EMNPKISDFGMARIFGGDETE  NT RVVGTYGY
Sbjct  565  LLYLHQDSRLRIIHRDLKASNVLLDNEMNPKISDFGMARIFGGDETEG-NTNRVVGTYGY  623

Query  182  MS  187
            M+
Sbjct  624  MA  625



>gb|KDO74363.1| hypothetical protein CISIN_1g0467031mg, partial [Citrus sinensis]
Length=230

 Score =   112 bits (281),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLKA N+LLD++MNPKISDFG+AR FGGDETE N T RVVGTYGY
Sbjct  23   LLYLHQDSRLRIIHRDLKAGNVLLDQDMNPKISDFGLARTFGGDETEGNTT-RVVGTYGY  81

Query  182  MS  187
            M+
Sbjct  82   MA  83



>ref|XP_008355368.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1 isoform X3 [Malus domestica]
Length=303

 Score =   114 bits (285),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLKASN+LLDK+MNPKISDFGMAR+FGGD+TEA  TKRVVGTYGY
Sbjct  86   LLYLHQDSRLRIIHRDLKASNVLLDKDMNPKISDFGMARLFGGDQTEA-VTKRVVGTYGY  144

Query  182  MS  187
            M+
Sbjct  145  MA  146



>gb|KDO74291.1| hypothetical protein CISIN_1g0453151mg, partial [Citrus sinensis]
Length=224

 Score =   112 bits (280),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQ SR R+IHRDLKASNILLDK+MNPKISDFGMAR+FGGDE ++ NTKR+VGTYGY
Sbjct  23   LLYLHQYSRLRVIHRDLKASNILLDKDMNPKISDFGMARMFGGDELQS-NTKRIVGTYGY  81

Query  182  MS  187
            MS
Sbjct  82   MS  83



>ref|XP_008345021.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like serine/threonine-protein 
kinase SD1-8 [Malus domestica]
Length=411

 Score =   115 bits (287),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASNILLD E+ PKISDFGMARIFG D+TEA NT+RVVGTYGY
Sbjct  200  LLYLHQDSRFRIIHRDLKASNILLDGELTPKISDFGMARIFGNDQTEA-NTRRVVGTYGY  258

Query  182  MS  187
            MS
Sbjct  259  MS  260



>ref|XP_009398952.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Musa acuminata subsp. malaccensis]
Length=820

 Score =   117 bits (294),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 60/62 (97%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLH+DSRFRIIHRDLKASNILLDK+MNPKISDFGMAR+FGGD+T+A  T+RVVGTYGY
Sbjct  612  LLYLHRDSRFRIIHRDLKASNILLDKDMNPKISDFGMARMFGGDDTDA-RTRRVVGTYGY  670

Query  182  MS  187
            MS
Sbjct  671  MS  672



>ref|XP_006370370.1| hypothetical protein POPTR_0001s42050g [Populus trichocarpa]
 gb|ERP66939.1| hypothetical protein POPTR_0001s42050g [Populus trichocarpa]
Length=799

 Score =   117 bits (294),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRD+KASNILLD E+NPKISDFG+AR+FGGD+TEA NTKRVVGTYGY
Sbjct  592  LLYLHQDSRLRIIHRDIKASNILLDNELNPKISDFGLARMFGGDQTEA-NTKRVVGTYGY  650

Query  182  MS  187
            MS
Sbjct  651  MS  652



>gb|ACN52015.1| SRK protein [Brassica cretica]
Length=208

 Score =   112 bits (279),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 55/62 (89%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLK SNILLDK M PKISDFGMARIF  DETEA NT +VVGTYGY
Sbjct  4    LLYLHQDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFARDETEA-NTMKVVGTYGY  62

Query  182  MS  187
            MS
Sbjct  63   MS  64



>ref|XP_008363599.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1 isoform X2 [Malus domestica]
Length=303

 Score =   114 bits (284),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLKASN+LLDK+MNPKISDFGMAR+FGGD+TEA  TKRVVGTYGY
Sbjct  86   LLYLHQDSRLRIIHRDLKASNVLLDKDMNPKISDFGMARLFGGDQTEA-VTKRVVGTYGY  144

Query  182  MS  187
            M+
Sbjct  145  MA  146



>gb|AGC54823.1| S-locus receptor kinase 13-15, partial [Arabidopsis lyrata]
Length=764

 Score =   117 bits (293),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 56/62 (90%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASNILLDK+M PKISDFGMARIFG DETEA NT++VVGTYGY
Sbjct  642  LLYLHQDSRFRIIHRDLKASNILLDKDMTPKISDFGMARIFGRDETEA-NTRKVVGTYGY  700

Query  182  MS  187
            MS
Sbjct  701  MS  702



>emb|CAA73133.1| serine /threonine kinase [Brassica oleracea]
Length=847

 Score =   117 bits (293),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMARIFG DETEA NT++VVGTYGY
Sbjct  632  LLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-NTRKVVGTYGY  690

Query  182  MS  187
            MS
Sbjct  691  MS  692



>dbj|BAB40987.1| SRKb [Arabidopsis lyrata]
 gb|ADQ37349.1| unknown [Arabidopsis lyrata]
Length=853

 Score =   117 bits (293),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMARIFG DETEA NT++VVGTYGY
Sbjct  637  LLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-NTRKVVGTYGY  695

Query  182  MS  187
            MS
Sbjct  696  MS  697



>gb|ADQ37372.1| unknown [Arabidopsis lyrata]
Length=861

 Score =   117 bits (293),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMARIFG DETEA NT++VVGTYGY
Sbjct  649  LLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-NTRKVVGTYGY  707

Query  182  MS  187
            MS
Sbjct  708  MS  709



>emb|CAA67145.1| receptor-like kinase [Brassica oleracea var. viridis]
Length=847

 Score =   117 bits (293),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMARIFG DETEA NT++VVGTYGY
Sbjct  632  LLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-NTRKVVGTYGY  690

Query  182  MS  187
            MS
Sbjct  691  MS  692



>gb|KDP30509.1| hypothetical protein JCGZ_16689 [Jatropha curcas]
Length=789

 Score =   117 bits (293),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLKASN+LLDK+MNPKISDFGMARIFGGD+TEA NT RVVGT+GY
Sbjct  582  LLYLHQDSRLRIIHRDLKASNVLLDKDMNPKISDFGMARIFGGDQTEA-NTNRVVGTFGY  640

Query  182  MS  187
            M+
Sbjct  641  MA  642



>dbj|BAB69683.1| receptor kinase 5 [Brassica rapa]
Length=838

 Score =   117 bits (293),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMARIFG DETEA NT++VVGTYGY
Sbjct  623  LLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-NTRKVVGTYGY  681

Query  182  MS  187
            MS
Sbjct  682  MS  683



>emb|CDX79055.1| BnaA01g11220D [Brassica napus]
Length=846

 Score =   117 bits (293),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMARIFG DETEA NT++VVGTYGY
Sbjct  631  LLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-NTRKVVGTYGY  689

Query  182  MS  187
            MS
Sbjct  690  MS  691



>ref|XP_002518601.1| S-locus-specific glycoprotein S6 precursor, putative [Ricinus 
communis]
 gb|EEF43988.1| S-locus-specific glycoprotein S6 precursor, putative [Ricinus 
communis]
Length=834

 Score =   117 bits (293),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 56/62 (90%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLY+HQDSRFRIIHRDLKASNILLD E NPKISDFGMARIFGGD+TEA +TKRVVGTYGY
Sbjct  625  LLYMHQDSRFRIIHRDLKASNILLDGEWNPKISDFGMARIFGGDQTEA-STKRVVGTYGY  683

Query  182  MS  187
            MS
Sbjct  684  MS  685



>ref|XP_009408779.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Musa acuminata subsp. malaccensis]
Length=824

 Score =   117 bits (292),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLKA NILLD  MNPKISDFGMARIFGGDE+E  NTKRVVGTYGY
Sbjct  616  LLYLHQDSRLRIIHRDLKAGNILLDMHMNPKISDFGMARIFGGDESEV-NTKRVVGTYGY  674

Query  182  MS  187
            MS
Sbjct  675  MS  676



>emb|CDY39264.1| BnaC06g27270D [Brassica napus]
Length=233

 Score =   112 bits (279),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFR+IHRDLKASN+LLDK M PKISDFGMARIFG +ETEA NT++VVGTYGY
Sbjct  18   LLYLHQDSRFRVIHRDLKASNVLLDKNMTPKISDFGMARIFGREETEA-NTRKVVGTYGY  76

Query  182  MS  187
            MS
Sbjct  77   MS  78



>gb|KDP34761.1| hypothetical protein JCGZ_10541 [Jatropha curcas]
Length=823

 Score =   117 bits (292),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLKASN+LLDK+MNPKISDFGMARIFGGD+TEA NT RVVGT+GY
Sbjct  616  LLYLHQDSRLRIIHRDLKASNVLLDKDMNPKISDFGMARIFGGDQTEA-NTNRVVGTFGY  674

Query  182  MS  187
            M+
Sbjct  675  MA  676



>ref|XP_003608281.1| Serine/threonine protein kinase [Medicago truncatula]
 gb|AES90478.1| G-type lectin S-receptor-like Serine/Threonine-kinase [Medicago 
truncatula]
Length=852

 Score =   117 bits (293),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 57/62 (92%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASNILLD EMNPKISDFGMARIFG D+TEA NT RVVGTYGY
Sbjct  643  LLYLHQDSRFRIIHRDLKASNILLDGEMNPKISDFGMARIFGTDQTEA-NTVRVVGTYGY  701

Query  182  MS  187
            MS
Sbjct  702  MS  703



>ref|XP_007021380.1| S-locus lectin protein kinase family protein [Theobroma cacao]
 gb|EOY12905.1| S-locus lectin protein kinase family protein [Theobroma cacao]
Length=817

 Score =   117 bits (292),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLKASN+LLD EMNPKISDFGMAR FGGD+TEA NT RVVGTYGY
Sbjct  610  LLYLHQDSRLRIIHRDLKASNVLLDSEMNPKISDFGMARTFGGDQTEA-NTNRVVGTYGY  668

Query  182  MS  187
            M+
Sbjct  669  MA  670



>ref|XP_008226752.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Prunus mume]
Length=711

 Score =   116 bits (291),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLKASN+LLDKEMNPKISDFGMARIFGGD+TE   TK+VVGTYGY
Sbjct  493  LLYLHQDSRLRIIHRDLKASNVLLDKEMNPKISDFGMARIFGGDQTEG-VTKKVVGTYGY  551

Query  182  MS  187
            M+
Sbjct  552  MA  553



>ref|XP_010268959.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Nelumbo nucifera]
Length=848

 Score =   117 bits (292),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRI+HRDLKASN+LLD EMNPKISDFGMARIFG D+TEA NT+R+VGTYGY
Sbjct  641  LLYLHQDSRFRIVHRDLKASNVLLDGEMNPKISDFGMARIFGEDQTEA-NTRRIVGTYGY  699

Query  182  MS  187
            MS
Sbjct  700  MS  701



>gb|ABY55235.1| S-locus receptor kinase [Diplotaxis tenuifolia]
Length=232

 Score =   112 bits (279),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMARIFG DETEA +T++VVGTYGY
Sbjct  31   LLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-DTRKVVGTYGY  89

Query  182  MS  187
            M+
Sbjct  90   MA  91



>ref|XP_008226748.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Prunus mume]
 ref|XP_008226749.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Prunus mume]
 ref|XP_008226750.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Prunus mume]
 ref|XP_008226751.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Prunus mume]
Length=713

 Score =   116 bits (291),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLKASN+LLDKEMNPKISDFGMARIFGGD+TE   TK+VVGTYGY
Sbjct  495  LLYLHQDSRLRIIHRDLKASNVLLDKEMNPKISDFGMARIFGGDQTEG-VTKKVVGTYGY  553

Query  182  MS  187
            M+
Sbjct  554  MA  555



>gb|ACN52028.1| SRK protein [Brassica cretica]
Length=213

 Score =   111 bits (278),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 55/62 (89%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLK SNILLDK M PKISDFGMARIF  DETEA NT +VVGTYGY
Sbjct  1    LLYLHQDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFARDETEA-NTMKVVGTYGY  59

Query  182  MS  187
            MS
Sbjct  60   MS  61



>ref|XP_008355367.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1 isoform X2 [Malus domestica]
Length=357

 Score =   114 bits (284),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLKASN+LLDK+MNPKISDFGMAR+FGGD+TEA  TKRVVGTYGY
Sbjct  140  LLYLHQDSRLRIIHRDLKASNVLLDKDMNPKISDFGMARLFGGDQTEA-VTKRVVGTYGY  198

Query  182  MS  187
            M+
Sbjct  199  MA  200



>ref|XP_008363596.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1 isoform X1 [Malus domestica]
 ref|XP_008363597.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1 isoform X1 [Malus domestica]
 ref|XP_008363598.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1 isoform X1 [Malus domestica]
Length=598

 Score =   115 bits (289),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLKASN+LLDK+MNPKISDFGMAR+FGGD+TEA  TKRVVGTYGY
Sbjct  381  LLYLHQDSRLRIIHRDLKASNVLLDKDMNPKISDFGMARLFGGDQTEA-VTKRVVGTYGY  439

Query  182  MS  187
            M+
Sbjct  440  MA  441



>ref|XP_002317551.2| hypothetical protein POPTR_0011s13260g [Populus trichocarpa]
 gb|EEE98163.2| hypothetical protein POPTR_0011s13260g [Populus trichocarpa]
Length=794

 Score =   117 bits (292),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 56/62 (90%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLK SNILLD+EMNPKISDFGMAR FGG+ETEA NTKRVVGTYGY
Sbjct  587  LLYLHQDSRLRIIHRDLKPSNILLDEEMNPKISDFGMARSFGGNETEA-NTKRVVGTYGY  645

Query  182  MS  187
            MS
Sbjct  646  MS  647



>ref|XP_010646879.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 [Vitis vinifera]
Length=857

 Score =   117 bits (292),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLH+DSR RIIHRD+KASNILLD+EMNPKISDFGMARIFGGD+ EAN T RVVGTYGY
Sbjct  650  LLYLHRDSRLRIIHRDMKASNILLDEEMNPKISDFGMARIFGGDQNEANTT-RVVGTYGY  708

Query  182  MS  187
            MS
Sbjct  709  MS  710



>emb|CBI33185.3| unnamed protein product [Vitis vinifera]
Length=575

 Score =   115 bits (289),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 53/62 (85%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            +LYLHQDSR RIIHRDLKASN+LLD EMNPKISDFGMARIFGGD+ E  NT RVVGTYGY
Sbjct  376  ILYLHQDSRLRIIHRDLKASNVLLDAEMNPKISDFGMARIFGGDQIEG-NTSRVVGTYGY  434

Query  182  MS  187
            MS
Sbjct  435  MS  436



>ref|XP_006391514.1| hypothetical protein EUTSA_v10018117mg [Eutrema salsugineum]
 gb|ESQ28800.1| hypothetical protein EUTSA_v10018117mg [Eutrema salsugineum]
Length=848

 Score =   117 bits (292),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 56/62 (90%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLK SNILLDK M PKISDFGMARIFG DETEA NT+RVVGTYGY
Sbjct  636  LLYLHQDSRFRIIHRDLKVSNILLDKNMTPKISDFGMARIFGRDETEA-NTRRVVGTYGY  694

Query  182  MS  187
            MS
Sbjct  695  MS  696



>dbj|BAF91390.1| S-locus receptor kinase [Brassica rapa]
Length=420

 Score =   114 bits (285),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMARIFG DETEA +T++VVGTYGY
Sbjct  209  LLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-DTRKVVGTYGY  267

Query  182  MS  187
            MS
Sbjct  268  MS  269



>ref|XP_002304966.1| Brassica self-incompatibility locus family protein [Populus trichocarpa]
 gb|EEE85477.1| Brassica self-incompatibility locus family protein [Populus trichocarpa]
Length=834

 Score =   116 bits (291),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASNILLD E  PKISDFGMARIFGGD+T+A NT+R+VGTYGY
Sbjct  625  LLYLHQDSRFRIIHRDLKASNILLDGEWTPKISDFGMARIFGGDQTQA-NTRRIVGTYGY  683

Query  182  MS  187
            MS
Sbjct  684  MS  685



>ref|XP_008355366.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1 isoform X1 [Malus domestica]
Length=598

 Score =   115 bits (289),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLKASN+LLDK+MNPKISDFGMAR+FGGD+TEA  TKRVVGTYGY
Sbjct  381  LLYLHQDSRLRIIHRDLKASNVLLDKDMNPKISDFGMARLFGGDQTEA-VTKRVVGTYGY  439

Query  182  MS  187
            M+
Sbjct  440  MA  441



>ref|XP_009398189.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Musa acuminata subsp. malaccensis]
Length=818

 Score =   116 bits (291),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLH DSRFRIIHRDLKASNILLDK+MNPKISDFGMAR+FGGD+T+A  T+RVVGTYGY
Sbjct  612  LLYLHHDSRFRIIHRDLKASNILLDKDMNPKISDFGMARMFGGDDTDA-RTRRVVGTYGY  670

Query  182  MS  187
            MS
Sbjct  671  MS  672



>ref|XP_004159218.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g03230-like, partial [Cucumis sativus]
Length=1010

 Score =   117 bits (292),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLK SNILLD+EMNPKISDFG+ARIFGG ET A NTKRVVGTYGY
Sbjct  822  LLYLHQDSRLRIIHRDLKTSNILLDEEMNPKISDFGLARIFGGKET-ATNTKRVVGTYGY  880

Query  182  MS  187
            MS
Sbjct  881  MS  882



>ref|XP_010052484.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Eucalyptus grandis]
 gb|KCW76535.1| hypothetical protein EUGRSUZ_D00923 [Eucalyptus grandis]
Length=854

 Score =   116 bits (291),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASNILLD E+NPKISDFGMARIFG D+ EA NTKRVVGTYGY
Sbjct  646  LLYLHQDSRFRIIHRDLKASNILLDGELNPKISDFGMARIFGRDQVEA-NTKRVVGTYGY  704

Query  182  MS  187
            M+
Sbjct  705  MA  706



>gb|AFU83023.1| SRK protein, partial [Brassica oleracea var. italica]
Length=234

 Score =   111 bits (278),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 55/62 (89%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLK SNILLDK M PKISDFGMARIF  DETEA NT +VVGTYGY
Sbjct  15   LLYLHQDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFARDETEA-NTMKVVGTYGY  73

Query  182  MS  187
            MS
Sbjct  74   MS  75



>ref|XP_006370567.1| hypothetical protein POPTR_0001s438602g, partial [Populus trichocarpa]
 gb|ERP67136.1| hypothetical protein POPTR_0001s438602g, partial [Populus trichocarpa]
Length=209

 Score =   111 bits (277),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RI+HRDLKASN+LLDK+MNPKISDFG+AR+FGGD+TE N T RVVGTYGY
Sbjct  1    LLYLHQDSRLRIVHRDLKASNVLLDKDMNPKISDFGLARMFGGDQTEGNTT-RVVGTYGY  59

Query  182  MS  187
            M+
Sbjct  60   MA  61



>gb|AFU83021.1| SRK protein, partial [Brassica oleracea var. italica]
Length=234

 Score =   111 bits (278),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 55/62 (89%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLK SNILLDK M PKISDFGMARIF  DETEA NT +VVGTYGY
Sbjct  15   LLYLHQDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFARDETEA-NTMKVVGTYGY  73

Query  182  MS  187
            MS
Sbjct  74   MS  75



>dbj|BAF91392.1| S-locus receptor kinase (kinase domain) [Brassica rapa]
Length=420

 Score =   114 bits (284),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMARIFG DETEA +T++VVGTYGY
Sbjct  209  LLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-DTRKVVGTYGY  267

Query  182  MS  187
            MS
Sbjct  268  MS  269



>gb|ACN52029.1| SRK protein [Brassica cretica]
Length=213

 Score =   111 bits (277),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 55/62 (89%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLK SNILLDK M PKISDFGMARIF  DETEA NT +VVGTYGY
Sbjct  1    LLYLHQDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFARDETEA-NTMKVVGTYGY  59

Query  182  MS  187
            MS
Sbjct  60   MS  61



>ref|XP_006449083.1| hypothetical protein CICLE_v10016609mg [Citrus clementina]
 gb|ESR62323.1| hypothetical protein CICLE_v10016609mg [Citrus clementina]
Length=221

 Score =   111 bits (277),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLH+DSR +IIHRDLKASN+LLD EMNPKISDFGMARIFGG+++EA NT RVVGTYGY
Sbjct  22   LLYLHEDSRLKIIHRDLKASNVLLDHEMNPKISDFGMARIFGGNQSEA-NTNRVVGTYGY  80

Query  182  MS  187
            M+
Sbjct  81   MA  82



>ref|XP_008364109.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Malus domestica]
Length=877

 Score =   116 bits (291),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASNILLD E+ PKISDFGMARIFG D+TEA NT+RVVGTYGY
Sbjct  666  LLYLHQDSRFRIIHRDLKASNILLDGELTPKISDFGMARIFGNDQTEA-NTRRVVGTYGY  724

Query  182  MS  187
            MS
Sbjct  725  MS  726



>ref|XP_004144482.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g03230-like [Cucumis sativus]
Length=1030

 Score =   117 bits (292),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLK SNILLD+EMNPKISDFG+ARIFGG ET A NTKRVVGTYGY
Sbjct  822  LLYLHQDSRLRIIHRDLKTSNILLDEEMNPKISDFGLARIFGGKET-ATNTKRVVGTYGY  880

Query  182  MS  187
            MS
Sbjct  881  MS  882



>ref|XP_009134691.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Brassica rapa]
Length=882

 Score =   116 bits (291),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMARIFG DETEA NT++VVGTYGY
Sbjct  667  LLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-NTRKVVGTYGY  725

Query  182  MS  187
            MS
Sbjct  726  MS  727



>ref|XP_006452097.1| hypothetical protein CICLE_v10010721mg [Citrus clementina]
 gb|ESR65337.1| hypothetical protein CICLE_v10010721mg [Citrus clementina]
Length=284

 Score =   112 bits (280),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLKASN+LLD +MNPKISDFG+AR FGGDETE  NT RVVGTYGY
Sbjct  98   LLYLHQDSRLRIIHRDLKASNVLLDHDMNPKISDFGLARAFGGDETEG-NTYRVVGTYGY  156

Query  182  MS  187
            M+
Sbjct  157  MA  158



>gb|ABN05291.1| ARK3 protein [Arabidopsis thaliana]
Length=850

 Score =   116 bits (291),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 56/62 (90%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASNILLDK M PKISDFGMARIFG DETEA NT++VVGTYGY
Sbjct  636  LLYLHQDSRFRIIHRDLKASNILLDKYMTPKISDFGMARIFGRDETEA-NTRKVVGTYGY  694

Query  182  MS  187
            MS
Sbjct  695  MS  696



>gb|KCW76538.1| hypothetical protein EUGRSUZ_D00925 [Eucalyptus grandis]
Length=831

 Score =   116 bits (291),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASNILLD E+NPKISDFGMARIFG D+ EA NTKRVVGTYGY
Sbjct  623  LLYLHQDSRFRIIHRDLKASNILLDGELNPKISDFGMARIFGRDQVEA-NTKRVVGTYGY  681

Query  182  MS  187
            M+
Sbjct  682  MA  683



>ref|XP_007021379.1| S-locus lectin protein kinase family protein [Theobroma cacao]
 gb|EOY12904.1| S-locus lectin protein kinase family protein [Theobroma cacao]
Length=817

 Score =   116 bits (290),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLKASN+LLD EMNPKISDFGMAR FGGD+TEA NT RVVGTYGY
Sbjct  610  LLYLHQDSRLRIIHRDLKASNVLLDSEMNPKISDFGMARTFGGDQTEA-NTNRVVGTYGY  668

Query  182  MS  187
            M+
Sbjct  669  MA  670



>ref|XP_008455381.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g03230 isoform X2 [Cucumis melo]
Length=1009

 Score =   116 bits (291),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLK SNILLD+EMNPKISDFG+ARIFGG ET A NTKRVVGTYGY
Sbjct  801  LLYLHQDSRLRIIHRDLKTSNILLDEEMNPKISDFGLARIFGGKET-ATNTKRVVGTYGY  859

Query  182  MS  187
            MS
Sbjct  860  MS  861



>gb|ACN52030.1| SRK protein [Brassica cretica]
Length=206

 Score =   110 bits (275),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 55/62 (89%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLK SNILLDK M PKISDFGMARIF  DETEA NT +VVGTYGY
Sbjct  2    LLYLHQDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFARDETEA-NTMKVVGTYGY  60

Query  182  MS  187
            MS
Sbjct  61   MS  62



>emb|CDY07074.1| BnaA04g22410D [Brassica napus]
Length=149

 Score =   108 bits (271),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK+M PKISD G+AR+FG DETEA NT++VVGTYGY
Sbjct  34   LLYLHQDSRFRIIHRDLKASNVLLDKDMAPKISDLGLARMFGRDETEA-NTRKVVGTYGY  92

Query  182  MS  187
            MS
Sbjct  93   MS  94



>ref|XP_008813304.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like serine/threonine-protein 
kinase SD1-8, partial [Phoenix dactylifera]
Length=1592

 Score =   117 bits (292),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 60/62 (97%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK+MNPKISDFG+ARIFGGD+++A  TKRVVGTYGY
Sbjct  639  LLYLHQDSRFRIIHRDLKASNVLLDKDMNPKISDFGVARIFGGDQSDA-YTKRVVGTYGY  697

Query  182  MS  187
            MS
Sbjct  698  MS  699


 Score = 94.4 bits (233),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 42/44 (95%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = +2

Query  2     LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGD  133
             LLYLHQDSRFRIIHRDLKASNILLDK+MNPKISDFG+ARIFGGD
Sbjct  1549  LLYLHQDSRFRIIHRDLKASNILLDKDMNPKISDFGVARIFGGD  1592



>gb|ACN52031.1| SRK protein [Brassica cretica]
Length=214

 Score =   110 bits (276),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 53/62 (85%), Positives = 55/62 (89%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRD+K SNILLDK M PKISDFGMARIF  DETEA NT+ VVGTYGY
Sbjct  2    LLYLHQDSRFRIIHRDMKVSNILLDKNMIPKISDFGMARIFARDETEA-NTRNVVGTYGY  60

Query  182  MS  187
            MS
Sbjct  61   MS  62



>ref|XP_010054468.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like serine/threonine-protein 
kinase SD1-8 [Eucalyptus grandis]
Length=846

 Score =   116 bits (290),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASNILLD E+NPKISDFGMARIFG D+ EA NTKRVVGTYGY
Sbjct  638  LLYLHQDSRFRIIHRDLKASNILLDGELNPKISDFGMARIFGRDQVEA-NTKRVVGTYGY  696

Query  182  MS  187
            M+
Sbjct  697  MA  698



>emb|CDY39269.1| BnaC06g27220D [Brassica napus]
Length=479

 Score =   114 bits (284),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK M PKISDFGMARIFG DETEA NT++VVGTYGY
Sbjct  265  LLYLHQDSRFRIIHRDLKASNVLLDKNMTPKISDFGMARIFGPDETEA-NTRKVVGTYGY  323

Query  182  MS  187
            M+
Sbjct  324  MA  325



>ref|XP_007025879.1| S-locus lectin protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY28501.1| S-locus lectin protein kinase family protein isoform 1 [Theobroma 
cacao]
Length=818

 Score =   116 bits (290),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 53/61 (87%), Positives = 58/61 (95%), Gaps = 1/61 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLH+DSR RIIHRDLKASN+LLD EMNPKISDFG+AR+FGGD+TEA NTKRVVGTYGY
Sbjct  612  LLYLHRDSRLRIIHRDLKASNVLLDNEMNPKISDFGLARMFGGDQTEA-NTKRVVGTYGY  670

Query  182  M  184
            M
Sbjct  671  M  671



>gb|KDP38993.1| hypothetical protein JCGZ_00750 [Jatropha curcas]
Length=513

 Score =   114 bits (285),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLK SN+LLD EMNPKISDFGMAR FGGD+TE  NT+RVVGTYGY
Sbjct  306  LLYLHQDSRLRIIHRDLKPSNVLLDNEMNPKISDFGMARTFGGDQTEG-NTRRVVGTYGY  364

Query  182  MS  187
            M+
Sbjct  365  MA  366



>emb|CDY62911.1| BnaC01g41140D [Brassica napus]
Length=635

 Score =   115 bits (288),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMARIFG DETEA NT++VVGTYGY
Sbjct  420  LLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-NTRKVVGTYGY  478

Query  182  MS  187
            MS
Sbjct  479  MS  480



>ref|XP_008455380.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g03230 isoform X1 [Cucumis melo]
Length=1057

 Score =   116 bits (291),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLK SNILLD+EMNPKISDFG+ARIFGG ET A NTKRVVGTYGY
Sbjct  849  LLYLHQDSRLRIIHRDLKTSNILLDEEMNPKISDFGLARIFGGKET-ATNTKRVVGTYGY  907

Query  182  MS  187
            MS
Sbjct  908  MS  909



>gb|EEC71606.1| hypothetical protein OsI_04006 [Oryza sativa Indica Group]
Length=257

 Score =   111 bits (278),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 53/62 (85%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLH+ SRFRIIHRDLKASNILLD +MNPKISDFGMARIFG  ETEA NT RVVGTYGY
Sbjct  73   LLYLHKHSRFRIIHRDLKASNILLDIDMNPKISDFGMARIFGSKETEA-NTNRVVGTYGY  131

Query  182  MS  187
            M+
Sbjct  132  MA  133



>gb|KCW72107.1| hypothetical protein EUGRSUZ_E00547 [Eucalyptus grandis]
Length=817

 Score =   116 bits (290),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 53/62 (85%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLH+DSR RIIHRDLKASNILLDKE+NPKISDFGMARIFGG+E +A NT+RVVGTYGY
Sbjct  609  LLYLHRDSRLRIIHRDLKASNILLDKELNPKISDFGMARIFGGNENQA-NTRRVVGTYGY  667

Query  182  MS  187
            M+
Sbjct  668  MA  669



>gb|KCW72108.1| hypothetical protein EUGRSUZ_E00547 [Eucalyptus grandis]
Length=818

 Score =   116 bits (290),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 53/62 (85%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLH+DSR RIIHRDLKASNILLDKE+NPKISDFGMARIFGG+E +A NT+RVVGTYGY
Sbjct  610  LLYLHRDSRLRIIHRDLKASNILLDKELNPKISDFGMARIFGGNENQA-NTRRVVGTYGY  668

Query  182  MS  187
            M+
Sbjct  669  MA  670



>ref|XP_010924050.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Elaeis guineensis]
Length=828

 Score =   116 bits (290),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 53/62 (85%), Positives = 60/62 (97%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK+MNPKISDFG+ARIFGGD+++A  T+RVVGTYGY
Sbjct  624  LLYLHQDSRFRIIHRDLKASNVLLDKDMNPKISDFGVARIFGGDQSDA-YTQRVVGTYGY  682

Query  182  MS  187
            MS
Sbjct  683  MS  684



>ref|XP_008227125.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Prunus mume]
Length=865

 Score =   116 bits (290),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASNILLD E+ PKISDFGMARIFG D+TEA NT+RVVGTYGY
Sbjct  654  LLYLHQDSRFRIIHRDLKASNILLDGELTPKISDFGMARIFGRDQTEA-NTRRVVGTYGY  712

Query  182  MS  187
            MS
Sbjct  713  MS  714



>gb|EPS70219.1| hypothetical protein M569_04543, partial [Genlisea aurea]
Length=738

 Score =   115 bits (289),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRI+HRDLKASNILLD +MNPKISDFGMARIF GD+ EA  TKRVVGTYGY
Sbjct  628  LLYLHQDSRFRIVHRDLKASNILLDADMNPKISDFGMARIFAGDQIEA-QTKRVVGTYGY  686

Query  182  MS  187
            MS
Sbjct  687  MS  688



>ref|XP_006377788.1| hypothetical protein POPTR_0011s12840g [Populus trichocarpa]
 gb|ERP55585.1| hypothetical protein POPTR_0011s12840g [Populus trichocarpa]
Length=816

 Score =   115 bits (289),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLKASN+LLD +MNPKISDFGMARIFGG++TEA NTKRVVGTYGY
Sbjct  609  LLYLHQDSRLRIIHRDLKASNVLLDTDMNPKISDFGMARIFGGNQTEA-NTKRVVGTYGY  667

Query  182  MS  187
            M+
Sbjct  668  MA  669



>gb|AFP33761.1| SRK, partial [Arabidopsis kamchatica subsp. kamchatica]
 gb|AFP33762.1| SRK, partial [Arabidopsis kamchatica subsp. kamchatica]
 gb|AFP33763.1| SRK, partial [Arabidopsis kamchatica subsp. kamchatica]
 gb|AFP33764.1| SRK, partial [Arabidopsis halleri subsp. gemmifera]
Length=857

 Score =   116 bits (290),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 56/62 (90%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASNILLDK+M PKISDFGMARIFG DETEA NT++VVGTYGY
Sbjct  638  LLYLHQDSRFRIIHRDLKASNILLDKDMIPKISDFGMARIFGRDETEA-NTRKVVGTYGY  696

Query  182  MS  187
            MS
Sbjct  697  MS  698



>gb|KFK28717.1| hypothetical protein AALP_AA7G037900 [Arabis alpina]
Length=848

 Score =   116 bits (290),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLK SNILLDK+M PKISDFGMARIFG DETEA NT++VVGTYGY
Sbjct  635  LLYLHQDSRFRIIHRDLKTSNILLDKDMTPKISDFGMARIFGRDETEA-NTRKVVGTYGY  693

Query  182  MS  187
            MS
Sbjct  694  MS  695



>gb|AGC55017.1| S-receptor kinase, partial [Arabidopsis lyrata]
Length=832

 Score =   115 bits (289),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK++ PKISDFGMARIFG DETEA NT++VVGTYGY
Sbjct  627  LLYLHQDSRFRIIHRDLKASNVLLDKDLTPKISDFGMARIFGRDETEA-NTRKVVGTYGY  685

Query  182  MS  187
            MS
Sbjct  686  MS  687



>ref|XP_006391517.1| hypothetical protein EUTSA_v10018116mg [Eutrema salsugineum]
 gb|ESQ28803.1| hypothetical protein EUTSA_v10018116mg [Eutrema salsugineum]
Length=852

 Score =   115 bits (289),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 56/62 (90%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLK SNILLDK M PKISDFGMARIFG DETEA NT+RVVGTYGY
Sbjct  637  LLYLHQDSRFRIIHRDLKVSNILLDKNMTPKISDFGMARIFGRDETEA-NTRRVVGTYGY  695

Query  182  MS  187
            MS
Sbjct  696  MS  697



>gb|KDP20850.1| hypothetical protein JCGZ_21321 [Jatropha curcas]
Length=470

 Score =   113 bits (283),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 53/61 (87%), Positives = 57/61 (93%), Gaps = 1/61 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLH+DSR RIIHRDLKASNILLD E+NPKISDFGMARIFGGD+TE  NTKR+VGTYGY
Sbjct  264  LLYLHRDSRLRIIHRDLKASNILLDGELNPKISDFGMARIFGGDQTEG-NTKRIVGTYGY  322

Query  182  M  184
            M
Sbjct  323  M  323



>ref|XP_009611412.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Nicotiana tomentosiformis]
Length=828

 Score =   115 bits (289),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            L+YLHQDSR RIIHRDLKASN+LLD EMNPKISDFGMAR FGGDET A NT+RVVGTYGY
Sbjct  621  LMYLHQDSRLRIIHRDLKASNVLLDNEMNPKISDFGMARSFGGDETGA-NTRRVVGTYGY  679

Query  182  MS  187
            MS
Sbjct  680  MS  681



>ref|XP_009377332.1| PREDICTED: uncharacterized protein LOC103965953 [Pyrus x bretschneideri]
Length=1291

 Score =   116 bits (291),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2     LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
             LLYLHQDSR RIIHRDLKASN+LLDK+MNPKISDFGMAR+FGGD+TEA  TKRVVGTYGY
Sbjct  1074  LLYLHQDSRLRIIHRDLKASNVLLDKDMNPKISDFGMARLFGGDQTEA-VTKRVVGTYGY  1132

Query  182   MS  187
             M+
Sbjct  1133  MA  1134


 Score =   114 bits (285),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 53/62 (85%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLKASN+LLDK+MNPKISDFG+AR+FGGD+TEA  TKRVVGTYGY
Sbjct  381  LLYLHQDSRLRIIHRDLKASNVLLDKDMNPKISDFGVARLFGGDQTEA-VTKRVVGTYGY  439

Query  182  MS  187
            M+
Sbjct  440  MA  441



>dbj|BAE93137.1| S-receptor kinase [Brassica rapa]
Length=855

 Score =   115 bits (289),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMARIFG DETEA +T++VVGTYGY
Sbjct  644  LLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-DTRKVVGTYGY  702

Query  182  MS  187
            MS
Sbjct  703  MS  704



>gb|ACN52016.1| SRK protein [Brassica cretica]
Length=210

 Score =   110 bits (275),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 53/61 (87%), Positives = 54/61 (89%), Gaps = 1/61 (2%)
 Frame = +2

Query  5    LYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGYM  184
            LYLHQDSRFRIIHRDLK SNILLDK M PKISDFGMARIF  DETEA NT +VVGTYGYM
Sbjct  1    LYLHQDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFARDETEA-NTMKVVGTYGYM  59

Query  185  S  187
            S
Sbjct  60   S  60



>ref|XP_009411995.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11300 [Musa acuminata subsp. malaccensis]
Length=842

 Score =   115 bits (289),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLKASNILLD EMNPKISDFGMARIFGG++ EA NT RVVGTYGY
Sbjct  631  LLYLHQDSRLRIIHRDLKASNILLDAEMNPKISDFGMARIFGGNQDEA-NTNRVVGTYGY  689

Query  182  MS  187
            MS
Sbjct  690  MS  691



>gb|ACO83273.1| SRK [Capsella rubella]
 gb|ACO83274.1| SRK [Capsella rubella]
 gb|ACO83275.1| SRK [Capsella rubella]
 gb|ACO83276.1| SRK [Capsella rubella]
 gb|ACO83277.1| SRK [Capsella rubella]
Length=853

 Score =   115 bits (289),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK M PKISDFGMARIFG DETEA NT++VVGTYGY
Sbjct  638  LLYLHQDSRFRIIHRDLKASNVLLDKYMTPKISDFGMARIFGRDETEA-NTRKVVGTYGY  696

Query  182  MS  187
            MS
Sbjct  697  MS  698



>ref|XP_006388693.1| hypothetical protein POPTR_0118s002202g, partial [Populus trichocarpa]
 gb|ERP47607.1| hypothetical protein POPTR_0118s002202g, partial [Populus trichocarpa]
Length=219

 Score =   110 bits (275),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            L+YLHQDSR RIIHRD+KASNILLD E+NPKISDFG+AR+FGGD+ EA NT RVVGTYGY
Sbjct  12   LVYLHQDSRLRIIHRDIKASNILLDNELNPKISDFGLARLFGGDQVEA-NTNRVVGTYGY  70

Query  182  MS  187
            MS
Sbjct  71   MS  72



>dbj|BAF91409.1| S-locus receptor kinase (kinase domain) [Brassica oleracea]
Length=424

 Score =   113 bits (282),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLK SNILLDK M PKISDFGMARIF  DETEA NTK+VVGTYGY
Sbjct  205  LLYLHQDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFARDETEA-NTKKVVGTYGY  263

Query  182  MS  187
            MS
Sbjct  264  MS  265



>emb|CAB41878.1| SRK5 protein [Brassica oleracea]
Length=848

 Score =   115 bits (289),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMARIFG DETEA +T++VVGTYGY
Sbjct  637  LLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-DTRKVVGTYGY  695

Query  182  MS  187
            MS
Sbjct  696  MS  697



>ref|XP_010907385.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 isoform X1 [Elaeis guineensis]
Length=846

 Score =   115 bits (289),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLKASNILLD++MNPKISDFGMARIFGGD+ E  NT RVVGTYGY
Sbjct  638  LLYLHQDSRLRIIHRDLKASNILLDQDMNPKISDFGMARIFGGDQNEV-NTNRVVGTYGY  696

Query  182  MS  187
            MS
Sbjct  697  MS  698



>ref|XP_002316940.2| hypothetical protein POPTR_0011s13040g [Populus trichocarpa]
 gb|EEE97552.2| hypothetical protein POPTR_0011s13040g [Populus trichocarpa]
Length=784

 Score =   115 bits (289),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLKASN+LLD +MNPKISDFGMARIFGG++TEA NTKRVVGTYGY
Sbjct  577  LLYLHQDSRLRIIHRDLKASNVLLDTDMNPKISDFGMARIFGGNQTEA-NTKRVVGTYGY  635

Query  182  MS  187
            M+
Sbjct  636  MA  637



>ref|NP_193869.1| receptor kinase 3 [Arabidopsis thaliana]
 sp|O81905.1|SD18_ARATH RecName: Full=Receptor-like serine/threonine-protein kinase SD1-8; 
AltName: Full=Arabidopsis thaliana receptor kinase 3; 
AltName: Full=S-domain-1 (SD1) receptor kinase 8; Short=SD1-8; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAA20203.1| receptor-like serine/threonine protein kinase ARK3 [Arabidopsis 
thaliana]
 emb|CAB81245.1| receptor-like serine/threonine protein kinase ARK3 [Arabidopsis 
thaliana]
 dbj|BAC43479.1| putative receptor-like serine/threonine protein kinase ARK3 [Arabidopsis 
thaliana]
 gb|AAP04019.1| putative receptor serine/threonine protein kinase ARK3 [Arabidopsis 
thaliana]
 gb|AEE84446.1| receptor kinase 3 [Arabidopsis thaliana]
Length=850

 Score =   115 bits (289),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 56/62 (90%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASNILLDK M PKISDFGMARIFG DETEA NT++VVGTYGY
Sbjct  636  LLYLHQDSRFRIIHRDLKASNILLDKYMTPKISDFGMARIFGRDETEA-NTRKVVGTYGY  694

Query  182  MS  187
            MS
Sbjct  695  MS  696



>gb|AAB33487.1| ARK3 product/receptor-like serine/threonine protein kinase ARK3 
[Arabidopsis thaliana, Columbia, Peptide, 851 aa]
Length=851

 Score =   115 bits (289),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 56/62 (90%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASNILLDK M PKISDFGMARIFG DETEA NT++VVGTYGY
Sbjct  636  LLYLHQDSRFRIIHRDLKASNILLDKYMTPKISDFGMARIFGRDETEA-NTRKVVGTYGY  694

Query  182  MS  187
            MS
Sbjct  695  MS  696



>ref|XP_006388050.1| hypothetical protein POPTR_0379s00200g [Populus trichocarpa]
 gb|ERP46964.1| hypothetical protein POPTR_0379s00200g [Populus trichocarpa]
Length=551

 Score =   114 bits (285),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLH+DSR RIIHRDLKASNILLD EMNPKISDFGMARIFGG+++EA NT R+VGTYGY
Sbjct  344  LLYLHEDSRLRIIHRDLKASNILLDYEMNPKISDFGMARIFGGNQSEA-NTNRIVGTYGY  402

Query  182  MS  187
            M+
Sbjct  403  MA  404



>gb|AID21612.1| ARK3p [Arabidopsis halleri]
Length=846

 Score =   115 bits (289),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK M PKISDFGMARIFG DETEA NT++VVGTYGY
Sbjct  632  LLYLHQDSRFRIIHRDLKASNVLLDKYMTPKISDFGMARIFGRDETEA-NTRKVVGTYGY  690

Query  182  MS  187
            MS
Sbjct  691  MS  692



>gb|ABV21214.1| At4g21380 [Arabidopsis thaliana]
Length=850

 Score =   115 bits (289),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 56/62 (90%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASNILLDK M PKISDFGMARIFG DETEA NT++VVGTYGY
Sbjct  636  LLYLHQDSRFRIIHRDLKASNILLDKYMTPKISDFGMARIFGRDETEA-NTRKVVGTYGY  694

Query  182  MS  187
            MS
Sbjct  695  MS  696



>ref|XP_008446571.1| PREDICTED: uncharacterized protein LOC103489262 [Cucumis melo]
Length=1667

 Score =   116 bits (291),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLH+DSR RIIHRDLKASNILLDK+MNPKISDFGMARIFGG+E EA NT RVVGTYGY
Sbjct  621  LLYLHRDSRLRIIHRDLKASNILLDKDMNPKISDFGMARIFGGNEVEA-NTIRVVGTYGY  679

Query  182  MS  187
            MS
Sbjct  680  MS  681


 Score =   112 bits (281),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  2     LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
             LLYLH+DSR +IIHRDLK SNILLDK++NPKISDFGMARIFGGDE +A NT RVVGTYGY
Sbjct  1459  LLYLHRDSRLKIIHRDLKVSNILLDKDLNPKISDFGMARIFGGDEVQA-NTVRVVGTYGY  1517

Query  182   MS  187
             MS
Sbjct  1518  MS  1519



>ref|XP_004295386.1| PREDICTED: uncharacterized protein LOC101313198 [Fragaria vesca 
subsp. vesca]
Length=1664

 Score =   116 bits (291),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASNILLD E++PKISDFGMARIFG D+TEA NTK+VVGTYGY
Sbjct  641  LLYLHQDSRFRIIHRDLKASNILLDGELDPKISDFGMARIFGQDQTEA-NTKKVVGTYGY  699

Query  182  MS  187
            MS
Sbjct  700  MS  701


 Score =   105 bits (263),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 50/62 (81%), Positives = 54/62 (87%), Gaps = 1/62 (2%)
 Frame = +2

Query  2     LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
             LLYLHQDSR RIIHRDLKASNILLD EM  KISDFG ARIFGG++TE   T+RV+GTYGY
Sbjct  1457  LLYLHQDSRLRIIHRDLKASNILLDSEMKSKISDFGTARIFGGEQTE-EMTRRVIGTYGY  1515

Query  182   MS  187
             MS
Sbjct  1516  MS  1517



>ref|XP_011029382.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Populus euphratica]
Length=829

 Score =   115 bits (289),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLKASN+LLD +MNPKISDFGMARIFGG++TEA NTKRVVGTYGY
Sbjct  622  LLYLHQDSRLRIIHRDLKASNVLLDTDMNPKISDFGMARIFGGNQTEA-NTKRVVGTYGY  680

Query  182  MS  187
            M+
Sbjct  681  MA  682



>dbj|BAF91404.1| S-locus receptor kinase (kinase domain) [Brassica oleracea]
Length=428

 Score =   113 bits (282),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASNILLDK M PKISDFGMARIF  DETEA NT++VVGTYGY
Sbjct  209  LLYLHQDSRFRIIHRDLKASNILLDKNMIPKISDFGMARIFARDETEA-NTRKVVGTYGY  267

Query  182  MS  187
            MS
Sbjct  268  MS  269



>ref|XP_007021377.1| S-locus lectin protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY12902.1| S-locus lectin protein kinase family protein isoform 1 [Theobroma 
cacao]
Length=815

 Score =   115 bits (288),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLKASN+LLD EMNPKISDFGMAR FGGD+TEA NT RVVGTYGY
Sbjct  608  LLYLHQDSRLRIIHRDLKASNVLLDSEMNPKISDFGMARTFGGDQTEA-NTNRVVGTYGY  666

Query  182  MS  187
            M+
Sbjct  667  MA  668



>gb|ADQ37383.1| unknown [Arabidopsis lyrata]
Length=850

 Score =   115 bits (289),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK M PKISDFGMARIFG DETEA NT++VVGTYGY
Sbjct  636  LLYLHQDSRFRIIHRDLKASNVLLDKYMTPKISDFGMARIFGRDETEA-NTRKVVGTYGY  694

Query  182  MS  187
            MS
Sbjct  695  MS  696



>dbj|BAA31252.1| SRK29 [Brassica rapa]
Length=854

 Score =   115 bits (289),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMARIFG DETEA +T++VVGTYGY
Sbjct  643  LLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-DTRKVVGTYGY  701

Query  182  MS  187
            MS
Sbjct  702  MS  703



>ref|XP_006594644.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like isoform X2 [Glycine max]
Length=820

 Score =   115 bits (288),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLH+DSR RIIHRDLKASN+LLD EMNPKISDFGMAR+FGGD+TEA  TKR+VGTYGY
Sbjct  612  LLYLHRDSRLRIIHRDLKASNVLLDGEMNPKISDFGMARMFGGDQTEA-KTKRIVGTYGY  670

Query  182  MS  187
            MS
Sbjct  671  MS  672



>dbj|BAA83746.1| SRK2-b [Brassica oleracea]
Length=854

 Score =   115 bits (288),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMARIFG DETEA +T++VVGTYGY
Sbjct  643  LLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-DTRKVVGTYGY  701

Query  182  MS  187
            MS
Sbjct  702  MS  703



>emb|CDY52920.1| BnaA04g29270D [Brassica napus]
Length=232

 Score =   110 bits (275),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK+M PKISD G+AR+FG DETEA NT++VVGTYGY
Sbjct  18   LLYLHQDSRFRIIHRDLKASNVLLDKDMAPKISDLGLARMFGRDETEA-NTRKVVGTYGY  76

Query  182  MS  187
            MS
Sbjct  77   MS  78



>ref|XP_009385294.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 [Musa acuminata subsp. malaccensis]
Length=837

 Score =   115 bits (288),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLH+DSR RIIHRDLKASNILLDK+MNPKISDFGMARIFG D+ E  NTKRVVGTYGY
Sbjct  630  LLYLHRDSRLRIIHRDLKASNILLDKDMNPKISDFGMARIFGSDDNE-TNTKRVVGTYGY  688

Query  182  MS  187
            MS
Sbjct  689  MS  690



>ref|XP_003541760.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like isoform X1 [Glycine max]
Length=825

 Score =   115 bits (288),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLH+DSR RIIHRDLKASN+LLD EMNPKISDFGMAR+FGGD+TEA  TKR+VGTYGY
Sbjct  617  LLYLHRDSRLRIIHRDLKASNVLLDGEMNPKISDFGMARMFGGDQTEA-KTKRIVGTYGY  675

Query  182  MS  187
            MS
Sbjct  676  MS  677



>gb|KDP20856.1| hypothetical protein JCGZ_21327 [Jatropha curcas]
Length=729

 Score =   115 bits (287),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 53/62 (85%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLH+DSR RIIHRDLKASNILLD+E+NPKISDFGMARIFGG+E +A NT+RVVGTYGY
Sbjct  520  LLYLHRDSRLRIIHRDLKASNILLDQELNPKISDFGMARIFGGNEDQA-NTRRVVGTYGY  578

Query  182  MS  187
            MS
Sbjct  579  MS  580



>ref|XP_007021378.1| S-locus lectin protein kinase family protein isoform 2, partial 
[Theobroma cacao]
 gb|EOY12903.1| S-locus lectin protein kinase family protein isoform 2, partial 
[Theobroma cacao]
Length=744

 Score =   115 bits (287),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLKASN+LLD EMNPKISDFGMAR FGGD+TEA NT RVVGTYGY
Sbjct  608  LLYLHQDSRLRIIHRDLKASNVLLDSEMNPKISDFGMARTFGGDQTEA-NTNRVVGTYGY  666

Query  182  MS  187
            M+
Sbjct  667  MA  668



>gb|KDP34760.1| hypothetical protein JCGZ_10540 [Jatropha curcas]
Length=655

 Score =   114 bits (286),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            L+YLHQDSR RIIHRDLKASN+LLDK+MNPKISDFG+ARIFGGD+TEA NT RV GTYGY
Sbjct  449  LVYLHQDSRLRIIHRDLKASNVLLDKDMNPKISDFGLARIFGGDQTEA-NTNRVAGTYGY  507

Query  182  MS  187
            MS
Sbjct  508  MS  509



>ref|XP_007021381.1| S-locus lectin protein kinase family protein [Theobroma cacao]
 gb|EOY12906.1| S-locus lectin protein kinase family protein [Theobroma cacao]
Length=1488

 Score =   116 bits (290),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  2     LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
             LLYLHQDSR RIIHRDLKASN+LLD EMNPKISDFGMAR FGGD+TEA NT RVVGTYGY
Sbjct  1280  LLYLHQDSRLRIIHRDLKASNVLLDSEMNPKISDFGMARTFGGDQTEA-NTNRVVGTYGY  1338

Query  182   MS  187
             M+
Sbjct  1339  MA  1340



>gb|AFW84882.1| putative S-locus receptor-like protein kinase family protein 
[Zea mays]
Length=296

 Score =   111 bits (278),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR+RIIHRDLKA+N+LLDKEM PKISDFGMARIFG +ETE  NT++VVGTYGY
Sbjct  87   LLYLHQDSRYRIIHRDLKAANVLLDKEMTPKISDFGMARIFGNEETEI-NTRKVVGTYGY  145

Query  182  MS  187
            MS
Sbjct  146  MS  147



>ref|XP_010247456.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g03230 [Nelumbo nucifera]
Length=840

 Score =   115 bits (288),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLK SNILLDKEMNPKISDFGMARIFG D+T+  NT RVVGTYGY
Sbjct  631  LLYLHQDSRLRIIHRDLKTSNILLDKEMNPKISDFGMARIFGRDQTQG-NTSRVVGTYGY  689

Query  182  MS  187
            MS
Sbjct  690  MS  691



>ref|XP_007022738.1| S-locus lectin protein kinase family protein [Theobroma cacao]
 gb|EOY14263.1| S-locus lectin protein kinase family protein [Theobroma cacao]
Length=425

 Score =   112 bits (281),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLKA N+LLD EMNPKISDFG+AR FGGDETEA NT RVVGTYGY
Sbjct  315  LLYLHQDSRLRIIHRDLKAGNVLLDYEMNPKISDFGLARSFGGDETEA-NTNRVVGTYGY  373

Query  182  MS  187
            MS
Sbjct  374  MS  375



>ref|XP_009345819.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Pyrus x bretschneideri]
Length=850

 Score =   115 bits (288),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASNILLD E+ PKISDFGMARIFG D+TEA NTKRVVG YGY
Sbjct  639  LLYLHQDSRFRIIHRDLKASNILLDGELTPKISDFGMARIFGNDQTEA-NTKRVVGKYGY  697

Query  182  MS  187
            MS
Sbjct  698  MS  699



>gb|KHN19079.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
[Glycine soja]
Length=661

 Score =   114 bits (286),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLH+DSR RIIHRDLKASN+LLD EMNPKISDFGMAR+FGGD+TEA  TKR+VGTYGY
Sbjct  453  LLYLHRDSRLRIIHRDLKASNVLLDGEMNPKISDFGMARMFGGDQTEA-KTKRIVGTYGY  511

Query  182  MS  187
            MS
Sbjct  512  MS  513



>ref|XP_009105220.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Brassica rapa]
 dbj|BAC76056.1| S receptor kinase [Brassica rapa]
Length=859

 Score =   115 bits (288),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMARIFG DETEA +T++VVGTYGY
Sbjct  644  LLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGQDETEA-DTRKVVGTYGY  702

Query  182  MS  187
            MS
Sbjct  703  MS  704



>dbj|BAE93138.1| S-receptor kinase [Brassica rapa]
Length=854

 Score =   115 bits (288),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMARIFG DETEA +T++VVGTYGY
Sbjct  643  LLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-DTRKVVGTYGY  701

Query  182  MS  187
            MS
Sbjct  702  MS  703



>gb|EYU33574.1| hypothetical protein MIMGU_mgv1a0256212mg, partial [Erythranthe 
guttata]
Length=628

 Score =   114 bits (286),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLKASNILLD EMNPKISDFGMAR FGG+ETEA  T+RVVGTYGY
Sbjct  421  LLYLHQDSRLRIIHRDLKASNILLDSEMNPKISDFGMARSFGGNETEA-KTRRVVGTYGY  479

Query  182  MS  187
            MS
Sbjct  480  MS  481



>ref|XP_006370566.1| hypothetical protein POPTR_0001s43850g [Populus trichocarpa]
 gb|ERP67135.1| hypothetical protein POPTR_0001s43850g [Populus trichocarpa]
Length=819

 Score =   115 bits (288),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RI+HRDLKASN+LLDK+MNPKISDFG+AR+FGGD+TE N T RVVGTYGY
Sbjct  611  LLYLHQDSRLRIVHRDLKASNVLLDKDMNPKISDFGLARMFGGDQTEGNTT-RVVGTYGY  669

Query  182  MS  187
            M+
Sbjct  670  MA  671



>dbj|BAF91388.1| S-locus receptor kinase (kinase domain) [Brassica rapa]
Length=438

 Score =   112 bits (281),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASNILLDK M PKISDFGMARIF  DETEA NT++VVGTYGY
Sbjct  219  LLYLHQDSRFRIIHRDLKASNILLDKNMIPKISDFGMARIFARDETEA-NTRKVVGTYGY  277

Query  182  MS  187
            MS
Sbjct  278  MS  279



>ref|XP_009611413.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Nicotiana tomentosiformis]
Length=797

 Score =   115 bits (288),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            L+YLHQDSR RIIHRDLKASN+LLD EMNPKISDFGMAR FGGDET A NT+RVVGTYGY
Sbjct  621  LMYLHQDSRLRIIHRDLKASNVLLDNEMNPKISDFGMARSFGGDETGA-NTRRVVGTYGY  679

Query  182  MS  187
            MS
Sbjct  680  MS  681



>gb|AGN12871.1| putative receptor kinase 3 [Leavenworthia alabamica]
Length=815

 Score =   115 bits (288),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            +LYLHQDSRFRIIHRDLKASN+LLDK M PKISDFGMARIFG DETEA NT++VVGTYGY
Sbjct  599  MLYLHQDSRFRIIHRDLKASNVLLDKNMTPKISDFGMARIFGRDETEA-NTRKVVGTYGY  657

Query  182  MS  187
            MS
Sbjct  658  MS  659



>ref|XP_009388065.1| PREDICTED: putative G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g61610, partial [Musa acuminata subsp. 
malaccensis]
Length=643

 Score =   114 bits (286),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLK SNILLD EMNPKISDFGMARIFGG++ EA NT RVVGTYGY
Sbjct  575  LLYLHQDSRLRIIHRDLKTSNILLDAEMNPKISDFGMARIFGGNQDEA-NTNRVVGTYGY  633

Query  182  MS  187
            MS
Sbjct  634  MS  635



>ref|XP_006370573.1| hypothetical protein POPTR_0001s43900g [Populus trichocarpa]
 gb|ERP67142.1| hypothetical protein POPTR_0001s43900g [Populus trichocarpa]
Length=490

 Score =   113 bits (282),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLK+SN+LLDK+MNPKISDFG+AR FGGD+TE  NT RVVGTYGY
Sbjct  283  LLYLHQDSRLRIIHRDLKSSNVLLDKDMNPKISDFGLARTFGGDQTEG-NTSRVVGTYGY  341

Query  182  MS  187
            M+
Sbjct  342  MA  343



>gb|AFP33758.1| SRK [Arabidopsis kamchatica subsp. kamchatica]
 gb|AFP33759.1| SRK [Arabidopsis kamchatica subsp. kamchatica]
 gb|AFP33760.1| SRK [Arabidopsis halleri subsp. gemmifera]
Length=840

 Score =   115 bits (288),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLKASN+LLDK+M PKISDFGMARIFG DETEA NT+RVVGTYGY
Sbjct  634  LLYLHQDSRCRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-NTRRVVGTYGY  692

Query  182  MS  187
            MS
Sbjct  693  MS  694



>gb|AFN53707.1| hypothetical protein [Linum usitatissimum]
Length=874

 Score =   115 bits (288),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLH+DSR R+IHRDLKASN+LLD EMNPKISDFGMARIFGG+  EA NT RVVGTYGY
Sbjct  741  LLYLHRDSRLRVIHRDLKASNVLLDDEMNPKISDFGMARIFGGNPNEAANTIRVVGTYGY  800

Query  182  MS  187
            MS
Sbjct  801  MS  802



>ref|XP_006370405.1| hypothetical protein POPTR_0001s42300g [Populus trichocarpa]
 gb|ERP66974.1| hypothetical protein POPTR_0001s42300g [Populus trichocarpa]
Length=792

 Score =   115 bits (287),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RI+HRDLKASN+LLDK+MNPKISDFG+AR+FGGD+TE N T RVVGTYGY
Sbjct  584  LLYLHQDSRLRIVHRDLKASNVLLDKDMNPKISDFGLARMFGGDQTEGNTT-RVVGTYGY  642

Query  182  MS  187
            M+
Sbjct  643  MA  644



>ref|XP_004295873.1| PREDICTED: uncharacterized protein LOC101296759 [Fragaria vesca 
subsp. vesca]
Length=3273

 Score =   116 bits (290),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLKASN+LLD E+NPKISDFG+AR FGGDETEA NTKRVVGTYGY
Sbjct  624  LLYLHQDSRLRIIHRDLKASNVLLDYELNPKISDFGIARSFGGDETEA-NTKRVVGTYGY  682

Query  182  MS  187
            MS
Sbjct  683  MS  684


 Score =   102 bits (253),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 1/62 (2%)
 Frame = +2

Query  2     LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
             LLYLHQDSR RIIHRDLK+SNILLD E+ PKISDFG+ARIF  ++TE   TKRV+GTYGY
Sbjct  3065  LLYLHQDSRLRIIHRDLKSSNILLDDELAPKISDFGIARIFEQNQTEG-KTKRVIGTYGY  3123

Query  182   MS  187
             MS
Sbjct  3124  MS  3125



>dbj|BAF56998.1| S receptor kinase [Brassica napus]
Length=855

 Score =   115 bits (287),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMARIFG DETEA +T++VVGTYGY
Sbjct  641  LLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-DTRKVVGTYGY  699

Query  182  MS  187
            MS
Sbjct  700  MS  701



>ref|XP_004295782.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like [Fragaria vesca subsp. vesca]
Length=1396

 Score =   115 bits (289),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  2     LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
             LLYLHQDSR RIIHRDLKASN+LLDKEMNPKISDFGMAR FGGDETE   T+RVVGTYGY
Sbjct  1175  LLYLHQDSRLRIIHRDLKASNVLLDKEMNPKISDFGMARTFGGDETEG-VTRRVVGTYGY  1233

Query  182   MS  187
             M+
Sbjct  1234  MA  1235


 Score =   114 bits (286),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLKASN+LLD+EMNPKISDFG+AR FGGD+TE  NT RVVGTYGY
Sbjct  607  LLYLHQDSRLRIIHRDLKASNVLLDREMNPKISDFGLARTFGGDQTEG-NTNRVVGTYGY  665

Query  182  MS  187
            M+
Sbjct  666  MA  667



>ref|XP_010240981.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-13 [Nelumbo nucifera]
 ref|XP_010240982.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-13 [Nelumbo nucifera]
Length=847

 Score =   115 bits (287),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLH+DSR +IIHRDLKASNILLDKEMNPKISDFGMARIFGG + E  NTKRVVGTYGY
Sbjct  639  LLYLHRDSRLKIIHRDLKASNILLDKEMNPKISDFGMARIFGGSQDE-ENTKRVVGTYGY  697

Query  182  MS  187
            MS
Sbjct  698  MS  699



>ref|XP_006391515.1| hypothetical protein EUTSA_v10018118mg [Eutrema salsugineum]
 gb|ESQ28801.1| hypothetical protein EUTSA_v10018118mg [Eutrema salsugineum]
Length=848

 Score =   115 bits (287),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 56/62 (90%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASNILLDK M PKISDFGMARIFG DETEA NT+ VVGTYGY
Sbjct  635  LLYLHQDSRFRIIHRDLKASNILLDKNMTPKISDFGMARIFGRDETEA-NTRNVVGTYGY  693

Query  182  MS  187
            MS
Sbjct  694  MS  695



>gb|AAS94095.1| S-locus receptor kinase [Raphanus sativus]
Length=290

 Score =   111 bits (277),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 55/62 (89%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLK SNILLDK M PKISDFGMARIF  DETEA NT +VVGTYGY
Sbjct  71   LLYLHQDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFARDETEA-NTMKVVGTYGY  129

Query  182  MS  187
            MS
Sbjct  130  MS  131



>emb|CAB41879.1| SRK15 protein [Brassica oleracea var. viridis]
Length=849

 Score =   115 bits (287),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMARIFG DETEA +T++VVGTYGY
Sbjct  634  LLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-DTRKVVGTYGY  692

Query  182  MS  187
            MS
Sbjct  693  MS  694



>ref|XP_010456965.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g03230 [Camelina sativa]
Length=967

 Score =   115 bits (288),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLK SNILLD+EMNPKISDFG+ARIFGG ET A NT RVVGTYGY
Sbjct  757  LLYLHQDSRLRIIHRDLKTSNILLDEEMNPKISDFGLARIFGGSETSA-NTNRVVGTYGY  815

Query  182  MS  187
            MS
Sbjct  816  MS  817



>emb|CDY07469.1| BnaA07g25480D [Brassica napus]
Length=492

 Score =   112 bits (281),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFR+IHRDLKASNILLDK M PKISDFGMARIFG +ETEA NT++VVGTYGY
Sbjct  277  LLYLHQDSRFRVIHRDLKASNILLDKNMTPKISDFGMARIFGREETEA-NTRKVVGTYGY  335

Query  182  MS  187
            MS
Sbjct  336  MS  337



>ref|XP_010422487.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g03230 isoform X3 [Camelina sativa]
Length=988

 Score =   115 bits (288),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLK SNILLD+EMNPKISDFG+ARIFGG ET A NT RVVGTYGY
Sbjct  778  LLYLHQDSRLRIIHRDLKTSNILLDEEMNPKISDFGLARIFGGSETSA-NTNRVVGTYGY  836

Query  182  MS  187
            MS
Sbjct  837  MS  838



>ref|XP_010422486.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g03230 isoform X2 [Camelina sativa]
Length=989

 Score =   115 bits (288),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLK SNILLD+EMNPKISDFG+ARIFGG ET A NT RVVGTYGY
Sbjct  779  LLYLHQDSRLRIIHRDLKTSNILLDEEMNPKISDFGLARIFGGSETSA-NTNRVVGTYGY  837

Query  182  MS  187
            MS
Sbjct  838  MS  839



>ref|NP_192232.5| G-type lectin S-receptor-like serine/threonine-protein kinase 
[Arabidopsis thaliana]
 gb|AEE82295.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
[Arabidopsis thaliana]
Length=1010

 Score =   115 bits (288),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLK SNILLD+EMNPKISDFG+ARIFGG ET A NT RVVGTYGY
Sbjct  800  LLYLHQDSRLRIIHRDLKTSNILLDEEMNPKISDFGLARIFGGSETSA-NTNRVVGTYGY  858

Query  182  MS  187
            MS
Sbjct  859  MS  860



>dbj|BAF57002.1| S receptor kinase [Brassica napus]
 emb|CDY36217.1| BnaC06g27610D [Brassica napus]
Length=856

 Score =   115 bits (287),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMARIFG DETEA +T++VVGTYGY
Sbjct  641  LLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-DTRKVVGTYGY  699

Query  182  MS  187
            MS
Sbjct  700  MS  701



>dbj|BAE95187.1| S-locus receptor kinase [Brassica oleracea]
Length=856

 Score =   115 bits (287),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMARIFG DETEA +T++VVGTYGY
Sbjct  641  LLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-DTRKVVGTYGY  699

Query  182  MS  187
            MS
Sbjct  700  MS  701



>ref|XP_010422485.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g03230 isoform X1 [Camelina sativa]
Length=1017

 Score =   115 bits (288),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLK SNILLD+EMNPKISDFG+ARIFGG ET A NT RVVGTYGY
Sbjct  807  LLYLHQDSRLRIIHRDLKTSNILLDEEMNPKISDFGLARIFGGSETSA-NTNRVVGTYGY  865

Query  182  MS  187
            MS
Sbjct  866  MS  867



>gb|EYU27870.1| hypothetical protein MIMGU_mgv1a002421mg [Erythranthe guttata]
Length=677

 Score =   114 bits (285),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLH+DSR RIIHRDLKASNILLD+EMNPKISDFGMARIFGG++ EA NT RVVGTYGY
Sbjct  469  LLYLHRDSRLRIIHRDLKASNILLDEEMNPKISDFGMARIFGGNQNEA-NTNRVVGTYGY  527

Query  182  MS  187
            M+
Sbjct  528  MA  529



>emb|CDY39268.1| BnaC06g27230D [Brassica napus]
Length=848

 Score =   115 bits (287),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK M PKISDFGMARIFG DETEA NT++VVGTYGY
Sbjct  633  LLYLHQDSRFRIIHRDLKASNVLLDKNMTPKISDFGMARIFGPDETEA-NTRKVVGTYGY  691

Query  182  MS  187
            M+
Sbjct  692  MA  693



>gb|ABS53282.1| S-locus lectin protein kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|ABS53302.1| S-locus lectin protein kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=173

 Score =   108 bits (270),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLH+DSR RIIHRDLK SN+LLD EMNPKISDFGMARIFGG++ EA NT RVVGTYGY
Sbjct  68   LLYLHRDSRLRIIHRDLKVSNVLLDAEMNPKISDFGMARIFGGNQNEA-NTVRVVGTYGY  126

Query  182  MS  187
            MS
Sbjct  127  MS  128



>gb|KDO37835.1| hypothetical protein CISIN_1g043872mg, partial [Citrus sinensis]
Length=198

 Score =   109 bits (272),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLKASN+LLD +MNPKISDFG+AR FGGDETE  NT RVVGTYGY
Sbjct  98   LLYLHQDSRLRIIHRDLKASNVLLDHDMNPKISDFGLARAFGGDETEG-NTYRVVGTYGY  156

Query  182  MS  187
            M+
Sbjct  157  MA  158



>ref|XP_006433098.1| hypothetical protein CICLE_v10000574mg [Citrus clementina]
 gb|ESR46338.1| hypothetical protein CICLE_v10000574mg [Citrus clementina]
Length=633

 Score =   114 bits (285),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLH+DSR RIIHRDLKASN+LLD EMNPKISDFGMARIFGG+++EA NT R+VGTYGY
Sbjct  425  LLYLHEDSRLRIIHRDLKASNVLLDHEMNPKISDFGMARIFGGNQSEA-NTNRIVGTYGY  483

Query  182  MS  187
            M+
Sbjct  484  MA  485



>ref|XP_010927549.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X3 [Elaeis guineensis]
Length=782

 Score =   114 bits (286),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 53/62 (85%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLH+DSR RIIHRDLKASNILLDK+MNPKISDFG+ARIF GDET   NT+RVVGTYGY
Sbjct  566  LLYLHRDSRLRIIHRDLKASNILLDKDMNPKISDFGLARIFRGDETMLLNTQRVVGTYGY  625

Query  182  MS  187
            MS
Sbjct  626  MS  627



>ref|XP_006377805.1| hypothetical protein POPTR_0011s130601g, partial [Populus trichocarpa]
 gb|ERP55602.1| hypothetical protein POPTR_0011s130601g, partial [Populus trichocarpa]
Length=230

 Score =   109 bits (273),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLKASN+LLD  MNPKISDFGMARIFGGD+ EA NT R+VGTYGY
Sbjct  23   LLYLHQDSRLRIIHRDLKASNVLLDNSMNPKISDFGMARIFGGDQIEA-NTNRIVGTYGY  81

Query  182  MS  187
            +S
Sbjct  82   IS  83



>gb|ACN52024.1| SRK protein [Brassica cretica]
Length=203

 Score =   109 bits (272),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 54/62 (87%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLK SNILLDK M PKISDFGMARIF  DETEA NT  VVGTYGY
Sbjct  1    LLYLHQDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFARDETEA-NTMTVVGTYGY  59

Query  182  MS  187
            MS
Sbjct  60   MS  61



>ref|XP_006391306.1| hypothetical protein EUTSA_v10018108mg [Eutrema salsugineum]
 gb|ESQ28592.1| hypothetical protein EUTSA_v10018108mg [Eutrema salsugineum]
Length=872

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK M PKISDFGMARIFG DETEA NT++VVGTYGY
Sbjct  658  LLYLHQDSRFRIIHRDLKASNVLLDKNMTPKISDFGMARIFGQDETEA-NTRKVVGTYGY  716

Query  182  MS  187
            MS
Sbjct  717  MS  718



>ref|XP_010522657.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g03230 isoform X6 [Tarenaya hassleriana]
Length=821

 Score =   114 bits (286),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLK SNILLD+EMNPKISDFG+ARIFGG ET A NT RVVGTYGY
Sbjct  613  LLYLHQDSRLRIIHRDLKTSNILLDEEMNPKISDFGLARIFGGKETAA-NTNRVVGTYGY  671

Query  182  MS  187
            MS
Sbjct  672  MS  673



>ref|XP_010927531.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Elaeis guineensis]
Length=823

 Score =   114 bits (286),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 53/62 (85%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLH+DSR RIIHRDLKASNILLDK+MNPKISDFG+ARIF GDET   NT+RVVGTYGY
Sbjct  607  LLYLHRDSRLRIIHRDLKASNILLDKDMNPKISDFGLARIFRGDETMLLNTQRVVGTYGY  666

Query  182  MS  187
            MS
Sbjct  667  MS  668



>ref|XP_007148276.1| hypothetical protein PHAVU_006G194700g [Phaseolus vulgaris]
 gb|ESW20270.1| hypothetical protein PHAVU_006G194700g [Phaseolus vulgaris]
Length=829

 Score =   114 bits (286),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            +LYLH+DSR RIIHRDLKASN+LLD EMNPKISDFGMAR+FGGD+TEA  TKRVVGTYGY
Sbjct  621  VLYLHRDSRLRIIHRDLKASNVLLDSEMNPKISDFGMARMFGGDQTEA-KTKRVVGTYGY  679

Query  182  MS  187
            M+
Sbjct  680  MA  681



>gb|AIZ68213.1| receptor-like serine/threonine-protein kinase SD1-8 [Galtonia 
saundersiae]
Length=829

 Score =   114 bits (286),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 53/62 (85%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKA NILLD +MNPKISDFG+ARIFGGDET+   T+RVVGTYGY
Sbjct  620  LLYLHQDSRFRIIHRDLKAGNILLDGDMNPKISDFGLARIFGGDETK-TKTRRVVGTYGY  678

Query  182  MS  187
            MS
Sbjct  679  MS  680



>ref|XP_006452092.1| hypothetical protein CICLE_v10010321mg, partial [Citrus clementina]
 gb|ESR65332.1| hypothetical protein CICLE_v10010321mg, partial [Citrus clementina]
Length=622

 Score =   114 bits (284),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 50/62 (81%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            ++YLHQDSR RIIHRDLKASN+LLD++MNPKISDFG+AR FGGDETE  NTKRV+GTYGY
Sbjct  415  VMYLHQDSRLRIIHRDLKASNVLLDQDMNPKISDFGLARAFGGDETEG-NTKRVIGTYGY  473

Query  182  MS  187
            M+
Sbjct  474  MA  475



>ref|XP_006370627.1| hypothetical protein POPTR_0001s44380g [Populus trichocarpa]
 gb|ERP67196.1| hypothetical protein POPTR_0001s44380g [Populus trichocarpa]
Length=814

 Score =   114 bits (286),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RI+HRDLKASN+LLDK+MNPKISDFG+AR+FGGD+TE N T RVVGTYGY
Sbjct  606  LLYLHQDSRLRIVHRDLKASNVLLDKDMNPKISDFGLARMFGGDQTEGNTT-RVVGTYGY  664

Query  182  MS  187
            M+
Sbjct  665  MA  666



>ref|XP_010665760.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=864

 Score =   114 bits (286),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR+RI+HRD+KASNILLD +MNPKISDFGMARIFGGD+TE  NT+RVVGTYGY
Sbjct  654  LLYLHQDSRYRIVHRDMKASNILLDGDMNPKISDFGMARIFGGDQTEG-NTRRVVGTYGY  712

Query  182  MS  187
            M+
Sbjct  713  MA  714



>ref|XP_010665759.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=867

 Score =   114 bits (286),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR+RI+HRD+KASNILLD +MNPKISDFGMARIFGGD+TE  NT+RVVGTYGY
Sbjct  657  LLYLHQDSRYRIVHRDMKASNILLDGDMNPKISDFGMARIFGGDQTEG-NTRRVVGTYGY  715

Query  182  MS  187
            M+
Sbjct  716  MA  717



>sp|Q9ZR08.3|Y4230_ARATH RecName: Full=G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g03230; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD14451.1| putative receptor kinase [Arabidopsis thaliana]
 emb|CAB77808.1| putative receptor kinase [Arabidopsis thaliana]
Length=852

 Score =   114 bits (286),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLK SNILLD+EMNPKISDFG+ARIFGG ET A NT RVVGTYGY
Sbjct  642  LLYLHQDSRLRIIHRDLKTSNILLDEEMNPKISDFGLARIFGGSETSA-NTNRVVGTYGY  700

Query  182  MS  187
            MS
Sbjct  701  MS  702



>gb|ABS53280.1| S-locus lectin protein kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|ABS53281.1| S-locus lectin protein kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|ABS53283.1| S-locus lectin protein kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|ABS53284.1| S-locus lectin protein kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|ABS53285.1| S-locus lectin protein kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|ABS53286.1| S-locus lectin protein kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|ABS53287.1| S-locus lectin protein kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|ABS53288.1| S-locus lectin protein kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|ABS53289.1| S-locus lectin protein kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|ABS53290.1| S-locus lectin protein kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|ABS53291.1| S-locus lectin protein kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|ABS53292.1| S-locus lectin protein kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|ABS53293.1| S-locus lectin protein kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|ABS53294.1| S-locus lectin protein kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|ABS53295.1| S-locus lectin protein kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|ABS53296.1| S-locus lectin protein kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|ABS53297.1| S-locus lectin protein kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|ABS53298.1| S-locus lectin protein kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|ABS53299.1| S-locus lectin protein kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|ABS53300.1| S-locus lectin protein kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|ABS53301.1| S-locus lectin protein kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|ABS53303.1| S-locus lectin protein kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=173

 Score =   108 bits (269),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLH+DSR RIIHRDLK SN+LLD EMNPKISDFGMARIFGG++ EA NT RVVGTYGY
Sbjct  68   LLYLHRDSRLRIIHRDLKVSNVLLDAEMNPKISDFGMARIFGGNQNEA-NTVRVVGTYGY  126

Query  182  MS  187
            MS
Sbjct  127  MS  128



>ref|XP_010522656.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g03230 isoform X5 [Tarenaya hassleriana]
Length=883

 Score =   114 bits (286),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLK SNILLD+EMNPKISDFG+ARIFGG ET A NT RVVGTYGY
Sbjct  675  LLYLHQDSRLRIIHRDLKTSNILLDEEMNPKISDFGLARIFGGKETAA-NTNRVVGTYGY  733

Query  182  MS  187
            MS
Sbjct  734  MS  735



>ref|XP_006370371.1| S-locus protein kinase [Populus trichocarpa]
 gb|ERP66940.1| S-locus protein kinase [Populus trichocarpa]
Length=831

 Score =   114 bits (286),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLKASNILLD EMNPKISDFGMAR FGGDET A NT R+VGTYGY
Sbjct  624  LLYLHQDSRLRIIHRDLKASNILLDYEMNPKISDFGMARSFGGDETSA-NTSRIVGTYGY  682

Query  182  MS  187
            MS
Sbjct  683  MS  684



>ref|XP_011030922.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Populus euphratica]
Length=864

 Score =   114 bits (286),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 55/62 (89%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLK SNILLD+EMNPKISDFGMAR FGG+E EA NTKRVVGTYGY
Sbjct  657  LLYLHQDSRLRIIHRDLKPSNILLDEEMNPKISDFGMARSFGGNEIEA-NTKRVVGTYGY  715

Query  182  MS  187
            MS
Sbjct  716  MS  717



>ref|XP_006646397.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like [Oryza brachyantha]
Length=788

 Score =   114 bits (286),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR+RIIHRDLKASN+LLDKEM PKISDFGMAR+FG +ETE  NT++VVGTYGY
Sbjct  565  LLYLHQDSRYRIIHRDLKASNVLLDKEMTPKISDFGMARMFGSEETEI-NTRKVVGTYGY  623

Query  182  MS  187
            MS
Sbjct  624  MS  625



>ref|XP_009402802.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 [Musa acuminata subsp. malaccensis]
Length=826

 Score =   114 bits (286),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLH+DSR RIIHRDLKA+NILLDK+MNPKISDFGMARIFG D+ E+ NTKRVVGTYGY
Sbjct  619  LLYLHRDSRLRIIHRDLKAANILLDKDMNPKISDFGMARIFGSDDNES-NTKRVVGTYGY  677

Query  182  MS  187
            MS
Sbjct  678  MS  679



>ref|XP_006377792.1| hypothetical protein POPTR_0011s12880g [Populus trichocarpa]
 gb|ERP55589.1| hypothetical protein POPTR_0011s12880g [Populus trichocarpa]
Length=750

 Score =   114 bits (285),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 53/62 (85%), Positives = 59/62 (95%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLKASN+LLD +M+PKISDFG+AR+FGGDETEA NTK+VVGTYGY
Sbjct  543  LLYLHQDSRLRIIHRDLKASNVLLDSKMDPKISDFGLARMFGGDETEA-NTKKVVGTYGY  601

Query  182  MS  187
            MS
Sbjct  602  MS  603



>ref|XP_010907389.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 [Elaeis guineensis]
Length=840

 Score =   114 bits (286),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 53/62 (85%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLH+DSR R+IHRDLKASNILLD+EMNPKISDFGMARIFG D+ E  NTKRVVGTYGY
Sbjct  633  LLYLHRDSRLRVIHRDLKASNILLDEEMNPKISDFGMARIFGNDDNE-TNTKRVVGTYGY  691

Query  182  MS  187
            MS
Sbjct  692  MS  693



>ref|XP_006452085.1| hypothetical protein CICLE_v10010368mg, partial [Citrus clementina]
 gb|ESR65325.1| hypothetical protein CICLE_v10010368mg, partial [Citrus clementina]
Length=750

 Score =   114 bits (285),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLKASN+LLD++MNPKISDFG+AR FGGDETE  NT RVVGTYGY
Sbjct  543  LLYLHQDSRLRIIHRDLKASNVLLDQDMNPKISDFGLARTFGGDETEG-NTNRVVGTYGY  601

Query  182  MS  187
            M+
Sbjct  602  MA  603



>gb|AAP92126.1| receptor-like protein kinase ARK1 [Oryza sativa]
Length=835

 Score =   114 bits (286),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR+RIIHRDLKASN+LLDKEM PKISDFGMAR+FG +ETE  NT++VVGTYGY
Sbjct  626  LLYLHQDSRYRIIHRDLKASNVLLDKEMTPKISDFGMARMFGSEETEI-NTRKVVGTYGY  684

Query  182  MS  187
            MS
Sbjct  685  MS  686



>ref|NP_001044463.1| Os01g0784700 [Oryza sativa Japonica Group]
 dbj|BAF06377.1| Os01g0784700 [Oryza sativa Japonica Group]
Length=835

 Score =   114 bits (286),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR+RIIHRDLKASN+LLDKEM PKISDFGMAR+FG +ETE  NT++VVGTYGY
Sbjct  626  LLYLHQDSRYRIIHRDLKASNVLLDKEMTPKISDFGMARMFGSEETEI-NTRKVVGTYGY  684

Query  182  MS  187
            MS
Sbjct  685  MS  686



>ref|XP_010522655.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g03230 isoform X4 [Tarenaya hassleriana]
Length=973

 Score =   114 bits (286),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLK SNILLD+EMNPKISDFG+ARIFGG ET A NT RVVGTYGY
Sbjct  765  LLYLHQDSRLRIIHRDLKTSNILLDEEMNPKISDFGLARIFGGKETAA-NTNRVVGTYGY  823

Query  182  MS  187
            MS
Sbjct  824  MS  825



>ref|XP_010522654.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g03230 isoform X3 [Tarenaya hassleriana]
Length=980

 Score =   114 bits (286),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLK SNILLD+EMNPKISDFG+ARIFGG ET A NT RVVGTYGY
Sbjct  772  LLYLHQDSRLRIIHRDLKTSNILLDEEMNPKISDFGLARIFGGKETAA-NTNRVVGTYGY  830

Query  182  MS  187
            MS
Sbjct  831  MS  832



>dbj|BAD53361.1| putative receptor-like protein kinase ARK1 [Oryza sativa Japonica 
Group]
 gb|EEE55505.1| hypothetical protein OsJ_03704 [Oryza sativa Japonica Group]
Length=846

 Score =   114 bits (286),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR+RIIHRDLKASN+LLDKEM PKISDFGMAR+FG +ETE  NT++VVGTYGY
Sbjct  637  LLYLHQDSRYRIIHRDLKASNVLLDKEMTPKISDFGMARMFGSEETEI-NTRKVVGTYGY  695

Query  182  MS  187
            MS
Sbjct  696  MS  697



>ref|NP_001288457.1| receptor-like serine/threonine-protein kinase SD1-8 precursor 
[Zea mays]
 gb|ACG43500.1| serine/threonine-protein kinase receptor precursor [Zea mays]
Length=843

 Score =   114 bits (286),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR+RIIHRDLKA+N+LLDKEM PKISDFGMARIFG +ETE  NT++VVGTYGY
Sbjct  634  LLYLHQDSRYRIIHRDLKAANVLLDKEMTPKISDFGMARIFGNEETEI-NTRKVVGTYGY  692

Query  182  MS  187
            MS
Sbjct  693  MS  694



>ref|XP_010522653.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g03230 isoform X2 [Tarenaya hassleriana]
Length=989

 Score =   114 bits (286),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLK SNILLD+EMNPKISDFG+ARIFGG ET A NT RVVGTYGY
Sbjct  781  LLYLHQDSRLRIIHRDLKTSNILLDEEMNPKISDFGLARIFGGKETAA-NTNRVVGTYGY  839

Query  182  MS  187
            MS
Sbjct  840  MS  841



>ref|XP_009115144.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
isoform X1 [Brassica rapa]
Length=887

 Score =   114 bits (286),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR R+IHRDLKASN+LLDK+M PKISDFGMARIFG DETEA NT++VVGTYGY
Sbjct  677  LLYLHQDSRLRVIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-NTRKVVGTYGY  735

Query  182  MS  187
            MS
Sbjct  736  MS  737



>ref|XP_010522650.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g03230 isoform X1 [Tarenaya hassleriana]
 ref|XP_010522652.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g03230 isoform X1 [Tarenaya hassleriana]
Length=1013

 Score =   114 bits (286),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLK SNILLD+EMNPKISDFG+ARIFGG ET A NT RVVGTYGY
Sbjct  805  LLYLHQDSRLRIIHRDLKTSNILLDEEMNPKISDFGLARIFGGKETAA-NTNRVVGTYGY  863

Query  182  MS  187
            MS
Sbjct  864  MS  865



>ref|XP_006413786.1| hypothetical protein EUTSA_v10025088mg [Eutrema salsugineum]
 gb|ESQ55239.1| hypothetical protein EUTSA_v10025088mg [Eutrema salsugineum]
Length=476

 Score =   112 bits (280),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASN+LLDK+M PKISDFGMARIFG DETEA  T++VVGTYGY
Sbjct  262  LLYLHQDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-ITRKVVGTYGY  320

Query  182  MS  187
            MS
Sbjct  321  MS  322



>ref|XP_008657161.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Zea mays]
Length=864

 Score =   114 bits (286),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR+RIIHRDLKA+N+LLDKEM PKISDFGMARIFG +ETE  NT++VVGTYGY
Sbjct  655  LLYLHQDSRYRIIHRDLKAANVLLDKEMTPKISDFGMARIFGNEETEI-NTRKVVGTYGY  713

Query  182  MS  187
            MS
Sbjct  714  MS  715



>ref|XP_009115145.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
isoform X2 [Brassica rapa]
Length=855

 Score =   114 bits (286),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR R+IHRDLKASN+LLDK+M PKISDFGMARIFG DETEA NT++VVGTYGY
Sbjct  645  LLYLHQDSRLRVIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETEA-NTRKVVGTYGY  703

Query  182  MS  187
            MS
Sbjct  704  MS  705



>ref|XP_004970203.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8-like 
[Setaria italica]
Length=867

 Score =   114 bits (286),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR+RIIHRDLKA+N+LLDKEM PKISDFGMARIFG +ETE  NT++VVGTYGY
Sbjct  659  LLYLHQDSRYRIIHRDLKAANVLLDKEMTPKISDFGMARIFGNEETEI-NTRKVVGTYGY  717

Query  182  MS  187
            MS
Sbjct  718  MS  719



>ref|XP_002872790.1| S-locus lectin protein kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH49049.1| S-locus lectin protein kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=852

 Score =   114 bits (285),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLK SNILLD+EMNPKISDFG+ARIFGG ET A NT RVVGTYGY
Sbjct  642  LLYLHQDSRLRIIHRDLKTSNILLDEEMNPKISDFGLARIFGGSETSA-NTNRVVGTYGY  700

Query  182  MS  187
            MS
Sbjct  701  MS  702



>gb|AAS94091.1| S-locus receptor kinase [Raphanus sativus]
Length=290

 Score =   110 bits (275),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 56/62 (90%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSRFRIIHRDLKASNILLDK M PKISDFGMARIF  DETEA  T++VVGTYGY
Sbjct  71   LLYLHQDSRFRIIHRDLKASNILLDKNMIPKISDFGMARIFERDETEA-KTRKVVGTYGY  129

Query  182  MS  187
            MS
Sbjct  130  MS  131



>ref|XP_004487639.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like [Cicer arietinum]
Length=834

 Score =   114 bits (285),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            L+YLHQDSR RIIHRDLKASN+LLDKE+NPKISDFGMARIFGGD+ E  NT+R+VGTYGY
Sbjct  628  LIYLHQDSRLRIIHRDLKASNVLLDKELNPKISDFGMARIFGGDQKEG-NTRRIVGTYGY  686

Query  182  MS  187
            M+
Sbjct  687  MA  688



>ref|XP_006471786.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
[Citrus sinensis]
Length=693

 Score =   114 bits (284),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLH+DSR RIIHRDLKASN+LLD EMNPKISDFGMARIFGG+++EA NT R+VGTYGY
Sbjct  485  LLYLHEDSRLRIIHRDLKASNVLLDHEMNPKISDFGMARIFGGNQSEA-NTNRIVGTYGY  543

Query  182  MS  187
            M+
Sbjct  544  MA  545



>gb|AFW84881.1| putative S-locus receptor-like protein kinase family protein 
[Zea mays]
Length=905

 Score =   114 bits (286),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR+RIIHRDLKA+N+LLDKEM PKISDFGMARIFG +ETE  NT++VVGTYGY
Sbjct  696  LLYLHQDSRYRIIHRDLKAANVLLDKEMTPKISDFGMARIFGNEETEI-NTRKVVGTYGY  754

Query  182  MS  187
            MS
Sbjct  755  MS  756



>ref|XP_002528889.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF33513.1| ATP binding protein, putative [Ricinus communis]
Length=1597

 Score =   115 bits (287),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 1/62 (2%)
 Frame = +2

Query  2    LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
            LLYLHQDSR RIIHRDLKASN+LLDK+MNPKISDFGMARIFGGD+TEA NT +V GTYGY
Sbjct  599  LLYLHQDSRLRIIHRDLKASNVLLDKDMNPKISDFGMARIFGGDQTEA-NTNKVAGTYGY  657

Query  182  MS  187
            M+
Sbjct  658  MA  659


 Score =   113 bits (283),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 53/62 (85%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +2

Query  2     LLYLHQDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETEANNTKRVVGTYGY  181
             LLYLHQDSR +IIHRDLKASNILLD EMNPKISDFG+ARIFG D+TEA NT R+VGTYGY
Sbjct  1390  LLYLHQDSRLKIIHRDLKASNILLDNEMNPKISDFGLARIFGADQTEA-NTNRIVGTYGY  1448

Query  182   MS  187
             MS
Sbjct  1449  MS  1450



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 525646009952