BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24102_g1_i1 len=953 path=[2144:0-282 2427:283-320 4132:321-335
2479:336-384 2528:385-414 4149:415-435 4170:436-451 2593:452-546
2688:547-556 146:557-602 4209:603-614 2754:615-624 2764:625-648
2788:649-677 392:678-709 4254:710-722 2860:723-952]

Length=953
                                                                      Score     E

emb|CDP10828.1|  unnamed protein product                                415   2e-142   
ref|XP_006359038.1|  PREDICTED: chitinase 5-like                        410   3e-140   
ref|XP_009777773.1|  PREDICTED: endochitinase PR4-like                  409   9e-140   
dbj|BAF44533.1|  class IV chitinase                                     408   1e-139   Nicotiana tabacum [American tobacco]
gb|EYU40983.1|  hypothetical protein MIMGU_mgv1a011672mg                406   9e-139   
ref|XP_004237833.1|  PREDICTED: chitinase 6                             400   1e-136   
ref|XP_009802809.1|  PREDICTED: chitinase 4-like                        400   2e-136   
ref|XP_009591110.1|  PREDICTED: endochitinase PR4-like                  399   5e-136   
emb|CDP10829.1|  unnamed protein product                                397   4e-135   
emb|CDP21309.1|  unnamed protein product                                395   9e-135   
ref|XP_009796978.1|  PREDICTED: chitinase 4-like                        394   5e-134   
ref|XP_010687451.1|  PREDICTED: chitinase 6-like                        390   2e-132   
ref|XP_011091571.1|  PREDICTED: chitinase 6-like                        389   3e-132   
ref|XP_009591111.1|  PREDICTED: chitinase 4-like                        388   1e-131   
ref|XP_008801201.1|  PREDICTED: chitinase 6-like                        385   7e-131   
ref|XP_007033803.1|  Carrot EP3-3 chitinase                             384   4e-130   
ref|XP_010055735.1|  PREDICTED: endochitinase PR4-like                  383   1e-129   
emb|CAN79254.1|  hypothetical protein VITISV_009137                     380   8e-129   Vitis vinifera
ref|XP_002274537.1|  PREDICTED: endochitinase PR4                       380   1e-128   Vitis vinifera
gb|ACM45716.1|  class IV chitinase                                      380   1e-128   Pyrus pyrifolia [sha li]
ref|XP_008369197.1|  PREDICTED: endochitinase PR4-like                  380   2e-128   
gb|ACX94236.1|  chitinase                                               378   5e-128   Lactuca sativa [cultivated lettuce]
ref|XP_009405567.1|  PREDICTED: chitinase 6                             378   7e-128   
ref|XP_010930457.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    393   1e-127   
ref|XP_002274758.1|  PREDICTED: endochitinase PR4                       377   3e-127   Vitis vinifera
gb|EYU40975.1|  hypothetical protein MIMGU_mgv1a011768mg                375   8e-127   
ref|XP_010094107.1|  Endochitinase                                      375   2e-126   
ref|XP_004240991.1|  PREDICTED: endochitinase PR4-like                  374   9e-126   
ref|XP_008222565.1|  PREDICTED: endochitinase PR4-like                  373   9e-126   
ref|XP_011091730.1|  PREDICTED: uncharacterized protein LOC105172091    381   5e-125   
ref|XP_008444611.1|  PREDICTED: endochitinase PR4-like                  370   2e-124   
ref|XP_004309832.1|  PREDICTED: endochitinase PR4-like                  369   3e-124   
gb|ACL36992.1|  class IV chitinase                                      369   6e-124   Medicago sativa [alfalfa]
ref|XP_010268233.1|  PREDICTED: endochitinase PR4-like                  368   8e-124   
gb|AFK40619.1|  unknown                                                 368   8e-124   
ref|XP_010056776.1|  PREDICTED: endochitinase PR4-like                  368   1e-123   
ref|XP_006442844.1|  hypothetical protein CICLE_v10021602mg             367   1e-123   
ref|XP_006376418.1|  class IV chitinase family protein                  367   2e-123   
gb|AEZ67306.1|  chitinase 7                                             367   2e-123   
ref|XP_007222515.1|  hypothetical protein PRUPE_ppa009844mg             367   3e-123   
ref|XP_006350735.1|  PREDICTED: endochitinase PR4-like                  367   3e-123   
ref|XP_006858883.1|  hypothetical protein AMTR_s00066p00199730          365   8e-123   
gb|AAR87869.1|  class IV chitinase precursor                            365   1e-122   Medicago truncatula
ref|XP_006478596.1|  PREDICTED: endochitinase PR4-like                  364   2e-122   
ref|XP_002274620.1|  PREDICTED: chitinase 5                             364   2e-122   Vitis vinifera
gb|AII99852.1|  chitinase                                               363   5e-122   
ref|XP_009416020.1|  PREDICTED: chitinase 6-like                        362   7e-122   
gb|AEM97876.1|  class IV chitinase                                      363   8e-122   
ref|XP_002274935.1|  PREDICTED: chitinase 5-like                        362   2e-121   Vitis vinifera
gb|EYU40977.1|  hypothetical protein MIMGU_mgv1a023931mg                360   3e-121   
ref|XP_004145227.1|  PREDICTED: endochitinase PR4-like                  361   4e-121   
ref|XP_010069256.1|  PREDICTED: chitinase 6-like                        361   6e-121   
ref|XP_010515969.1|  PREDICTED: endochitinase PR4                       360   1e-120   
emb|CDX73482.1|  BnaC08g25210D                                          359   2e-120   
emb|CBI24655.3|  unnamed protein product                                360   2e-120   
gb|KDP44264.1|  hypothetical protein JCGZ_05731                         359   2e-120   
ref|NP_191010.1|  chitinase class IV                                    359   2e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010069261.1|  PREDICTED: chitinase 6-like                        359   2e-120   
ref|XP_010427142.1|  PREDICTED: endochitinase PR4-like                  359   3e-120   
emb|CAN82242.1|  hypothetical protein VITISV_010460                     358   3e-120   Vitis vinifera
ref|XP_009116128.1|  PREDICTED: endochitinase PR4-like                  357   2e-119   
ref|XP_006376419.1|  hypothetical protein POPTR_0013s12880g             357   2e-119   
ref|XP_010069257.1|  PREDICTED: endochitinase PR4-like                  357   3e-119   
ref|XP_003597548.1|  Endochitinase PR4                                  366   3e-119   
gb|KCW87623.1|  hypothetical protein EUGRSUZ_A00021                     356   4e-119   
ref|XP_006403578.1|  hypothetical protein EUTSA_v10010625mg             356   5e-119   
ref|XP_006291664.1|  hypothetical protein CARUB_v10017824mg             355   7e-119   
ref|XP_010069255.1|  PREDICTED: endochitinase PR4-like                  355   7e-119   
gb|ABK95688.1|  unknown                                                 355   8e-119   Populus trichocarpa [western balsam poplar]
ref|NP_001268173.1|  class IV chitinase precursor                       355   9e-119   
ref|XP_002326039.1|  chitinase family protein                           354   1e-118   Populus trichocarpa [western balsam poplar]
ref|XP_010524052.1|  PREDICTED: endochitinase PR4                       354   2e-118   
ref|XP_004486869.1|  PREDICTED: LOW QUALITY PROTEIN: endochitinas...    360   2e-118   
gb|AAP03085.1|  class IV chitinase                                      354   2e-118   Galega orientalis
ref|XP_002274819.1|  PREDICTED: chitinase 5-like                        353   3e-118   Vitis vinifera
ref|XP_002876253.1|  hypothetical protein ARALYDRAFT_485842             353   3e-118   
ref|XP_010504246.1|  PREDICTED: endochitinase PR4-like                  353   7e-118   
ref|XP_010069259.1|  PREDICTED: endochitinase PR4-like                  353   8e-118   
ref|XP_008791790.1|  PREDICTED: endochitinase PR4-like                  352   8e-118   
emb|CAA74930.1|  class IV chitinase                                     352   1e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002448105.1|  hypothetical protein SORBIDRAFT_06g021220          352   2e-117   Sorghum bicolor [broomcorn]
ref|XP_010069260.1|  PREDICTED: endochitinase PR4-like                  352   2e-117   
ref|NP_001268031.1|  class IV endochitinase precursor                   351   2e-117   
emb|CAN66296.1|  hypothetical protein VITISV_043424                     351   3e-117   Vitis vinifera
ref|XP_010069263.1|  PREDICTED: endochitinase PR4-like                  351   5e-117   
ref|XP_006858884.1|  hypothetical protein AMTR_s00066p00199930          350   6e-117   
ref|XP_011002654.1|  PREDICTED: basic endochitinase CHB4-like           350   6e-117   
gb|KFK34682.1|  hypothetical protein AALP_AA5G177800                    350   7e-117   
ref|XP_002326042.1|  hypothetical protein POPTR_0019s12390g             349   2e-116   Populus trichocarpa [western balsam poplar]
emb|CAA87072.1|  pathogenesis-related protein PR-3 type                 348   2e-116   Sambucus nigra
emb|CAA40474.1|  chitinase                                              348   4e-116   Phaseolus vulgaris [French bean]
ref|XP_002326041.2|  hypothetical protein POPTR_0019s12380g             348   4e-116   Populus trichocarpa [western balsam poplar]
dbj|BAF98919.1|  class IV chitinase                                     348   5e-116   Nepenthes alata
ref|XP_011002656.1|  PREDICTED: basic endochitinase CHB4-like           347   9e-116   
gb|ACJ24349.1|  chitinase class IVa                                     348   1e-115   Oryza grandiglumis
ref|XP_002326040.2|  hypothetical protein POPTR_0019s12360g             347   1e-115   Populus trichocarpa [western balsam poplar]
ref|NP_001053186.1|  Os04g0494100                                       347   2e-115   Oryza sativa Japonica Group [Japonica rice]
gb|ABY66957.1|  class IV chitinase                                      346   2e-115   Vitis pseudoreticulata
ref|XP_002275534.1|  PREDICTED: chitinase 5                             346   2e-115   Vitis vinifera
ref|XP_007150477.1|  hypothetical protein PHAVU_005G155800g             346   2e-115   
ref|NP_001150754.1|  endochitinase PR4 precursor                        345   5e-115   Zea mays [maize]
gb|ACU23323.1|  unknown                                                 345   5e-115   Glycine max [soybeans]
gb|KHN30080.1|  Endochitinase PR4                                       345   6e-115   
ref|XP_003543578.1|  PREDICTED: endochitinase PR4-like                  345   7e-115   
ref|XP_006648823.1|  PREDICTED: chitinase 6-like                        345   1e-114   
ref|NP_001239790.1|  uncharacterized protein LOC100778526 precursor     345   1e-114   
gb|EPS66639.1|  hypothetical protein M569_08138                         345   1e-114   
ref|XP_004976077.1|  PREDICTED: endochitinase A-like                    344   1e-114   
ref|XP_003575320.1|  PREDICTED: chitinase 6-like                        344   2e-114   
ref|XP_011002657.1|  PREDICTED: endochitinase PR4-like                  344   3e-114   
gb|ABJ74186.1|  chitinase-like protein                                  341   4e-114   Artemisia annua [sweet Annie]
gb|AGS80333.1|  chitinase protein                                       343   5e-114   
gb|AET25429.1|  class IV chitinase                                      343   5e-114   
emb|CAN79256.1|  hypothetical protein VITISV_009139                     342   8e-114   Vitis vinifera
sp|O04138.2|CHI4_ORYSJ  RecName: Full=Chitinase 4; AltName: Full=...    342   1e-113   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001047373.1|  Os02g0605900                                       342   1e-113   Oryza sativa Japonica Group [Japonica rice]
gb|ABY66958.1|  class IV chitinase                                      342   1e-113   Vitis pseudoreticulata
gb|KDP44262.1|  hypothetical protein JCGZ_05729                         342   3e-113   
ref|NP_001268075.1|  class IV chitinase precursor                       340   4e-113   
emb|CBI24650.3|  unnamed protein product                                340   4e-113   
ref|XP_008223736.1|  PREDICTED: endochitinase PR4-like                  340   1e-112   
ref|XP_002274419.2|  PREDICTED: endochitinase PR4                       341   2e-112   Vitis vinifera
ref|XP_010036821.1|  PREDICTED: chitinase 6-like                        339   2e-112   
ref|XP_008800296.1|  PREDICTED: chitinase 6-like                        337   2e-112   
emb|CAN68040.1|  hypothetical protein VITISV_033610                     338   2e-112   Vitis vinifera
sp|P27054.1|CHI4_PHAVU  RecName: Full=Endochitinase PR4; Flags: P...    338   2e-112   Phaseolus vulgaris [French bean]
ref|XP_007226544.1|  hypothetical protein PRUPE_ppa024941mg             339   2e-112   
ref|XP_010687448.1|  PREDICTED: chitinase 4-like                        338   4e-112   
gb|AGS80329.1|  chitinase protein                                       338   4e-112   
ref|XP_010687454.1|  PREDICTED: endochitinase A-like                    338   5e-112   
ref|XP_009368228.1|  PREDICTED: endochitinase PR4-like                  336   5e-112   
ref|XP_009368176.1|  PREDICTED: endochitinase PR4-like                  336   5e-112   
ref|XP_010650683.1|  PREDICTED: endochitinase PR4-like                  338   6e-112   
ref|XP_010258575.1|  PREDICTED: chitinase 5-like                        337   1e-111   
gb|ACO57438.1|  class IV chitinase                                      336   2e-111   Elaeis oleifera
ref|XP_006652462.1|  PREDICTED: chitinase 5-like                        336   2e-111   
ref|XP_010650685.1|  PREDICTED: endochitinase A-like isoform X1         339   2e-111   
gb|AHA62771.1|  chitinase                                               336   3e-111   
ref|XP_010912786.1|  PREDICTED: endochitinase PR4-like                  336   4e-111   
ref|XP_010094102.1|  Endochitinase                                      335   4e-111   
ref|XP_010094101.1|  Endochitinase                                      335   5e-111   
emb|CBI24659.3|  unnamed protein product                                341   6e-111   
gb|KCW48473.1|  hypothetical protein EUGRSUZ_K02166                     335   6e-111   
dbj|BAA22966.1|  chitinase                                              335   7e-111   Chenopodium amaranticolor
ref|XP_010687452.1|  PREDICTED: endochitinase A-like                    334   1e-110   
dbj|BAA22968.1|  chitinase                                              334   1e-110   Chenopodium amaranticolor
gb|AAB65777.1|  class IV endochitinase                                  334   1e-110   Vitis vinifera
dbj|BAA22967.1|  chitinase                                              334   1e-110   Chenopodium amaranticolor
dbj|BAA22965.1|  chitinase                                              334   2e-110   Chenopodium amaranticolor
emb|CAA61281.1|  chitinase class 4                                      330   2e-109   Vigna unguiculata
ref|XP_009609718.1|  PREDICTED: chitinase 6-like                        328   2e-109   
gb|ACJ61929.1|  chitinase                                               331   3e-109   Zea mays subsp. parviglumis [Balsas teosinte]
dbj|BAJ93881.1|  predicted protein                                      330   4e-109   
ref|XP_004976079.1|  PREDICTED: endochitinase A-like                    330   5e-109   
gb|AAT40038.1|  chitinase                                               329   2e-108   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACX37090.1|  chitinase                                               328   3e-108   Zea mays [maize]
ref|XP_002452418.1|  hypothetical protein SORBIDRAFT_04g025430          328   3e-108   Sorghum bicolor [broomcorn]
emb|CAA87074.1|  pathogenesis-related protein, PR-3 type                327   4e-108   Sambucus nigra
ref|XP_004291061.1|  PREDICTED: endochitinase PR4-like                  327   1e-107   
ref|XP_004953034.1|  PREDICTED: chitinase 6-like                        327   1e-107   
gb|AAT40041.1|  chitinase                                               327   2e-107   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAT40047.1|  chitinase                                               326   2e-107   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAT40042.1|  chitinase                                               326   2e-107   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_007223824.1|  hypothetical protein PRUPE_ppa010731mg             324   3e-107   
gb|ACJ61928.1|  chitinase                                               326   3e-107   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAT40046.1|  chitinase                                               325   5e-107   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ61916.1|  chitinase                                               325   5e-107   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAT40039.1|  chitinase                                               325   5e-107   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_008222566.1|  PREDICTED: endochitinase PR4-like                  323   6e-107   
gb|ACJ61920.1|  chitinase                                               325   6e-107   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAK92198.1|AF402937_1  chitinase-B                                   324   6e-107   Saccharum officinarum [noble cane]
gb|AAT40040.1|  chitinase                                               325   7e-107   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ61895.1|  chitinase                                               325   7e-107   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ61887.1|  chitinase                                               325   7e-107   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_010687455.1|  PREDICTED: endochitinase A-like                    324   8e-107   
gb|ACJ61917.1|  chitinase                                               325   9e-107   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAT40049.1|  chitinase                                               325   9e-107   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ61921.1|  chitinase                                               325   9e-107   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ61904.1|  chitinase                                               325   1e-106   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_010268234.1|  PREDICTED: endochitinase PR4-like                  324   1e-106   
gb|ACJ61859.1|  chitinase                                               324   1e-106   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAT40051.1|  chitinase                                               324   1e-106   Zea diploperennis [chapule]
gb|ACJ61874.1|  chitinase                                               324   1e-106   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAT40037.1|  chitinase                                               324   1e-106   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAT40036.1|  chitinase                                               324   1e-106   Tripsacum dactyloides
gb|KEH39504.1|  class I chitinase                                       323   2e-106   
gb|ACJ61914.1|  chitinase                                               324   2e-106   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ61934.1|  chitinase                                               324   2e-106   Zea mays subsp. parviglumis [Balsas teosinte]
gb|EMS68176.1|  Chitinase 6                                             323   2e-106   
gb|AAT40043.1|  chitinase                                               324   2e-106   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ61937.1|  chitinase                                               323   2e-106   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ61918.1|  chitinase                                               323   2e-106   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ61858.1|  chitinase                                               323   2e-106   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACL00870.1|  chitinase B                                             323   3e-106   
gb|AAT40045.1|  chitinase                                               323   3e-106   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAT40050.1|  chitinase                                               323   3e-106   Zea diploperennis [chapule]
ref|NP_001158904.1|  endochitinase A precursor                          323   3e-106   Zea mays [maize]
gb|AAT40044.1|  chitinase                                               323   4e-106   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_002273248.1|  PREDICTED: endochitinase PR4                       323   4e-106   Vitis vinifera
gb|ACJ61875.1|  chitinase                                               323   4e-106   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAK92200.1|AF402939_1  chitinase-B                                   322   4e-106   Sorghum halepense [Johnson grass]
gb|ACJ61923.1|  chitinase                                               323   4e-106   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ61926.1|  chitinase                                               323   4e-106   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ61879.1|  chitinase                                               323   5e-106   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ61911.1|  chitinase                                               323   5e-106   Zea mays subsp. parviglumis [Balsas teosinte]
ref|NP_001149472.1|  endochitinase A precursor                          323   5e-106   Zea mays [maize]
gb|ACJ61862.1|  chitinase                                               323   5e-106   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ61919.1|  chitinase                                               323   6e-106   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ61905.1|  chitinase                                               322   7e-106   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AET44160.1|  class IV chitinase                                      322   7e-106   
gb|ACJ61915.1|  chitinase                                               322   8e-106   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_010036822.1|  PREDICTED: chitinase 6-like                        322   8e-106   
gb|AGS80332.1|  chitinase protein                                       324   8e-106   
gb|ACJ61896.1|  chitinase                                               322   8e-106   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ61876.1|  chitinase                                               322   8e-106   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAT39997.1|  chitinase                                               322   8e-106   Zea mays subsp. parviglumis [Balsas teosinte]
sp|P29022.1|CHIA_MAIZE  RecName: Full=Endochitinase A; AltName: F...    322   9e-106   Zea mays [maize]
gb|ACJ61907.1|  chitinase                                               322   9e-106   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ61861.1|  chitinase                                               322   1e-105   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ61908.1|  chitinase                                               322   1e-105   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ61867.1|  chitinase                                               322   1e-105   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_004976078.1|  PREDICTED: endochitinase A-like                    322   1e-105   
gb|ACJ61889.1|  chitinase                                               322   1e-105   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_002448109.1|  hypothetical protein SORBIDRAFT_06g021260          322   1e-105   Sorghum bicolor [broomcorn]
gb|ACJ61922.1|  chitinase                                               322   1e-105   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ61865.1|  chitinase                                               322   2e-105   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ61873.1|  chitinase                                               322   2e-105   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ61886.1|  chitinase                                               321   2e-105   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ61932.1|  chitinase                                               321   2e-105   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ61868.1|  chitinase                                               321   2e-105   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABP37821.1|  chitinase B                                             320   2e-105   Saccharum officinarum [noble cane]
gb|ACJ61970.1|  chitinase                                               321   3e-105   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ61927.1|  chitinase                                               321   3e-105   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ61885.1|  chitinase                                               320   3e-105   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_004976080.1|  PREDICTED: endochitinase A-like                    320   3e-105   
gb|ACJ61857.1|  chitinase                                               320   4e-105   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ61973.1|  chitinase                                               320   4e-105   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ61906.1|  chitinase                                               320   4e-105   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ61900.1|  chitinase                                               320   5e-105   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ61864.1|  chitinase                                               320   5e-105   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_010687453.1|  PREDICTED: endochitinase A-like                    320   6e-105   
gb|ACJ61910.1|  chitinase                                               320   7e-105   Zea mays subsp. parviglumis [Balsas teosinte]
emb|CAA53544.1|  chitinase                                              319   7e-105   Beta vulgaris subsp. vulgaris [field beet]
gb|ACJ61988.1|  chitinase                                               320   7e-105   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAK97762.1|  chitinase-B                                             319   8e-105   Sorghum bicolor [broomcorn]
ref|XP_002448106.1|  hypothetical protein SORBIDRAFT_06g021230          319   9e-105   Sorghum bicolor [broomcorn]
gb|AAT39999.1|  chitinase                                               320   1e-104   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ61866.1|  chitinase                                               319   1e-104   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ61871.1|  chitinase                                               319   1e-104   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_002448107.1|  hypothetical protein SORBIDRAFT_06g021240          319   1e-104   Sorghum bicolor [broomcorn]
gb|ABP37785.1|  chitinase B                                             318   2e-104   Saccharum officinarum [noble cane]
gb|ACJ62000.1|  chitinase                                               319   2e-104   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAK97763.1|  chitinase-B1                                            318   2e-104   Sorghum bicolor [broomcorn]
gb|ACJ61941.1|  chitinase                                               318   2e-104   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ61968.1|  chitinase                                               318   2e-104   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_008222568.1|  PREDICTED: endochitinase PR4-like                  317   2e-104   
gb|ACJ61936.1|  chitinase                                               318   3e-104   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_003580049.1|  PREDICTED: chitinase 5-like                        318   3e-104   
gb|ABP37783.1|  chitinase B                                             317   3e-104   Saccharum officinarum [noble cane]
ref|XP_004976074.1|  PREDICTED: endochitinase A-like                    318   3e-104   
emb|CBI24653.3|  unnamed protein product                                327   3e-104   
gb|AAK92199.1|AF402938_1  chitinase-B                                   317   3e-104   Sorghum arundinaceum [common wild sorghum]
gb|ACJ61982.1|  chitinase                                               318   4e-104   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ61958.1|  chitinase                                               318   5e-104   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAT39994.1|  chitinase                                               318   5e-104   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ61960.1|  chitinase                                               317   5e-104   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACL00871.1|  chitinase B                                             318   5e-104   
gb|AAT39991.1|  chitinase                                               318   6e-104   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ61983.1|  chitinase                                               317   7e-104   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAT40000.1|  chitinase                                               317   7e-104   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACN27767.1|  unknown                                                 317   7e-104   Zea mays [maize]
gb|ACJ62007.1|  chitinase                                               317   7e-104   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAT40005.1|  chitinase                                               317   8e-104   Zea diploperennis [chapule]
gb|ACJ61985.1|  chitinase                                               317   8e-104   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAT39998.1|  chitinase                                               317   9e-104   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ61912.1|  chitinase                                               317   9e-104   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ61977.1|  chitinase                                               317   9e-104   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ61954.1|  chitinase                                               317   1e-103   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_010930230.1|  PREDICTED: endochitinase A-like isoform X1         317   1e-103   
gb|AAT40002.1|  chitinase                                               317   1e-103   
ref|XP_002534548.1|  class IV chitinase, putative                       317   1e-103   
gb|AAT39992.1|  chitinase                                               317   1e-103   
gb|ACJ62001.1|  chitinase                                               317   1e-103   
gb|AAT40010.1|  chitinase                                               317   1e-103   
gb|ACJ61997.1|  chitinase                                               317   1e-103   
gb|KHG24557.1|  Endochitinase PR4                                       316   1e-103   
gb|ACJ61992.1|  chitinase                                               317   1e-103   
gb|ACJ61989.1|  chitinase                                               317   2e-103   
gb|ACJ61984.1|  chitinase                                               316   2e-103   
gb|AAT39995.1|  chitinase                                               316   2e-103   
gb|ACJ61978.1|  chitinase                                               316   2e-103   
ref|XP_010930231.1|  PREDICTED: endochitinase A-like isoform X2         316   2e-103   
gb|ACJ61994.1|  chitinase                                               316   2e-103   
gb|AAT40006.1|  chitinase                                               316   2e-103   
gb|AFK37127.1|  unknown                                                 314   2e-103   
gb|ACJ62005.1|  chitinase                                               316   2e-103   
gb|ACJ61940.1|  chitinase                                               316   2e-103   
gb|ACJ61993.1|  chitinase                                               316   3e-103   
gb|ACJ61998.1|  chitinase                                               316   3e-103   
gb|ACJ61942.1|  chitinase                                               316   3e-103   
gb|ACJ61955.1|  chitinase                                               316   3e-103   
gb|AAT40003.1|  chitinase                                               316   3e-103   
gb|ACJ61944.1|  chitinase                                               316   3e-103   
gb|ACJ62010.1|  chitinase                                               316   3e-103   
gb|ACJ61999.1|  chitinase                                               315   3e-103   
gb|ACJ62003.1|  chitinase                                               315   3e-103   
gb|ACJ61965.1|  chitinase                                               315   4e-103   
gb|ACJ62004.1|  chitinase                                               315   4e-103   
ref|XP_007033796.1|  Carrot EP3-3 chitinase, putative isoform 1         317   5e-103   
gb|ACJ61971.1|  chitinase                                               315   5e-103   
gb|ACJ62009.1|  chitinase                                               315   5e-103   
gb|ACJ62002.1|  chitinase                                               315   5e-103   
ref|XP_007033802.1|  Carrot EP3-3 chitinase                             313   5e-103   
gb|AAT39996.1|  chitinase                                               315   5e-103   
gb|ACJ61962.1|  chitinase                                               315   6e-103   
gb|AAK97764.1|  chitinase-B                                             314   7e-103   
gb|AER29902.1|  class IV chitinase                                      314   1e-102   
gb|ACJ61939.1|  chitinase                                               314   1e-102   
gb|ACJ61948.1|  chitinase                                               314   1e-102   
ref|XP_010930232.1|  PREDICTED: endochitinase A-like isoform X3         313   1e-102   
gb|AAT39993.1|  chitinase                                               314   1e-102   
gb|AAT40001.1|  chitinase                                               314   1e-102   
gb|ACD69683.1|  chitinase                                               312   2e-102   
gb|ACJ61945.1|  chitinase                                               314   2e-102   
ref|XP_006293537.1|  hypothetical protein CARUB_v10025331mg             313   2e-102   
gb|AAT40009.1|  chitinase                                               313   3e-102   
gb|AAD28733.1|AF112966_1  chitinase IV precursor                        312   5e-102   
ref|NP_001170082.1|  hypothetical protein precursor                     311   1e-101   
emb|CBI24660.3|  unnamed protein product                                309   2e-101   
gb|AAT39990.1|  chitinase                                               311   2e-101   
ref|XP_002448108.1|  hypothetical protein SORBIDRAFT_06g021250          310   4e-101   
ref|XP_006397531.1|  hypothetical protein EUTSA_v10001590mg             309   5e-101   
gb|KHN06178.1|  Endochitinase PR4                                       307   6e-101   
ref|XP_010042788.1|  PREDICTED: chitinase 6-like                        309   6e-101   
sp|P29023.1|CHIB_MAIZE  RecName: Full=Endochitinase B; AltName: F...    309   7e-101   
ref|NP_001238555.1|  uncharacterized protein LOC100527091               307   1e-100   
emb|CBI24654.3|  unnamed protein product                                306   2e-100   
ref|XP_008801195.1|  PREDICTED: endochitinase A-like                    308   3e-100   
ref|XP_009132730.1|  PREDICTED: basic endochitinase CHB4-like           307   4e-100   
dbj|BAD77932.1|  class IV chitinase                                     307   6e-100   
ref|XP_010650684.1|  PREDICTED: chitinase 4-like                        306   1e-99    
ref|XP_007033801.1|  Carrot EP3-3 chitinase                             306   2e-99    
emb|CDY65766.1|  BnaA03g56430D                                          305   2e-99    
ref|XP_009143675.1|  PREDICTED: basic endochitinase CHB4-like           304   6e-99    
emb|CDX79601.1|  BnaC03g19370D                                          304   7e-99    
emb|CDY31683.1|  BnaA05g08640D                                          304   7e-99    
ref|XP_010526405.1|  PREDICTED: basic endochitinase CHB4-like           303   2e-98    
emb|CDX78234.1|  BnaA09g34290D                                          305   2e-98    
ref|XP_010517938.1|  PREDICTED: basic endochitinase CHB4-like           303   2e-98    
gb|AAS83986.1|  class IV chitinase Ab                                   302   5e-98    
ref|NP_001053184.1|  Os04g0493400                                       300   6e-98    
ref|XP_007033797.1|  Carrot EP3-3 chitinase, putative isoform 2         303   6e-98    
gb|AAC49435.1|  class IV chitinase EP3-1/H5                             301   8e-98    
emb|CDY44237.1|  BnaC03g24290D                                          300   2e-97    
sp|Q06209.2|CHI4_BRANA  RecName: Full=Basic endochitinase CHB4; F...    300   2e-97    
gb|AAB08468.1|  class IV chitinase EP3-2/H1                             300   2e-97    
ref|XP_002881917.1|  hypothetical protein ARALYDRAFT_483470             300   2e-97    
emb|CAN69336.1|  hypothetical protein VITISV_038423                     300   2e-97    
ref|XP_009368181.1|  PREDICTED: chitinase 5-like                        299   2e-97    
ref|XP_009133618.1|  PREDICTED: basic endochitinase CHB4                300   3e-97    
gb|KFK37184.1|  hypothetical protein AALP_AA4G224900                    300   4e-97    
gb|ABK22417.1|  unknown                                                 300   4e-97    
ref|XP_010069262.1|  PREDICTED: chitinase 4-like                        298   5e-97    
ref|XP_010508399.1|  PREDICTED: basic endochitinase CHB4-like           299   5e-97    
gb|KFK31365.1|  hypothetical protein AALP_AA6G103000                    299   5e-97    
ref|XP_010268232.1|  PREDICTED: chitinase 5-like                        299   5e-97    
ref|XP_010526395.1|  PREDICTED: basic endochitinase CHB4-like           300   5e-97    
ref|XP_010506253.1|  PREDICTED: basic endochitinase CHB4                299   6e-97    
gb|ACZ52964.1|  chitinase                                               298   6e-97    
gb|ABK23737.1|  unknown                                                 299   1e-96    
ref|NP_181887.1|  chitinase family protein                              298   1e-96    
gb|ACJ61950.1|  chitinase                                               299   1e-96    
gb|AAQ17050.1|  class IV chitinase Chia4-Pa1                            298   1e-96    
gb|AAS83984.1|  class IV chitinase A                                    298   1e-96    
gb|ACM89954.1|  class IV chitinase Chia4-Pa2 variant                    297   2e-96    
ref|XP_007131917.1|  hypothetical protein PHAVU_011G051500g             296   2e-96    
gb|AAB08469.1|  class IV chitinase EP3-3/E7                             298   2e-96    
gb|AAQ17048.1|  class IV chitinase Chia4-Pa1.3                          298   2e-96    
gb|ABK23018.1|  unknown                                                 298   3e-96    
ref|XP_008355536.1|  PREDICTED: chitinase 4-like                        297   3e-96    
ref|XP_004309834.1|  PREDICTED: chitinase 4-like isoform 1              296   3e-96    
gb|AAQ17051.1|  class IV chitinase Chia4-Pa2                            297   3e-96    
gb|AEF59006.1|  class I chitinase                                       297   4e-96    
dbj|BAK08163.1|  predicted protein                                      297   4e-96    
emb|CDX73484.1|  BnaC08g25190D                                          297   5e-96    
ref|XP_009368179.1|  PREDICTED: chitinase 5-like                        295   5e-96    
gb|ABR17951.1|  unknown                                                 297   6e-96    
gb|ACN40402.1|  unknown                                                 297   6e-96    
gb|ACJ61964.1|  chitinase                                               296   8e-96    
ref|XP_006294804.1|  hypothetical protein CARUB_v10023855mg             296   1e-95    
gb|AAB08470.1|  class IV chitinase EP3B/E6                              296   1e-95    
gb|ACJ61891.1|  chitinase                                               295   1e-95    
gb|AAS83985.1|  class IV chitinase Aa                                   295   2e-95    
ref|XP_007223909.1|  hypothetical protein PRUPE_ppa010947mg             294   2e-95    
gb|AIA22194.1|  chitinase                                               294   2e-95    
gb|KHF98356.1|  Endochitinase PR4                                       295   3e-95    
gb|ACY06323.1|  class IV chitinase 4-4                                  295   4e-95    
ref|XP_006442848.1|  hypothetical protein CICLE_v10022063mg             293   4e-95    
gb|ACM89955.1|  class IV chitinase Chia4-Pa1 variant                    294   4e-95    
ref|XP_008223777.1|  PREDICTED: endochitinase PR4-like                  294   5e-95    
ref|XP_010258713.1|  PREDICTED: chitinase 5-like                        291   5e-95    
gb|AAQ17049.1|  class IV chitinase Chia4-Pa1.1                          294   6e-95    
ref|XP_008222573.1|  PREDICTED: chitinase 5-like                        292   7e-95    
ref|XP_008655895.1|  PREDICTED: endochitinase A-like                    294   8e-95    
gb|ABV89613.1|  chitinase                                               293   9e-95    
ref|XP_007223911.1|  hypothetical protein PRUPE_ppa010952mg             292   1e-94    
ref|XP_008222517.1|  PREDICTED: chitinase 5-like                        291   1e-94    
gb|KFK37183.1|  hypothetical protein AALP_AA4G224800                    293   2e-94    
ref|XP_007211771.1|  hypothetical protein PRUPE_ppa009653mg             292   4e-94    
ref|XP_009368202.1|  PREDICTED: chitinase 5-like                        290   6e-94    
ref|XP_004987409.1|  PREDICTED: endochitinase A-like                    290   7e-94    
sp|P42820.1|CHIP_BETVU  RecName: Full=Acidic endochitinase SP2; F...    292   7e-94    
ref|XP_009368180.1|  PREDICTED: chitinase 5-like                        290   9e-94    
ref|XP_010672299.1|  PREDICTED: acidic endochitinase SP2                291   1e-93    
emb|CDX83477.1|  BnaA03g20290D                                          290   2e-93    
gb|KDP44263.1|  hypothetical protein JCGZ_05730                         289   2e-93    
sp|P80052.2|CHIT_DIOJA  RecName: Full=Acidic endochitinase              289   4e-93    
emb|CBI24657.3|  unnamed protein product                                290   5e-93    
ref|XP_002881915.1|  hypothetical protein ARALYDRAFT_346169             289   8e-93    
ref|XP_010508400.1|  PREDICTED: basic endochitinase CHB4-like           288   1e-92    
emb|CDY44235.1|  BnaC03g24270D                                          289   1e-92    
gb|AAB23692.1|  acidic class I chitinase                                288   1e-92    
gb|ACP43362.1|  class IV chitinase                                      288   1e-92    
ref|XP_009133615.1|  PREDICTED: basic endochitinase CHB4                288   1e-92    
gb|ACY06321.1|  class IV chitinase 4-2                                  287   3e-92    
dbj|BAC56863.1|  chitinase                                              286   9e-92    
gb|KDP44269.1|  hypothetical protein JCGZ_05736                         285   2e-91    
ref|XP_006294805.1|  hypothetical protein CARUB_v10023857mg             284   4e-91    
gb|AET86623.2|  class IV endochitinase                                  285   4e-91    
gb|ABK21634.1|  unknown                                                 285   4e-91    
gb|AEF59002.1|  class IV chitinase                                      284   5e-91    
gb|ACP43363.1|  class IV chitinase                                      284   5e-91    
gb|ABK27070.1|  unknown                                                 284   5e-91    
gb|AAT09426.1|  putative class IV chitanase                             282   3e-90    
gb|ACJ61996.1|  chitinase                                               282   3e-90    
ref|XP_006293508.1|  hypothetical protein CARUB_v10023814mg             282   4e-90    
ref|XP_004976076.1|  PREDICTED: endochitinase A-like                    280   4e-90    
ref|XP_004309835.1|  PREDICTED: chitinase 4-like isoform 2              280   5e-90    
ref|XP_006397529.1|  hypothetical protein EUTSA_v10001581mg             282   5e-90    
gb|KDP44268.1|  hypothetical protein JCGZ_05735                         280   9e-90    
ref|NP_181886.1|  chitinase family protein                              281   1e-89    
ref|XP_002455593.1|  hypothetical protein SORBIDRAFT_03g013610          281   1e-89    
ref|XP_010506252.1|  PREDICTED: basic endochitinase CHB4-like           280   1e-89    
gb|ACY06320.1|  class II chitinase 4-1                                  281   1e-89    
ref|XP_007211772.1|  hypothetical protein PRUPE_ppa009661mg             280   3e-89    
ref|XP_006397530.1|  hypothetical protein EUTSA_v10001575mg             280   4e-89    
ref|XP_010517937.1|  PREDICTED: basic endochitinase CHB4-like           278   6e-89    
gb|KCW57553.1|  hypothetical protein EUGRSUZ_H00322                     277   9e-89    
gb|AAA85364.1|  chitinase                                               278   1e-88    
pdb|4MCK|A  Chain A, Crystal Structure Of Family Gh19, Class Iv C...    273   9e-88    
ref|XP_010517935.1|  PREDICTED: basic endochitinase CHB4-like           275   3e-87    
ref|XP_009133616.1|  PREDICTED: basic endochitinase CHB4 isoform X1     273   7e-87    
ref|XP_008669231.1|  PREDICTED: endochitinase A-like                    271   1e-86    
gb|ACY06317.1|  class II chitinase 2-1                                  271   2e-86    
ref|XP_008801197.1|  PREDICTED: acidic endochitinase SP2-like iso...    271   3e-86    
ref|NP_001275834.1|  chitinase CHI1 precursor                           270   3e-86    
ref|XP_004971797.1|  PREDICTED: LOW QUALITY PROTEIN: chitinase 5-...    272   3e-86    
ref|XP_010508401.1|  PREDICTED: basic endochitinase CHB4-like           272   4e-86    
gb|KFK32381.1|  hypothetical protein AALP_AA6G233800                    271   5e-86    
ref|XP_010650772.1|  PREDICTED: endochitinase PR4-like                  270   1e-85    
ref|XP_002881916.1|  hypothetical protein ARALYDRAFT_483469             270   2e-85    
gb|ABK22440.1|  unknown                                                 268   2e-85    
ref|NP_001148209.1|  endochitinase A precursor                          268   3e-85    
ref|XP_004976075.1|  PREDICTED: endochitinase A-like                    267   8e-85    
ref|XP_006410096.1|  hypothetical protein EUTSA_v10017716mg             267   1e-84    
gb|KCW57551.1|  hypothetical protein EUGRSUZ_H00320                     264   1e-84    
ref|XP_002448104.1|  hypothetical protein SORBIDRAFT_06g021210          265   3e-84    
gb|ACN39919.1|  unknown                                                 265   6e-84    
gb|ABK23908.1|  unknown                                                 264   8e-84    
gb|AEF59003.1|  class VII chitinase                                     264   9e-84    
tpg|DAA37157.1|  TPA: hypothetical protein ZEAMMB73_317592              263   1e-83    
emb|CBI24652.3|  unnamed protein product                                264   2e-83    
gb|ABK22545.1|  unknown                                                 263   2e-83    
emb|CAN76727.1|  hypothetical protein VITISV_043201                     275   3e-83    
gb|AAB01665.1|  chitinase class IV                                      264   4e-83    
ref|XP_006294764.1|  hypothetical protein CARUB_v10023810mg             264   6e-83    
ref|XP_010506250.1|  PREDICTED: basic endochitinase CHB4-like           264   7e-83    
gb|EMS52215.1|  Chitinase 5                                             260   2e-82    
gb|ABK21702.1|  unknown                                                 260   3e-82    
gb|KFK37182.1|  hypothetical protein AALP_AA4G224700                    262   4e-82    
pdb|3HBD|A  Chain A, Class Iv Chitinase Structure From Picea Abie...    257   2e-81    
gb|ABR17294.1|  unknown                                                 258   2e-81    
emb|CBI24648.3|  unnamed protein product                                259   3e-81    
ref|XP_006432581.1|  hypothetical protein CICLE_v10003750mg             257   4e-81    
emb|CDY62220.1|  BnaCnng39650D                                          257   4e-81    
ref|XP_010506247.1|  PREDICTED: basic endochitinase CHB4-like           259   5e-81    
ref|XP_009142208.1|  PREDICTED: basic endochitinase CHB4-like           258   5e-81    
ref|XP_010517931.1|  PREDICTED: basic endochitinase CHB4-like           258   1e-80    
emb|CDY23381.1|  BnaC04g49090D                                          257   1e-80    
ref|XP_006371499.1|  hypothetical protein POPTR_0019s12370g             253   2e-80    
emb|CDX83476.1|  BnaA03g20300D                                          255   4e-80    
gb|AAO93092.1|  chitinase EP3                                           254   6e-80    
gb|ABQ57389.1|  class IV chitinase                                      256   7e-80    
gb|AAK62047.1|  chitinase class 4-like protein                          256   8e-80    
ref|XP_010508403.1|  PREDICTED: basic endochitinase CHB4-like           256   8e-80    
ref|XP_010506249.1|  PREDICTED: basic endochitinase CHB4-like           254   1e-79    
gb|ABK21750.1|  unknown                                                 253   2e-79    
gb|AEF59007.1|  class VII chitinase                                     253   2e-79    
gb|ABK23371.1|  unknown                                                 253   2e-79    
gb|AAD28730.1|AF112963_1  chitinase II precursor                        253   2e-79    



>emb|CDP10828.1| unnamed protein product [Coffea canephora]
Length=273

 Score =   415 bits (1067),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 196/249 (79%), Positives = 223/249 (90%), Gaps = 0/249 (0%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCA  LCCS++GYCGTG+DYCG GC+ GPC   PS  + G SVADIV+DAFFNGIAD
Sbjct  25   QNCGCAPDLCCSKFGYCGTGNDYCGSGCQSGPCTAAPSSGNSGVSVADIVTDAFFNGIAD  84

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA SSC GKGFYTR++FL+A+NSYPQFGTVGS DDSKREIAAFFAHVTHETGH+CYI+EI
Sbjct  85   QAASSCAGKGFYTRSAFLEALNSYPQFGTVGSVDDSKREIAAFFAHVTHETGHLCYIEEI  144

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            DG SRDYCD++NTQYPC PGK YYGRGPIQLSWNFNYGPAG+SIGF+GL+ P+ VAT+ +
Sbjct  145  DGPSRDYCDESNTQYPCVPGKGYYGRGPIQLSWNFNYGPAGESIGFNGLSQPETVATNNV  204

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKT LW+WMN+CH LITSGQGFGATIRAINGQLECDGANP+TV  RVEYYT+YC+QLG
Sbjct  205  ISFKTGLWYWMNHCHDLITSGQGFGATIRAINGQLECDGANPNTVSARVEYYTEYCRQLG  264

Query  833  VDPGNNLEC  859
            V+ G+NL C
Sbjct  265  VETGDNLRC  273



>ref|XP_006359038.1| PREDICTED: chitinase 5-like [Solanum tuberosum]
Length=276

 Score =   410 bits (1053),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 195/250 (78%), Positives = 217/250 (87%), Gaps = 1/250 (0%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHpp-sppsgggsVADIVSDAFFNGIA  289
            QNCGC+  LCCS+WGYCGTG+DYCGEGC+ GPC+    S  + G SV+D+V+DAFFNGIA
Sbjct  27   QNCGCSSDLCCSRWGYCGTGNDYCGEGCQGGPCFSTTPSNNNNGVSVSDVVTDAFFNGIA  86

Query  290  DQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKE  469
            DQA SSCEGKGFYTR  F +A+ SY  FGTVGS+DDSKREIAAFFAHVTHETGHMCYI E
Sbjct  87   DQAASSCEGKGFYTRERFFEALQSYSNFGTVGSSDDSKREIAAFFAHVTHETGHMCYINE  146

Query  470  IDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDP  649
            I+G S DYCD+TNT+YPC  GK Y+GRGPIQLSWNFNYGPAGQSIGFDGLN+PD+V  D 
Sbjct  147  INGPSGDYCDETNTEYPCVSGKNYFGRGPIQLSWNFNYGPAGQSIGFDGLNDPDIVGRDG  206

Query  650  IISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQL  829
            +ISFKTALW+WMNNCHSLITSGQGFG TIRAINGQLECDG NP TV +RVEYYTQYCQQL
Sbjct  207  VISFKTALWYWMNNCHSLITSGQGFGPTIRAINGQLECDGGNPQTVARRVEYYTQYCQQL  266

Query  830  GVDPGNNLEC  859
            GVD G+NL C
Sbjct  267  GVDTGDNLTC  276



>ref|XP_009777773.1| PREDICTED: endochitinase PR4-like [Nicotiana sylvestris]
Length=276

 Score =   409 bits (1050),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 190/249 (76%), Positives = 219/249 (88%), Gaps = 1/249 (0%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCAE LCCS+WG+CGTG+D+CG+GC+ GPC+      +GG  VAD+VS+AFFNGIAD
Sbjct  29   QNCGCAESLCCSKWGFCGTGNDFCGQGCQGGPCFSASLSSNGGS-VADVVSNAFFNGIAD  87

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA S+CEGKGFYTR +FL+A+ SYP FGT+GS DDSKREIAAFFAHVTHETGHMC+I EI
Sbjct  88   QAASTCEGKGFYTRANFLEALQSYPNFGTMGSTDDSKREIAAFFAHVTHETGHMCFINEI  147

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G S DYCD+ NT+YPC  GK YYGRGPIQLSWNFNYGPAG+SIGFDGLN+PD+VA D +
Sbjct  148  NGPSGDYCDEDNTEYPCVSGKNYYGRGPIQLSWNFNYGPAGKSIGFDGLNDPDIVARDAV  207

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALW+WMNNCHSLITSGQGFG TIRAINGQ+ECDG NP TV +RVEYYT+YCQQLG
Sbjct  208  ISFKTALWYWMNNCHSLITSGQGFGPTIRAINGQIECDGGNPQTVARRVEYYTEYCQQLG  267

Query  833  VDPGNNLEC  859
            V+ G+NL C
Sbjct  268  VETGDNLTC  276



>dbj|BAF44533.1| class IV chitinase [Nicotiana tabacum]
Length=276

 Score =   408 bits (1049),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 189/249 (76%), Positives = 218/249 (88%), Gaps = 1/249 (0%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCAE LCCS+WG+CGTG+D+CG+GC+ GPC+      +GG  VAD+VS+AFFNGI D
Sbjct  29   QNCGCAESLCCSKWGFCGTGNDFCGQGCQGGPCFSASLSSNGGS-VADVVSNAFFNGITD  87

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA S+CEGKGFYTR +FL+A+ SYP FGT+GS DDSKREIAAFFAHVTHETGHMC+I EI
Sbjct  88   QAASTCEGKGFYTRANFLEALQSYPNFGTMGSTDDSKREIAAFFAHVTHETGHMCFINEI  147

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G S DYCD+ NT+YPC  GK YYGRGPIQLSWNFNYGPAG+SIGFDGLN+PD+VA D +
Sbjct  148  NGPSLDYCDENNTEYPCVSGKNYYGRGPIQLSWNFNYGPAGKSIGFDGLNDPDIVARDAV  207

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALW+WMNNCHSLITSGQGFG TIRAINGQ+ECDG NP TV +RVEYYT+YCQQLG
Sbjct  208  ISFKTALWYWMNNCHSLITSGQGFGPTIRAINGQIECDGGNPQTVARRVEYYTEYCQQLG  267

Query  833  VDPGNNLEC  859
            V+ G+NL C
Sbjct  268  VETGDNLTC  276



>gb|EYU40983.1| hypothetical protein MIMGU_mgv1a011672mg [Erythranthe guttata]
Length=274

 Score =   406 bits (1043),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 196/249 (79%), Positives = 218/249 (88%), Gaps = 2/249 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCA  LCCSQ+G+CG G+DYCG GC+ GPC     P S GGSV++IV+DAFFNGI+D
Sbjct  28   QNCGCASDLCCSQFGFCGIGNDYCGRGCQSGPC--SAGPASNGGSVSNIVTDAFFNGISD  85

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA  SC GKGFYTR++FL+AVNSY +FGTVGSADDSKREIAAFFAHVTHETGHMC+I+EI
Sbjct  86   QAAGSCAGKGFYTRSAFLEAVNSYTEFGTVGSADDSKREIAAFFAHVTHETGHMCFIEEI  145

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            DG S+DYCD+TNTQYPC P K YYGRGPIQLSWNFNYGPAG SIGFDGLNNP++VATD I
Sbjct  146  DGASKDYCDETNTQYPCTPNKGYYGRGPIQLSWNFNYGPAGSSIGFDGLNNPEIVATDRI  205

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALW+WMNNCH  I SGQGFG+TIRAING LECDGANPDTV  RV+YYTQYC QLG
Sbjct  206  ISFKTALWYWMNNCHDRIISGQGFGSTIRAINGPLECDGANPDTVSARVQYYTQYCDQLG  265

Query  833  VDPGNNLEC  859
            V PGN+L C
Sbjct  266  VAPGNDLRC  274



>ref|XP_004237833.1| PREDICTED: chitinase 6 [Solanum lycopersicum]
Length=276

 Score =   400 bits (1029),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/250 (76%), Positives = 213/250 (85%), Gaps = 1/250 (0%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHpp-sppsgggsVADIVSDAFFNGIA  289
            Q+CGC+  LCCS+WGYCG+G+DYCGEGC+ GPC+    S  + G  V+D+V++AFFNGIA
Sbjct  27   QDCGCSSDLCCSKWGYCGSGNDYCGEGCQGGPCFSTTPSNNNNGVIVSDVVTNAFFNGIA  86

Query  290  DQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKE  469
            DQ  SSCEGKGFYTR  FL+A+ SY  FGTVGS DDSKREIAAFFAHVTHETGHMCYI E
Sbjct  87   DQGASSCEGKGFYTRERFLEALQSYSNFGTVGSTDDSKREIAAFFAHVTHETGHMCYINE  146

Query  470  IDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDP  649
            I+G S DYCD+ NT YPC  GK YYGRGPIQLSWNFNYGPAGQSIGFDGLN+PD+V  D 
Sbjct  147  INGPSGDYCDENNTDYPCVSGKNYYGRGPIQLSWNFNYGPAGQSIGFDGLNDPDIVGRDG  206

Query  650  IISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQL  829
            +ISFKTALW+WMNNCHSLITSGQGFG TIRAINGQ+ECDG NP TV +RVEYYTQYCQQL
Sbjct  207  VISFKTALWYWMNNCHSLITSGQGFGPTIRAINGQIECDGGNPQTVARRVEYYTQYCQQL  266

Query  830  GVDPGNNLEC  859
            GVD G+NL C
Sbjct  267  GVDTGDNLTC  276



>ref|XP_009802809.1| PREDICTED: chitinase 4-like [Nicotiana sylvestris]
Length=276

 Score =   400 bits (1027),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 182/249 (73%), Positives = 214/249 (86%), Gaps = 0/249 (0%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            Q CGCAEGLCCS+WGYCGTG+DYCG+GC+ GPCY          SV++IVS+AFFNGIA+
Sbjct  28   QKCGCAEGLCCSKWGYCGTGNDYCGKGCQGGPCYGSLISNGSAFSVSEIVSEAFFNGIAN  87

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA SSC+GKGFYTR++FL+A+ SYP+FGTVGS++D++REIAAFFAHVTHETGHMCYI EI
Sbjct  88   QAASSCDGKGFYTRSAFLEALKSYPRFGTVGSSNDTRREIAAFFAHVTHETGHMCYISEI  147

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G +RDYCD+ N +YPC PGK YYGRGPIQLSWNFNYGPAG+ IGFDGLN+PD+VA D I
Sbjct  148  NGPTRDYCDQQNVEYPCVPGKKYYGRGPIQLSWNFNYGPAGKDIGFDGLNDPDIVARDSI  207

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALW+WM+NCHSLITSGQGFGATIRA  G  ECDG NP  V +R++YYT+YC QLG
Sbjct  208  ISFKTALWYWMSNCHSLITSGQGFGATIRATYGPFECDGGNPPAVARRIDYYTEYCHQLG  267

Query  833  VDPGNNLEC  859
            V+ GNN  C
Sbjct  268  VETGNNSSC  276



>ref|XP_009591110.1| PREDICTED: endochitinase PR4-like [Nicotiana tomentosiformis]
Length=277

 Score =   399 bits (1025),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 182/249 (73%), Positives = 213/249 (86%), Gaps = 0/249 (0%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            Q CGCAEGLCCS+WGYCGTG+DYCG+GC+ GPCY           V++IVS+AFFNGIA+
Sbjct  29   QKCGCAEGLCCSKWGYCGTGNDYCGKGCQGGPCYGSLISNGSAYPVSEIVSEAFFNGIAN  88

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA SSC+GKGFYTR++FL+A+ SYP+FGTVGS++D+KREIAAFFAHVTHETGHMCYI EI
Sbjct  89   QAASSCDGKGFYTRSAFLEALKSYPRFGTVGSSNDTKREIAAFFAHVTHETGHMCYISEI  148

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G +RDYCD+ N +YPC PGK YYGRGPIQLSWNFNYGPAG+ IGFDGLN+PD+VA D I
Sbjct  149  NGPTRDYCDQLNIEYPCVPGKKYYGRGPIQLSWNFNYGPAGKDIGFDGLNDPDIVARDSI  208

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALW+WM+NCHSLITSGQGFGATIRA  G  ECDG NP  V +R++YYT+YC QLG
Sbjct  209  ISFKTALWYWMSNCHSLITSGQGFGATIRATYGPFECDGGNPPAVARRIDYYTEYCHQLG  268

Query  833  VDPGNNLEC  859
            V+ GNN  C
Sbjct  269  VETGNNSSC  277



>emb|CDP10829.1| unnamed protein product [Coffea canephora]
Length=273

 Score =   397 bits (1019),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 188/249 (76%), Positives = 215/249 (86%), Gaps = 0/249 (0%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCA  LCCS++GYCGT +DYCG GC+ GPC   PS  + G SVA IV+DAFFNGIA+
Sbjct  25   QNCGCAPNLCCSKFGYCGTSNDYCGPGCQSGPCTGAPSGGNNGASVAGIVTDAFFNGIAN  84

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA S C GKGFYTR++FL A  SY +FGT GSA DSKRE+AAFFAHVTHETGH+CYI+EI
Sbjct  85   QAASGCAGKGFYTRSAFLQAQKSYSKFGTAGSAADSKREVAAFFAHVTHETGHLCYIEEI  144

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G SR+YCDK+NTQYPC PGK YYGRGP+Q+SWN+NYGPAGQSIGF+GL+ P++VA D +
Sbjct  145  NGPSRNYCDKSNTQYPCVPGKGYYGRGPLQISWNYNYGPAGQSIGFNGLSQPELVARDNV  204

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALWFWMNNCHSLI SGQGFGATIRAING+LECDGANP+TV  RV YYTQYC+QLG
Sbjct  205  ISFKTALWFWMNNCHSLIISGQGFGATIRAINGRLECDGANPNTVSARVGYYTQYCRQLG  264

Query  833  VDPGNNLEC  859
            VDPG NL C
Sbjct  265  VDPGPNLRC  273



>emb|CDP21309.1| unnamed protein product [Coffea canephora]
Length=273

 Score =   395 bits (1016),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 187/249 (75%), Positives = 215/249 (86%), Gaps = 0/249 (0%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCA  LCCS++GYCGT +DYCG GC+ GPC   PS  + G SVA IV+DAFFNGIA+
Sbjct  25   QNCGCAPNLCCSKFGYCGTSNDYCGPGCQSGPCTGAPSGGNNGASVAGIVTDAFFNGIAN  84

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA S C GKGFYTR++FL A  SY +FGT GSA DSKRE+AAFFAHVTHETGH+CYI+EI
Sbjct  85   QAASGCAGKGFYTRSAFLQAQKSYSKFGTAGSAADSKREVAAFFAHVTHETGHLCYIEEI  144

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G SR+YCDK+NTQYPC PGK YYGRGP+Q+SWN+NYGPAGQSIGF+GL+ P++VA D +
Sbjct  145  NGPSRNYCDKSNTQYPCVPGKGYYGRGPLQISWNYNYGPAGQSIGFNGLSQPELVARDNV  204

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALWFWMNNCHSLI +GQGFGATIRAING+LECDGANP+TV  RV YYTQYC+QLG
Sbjct  205  ISFKTALWFWMNNCHSLIIAGQGFGATIRAINGRLECDGANPNTVSARVGYYTQYCRQLG  264

Query  833  VDPGNNLEC  859
            VDPG NL C
Sbjct  265  VDPGPNLRC  273



>ref|XP_009796978.1| PREDICTED: chitinase 4-like [Nicotiana sylvestris]
Length=274

 Score =   394 bits (1011),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 184/249 (74%), Positives = 215/249 (86%), Gaps = 2/249 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCAEGLCCS+WGYCGTG+ YCG+GCK GPC+   +   G  SV+ IVS+ FFNGIA+
Sbjct  28   QNCGCAEGLCCSRWGYCGTGNAYCGQGCKGGPCF--ITANYGISSVSQIVSEPFFNGIAN  85

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA  +CEGKGFYTR +FL+A+ SYP+FGT GS+DD+KREIAAFFAHVTHETG MCY  EI
Sbjct  86   QAAPNCEGKGFYTRAAFLEALRSYPRFGTDGSSDDNKREIAAFFAHVTHETGQMCYRNEI  145

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G SRDYCD+TN +YPC PGK YYGRGPIQLSWNFNYGPAG+  GFDGLN+PD+VA D +
Sbjct  146  NGASRDYCDETNAEYPCVPGKKYYGRGPIQLSWNFNYGPAGKDNGFDGLNDPDIVARDSL  205

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALW+WMNNCH+LITSGQGFGATIRAING LEC+G NP+ V +R++YYT++CQQLG
Sbjct  206  ISFKTALWYWMNNCHALITSGQGFGATIRAINGPLECNGGNPEPVARRIQYYTEFCQQLG  265

Query  833  VDPGNNLEC  859
            VD GNNL C
Sbjct  266  VDTGNNLTC  274



>ref|XP_010687451.1| PREDICTED: chitinase 6-like [Beta vulgaris subsp. vulgaris]
Length=273

 Score =   390 bits (1001),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 178/249 (71%), Positives = 208/249 (84%), Gaps = 0/249 (0%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC  G+CCSQWG+CGT  +YCGEGC+EGPC  P        SV ++V++AFFNGI D
Sbjct  25   QNCGCGAGICCSQWGFCGTTTEYCGEGCREGPCDTPVPSTPNDVSVPEVVTNAFFNGIID  84

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            Q+D+SC G+ FY+R++FLDA+N YPQFGTVGS DDS+REIAAFFAHVTHETGH CYI+EI
Sbjct  85   QSDASCAGRNFYSRSAFLDALNHYPQFGTVGSTDDSRREIAAFFAHVTHETGHFCYIEEI  144

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G S DYCD+TNT +PC P + YYGRGPIQLSWNFNYGPAGQSIGFDGLN P+ VA DP+
Sbjct  145  NGASGDYCDETNTDWPCNPDRQYYGRGPIQLSWNFNYGPAGQSIGFDGLNAPETVANDPV  204

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            I+F+TALW+WMNN HS I SGQGFG+TIRAING+LECDG NP TV  R+ YYTQYC QLG
Sbjct  205  IAFRTALWYWMNNVHSRIISGQGFGSTIRAINGRLECDGGNPATVNARIGYYTQYCNQLG  264

Query  833  VDPGNNLEC  859
            V PG+NL C
Sbjct  265  VSPGDNLSC  273



>ref|XP_011091571.1| PREDICTED: chitinase 6-like [Sesamum indicum]
Length=270

 Score =   389 bits (999),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 191/249 (77%), Positives = 210/249 (84%), Gaps = 8/249 (3%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCA  LCCSQWGYCGTG+       + GPC     P S G SV DIV+D FF GIAD
Sbjct  30   QNCGCAPDLCCSQWGYCGTGNG------QSGPC--SAPPSSNGVSVPDIVTDQFFYGIAD  81

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA +SC GKGFYTR +FL+A+NSY QFGTVGS+DDS+REIAAFFAHVTHETGHMCYI+EI
Sbjct  82   QAAASCSGKGFYTRAAFLEALNSYQQFGTVGSSDDSRREIAAFFAHVTHETGHMCYIEEI  141

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            DG S+DYCD+TNTQYPCAP K YYGRGPIQLSWNFNYGPAG SIGFDGLNNP++VAT  +
Sbjct  142  DGPSKDYCDETNTQYPCAPNKGYYGRGPIQLSWNFNYGPAGNSIGFDGLNNPEIVATGRV  201

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISF+TALW+WMNNCH LI SGQGFGATIRAING+LECDGANPDTV  RV YYTQYC QL 
Sbjct  202  ISFRTALWYWMNNCHDLIVSGQGFGATIRAINGRLECDGANPDTVSARVRYYTQYCNQLQ  261

Query  833  VDPGNNLEC  859
            VDPGN+L C
Sbjct  262  VDPGNDLRC  270



>ref|XP_009591111.1| PREDICTED: chitinase 4-like [Nicotiana tomentosiformis]
Length=274

 Score =   388 bits (996),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 181/249 (73%), Positives = 212/249 (85%), Gaps = 2/249 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCAEGLCCS+WGYCGTG+ YCG+GCK GPC+   +   G  SV+ IVS+ FFNGIA+
Sbjct  28   QNCGCAEGLCCSRWGYCGTGNAYCGQGCKGGPCF--ITENYGISSVSQIVSEPFFNGIAN  85

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA  +CEGKGFYTR++FL+A+ SYP F T GS+DD+KREIAAFFAHVTHETG MCY  EI
Sbjct  86   QAAPNCEGKGFYTRSAFLEALRSYPLFATAGSSDDNKREIAAFFAHVTHETGQMCYRNEI  145

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G SRDYCD+TN +YPC  GK YYGRGPIQLSWNFNYGPAG+ IGFDG+N+PD+VA D +
Sbjct  146  NGASRDYCDETNKEYPCVLGKKYYGRGPIQLSWNFNYGPAGKDIGFDGVNDPDIVARDSL  205

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            I+FKTA W+WMNNCHSLITSG GFGATIRAING LEC+G NP+ V +R++YYT+YCQQLG
Sbjct  206  IAFKTAFWYWMNNCHSLITSGHGFGATIRAINGPLECNGGNPEPVARRIQYYTEYCQQLG  265

Query  833  VDPGNNLEC  859
            VD GNNL C
Sbjct  266  VDTGNNLTC  274



>ref|XP_008801201.1| PREDICTED: chitinase 6-like [Phoenix dactylifera]
Length=269

 Score =   385 bits (990),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 186/249 (75%), Positives = 207/249 (83%), Gaps = 2/249 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC+  LCCSQWGYCGTG DYCG GC+EGPC    SPP    SVADIV+  FF+GI +
Sbjct  23   QNCGCSPDLCCSQWGYCGTGSDYCGTGCREGPC--ESSPPPNDVSVADIVTQQFFDGIIN  80

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QAD+ C GK FYTR +FLDA+ SYP FG  G+ DDSKREIAAFFAHVTHETGH CYI+EI
Sbjct  81   QADNGCVGKSFYTRAAFLDALGSYPNFGRDGTVDDSKREIAAFFAHVTHETGHFCYIEEI  140

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            DG S+DYCD+TNTQ+PC PGK YYGRGPIQLSWNFNYGPAG+SIGFDGLN+P+ VA D +
Sbjct  141  DGASKDYCDETNTQWPCVPGKGYYGRGPIQLSWNFNYGPAGKSIGFDGLNSPETVANDVV  200

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALW+WM N HSLITSGQGFGATIRAING LECDG NP+TV KRV YY  YC+Q G
Sbjct  201  ISFKTALWYWMTNVHSLITSGQGFGATIRAINGALECDGKNPETVNKRVGYYLDYCKQFG  260

Query  833  VDPGNNLEC  859
            V PG+NL C
Sbjct  261  VAPGDNLTC  269



>ref|XP_007033803.1| Carrot EP3-3 chitinase [Theobroma cacao]
 gb|EOY04729.1| Carrot EP3-3 chitinase [Theobroma cacao]
Length=273

 Score =   384 bits (986),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 182/249 (73%), Positives = 211/249 (85%), Gaps = 4/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCAEGLCCS+WG+CGTGDD+CG GC+EGPC   P P     SVADIV+  FFNGI D
Sbjct  29   QNCGCAEGLCCSRWGFCGTGDDFCGTGCQEGPC--NPPPTLNNVSVADIVTPQFFNGILD  86

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            +A++SCEGK FY+R +FL+A+NSYPQFG +GS DDSKREIAAFF HVTHETGH C+I+EI
Sbjct  87   EAEASCEGKNFYSRAAFLEALNSYPQFGRIGSIDDSKREIAAFFGHVTHETGHFCFIEEI  146

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G +RDYCD+++TQYPC P K YYGRGPIQLSWNFNYGPAG+SIGFDGLN+P+ VATDP+
Sbjct  147  NGTTRDYCDESSTQYPCNPDKGYYGRGPIQLSWNFNYGPAGESIGFDGLNSPETVATDPV  206

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALW+W+N    +I  GQGFGATIRAING LECDG NP TV+ R+EYYT YC QLG
Sbjct  207  ISFKTALWYWVNFVQPVI--GQGFGATIRAINGALECDGGNPATVQARIEYYTDYCNQLG  264

Query  833  VDPGNNLEC  859
            VDPG NL C
Sbjct  265  VDPGANLTC  273



>ref|XP_010055735.1| PREDICTED: endochitinase PR4-like [Eucalyptus grandis]
 gb|KCW87622.1| hypothetical protein EUGRSUZ_A00020 [Eucalyptus grandis]
Length=275

 Score =   383 bits (983),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 185/249 (74%), Positives = 207/249 (83%), Gaps = 4/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCA   CCS+WGYCGTGDDYCG GC+EGPC     PP+    VAD+V++AFF+GI  
Sbjct  31   QNCGCAADQCCSRWGYCGTGDDYCGTGCQEGPC--NAPPPTNDVVVADVVTEAFFDGIIG  88

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA  SCEGKGFY+R +FL+A  SYPQFG VGS DDSKREIAAFFAHVTHETGH CYI EI
Sbjct  89   QAAESCEGKGFYSRGTFLEAAGSYPQFGRVGSVDDSKREIAAFFAHVTHETGHFCYINEI  148

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            DG S+DYCD+TNTQYPC+P K YYGRGPIQLSWNFNYGPAG+SIGFDGLN+PD VATDP+
Sbjct  149  DGASKDYCDETNTQYPCSPNKGYYGRGPIQLSWNFNYGPAGESIGFDGLNSPDTVATDPL  208

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALW+WMN    +I   QGFGATIRAING LECDG NP TV+ RV+YYT+YC QLG
Sbjct  209  ISFKTALWYWMNFVRPVID--QGFGATIRAINGALECDGGNPATVQARVQYYTEYCSQLG  266

Query  833  VDPGNNLEC  859
            V PG+NL C
Sbjct  267  VAPGDNLTC  275



>emb|CAN79254.1| hypothetical protein VITISV_009137 [Vitis vinifera]
Length=274

 Score =   380 bits (977),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 183/249 (73%), Positives = 209/249 (84%), Gaps = 4/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            Q+CGCA  LCCS+WGYCGTGDDYCG GC+EGPC   P+P +   SVADIV+  FFNGI D
Sbjct  30   QDCGCAADLCCSRWGYCGTGDDYCGTGCQEGPC--NPAPSTNNVSVADIVTQKFFNGIID  87

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QAD+SCEGK FY+R  FL+A+NS+ QFG VGS +DSKREIAAFFAHVTHETGH CYI+EI
Sbjct  88   QADASCEGKNFYSRAXFLEALNSFSQFGRVGSEEDSKREIAAFFAHVTHETGHFCYIEEI  147

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G SRDYCD+TNTQYPC  GK YYGRGPIQLSWNFNYGPAG+ IGFDGLN+P+ VA+DP+
Sbjct  148  NGSSRDYCDETNTQYPCVAGKGYYGRGPIQLSWNFNYGPAGEDIGFDGLNSPETVASDPV  207

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            +SFKTALW+W+N    +I  GQGFGATIRAING LECDGAN  TV  RVEYYT+YC QLG
Sbjct  208  VSFKTALWYWVNFVQPVI--GQGFGATIRAINGALECDGANQATVNARVEYYTEYCNQLG  265

Query  833  VDPGNNLEC  859
            V PG+NL C
Sbjct  266  VTPGDNLTC  274



>ref|XP_002274537.1| PREDICTED: endochitinase PR4 [Vitis vinifera]
Length=274

 Score =   380 bits (977),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 183/249 (73%), Positives = 209/249 (84%), Gaps = 4/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            Q+CGCA  LCCS+WGYCGTGDDYCG GC+EGPC   P+P +   SVADIV+  FFNGI D
Sbjct  30   QDCGCAADLCCSRWGYCGTGDDYCGTGCQEGPC--NPAPSTNNVSVADIVTQKFFNGIID  87

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QAD+SCEGK FY+R  FL+A+NS+ QFG VGS +DSKREIAAFFAHVTHETGH CYI+EI
Sbjct  88   QADASCEGKNFYSRARFLEALNSFSQFGRVGSEEDSKREIAAFFAHVTHETGHFCYIEEI  147

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G SRDYCD+TNTQYPC  GK YYGRGPIQLSWNFNYGPAG+ IGFDGLN+P+ VA+DP+
Sbjct  148  NGSSRDYCDETNTQYPCVAGKGYYGRGPIQLSWNFNYGPAGEDIGFDGLNSPETVASDPV  207

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            +SFKTALW+W+N   S+I   QGFGATIRAING LECDGAN  TV  RVEYYT+YC QLG
Sbjct  208  VSFKTALWYWVNFVQSVID--QGFGATIRAINGALECDGANQATVNARVEYYTEYCNQLG  265

Query  833  VDPGNNLEC  859
            V PG+NL C
Sbjct  266  VTPGDNLTC  274



>gb|ACM45716.1| class IV chitinase [Pyrus pyrifolia]
 gb|AIL82439.1| chitinase ppl-2 [Pyrus x bretschneideri]
Length=272

 Score =   380 bits (976),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 181/250 (72%), Positives = 206/250 (82%), Gaps = 3/250 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsp-psgggsVADIVSDAFFNGIA  289
            QNCGCA  LCCSQ+GYCGT D YCG+GC+ GPC  P     +    VADIV+  FFNGI 
Sbjct  25   QNCGCAADLCCSQYGYCGTDDAYCGKGCQSGPCKTPAQTPSTNDVVVADIVTPEFFNGII  84

Query  290  DQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKE  469
            DQAD+SC GK FY+R +FL+A+NSY QFG +GS DDSKREIAAFFAHVTHETGH CYI+E
Sbjct  85   DQADASCAGKNFYSRATFLEALNSYNQFGRIGSVDDSKREIAAFFAHVTHETGHFCYIEE  144

Query  470  IDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDP  649
            IDG S+DYCD+ NTQYPC P K YYGRGPIQLSWNFNYGPAG+SIGFDGLN+P+ VA DP
Sbjct  145  IDGASKDYCDENNTQYPCNPNKGYYGRGPIQLSWNFNYGPAGESIGFDGLNSPETVANDP  204

Query  650  IISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQL  829
            +I+FKTALW+WMNN   +I  G+GFGATIRAING LECDG NP TV+KRVEYYT+YC QL
Sbjct  205  VIAFKTALWYWMNNVRPVI--GEGFGATIRAINGALECDGGNPATVQKRVEYYTEYCNQL  262

Query  830  GVDPGNNLEC  859
            GV PG+NL C
Sbjct  263  GVAPGDNLTC  272



>ref|XP_008369197.1| PREDICTED: endochitinase PR4-like [Malus domestica]
Length=272

 Score =   380 bits (975),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 181/250 (72%), Positives = 205/250 (82%), Gaps = 3/250 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsp-psgggsVADIVSDAFFNGIA  289
            QNCGCA   CCSQ+GYCGT D YCG GCK GPC  P     +    VADIV+  FFNGI 
Sbjct  25   QNCGCAADQCCSQYGYCGTDDAYCGTGCKSGPCKTPAQTPSTSDVVVADIVTPEFFNGII  84

Query  290  DQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKE  469
            DQAD+SC GK FY+R +FL+A+NSY QFG +GS DDSKREIAAFFAHVTHETGH CYI+E
Sbjct  85   DQADASCAGKNFYSRATFLEALNSYTQFGRIGSIDDSKREIAAFFAHVTHETGHFCYIEE  144

Query  470  IDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDP  649
            IDG S+DYCD+TNTQYPC P K YYGRGPIQLSWNFNYGPAG+SIGFDGLN+P+ VA DP
Sbjct  145  IDGASKDYCDETNTQYPCNPNKGYYGRGPIQLSWNFNYGPAGESIGFDGLNSPETVANDP  204

Query  650  IISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQL  829
            +I+FKTALW+WMNN   +I  G+GFGATIRAING LECDG NP TV++RVEYYT+YC QL
Sbjct  205  VIAFKTALWYWMNNVRPVI--GEGFGATIRAINGALECDGGNPATVQRRVEYYTEYCNQL  262

Query  830  GVDPGNNLEC  859
            GV PG+NL C
Sbjct  263  GVAPGDNLTC  272



>gb|ACX94236.1| chitinase [Lactuca sativa]
Length=267

 Score =   378 bits (971),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 182/249 (73%), Positives = 213/249 (86%), Gaps = 5/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCA GLCCS++G+CG+ + YCG GC+EG C+    PP+   SVADIV+DAFF+GI D
Sbjct  24   QNCGCAPGLCCSRFGFCGSDEAYCGAGCQEGSCF--GPPPTNDVSVADIVTDAFFDGIVD  81

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            Q+DSSCEG+ FY+R +FL+AV +YPQFG VGS DDSKREIAAFFAHVTHETGH CYI+EI
Sbjct  82   QSDSSCEGRPFYSRAAFLEAVGNYPQFGRVGSEDDSKREIAAFFAHVTHETGHFCYIEEI  141

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G SRDYCD+ NTQYPC P K YYGRGPIQLSWN+NYGPAG+SIGFDG+NNP++VATDP+
Sbjct  142  NGPSRDYCDEDNTQYPCNPSKGYYGRGPIQLSWNYNYGPAGRSIGFDGVNNPEIVATDPV  201

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            I+F+TALWFWMNN  S++  GQGFGATIRAING +ECDG NPDTV  RV YYTQYC QLG
Sbjct  202  IAFRTALWFWMNNVQSVL--GQGFGATIRAING-MECDGGNPDTVSSRVRYYTQYCDQLG  258

Query  833  VDPGNNLEC  859
            V PG+NL C
Sbjct  259  VAPGDNLRC  267



>ref|XP_009405567.1| PREDICTED: chitinase 6 [Musa acuminata subsp. malaccensis]
Length=270

 Score =   378 bits (971),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 184/249 (74%), Positives = 202/249 (81%), Gaps = 2/249 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC+  LCCS+WGYCGTG DYCG GC+ GPC    SPP+   SVADIV+ +FF+GI  
Sbjct  24   QNCGCSSDLCCSKWGYCGTGSDYCGAGCQSGPC--EASPPANDVSVADIVTQSFFDGIIG  81

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QAD  C GK FYTR +FL A+ SY  FG VG+ DDSKREIAAFFAHVTHETGH CYI+EI
Sbjct  82   QADGGCVGKSFYTRDAFLSALGSYTSFGRVGTVDDSKREIAAFFAHVTHETGHFCYIEEI  141

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            DG S+DYCDKTNTQYPC  GK YYGRGPIQLSWNFNYGPAG+SIGFDGL+ P+ VA D +
Sbjct  142  DGASKDYCDKTNTQYPCVAGKGYYGRGPIQLSWNFNYGPAGESIGFDGLSAPETVANDVV  201

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALW+WMNNCHSLITSGQGFGATIRAING LECDG NP TV  RV YY  YC Q G
Sbjct  202  ISFKTALWYWMNNCHSLITSGQGFGATIRAINGALECDGKNPATVNARVGYYQDYCGQFG  261

Query  833  VDPGNNLEC  859
            VD G+NL C
Sbjct  262  VDTGDNLTC  270



>ref|XP_010930457.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105051630 
[Elaeis guineensis]
Length=718

 Score =   393 bits (1009),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 188/249 (76%), Positives = 210/249 (84%), Gaps = 2/249 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC+  LCCSQWGYCGTG DYCG GC+EGPC    SPP+   SVADIV+  FF+GI +
Sbjct  28   QNCGCSPDLCCSQWGYCGTGSDYCGTGCREGPC--ELSPPTNDVSVADIVTQQFFDGIIN  85

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QAD+ C GK FYTR +FLDA++ YP FG VG+ DDSKREIAAFFAHVTHETGH CYI+EI
Sbjct  86   QADNGCVGKSFYTRAAFLDALDFYPNFGQVGTVDDSKREIAAFFAHVTHETGHFCYIEEI  145

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            DG S+DYCDKTNTQ+PC PGK YYGRGPIQLSWNFNYGPAG+SIGFDGLN+P+ VA D +
Sbjct  146  DGASKDYCDKTNTQWPCVPGKGYYGRGPIQLSWNFNYGPAGKSIGFDGLNSPETVANDAV  205

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISF+TALW+WMNN HSLITSGQGFGATIRAING LECDG NP+TV KRV YY  YC+Q G
Sbjct  206  ISFRTALWYWMNNVHSLITSGQGFGATIRAINGALECDGKNPETVNKRVGYYEDYCKQFG  265

Query  833  VDPGNNLEC  859
            VDPG NL C
Sbjct  266  VDPGANLTC  274


 Score =   385 bits (988),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 184/249 (74%), Positives = 208/249 (84%), Gaps = 2/249 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC+  LCCSQWGYCGTG DYCG GC+EGPC    SPP+   SVADIV+  FF+GI +
Sbjct  472  QNCGCSPDLCCSQWGYCGTGSDYCGTGCREGPC--ESSPPTNDVSVADIVTQQFFDGIIN  529

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QAD+ C GK FYTR +FLDA++ YP FG VG+ DDSKREIAAFFAHVTHETGH CYI+EI
Sbjct  530  QADNGCVGKSFYTRAAFLDALDFYPNFGRVGTVDDSKREIAAFFAHVTHETGHFCYIEEI  589

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            DG S+DYCD+ +TQ+PC PGK YYGRGPIQLSWNFNYGPAGQSIGFDGLN+P+ VA D +
Sbjct  590  DGASKDYCDENDTQWPCVPGKGYYGRGPIQLSWNFNYGPAGQSIGFDGLNSPETVANDVV  649

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISF+TALW+WM   HSLITSGQGFGATIRAING LECDG NP+TV KRV YY  YC+Q G
Sbjct  650  ISFRTALWYWMKYVHSLITSGQGFGATIRAINGALECDGKNPETVNKRVGYYEDYCKQFG  709

Query  833  VDPGNNLEC  859
            VDPG+NL C
Sbjct  710  VDPGDNLTC  718


 Score =   149 bits (375),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 86/114 (75%), Gaps = 2/114 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC+  LCCSQWGYCGTG DYCG GC+EGPC +  S      SVA+IV+  FF+GI +
Sbjct  326  QNCGCSPELCCSQWGYCGTGSDYCGMGCREGPCEY-VSATIYDVSVAEIVTQQFFDGIIN  384

Query  293  -QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGH  451
             Q D+ C GK FYTR +FLDA+ SY  FG VGS DDSKREIAAFFAHVTHETG 
Sbjct  385  HQVDNECVGKSFYTRAAFLDALRSYLNFGQVGSVDDSKREIAAFFAHVTHETGR  438



>ref|XP_002274758.1| PREDICTED: endochitinase PR4 [Vitis vinifera]
Length=274

 Score =   377 bits (967),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 181/249 (73%), Positives = 208/249 (84%), Gaps = 4/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            Q+CGCA  LCCS+WGYCGTGDDYCG GC+EGPC   P P +   SVADIV+  FFNGI D
Sbjct  30   QDCGCAADLCCSRWGYCGTGDDYCGTGCQEGPC--NPPPSTNNVSVADIVTQEFFNGIID  87

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QAD+SCEGK FY+R  FL+A+NS+ QFG VGS +DSKREIAAFFAHVTHETGH CYI+EI
Sbjct  88   QADASCEGKNFYSRARFLEALNSFSQFGRVGSEEDSKREIAAFFAHVTHETGHFCYIEEI  147

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G SRDYCD+TNTQYPC  GK YYGRGPIQLSWN+NYGPAG+ IGFDGLN+P+ VA+DP+
Sbjct  148  NGSSRDYCDETNTQYPCVAGKGYYGRGPIQLSWNYNYGPAGEDIGFDGLNSPETVASDPV  207

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            +SFKTALW+W+N    +I  GQGFGATIRAI+G LECDGAN  TV  RVEYYT+YC QLG
Sbjct  208  VSFKTALWYWVNFVQPVI--GQGFGATIRAISGALECDGANQATVNARVEYYTEYCNQLG  265

Query  833  VDPGNNLEC  859
            V PG+NL C
Sbjct  266  VTPGDNLTC  274



>gb|EYU40975.1| hypothetical protein MIMGU_mgv1a011768mg [Erythranthe guttata]
Length=271

 Score =   375 bits (964),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 178/249 (71%), Positives = 201/249 (81%), Gaps = 1/249 (0%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCA  LCCSQ+GYCGTG+DYCG GC+ GPC+   S  + G  V+DIV+DAFFNGI +
Sbjct  24   QNCGCASNLCCSQFGYCGTGNDYCGTGCRSGPCF-GSSGGNNGVRVSDIVTDAFFNGIIN  82

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            Q+ S C G+ FYTR++FL A  SYP FGT GSADDS+REIAAFFAHVTHETGHMC   E 
Sbjct  83   QSPSGCPGRTFYTRSAFLQAAGSYPNFGTAGSADDSRREIAAFFAHVTHETGHMCSRVET  142

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
             G+SR+YCD +NTQYPCAP K YYGRGP+QLSWN+NYGPAGQSIGFDGLNNP++VA DP+
Sbjct  143  GGQSRNYCDSSNTQYPCAPNKGYYGRGPLQLSWNYNYGPAGQSIGFDGLNNPEIVARDPV  202

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALWFWM  CH  IT+GQGFGATIRAING LEC+GAN  TV  RV YY  YC Q  
Sbjct  203  ISFKTALWFWMRTCHGPITTGQGFGATIRAINGNLECNGANSGTVTARVNYYRDYCGQFR  262

Query  833  VDPGNNLEC  859
            VDPG NL C
Sbjct  263  VDPGTNLRC  271



>ref|XP_010094107.1| Endochitinase [Morus notabilis]
 gb|EXB55197.1| Endochitinase [Morus notabilis]
Length=279

 Score =   375 bits (962),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 181/250 (72%), Positives = 204/250 (82%), Gaps = 3/250 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC-YHppsppsgggsVADIVSDAFFNGIA  289
            QNCGCA   CCS++GYCG  DDYCG GC+EGPC   P +P +   SVADIV+  FFNGI 
Sbjct  32   QNCGCAADECCSRYGYCGKSDDYCGTGCQEGPCNTQPLTPSTHNVSVADIVTPEFFNGII  91

Query  290  DQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKE  469
            DQAD+ C GK FY+R  FL+A NSYP+FG VGS DDSKREIAAFF HVTHETGH CYI+E
Sbjct  92   DQADAGCAGKNFYSREVFLEAANSYPEFGQVGSIDDSKREIAAFFGHVTHETGHFCYIEE  151

Query  470  IDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDP  649
            I+G S DYCD+TNTQYPC P K YYGRGPIQLSWNFNYGPAG+SIGFDGLN+P+ VA DP
Sbjct  152  INGASGDYCDETNTQYPCNPEKKYYGRGPIQLSWNFNYGPAGESIGFDGLNSPETVANDP  211

Query  650  IISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQL  829
            +ISFKTALW+WM N   +I  G+GFGATIRAING LECDG NP TV+KR+EYYT+YC QL
Sbjct  212  VISFKTALWYWMENVRPVI--GEGFGATIRAINGALECDGGNPTTVQKRIEYYTEYCNQL  269

Query  830  GVDPGNNLEC  859
            GVDPG NL C
Sbjct  270  GVDPGENLTC  279



>ref|XP_004240991.1| PREDICTED: endochitinase PR4-like [Solanum lycopersicum]
Length=289

 Score =   374 bits (959),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 175/260 (67%), Positives = 210/260 (81%), Gaps = 11/260 (4%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsggg----------sVADIV  262
            Q CGC EGLCCS+WGYCG+G  YCG+GC+ GPCY+  +                 V+DIV
Sbjct  30   QYCGCTEGLCCSRWGYCGSGKAYCGQGCQGGPCYNSSTKNYNHNINNNNNNNTNRVSDIV  89

Query  263  SDAFFNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVG-SADDSKREIAAFFAHVTH  439
            S++FFNGIA+QA S+CEGKGFYTR+ FL+A+ SYP+F T+G S DD+KREIAAFFAHVTH
Sbjct  90   SESFFNGIANQAASNCEGKGFYTRSVFLEALKSYPEFATIGFSDDDNKREIAAFFAHVTH  149

Query  440  ETGHMCYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGL  619
            ETG MCYI EI+G SRDYCD TN++YPC  G+ YYGRGPIQLSWNFNYGPAG+ IGFDGL
Sbjct  150  ETGQMCYINEINGSSRDYCDMTNSEYPCVSGQNYYGRGPIQLSWNFNYGPAGKDIGFDGL  209

Query  620  NNPDVVATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRV  799
            N+PD+V+ D +ISFKTALW+WMN C  L++SGQGFGATIRAING LECDGA P+ V +RV
Sbjct  210  NDPDIVSRDSLISFKTALWYWMNTCQPLLSSGQGFGATIRAINGPLECDGALPEPVSRRV  269

Query  800  EYYTQYCQQLGVDPGNNLEC  859
            ++Y QYC+QLGVD G+NL C
Sbjct  270  QHYVQYCKQLGVDTGDNLTC  289



>ref|XP_008222565.1| PREDICTED: endochitinase PR4-like [Prunus mume]
Length=275

 Score =   373 bits (957),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 177/250 (71%), Positives = 205/250 (82%), Gaps = 3/250 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsp-psgggsVADIVSDAFFNGIA  289
            QNCGCA  LCCS++GYCGT DDYCG GC+ GPC   P    +   SVADIV+  FFN I 
Sbjct  28   QNCGCASDLCCSKYGYCGTSDDYCGTGCQAGPCKTAPLTPSTSNVSVADIVTPEFFNSII  87

Query  290  DQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKE  469
             QA++SC GK FY+R +FL+A+ SY QFG +GS DDSKREIAAFFAHVTHETGH CYI+E
Sbjct  88   GQAEASCAGKNFYSRATFLEALKSYDQFGKIGSIDDSKREIAAFFAHVTHETGHFCYIEE  147

Query  470  IDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDP  649
            IDG S+DYCD++NTQYPC P K YYGRGPIQLSWNFNYGPAG+SIGFDGLN+P+ VA DP
Sbjct  148  IDGPSKDYCDESNTQYPCKPNKGYYGRGPIQLSWNFNYGPAGESIGFDGLNSPETVANDP  207

Query  650  IISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQL  829
            II+FKTALW+WMN+   +I  G+GFGATIRAING LECDG NP TV+KRVEY+T+YC QL
Sbjct  208  IIAFKTALWYWMNSVRPVI--GEGFGATIRAINGALECDGGNPATVQKRVEYFTEYCNQL  265

Query  830  GVDPGNNLEC  859
            GV PG+NL C
Sbjct  266  GVAPGDNLTC  275



>ref|XP_011091730.1| PREDICTED: uncharacterized protein LOC105172091 [Sesamum indicum]
Length=560

 Score =   381 bits (979),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 180/248 (73%), Positives = 207/248 (83%), Gaps = 2/248 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCA  LCCSQ+GYCGTG+DYCG+GC+ GPCY    P + G  VADIV+D+FFNGIA+
Sbjct  31   QNCGCASNLCCSQYGYCGTGNDYCGDGCQAGPCY--APPGNNGVKVADIVTDSFFNGIAN  88

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA S C G+GFYTR++FL A+ SYP+FGT GS DDSKREIAAFFAHVTHETGHMC   E 
Sbjct  89   QAPSGCPGRGFYTRSAFLQALASYPKFGTTGSVDDSKREIAAFFAHVTHETGHMCSRVEN  148

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
             G+S+DYCD+ N Q+PCAP K YYGRGP+QLSWN+NYGPAGQSIGFDGLNNP++VA D +
Sbjct  149  GGQSKDYCDENNRQWPCAPNKGYYGRGPLQLSWNYNYGPAGQSIGFDGLNNPEIVARDAV  208

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            +SF+TA WFWMNNCH+ ITSGQGFGATIRAING LEC+GANP TV  RV YY  YC QLG
Sbjct  209  VSFRTAFWFWMNNCHNAITSGQGFGATIRAINGPLECNGANPATVTARVNYYRDYCNQLG  268

Query  833  VDPGNNLE  856
            V+PG NL 
Sbjct  269  VNPGTNLR  276


 Score =   377 bits (969),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 181/249 (73%), Positives = 202/249 (81%), Gaps = 2/249 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCA  LCCSQ+GYCGTGD YCG GC+ GPCY      + G  V+DIV+DAFF GIA+
Sbjct  314  QNCGCASNLCCSQYGYCGTGDAYCGNGCQGGPCY--APQGNNGVRVSDIVTDAFFYGIAN  371

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA S C G+ FY+R +FL A+ SYP+FGT GS DDSKREIAAFFAHVTHETGHMC   E 
Sbjct  372  QAPSGCPGRRFYSRAAFLQALGSYPKFGTAGSVDDSKREIAAFFAHVTHETGHMCSRVEN  431

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
             G SRDYCD+TN Q+PCAP K YYGRGP+QLSWN+NYGPAGQSIGFDGLNNP++VA DP+
Sbjct  432  GGRSRDYCDETNQQWPCAPNKGYYGRGPLQLSWNYNYGPAGQSIGFDGLNNPEIVARDPV  491

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALWFWMNNCH  ITSG+GFGATIRAING LEC+GAN +TV  RV YY  YC QLG
Sbjct  492  ISFKTALWFWMNNCHDTITSGRGFGATIRAINGPLECNGANTETVSARVNYYRDYCNQLG  551

Query  833  VDPGNNLEC  859
            VDPG N  C
Sbjct  552  VDPGTNQWC  560



>ref|XP_008444611.1| PREDICTED: endochitinase PR4-like [Cucumis melo]
Length=275

 Score =   370 bits (949),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 170/250 (68%), Positives = 210/250 (84%), Gaps = 3/250 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC-YHppsppsgggsVADIVSDAFFNGIA  289
            QNCGCA GLCCS++G+CGTG+D+CG GC+EGPC   P +P     +VA+ V++ FFNGI 
Sbjct  28   QNCGCAAGLCCSRFGFCGTGEDFCGTGCREGPCNIPPLTPSVNDVNVAEFVTEEFFNGII  87

Query  290  DQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKE  469
            +QAD+SC G+GFY+R +FL+A+ S+ +FG +G+ DDSKREIAAFFAHVTHETGH C+I+E
Sbjct  88   NQADASCAGRGFYSRATFLEALQSFDRFGRIGTVDDSKREIAAFFAHVTHETGHFCFIEE  147

Query  470  IDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDP  649
            IDG +RDYCD+ NTQYPC P K Y+GRGPIQLSWNFNYGPAG++IGFDGLNNP++VAT+P
Sbjct  148  IDGATRDYCDEENTQYPCNPSKGYFGRGPIQLSWNFNYGPAGENIGFDGLNNPEIVATNP  207

Query  650  IISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQL  829
            ++SFKTALW+WMN    +I   QGFGATIRAING LECDGAN  TV++RV++Y QYC QL
Sbjct  208  VVSFKTALWYWMNFVRPVIN--QGFGATIRAINGALECDGANTATVQRRVQFYNQYCNQL  265

Query  830  GVDPGNNLEC  859
             VDPGNNL C
Sbjct  266  NVDPGNNLTC  275



>ref|XP_004309832.1| PREDICTED: endochitinase PR4-like [Fragaria vesca subsp. vesca]
Length=283

 Score =   369 bits (948),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 178/250 (71%), Positives = 204/250 (82%), Gaps = 3/250 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggs-VADIVSDAFFNGIA  289
            QNCGCA  LCCS++GYCGTGDDYCG GC+ GPC   P  PS     VADIV+  FFNGI 
Sbjct  36   QNCGCAADLCCSRYGYCGTGDDYCGTGCQAGPCNTAPLTPSTSDVPVADIVTPEFFNGII  95

Query  290  DQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKE  469
            DQAD+SC GK FY+R +FLDA+NSY QFG +GS DDSKREIAAFFAHVTHETGH CYI+E
Sbjct  96   DQADASCAGKDFYSRAAFLDALNSYDQFGKIGSLDDSKREIAAFFAHVTHETGHFCYIEE  155

Query  470  IDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDP  649
            IDG S+DYCD+TNT+YPC P K YYGRGPIQLSWN+NYGPAG+SIGFDG+N+P+ VA D 
Sbjct  156  IDGASKDYCDETNTEYPCNPNKGYYGRGPIQLSWNYNYGPAGKSIGFDGVNSPESVANDA  215

Query  650  IISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQL  829
            +I+FKTALW+WMNN   +I   +GFG TIRAING LECDG NP TV+KRV+YY  YC QL
Sbjct  216  LIAFKTALWYWMNNVRPVIA--EGFGETIRAINGALECDGGNPATVQKRVDYYVDYCNQL  273

Query  830  GVDPGNNLEC  859
            GV PG+NL C
Sbjct  274  GVAPGDNLTC  283



>gb|ACL36992.1| class IV chitinase [Medicago sativa]
Length=282

 Score =   369 bits (946),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 177/252 (70%), Positives = 204/252 (81%), Gaps = 5/252 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHpp---sppsgggsVADIVSDAFFNG  283
            QNCGCAEG+CCSQ+GYCG GD YCG GCK+GPCY      S P+   +VADI++  FFN 
Sbjct  33   QNCGCAEGVCCSQYGYCGNGDAYCGTGCKQGPCYAGQTPPSLPNNDANVADILTQDFFNS  92

Query  284  IADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYI  463
            I DQADSSC GK FYTR +FLDA+NSY QFG  GS DDSKRE+AA FAH THETGH CY 
Sbjct  93   IIDQADSSCAGKNFYTRAAFLDALNSYNQFGRSGSLDDSKREVAAAFAHFTHETGHFCYT  152

Query  464  KEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVAT  643
            +EIDG S+DYCD+ NT++PCAP K YYGRGPIQLSWN+NYGPAG+  GFDGLN+P+ VA 
Sbjct  153  EEIDGPSKDYCDENNTEWPCAPNKGYYGRGPIQLSWNYNYGPAGRDNGFDGLNSPETVAN  212

Query  644  DPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQ  823
            D ++SFKTALW+WMNN H +I   QGFGATIRAING+LECDGANP TV+ RV YYTQYC 
Sbjct  213  DAVVSFKTALWYWMNNVHGVIN--QGFGATIRAINGRLECDGANPSTVQTRVGYYTQYCS  270

Query  824  QLGVDPGNNLEC  859
            +LGV PG+NL C
Sbjct  271  ELGVAPGDNLTC  282



>ref|XP_010268233.1| PREDICTED: endochitinase PR4-like [Nelumbo nucifera]
Length=271

 Score =   368 bits (944),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 178/249 (71%), Positives = 201/249 (81%), Gaps = 5/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC   LCCSQWGYCGTG DYCG GC+ GPC       SGG SVAD+V+ +FF+GI +
Sbjct  28   QNCGCDPNLCCSQWGYCGTGSDYCGAGCQAGPC----DSGSGGVSVADVVTQSFFDGIIN  83

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QADS C GK FYTR +FL+A+NSYP FG  G++D SKREIAAFFAHVTHETGH CYI+EI
Sbjct  84   QADSGCAGKSFYTRDAFLNALNSYPSFGQDGTSDVSKREIAAFFAHVTHETGHFCYIEEI  143

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            DG S+DYCD+TNTQYPC PGK YYGRGPIQLSWN+NYG AG  IGFDGLN P+ VA D +
Sbjct  144  DGASKDYCDETNTQYPCVPGKGYYGRGPIQLSWNYNYGAAGNDIGFDGLNYPETVANDVV  203

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            +SFKTA WFWMNN HS++TSGQGFGATIRAING +ECDG NPD V+ RV YYT YC Q G
Sbjct  204  VSFKTAFWFWMNNVHSIMTSGQGFGATIRAING-MECDGGNPDAVQARVGYYTDYCNQFG  262

Query  833  VDPGNNLEC  859
            V  G+NL C
Sbjct  263  VSTGDNLSC  271



>gb|AFK40619.1| unknown [Medicago truncatula]
 gb|AES67799.2| Chitinase (Class IV) / Hevein [Medicago truncatula]
Length=282

 Score =   368 bits (945),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 178/252 (71%), Positives = 204/252 (81%), Gaps = 5/252 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHpp---sppsgggsVADIVSDAFFNG  283
            QNCGCAEG+CCSQ+GYCG GD YCG GCK+GPCY      S P+   +VADI++  FFN 
Sbjct  33   QNCGCAEGVCCSQYGYCGNGDAYCGTGCKQGPCYAGQTPPSLPNNDANVADILTQDFFNR  92

Query  284  IADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYI  463
            I DQADSSC GK FYTR +FLDA+NSY QFG  GS DDSKRE+AA FAH THETGH CY 
Sbjct  93   IIDQADSSCAGKNFYTRAAFLDALNSYNQFGRSGSLDDSKREVAAAFAHFTHETGHFCYT  152

Query  464  KEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVAT  643
            +EIDG S+DYCD+ NT++PCAP K YYGRGPIQLSWN+NYGPAG+  GFDGLN+P+ VA 
Sbjct  153  EEIDGPSKDYCDEGNTEWPCAPNKGYYGRGPIQLSWNYNYGPAGRDNGFDGLNSPETVAN  212

Query  644  DPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQ  823
            DP +SFKTALW+WMNN H +I   QGFGATIRAING+LECDGANP TV+ RV YYTQYC 
Sbjct  213  DPTVSFKTALWYWMNNVHGVIN--QGFGATIRAINGRLECDGANPSTVQTRVGYYTQYCS  270

Query  824  QLGVDPGNNLEC  859
            +LGV PG+NL C
Sbjct  271  ELGVAPGDNLTC  282



>ref|XP_010056776.1| PREDICTED: endochitinase PR4-like [Eucalyptus grandis]
Length=275

 Score =   368 bits (944),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 178/249 (71%), Positives = 202/249 (81%), Gaps = 4/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCA   CCSQWGYCG GDD+CG GC+EGPC     PP+    VAD+V++AFFNGI  
Sbjct  31   QNCGCAADQCCSQWGYCGLGDDFCGMGCREGPC--NTPPPTNDVVVADVVTEAFFNGIIG  88

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA  SCEGKGFY+R +FL+A  SYPQFG VGS DDSKREIAAFFAHVTHETGH CYI EI
Sbjct  89   QAAESCEGKGFYSRGTFLEAAGSYPQFGRVGSVDDSKREIAAFFAHVTHETGHFCYINEI  148

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            DG S+DYCD+TNTQYPC P K YYGRGPIQL+ N NYGPAG SI FDGLN+P+ VATDP+
Sbjct  149  DGASKDYCDETNTQYPCNPNKGYYGRGPIQLTGNANYGPAGDSIRFDGLNSPETVATDPL  208

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALW+WMN+   +I   QGFGATIRAING +ECDG +P TV+ RV+YYT+YC QLG
Sbjct  209  ISFKTALWYWMNSVRPVIN--QGFGATIRAINGAIECDGKSPTTVQARVQYYTEYCNQLG  266

Query  833  VDPGNNLEC  859
            V PG+NL C
Sbjct  267  VAPGDNLTC  275



>ref|XP_006442844.1| hypothetical protein CICLE_v10021602mg [Citrus clementina]
 gb|ESR56084.1| hypothetical protein CICLE_v10021602mg [Citrus clementina]
Length=276

 Score =   367 bits (943),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 174/249 (70%), Positives = 207/249 (83%), Gaps = 4/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCA GLCCS+WG+CGTGDDYCG GC++GPC   P PP+   SVADIV+  FFNGI +
Sbjct  32   QNCGCAAGLCCSRWGFCGTGDDYCGTGCQQGPC--NPPPPTNDVSVADIVTPEFFNGILN  89

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QAD+SC GK FY+R++FLDA+ S+ QFG +G+ ++S+REIAAFFAHVTHETGH CYI+EI
Sbjct  90   QADASCVGKNFYSRSAFLDALGSFSQFGRIGTEENSRREIAAFFAHVTHETGHFCYIEEI  149

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            DG S+DYCD+ NTQYPC P K YYGRGPIQLSWN+NYGPAG SIGFDGLN P+ VA DP+
Sbjct  150  DGPSKDYCDEENTQYPCNPSKGYYGRGPIQLSWNYNYGPAGNSIGFDGLNAPETVANDPV  209

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALW+W N+  S++   QGFGATIRAING LECDGANP TV+ R+ Y+T+YC QLG
Sbjct  210  ISFKTALWYWTNHVQSVMN--QGFGATIRAINGALECDGANPSTVQARIRYFTEYCSQLG  267

Query  833  VDPGNNLEC  859
            V  G+NL C
Sbjct  268  VSTGDNLTC  276



>ref|XP_006376418.1| class IV chitinase family protein [Populus trichocarpa]
 gb|ERP54215.1| class IV chitinase family protein [Populus trichocarpa]
Length=275

 Score =   367 bits (942),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 178/249 (71%), Positives = 205/249 (82%), Gaps = 4/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCA   CCS+WGYCGTG+DYCG GC+EG C+  P+ P+   SV DIV+  FF GI D
Sbjct  31   QNCGCAADECCSRWGYCGTGNDYCGTGCQEGQCF--PAAPTNDVSVPDIVTPEFFGGILD  88

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QADSSC GK FY+R +FL+A+NSY +FG +GS DDS+REIAAFFAHVTHETGH CYI+EI
Sbjct  89   QADSSCAGKNFYSRDAFLEALNSYSRFGRIGSVDDSRREIAAFFAHVTHETGHFCYIEEI  148

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G SRDYCD+ NTQYPC P K YYGRGPIQLSWNFNYGPAG+SIGFDGLN+P+ VA DP+
Sbjct  149  NGPSRDYCDEGNTQYPCNPDKGYYGRGPIQLSWNFNYGPAGESIGFDGLNSPETVANDPV  208

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALW+W N+   +I+  QGFGATIRAING LECDGANP TV+ RV YYT YC QLG
Sbjct  209  ISFKTALWYWTNSVQPVIS--QGFGATIRAINGALECDGANPATVQARVGYYTDYCNQLG  266

Query  833  VDPGNNLEC  859
            V PG+NL C
Sbjct  267  VAPGDNLTC  275



>gb|AEZ67306.1| chitinase 7 [Populus x canadensis]
Length=275

 Score =   367 bits (942),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 178/249 (71%), Positives = 205/249 (82%), Gaps = 4/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCA   CCS+WGYCGTG+DYCG GC+EG C+  P+ P+   SV DIV+  FF GI D
Sbjct  31   QNCGCAADECCSRWGYCGTGNDYCGTGCQEGQCF--PAAPTNDVSVPDIVTPEFFGGILD  88

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QADSSC GK FY+R +FL+A+NSY +FG +GS DDS+REIAAFFAHVTHETGH CYI+EI
Sbjct  89   QADSSCAGKNFYSRDAFLEALNSYSRFGRIGSVDDSRREIAAFFAHVTHETGHFCYIEEI  148

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G SRDYCD+ NTQYPC P K YYGRGPIQLSWNFNYGPAG+SIGFDGLN+P+ VA DP+
Sbjct  149  NGPSRDYCDEGNTQYPCNPDKGYYGRGPIQLSWNFNYGPAGESIGFDGLNSPETVANDPV  208

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALW+W N+   +I+  QGFGATIRAING LECDGANP TV+ RV YYT YC QLG
Sbjct  209  ISFKTALWYWTNSVQPVIS--QGFGATIRAINGALECDGANPATVQARVGYYTDYCNQLG  266

Query  833  VDPGNNLEC  859
            V PG+NL C
Sbjct  267  VAPGDNLTC  275



>ref|XP_007222515.1| hypothetical protein PRUPE_ppa009844mg [Prunus persica]
 gb|EMJ23714.1| hypothetical protein PRUPE_ppa009844mg [Prunus persica]
Length=275

 Score =   367 bits (941),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 177/250 (71%), Positives = 204/250 (82%), Gaps = 3/250 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgg-gsVADIVSDAFFNGIA  289
            QNCGCA  LCCS++GYCGT DDYCG GC+ GPC   P  PS    SVADIV+  FFN I 
Sbjct  28   QNCGCASDLCCSKYGYCGTSDDYCGTGCQAGPCKTAPLTPSTSDVSVADIVTPEFFNSII  87

Query  290  DQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKE  469
             QA++SC GK FY+R +FL+A+ SY QFG +GS DDSKREIAAFFAHVTHET H CYI+E
Sbjct  88   GQAEASCAGKNFYSRATFLEALKSYDQFGKIGSIDDSKREIAAFFAHVTHETFHFCYIEE  147

Query  470  IDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDP  649
            IDG S+DYCD++NTQYPC P K YYGRGPIQLSWNFNYGPAG+SIGFDGLN+P+ VA DP
Sbjct  148  IDGPSKDYCDESNTQYPCKPNKGYYGRGPIQLSWNFNYGPAGESIGFDGLNSPETVANDP  207

Query  650  IISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQL  829
            II+FKTALW+WM +   +I  G+GFGATIRAING LECDG NP TV+KRVEY+T+YC QL
Sbjct  208  IIAFKTALWYWMKSVRPVI--GEGFGATIRAINGALECDGGNPATVQKRVEYFTEYCNQL  265

Query  830  GVDPGNNLEC  859
            GV PG+NL C
Sbjct  266  GVAPGDNLTC  275



>ref|XP_006350735.1| PREDICTED: endochitinase PR4-like [Solanum tuberosum]
Length=282

 Score =   367 bits (942),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 172/256 (67%), Positives = 202/256 (79%), Gaps = 7/256 (3%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsggg------sVADIVSDAF  274
            Q CGC EGLCCS+WGYCG+G  YCG+GC+ GPCY   +             V+DIVS++F
Sbjct  27   QYCGCTEGLCCSRWGYCGSGKAYCGQGCQGGPCYTSSTKNYNHNNNNNNNRVSDIVSESF  86

Query  275  FNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVG-SADDSKREIAAFFAHVTHETGH  451
            FNGIA+Q  S+CEGKGFY R+ FL+A+ SYP+F T   S DD+KREIAAFFAHVTHETG 
Sbjct  87   FNGIANQTSSNCEGKGFYARSVFLEALKSYPEFATTDFSDDDNKREIAAFFAHVTHETGQ  146

Query  452  MCYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPD  631
            MCYI EI+G SRDYCD   ++YPC  G+ YYGRGPIQLSWNFNYGPAG+ IGFDGLN+PD
Sbjct  147  MCYINEINGSSRDYCDMRKSEYPCVSGQNYYGRGPIQLSWNFNYGPAGKDIGFDGLNDPD  206

Query  632  VVATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYT  811
            +V+ D +ISFKTALW+WMN CH L+TSGQGFGATIRAING LECDGA P  V +RV++Y 
Sbjct  207  IVSRDSLISFKTALWYWMNTCHPLLTSGQGFGATIRAINGPLECDGALPQPVARRVQHYV  266

Query  812  QYCQQLGVDPGNNLEC  859
            QYC QLGVD G+NL C
Sbjct  267  QYCHQLGVDTGDNLTC  282



>ref|XP_006858883.1| hypothetical protein AMTR_s00066p00199730 [Amborella trichopoda]
 gb|ERN20350.1| hypothetical protein AMTR_s00066p00199730 [Amborella trichopoda]
Length=274

 Score =   365 bits (938),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 177/250 (71%), Positives = 203/250 (81%), Gaps = 3/250 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCA  LCCS+WG+CGTGDDYCG GC+EGPC      PS G  VADI + +FF+GI  
Sbjct  27   QNCGCASNLCCSRWGFCGTGDDYCGAGCQEGPC--NAPAPSNGAVVADIATQSFFDGIIG  84

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA++SC GKGFYTR +FL A+ +YP FGTVGS DDSKRE+AAFFAHVTHETGH CYI+EI
Sbjct  85   QAEASCVGKGFYTRDAFLTALGNYPGFGTVGSLDDSKREVAAFFAHVTHETGHFCYIEEI  144

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +GES DYCD+TNTQYPC P K Y+GRGPIQLSWNFNYGPAG+SIGFDGLN P+ VATD +
Sbjct  145  NGESGDYCDETNTQYPCNPDKKYFGRGPIQLSWNFNYGPAGESIGFDGLNAPETVATDVV  204

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGA-NPDTVRKRVEYYTQYCQQL  829
            ISF+TALW+WMN+ HS   +GQGFGATIRAING LECDG      V +RV YY  YC+QL
Sbjct  205  ISFRTALWYWMNHVHSGFIAGQGFGATIRAINGALECDGGPGSAAVARRVSYYQSYCEQL  264

Query  830  GVDPGNNLEC  859
            GV PG+NL C
Sbjct  265  GVAPGDNLTC  274



>gb|AAR87869.1| class IV chitinase precursor [Medicago truncatula]
Length=282

 Score =   365 bits (938),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 177/252 (70%), Positives = 203/252 (81%), Gaps = 5/252 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHpp---sppsgggsVADIVSDAFFNG  283
            QNCGCAEG+CCSQ+GYCG GD YCG GCK+GPCY      S P+   +VADI++  FFN 
Sbjct  33   QNCGCAEGVCCSQYGYCGNGDAYCGTGCKQGPCYAGQTPPSLPNNDANVADILTQDFFNR  92

Query  284  IADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYI  463
            I DQADSSC GK FYTR +FLDA+NSY QFG  GS D SKRE+AA FAH THETGH CY 
Sbjct  93   IIDQADSSCAGKNFYTRAAFLDALNSYNQFGRSGSLDGSKREVAAAFAHFTHETGHFCYT  152

Query  464  KEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVAT  643
            +EIDG S+DYCD+ NT++PCAP K YYGRGPIQLSWN+NYGPAG+  GFDGLN+P+ VA 
Sbjct  153  EEIDGPSKDYCDEGNTEWPCAPNKGYYGRGPIQLSWNYNYGPAGRDNGFDGLNSPETVAN  212

Query  644  DPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQ  823
            DP +SFKTALW+WMNN H +I   QGFGATIRAING+LECDGANP TV+ RV YYTQYC 
Sbjct  213  DPTVSFKTALWYWMNNVHGVIN--QGFGATIRAINGRLECDGANPSTVQTRVGYYTQYCS  270

Query  824  QLGVDPGNNLEC  859
            +LGV PG+NL C
Sbjct  271  ELGVAPGDNLTC  282



>ref|XP_006478596.1| PREDICTED: endochitinase PR4-like [Citrus sinensis]
 gb|KDO45789.1| hypothetical protein CISIN_1g023873mg [Citrus sinensis]
Length=276

 Score =   364 bits (935),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 173/249 (69%), Positives = 205/249 (82%), Gaps = 4/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCA GLCCS+WG+CGTGDDYCG GC++GPC   P PP+   SVADIV+  FFNGI +
Sbjct  32   QNCGCAAGLCCSRWGFCGTGDDYCGTGCQQGPC--NPPPPTNDVSVADIVTPEFFNGILN  89

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QAD+SC GK FY+R++FLDA+ S+ QFG +G+ ++S+REIAAFFAHVTHETGH C I+EI
Sbjct  90   QADASCVGKNFYSRSAFLDALGSFSQFGRIGTEENSRREIAAFFAHVTHETGHFCSIEEI  149

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            DG S+DYCD+ NTQYPC P K YYGRGPIQLSWNFNYGPAG SIGFDGLN P+ VA DP+
Sbjct  150  DGPSKDYCDEENTQYPCNPSKGYYGRGPIQLSWNFNYGPAGNSIGFDGLNAPETVANDPV  209

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALW+W N+  S++   QGFGATIRAING LECDG NP TV+ R+ Y+T+YC QLG
Sbjct  210  ISFKTALWYWTNHVQSVMN--QGFGATIRAINGALECDGGNPSTVQARIRYFTEYCSQLG  267

Query  833  VDPGNNLEC  859
            V  G+NL C
Sbjct  268  VSTGDNLTC  276



>ref|XP_002274620.1| PREDICTED: chitinase 5 [Vitis vinifera]
Length=273

 Score =   364 bits (934),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 179/252 (71%), Positives = 208/252 (83%), Gaps = 6/252 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsV---ADIVSDAFFNG  283
            QNCGC  GLCCSQ+GYCGTG+DYCG GC+ GPCY PPS   GGGS    AD+V++ FFNG
Sbjct  25   QNCGCDAGLCCSQYGYCGTGNDYCGTGCQAGPCYSPPSGGGGGGSGVSVADVVTNGFFNG  84

Query  284  IADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYI  463
            I +QAD+SC GK FYTR +FLDA+NSYPQFG  GSADDSKREIAAFFAHVTHETGH CYI
Sbjct  85   ILNQADASCAGKNFYTRRAFLDALNSYPQFGQGGSADDSKREIAAFFAHVTHETGHFCYI  144

Query  464  KEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVAT  643
            +EIDG S+DYCD++NT+YPC PGK YYGRGPIQLSWN+NYGPAG+SIGF+GLNNP+ VA 
Sbjct  145  EEIDGPSKDYCDESNTRYPCVPGKGYYGRGPIQLSWNYNYGPAGESIGFNGLNNPETVAN  204

Query  644  DPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQ  823
            D ++SFKTALWFWMNN HS+++  QGFGATIRAIN  +EC+G N   V  RV Y+  YC 
Sbjct  205  DAVVSFKTALWFWMNNVHSVVS--QGFGATIRAIN-SMECNGGNSGAVNARVGYFRDYCN  261

Query  824  QLGVDPGNNLEC  859
            Q GV PG+N+ C
Sbjct  262  QFGVSPGDNISC  273



>gb|AII99852.1| chitinase [Cicer arietinum]
Length=258

 Score =   363 bits (931),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 175/252 (69%), Positives = 206/252 (82%), Gaps = 5/252 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCY---HppsppsgggsVADIVSDAFFNG  283
            QNCGCAEGLCCSQ+GYCG  D YCG GC++GPC+   +PP+  +   +VADIV+  FF+ 
Sbjct  9    QNCGCAEGLCCSQYGYCGNSDAYCGTGCQQGPCFGGQNPPNSNTNDVNVADIVTPQFFDS  68

Query  284  IADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYI  463
            I DQADSSC GK FY+R +FLDA+NSY QFG VG  +DSKREIAA FAH THETGH CYI
Sbjct  69   IIDQADSSCAGKNFYSRDAFLDALNSYNQFGRVGLVEDSKREIAAAFAHFTHETGHFCYI  128

Query  464  KEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVAT  643
            +EIDG S+DYCD++NT+YPCA  K YYGRGPIQLSWN+NYG AG+  GFDGLN+P+ VA 
Sbjct  129  EEIDGASKDYCDESNTEYPCATNKGYYGRGPIQLSWNYNYGAAGKDNGFDGLNSPETVAN  188

Query  644  DPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQ  823
            DP++SFKTALW+WM + H +I   QGFGATIRAINGQLECDGANP+TV+ RV YYTQYC 
Sbjct  189  DPVVSFKTALWYWMKHVHPVIN--QGFGATIRAINGQLECDGANPNTVQARVSYYTQYCS  246

Query  824  QLGVDPGNNLEC  859
            QLGV PG+NL C
Sbjct  247  QLGVAPGDNLTC  258



>ref|XP_009416020.1| PREDICTED: chitinase 6-like [Musa acuminata subsp. malaccensis]
Length=264

 Score =   362 bits (930),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 173/249 (69%), Positives = 193/249 (78%), Gaps = 2/249 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC+  LCCS WGYCGTG+DYCG GC  GPC    SP      VA IV+ +FF+GI  
Sbjct  18   QNCGCSPDLCCSSWGYCGTGNDYCGAGCHSGPC--EASPRPDDVPVARIVTQSFFDGIIS  75

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QAD  C GK FY R +FL A +SY  FG VG+ DDSKREIAAFFAH+THETGH CYI+EI
Sbjct  76   QADRGCAGKSFYKRDAFLTAASSYTSFGHVGTTDDSKREIAAFFAHITHETGHFCYIEEI  135

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            DG SRDYCD+ NT+YPC  GK YYGRGPIQLSWN+NYG AG+SIGFDGL +P+ VA D +
Sbjct  136  DGASRDYCDEANTEYPCVSGKSYYGRGPIQLSWNYNYGAAGESIGFDGLRSPETVAIDVV  195

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            +SFKTALWFWMN CHSLITSGQGFGATIRAING LECDG NP T   RV YY  YC QLG
Sbjct  196  VSFKTALWFWMNTCHSLITSGQGFGATIRAINGDLECDGKNPATANARVGYYKDYCSQLG  255

Query  833  VDPGNNLEC  859
            VD G++L C
Sbjct  256  VDAGSDLTC  264



>gb|AEM97876.1| class IV chitinase [Corylus heterophylla]
Length=273

 Score =   363 bits (931),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 172/249 (69%), Positives = 200/249 (80%), Gaps = 2/249 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCA   CCS++GYCGT  +YCG+GC+EGPC   P+ PS G SVADIV+DAFFNGI +
Sbjct  27   QNCGCAANECCSEFGYCGTTTEYCGKGCREGPCTASPTTPSSGVSVADIVTDAFFNGIIN  86

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            Q    C GK FYTR +FL+A+NSY QFGT G+ADDSKREIAAFFAHVTHETG +C I+E 
Sbjct  87   QGTGDCPGKSFYTRAAFLNALNSYTQFGTTGTADDSKREIAAFFAHVTHETGFLCKIEET  146

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G S+DYCD+ NTQYPC P K YYGRGP+QL+WN+NYG AG SIGFDGLN P+ VATD +
Sbjct  147  NGASQDYCDENNTQYPCNPAKKYYGRGPLQLTWNYNYGAAGNSIGFDGLNAPETVATDAV  206

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            +SFKTALWFWM N HS+I  GQGFGAT RAING +ECDG  PD V+ R+ YYTQYC Q G
Sbjct  207  VSFKTALWFWMTNVHSVI--GQGFGATTRAINGAVECDGKRPDLVQARINYYTQYCNQFG  264

Query  833  VDPGNNLEC  859
            V PG+NL C
Sbjct  265  VAPGDNLSC  273



>ref|XP_002274935.1| PREDICTED: chitinase 5-like [Vitis vinifera]
Length=271

 Score =   362 bits (928),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 173/250 (69%), Positives = 195/250 (78%), Gaps = 4/250 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVA-DIVSDAFFNGIA  289
            QNCGC  GLCCSQWGYCGTGDD+CG GC+ GPCY        G     D+V++ FFNGI 
Sbjct  25   QNCGCDAGLCCSQWGYCGTGDDFCGTGCQAGPCYSSGGGGGNGSVSVSDVVTEDFFNGII  84

Query  290  DQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKE  469
             QA  SC GK FY+R +FLDAV+SYPQFG  GSADDSKREIAAFFAHVTHETGH CYI+E
Sbjct  85   SQAAGSCAGKNFYSRNAFLDAVSSYPQFGQDGSADDSKREIAAFFAHVTHETGHFCYIEE  144

Query  470  IDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDP  649
            IDG S+DYCD++NTQYPC  GK YYGRGP+Q+SWN+NYGPAGQSIGFDGLNNP+ VA DP
Sbjct  145  IDGASKDYCDESNTQYPCVAGKGYYGRGPLQISWNYNYGPAGQSIGFDGLNNPETVANDP  204

Query  650  IISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQL  829
            ++SFKTA WFWMNN HS+I  GQGFGATIRAIN  +EC G N   V  R+ YYT YC Q 
Sbjct  205  VVSFKTAFWFWMNNVHSII--GQGFGATIRAIN-SMECGGGNTAAVNARIGYYTDYCNQF  261

Query  830  GVDPGNNLEC  859
             V  G+NL C
Sbjct  262  SVSTGDNLSC  271



>gb|EYU40977.1| hypothetical protein MIMGU_mgv1a023931mg, partial [Erythranthe 
guttata]
Length=246

 Score =   360 bits (924),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 173/249 (69%), Positives = 198/249 (80%), Gaps = 6/249 (2%)
 Frame = +2

Query  119  CGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIADQA  298
            CGC    CCSQ GYCGTG+ YCG GC+ G C+      S G  V+D V+ AFFNGIA+QA
Sbjct  2    CGCRANECCSQHGYCGTGEVYCGNGCRSGRCH----VSSTGNKVSDTVTAAFFNGIANQA  57

Query  299  DSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEIDG  478
               C G+GFYTR +FL+A  SYP+FG VGSADDSKREIAAFFAHVTHETGHMC+++EI+G
Sbjct  58   GGGCAGRGFYTRAAFLEAARSYPRFGGVGSADDSKREIAAFFAHVTHETGHMCHVEEING  117

Query  479  ESR--DYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
             S+  DYCDK N QYPC  GK YYGRGPIQLSWN+NYG AG+SIGFDGLNNP++VATD +
Sbjct  118  PSKAADYCDKQNKQYPCKAGKGYYGRGPIQLSWNYNYGAAGESIGFDGLNNPEIVATDRV  177

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            +SFKTALWFWMN CHS++TSG+GFGATIRAING  EC GANP TV  RV+YY  YC QL 
Sbjct  178  VSFKTALWFWMNGCHSIMTSGKGFGATIRAINGPKECGGANPSTVSARVKYYRDYCNQLR  237

Query  833  VDPGNNLEC  859
            VDPG NL C
Sbjct  238  VDPGTNLRC  246



>ref|XP_004145227.1| PREDICTED: endochitinase PR4-like [Cucumis sativus]
 ref|XP_004154205.1| PREDICTED: endochitinase PR4-like [Cucumis sativus]
 ref|XP_004162706.1| PREDICTED: endochitinase PR4-like [Cucumis sativus]
 gb|KGN65869.1| hypothetical protein Csa_1G534750 [Cucumis sativus]
Length=278

 Score =   361 bits (927),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 165/250 (66%), Positives = 208/250 (83%), Gaps = 3/250 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC-YHppsppsgggsVADIVSDAFFNGIA  289
            QNCGCA GLCCS++G+CG G+D+CG GC+EGPC   P +P     +VA+ V++ FFNGI 
Sbjct  31   QNCGCAAGLCCSRFGFCGNGEDFCGTGCREGPCNIPPLTPSVNDVNVAEFVTEEFFNGII  90

Query  290  DQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKE  469
            ++AD+ C G+GFY+R +FL+A+ S+ +FG +GS +DSKREIAAFFAHVTHETGH+C+I+E
Sbjct  91   NEADAGCAGRGFYSRATFLEALQSFDRFGRIGSVEDSKREIAAFFAHVTHETGHLCFIEE  150

Query  470  IDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDP  649
            IDG +RDYCD+ NTQYPC P K Y+GRGPIQLSWNFNYGPAG++IGFDGLNNP++VAT+P
Sbjct  151  IDGATRDYCDEENTQYPCNPSKGYFGRGPIQLSWNFNYGPAGENIGFDGLNNPEIVATNP  210

Query  650  IISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQL  829
            ++SFKTALW+WMN    +I   QGFGATIRAING LECDGAN  TV++R+++Y QYC QL
Sbjct  211  VVSFKTALWYWMNFVRPVIN--QGFGATIRAINGALECDGANTATVQRRIQFYNQYCNQL  268

Query  830  GVDPGNNLEC  859
             V PGNNL C
Sbjct  269  NVAPGNNLTC  278



>ref|XP_010069256.1| PREDICTED: chitinase 6-like [Eucalyptus grandis]
 gb|KCW57554.1| hypothetical protein EUGRSUZ_H00323 [Eucalyptus grandis]
Length=281

 Score =   361 bits (926),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 170/251 (68%), Positives = 200/251 (80%), Gaps = 3/251 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsg--ggsVADIVSDAFFNGI  286
            Q CGCA  LCCSQ+GYCGTGD YCG GC+ GPCY   +P +     SVAD+V+D+FFN I
Sbjct  32   QGCGCATNLCCSQYGYCGTGDQYCGTGCQSGPCYSSSTPTTPSSRVSVADVVTDSFFNSI  91

Query  287  ADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIK  466
              QA++ C GK FYTR +FLDA   YP+FGTVGSADDSK EIAAFFAHVTHETGH CYI+
Sbjct  92   IGQANAGCAGKSFYTRPAFLDAAGGYPEFGTVGSADDSKLEIAAFFAHVTHETGHFCYIE  151

Query  467  EIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATD  646
            EIDG S++YC ++NTQYPC P K YYGRGP Q+SWN+NYGPAG+SIGFDGLN+P+ VA +
Sbjct  152  EIDGPSKNYCQESNTQYPCNPNKGYYGRGPFQISWNYNYGPAGESIGFDGLNSPETVANN  211

Query  647  PIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQ  826
             ++SFKTA WFWMNN HS+ITSGQGFG TIRAING +EC   NP  V+ RV+YYT YC +
Sbjct  212  AVVSFKTAFWFWMNNVHSVITSGQGFGTTIRAING-MECGSGNPAAVQARVKYYTDYCNR  270

Query  827  LGVDPGNNLEC  859
             GV PG+NL C
Sbjct  271  FGVSPGDNLTC  281



>ref|XP_010515969.1| PREDICTED: endochitinase PR4 [Camelina sativa]
Length=273

 Score =   360 bits (923),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 174/249 (70%), Positives = 202/249 (81%), Gaps = 4/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC+  LCCSQ+G+CG   DYCG GC++GPC+    PP+ G SVA+IV+  FFNGI  
Sbjct  29   QNCGCSSELCCSQFGFCGNTSDYCGVGCQQGPCF--APPPANGVSVAEIVTPDFFNGIIS  86

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA+SSC G GFY+R +FL+A+ SY +FG VGS DDS+REIAAFFAHVTHETGH CYI+EI
Sbjct  87   QAESSCAGNGFYSRGAFLEALESYSRFGRVGSTDDSRREIAAFFAHVTHETGHFCYIEEI  146

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            DG S+DYCD+  TQYPC P K YYGRGPIQLSWNFNYGPAG +IGFDGLN P+ VATDP+
Sbjct  147  DGASKDYCDENATQYPCNPNKGYYGRGPIQLSWNFNYGPAGTAIGFDGLNAPETVATDPV  206

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALW+W N    +++  QGFGATIRAING LECDGAN  TV+ RV YYT YC+QLG
Sbjct  207  ISFKTALWYWTNRVQPVLS--QGFGATIRAINGALECDGANTATVQARVRYYTDYCRQLG  264

Query  833  VDPGNNLEC  859
            VDPGNNL C
Sbjct  265  VDPGNNLTC  273



>emb|CDX73482.1| BnaC08g25210D [Brassica napus]
Length=273

 Score =   359 bits (922),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 173/249 (69%), Positives = 203/249 (82%), Gaps = 4/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC+  LCCSQ+G+CG+  DYCG GC++GPC+    PP+ G SV +IV+  FFNGI D
Sbjct  29   QNCGCSPDLCCSQFGFCGSTSDYCGVGCQQGPCF--APPPANGVSVDEIVTQEFFNGIID  86

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA+SSC G GFY+R +FL+A+ SY +F  +GS DDS+REIAAFFAHVTHETGH CYI+EI
Sbjct  87   QAESSCAGNGFYSRGAFLEALESYSRFARIGSVDDSRREIAAFFAHVTHETGHFCYIEEI  146

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G SRDYCD+  TQYPC P K YYGRGPIQLSWNFNYGPAG +IGFDGLN P+ VATDP+
Sbjct  147  NGPSRDYCDENATQYPCNPNKGYYGRGPIQLSWNFNYGPAGTAIGFDGLNAPETVATDPV  206

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALW+W N    +I+  QGFGATIRAING LECDGAN  TV+ RV YYT+YC+QLG
Sbjct  207  ISFKTALWYWTNRVQPVIS--QGFGATIRAINGALECDGANSATVQARVRYYTEYCRQLG  264

Query  833  VDPGNNLEC  859
            VDPGNNL C
Sbjct  265  VDPGNNLIC  273



>emb|CBI24655.3| unnamed protein product [Vitis vinifera]
Length=306

 Score =   360 bits (925),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 173/250 (69%), Positives = 195/250 (78%), Gaps = 4/250 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVA-DIVSDAFFNGIA  289
            QNCGC  GLCCSQWGYCGTGDD+CG GC+ GPCY        G     D+V++ FFNGI 
Sbjct  60   QNCGCDAGLCCSQWGYCGTGDDFCGTGCQAGPCYSSGGGGGNGSVSVSDVVTEDFFNGII  119

Query  290  DQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKE  469
             QA  SC GK FY+R +FLDAV+SYPQFG  GSADDSKREIAAFFAHVTHETGH CYI+E
Sbjct  120  SQAAGSCAGKNFYSRNAFLDAVSSYPQFGQDGSADDSKREIAAFFAHVTHETGHFCYIEE  179

Query  470  IDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDP  649
            IDG S+DYCD++NTQYPC  GK YYGRGP+Q+SWN+NYGPAGQSIGFDGLNNP+ VA DP
Sbjct  180  IDGASKDYCDESNTQYPCVAGKGYYGRGPLQISWNYNYGPAGQSIGFDGLNNPETVANDP  239

Query  650  IISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQL  829
            ++SFKTA WFWMNN HS+I  GQGFGATIRAIN  +EC G N   V  R+ YYT YC Q 
Sbjct  240  VVSFKTAFWFWMNNVHSII--GQGFGATIRAIN-SMECGGGNTAAVNARIGYYTDYCNQF  296

Query  830  GVDPGNNLEC  859
             V  G+NL C
Sbjct  297  SVSTGDNLSC  306



>gb|KDP44264.1| hypothetical protein JCGZ_05731 [Jatropha curcas]
 gb|KDP44270.1| hypothetical protein JCGZ_05737 [Jatropha curcas]
Length=269

 Score =   359 bits (921),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 172/249 (69%), Positives = 201/249 (81%), Gaps = 4/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC    CCS+WG+CGT ++YCG GC+EGPC+ PP        V +IV+  FFNGI D
Sbjct  25   QNCGCPSDQCCSRWGFCGTTEEYCGTGCQEGPCFSPPPTNDVA--VPEIVTPEFFNGIID  82

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA+ SC GK FY+R  FL+A++SYP+FG VGSA+DS+REIAAFFAHVTHETGH C+I+EI
Sbjct  83   QAEDSCVGKRFYSREVFLEALDSYPRFGRVGSAEDSRREIAAFFAHVTHETGHFCHIEEI  142

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G +RDYCD+ NTQYPC P K YYGRGPIQLSWNFNYGPAG+SIGFDGLN+P+ VA DP+
Sbjct  143  NGATRDYCDEDNTQYPCNPEKGYYGRGPIQLSWNFNYGPAGESIGFDGLNSPETVANDPV  202

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALW+WMNN   +I  GQGFGATIRAING LECDG N  TV+ RV YYT YC QLG
Sbjct  203  ISFKTALWYWMNNVQPVI--GQGFGATIRAINGALECDGGNSATVQARVGYYTDYCDQLG  260

Query  833  VDPGNNLEC  859
            V PG+NL C
Sbjct  261  VAPGDNLTC  269



>ref|NP_191010.1| chitinase class IV [Arabidopsis thaliana]
 emb|CAB81807.1| class IV chitinase (CHIV) [Arabidopsis thaliana]
 gb|AAQ62423.1| At3g54420 [Arabidopsis thaliana]
 dbj|BAD44251.1| class IV chitinase (CHIV) [Arabidopsis thaliana]
 gb|AEE79228.1| chitinase class IV [Arabidopsis thaliana]
Length=273

 Score =   359 bits (922),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 174/249 (70%), Positives = 201/249 (81%), Gaps = 4/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC+  LCCSQ+G+CG   DYCG GC++GPC+    PP+ G SVA+IV+  FFNGI  
Sbjct  29   QNCGCSSELCCSQFGFCGNTSDYCGVGCQQGPCF--APPPANGVSVAEIVTQEFFNGIIS  86

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA SSC G  FY+R +FL+A++SY +FG VGS DDS+REIAAFFAHVTHETGH CYI+EI
Sbjct  87   QAASSCAGNRFYSRGAFLEALDSYSRFGRVGSTDDSRREIAAFFAHVTHETGHFCYIEEI  146

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            DG S+DYCD+  TQYPC P K YYGRGPIQLSWNFNYGPAG +IGFDGLN P+ VATDP+
Sbjct  147  DGASKDYCDENATQYPCNPNKGYYGRGPIQLSWNFNYGPAGTAIGFDGLNAPETVATDPV  206

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALW+W N    +I+  QGFGATIRAING LECDGAN  TV+ RV YYT YC+QLG
Sbjct  207  ISFKTALWYWTNRVQPVIS--QGFGATIRAINGALECDGANTATVQARVRYYTDYCRQLG  264

Query  833  VDPGNNLEC  859
            VDPGNNL C
Sbjct  265  VDPGNNLTC  273



>ref|XP_010069261.1| PREDICTED: chitinase 6-like [Eucalyptus grandis]
 gb|KCW57558.1| hypothetical protein EUGRSUZ_H00327 [Eucalyptus grandis]
Length=281

 Score =   359 bits (922),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 169/251 (67%), Positives = 201/251 (80%), Gaps = 3/251 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsg--ggsVADIVSDAFFNGI  286
            Q CGCA  LCCSQ+GYCGTGD YCG GC+ GPCY   +P +     SVAD+V+D+FFN I
Sbjct  32   QGCGCATNLCCSQYGYCGTGDQYCGTGCQSGPCYSSSTPTTPSSRVSVADVVTDSFFNSI  91

Query  287  ADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIK  466
              QA++ C GK FYTR +FLDA   YP+FGTVGSA+DSKREIAAFFAHVTHETGH CYI+
Sbjct  92   IGQANAGCAGKSFYTRPAFLDAAGGYPEFGTVGSANDSKREIAAFFAHVTHETGHFCYIE  151

Query  467  EIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATD  646
            EIDG S++YC ++NTQYPC P K YYGRGP+Q+SWN+N GPAG+SIGFDGLN+P+ VA +
Sbjct  152  EIDGPSKNYCQESNTQYPCNPNKGYYGRGPLQISWNYNCGPAGESIGFDGLNSPETVANN  211

Query  647  PIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQ  826
             ++SFKTA WFWMNN HS+ITSGQGFG TIRAING +EC   NP  V+ RV+YYT YC +
Sbjct  212  AVVSFKTAFWFWMNNVHSVITSGQGFGTTIRAING-MECGSGNPAAVQARVKYYTDYCNR  270

Query  827  LGVDPGNNLEC  859
             GV PG+NL C
Sbjct  271  FGVSPGDNLTC  281



>ref|XP_010427142.1| PREDICTED: endochitinase PR4-like [Camelina sativa]
Length=288

 Score =   359 bits (922),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 173/249 (69%), Positives = 202/249 (81%), Gaps = 4/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC+  LCCSQ+G+CG   DYCG GC++GPC+    PP+ G SVA+IV+  FFNGI  
Sbjct  44   QNCGCSSELCCSQFGFCGNTSDYCGVGCQQGPCF--APPPANGVSVAEIVTPDFFNGIIS  101

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            Q++SSC G GFY+R +FL+A+ SY +FG VGS DDS+REIAAFFAHVTHETGH CYI+EI
Sbjct  102  QSESSCAGNGFYSRGAFLEALESYSRFGRVGSTDDSRREIAAFFAHVTHETGHFCYIEEI  161

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            DG S+DYCD+  T+YPC P K YYGRGPIQLSWNFNYGPAG +IGFDGLN P+ VATDP+
Sbjct  162  DGASKDYCDENATRYPCNPNKGYYGRGPIQLSWNFNYGPAGTAIGFDGLNAPETVATDPV  221

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALW+W N    +I+  QGFGATIRAING LECDGAN  TV+ RV YYT YC+QLG
Sbjct  222  ISFKTALWYWTNRVQPVIS--QGFGATIRAINGALECDGANTATVQARVRYYTDYCRQLG  279

Query  833  VDPGNNLEC  859
            VDPGNNL C
Sbjct  280  VDPGNNLTC  288



>emb|CAN82242.1| hypothetical protein VITISV_010460 [Vitis vinifera]
Length=267

 Score =   358 bits (920),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 175/249 (70%), Positives = 196/249 (79%), Gaps = 7/249 (3%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            Q+CGC+   CCSQWGYCGTGDDYCG GC+ GPC    +  S   SV+D+V+  FF+GI D
Sbjct  26   QDCGCSSDQCCSQWGYCGTGDDYCGTGCQSGPC----TSTSNNVSVSDVVTQEFFDGIID  81

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QADSSC GK FYTR +FLDA+NSYP+FGT GS DDS REIAAFF HVTHETGH CYI+EI
Sbjct  82   QADSSCAGKNFYTRAAFLDALNSYPRFGTEGSTDDSLREIAAFFGHVTHETGHFCYIEEI  141

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            DG S DYCD+ NTQYPC  GK YYGRGPIQLSWN+NYG AG SIGFDGLNNP+ VATD  
Sbjct  142  DGASNDYCDEDNTQYPCVSGKDYYGRGPIQLSWNYNYGAAGDSIGFDGLNNPETVATDVD  201

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALW+WM N HS+I   QGFGATIRAIN  +ECDG N   V  RVEYYT+YC +LG
Sbjct  202  ISFKTALWYWMTNVHSVID--QGFGATIRAIN-SIECDGGNTAAVNARVEYYTEYCNELG  258

Query  833  VDPGNNLEC  859
            V  G+NL C
Sbjct  259  VSTGDNLTC  267



>ref|XP_009116128.1| PREDICTED: endochitinase PR4-like [Brassica rapa]
Length=273

 Score =   357 bits (916),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 173/249 (69%), Positives = 201/249 (81%), Gaps = 4/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC+  LCCSQ+G+CG   DYCG GC++GPC+    PP+ G SV +IV+  FFNGI D
Sbjct  29   QNCGCSPDLCCSQFGFCGNTSDYCGVGCQQGPCF--APPPANGVSVDEIVTQEFFNGIID  86

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA+SSC G GFY+R +FL+A+ SY +F  +GS DDS+REIAAFFAHVTHETGH CYI+EI
Sbjct  87   QAESSCAGNGFYSRGAFLEALESYSRFARIGSVDDSRREIAAFFAHVTHETGHFCYIEEI  146

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G SRDYCD+  TQYPC P K YYGRGPIQLSWNFNYGPAG +IGFDGLN P+ VATDP+
Sbjct  147  NGPSRDYCDENATQYPCNPNKGYYGRGPIQLSWNFNYGPAGTAIGFDGLNAPETVATDPV  206

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALW+W N    +I+  QGFGATIRAING LECDGAN  TV+ RV YYT YC+QLG
Sbjct  207  ISFKTALWYWTNRVQPVIS--QGFGATIRAINGALECDGANSATVQARVRYYTDYCRQLG  264

Query  833  VDPGNNLEC  859
            VDPGNNL C
Sbjct  265  VDPGNNLTC  273



>ref|XP_006376419.1| hypothetical protein POPTR_0013s12880g [Populus trichocarpa]
 gb|ERP54216.1| hypothetical protein POPTR_0013s12880g [Populus trichocarpa]
Length=273

 Score =   357 bits (916),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 173/250 (69%), Positives = 200/250 (80%), Gaps = 3/250 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsp-psgggsVADIVSDAFFNGIA  289
            Q+CGCA  LCCSQ+GYCGTG+ YCG+GCK+GPC   PS    GG SVADIV+ +FFNGI 
Sbjct  26   QSCGCAANLCCSQYGYCGTGNAYCGQGCKQGPCSASPSTPSGGGASVADIVTPSFFNGII  85

Query  290  DQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKE  469
             QA + C GK FYTR +FLDA+NSY QFG +GS D SK EIAAFFAHVTHETGH CYI+E
Sbjct  86   SQAGAGCAGKNFYTRNTFLDALNSYSQFGQLGSDDASKPEIAAFFAHVTHETGHFCYIEE  145

Query  470  IDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDP  649
            I+G SRDYCD  N +YPC PGK Y+GRGP+Q+SWNFNYGPAG+S  FDGLNNPD+VA DP
Sbjct  146  INGSSRDYCDGKNKEYPCVPGKKYHGRGPLQISWNFNYGPAGKSNDFDGLNNPDIVAKDP  205

Query  650  IISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQL  829
            +++FKTALWFWMNN   ++   QGFGATIRAING LEC+G NP TV+ R+ YY  YC QL
Sbjct  206  VVAFKTALWFWMNNIRPVLN--QGFGATIRAINGALECNGGNPRTVQTRIGYYRDYCNQL  263

Query  830  GVDPGNNLEC  859
            GV PGNNL C
Sbjct  264  GVAPGNNLSC  273



>ref|XP_010069257.1| PREDICTED: endochitinase PR4-like [Eucalyptus grandis]
 gb|KCW57555.1| hypothetical protein EUGRSUZ_H00324 [Eucalyptus grandis]
Length=281

 Score =   357 bits (915),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 172/251 (69%), Positives = 200/251 (80%), Gaps = 3/251 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsV--ADIVSDAFFNGI  286
            QNCGCA  LCCSQ+GYCGTG+ YCG GC+ GPCY   +P +    V  AD+V+D+FFN I
Sbjct  32   QNCGCAADLCCSQYGYCGTGEQYCGTGCQSGPCYLSSTPTTPSSGVSMADVVTDSFFNSI  91

Query  287  ADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIK  466
              QA++ C GK FYTR +FLDA   YP+FGTVGSADDSKREIAAFFAHVTHETGH CYI+
Sbjct  92   IGQANAGCAGKSFYTRQAFLDAAGGYPEFGTVGSADDSKREIAAFFAHVTHETGHFCYIE  151

Query  467  EIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATD  646
            EIDG S+DYCD++NTQYPC P K YYGRGP+Q+SWN+NYGPAG+SIGFDGLN+P+ VA D
Sbjct  152  EIDGPSKDYCDESNTQYPCNPNKGYYGRGPLQISWNYNYGPAGESIGFDGLNSPETVAND  211

Query  647  PIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQ  826
              +SFKTA WFWMNN HS+ITSGQGFGATI+AING     G N   V+ RV+YYT YC Q
Sbjct  212  VTVSFKTAFWFWMNNVHSVITSGQGFGATIKAINGGEC-GGGNSGAVQARVQYYTDYCNQ  270

Query  827  LGVDPGNNLEC  859
             GV PG+NL C
Sbjct  271  FGVSPGDNLTC  281



>ref|XP_003597548.1| Endochitinase PR4 [Medicago truncatula]
Length=553

 Score =   366 bits (939),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 178/250 (71%), Positives = 204/250 (82%), Gaps = 5/250 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppspps---gggsVADIVSDAFFNG  283
            QNCGCAEG+CCSQ+GYCG GD YCG GCK+GPCY   +PPS      +VADI++  FFN 
Sbjct  33   QNCGCAEGVCCSQYGYCGNGDAYCGTGCKQGPCYAGQTPPSLPNNDANVADILTQDFFNR  92

Query  284  IADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYI  463
            I DQADSSC GK FYTR +FLDA+NSY QFG  GS DDSKRE+AA FAH THETGH CY 
Sbjct  93   IIDQADSSCAGKNFYTRAAFLDALNSYNQFGRSGSLDDSKREVAAAFAHFTHETGHFCYT  152

Query  464  KEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVAT  643
            +EIDG S+DYCD+ NT++PCAP K YYGRGPIQLSWN+NYGPAG+  GFDGLN+P+ VA 
Sbjct  153  EEIDGPSKDYCDEGNTEWPCAPNKGYYGRGPIQLSWNYNYGPAGRDNGFDGLNSPETVAN  212

Query  644  DPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQ  823
            DP +SFKTALW+WMNN H +I   QGFGATIRAING+LECDGANP TV+ RV YYTQYC 
Sbjct  213  DPTVSFKTALWYWMNNVHGVIN--QGFGATIRAINGRLECDGANPSTVQTRVGYYTQYCS  270

Query  824  QLGVDPGNNL  853
            +LGV PG+NL
Sbjct  271  ELGVAPGDNL  280


 Score =   360 bits (925),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 173/254 (68%), Positives = 201/254 (79%), Gaps = 6/254 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsg-----ggsVADIVSDAFF  277
            QNCGC EGLCCS+ GYCG  D YCG GCK+GPCY     PS        +VADIV+  FF
Sbjct  301  QNCGCEEGLCCSEHGYCGNTDPYCGTGCKQGPCYAGQISPSTPGPSNDVNVADIVTQEFF  360

Query  278  NGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMC  457
            N I DQADSSC GK FY+R  FLDA+ SY QFG VGS DDSKREIAA FAH THETGH C
Sbjct  361  NSIIDQADSSCAGKNFYSRAVFLDALGSYNQFGRVGSVDDSKREIAAAFAHFTHETGHFC  420

Query  458  YIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVV  637
            YI+E DG S+DYCD++NT+YPCAP K YYGRGPIQLSWNFNYGPAG+  GFD LN+P+ V
Sbjct  421  YIEEKDGASKDYCDESNTEYPCAPNKGYYGRGPIQLSWNFNYGPAGKDSGFDELNSPETV  480

Query  638  ATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQY  817
            A DP++SFKTALW+WMN+ H+++   QGFGAT+RAING+LECDG +P+TV+ RV+YYTQY
Sbjct  481  ANDPLVSFKTALWYWMNHVHNVMNQ-QGFGATVRAINGRLECDGVDPNTVKARVDYYTQY  539

Query  818  CQQLGVDPGNNLEC  859
            C QLGV PG+ L C
Sbjct  540  CSQLGVAPGDKLNC  553



>gb|KCW87623.1| hypothetical protein EUGRSUZ_A00021, partial [Eucalyptus grandis]
Length=266

 Score =   356 bits (913),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 172/240 (72%), Positives = 195/240 (81%), Gaps = 4/240 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCA   CCSQWGYCG GDD+CG GC+EGPC     PP+    VAD+V++AFFNGI  
Sbjct  31   QNCGCAADQCCSQWGYCGLGDDFCGMGCREGPC--NTPPPTNDVVVADVVTEAFFNGIIG  88

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA  SCEGKGFY+R +FL+A  SYPQFG VGS DDSKREIAAFFAHVTHETGH CYI EI
Sbjct  89   QAAESCEGKGFYSRGTFLEAAGSYPQFGRVGSVDDSKREIAAFFAHVTHETGHFCYINEI  148

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            DG S+DYCD+TNTQYPC P K YYGRGPIQL+ N NYGPAG SI FDGLN+P+ VATDP+
Sbjct  149  DGASKDYCDETNTQYPCNPNKGYYGRGPIQLTGNANYGPAGDSIRFDGLNSPETVATDPL  208

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALW+WMN+   +I   QGFGATIRAING +ECDG +P TV+ RV+YYT+YC QLG
Sbjct  209  ISFKTALWYWMNSVRPVIN--QGFGATIRAINGAIECDGKSPTTVQARVQYYTEYCNQLG  266



>ref|XP_006403578.1| hypothetical protein EUTSA_v10010625mg [Eutrema salsugineum]
 gb|ESQ45031.1| hypothetical protein EUTSA_v10010625mg [Eutrema salsugineum]
Length=273

 Score =   356 bits (913),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 170/249 (68%), Positives = 201/249 (81%), Gaps = 4/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC+  LCCSQ+G+CG   DYCG GC++GPC+    PP+   SVA+IV+  FFNGI +
Sbjct  29   QNCGCSSELCCSQFGFCGNTSDYCGVGCQQGPCF--APPPANDVSVAEIVTQDFFNGIIN  86

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA+SSC G  FY+R +FL A++SY +FG +GS DDS+REIA+FFAHVTHETGH CYI+EI
Sbjct  87   QAESSCAGNRFYSRGAFLGALDSYSRFGRIGSVDDSRREIASFFAHVTHETGHFCYIEEI  146

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G S+DYCD+  TQYPC P K YYGRGPIQLSWNFNYGPAG +IGFDGLN P+ VATDP+
Sbjct  147  EGASKDYCDENATQYPCNPNKGYYGRGPIQLSWNFNYGPAGTAIGFDGLNAPETVATDPV  206

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALW+W N    +I+  QGFGATIRAING LECDGAN  TV+ RV YYT YC+QLG
Sbjct  207  ISFKTALWYWTNRVQPVIS--QGFGATIRAINGALECDGANTATVQARVRYYTDYCRQLG  264

Query  833  VDPGNNLEC  859
            VDPGNNL C
Sbjct  265  VDPGNNLTC  273



>ref|XP_006291664.1| hypothetical protein CARUB_v10017824mg [Capsella rubella]
 gb|EOA24562.1| hypothetical protein CARUB_v10017824mg [Capsella rubella]
Length=273

 Score =   355 bits (912),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 172/249 (69%), Positives = 202/249 (81%), Gaps = 4/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC+  LCCSQ+G+CG   DYCG GC++GPC+    PP+ G SVA++V+  FFNGI  
Sbjct  29   QNCGCSSELCCSQFGFCGNTSDYCGVGCQQGPCF--APPPANGVSVAEVVTPDFFNGIIG  86

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA+SSC G GFY+R +FL+A+ SY +FG VGS DDS+REIA+FFAHVTHETGH CYI+EI
Sbjct  87   QAESSCAGIGFYSRGAFLEALESYSRFGRVGSTDDSRREIASFFAHVTHETGHFCYIEEI  146

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G S+DYCD+T TQYPC P K YYGRGPIQLSWNFNYGPAG +IGFDGLN P+ VATDP+
Sbjct  147  NGASKDYCDETATQYPCNPNKGYYGRGPIQLSWNFNYGPAGTAIGFDGLNAPETVATDPV  206

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALW+W N    ++   QGFGATIRAING LECDGAN  TV+ RV YYT YC+QLG
Sbjct  207  ISFKTALWYWTNRVQPVLP--QGFGATIRAINGALECDGANTATVQARVGYYTDYCRQLG  264

Query  833  VDPGNNLEC  859
            VDPGNNL C
Sbjct  265  VDPGNNLTC  273



>ref|XP_010069255.1| PREDICTED: endochitinase PR4-like [Eucalyptus grandis]
 gb|KCW57552.1| hypothetical protein EUGRSUZ_H00321 [Eucalyptus grandis]
Length=281

 Score =   355 bits (912),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 174/251 (69%), Positives = 200/251 (80%), Gaps = 3/251 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgg--gsVADIVSDAFFNGI  286
            QNCGCA  LCCSQ+GYCGTGD YCG GC+ GPCY   +P +     SVAD+V+D+FFN I
Sbjct  32   QNCGCAADLCCSQYGYCGTGDQYCGTGCQSGPCYSSSTPTTPSSGVSVADVVTDSFFNSI  91

Query  287  ADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIK  466
              QAD+ C GK FYTR +FLDA   YP+FGTVGSADDSKREIAAFFAHVTHETGH CYI+
Sbjct  92   IGQADAGCAGKSFYTRQAFLDAAGGYPEFGTVGSADDSKREIAAFFAHVTHETGHFCYIE  151

Query  467  EIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATD  646
            EIDG S+DYCD++NTQYPC P K YYGRGP+Q+SWN+NYGPAG+SIGFDGLN+P+ VA D
Sbjct  152  EIDGPSKDYCDESNTQYPCNPNKGYYGRGPLQISWNYNYGPAGESIGFDGLNSPETVAND  211

Query  647  PIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQ  826
              +SFKTA WFWMNN HS+ITSGQGFGATI+AING     G N   V+ R +YYT YC Q
Sbjct  212  VTVSFKTAFWFWMNNVHSVITSGQGFGATIKAINGGEC-GGGNSGAVQARGQYYTDYCNQ  270

Query  827  LGVDPGNNLEC  859
             GV PG+NL C
Sbjct  271  FGVSPGDNLTC  281



>gb|ABK95688.1| unknown [Populus trichocarpa]
Length=274

 Score =   355 bits (911),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 175/251 (70%), Positives = 201/251 (80%), Gaps = 5/251 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppspp--sgggsVADIVSDAFFNGI  286
            QNCGCA  LCCSQ+GYCGTG+ YCG+GCK+GPC   P+P   SG GSVADIV+ AFFNGI
Sbjct  27   QNCGCAANLCCSQYGYCGTGNAYCGQGCKQGPCNSSPTPTTPSGSGSVADIVTPAFFNGI  86

Query  287  ADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIK  466
              QA +SC GK FYTR +FL AVNSYPQFG +GSA+ SKREIAAFFAHVTHETGH CYI+
Sbjct  87   ISQAAASCAGKNFYTRNAFLSAVNSYPQFGKLGSAEASKREIAAFFAHVTHETGHFCYIE  146

Query  467  EIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATD  646
            EI+G S DYCD+ N +YPC PGK YYGRGP+QLSWN+NYGPAG+S  FDGLNNPD+VA D
Sbjct  147  EINGASGDYCDENNREYPCVPGKKYYGRGPLQLSWNYNYGPAGRSNNFDGLNNPDIVARD  206

Query  647  PIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQ  826
             ++SFKTALWFWMN    +++  QGFGATIRAING +EC+G NP  V+ RV YY  YC Q
Sbjct  207  AVVSFKTALWFWMNRVRPVVS--QGFGATIRAING-IECNGGNPGAVQARVRYYRDYCSQ  263

Query  827  LGVDPGNNLEC  859
            LGV   NNL C
Sbjct  264  LGVSTENNLTC  274



>ref|NP_001268173.1| class IV chitinase precursor [Vitis vinifera]
 gb|AAM95447.1| class IV chitinase [Vitis vinifera]
Length=267

 Score =   355 bits (910),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 174/249 (70%), Positives = 194/249 (78%), Gaps = 7/249 (3%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            Q+CGC+   CCSQWGYCGTGDDYCG GC+ GPC    +  S   SV+D+V+  FFNGI D
Sbjct  26   QDCGCSSDQCCSQWGYCGTGDDYCGTGCQSGPC----TSTSNNVSVSDVVTQEFFNGIID  81

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QAD+SC GK FYTR +FLDA+NSYP FGT G  DDS REIAAFF HVTHETGH CYI+EI
Sbjct  82   QADASCAGKNFYTRAAFLDALNSYPGFGTEGPTDDSLREIAAFFGHVTHETGHFCYIEEI  141

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            DG S DYCD+ NTQYPC  GK YYGRGPIQLSWN+NYG AG SIGFDGLNNP+ VATD  
Sbjct  142  DGASNDYCDEDNTQYPCVSGKDYYGRGPIQLSWNYNYGAAGDSIGFDGLNNPETVATDVD  201

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALW+WM N HS+I   QGFGATIRAIN  +ECDG N   V  RVEYYT+YC +LG
Sbjct  202  ISFKTALWYWMTNVHSVID--QGFGATIRAIN-SIECDGGNTAAVNARVEYYTEYCNELG  258

Query  833  VDPGNNLEC  859
            V  G+NL C
Sbjct  259  VSTGDNLTC  267



>ref|XP_002326039.1| chitinase family protein, partial [Populus trichocarpa]
 gb|EEF00421.1| chitinase family protein, partial [Populus trichocarpa]
Length=258

 Score =   354 bits (909),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 171/249 (69%), Positives = 199/249 (80%), Gaps = 4/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCA   CCS+WG+CGTG++YCG GC+EGPC+     P+   SV DIV+  FF GI D
Sbjct  14   QNCGCAANECCSRWGFCGTGNEYCGTGCQEGPCF--APAPTNDVSVPDIVTPEFFGGILD  71

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA+SSC GK FY+R  FL+A+ SY +FG +GS DDS+REIAAFFAHVTHETGH C I+EI
Sbjct  72   QANSSCVGKSFYSRDVFLEALGSYSRFGRIGSVDDSRREIAAFFAHVTHETGHFCSIEEI  131

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G SRDYCD+ NTQYPC P K YYGRGPIQLSWN+NYGPAG+SIGFDGLN+P+VVA DP+
Sbjct  132  NGPSRDYCDEDNTQYPCNPDKGYYGRGPIQLSWNYNYGPAGESIGFDGLNSPEVVANDPL  191

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALW+WMN    +I+  QGFG TIRAING LECDG N  TV+ RV YYT YC QLG
Sbjct  192  ISFKTALWYWMNFVQPVIS--QGFGETIRAINGALECDGGNSATVQARVRYYTNYCNQLG  249

Query  833  VDPGNNLEC  859
            V PG+NL C
Sbjct  250  VAPGDNLTC  258



>ref|XP_010524052.1| PREDICTED: endochitinase PR4 [Tarenaya hassleriana]
Length=268

 Score =   354 bits (909),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 168/249 (67%), Positives = 200/249 (80%), Gaps = 4/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC  G CCSQ+GYCG   +YCG GC+EGPC     PP+    VADIV+  FF+GI D
Sbjct  24   QNCGCERGFCCSQYGYCGQTVEYCGAGCQEGPCL--APPPTNDAVVADIVTPGFFDGIID  81

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA SSCEGK FY+R +FL+A+  YP+FG +GS+DDS+REIAAFFAHVTHETGH CY++EI
Sbjct  82   QAASSCEGKRFYSRGAFLEALRLYPRFGRIGSSDDSRREIAAFFAHVTHETGHFCYVEEI  141

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            DG S+DYCD+T+TQYPC P K Y+GRGPIQLSWN+NYGPAG S+GFDGLN P+ VATDP+
Sbjct  142  DGPSKDYCDETSTQYPCNPSKGYHGRGPIQLSWNYNYGPAGNSLGFDGLNAPETVATDPV  201

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            +SFKTALW+W N    +++  QGFGATIRAING LECDGAN  TV+ RV YYT+YC Q G
Sbjct  202  LSFKTALWYWNNRVQPVVS--QGFGATIRAINGALECDGANTATVQSRVGYYTRYCSQFG  259

Query  833  VDPGNNLEC  859
            V PG+NL C
Sbjct  260  VAPGDNLTC  268



>ref|XP_004486869.1| PREDICTED: LOW QUALITY PROTEIN: endochitinase PR4-like [Cicer 
arietinum]
Length=449

 Score =   360 bits (925),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 174/250 (70%), Positives = 205/250 (82%), Gaps = 5/250 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCY---HppsppsgggsVADIVSDAFFNG  283
            QNCGCAEGLCCSQ+GYCG  D YCG GC++GPC+   +PP+  +   +VADIV+  FF+ 
Sbjct  25   QNCGCAEGLCCSQYGYCGNSDAYCGTGCQQGPCFGGQNPPNSNTNDVNVADIVTPQFFDS  84

Query  284  IADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYI  463
            I DQADSSC GK FY+R +FLDA+NSY QFG VG  +DSKREIAA FAH THETGH CYI
Sbjct  85   IIDQADSSCAGKNFYSRDAFLDALNSYNQFGRVGLVEDSKREIAAAFAHFTHETGHFCYI  144

Query  464  KEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVAT  643
            +EIDG S+DYCD++NT+YPCA  K YYGRGPIQLSWN+NYG AG+  GFDGLN+P+ VA 
Sbjct  145  EEIDGASKDYCDESNTEYPCATNKGYYGRGPIQLSWNYNYGAAGKDNGFDGLNSPETVAN  204

Query  644  DPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQ  823
            DP++SFKTALW+WM + H +I   QGFGATIRAINGQLECDGANP+TV+ RV YYTQYC 
Sbjct  205  DPVVSFKTALWYWMKHVHPVIN--QGFGATIRAINGQLECDGANPNTVQARVSYYTQYCS  262

Query  824  QLGVDPGNNL  853
            QLGV PG+NL
Sbjct  263  QLGVAPGDNL  272


 Score =   102 bits (253),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 83/149 (56%), Gaps = 13/149 (9%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCY---HppsppsgggsVADIVSDAFFNG  283
            QNCGCA+GLCCS+ GYCG  D Y      +GPC+   + PS  +   +V +IV+  FFN 
Sbjct  299  QNCGCAQGLCCSKDGYCGNSDAYI---VAQGPCFGGQNAPSSTTNDVNVTNIVTPQFFNS  355

Query  284  IADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYI  463
            I DQADSSC GK FY+R +FLDA+NSY QFG VGS ++           + H       +
Sbjct  356  INDQADSSCAGKNFYSRDAFLDALNSYNQFGRVGSVEE------LLHKKLDHRFSSSLLV  409

Query  464  KEIDGESRDYCDKTNTQYPCAPGKMYYGR  550
            ++  G    YC  T  QY C  G  +  R
Sbjct  410  RKW-GMIHCYCHCTLIQYCCWEGTRWLRR  437



>gb|AAP03085.1| class IV chitinase [Galega orientalis]
Length=275

 Score =   354 bits (908),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 169/249 (68%), Positives = 196/249 (79%), Gaps = 6/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCA G+CCSQ+GYCG GD YCG GCK+GPCY          SVADIV+ AFFNGI +
Sbjct  33   QNCGCAAGVCCSQYGYCGNGDPYCGTGCKQGPCY---GSTLSSSSVADIVTPAFFNGIIN  89

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA SSC GK FYTR +FL+A+NSY QFG  GS DD+KREIAA FAH THETGH CY++EI
Sbjct  90   QAGSSCAGKNFYTRDAFLNALNSYNQFGKGGSLDDTKREIAAAFAHFTHETGHFCYMEEI  149

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G S DYCD T TQYPCAPGK YYGRGP+Q++WN+NYGPAG   GFDGL +P+ VA + +
Sbjct  150  NGASHDYCDNTKTQYPCAPGKGYYGRGPLQITWNYNYGPAGTDNGFDGLKSPETVANNAV  209

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALWFWM N HS++   QGFGATIRAIN  +EC+G N + V+ RV YYTQYC QLG
Sbjct  210  ISFKTALWFWMKNVHSVVN--QGFGATIRAIN-SIECNGGNSNAVQARVNYYTQYCSQLG  266

Query  833  VDPGNNLEC  859
            V PGNNL+C
Sbjct  267  VAPGNNLKC  275



>ref|XP_002274819.1| PREDICTED: chitinase 5-like [Vitis vinifera]
Length=273

 Score =   353 bits (907),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 174/252 (69%), Positives = 194/252 (77%), Gaps = 6/252 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVA---DIVSDAFFNG  283
            QNCGC  GLCCSQWGYCGTGDDYCG GC+ GPC        GG       D+V++ FFNG
Sbjct  25   QNCGCDAGLCCSQWGYCGTGDDYCGTGCQAGPCSSSGGGGGGGSGSVSVSDVVTEDFFNG  84

Query  284  IADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYI  463
            I  QAD SC G+ FY+R +FLDAV+SYPQFG  GSADDSKREIAAFFAHVTHETGH CYI
Sbjct  85   IISQADRSCAGRNFYSRNAFLDAVSSYPQFGQDGSADDSKREIAAFFAHVTHETGHFCYI  144

Query  464  KEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVAT  643
            +EIDG S+DY D++NTQYPC   K YYGRGPIQ+SWN+NYGPAG+SIGFDGLNNP+ VA 
Sbjct  145  EEIDGPSKDYYDESNTQYPCVSRKGYYGRGPIQISWNYNYGPAGESIGFDGLNNPETVAN  204

Query  644  DPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQ  823
            DP +SFKTA WFWMNN HS+I  GQGFGATIRAING  EC G N   V  R+ YYT YC 
Sbjct  205  DPAVSFKTAFWFWMNNVHSII--GQGFGATIRAINGG-ECGGGNSAAVNARIGYYTDYCN  261

Query  824  QLGVDPGNNLEC  859
            Q GV  G+NL C
Sbjct  262  QFGVSTGDNLSC  273



>ref|XP_002876253.1| hypothetical protein ARALYDRAFT_485842 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52512.1| hypothetical protein ARALYDRAFT_485842 [Arabidopsis lyrata subsp. 
lyrata]
Length=273

 Score =   353 bits (907),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 168/249 (67%), Positives = 200/249 (80%), Gaps = 4/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC+  LCCSQ+G+CG   DYCG GC++GPC+    PP+ G +V+++V+  FFNGI  
Sbjct  29   QNCGCSSELCCSQFGFCGNTSDYCGVGCQQGPCF--APPPANGVTVSEVVTQDFFNGIIS  86

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA SSC G  FY+R +FL+A++SY +FG VGS DDS+REIAAFFAHVTHETGH CYI+EI
Sbjct  87   QAASSCAGNSFYSRGAFLEALDSYSRFGRVGSTDDSRREIAAFFAHVTHETGHFCYIEEI  146

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            DG ++DYCD+  TQYPC P K YYGRGPIQLSWNFNYGPAG +IGFDGLN P+ V TDP+
Sbjct  147  DGAAKDYCDENATQYPCNPNKGYYGRGPIQLSWNFNYGPAGTAIGFDGLNAPETVGTDPV  206

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALW+W N    +++  QGFGATIRAING LECDGAN  TV+ RV YYT YC+QLG
Sbjct  207  ISFKTALWYWTNRVQPVLS--QGFGATIRAINGALECDGANTATVQARVRYYTDYCRQLG  264

Query  833  VDPGNNLEC  859
            VDPGNNL C
Sbjct  265  VDPGNNLTC  273



>ref|XP_010504246.1| PREDICTED: endochitinase PR4-like [Camelina sativa]
Length=273

 Score =   353 bits (905),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 172/249 (69%), Positives = 199/249 (80%), Gaps = 4/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC+  LCCSQ+G+CG   DYCG GC++GPC+    PP+ G SVA+IV+  FFNGI  
Sbjct  29   QNCGCSSELCCSQFGFCGNTSDYCGVGCQQGPCF--APPPANGVSVAEIVTPDFFNGIIS  86

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            Q++SSC G G Y+R +FL+A+ SY +FG VGS DDS+REIAAFFAHVTHETGH CYI+EI
Sbjct  87   QSESSCAGNGIYSRGAFLEALESYSRFGRVGSTDDSRREIAAFFAHVTHETGHFCYIEEI  146

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            DG S+DYCD+  TQY C P K YYGRGPIQLSWNFNYGPAG +IGFDGLN P+ VATDP+
Sbjct  147  DGASKDYCDENATQYLCNPNKGYYGRGPIQLSWNFNYGPAGTAIGFDGLNAPETVATDPV  206

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALW+W N    +I   QGFGATIRAING LECDGAN  TV+ RV YYT YC+QLG
Sbjct  207  ISFKTALWYWTNRVQPVIY--QGFGATIRAINGALECDGANTATVQARVRYYTDYCRQLG  264

Query  833  VDPGNNLEC  859
            VDPGNNL C
Sbjct  265  VDPGNNLTC  273



>ref|XP_010069259.1| PREDICTED: endochitinase PR4-like [Eucalyptus grandis]
 gb|KCW57556.1| hypothetical protein EUGRSUZ_H00325 [Eucalyptus grandis]
Length=281

 Score =   353 bits (905),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 174/251 (69%), Positives = 200/251 (80%), Gaps = 3/251 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgg--gsVADIVSDAFFNGI  286
            QNCGCA  LCCSQ+GYCGTG+ YCG GC+ GPCY   +P +     SVAD+V+D+FFN I
Sbjct  32   QNCGCAADLCCSQYGYCGTGEQYCGTGCQSGPCYSSSTPTTPSSGVSVADVVTDSFFNSI  91

Query  287  ADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIK  466
              QAD+ C GK FYTR +FLDA   YP+FGTVGSADDSKREIAAFFAHVTHETGH CYI+
Sbjct  92   IGQADAGCAGKSFYTRQAFLDAAGGYPEFGTVGSADDSKREIAAFFAHVTHETGHFCYIE  151

Query  467  EIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATD  646
            EIDG S+DYCD++NTQYPC P K YYGRGP+Q+SWN+NYGPAG+SIGFDGLN P+ VA D
Sbjct  152  EIDGPSKDYCDESNTQYPCNPNKGYYGRGPLQISWNYNYGPAGESIGFDGLNTPETVAND  211

Query  647  PIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQ  826
              +SFKTA WFWMNN HS+ITSGQGFGATI+AING     G NP  V+ R +YYT YC Q
Sbjct  212  VTVSFKTAFWFWMNNVHSVITSGQGFGATIKAINGGEC-GGGNPGAVQARGQYYTDYCNQ  270

Query  827  LGVDPGNNLEC  859
             GV PG+NL C
Sbjct  271  FGVSPGDNLTC  281



>ref|XP_008791790.1| PREDICTED: endochitinase PR4-like [Phoenix dactylifera]
Length=272

 Score =   352 bits (904),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 174/251 (69%), Positives = 201/251 (80%), Gaps = 4/251 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC+ GLCCS++GYCGTG+DYCG GC++GPC    SPP+ G SVADIV+  FF+GI  
Sbjct  24   QNCGCSPGLCCSEYGYCGTGNDYCGPGCQQGPC--QASPPANGVSVADIVTQQFFDGIIS  81

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QAD  C GKGFYTR++FLDA+ SYP FG  G+ADDSKREIAAFFAHVTHETGH+C+I+E 
Sbjct  82   QADGGCPGKGFYTRSAFLDALGSYPSFGRAGTADDSKREIAAFFAHVTHETGHLCFIEEK  141

Query  473  DGESRD-YCDKTNTQ-YPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATD  646
            +G S+D YCDK  TQ YPCAPGK YYGRGP+QLSWN+NYGPAG+SIGFDGLNNP+ VA D
Sbjct  142  NGTSQDDYCDKRYTQQYPCAPGKKYYGRGPLQLSWNYNYGPAGRSIGFDGLNNPETVAND  201

Query  647  PIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQ  826
               SFK ALWFWM N HS+ITSGQGFGATIR ING  ECDG   D +  R+ YY  YC+Q
Sbjct  202  VNTSFKAALWFWMENVHSVITSGQGFGATIRRINGAYECDGKGVDLMNARIRYYQDYCKQ  261

Query  827  LGVDPGNNLEC  859
             GV PG+ L C
Sbjct  262  FGVAPGDKLTC  272



>emb|CAA74930.1| class IV chitinase [Arabidopsis thaliana]
Length=274

 Score =   352 bits (904),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 173/250 (69%), Positives = 201/250 (80%), Gaps = 5/250 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC+  LCCSQ+G+CG   DYCG GC++GPC+    PP+ G SVA+IV+  FFNGI  
Sbjct  29   QNCGCSSELCCSQFGFCGNTSDYCGVGCQQGPCF--APPPANGVSVAEIVTQEFFNGIIS  86

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETG-HMCYIKE  469
            QA SSC G  FY+R +FL+A++SY +FG VGS DDS+REIAAFFAHVTHETG + CYI+E
Sbjct  87   QAASSCAGNRFYSRGAFLEALDSYSRFGRVGSTDDSRREIAAFFAHVTHETGRNFCYIEE  146

Query  470  IDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDP  649
            IDG S+DYCD+  TQYPC P K YYGRGPIQLSWNFNYGPAG +IGFDGLN P+ VATDP
Sbjct  147  IDGASKDYCDENATQYPCNPNKGYYGRGPIQLSWNFNYGPAGTAIGFDGLNAPETVATDP  206

Query  650  IISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQL  829
            +ISFKTALW+W N    +I+  QGFGATIRAING LECDGAN  TV+ RV YYT YC+QL
Sbjct  207  VISFKTALWYWTNRVQPVIS--QGFGATIRAINGALECDGANTATVQARVRYYTDYCRQL  264

Query  830  GVDPGNNLEC  859
            GVDPGNNL C
Sbjct  265  GVDPGNNLTC  274



>ref|XP_002448105.1| hypothetical protein SORBIDRAFT_06g021220 [Sorghum bicolor]
 gb|EES12433.1| hypothetical protein SORBIDRAFT_06g021220 [Sorghum bicolor]
Length=271

 Score =   352 bits (903),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 167/249 (67%), Positives = 193/249 (78%), Gaps = 5/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC  G CCSQ+GYCG GD YCG+GC+ GPC         G +V  +V+DAFFNGI +
Sbjct  28   QNCGCQPGYCCSQYGYCGKGDAYCGKGCRSGPC---QGGGGSGANVGSVVTDAFFNGIKN  84

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA + CEGK FYTR++FL+A N+YP F   GS  + KREIAAFFAHVTHETGH CYI EI
Sbjct  85   QAPNWCEGKNFYTRSAFLNAANAYPGFAHGGSEVEGKREIAAFFAHVTHETGHFCYINEI  144

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G SR+YCD  N Q+PCAPGK YYGRGP+Q+SWN+NYGPAG++IGFDGL NPD VA DP+
Sbjct  145  NGASRNYCDANNRQWPCAPGKKYYGRGPLQISWNYNYGPAGKAIGFDGLGNPDKVAQDPV  204

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  V  RV YY  YC+Q G
Sbjct  205  ISFKTALWFWMNNVHQVMP--QGFGATIRAINGALECNGKNPGAVNARVGYYKDYCKQFG  262

Query  833  VDPGNNLEC  859
            VDPGNNL C
Sbjct  263  VDPGNNLTC  271



>ref|XP_010069260.1| PREDICTED: endochitinase PR4-like [Eucalyptus grandis]
 gb|KCW57557.1| hypothetical protein EUGRSUZ_H00326 [Eucalyptus grandis]
Length=281

 Score =   352 bits (903),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 172/251 (69%), Positives = 200/251 (80%), Gaps = 3/251 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgg--gsVADIVSDAFFNGI  286
            QNCGCA  LCCSQ+GYCGTG++YCG  C+ GPCY   +P +     SVAD+V+D+FFN I
Sbjct  32   QNCGCAADLCCSQYGYCGTGEEYCGTNCQSGPCYSSSTPTTPSSGVSVADVVTDSFFNSI  91

Query  287  ADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIK  466
              QAD+ C GK FYTR +FLDA   YP+FGTVGSADDSKREIAAFFAHVTHETGH CYI+
Sbjct  92   IGQADAGCAGKNFYTRQAFLDAAGGYPEFGTVGSADDSKREIAAFFAHVTHETGHFCYIE  151

Query  467  EIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATD  646
            EIDG S+DYCD++NTQYPC P K YYGRGP+Q+SWN+NYGPAG+SIGFDGLN+P+ VA D
Sbjct  152  EIDGPSKDYCDESNTQYPCNPNKGYYGRGPLQISWNYNYGPAGESIGFDGLNSPETVAND  211

Query  647  PIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQ  826
              +SFKTA WFWMNN HS+ITSGQGFGATI+AING     G N   V+ R +YYT YC Q
Sbjct  212  VAVSFKTAFWFWMNNVHSVITSGQGFGATIKAINGGEC-GGGNSGAVQARGQYYTDYCNQ  270

Query  827  LGVDPGNNLEC  859
             GV PG+NL C
Sbjct  271  FGVSPGDNLTC  281



>ref|NP_001268031.1| class IV endochitinase precursor [Vitis vinifera]
 gb|AAB65776.1| class IV endochitinase [Vitis vinifera]
Length=261

 Score =   351 bits (901),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 167/249 (67%), Positives = 195/249 (78%), Gaps = 8/249 (3%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCA GLCCS++GYCGTG DYCG+GC+ GPC       S G SV+DIV+ +FF+GI  
Sbjct  21   QNCGCASGLCCSKYGYCGTGSDYCGDGCQSGPC------DSSGSSVSDIVTQSFFDGIIS  74

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA SSC GK FYTR +FL A+NSY  FG  GS D +KREIAAFFAHVTHETGH CYI+EI
Sbjct  75   QAASSCAGKNFYTRAAFLSALNSYSGFGNDGSTDANKREIAAFFAHVTHETGHFCYIEEI  134

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G S +YCD +NTQYPC  G+ YYGRGP+QL+WN+NYG AG SIGF+GL+NP +VATD +
Sbjct  135  NGASHNYCDSSNTQYPCVSGQNYYGRGPLQLTWNYNYGAAGNSIGFNGLSNPGIVATDVV  194

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
             SFKTALWFWMNN HS+I  GQGFGATIRAING +EC+G N   V  RV+YY  YC QLG
Sbjct  195  TSFKTALWFWMNNVHSVI--GQGFGATIRAINGAVECNGGNTAAVNARVQYYKDYCSQLG  252

Query  833  VDPGNNLEC  859
              PG+NL C
Sbjct  253  ASPGDNLTC  261



>emb|CAN66296.1| hypothetical protein VITISV_043424 [Vitis vinifera]
Length=266

 Score =   351 bits (900),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 171/249 (69%), Positives = 197/249 (79%), Gaps = 7/249 (3%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCA GLCCSQ+GYCGTG+D+CG GC+ GPCY      S    V+D+V++ FFNGI  
Sbjct  25   QNCGCAAGLCCSQYGYCGTGNDFCGTGCQAGPCYSSGGSVS----VSDVVTEDFFNGIIS  80

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA  SC GK FY+R +FL+A +SYPQFG  GSADDSKREIAAFFAHVTHETGH CYI+EI
Sbjct  81   QAAGSCAGKNFYSRNAFLNAASSYPQFGQDGSADDSKREIAAFFAHVTHETGHFCYIEEI  140

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            DG S+DYCD++NTQYPC  GK YYGRGP+Q+SWN+NYGPAGQSIGFDGLNNP+ VA DP+
Sbjct  141  DGASKDYCDESNTQYPCVAGKGYYGRGPLQISWNYNYGPAGQSIGFDGLNNPETVANDPV  200

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            +SFKTA WFWMN+ HS+I  GQGFGATIRAIN  +EC G N   V  R+ YYT YC Q G
Sbjct  201  VSFKTAFWFWMNHVHSII--GQGFGATIRAIN-SMECGGGNTAAVNARIGYYTDYCNQFG  257

Query  833  VDPGNNLEC  859
            V  G NL C
Sbjct  258  VSTGGNLSC  266



>ref|XP_010069263.1| PREDICTED: endochitinase PR4-like [Eucalyptus grandis]
 gb|KCW57559.1| hypothetical protein EUGRSUZ_H00328 [Eucalyptus grandis]
Length=281

 Score =   351 bits (900),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 172/251 (69%), Positives = 199/251 (79%), Gaps = 3/251 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgg--gsVADIVSDAFFNGI  286
            QNCGCA  LCCSQ+GYCGTG+ YCG GC+ G CY   +P +     SVA +V+D+FFN I
Sbjct  32   QNCGCAADLCCSQYGYCGTGEQYCGTGCQSGLCYSSSTPTTPSSGVSVAAVVTDSFFNSI  91

Query  287  ADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIK  466
              QAD+ C GK FYTR +FLDA   YP+FGTVGSADDSKREIAAFFAHVTHETGH CYI+
Sbjct  92   IGQADAGCAGKSFYTRQAFLDAAGGYPEFGTVGSADDSKREIAAFFAHVTHETGHFCYIE  151

Query  467  EIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATD  646
            EIDG S+DYCD++NTQYPC P K YYGRGP+Q+SWN+NYGPAG+SIGFDGLN+P+ VA D
Sbjct  152  EIDGPSKDYCDESNTQYPCNPNKGYYGRGPLQISWNYNYGPAGESIGFDGLNSPETVAND  211

Query  647  PIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQ  826
              +SFKTA WFWMNN HS+ITSGQGFGATI+AING     G N   V+ RV+YYT YC Q
Sbjct  212  VAVSFKTAFWFWMNNVHSVITSGQGFGATIKAINGGEC-GGGNSGAVQARVQYYTDYCNQ  270

Query  827  LGVDPGNNLEC  859
             GV PG+NL C
Sbjct  271  FGVSPGDNLTC  281



>ref|XP_006858884.1| hypothetical protein AMTR_s00066p00199930 [Amborella trichopoda]
 gb|ERN20351.1| hypothetical protein AMTR_s00066p00199930 [Amborella trichopoda]
Length=278

 Score =   350 bits (899),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 170/252 (67%), Positives = 196/252 (78%), Gaps = 3/252 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppspp--sgggsVADIVSDAFFNGI  286
            QNCGC    CCSQ+GYCG+ D+YCG GCKEGPC +       + G  V++IV+ AFF+GI
Sbjct  27   QNCGCPSDQCCSQYGYCGSTDEYCGNGCKEGPCKNSAPTGGGNNGVVVSNIVTQAFFDGI  86

Query  287  ADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIK  466
              QAD SC GK FYTR +FL+A+ SY  FGT GS DDSKREIAAFFAHVTHETGH CYI+
Sbjct  87   ISQADGSCAGKQFYTRDAFLNALGSYSGFGTTGSTDDSKREIAAFFAHVTHETGHFCYIE  146

Query  467  EIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATD  646
            EIDG S+DYCD++NTQY C P K Y+GRGP+QLSWN+NYGPAG SIGFDGLN+P+ VA +
Sbjct  147  EIDGASKDYCDESNTQYRCNPDKKYFGRGPLQLSWNYNYGPAGNSIGFDGLNDPETVANN  206

Query  647  PIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGA-NPDTVRKRVEYYTQYCQ  823
             + SFK ALWFWMNN HS ITSGQGFGATIRAING LEC+G      V+ RV YY  YCQ
Sbjct  207  AVTSFKAALWFWMNNVHSAITSGQGFGATIRAINGALECNGGPGSAAVQTRVGYYQNYCQ  266

Query  824  QLGVDPGNNLEC  859
            QLGV PG+NL C
Sbjct  267  QLGVAPGDNLTC  278



>ref|XP_011002654.1| PREDICTED: basic endochitinase CHB4-like [Populus euphratica]
Length=274

 Score =   350 bits (899),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 173/251 (69%), Positives = 199/251 (79%), Gaps = 5/251 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppspp--sgggsVADIVSDAFFNGI  286
            QNCGCA  LCCSQ+GYCGTG+ YCG GCK+GPCY  P+P   SG GSVADIV+ AFFNGI
Sbjct  27   QNCGCAANLCCSQYGYCGTGNAYCGRGCKQGPCYSSPAPTTPSGSGSVADIVTPAFFNGI  86

Query  287  ADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIK  466
             ++A +SC GK FYTR +FL AVNSYPQFG +GSA+ SKREIAAFFAHVTHETGH CY +
Sbjct  87   INKAAASCAGKNFYTRNAFLSAVNSYPQFGKLGSAEASKREIAAFFAHVTHETGHFCYTE  146

Query  467  EIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATD  646
            EI+G SRDYCD+ N QYPC PGK Y+GRGPIQLSWN+NYGPAG+S  FDGLNNPD+VA D
Sbjct  147  EINGASRDYCDENNKQYPCVPGKKYHGRGPIQLSWNYNYGPAGRSNNFDGLNNPDIVARD  206

Query  647  PIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQ  826
             ++SFKTALWFWM +   +++  QGFGATIRAING  EC+G N   V+ R  YY  YC Q
Sbjct  207  AVVSFKTALWFWMKSVRPVVS--QGFGATIRAINGN-ECNGGNSGAVQARGRYYRDYCSQ  263

Query  827  LGVDPGNNLEC  859
            LGV   NNL C
Sbjct  264  LGVSTENNLAC  274



>gb|KFK34682.1| hypothetical protein AALP_AA5G177800 [Arabis alpina]
Length=273

 Score =   350 bits (898),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 168/249 (67%), Positives = 199/249 (80%), Gaps = 4/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC+  LCCS++G+CG   DYCG GC++GPC+    PP+   SVA+IV+  FFNGI +
Sbjct  29   QNCGCSSDLCCSRFGFCGNTSDYCGVGCQQGPCF--APPPANDVSVAEIVTQDFFNGIIN  86

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA SSC G GFY+R +FL+A+ SY +FG +GSADDS+REIA+FFAHVTHETGH CYI+EI
Sbjct  87   QAASSCAGVGFYSRGAFLEALESYSRFGRIGSADDSRREIASFFAHVTHETGHFCYIEEI  146

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G S DYCD+  TQYPC P K Y+GRGPIQLSWNFNYGPAG +IGFDGLN P+ VATDP+
Sbjct  147  NGASNDYCDENATQYPCNPNKGYFGRGPIQLSWNFNYGPAGSAIGFDGLNAPETVATDPV  206

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALWFW NN   +++  QGFGATIRAING LECDGAN  TV+ RV YYT YC+  G
Sbjct  207  ISFKTALWFWTNNVQPVLS--QGFGATIRAINGALECDGANSATVQARVRYYTDYCRIFG  264

Query  833  VDPGNNLEC  859
            VD GNNL C
Sbjct  265  VDRGNNLTC  273



>ref|XP_002326042.1| hypothetical protein POPTR_0019s12390g [Populus trichocarpa]
 gb|EEF00424.1| hypothetical protein POPTR_0019s12390g [Populus trichocarpa]
Length=274

 Score =   349 bits (896),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 173/251 (69%), Positives = 196/251 (78%), Gaps = 5/251 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppspp--sgggsVADIVSDAFFNGI  286
            QNCGCA  LCCSQ+GYCGT + YCG+GCK+GPCY  P+P   SG GSVADIV+  FFNGI
Sbjct  27   QNCGCAANLCCSQYGYCGTSNAYCGQGCKQGPCYSSPTPTTPSGSGSVADIVTPGFFNGI  86

Query  287  ADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIK  466
              QA + C GK FYTR +FL AVNSYPQFG +GSA+ SKREIAAFFAHVTHETGH CY +
Sbjct  87   ISQAGAGCAGKNFYTRNAFLSAVNSYPQFGKLGSAEASKREIAAFFAHVTHETGHFCYTE  146

Query  467  EIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATD  646
            EI+G SRDYCD+ N QYPC PGK Y+GRGPIQLSWN+NYGPAG S  FDGLNNPD+VA D
Sbjct  147  EINGASRDYCDENNRQYPCVPGKKYHGRGPIQLSWNYNYGPAGSSNNFDGLNNPDIVARD  206

Query  647  PIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQ  826
             ++SFKTALWFWM +   ++  GQGFGATIRAING  EC+G N   V+ RV YY  YC Q
Sbjct  207  AVVSFKTALWFWMKSVRPVV--GQGFGATIRAINGN-ECNGGNSGAVQARVRYYRDYCSQ  263

Query  827  LGVDPGNNLEC  859
            LGV   NNL C
Sbjct  264  LGVSTENNLAC  274



>emb|CAA87072.1| pathogenesis-related protein PR-3 type [Sambucus nigra]
Length=261

 Score =   348 bits (893),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 165/249 (66%), Positives = 194/249 (78%), Gaps = 3/249 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCA  LCCSQ+GYCG+   YCGEGC+ GPCY   S P    SVA+IV++ FFNG+  
Sbjct  16   QNCGCAPNLCCSQFGYCGSDAAYCGEGCRSGPCY--GSNPGSASSVANIVTNNFFNGLIS  73

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
              +  C G+GFYTR +FL A + YP FGT GS +D +REIAAFFAH +HETG  CY +EI
Sbjct  74   -PNGGCAGRGFYTRDAFLRAASFYPAFGTTGSNEDRRREIAAFFAHTSHETGRFCYREEI  132

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G SRDYCD+ N QYPC PG+ Y+GRGP+QLSWN+NYGPAGQSIGFDGL +P +VA DP+
Sbjct  133  NGASRDYCDENNRQYPCRPGQGYFGRGPLQLSWNYNYGPAGQSIGFDGLGDPGIVARDPV  192

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISF+ +LWFWMNNCHS I SGQGFG+TIRAING LEC+GANP TV  RV YYTQ+C QL 
Sbjct  193  ISFRASLWFWMNNCHSRIISGQGFGSTIRAINGNLECNGANPGTVTTRVNYYTQFCNQLS  252

Query  833  VDPGNNLEC  859
            V PG NL C
Sbjct  253  VPPGGNLRC  261



>emb|CAA40474.1| chitinase [Phaseolus vulgaris]
Length=271

 Score =   348 bits (893),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 171/250 (68%), Positives = 197/250 (79%), Gaps = 3/250 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCAEGLCCSQ+GYCGTG+DYCG GC++GPC     PPS   +VADIV+  FFNGI D
Sbjct  24   QNCGCAEGLCCSQYGYCGTGEDYCGTGCQQGPCTTASPPPSNNVNVADIVTADFFNGIID  83

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QADS C GK FYTR +FL A+NSY  FG VGS DDSKREIAA FAH THETGH CYI+EI
Sbjct  84   QADSGCAGKNFYTRDAFLSALNSYTDFGRVGSEDDSKREIAAAFAHFTHETGHFCYIEEI  143

Query  473  DGESRDYCDKTN-TQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDP  649
            DG S+DYCD+ +  QYPC+  K Y+GRGPIQLSWNFNYGPAG +  FDGL  P+ V+ D 
Sbjct  144  DGASKDYCDEESIAQYPCSSSKGYHGRGPIQLSWNFNYGPAGSANNFDGLGAPETVSNDV  203

Query  650  IISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQL  829
            ++SFKTALW+WM +   +I   QGFGATIRAING LECDGANP TV+ RV YYT+YC+QL
Sbjct  204  VVSFKTALWYWMQHVRPVIN--QGFGATIRAINGALECDGANPTTVQARVNYYTEYCRQL  261

Query  830  GVDPGNNLEC  859
            GV  G+NL C
Sbjct  262  GVATGDNLTC  271



>ref|XP_002326041.2| hypothetical protein POPTR_0019s12380g [Populus trichocarpa]
 gb|EEF00423.2| hypothetical protein POPTR_0019s12380g [Populus trichocarpa]
Length=275

 Score =   348 bits (893),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 172/252 (68%), Positives = 200/252 (79%), Gaps = 6/252 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggs--VADIVSDAFFNGI  286
            QNCGCA  LCCSQ+GYCGTG+DYCG+GCK+GPC   P+P +  GS  VADIV+  FFNGI
Sbjct  27   QNCGCAANLCCSQYGYCGTGNDYCGQGCKQGPCSSSPTPTTPSGSGSVADIVTPGFFNGI  86

Query  287  ADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIK  466
              QA + C GK FYTR +FL AVNSYPQFG +GS + SKREIAAFFAHVTHETGH CY +
Sbjct  87   ISQAPAGCAGKNFYTRDAFLSAVNSYPQFGKLGSVEASKREIAAFFAHVTHETGHFCYKE  146

Query  467  EIDGES-RDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVAT  643
            EI+G S +DYCDK N +YPC PGK YYGRGP+QLSWN+NYGPAG+S  FDGLNNPD+VA+
Sbjct  147  EINGASGQDYCDKNNREYPCVPGKKYYGRGPLQLSWNYNYGPAGRSNNFDGLNNPDIVAS  206

Query  644  DPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQ  823
            D ++SFKTALWFWMN    +++  QGFGATIRAIN  +EC+G NP TV+ RV YY  YC 
Sbjct  207  DAVVSFKTALWFWMNIVRPVVS--QGFGATIRAIN-SMECNGGNPGTVQARVRYYRDYCS  263

Query  824  QLGVDPGNNLEC  859
            QLGV P NNL C
Sbjct  264  QLGVAPENNLTC  275



>dbj|BAF98919.1| class IV chitinase [Nepenthes alata]
Length=277

 Score =   348 bits (893),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 169/252 (67%), Positives = 193/252 (77%), Gaps = 7/252 (3%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCA  LCCS+WGYCGTGD YCG GC+EGPCY      S    VADIV+D+FF+GI +
Sbjct  30   QNCGCAANLCCSKWGYCGTGDAYCGPGCQEGPCYSSGGGGSS---VADIVTDSFFDGIIN  86

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA SSC GK FY+R++FLDA++SYP FGT   AD +K+EIAAFFAHVTHETGH CYI+EI
Sbjct  87   QASSSCAGKYFYSRSAFLDALDSYPAFGTSSDADTNKQEIAAFFAHVTHETGHFCYIEEI  146

Query  473  DGES---RDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVAT  643
             G S     YCD +  Q+PC P   YYGRGPIQ+SWN+NYGPAGQ+IGFDGLN+P  VA 
Sbjct  147  GGPSLPTSAYCDPSAAQWPCNPNVGYYGRGPIQISWNYNYGPAGQAIGFDGLNSPQTVAN  206

Query  644  DPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQ  823
            DPIISFK+ALWFWM N HS+I SGQGFGATIRAIN  +EC+G NP  V  RV YY  YC 
Sbjct  207  DPIISFKSALWFWMKNVHSIIVSGQGFGATIRAIN-SMECNGGNPSAVDDRVGYYVAYCN  265

Query  824  QLGVDPGNNLEC  859
            Q GV PG NL C
Sbjct  266  QFGVSPGGNLYC  277



>ref|XP_011002656.1| PREDICTED: basic endochitinase CHB4-like [Populus euphratica]
Length=274

 Score =   347 bits (891),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 172/251 (69%), Positives = 199/251 (79%), Gaps = 5/251 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppspp--sgggsVADIVSDAFFNGI  286
            QNCGCA  LCCSQ+GYCGTG+ YCG GCK+GPC   P+P   SG GSVADIV+ AFFNGI
Sbjct  27   QNCGCAANLCCSQYGYCGTGNAYCGPGCKQGPCNSSPTPTTPSGSGSVADIVTPAFFNGI  86

Query  287  ADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIK  466
             ++A +SC GK FYTR +FL AVNSYPQFG +GSA+ SKREIAAFFAHVTHETGH CY +
Sbjct  87   INKAAASCAGKNFYTRNAFLSAVNSYPQFGKLGSAEASKREIAAFFAHVTHETGHFCYTE  146

Query  467  EIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATD  646
            EI+G S DYCD+ N +YPC PGK YYGRGP+QLSWN+NYGPAG+S  FDGLNNPD+VA D
Sbjct  147  EINGASGDYCDENNREYPCVPGKKYYGRGPLQLSWNYNYGPAGRSNNFDGLNNPDIVARD  206

Query  647  PIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQ  826
             ++SFKTALWFWMN    +++  QGFGATIRAING +EC+G N   V+ R  YY  YC Q
Sbjct  207  AVVSFKTALWFWMNRVRPVVS--QGFGATIRAING-IECNGGNSGAVQARGRYYRDYCSQ  263

Query  827  LGVDPGNNLEC  859
            LGV P NNL C
Sbjct  264  LGVAPENNLTC  274



>gb|ACJ24349.1| chitinase class IVa [Oryza grandiglumis]
Length=288

 Score =   348 bits (892),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 168/261 (64%), Positives = 192/261 (74%), Gaps = 14/261 (5%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgg------------gsVAD  256
            QNCGC   +CCS+WGYCGTG DYCGEGC+ GPCY       GG             S+  
Sbjct  30   QNCGCQPNMCCSKWGYCGTGKDYCGEGCRSGPCYGGGGGGGGGGGGGGGGGGGSGVSLES  89

Query  257  IVSDAFFNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVT  436
            +V++AFFNGI +QA + C GK FYTR SFL+A  SY  F    + DDSKREIAAFFAHVT
Sbjct  90   VVTEAFFNGIKNQAPNGCAGKNFYTRQSFLNAARSYSGFARDRTNDDSKREIAAFFAHVT  149

Query  437  HETGHMCYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDG  616
            HETGHMCYI EI+G S DYCD+ N Q+PC PGK YYGRGP+Q+SWN+NYGPAGQ+IGFDG
Sbjct  150  HETGHMCYINEINGASMDYCDRNNKQWPCQPGKKYYGRGPLQISWNYNYGPAGQNIGFDG  209

Query  617  LNNPDVVATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKR  796
            L +PD VA DP ISFKTALWFWMNN H +++  QGFGATIRAING LEC+G NP  V  R
Sbjct  210  LRDPDRVAQDPTISFKTALWFWMNNVHQVVS--QGFGATIRAINGALECNGKNPGAVNAR  267

Query  797  VEYYTQYCQQLGVDPGNNLEC  859
            V YY  YC+Q GVDPG NL C
Sbjct  268  VNYYKDYCRQFGVDPGGNLYC  288



>ref|XP_002326040.2| hypothetical protein POPTR_0019s12360g [Populus trichocarpa]
 gb|EEF00422.2| hypothetical protein POPTR_0019s12360g [Populus trichocarpa]
Length=275

 Score =   347 bits (890),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 164/249 (66%), Positives = 196/249 (79%), Gaps = 3/249 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCA  LCCSQ+G+CGTGD YCG+GC+EGPC  P +P +   +VAD+V+  FFNGI +
Sbjct  30   QNCGCAPNLCCSQFGFCGTGDAYCGQGCREGPC-TPSTPSNNDVTVADVVTPEFFNGIIN  88

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA   C GK FYTR +FL A+NSY QFG +GS DDSKREIAAFFAHVTHETGH CYI+EI
Sbjct  89   QAGGDCAGKSFYTRDAFLSALNSYSQFGKIGSNDDSKREIAAFFAHVTHETGHFCYIEEI  148

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G S DYCD+TNTQYPC P K Y+GRGP+QL+WN+NYG AG +  FDGLN+P+ VA DP+
Sbjct  149  NGASHDYCDETNTQYPCNPNKNYFGRGPLQLTWNYNYGAAGGANNFDGLNSPETVANDPV  208

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            +SFKTALWFWM N   ++T  QGFGATIRAING +EC+G N   V+ R+ YYT YC Q G
Sbjct  209  VSFKTALWFWMTNVRPVVT--QGFGATIRAINGAVECNGGNSGAVQARIGYYTDYCNQFG  266

Query  833  VDPGNNLEC  859
            V PG+NL C
Sbjct  267  VAPGDNLSC  275



>ref|NP_001053186.1| Os04g0494100 [Oryza sativa Japonica Group]
 sp|Q7Y1Z0.1|CHI5_ORYSJ RecName: Full=Chitinase 5; AltName: Full=Class IV chitinase a; 
Short=OsChia4a; AltName: Full=Pathogenesis related (PR)-3 
chitinase 5; Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAC76691.1| chitinase [Oryza sativa Japonica Group]
 emb|CAE01675.2| OSJNBb0091E11.12 [Oryza sativa Japonica Group]
 dbj|BAF15100.1| Os04g0494100 [Oryza sativa Japonica Group]
 emb|CAH67288.1| OSIGBa0103O01.6 [Oryza sativa Indica Group]
 dbj|BAG92259.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96537.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96672.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC77552.1| hypothetical protein OsI_16469 [Oryza sativa Indica Group]
 gb|EEE61251.1| hypothetical protein OsJ_15308 [Oryza sativa Japonica Group]
Length=288

 Score =   347 bits (891),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 169/261 (65%), Positives = 192/261 (74%), Gaps = 14/261 (5%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgg------------gsVAD  256
            QNCGC   +CCS+WGYCGTG DYCG+GC+ GPCY       GG             SV  
Sbjct  30   QNCGCQSNMCCSKWGYCGTGKDYCGDGCRSGPCYGGGGGGGGGGGGGGGGGGGSGVSVES  89

Query  257  IVSDAFFNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVT  436
            +V++AFFNGI +QA + C GK FYTR SFL+A +SY  F    + DDSKREIAAFFAHVT
Sbjct  90   VVTEAFFNGIKNQAPNGCAGKNFYTRQSFLNAAHSYSGFARDRTNDDSKREIAAFFAHVT  149

Query  437  HETGHMCYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDG  616
            HETGHMCYI EI+G S DYCDK N Q+PC PGK YYGRGP+Q+SWN+NYGPAGQ+IGFDG
Sbjct  150  HETGHMCYINEINGASMDYCDKNNKQWPCQPGKKYYGRGPLQISWNYNYGPAGQNIGFDG  209

Query  617  LNNPDVVATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKR  796
            L +PD VA DP ISFKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  V  R
Sbjct  210  LRDPDRVAQDPTISFKTALWFWMNNVHQVML--QGFGATIRAINGALECNGKNPGAVNAR  267

Query  797  VEYYTQYCQQLGVDPGNNLEC  859
            V YY  YC+Q GVDPG NL C
Sbjct  268  VNYYKDYCRQFGVDPGGNLYC  288



>gb|ABY66957.1| class IV chitinase [Vitis pseudoreticulata]
Length=261

 Score =   346 bits (888),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 166/249 (67%), Positives = 195/249 (78%), Gaps = 8/249 (3%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCA  LCCS++GYCGTG +YCG+GC+ GPC       S G SV+DIV+ AFF+GI +
Sbjct  21   QNCGCASDLCCSKYGYCGTGSEYCGDGCQSGPC------DSSGSSVSDIVTQAFFDGIIN  74

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA SSC GK FYTR +FL A+NSY  FG  GS D +KREIAAFFAHVTHETGH CYI+EI
Sbjct  75   QAASSCAGKNFYTRAAFLSALNSYSGFGNDGSTDANKREIAAFFAHVTHETGHFCYIEEI  134

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G S +YCD +NTQ PC  G+ YYGRGP+QL+WN+NYG AG SIGF+GL+NP +VATD +
Sbjct  135  NGASHNYCDSSNTQDPCVSGQNYYGRGPLQLTWNYNYGAAGNSIGFNGLSNPGIVATDVV  194

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
             SFKTALWFWMNN HS+I  GQGFGATIRAING +EC+G N   V  RV+YY  YC QLG
Sbjct  195  TSFKTALWFWMNNVHSVI--GQGFGATIRAINGAVECNGGNTAAVNARVQYYKDYCSQLG  252

Query  833  VDPGNNLEC  859
            V PG+NL C
Sbjct  253  VSPGDNLTC  261



>ref|XP_002275534.1| PREDICTED: chitinase 5 [Vitis vinifera]
 emb|CAN62562.1| hypothetical protein VITISV_033131 [Vitis vinifera]
Length=269

 Score =   346 bits (888),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 170/251 (68%), Positives = 193/251 (77%), Gaps = 4/251 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggs--VADIVSDAFFNGI  286
            QNCGCA   CCS++GYCGTG+DYCG  C+ GPCY      S GG   VADIV+ AFF+GI
Sbjct  21   QNCGCASDQCCSKYGYCGTGNDYCGNTCQSGPCYSSGGNGSSGGGSSVADIVTQAFFDGI  80

Query  287  ADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIK  466
             +QA SSC GK FYTR +FL+A NSY QFG  GSA+ +KREIAAFFAHVT ETGH CYI+
Sbjct  81   INQAASSCAGKNFYTRAAFLNASNSYSQFGNDGSANGTKREIAAFFAHVTQETGHFCYIE  140

Query  467  EIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATD  646
            EIDG S DYCD  NTQYPC  G+ YYGRGP+QL+WN+NYG AG SIGFDGL NP +VATD
Sbjct  141  EIDGASHDYCDSNNTQYPCVAGQKYYGRGPLQLTWNYNYGAAGNSIGFDGLGNPGIVATD  200

Query  647  PIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQ  826
             +ISFKTALWFWMNN HS++   QGFGATIRAING +EC+G N   V  RV YY  YC Q
Sbjct  201  VLISFKTALWFWMNNVHSVLD--QGFGATIRAINGAVECNGGNTPAVNARVGYYEDYCSQ  258

Query  827  LGVDPGNNLEC  859
            LGV PG+NL C
Sbjct  259  LGVSPGDNLTC  269



>ref|XP_007150477.1| hypothetical protein PHAVU_005G155800g [Phaseolus vulgaris]
 gb|ESW22471.1| hypothetical protein PHAVU_005G155800g [Phaseolus vulgaris]
Length=271

 Score =   346 bits (888),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 170/250 (68%), Positives = 196/250 (78%), Gaps = 3/250 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCAEGLCCSQ+GYCGTG+DYCG GC++GPC     PPS   +VADIV+  FFNGI D
Sbjct  24   QNCGCAEGLCCSQYGYCGTGEDYCGTGCQQGPCTTASPPPSNNVNVADIVTADFFNGIID  83

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QADS C GK FYTR +FL A+NSY  FG VGS DDSKREIAA FAH THETGH CYI+EI
Sbjct  84   QADSGCAGKNFYTRDAFLSALNSYTDFGRVGSEDDSKREIAAAFAHFTHETGHFCYIEEI  143

Query  473  DGESRDYCDKTN-TQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDP  649
            DG S+DYCD+ +  QYPC+  K Y+GRGPIQLSWNFNYGPAG +  FDGL  P+ V+ D 
Sbjct  144  DGASKDYCDEESIAQYPCSSSKGYHGRGPIQLSWNFNYGPAGSANNFDGLGAPETVSNDV  203

Query  650  IISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQL  829
            ++SFKTALW+WM +   +I   QGF ATIRAING LECDGANP TV+ RV YYT+YC+QL
Sbjct  204  VVSFKTALWYWMQHVRPVIN--QGFSATIRAINGALECDGANPTTVQARVNYYTEYCRQL  261

Query  830  GVDPGNNLEC  859
            GV  G+NL C
Sbjct  262  GVATGDNLTC  271



>ref|NP_001150754.1| endochitinase PR4 precursor [Zea mays]
 gb|ACG40233.1| endochitinase PR4 precursor [Zea mays]
 gb|ACN27752.1| unknown [Zea mays]
 gb|AFW72233.1| endochitinase PR4 [Zea mays]
Length=271

 Score =   345 bits (886),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 162/249 (65%), Positives = 190/249 (76%), Gaps = 3/249 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCA GLCCS++GYCGTG+DYCG GC+ GPC     P +   SVA IV+ AFF+ +  
Sbjct  26   QNCGCASGLCCSRFGYCGTGEDYCGAGCQSGPC---DVPETNNASVASIVTPAFFDALLA  82

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA +SCE  GFYTR +FL A   YP FG  G+ DDSKREIAAFF +  HET   CYI EI
Sbjct  83   QAAASCEANGFYTRDAFLAAAGYYPAFGRTGTVDDSKREIAAFFGNANHETIKFCYINEI  142

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            DG S++YCD+ NTQ+PC  GK YYGRGP+Q+SWNFNYGPAGQSIGFDGL +PD VA   +
Sbjct  143  DGPSKNYCDRNNTQWPCQAGKGYYGRGPLQISWNFNYGPAGQSIGFDGLGDPDAVARSAV  202

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ++F++ALW+WMNN H  I SGQGFGATIRAING LECDG NP++V  RV YY Q+CQ  G
Sbjct  203  LAFRSALWYWMNNVHGAIVSGQGFGATIRAINGALECDGKNPNSVNNRVAYYKQFCQDFG  262

Query  833  VDPGNNLEC  859
            VDPGNNL C
Sbjct  263  VDPGNNLTC  271



>gb|ACU23323.1| unknown [Glycine max]
Length=274

 Score =   345 bits (886),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 169/250 (68%), Positives = 197/250 (79%), Gaps = 4/250 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCAEGLCCSQ GYCG G++YCG GCK+GPCY   +P +    VADIV+  FF+GI D
Sbjct  28   QNCGCAEGLCCSQHGYCGNGEEYCGTGCKQGPCY-SSTPSTNNVIVADIVTPQFFSGIID  86

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QADS C GK FY+R +FL+A+NSY  FG +GS DDSKREIAA FAH THETGH C+I+EI
Sbjct  87   QADSGCAGKNFYSRDAFLNALNSYNDFGRLGSQDDSKREIAAAFAHFTHETGHFCHIEEI  146

Query  473  DGESRDYCDK-TNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDP  649
            +G S+DYCD+ T +QYPC   + YYGRGPIQL+WNFNYGPAGQS  FDGLN P+ V  DP
Sbjct  147  NGASQDYCDENTISQYPCLSNRGYYGRGPIQLTWNFNYGPAGQSNDFDGLNAPETVGNDP  206

Query  650  IISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQL  829
            +ISFKTALW+WM +   +I   QGFGATIRAINGQLECDGANP TV+ RV YYT YC+Q 
Sbjct  207  VISFKTALWYWMQHVRPVIN--QGFGATIRAINGQLECDGANPSTVQARVNYYTDYCRQF  264

Query  830  GVDPGNNLEC  859
            GV  G+NL C
Sbjct  265  GVATGDNLTC  274



>gb|KHN30080.1| Endochitinase PR4 [Glycine soja]
Length=274

 Score =   345 bits (885),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 169/250 (68%), Positives = 198/250 (79%), Gaps = 4/250 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCAEGLCCSQ GYCG G++YCG GCK+GPCY   +P +   +VADIV+  FF+GI D
Sbjct  28   QNCGCAEGLCCSQHGYCGNGEEYCGTGCKQGPCY-SSTPSTNNVNVADIVTPQFFSGIID  86

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QADS C GK FY+R +FL+A+NSY  FG +GS DDSKREIAA FAH THETGH C+I+EI
Sbjct  87   QADSGCAGKNFYSRDAFLNALNSYNDFGRLGSEDDSKREIAAAFAHFTHETGHFCHIEEI  146

Query  473  DGESRDYCDK-TNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDP  649
            +G S+DYCD+ T +QYPC   + YYGRGPIQL+WNFNYGPAGQS  FDGLN P+ V  DP
Sbjct  147  NGASQDYCDENTISQYPCLSNRGYYGRGPIQLTWNFNYGPAGQSNDFDGLNAPETVGNDP  206

Query  650  IISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQL  829
            +ISFKTALW+WM +   +I   QGFGATIRAINGQLECDGANP TV+ RV YYT YC+Q 
Sbjct  207  VISFKTALWYWMQHVRPVIN--QGFGATIRAINGQLECDGANPSTVQARVNYYTDYCRQF  264

Query  830  GVDPGNNLEC  859
            GV  G+NL C
Sbjct  265  GVATGDNLTC  274



>ref|XP_003543578.1| PREDICTED: endochitinase PR4-like [Glycine max]
Length=274

 Score =   345 bits (885),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 169/250 (68%), Positives = 198/250 (79%), Gaps = 4/250 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCAEGLCCSQ GYCG G++YCG GCK+GPCY   +P +   +VADIV+  FF+GI D
Sbjct  28   QNCGCAEGLCCSQHGYCGNGEEYCGTGCKQGPCY-SSTPSTNNVNVADIVTPQFFSGIID  86

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QADS C GK FY+R +FL+A+NSY  FG +GS DDSKREIAA FAH THETGH C+I+EI
Sbjct  87   QADSGCAGKNFYSRDAFLNALNSYNDFGRLGSQDDSKREIAAAFAHFTHETGHFCHIEEI  146

Query  473  DGESRDYCDK-TNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDP  649
            +G S+DYCD+ T +QYPC   + YYGRGPIQL+WNFNYGPAGQS  FDGLN P+ V  DP
Sbjct  147  NGASQDYCDENTISQYPCLSNRGYYGRGPIQLTWNFNYGPAGQSNDFDGLNAPETVGNDP  206

Query  650  IISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQL  829
            +ISFKTALW+WM +   +I   QGFGATIRAINGQLECDGANP TV+ RV YYT YC+Q 
Sbjct  207  VISFKTALWYWMQHVRPVIN--QGFGATIRAINGQLECDGANPSTVQARVNYYTDYCRQF  264

Query  830  GVDPGNNLEC  859
            GV  G+NL C
Sbjct  265  GVATGDNLTC  274



>ref|XP_006648823.1| PREDICTED: chitinase 6-like [Oryza brachyantha]
Length=276

 Score =   345 bits (884),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 165/251 (66%), Positives = 186/251 (74%), Gaps = 5/251 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCA   CCS+WGYCGTG DYCG GC+ GPC     P +   SVA IV+  FF  +  
Sbjct  29   QNCGCAADRCCSKWGYCGTGKDYCGTGCQSGPC---DVPATNSVSVASIVTPEFFAALVA  85

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA   C  KGFYTR +FL A   YP FG  GS DDSKREIAAFFAH  HET   CYI+EI
Sbjct  86   QAADGCAAKGFYTRDAFLSAAGGYPSFGRTGSDDDSKREIAAFFAHANHETIKFCYIEEI  145

Query  473  DGESRDYCDKTNT--QYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATD  646
            DG S++YCD+T+T  Q+PCA GK YYGRGP+Q+SWNFNYGPAGQSIGFDGL +PD VA  
Sbjct  146  DGASKNYCDETSTHTQWPCAAGKGYYGRGPLQISWNFNYGPAGQSIGFDGLGDPDAVARS  205

Query  647  PIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQ  826
            P+++F+TALW+W NN H  I SGQGFGATIRAING LECDG NP  V  RV YY Q CQQ
Sbjct  206  PVLAFQTALWYWANNVHDAIVSGQGFGATIRAINGALECDGKNPAAVNSRVAYYQQLCQQ  265

Query  827  LGVDPGNNLEC  859
            LGVDPG+NL C
Sbjct  266  LGVDPGSNLTC  276



>ref|NP_001239790.1| uncharacterized protein LOC100778526 precursor [Glycine max]
 gb|ACU17801.1| unknown [Glycine max]
 gb|KHN25322.1| Endochitinase PR4 [Glycine soja]
Length=280

 Score =   345 bits (884),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 165/249 (66%), Positives = 195/249 (78%), Gaps = 3/249 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC   LCCS++GYCG+GDDYCG+GCKEGPCY   + P+   SVADIV+  FFN I D
Sbjct  35   QNCGCEAELCCSKYGYCGSGDDYCGKGCKEGPCY-GTATPNDDVSVADIVTSEFFNAIID  93

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA+  C GK FY+R +FLDA+ +Y QF   GS DDSKREIAA FAH T+++ H CYI+EI
Sbjct  94   QAEDHCAGKNFYSRDAFLDALIAYDQFAKTGSVDDSKREIAAAFAHFTYQSRHFCYIEEI  153

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G S+DYCDKTN  YPCA  K YYGRGPIQLSWNFNYGPAG++ GFDGLN P+ VA+DP+
Sbjct  154  EGASKDYCDKTNRHYPCAHNKGYYGRGPIQLSWNFNYGPAGENNGFDGLNAPETVASDPV  213

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALW+W  N   ++    GFGATIRAING LECDGANP+TV+ RV YYT+YC QL 
Sbjct  214  ISFKTALWYWTQNVSPVMK--HGFGATIRAINGHLECDGANPETVQARVNYYTEYCSQLD  271

Query  833  VDPGNNLEC  859
            V PG+NL C
Sbjct  272  VAPGDNLTC  280



>gb|EPS66639.1| hypothetical protein M569_08138, partial [Genlisea aurea]
Length=271

 Score =   345 bits (884),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 168/249 (67%), Positives = 197/249 (79%), Gaps = 2/249 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCA G CCSQ+GYCGT   YCG  C+ GPCY       GG  V+ IVSD FFNGI +
Sbjct  25   QNCGCAAGYCCSQYGYCGTTAPYCGTNCRSGPCYSGGGSGGGG--VSGIVSDGFFNGIIN  82

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
             A   C GKGFYTR++FL AV +Y  FGT GS+DD+KREIAAFFA+V HETG +CY +E 
Sbjct  83   NAGGGCPGKGFYTRSAFLQAVGAYQGFGTTGSSDDAKREIAAFFANVAHETGSLCYTEES  142

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G S++YCD++ TQ+PC P K YYGRGP+QLSWN+NYG AGQSIGFDGLNNPD+VA DP+
Sbjct  143  NGPSKNYCDRSFTQWPCNPNKGYYGRGPLQLSWNYNYGSAGQSIGFDGLNNPDIVAQDPV  202

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            I++KTALW+WMNNCH LITSGQGFG+TIRAING +EC+G NP TV  RV YYT +C QLG
Sbjct  203  ITWKTALWYWMNNCHGLITSGQGFGSTIRAINGAIECNGGNPATVTSRVNYYTSFCGQLG  262

Query  833  VDPGNNLEC  859
            VDPG NL C
Sbjct  263  VDPGPNLRC  271



>ref|XP_004976077.1| PREDICTED: endochitinase A-like [Setaria italica]
Length=272

 Score =   344 bits (883),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 165/249 (66%), Positives = 195/249 (78%), Gaps = 4/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC    CCSQ+GYCGT + YCG+GC+ GPC+   S    G +VA++V+DAFFNGI +
Sbjct  28   QNCGCQSDYCCSQFGYCGTTEPYCGKGCRSGPCW-GSSTGGSGANVANVVTDAFFNGIKN  86

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA + CEGK FYTR++FL+AVNSY  F   GS  + KREIAAFFAHVTHETGH CYI EI
Sbjct  87   QAGAGCEGKNFYTRSAFLNAVNSYSGFARGGSEVEGKREIAAFFAHVTHETGHFCYISEI  146

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            + ++  YCD  N Q+PC PGK YYGRGP+Q+SWN+NYGPAG+ IGFDGL NPD VA DP+
Sbjct  147  N-KNDAYCDANNRQWPCVPGKKYYGRGPLQISWNYNYGPAGRDIGFDGLGNPDRVAQDPV  205

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NPD +  RV YY QYC+QLG
Sbjct  206  IAFKTALWFWMNNVHQVMP--QGFGATIRAINGALECNGRNPDQMNARVRYYRQYCKQLG  263

Query  833  VDPGNNLEC  859
            VDPGNNL C
Sbjct  264  VDPGNNLTC  272



>ref|XP_003575320.1| PREDICTED: chitinase 6-like [Brachypodium distachyon]
Length=270

 Score =   344 bits (882),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/249 (65%), Positives = 187/249 (75%), Gaps = 3/249 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCA G CCS+WGYCGT  +YCG GC+ G C     P +   SVA IV+ AFF  +  
Sbjct  25   QNCGCASGECCSRWGYCGTTKEYCGTGCRSGSC---EVPVTNDASVAGIVTPAFFGALVA  81

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA  SCE KGFYTR +FL A   YP FG  GS DDSKREIAA FAHV HET   CYI EI
Sbjct  82   QAADSCEAKGFYTRDAFLSAAAGYPAFGRTGSLDDSKREIAALFAHVNHETIKFCYINEI  141

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G S++YCD T+TQYPCA GK YYGRGP+Q+SWN+NYG AGQS+GFDGLN+PD VA  P+
Sbjct  142  NGPSKNYCDPTSTQYPCAAGKGYYGRGPLQISWNYNYGAAGQSLGFDGLNDPDAVARSPV  201

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ++F+ ALWFWMN+ H  I SGQGFGATIRAING LEC+G NP+ V  RV YY Q+CQQ G
Sbjct  202  LAFQAALWFWMNSVHEAIVSGQGFGATIRAINGALECNGKNPNAVNNRVAYYEQFCQQFG  261

Query  833  VDPGNNLEC  859
            VDPG+NL C
Sbjct  262  VDPGSNLTC  270



>ref|XP_011002657.1| PREDICTED: endochitinase PR4-like [Populus euphratica]
Length=280

 Score =   344 bits (882),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 164/253 (65%), Positives = 197/253 (78%), Gaps = 6/253 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsggg----sVADIVSDAFFN  280
            QNCGCA  LCCSQ+G+CGTGD YCG+GC+EGPC   PS PS       +VAD+V+  FFN
Sbjct  30   QNCGCAPNLCCSQFGFCGTGDAYCGQGCQEGPCTSAPSTPSTPSNNDVTVADVVTPEFFN  89

Query  281  GIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCY  460
            GI +QA   C GK FYTR +FL+A+NSY QFG +GS DDSKREIAAFFAHVTHETGH CY
Sbjct  90   GIINQAGGDCAGKSFYTRDAFLNALNSYSQFGKIGSNDDSKREIAAFFAHVTHETGHFCY  149

Query  461  IKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVA  640
            I+EI+G S+DYCD+T TQYPC P K Y+GRGP+QL+WN+NYG AG +  FDGLN+P+ VA
Sbjct  150  IEEINGASQDYCDETKTQYPCNPNKKYFGRGPLQLTWNYNYGAAGGANNFDGLNSPETVA  209

Query  641  TDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYC  820
             DP++SFKTALWFWM N   ++T  QGFGATIRAING +EC+G N   V+ R+ YYT YC
Sbjct  210  NDPVVSFKTALWFWMTNVRPVVT--QGFGATIRAINGAVECNGGNSGAVQARIGYYTDYC  267

Query  821  QQLGVDPGNNLEC  859
             + GV PG+NL C
Sbjct  268  NKFGVAPGDNLSC  280



>gb|ABJ74186.1| chitinase-like protein [Artemisia annua]
Length=217

 Score =   341 bits (875),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 166/220 (75%), Positives = 185/220 (84%), Gaps = 3/220 (1%)
 Frame = +2

Query  200  EGPCYHppsppsgggsVADIVSDAFFNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGT  379
            +GPC+    PP+   SV  IV+DAFFNGI DQ+D+SCEG+ FYTR +FL+A+ +Y QFG 
Sbjct  1    QGPCF--SPPPTNDVSVESIVTDAFFNGIKDQSDASCEGRDFYTRAAFLEALGNYQQFGR  58

Query  380  VGSADDSKREIAAFFAHVTHETGHMCYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPI  559
            VGS DDSKREIAAFFAHVTHETGH CYI+EI+G SRDYCD+ NTQYPC P K YYGRGPI
Sbjct  59   VGSEDDSKREIAAFFAHVTHETGHFCYIEEINGPSRDYCDENNTQYPCNPNKGYYGRGPI  118

Query  560  QLSWNFNYGPAGQSIGFDGLNNPDVVATDPIISFKTALWFWMNNCHSLITSGQGFGATIR  739
            QLSWNFNYGPAG SIGFDGLNNP+ VATDPIISF+TALWFWMNN HS+I SGQGFGATIR
Sbjct  119  QLSWNFNYGPAGSSIGFDGLNNPETVATDPIISFRTALWFWMNNVHSVILSGQGFGATIR  178

Query  740  AINGQLECDGANPDTVRKRVEYYTQYCQQLGVDPGNNLEC  859
            AING +ECDG NPDTV  RV YY QYC QLGV PG+NL C
Sbjct  179  AING-MECDGGNPDTVTARVRYYNQYCSQLGVAPGDNLRC  217



>gb|AGS80333.1| chitinase protein [Actinidia eriantha]
Length=279

 Score =   343 bits (880),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 158/249 (63%), Positives = 190/249 (76%), Gaps = 5/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            Q CGCA GLCCSQ+GYC TG++YCG GC+ GPC       S G  VA+IV+ AFFN I +
Sbjct  30   QRCGCAAGLCCSQYGYCNTGNEYCGTGCQSGPC-----TGSNGVVVANIVTQAFFNSIIN  84

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA + C GK FYTR++FL+A++ +  FGT+G+ DDSKREIAAFFAH +HETG +C I+E 
Sbjct  85   QASAGCVGKSFYTRSAFLNALSLFTAFGTIGTVDDSKREIAAFFAHASHETGSLCKIEED  144

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
             G S+DYCD+T T YPCAP K YYGRGP+QLSWN+NYG AG  +GF+GLNNP++VA D  
Sbjct  145  GGASKDYCDETRTDYPCAPNKNYYGRGPLQLSWNYNYGAAGDFLGFNGLNNPEIVANDSF  204

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            +SFK ALWFWM N HSL+T+GQGFGATIRAING +ECD   PD V  RV  Y  +C QLG
Sbjct  205  VSFKAALWFWMRNVHSLMTTGQGFGATIRAINGAIECDNKRPDLVTARVNLYKNFCSQLG  264

Query  833  VDPGNNLEC  859
            V PGNNL C
Sbjct  265  VAPGNNLRC  273



>gb|AET25429.1| class IV chitinase [Actinidia chinensis]
Length=276

 Score =   343 bits (880),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 157/249 (63%), Positives = 194/249 (78%), Gaps = 5/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            Q CGCA GLCCSQ+G+C TG+D+CG GC+ GPC       S G +VA+IV+ AFF+GI +
Sbjct  30   QRCGCAAGLCCSQFGFCNTGNDFCGTGCQSGPC-----TGSNGVAVANIVTQAFFDGIIN  84

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA + C GK FYTR++FL+ ++ +  FGT+G+ DDSKREIAAFFAH +HETG  C I+E 
Sbjct  85   QAPAGCVGKTFYTRSAFLNTLSLFTAFGTIGTVDDSKREIAAFFAHASHETGSFCKIEED  144

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
             G S+DYCD+T T YPCAP K YYGRGP+QLSWN+NYG AG  +GF+GLNNP++VATD +
Sbjct  145  GGASKDYCDETRTDYPCAPNKNYYGRGPLQLSWNYNYGAAGDFLGFNGLNNPEIVATDSL  204

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            +SFK A+WFWM N HS++T+GQGFGATIRAING +ECDG  PD V  RV  YT +C QLG
Sbjct  205  VSFKAAMWFWMRNVHSVMTTGQGFGATIRAINGNIECDGKRPDLVTARVNLYTNFCSQLG  264

Query  833  VDPGNNLEC  859
            V PGNNL C
Sbjct  265  VAPGNNLRC  273



>emb|CAN79256.1| hypothetical protein VITISV_009139 [Vitis vinifera]
Length=266

 Score =   342 bits (878),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 166/249 (67%), Positives = 197/249 (79%), Gaps = 7/249 (3%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNC C  GLCCSQ+GYCGTG+D+CG GC+ GPCY      S    V+D+V++ FFNGI  
Sbjct  25   QNCRCDAGLCCSQYGYCGTGNDFCGTGCQAGPCYSSGGSVS----VSDVVTEDFFNGIIS  80

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA  SC GK FY+R +FL+A +SYPQFG  GSADDSKREIAAFFAHV HETGH CYI+EI
Sbjct  81   QAAGSCAGKNFYSRNAFLNAASSYPQFGQDGSADDSKREIAAFFAHVAHETGHFCYIEEI  140

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            DG S+DYCD++NT+YPC PGK YYGRGPIQLSWN+NYGPAG+SIGF+GLNNP+ VA D +
Sbjct  141  DGPSKDYCDESNTRYPCVPGKGYYGRGPIQLSWNYNYGPAGESIGFNGLNNPETVANDAV  200

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            +SFKTALWFWMNN HS+++  QGFGATIRAIN  +EC+G N   V  RV Y+  YC Q G
Sbjct  201  VSFKTALWFWMNNVHSVVS--QGFGATIRAIN-SMECNGGNSGAVNARVGYFRDYCNQFG  257

Query  833  VDPGNNLEC  859
            V PG+N+ C
Sbjct  258  VSPGDNISC  266



>sp|O04138.2|CHI4_ORYSJ RecName: Full=Chitinase 4; AltName: Full=OsChia2b; AltName: Full=Pathogenesis 
related (PR)-3 chitinase 4; Flags: Precursor 
[Oryza sativa Japonica Group]
 emb|CAD41540.2| OSJNBb0091E11.8 [Oryza sativa Japonica Group]
 emb|CAH67741.1| H0522A01.12 [Oryza sativa Indica Group]
 emb|CAH67285.1| OSIGBa0103O01.3 [Oryza sativa Indica Group]
Length=285

 Score =   342 bits (878),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 165/260 (63%), Positives = 192/260 (74%), Gaps = 13/260 (5%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgg-----------gsVADI  259
            QNCGC +G CCSQWGYCGT + YCG+GC+ GPC+      + G            SV  +
Sbjct  28   QNCGCQDGYCCSQWGYCGTTEAYCGQGCQSGPCWGSGGEAAAGMAGRKAGAGAGVSVESV  87

Query  260  VSDAFFNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTH  439
            V++AFFNGI +QA + C GK FYTR SFL+A  SY  F    + DDSKREIAAFFAHVTH
Sbjct  88   VTEAFFNGIKNQAPNGCAGKSFYTRQSFLNAARSYSGFANDRTNDDSKREIAAFFAHVTH  147

Query  440  ETGHMCYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGL  619
            ETGHMCYI EI+G + DYCDK+N Q+PC PGK YYGRGP+Q+SWNFNYGPAG++IGFDGL
Sbjct  148  ETGHMCYINEINGANMDYCDKSNKQWPCQPGKKYYGRGPLQISWNFNYGPAGKNIGFDGL  207

Query  620  NNPDVVATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRV  799
             +PD VA DP ISFKTALWFWMNN H +++  QGFGATIRAING LEC+G NP  V  RV
Sbjct  208  RDPDKVAQDPTISFKTALWFWMNNVHQVMS--QGFGATIRAINGALECNGKNPGAVNARV  265

Query  800  EYYTQYCQQLGVDPGNNLEC  859
             YY  YC+Q GV PG NL C
Sbjct  266  NYYKDYCRQFGVSPGGNLYC  285



>ref|NP_001047373.1| Os02g0605900 [Oryza sativa Japonica Group]
 sp|Q6K8R2.1|CHI6_ORYSJ RecName: Full=Chitinase 6; AltName: Full=Pathogenesis related 
(PR)-3 chitinase 6; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAD19330.1| putative class IV chitinase (CHIV) [Oryza sativa Japonica Group]
 dbj|BAF09287.1| Os02g0605900 [Oryza sativa Japonica Group]
 gb|EAY86609.1| hypothetical protein OsI_07990 [Oryza sativa Indica Group]
 gb|EAZ23743.1| hypothetical protein OsJ_07447 [Oryza sativa Japonica Group]
Length=271

 Score =   342 bits (876),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/249 (65%), Positives = 185/249 (74%), Gaps = 3/249 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            Q+CGCA   CCS+WG+CGTG DYCG GC+ GPC     P +   SVA IV+  FF  +  
Sbjct  26   QSCGCASDQCCSKWGFCGTGSDYCGTGCQAGPC---DVPATNDVSVASIVTPEFFAALVA  82

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QAD  C  KGFYTR +FL A   YP FG  GS DDSKREIAAFFAH  HET   CYI+EI
Sbjct  83   QADDGCAAKGFYTRDAFLTAAGGYPSFGRTGSVDDSKREIAAFFAHANHETIKFCYIEEI  142

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            DG S++YCD+T+TQ+PC  GK YYGRGP+Q+SWNFNYGPAGQSIGFDGL +PD VA  P+
Sbjct  143  DGPSKNYCDETSTQWPCMAGKGYYGRGPLQISWNFNYGPAGQSIGFDGLGDPDAVARSPV  202

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ++F+TALW+W NN H    SGQGFGATIRAING LECDG NP  V  RV YY Q+CQQ G
Sbjct  203  LAFQTALWYWTNNVHDAFVSGQGFGATIRAINGALECDGKNPTAVSNRVAYYQQFCQQFG  262

Query  833  VDPGNNLEC  859
            VDPG+NL C
Sbjct  263  VDPGSNLTC  271



>gb|ABY66958.1| class IV chitinase [Vitis pseudoreticulata]
Length=264

 Score =   342 bits (876),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 168/249 (67%), Positives = 196/249 (79%), Gaps = 5/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCA GLCCS++GYCGTG DYCG+GC+ GP     S    G SV+DIVS +FF+GI +
Sbjct  21   QNCGCASGLCCSKYGYCGTGSDYCGDGCQSGP---CDSSSGSGSSVSDIVSQSFFDGIIN  77

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA SSC GK FYTR +FL A+NSY  FG  GS D +KREIAAFFAHVTHETGH CYI+EI
Sbjct  78   QAASSCAGKNFYTRAAFLSALNSYSGFGNDGSTDANKREIAAFFAHVTHETGHFCYIEEI  137

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G S +YCD +NTQYPC  G+ YYGRGP+QL+WN+NYG AG SIGF+GL+NP +VATD +
Sbjct  138  NGASHNYCDSSNTQYPCVSGQNYYGRGPLQLTWNYNYGAAGNSIGFNGLSNPGIVATDVV  197

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
             SFKTALWFWMNN HS+I  GQGFGATIRAING +EC+G N   V  RV+YY  YC QLG
Sbjct  198  TSFKTALWFWMNNVHSVI--GQGFGATIRAINGAVECNGGNTAAVNARVQYYKDYCSQLG  255

Query  833  VDPGNNLEC  859
            V PG+NL C
Sbjct  256  VSPGDNLTC  264



>gb|KDP44262.1| hypothetical protein JCGZ_05729 [Jatropha curcas]
Length=286

 Score =   342 bits (876),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 165/260 (63%), Positives = 196/260 (75%), Gaps = 13/260 (5%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgg----------gsVADIV  262
            QNCGC   LCCSQ+GYCGTGD YCG+GC++GPCY       GG           SVAD+V
Sbjct  29   QNCGCGASLCCSQYGYCGTGDPYCGQGCQQGPCYGGGGNNGGGAGASNGSGVGVSVADLV  88

Query  263  SDAFFNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVG-SADDSKREIAAFFAHVTH  439
            +  FFN I  +   +C GK FY+R +F+ A+NS+PQFG +G S DDSKREIAAFFAHVTH
Sbjct  89   TSDFFNRITSRDSGNCAGKNFYSRDAFISALNSFPQFGKIGASVDDSKREIAAFFAHVTH  148

Query  440  ETGHMCYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGL  619
            ETGH CYI+EIDG S+DYCD++N QYPCA GK YYGRGPIQL+WNFNYG AGQS+ FDGL
Sbjct  149  ETGHFCYIEEIDGASKDYCDESNKQYPCAQGKKYYGRGPIQLTWNFNYGAAGQSLNFDGL  208

Query  620  NNPDVVATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRV  799
            N+P++VA DPI+SF+TALW WM+N    I+  QGFGATIRAING +EC+G NP +V+ RV
Sbjct  209  NSPEIVANDPIMSFRTALWLWMDNVRPAIS--QGFGATIRAINGAIECNGGNPSSVQARV  266

Query  800  EYYTQYCQQLGVDPGNNLEC  859
             YY  YC Q GV PG NL C
Sbjct  267  GYYNDYCNQFGVTPGGNLIC  286



>ref|NP_001268075.1| class IV chitinase precursor [Vitis vinifera]
 gb|AAQ10093.1| class IV chitinase [Vitis vinifera]
Length=264

 Score =   340 bits (873),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 167/249 (67%), Positives = 196/249 (79%), Gaps = 5/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCA GLCCS++GYCGTG DYCG+GC+ GP     S    G SV+DIV+ +FF+GI +
Sbjct  21   QNCGCASGLCCSKYGYCGTGSDYCGDGCQSGP---CDSSSGSGSSVSDIVTQSFFDGIIN  77

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA SSC GK FYTR +FL A+NSY  FG  GS D +KREIAAFFAHVTHETGH CYI+EI
Sbjct  78   QAASSCAGKNFYTRAAFLSALNSYSGFGNDGSTDANKREIAAFFAHVTHETGHFCYIEEI  137

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G S +YCD +NTQYPC  G+ YYGRGP+QL+WN+NYG AG SIGF+GL+NP +VATD +
Sbjct  138  NGASHNYCDSSNTQYPCVSGQNYYGRGPLQLTWNYNYGAAGNSIGFNGLSNPGIVATDVV  197

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
             SFKTALWFWMNN HS+I  GQGFGATIRAING +EC+G N   V  RV+YY  YC QLG
Sbjct  198  TSFKTALWFWMNNVHSVI--GQGFGATIRAINGAVECNGGNTAAVNARVQYYKDYCSQLG  255

Query  833  VDPGNNLEC  859
            V PG+NL C
Sbjct  256  VSPGDNLTC  264



>emb|CBI24650.3| unnamed protein product [Vitis vinifera]
Length=251

 Score =   340 bits (871),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 165/249 (66%), Positives = 189/249 (76%), Gaps = 27/249 (11%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            Q+CGCA  LCCS+WG                         +   SVADIV+  FFNGI D
Sbjct  30   QDCGCAADLCCSRWG-------------------------TNNVSVADIVTQKFFNGIID  64

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QAD+SCEGK FY+R  FL+A+NS+ QFG VGS +DSKREIAAFFAHVTHETGH CYI+EI
Sbjct  65   QADASCEGKNFYSRARFLEALNSFSQFGRVGSEEDSKREIAAFFAHVTHETGHFCYIEEI  124

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G SRDYCD+TNTQYPC  GK YYGRGPIQLSWNFNYGPAG+ IGFDGLN+P+ VA+DP+
Sbjct  125  NGSSRDYCDETNTQYPCVAGKGYYGRGPIQLSWNFNYGPAGEDIGFDGLNSPETVASDPV  184

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            +SFKTALW+W+N   S+I   QGFGATIRAING LECDGAN  TV  RVEYYT+YC QLG
Sbjct  185  VSFKTALWYWVNFVQSVID--QGFGATIRAINGALECDGANQATVNARVEYYTEYCNQLG  242

Query  833  VDPGNNLEC  859
            V PG+NL C
Sbjct  243  VTPGDNLTC  251



>ref|XP_008223736.1| PREDICTED: endochitinase PR4-like [Prunus mume]
Length=276

 Score =   340 bits (871),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 164/251 (65%), Positives = 191/251 (76%), Gaps = 6/251 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHp--psppsgggsVADIVSDAFFNGI  286
            Q+CGCA+ LCCSQ+GYCGTGDDYCG+GCK+GPC           G SVADIV+ AFFNGI
Sbjct  30   QDCGCAQDLCCSQYGYCGTGDDYCGQGCKQGPCTGSGGTPTTPSGSSVADIVTAAFFNGI  89

Query  287  ADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIK  466
              QA S C GK FY+R  FLDAVNSY  FG +GS DDSKREIAAFFAHVTHETGH CYI+
Sbjct  90   ISQASSDCAGKNFYSRGGFLDAVNSYSDFGRLGSVDDSKREIAAFFAHVTHETGHFCYIE  149

Query  467  EIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATD  646
            EI+  +  YCD T T YPC P K YYGRGP+QL+WN+NYG AG SIGFDGLN+P+ VA+D
Sbjct  150  EINRAT--YCDTTRTDYPCNPNKQYYGRGPLQLTWNYNYGAAGNSIGFDGLNSPETVASD  207

Query  647  PIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQ  826
              ++FKTALW+WMNN   +++  QGFGATIRAING +ECDG  P  V+ R+ YY  YC Q
Sbjct  208  AAVAFKTALWYWMNNVRPVVS--QGFGATIRAINGAVECDGKEPGKVQARINYYNDYCTQ  265

Query  827  LGVDPGNNLEC  859
            L V+PG NL C
Sbjct  266  LNVNPGGNLYC  276



>ref|XP_002274419.2| PREDICTED: endochitinase PR4 [Vitis vinifera]
Length=326

 Score =   341 bits (875),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 167/249 (67%), Positives = 192/249 (77%), Gaps = 4/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC  GLCCS+WGYCGTGDDYCG GCK G CY     PS    V  +V++ FF+ I D
Sbjct  82   QNCGCDAGLCCSRWGYCGTGDDYCGTGCKSGSCY-TTPRPSSNIPVPAVVTEGFFDRIID  140

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QAD+SC GK FYTR +FLDA+ SYP+FG     DDS  EIAAFFAHVTHETG+ CY +E 
Sbjct  141  QADASCAGKNFYTRAAFLDALKSYPRFGREVYVDDSLYEIAAFFAHVTHETGNFCYTEED  200

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G S+DYCD+T+TQ+PC  GK YYGRGPIQLSWN+NYG AG SIGFDGLNNP++VATD  
Sbjct  201  NGASKDYCDETDTQFPCVSGKDYYGRGPIQLSWNYNYGAAGASIGFDGLNNPEIVATDAS  260

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALWFWM+N HS+I  GQGFGATIR IN   ECDG N   V  RVEY+T+YC +LG
Sbjct  261  ISFKTALWFWMSNVHSVI--GQGFGATIRVINSN-ECDGGNTAAVHARVEYFTEYCNELG  317

Query  833  VDPGNNLEC  859
            V PG+NL C
Sbjct  318  VLPGDNLTC  326



>ref|XP_010036821.1| PREDICTED: chitinase 6-like [Eucalyptus grandis]
 gb|KCW48474.1| hypothetical protein EUGRSUZ_K02166 [Eucalyptus grandis]
Length=278

 Score =   339 bits (870),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/253 (63%), Positives = 195/253 (77%), Gaps = 5/253 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVA-DIVSDAFFNGIA  289
            QNCGCA GLCCS++GYCGTG DYCG GC+ GPC    +PP+    V  DIV+DAFFNGI 
Sbjct  27   QNCGCAAGLCCSKYGYCGTGQDYCGPGCQAGPCNPAATPPATNAVVVGDIVTDAFFNGII  86

Query  290  DQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKE  469
            +QA +SC GK FY+R +FLDA+ S+P+FG VGS DDSKREIAAFFAH THETG  C+I+E
Sbjct  87   NQAAASCAGKRFYSRQAFLDALGSFPKFGQVGSVDDSKREIAAFFAHATHETGSFCFIEE  146

Query  470  IDGES---RDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVA  640
            IDG++   + YCD +  QYPC PG+ Y+GRGP+Q++WN+NYGPAGQS+GFDGLN+P+ VA
Sbjct  147  IDGQTDPKKTYCDSSKPQYPCKPGRKYFGRGPLQITWNYNYGPAGQSLGFDGLNSPETVA  206

Query  641  TDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYC  820
             +P+I+FK ALW+W  N      SGQGFGATIR IN  +ECDG  P+ VR RV YYT YC
Sbjct  207  NNPVIAFKAALWYWSTNNIQSKLSGQGFGATIRTIN-SIECDGMKPELVRNRVMYYTNYC  265

Query  821  QQLGVDPGNNLEC  859
            +Q GV PG NL C
Sbjct  266  KQFGVAPGGNLNC  278



>ref|XP_008800296.1| PREDICTED: chitinase 6-like [Phoenix dactylifera]
Length=227

 Score =   337 bits (864),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 164/227 (72%), Positives = 185/227 (81%), Gaps = 2/227 (1%)
 Frame = +2

Query  179  YCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIADQADSSCEGKGFYTRTSFLDAVN  358
            +    C+EGPC    SPP    SVADIV+  FF+GI +QAD+ C GK FYTR +FLDA+ 
Sbjct  3    WAAPSCREGPC--ESSPPPNDVSVADIVTQQFFDGIINQADNGCVGKNFYTRAAFLDALG  60

Query  359  SYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEIDGESRDYCDKTNTQYPCAPGKM  538
            SYP FG  G+ DDSKREIAAFFAHVTHETGH CYI+EIDG S+DYCD+TNTQ+PC PGK 
Sbjct  61   SYPNFGRDGTVDDSKREIAAFFAHVTHETGHFCYIEEIDGASKDYCDETNTQWPCVPGKG  120

Query  539  YYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPIISFKTALWFWMNNCHSLITSGQ  718
            YYGRGPIQLSWNFNYGPAG+SIGFDGLN+P+ VA D +ISFKTALW+WM N HSLITSGQ
Sbjct  121  YYGRGPIQLSWNFNYGPAGKSIGFDGLNSPETVANDVVISFKTALWYWMTNVHSLITSGQ  180

Query  719  GFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLGVDPGNNLEC  859
            GFGATIRAING LECDG NP+TV KRV YY  YC+Q GV PG+NL C
Sbjct  181  GFGATIRAINGALECDGKNPETVNKRVGYYLDYCKQFGVAPGDNLTC  227



>emb|CAN68040.1| hypothetical protein VITISV_033610 [Vitis vinifera]
Length=269

 Score =   338 bits (868),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 167/249 (67%), Positives = 192/249 (77%), Gaps = 4/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC  GLCCS+WGYCGTGDDYCG GCK G CY     PS    V  +V++ FF+ I D
Sbjct  25   QNCGCDAGLCCSRWGYCGTGDDYCGTGCKSGSCY-TTPRPSSNIPVPAVVTEGFFDRIID  83

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QAD+SC GK FYTR +FLDA+ SYP+FG     DDS  EIAAFFAHVTHETG+ CY +E 
Sbjct  84   QADASCAGKNFYTRAAFLDALKSYPRFGREVYVDDSLYEIAAFFAHVTHETGNFCYTEED  143

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G S+DYCD+T+TQ+PC  GK YYGRGPIQLSWN+NYG AG SIGFDGLNNP++VATD  
Sbjct  144  NGASKDYCDETDTQFPCVSGKDYYGRGPIQLSWNYNYGAAGASIGFDGLNNPEIVATDAS  203

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALWFWM+N HS+I  GQGFGATIR IN   ECDG N   V  RVEY+T+YC +LG
Sbjct  204  ISFKTALWFWMSNVHSVI--GQGFGATIRVINSN-ECDGGNTAAVHARVEYFTEYCNELG  260

Query  833  VDPGNNLEC  859
            V PG+NL C
Sbjct  261  VLPGDNLTC  269



>sp|P27054.1|CHI4_PHAVU RecName: Full=Endochitinase PR4; Flags: Precursor [Phaseolus 
vulgaris]
Length=270

 Score =   338 bits (868),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 168/250 (67%), Positives = 195/250 (78%), Gaps = 4/250 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCAEGLCCSQ+GYCGTG+DYCG GC++GPC     PPS   + ADI++  F NGI D
Sbjct  24   QNCGCAEGLCCSQYGYCGTGEDYCGTGCQQGPCTTASPPPSNNVN-ADILTADFLNGIID  82

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QADS C GK FYTR +FL A+NSY  FG VGS DDSKREIAA FAH THETGH CYI+EI
Sbjct  83   QADSGCAGKNFYTRDAFLSALNSYTDFGRVGSEDDSKREIAAAFAHFTHETGHFCYIEEI  142

Query  473  DGESRDYCDKTN-TQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDP  649
            DG S+DYCD+ +  QYPC+  K Y+GRGPIQLSWNFNYGPAG +  FDGL  P+ V+ D 
Sbjct  143  DGASKDYCDEESIAQYPCSSSKGYHGRGPIQLSWNFNYGPAGSANNFDGLGAPETVSNDV  202

Query  650  IISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQL  829
            ++SFKTALW+WM +   +I   QGFGATIRAING LECDGANP TV+ RV YYT+YC+QL
Sbjct  203  VVSFKTALWYWMQHVRPVIN--QGFGATIRAINGALECDGANPTTVQARVNYYTEYCRQL  260

Query  830  GVDPGNNLEC  859
            GV  G+NL C
Sbjct  261  GVATGDNLTC  270



>ref|XP_007226544.1| hypothetical protein PRUPE_ppa024941mg [Prunus persica]
 gb|EMJ27743.1| hypothetical protein PRUPE_ppa024941mg [Prunus persica]
Length=276

 Score =   339 bits (869),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 165/251 (66%), Positives = 190/251 (76%), Gaps = 6/251 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHp--psppsgggsVADIVSDAFFNGI  286
            QNCGCA  LCCSQ+GYCGTG+DYCG+GCK+GPC           G SVADIV+ AFFNGI
Sbjct  30   QNCGCAPDLCCSQYGYCGTGNDYCGQGCKQGPCTGSGGTPTTPSGSSVADIVTPAFFNGI  89

Query  287  ADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIK  466
              QA S C GK FY+R  FLDAVNSY  FG +GS DDSKREIAAFFAHVTHETGH CYI+
Sbjct  90   ISQASSDCAGKNFYSRGGFLDAVNSYSDFGRLGSVDDSKREIAAFFAHVTHETGHFCYIE  149

Query  467  EIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATD  646
            EI+  +  YCD T T YPC P K YYGRGP+QL+WN+NYG AG SIGFDGLN+P+ VA+D
Sbjct  150  EINRGT--YCDTTRTDYPCNPNKQYYGRGPLQLTWNYNYGAAGNSIGFDGLNSPETVASD  207

Query  647  PIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQ  826
              ++FKTALWFWMNN   +++  QGFGATIRAING +ECDG  P  V+ R+ YY  YC Q
Sbjct  208  AAVAFKTALWFWMNNVRPVVS--QGFGATIRAINGAVECDGKEPGKVQARINYYNDYCTQ  265

Query  827  LGVDPGNNLEC  859
            L V+PG NL C
Sbjct  266  LNVNPGGNLYC  276



>ref|XP_010687448.1| PREDICTED: chitinase 4-like [Beta vulgaris subsp. vulgaris]
Length=264

 Score =   338 bits (866),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 165/249 (66%), Positives = 194/249 (78%), Gaps = 9/249 (4%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC  GLCCS+WGYCGT D YCGEGC+EGPC+      S GGS++D+V+D+FFNGI D
Sbjct  25   QNCGCDAGLCCSRWGYCGTTDAYCGEGCQEGPCF-----SSSGGSISDLVTDSFFNGIID  79

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA SSC GK FY+R++FLDAV+ YPQF T GS+DD KRE+AA+FAH+THETGH CYI+EI
Sbjct  80   QASSSCAGKNFYSRSAFLDAVSFYPQFATEGSSDDIKREVAAYFAHLTHETGHFCYIEEI  139

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
                  YC  ++T +PC P K YYGRGP+Q++WN+NYGPAGQSIGFDGLN P+ VA DPI
Sbjct  140  --AKATYCQASDT-WPCNPDKQYYGRGPLQITWNYNYGPAGQSIGFDGLNAPETVANDPI  196

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            I+F+TA WFWMNN HS I SGQGF +TIRAING  EC G N   V  RV YYTQYC   G
Sbjct  197  IAFRTAFWFWMNNVHSRIISGQGFASTIRAINGG-ECGGGNTPAVNARVGYYTQYCDHFG  255

Query  833  VDPGNNLEC  859
            V PG+NL C
Sbjct  256  VSPGDNLYC  264



>gb|AGS80329.1| chitinase protein [Actinidia chinensis]
Length=276

 Score =   338 bits (867),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 154/249 (62%), Positives = 191/249 (77%), Gaps = 5/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            Q CGCA GLCCSQ+G+C TG+D+CG GC+ GPC       S G  VA+IV+ AFF+GI +
Sbjct  30   QRCGCAAGLCCSQFGFCNTGNDFCGTGCQSGPC-----TGSNGVVVANIVTQAFFDGIIN  84

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA + C GK FYTR++FL+ ++ +  FGT+G+ DDSKREIAAFFAH +HETG  C I+E 
Sbjct  85   QAPAGCVGKTFYTRSAFLNTLSLFTAFGTIGTVDDSKREIAAFFAHASHETGSFCKIEED  144

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
             G S++YCD   T YPCAP K YYGRGP++LSWN+NYG AG  +GF+GLNNP++VATD +
Sbjct  145  GGASKNYCDNKRTDYPCAPNKHYYGRGPLRLSWNYNYGAAGDFLGFNGLNNPEIVATDSL  204

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            +SFK A+WFWM N HS++T+GQGFGATIRAING +ECDG  PD V  RV  YT +C QLG
Sbjct  205  VSFKAAMWFWMRNVHSVMTTGQGFGATIRAINGNIECDGKRPDLVTARVNLYTNFCSQLG  264

Query  833  VDPGNNLEC  859
            V PGNNL C
Sbjct  265  VAPGNNLRC  273



>ref|XP_010687454.1| PREDICTED: endochitinase A-like [Beta vulgaris subsp. vulgaris]
Length=274

 Score =   338 bits (867),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 165/254 (65%), Positives = 197/254 (78%), Gaps = 9/254 (4%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggs-----VADIVSDAFF  277
            QNCGCA  LCCS++G+CGT D YCG+GC++GPC   P+P +         V  +V+D FF
Sbjct  25   QNCGCASNLCCSKFGFCGTTDAYCGDGCQQGPCRSKPTPSTPSTPSGGGSVPSLVTDQFF  84

Query  278  NGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMC  457
            NGI  QAD++C GK FYTR++FL+A+ SYPQFGT GS+D +KRE+AAFFAHVTHETGH C
Sbjct  85   NGIIGQADANCAGKRFYTRSAFLNALKSYPQFGTGGSSDVTKREVAAFFAHVTHETGHFC  144

Query  458  YIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVV  637
            YI+EI   +  YC  + TQ+PC P K YYGRGPIQ+SWN+NYGPAG+SIGFDGLN P+ V
Sbjct  145  YIEEIAKST--YCQPS-TQWPCNPSKQYYGRGPIQISWNYNYGPAGRSIGFDGLNAPETV  201

Query  638  ATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQY  817
            A DP+I+FKTA WFWMNN HS+I SGQGFG TIRAING +EC+G N   V  RV YYTQY
Sbjct  202  ANDPVIAFKTAFWFWMNNVHSIIVSGQGFGPTIRAING-IECNGGNSAAVTARVGYYTQY  260

Query  818  CQQLGVDPGNNLEC  859
            CQQLGV PG NL C
Sbjct  261  CQQLGVSPGINLRC  274



>ref|XP_009368228.1| PREDICTED: endochitinase PR4-like [Pyrus x bretschneideri]
Length=233

 Score =   336 bits (862),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 176/204 (86%), Gaps = 2/204 (1%)
 Frame = +2

Query  248  VADIVSDAFFNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFA  427
            VADIV+  FFNGI DQAD+SC GK FY+R +FL+A+NSY QFG +GS DDSKREIAAFFA
Sbjct  32   VADIVTPEFFNGIIDQADASCAGKNFYSRATFLEALNSYTQFGRIGSVDDSKREIAAFFA  91

Query  428  HVTHETGHMCYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIG  607
            HVTHETGH CYI+EIDG S+DYCD+ NTQYPC P K YYGRGPIQLSWNFNYGPAG+SIG
Sbjct  92   HVTHETGHFCYIEEIDGASKDYCDENNTQYPCNPNKGYYGRGPIQLSWNFNYGPAGESIG  151

Query  608  FDGLNNPDVVATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTV  787
            FDGLN+P+ VA DP+I+FKTALW+WMNN   +I  G+GFGATIRAING LECDG NP TV
Sbjct  152  FDGLNSPETVANDPVIAFKTALWYWMNNVRPVI--GEGFGATIRAINGALECDGGNPATV  209

Query  788  RKRVEYYTQYCQQLGVDPGNNLEC  859
            +KRVEYYT+YC QLGV PG+NL C
Sbjct  210  QKRVEYYTEYCNQLGVAPGDNLTC  233



>ref|XP_009368176.1| PREDICTED: endochitinase PR4-like [Pyrus x bretschneideri]
 ref|XP_009368206.1| PREDICTED: endochitinase PR4-like [Pyrus x bretschneideri]
Length=233

 Score =   336 bits (862),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 176/204 (86%), Gaps = 2/204 (1%)
 Frame = +2

Query  248  VADIVSDAFFNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFA  427
            VADIV+  FFNGI DQAD+SC GK FY+R +FL+A+NSY QFG +GS DDSKREIAAFFA
Sbjct  32   VADIVTPEFFNGIIDQADASCAGKNFYSRATFLEALNSYTQFGRIGSVDDSKREIAAFFA  91

Query  428  HVTHETGHMCYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIG  607
            HVTHETGH CYI+EIDG S+DYCD+ NTQYPC P K YYGRGPIQLSWNFNYGPAG+SIG
Sbjct  92   HVTHETGHFCYIEEIDGASKDYCDENNTQYPCNPNKGYYGRGPIQLSWNFNYGPAGESIG  151

Query  608  FDGLNNPDVVATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTV  787
            FDGLN+P+ VA DP+I+FKTALW+WMNN   +I  G+GFGATIRAING LECDG NP TV
Sbjct  152  FDGLNSPETVANDPVIAFKTALWYWMNNVRPVI--GEGFGATIRAINGALECDGGNPATV  209

Query  788  RKRVEYYTQYCQQLGVDPGNNLEC  859
            +KRVEYYT+YC QLGV PG+NL C
Sbjct  210  QKRVEYYTEYCNQLGVAPGDNLTC  233



>ref|XP_010650683.1| PREDICTED: endochitinase PR4-like [Vitis vinifera]
Length=301

 Score =   338 bits (868),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 161/246 (65%), Positives = 196/246 (80%), Gaps = 3/246 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            Q+CGC  GLCCS++GYCGTG +YCG GC+ GPC    S   GG SV+DIV+  FFNGI D
Sbjct  51   QDCGCGAGLCCSKFGYCGTGKEYCGTGCQAGPCDSSSSSSGGGVSVSDIVTKDFFNGILD  110

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA  +C G+ FYTR++FLDAV+SYP+FG  GSA DSKREIAAFFAH+THETGH CYI+E+
Sbjct  111  QASETCPGRSFYTRSAFLDAVDSYPEFGQGGSAVDSKREIAAFFAHITHETGHFCYIEEV  170

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            DG SR+YCD++NT+YPC  GK YYGRGPIQ+SWN+NYG AG+SIGFDGLNNP++VA D +
Sbjct  171  DGASRNYCDESNTKYPCVSGKGYYGRGPIQISWNYNYGQAGESIGFDGLNNPEIVANDSV  230

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            +SFKTA+WFWMNN HS+I   QGFGATI+AIN  +EC G N    + RV +Y +YC QLG
Sbjct  231  VSFKTAIWFWMNNVHSVID--QGFGATIKAIN-VMECSGGNNVAAKARVSFYQEYCNQLG  287

Query  833  VDPGNN  850
            V   +N
Sbjct  288  VSTSDN  293



>ref|XP_010258575.1| PREDICTED: chitinase 5-like [Nelumbo nucifera]
Length=273

 Score =   337 bits (864),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 169/249 (68%), Positives = 196/249 (79%), Gaps = 3/249 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCA  LCCS++GYCGTG  YCG+GC++GPC +     S G SVAD+V+  FFNGI  
Sbjct  28   QNCGCAXNLCCSRFGYCGTGXXYCGDGCQQGPCNNGGGGSSSGVSVADVVTPDFFNGIIG  87

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            +A S C GK FYTR +FL+A+NSYP+F   GSADDSKREIAAFFAHVTHETGH CYI+EI
Sbjct  88   KAASGCAGKNFYTRGAFLNALNSYPRFAXDGSADDSKREIAAFFAHVTHETGHFCYIEEI  147

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            DG S+DYCD+ NTQYPC PGK YYGRGPIQ+SWN+NYGPAGQSIGF+GLN P+ VA D +
Sbjct  148  DGASKDYCDEXNTQYPCVPGKGYYGRGPIQISWNYNYGPAGQSIGFNGLNAPETVANDVV  207

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            +SFKTA WFWMNN HS++   QGFGATIRAING     G N   V+ RV YYT YC +LG
Sbjct  208  VSFKTAFWFWMNNVHSVMR--QGFGATIRAINGGEC-GGGNSGAVQARVGYYTDYCNKLG  264

Query  833  VDPGNNLEC  859
            V PG+NL C
Sbjct  265  VSPGDNLTC  273



>gb|ACO57438.1| class IV chitinase [Elaeis oleifera]
Length=268

 Score =   336 bits (862),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 164/249 (66%), Positives = 193/249 (78%), Gaps = 3/249 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC+  LCCSQ+GYCGTG+ YCG+GC+ GPCY  P+   G   VAD+V+  FFN I +
Sbjct  23   QNCGCSSDLCCSQYGYCGTGNAYCGKGCRGGPCYSSPATGGGSS-VADLVTQQFFNSIIN  81

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA  SC GK FYTR +FLDA+ SYPQFG  GS+  SK+E+AAFFAHVTHETG++CYI E 
Sbjct  82   QASGSCPGKNFYTRQAFLDALGSYPQFGQDGSSVTSKQEVAAFFAHVTHETGYLCYIDET  141

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            D +S  YCD + TQYPCA G+ Y+GRGP+QLSWN+NYG AGQSIGFDGLN+P+ VATD I
Sbjct  142  D-QSNAYCDPSYTQYPCAQGQKYFGRGPLQLSWNYNYGAAGQSIGFDGLNSPNTVATDVI  200

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALWFWM N HS+ITSGQGFGATIR IN Q EC+G  P  +  RV+ Y QYC   G
Sbjct  201  ISFKTALWFWMENVHSVITSGQGFGATIRKINSQ-ECNGGQPAEMNARVQLYKQYCSDFG  259

Query  833  VDPGNNLEC  859
            V PG+NL C
Sbjct  260  VTPGDNLTC  268



>ref|XP_006652462.1| PREDICTED: chitinase 5-like [Oryza brachyantha]
Length=272

 Score =   336 bits (862),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 163/249 (65%), Positives = 193/249 (78%), Gaps = 2/249 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC   LCCS++GYCGTG++YCGEGC+ GPC    S  + G  V  +V++AFFNGI +
Sbjct  26   QNCGCQPNLCCSKYGYCGTGNEYCGEGCRSGPCSGSGSGGNTGVPVDSVVTEAFFNGIKN  85

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            +A +SC GK FYTR SFL+A  SY  F    S DDSKREIAAFFAHVTHETG MCYI+EI
Sbjct  86   KAPNSCAGKNFYTRQSFLNAAGSYSGFAKGRSNDDSKREIAAFFAHVTHETGSMCYIEEI  145

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G SR+YCD +N Q+PC PGK Y+GRGP+Q+SWN+NYGPAGQSIGFDGL NP+ VA DP+
Sbjct  146  NGASRNYCDSSNRQWPCQPGKGYFGRGPLQISWNYNYGPAGQSIGFDGLRNPERVAQDPV  205

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ++FKTALWFWMNN H ++   QGFGATIRAING LEC+G N   V  RV YY  YC+Q G
Sbjct  206  VAFKTALWFWMNNVHQVMP--QGFGATIRAINGALECNGKNSGAVNARVNYYRDYCRQFG  263

Query  833  VDPGNNLEC  859
            VDPG NL C
Sbjct  264  VDPGGNLSC  272



>ref|XP_010650685.1| PREDICTED: endochitinase A-like isoform X1 [Vitis vinifera]
 ref|XP_010650686.1| PREDICTED: endochitinase A-like isoform X2 [Vitis vinifera]
Length=356

 Score =   339 bits (870),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 161/245 (66%), Positives = 195/245 (80%), Gaps = 3/245 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCA GLCC+++GYCGTG+ YCG+GC+ GPCY       G   VAD+V+ AFFNGI +
Sbjct  25   QNCGCASGLCCNKFGYCGTGNAYCGDGCQAGPCYSSGGSSGGVS-VADVVTQAFFNGIIN  83

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA  +CEGK FYTR +FL A+NSYP FG  GSAD SKREIAAFFAHVTHETGH CYI EI
Sbjct  84   QAAGNCEGKHFYTRAAFLSALNSYPGFGKDGSADQSKREIAAFFAHVTHETGHFCYINEI  143

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G S +YCD +NTQ PC  G+ YYGRGP+Q+SWN+NYGPAG+SIGF+GL+NP +VAT+  
Sbjct  144  NGASPNYCDSSNTQNPCVAGQKYYGRGPLQISWNYNYGPAGKSIGFNGLSNPGIVATNAD  203

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALWFWMNN HS++   QGFGATI+AI+G +EC+G +P +V  RV+YY  YC Q G
Sbjct  204  ISFKTALWFWMNNVHSVVN--QGFGATIQAIDGAIECNGGSPSSVDARVQYYKNYCSQFG  261

Query  833  VDPGN  847
            V PG+
Sbjct  262  VSPGD  266



>gb|AHA62771.1| chitinase [Mirabilis jalapa]
Length=277

 Score =   336 bits (862),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 160/252 (63%), Positives = 194/252 (77%), Gaps = 4/252 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppspps---gggsVADIVSDAFFNG  283
            QNCGC   LCCS++GYCGTG  YCGEGC++GPCY  PS PS    G  VAD+V+  FF+ 
Sbjct  27   QNCGCTNNLCCSKYGYCGTGTPYCGEGCQQGPCYSTPSTPSGGGSGVKVADVVTQPFFDS  86

Query  284  IADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYI  463
            I +QA   C GKGFY+R+SF++A ++YP+F   G+    K+EIAA FAH THETGH CYI
Sbjct  87   IINQASGGCAGKGFYSRSSFINAASAYPKFAGEGTPTVGKQEIAAAFAHFTHETGHFCYI  146

Query  464  KEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVAT  643
            +EI+G SRDYCD+ N Q+PC P K YYGRGPIQ+SWN+NYGPAG++IGFDGLN P+ VA 
Sbjct  147  EEINGASRDYCDENNRQWPCNPSKGYYGRGPIQISWNYNYGPAGKAIGFDGLNAPETVAR  206

Query  644  DPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQ  823
            DP+++FKT +WFWMNN HSLI S +GFGATIRAING +EC+G N   V  RV YY QYC 
Sbjct  207  DPVVAFKTGMWFWMNNVHSLIISNRGFGATIRAING-MECNGGNTGAVNARVGYYKQYCS  265

Query  824  QLGVDPGNNLEC  859
            QLGV PG+NL C
Sbjct  266  QLGVSPGDNLYC  277



>ref|XP_010912786.1| PREDICTED: endochitinase PR4-like [Elaeis guineensis]
Length=276

 Score =   336 bits (861),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 165/253 (65%), Positives = 196/253 (77%), Gaps = 4/253 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC--YHppsppsgggsVADIVSDAFFNGI  286
            QNC C+ GLCCS++GYCG G+D+CG GC+EGPC    P   P+ G SVADIV+  FFNGI
Sbjct  24   QNCRCSPGLCCSKYGYCGAGNDFCGPGCQEGPCQAPAPAPAPANGVSVADIVAQQFFNGI  83

Query  287  ADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIK  466
             +QA   C GKGFYTR +FLDA+ SYP FG VG+ +DSKREIAA+FAHVTHETGH+C+I+
Sbjct  84   INQAGGGCPGKGFYTRAAFLDALGSYPNFGRVGTTNDSKREIAAYFAHVTHETGHLCFIE  143

Query  467  EIDGESRD-YCDKTNTQ-YPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVA  640
            E +  S+D YCDK   Q YPCAPGK YYGRGP+QLSWN+NYGPAG SIGFDGLN P++VA
Sbjct  144  EKNDTSQDDYCDKRFIQQYPCAPGKKYYGRGPLQLSWNYNYGPAGTSIGFDGLNKPEIVA  203

Query  641  TDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYC  820
            TD   SF+ +LWFWM N HS+ITSG+GFGATIR ING  ECDG   D++  RV YY  YC
Sbjct  204  TDVNTSFRASLWFWMENVHSVITSGKGFGATIRKINGAYECDGKGVDSMNARVGYYKDYC  263

Query  821  QQLGVDPGNNLEC  859
            +Q GV PG+ L C
Sbjct  264  KQFGVAPGDKLTC  276



>ref|XP_010094102.1| Endochitinase [Morus notabilis]
 gb|EXB55192.1| Endochitinase [Morus notabilis]
Length=274

 Score =   335 bits (860),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 157/249 (63%), Positives = 195/249 (78%), Gaps = 6/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC+   CCS++GYCGTGDDYCG+GC+ GPCY   + P+   +V DIV+  FF+GI +
Sbjct  32   QNCGCSSDQCCSKYGYCGTGDDYCGDGCQSGPCY---ATPTSSNNVGDIVTPEFFSGILN  88

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            +A   C GK F+TR +FL+A N+YPQFG+ GSAD+SKREIAAFFAHV+HETG +C+I+E 
Sbjct  89   KATGDCPGKSFFTRDAFLNAANAYPQFGS-GSADESKREIAAFFAHVSHETGFLCHIEET  147

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            DG S+DYCD+T T YPC   K YYGRGP+QL+WN+NYG AG +IGFDGLN+P+ VATD  
Sbjct  148  DGASQDYCDETRTDYPCNQNKKYYGRGPLQLTWNYNYGAAGNAIGFDGLNSPETVATDAT  207

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            +SFKTA+WFWM N HS+++  QG GAT R ING +ECDG  PD V+ R  YYT YC QLG
Sbjct  208  VSFKTAVWFWMENVHSVMS--QGLGATTRKINGDVECDGKEPDKVQARANYYTAYCNQLG  265

Query  833  VDPGNNLEC  859
            VDPG+NL C
Sbjct  266  VDPGSNLTC  274



>ref|XP_010094101.1| Endochitinase [Morus notabilis]
 gb|EXB55191.1| Endochitinase [Morus notabilis]
Length=274

 Score =   335 bits (859),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 157/249 (63%), Positives = 196/249 (79%), Gaps = 6/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC+   CCS++GYCGTGDDYCG+GC+ GPCY   + P+   +V DIV+  FF+GI +
Sbjct  32   QNCGCSSDQCCSKYGYCGTGDDYCGDGCQSGPCY---ATPTSSNNVGDIVTPEFFSGILN  88

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            +A   C GK F+TR +FL+A ++YPQFG+ GSAD+SKREIAAFFAHV+HETG +C+I+E 
Sbjct  89   KATGDCPGKSFFTRDAFLNAADAYPQFGS-GSADESKREIAAFFAHVSHETGFLCHIEET  147

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            DG S+DYCD+T T YPC   K YYGRGP+QL+WN+NYG AG +IGFDGLN+P+ VATD  
Sbjct  148  DGASQDYCDETRTDYPCNQNKKYYGRGPLQLTWNYNYGAAGNAIGFDGLNSPETVATDTT  207

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            +SFKTA+WFWM N HS+++  QGFGAT R ING +ECDG  PD V+ R  YYT YC QLG
Sbjct  208  VSFKTAVWFWMENVHSVMS--QGFGATTRKINGDVECDGKEPDKVQARANYYTDYCNQLG  265

Query  833  VDPGNNLEC  859
            VDPG+NL C
Sbjct  266  VDPGSNLTC  274



>emb|CBI24659.3| unnamed protein product [Vitis vinifera]
Length=427

 Score =   341 bits (874),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 161/245 (66%), Positives = 195/245 (80%), Gaps = 3/245 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCA GLCC+++GYCGTG+ YCG+GC+ GPCY       G   VAD+V+ AFFNGI +
Sbjct  96   QNCGCASGLCCNKFGYCGTGNAYCGDGCQAGPCYSSGGSSGGVS-VADVVTQAFFNGIIN  154

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA  +CEGK FYTR +FL A+NSYP FG  GSAD SKREIAAFFAHVTHETGH CYI EI
Sbjct  155  QAAGNCEGKHFYTRAAFLSALNSYPGFGKDGSADQSKREIAAFFAHVTHETGHFCYINEI  214

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G S +YCD +NTQ PC  G+ YYGRGP+Q+SWN+NYGPAG+SIGF+GL+NP +VAT+  
Sbjct  215  NGASPNYCDSSNTQNPCVAGQKYYGRGPLQISWNYNYGPAGKSIGFNGLSNPGIVATNAD  274

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALWFWMNN HS++   QGFGATI+AI+G +EC+G +P +V  RV+YY  YC Q G
Sbjct  275  ISFKTALWFWMNNVHSVVN--QGFGATIQAIDGAIECNGGSPSSVDARVQYYKNYCSQFG  332

Query  833  VDPGN  847
            V PG+
Sbjct  333  VSPGD  337



>gb|KCW48473.1| hypothetical protein EUGRSUZ_K02166 [Eucalyptus grandis]
Length=278

 Score =   335 bits (859),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 160/253 (63%), Positives = 192/253 (76%), Gaps = 5/253 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVA-DIVSDAFFNGIA  289
            QNCGCA GLCCS++GYCGTG DYCG GC+ GPC    +PP+    V  DIV+DAFFNGI 
Sbjct  27   QNCGCAAGLCCSKYGYCGTGQDYCGPGCQAGPCNPAATPPATNAVVVGDIVTDAFFNGII  86

Query  290  DQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKE  469
            +QA +SC GK FY+R +FLDA+ S+P+FG VGS DDSKREIAAFFAH THETG  C+I+E
Sbjct  87   NQAAASCAGKRFYSRQAFLDALGSFPKFGQVGSVDDSKREIAAFFAHATHETGSFCFIEE  146

Query  470  IDGES---RDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVA  640
            IDG +   + YCD    QYPC PG+ Y+GRGP+QLSWN+NYGPAG+S+GFDGLN+P+ VA
Sbjct  147  IDGRTDPKKTYCDPNVPQYPCKPGRKYFGRGPLQLSWNYNYGPAGESLGFDGLNSPETVA  206

Query  641  TDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYC  820
             +P+I+FK ALWFW  N      SGQGFGATIR IN  +EC+G NP   + RV YYT YC
Sbjct  207  NNPVIAFKAALWFWSTNNIQSKLSGQGFGATIRTIN-SIECNGRNPGAAQARVTYYTNYC  265

Query  821  QQLGVDPGNNLEC  859
            +Q GV PG NL C
Sbjct  266  KQFGVAPGGNLNC  278



>dbj|BAA22966.1| chitinase [Chenopodium amaranticolor]
Length=273

 Score =   335 bits (859),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 161/253 (64%), Positives = 194/253 (77%), Gaps = 8/253 (3%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgg----gsVADIVSDAFFN  280
            QNCGCA GLCCS++GYCGT   YCG+GCK+GPCY        G     SV  +V++AFFN
Sbjct  25   QNCGCASGLCCSKYGYCGTTAAYCGDGCKQGPCYSSTPTTPSGGGGGASVQSLVTNAFFN  84

Query  281  GIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCY  460
            GI +QA S C GK FYTR++FL+A+ +YPQFG  GS+DD+KRE+AAFFAHVTHETGH CY
Sbjct  85   GILNQAGSGCAGKSFYTRSAFLNALGNYPQFGKGGSSDDTKREVAAFFAHVTHETGHFCY  144

Query  461  IKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVA  640
            I+EI      YC +++ Q+PC P K YYGRGPIQ++WN+NYG AG+SIGFDG+N P+ VA
Sbjct  145  IEEI--AKSTYC-QSSAQWPCNPNKQYYGRGPIQITWNYNYGAAGKSIGFDGINAPETVA  201

Query  641  TDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYC  820
             +P+I+FKTA WFWMNN HS I SGQGFG+TIRA+NG  EC G N   V  RV YYTQYC
Sbjct  202  NNPVIAFKTAFWFWMNNVHSRIVSGQGFGSTIRAVNGG-ECGGGNTPAVNARVGYYTQYC  260

Query  821  QQLGVDPGNNLEC  859
            +QLGV PGNNL C
Sbjct  261  KQLGVSPGNNLSC  273



>ref|XP_010687452.1| PREDICTED: endochitinase A-like [Beta vulgaris subsp. vulgaris]
Length=268

 Score =   334 bits (857),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 165/249 (66%), Positives = 195/249 (78%), Gaps = 5/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCA GLCCS++GYCGT   YCG GC++GPC   PS PSGG SV  +V+DAFFNGI +
Sbjct  25   QNCGCASGLCCSRYGYCGTTAAYCGTGCQQGPCSSTPSTPSGGVSVPSLVTDAFFNGIIN  84

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA SSC GK FYTR++FL A++SYPQFG+ GS+D+ KRE+AAFFAH THETGH CYI+EI
Sbjct  85   QASSSCAGKSFYTRSAFLSALSSYPQFGS-GSSDEVKREVAAFFAHATHETGHFCYIEEI  143

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
                  YC +++T +PC   K YYGRGP+Q++WN+NYGPAG+SIGFDGLN P+ VA D +
Sbjct  144  --AKSTYC-QSSTTWPCTTNKQYYGRGPLQITWNYNYGPAGRSIGFDGLNAPETVANDAV  200

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            I+FKTA WFWMNN HS I SG+GFG+TIRAING  EC G N   V  RV YYTQYC QLG
Sbjct  201  IAFKTAFWFWMNNVHSRIVSGKGFGSTIRAINGG-ECGGGNTPAVNARVRYYTQYCNQLG  259

Query  833  VDPGNNLEC  859
            V PGNNL C
Sbjct  260  VSPGNNLSC  268



>dbj|BAA22968.1| chitinase [Chenopodium amaranticolor]
Length=272

 Score =   334 bits (857),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/252 (63%), Positives = 193/252 (77%), Gaps = 7/252 (3%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgg---gsVADIVSDAFFNG  283
            QNCGCA GLCCS++GYCGT   YCG+GCK+GPCY        G    SV  +V++AFFNG
Sbjct  25   QNCGCASGLCCSKYGYCGTTAAYCGDGCKQGPCYSSTPTTPSGGGGASVQSLVTNAFFNG  84

Query  284  IADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYI  463
            I +QA S C GK FYTR++FL+A+ +YPQFG  GS+DD+KRE+AAFFAHVTHETGH CYI
Sbjct  85   ILNQAGSGCAGKSFYTRSAFLNALGNYPQFGKGGSSDDTKREVAAFFAHVTHETGHFCYI  144

Query  464  KEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVAT  643
            +EI      YC +++ Q+PC P K YYGRGPIQ++WN+NYG AG+SIGFDG+N P+ VA 
Sbjct  145  EEI--AKSTYC-QSSAQWPCNPNKQYYGRGPIQITWNYNYGAAGKSIGFDGINAPETVAN  201

Query  644  DPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQ  823
            +P+I+FKTA WFWMNN HS I SGQGFG+TIRA+NG  EC G N   V  R  YYTQYC+
Sbjct  202  NPVIAFKTAFWFWMNNVHSRIVSGQGFGSTIRAVNGG-ECGGGNTPAVNARFGYYTQYCK  260

Query  824  QLGVDPGNNLEC  859
            QLGV PGNNL C
Sbjct  261  QLGVSPGNNLSC  272



>gb|AAB65777.1| class IV endochitinase [Vitis vinifera]
Length=264

 Score =   334 bits (856),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 164/249 (66%), Positives = 195/249 (78%), Gaps = 5/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCA GLCCS++GY GTG DYCG+GC+ GP     S    G SV+DIV+ AFF+GI +
Sbjct  21   QNCGCASGLCCSKYGYRGTGSDYCGDGCQSGP---CDSGSGSGSSVSDIVTQAFFDGIIN  77

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA SSC GK FYTR +FL A+NSY  FG  GS D +KREIAAFFAHVTHETGH CYI+EI
Sbjct  78   QAASSCAGKNFYTRAAFLSALNSYSGFGNDGSTDANKREIAAFFAHVTHETGHFCYIEEI  137

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G S +YCD +NTQYPC  G+ YYGRGP+QL+WN+NYG AG SIGF+GL+NP +VATD +
Sbjct  138  NGASHNYCDSSNTQYPCVSGQNYYGRGPLQLTWNYNYGAAGNSIGFNGLSNPGIVATDVV  197

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
             SFKTALWFWMNN HS+++  QGFGATI+AING +EC+G N   V  RV+YY  YC QLG
Sbjct  198  TSFKTALWFWMNNVHSVLS--QGFGATIQAINGAVECNGGNTAAVNARVQYYKDYCSQLG  255

Query  833  VDPGNNLEC  859
            V PG+NL C
Sbjct  256  VSPGDNLTC  264



>dbj|BAA22967.1| chitinase [Chenopodium amaranticolor]
Length=267

 Score =   334 bits (856),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 155/249 (62%), Positives = 192/249 (77%), Gaps = 6/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCA G+CCSQ+GYCG GD YCG+GC++GPCY      +    V  +V+DAFFNGI +
Sbjct  25   QNCGCASGVCCSQYGYCGNGDAYCGKGCQQGPCYSSTGSGAVS--VQSLVTDAFFNGIIN  82

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA SSC GK FYTR++FL+A+ +YPQFG  GS+DD+KRE+AAFFAHVTHETG  CYI+EI
Sbjct  83   QAGSSCAGKRFYTRSAFLNALGNYPQFGKGGSSDDTKREVAAFFAHVTHETGSFCYIEEI  142

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
               +  YC+ + T +PC P K YYGRGP+QL+WN+NYG AG+SIGFDG+N P+ VA +P+
Sbjct  143  SKST--YCNASAT-WPCNPSKQYYGRGPLQLTWNYNYGAAGRSIGFDGINAPETVANNPV  199

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
             +F+TA WFWMNN HS+I SG+GFGATIRAIN  +EC+G N   V  RV+ Y QYC Q G
Sbjct  200  TAFRTAFWFWMNNVHSIINSGRGFGATIRAIN-SIECNGGNTGAVNSRVQLYRQYCNQFG  258

Query  833  VDPGNNLEC  859
            V PGNNL C
Sbjct  259  VSPGNNLSC  267



>dbj|BAA22965.1| chitinase [Chenopodium amaranticolor]
Length=275

 Score =   334 bits (856),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/255 (63%), Positives = 194/255 (76%), Gaps = 10/255 (4%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgg------gsVADIVSDAF  274
            QNCGCA GLCCS++GYCGT   YCG+GCK+GPCY        G       SV  +V++AF
Sbjct  25   QNCGCASGLCCSKYGYCGTTKAYCGDGCKQGPCYSSTPTTPSGGGGGGGASVQSLVTNAF  84

Query  275  FNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHM  454
            FNGI +QA S C GK FYTR++FL+A+ +YPQFG  GS+DD+KRE+AAFFAHVTHETGH 
Sbjct  85   FNGILNQAGSGCAGKSFYTRSAFLNALGNYPQFGKGGSSDDTKREVAAFFAHVTHETGHF  144

Query  455  CYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDV  634
            CYI+EI      YC +++ Q+PC P K YYGRGPIQ++WN+NYG AG+SIGFDG+N P+ 
Sbjct  145  CYIEEI--AKSTYC-QSSAQWPCNPNKQYYGRGPIQITWNYNYGAAGKSIGFDGINAPET  201

Query  635  VATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQ  814
            VA +P+I+FKTA WFWMNN HS I SGQGFG+TIRA+NG  EC G N   V  RV YYTQ
Sbjct  202  VANNPVIAFKTAFWFWMNNVHSRIISGQGFGSTIRAVNGG-ECGGGNTPAVNARVGYYTQ  260

Query  815  YCQQLGVDPGNNLEC  859
            YC+QLGV PGNNL C
Sbjct  261  YCKQLGVSPGNNLSC  275



>emb|CAA61281.1| chitinase class 4 [Vigna unguiculata]
Length=249

 Score =   330 bits (846),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 166/250 (66%), Positives = 195/250 (78%), Gaps = 5/250 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCAEGLCCSQ+GYCGTG++YCG GC++GPC    S  S   +VADIV+DAFFNGI D
Sbjct  4    QNCGCAEGLCCSQYGYCGTGEEYCGTGCQQGPC-TSSSSLSNNVNVADIVTDAFFNGIID  62

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QADS C GK FY R +FL A++SY  FG VGS DDSKREIAA FAH THETGH CYI+EI
Sbjct  63   QADSGCVGKSFYARDAFLSALDSYTDFGRVGSEDDSKREIAAAFAHFTHETGHFCYIEEI  122

Query  473  DGESRDYCDKTN-TQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDP  649
            DG S+DYCD+ +  QYPC+  + Y    PIQLSWNFNYGPAG++  FDGL  P+ V+ D 
Sbjct  123  DGASKDYCDEDSIAQYPCSSSRGY-TVVPIQLSWNFNYGPAGEANNFDGLGPPETVSNDV  181

Query  650  IISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQL  829
            ++SFKTALW+WM +   +I   QGF ATIRAINGQLECDGANP TV+ RV YYT+YC+QL
Sbjct  182  VVSFKTALWYWMQHVRPVIN--QGFAATIRAINGQLECDGANPSTVQARVNYYTEYCRQL  239

Query  830  GVDPGNNLEC  859
            GVD G+NL C
Sbjct  240  GVDTGDNLTC  249



>ref|XP_009609718.1| PREDICTED: chitinase 6-like, partial [Nicotiana tomentosiformis]
Length=189

 Score =   328 bits (840),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA S+CEGKGFYTR  FL+A+ SYP FGT+GS DDSKREIAAFFAHVTHETGHMC+I EI
Sbjct  1    QAASTCEGKGFYTRARFLEALQSYPNFGTMGSTDDSKREIAAFFAHVTHETGHMCFINEI  60

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G S DYCD+ NT+YPC  GK YYGRGPIQLSWNFNYGPAG+SIGFDGLN+PD+VA D +
Sbjct  61   NGPSLDYCDENNTEYPCVSGKNYYGRGPIQLSWNFNYGPAGKSIGFDGLNDPDIVARDAV  120

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ISFKTALW+WMNNCHSLITSGQGFG TIRAINGQ+ECDG NP TV +RVEYYT+YCQQLG
Sbjct  121  ISFKTALWYWMNNCHSLITSGQGFGPTIRAINGQIECDGGNPQTVARRVEYYTEYCQQLG  180

Query  833  VDPGNNLEC  859
            V+ G+NL C
Sbjct  181  VETGDNLTC  189



>gb|ACJ61929.1| chitinase [Zea mays subsp. parviglumis]
Length=273

 Score =   331 bits (848),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 160/249 (64%), Positives = 191/249 (77%), Gaps = 3/249 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC    CCS++GYCGT DDYCG+GC+ GPC        GG +VA++VSDAFFNGI +
Sbjct  28   QNCGCQPNFCCSKFGYCGTTDDYCGDGCQSGPCRSGGGGGGGGANVANVVSDAFFNGIKN  87

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHETG  CYI EI
Sbjct  88   QAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETGRFCYISEI  147

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            + +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ VA D +
Sbjct  148  N-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLGDPNRVAQDAV  206

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY QYCQQL 
Sbjct  207  ITFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQYCQQLC  264

Query  833  VDPGNNLEC  859
            VDPG NL C
Sbjct  265  VDPGPNLTC  273



>dbj|BAJ93881.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=269

 Score =   330 bits (847),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 154/249 (62%), Positives = 184/249 (74%), Gaps = 3/249 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCA   CCS+WG+CGT  ++CG GC+ GPC     P +   SV  IV+ AFF  +  
Sbjct  24   QNCGCAATECCSRWGFCGTTREHCGTGCRSGPC---TVPVTNNVSVPAIVTPAFFGALVS  80

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA   C  KGFYTR +FL A+  YP FG  GS DDSKREIAAFFAHV HET   CYI EI
Sbjct  81   QAADDCAAKGFYTRDAFLTALGGYPAFGRTGSDDDSKREIAAFFAHVNHETIKFCYIDEI  140

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G S++YCD TNT++PC  GK YYGRGP+Q+SWN+NYG AGQS+GFDGLN+PD VA  P+
Sbjct  141  NGPSKNYCDPTNTEWPCVAGKGYYGRGPLQISWNYNYGAAGQSLGFDGLNDPDAVARSPV  200

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ++F+ ALW+WMN+ H +I SGQGFGATIRAING LEC+G NP  V  RV YY Q+CQQ G
Sbjct  201  LAFQAALWYWMNSVHDVIVSGQGFGATIRAINGALECNGKNPTAVNDRVAYYKQFCQQFG  260

Query  833  VDPGNNLEC  859
            VDPG +L C
Sbjct  261  VDPGTSLTC  269



>ref|XP_004976079.1| PREDICTED: endochitinase A-like [Setaria italica]
Length=274

 Score =   330 bits (847),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 160/251 (64%), Positives = 186/251 (74%), Gaps = 5/251 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsV--ADIVSDAFFNGI  286
            Q+CGC    CCS++GYCGT  DYCG+GC+ GPC    +    G  V    +V+DAFFNGI
Sbjct  27   QSCGCQPNFCCSKFGYCGTTIDYCGDGCRSGPCIGSGTGTGSGSGVDVGSVVTDAFFNGI  86

Query  287  ADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIK  466
              QA   CEG  FY+R +FL+A  +Y  F   GSADD KREIAAFFAHVTHETGH CYI 
Sbjct  87   KSQAGGGCEGSNFYSRDAFLNAAGAYSGFAHGGSADDGKREIAAFFAHVTHETGHFCYIS  146

Query  467  EIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATD  646
            EI+ +   YCD + TQ+PCA GK YYGRGP+Q+SWN+NYGPAGQSIGFDGL NPD VA D
Sbjct  147  EIN-KDNSYCDSSKTQWPCAAGKKYYGRGPLQISWNYNYGPAGQSIGFDGLGNPDAVAQD  205

Query  647  PIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQ  826
            P+I+FKTA WFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY QYCQQ
Sbjct  206  PVIAFKTAFWFWMNNVHGVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYQQYCQQ  263

Query  827  LGVDPGNNLEC  859
            LGVDPG+NL C
Sbjct  264  LGVDPGSNLTC  274



>gb|AAT40038.1| chitinase [Zea mays subsp. parviglumis]
Length=274

 Score =   329 bits (843),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 162/252 (64%), Positives = 193/252 (77%), Gaps = 6/252 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC---YHppsppsgggsVADIVSDAFFNG  283
            QNCGC    CCS++GYCGT DDYCG+GC+ GPC          SGG +VA++VSDAFFNG
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDDYCGDGCQSGPCRSGGGGGGGGSGGANVANVVSDAFFNG  85

Query  284  IADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYI  463
            I +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHETGH CYI
Sbjct  86   IKNQAGSGCEGKSFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETGHFCYI  145

Query  464  KEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVAT  643
             EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ VA 
Sbjct  146  SEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNRVAQ  204

Query  644  DPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQ  823
            D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY QYCQ
Sbjct  205  DAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQYCQ  262

Query  824  QLGVDPGNNLEC  859
            QL VDPG NL C
Sbjct  263  QLRVDPGPNLTC  274



>gb|ACX37090.1| chitinase [Zea mays]
Length=278

 Score =   328 bits (842),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 163/255 (64%), Positives = 192/255 (75%), Gaps = 9/255 (4%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC------YHppsppsgggsVADIVSDAF  274
            QNCGC    CCS++GYCGT DDYCG+GC+ GPC             SGG +VA++VSDAF
Sbjct  27   QNCGCQPNFCCSKFGYCGTTDDYCGDGCQSGPCRSGGGGGGGGGGGSGGANVANVVSDAF  86

Query  275  FNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHM  454
            FNGI +QA S CEGK FYTR++FL AVN YP F   G+  + KREIAAFFAHVTHETGH 
Sbjct  87   FNGIKNQAGSGCEGKNFYTRSAFLSAVNKYPGFAHGGTEVEGKREIAAFFAHVTHETGHF  146

Query  455  CYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDV  634
            CYI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ 
Sbjct  147  CYISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNR  205

Query  635  VATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQ  814
            VA D +I+FKTALWFWMNN H L+   QGFGATIRAING LEC+G NP  +  RV YY Q
Sbjct  206  VAQDAVIAFKTALWFWMNNVHRLMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQ  263

Query  815  YCQQLGVDPGNNLEC  859
            YCQQL VDPG NL C
Sbjct  264  YCQQLRVDPGPNLTC  278



>ref|XP_002452418.1| hypothetical protein SORBIDRAFT_04g025430 [Sorghum bicolor]
 gb|EES05394.1| hypothetical protein SORBIDRAFT_04g025430 [Sorghum bicolor]
Length=270

 Score =   328 bits (841),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 155/250 (62%), Positives = 186/250 (74%), Gaps = 4/250 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCG-EGCKEGPCYHppsppsgggsVADIVSDAFFNGIA  289
            QNCGCA   CCS++GYCGTG+DYCG + C+ GPC     P +   SVA IV+ AFF+ + 
Sbjct  24   QNCGCASDQCCSKYGYCGTGEDYCGADTCQSGPC---DVPATNNVSVASIVTPAFFDALL  80

Query  290  DQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKE  469
             QA +SCE  GFYTR +FL A   YP FG  G+ DDSKREIAAFF +  HET   CYI E
Sbjct  81   AQAAASCEANGFYTRDAFLAAAGYYPSFGRTGTVDDSKREIAAFFGNANHETIKFCYINE  140

Query  470  IDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDP  649
            IDG S++YCD  NT++PC  GK YYGRGP+Q+SWN+NYGPAGQSIGFDGL +PD VA   
Sbjct  141  IDGPSKNYCDANNTEWPCQAGKGYYGRGPLQISWNYNYGPAGQSIGFDGLGDPDAVARSA  200

Query  650  IISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQL  829
            +++F+ ALW+WMN+ H +  SGQGFGATIRAING LECDG NPD+V  RV YY Q+CQ  
Sbjct  201  VVAFRAALWYWMNSVHGVFVSGQGFGATIRAINGALECDGKNPDSVNDRVAYYKQFCQDF  260

Query  830  GVDPGNNLEC  859
            GVDPG+NL C
Sbjct  261  GVDPGSNLTC  270



>emb|CAA87074.1| pathogenesis-related protein, PR-3 type [Sambucus nigra]
Length=247

 Score =   327 bits (838),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 153/207 (74%), Positives = 174/207 (84%), Gaps = 4/207 (2%)
 Frame = +2

Query  248  VADIVSDAFFNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFA  427
            VADIV+DAFFNGI +  D SC G+GFYTR SFL AVN+ PQFGT GS+DD++REIAAFFA
Sbjct  42   VADIVTDAFFNGIIN-PDGSCPGRGFYTRASFLQAVNANPQFGTTGSSDDARREIAAFFA  100

Query  428  HVTHETGHMCYIKEIDGESRD---YCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQ  598
            H +HETG  CY +EI G S D   YCD+ NTQYPCA G+ Y+GRGP+QLSWN+NYGPAGQ
Sbjct  101  HASHETGRFCYREEIAGPSLDPSVYCDEQNTQYPCASGQRYHGRGPLQLSWNYNYGPAGQ  160

Query  599  SIGFDGLNNPDVVATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANP  778
            SIGFDGLNNP +VA DP+ISF+ +LWFWMNN HS+ITSGQGFGATIRAINGQLEC+GANP
Sbjct  161  SIGFDGLNNPQIVANDPVISFRASLWFWMNNVHSIITSGQGFGATIRAINGQLECNGANP  220

Query  779  DTVRKRVEYYTQYCQQLGVDPGNNLEC  859
            DTV  RV +YTQYC QLGV PG NL C
Sbjct  221  DTVTSRVNFYTQYCGQLGVSPGENLRC  247



>ref|XP_004291061.1| PREDICTED: endochitinase PR4-like [Fragaria vesca subsp. vesca]
Length=275

 Score =   327 bits (838),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 161/251 (64%), Positives = 189/251 (75%), Gaps = 6/251 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgg--gsVADIVSDAFFNGI  286
            QNCGCA  LCCS++GYCGTGD YCG+GC+ GPC    +P       SVADIV+  FFNGI
Sbjct  29   QNCGCAADLCCSEFGYCGTGDAYCGKGCQAGPCTTTTTPTPTTGGSSVADIVTTDFFNGI  88

Query  287  ADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIK  466
             +QA S C GK FYTR +FLDA+ SY  F T GSADD+KREIAAFFAHVTHETGH CY++
Sbjct  89   INQAGSDCAGKSFYTRQAFLDALGSYTDFATTGSADDNKREIAAFFAHVTHETGHFCYVE  148

Query  467  EIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATD  646
            EI  E   YCD + T YPC P K YYGRGP+QL+WN+NYG AG +IGFDGLN+P+ VA+D
Sbjct  149  EI--EKATYCDTSFTNYPCNPAKQYYGRGPLQLTWNYNYGAAGTAIGFDGLNSPETVASD  206

Query  647  PIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQ  826
             +++FKT LWFWMNN HS+I+  QGFGAT RAING +ECDG  PD V+ R+ YY  YC Q
Sbjct  207  SVVAFKTGLWFWMNNVHSVIS--QGFGATTRAINGAVECDGKAPDKVQARINYYKDYCTQ  264

Query  827  LGVDPGNNLEC  859
            L V PG NL C
Sbjct  265  LNVSPGENLYC  275



>ref|XP_004953034.1| PREDICTED: chitinase 6-like [Setaria italica]
Length=274

 Score =   327 bits (837),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 154/250 (62%), Positives = 185/250 (74%), Gaps = 4/250 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            Q CGCA GLCCS++G+CGTG+DYCG GC+ GPC     P +   SVA IV+ AFF+ +  
Sbjct  28   QKCGCATGLCCSRFGFCGTGNDYCGTGCQSGPC---NMPATNNVSVASIVTPAFFDALLA  84

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA + CE KGFYTR +FL A   YP FG  G+ADDS+REIAAFF +  HET   CY+ EI
Sbjct  85   QAAAGCEAKGFYTRDAFLAAAGYYPSFGRTGTADDSRREIAAFFGNANHETIRFCYVNEI  144

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            DG S++YCD  NT++PC  GK YYGRGP+Q+SWN+NYGPAGQSIGFDGL +PD VA   +
Sbjct  145  DGPSKNYCDAGNTEWPCQAGKGYYGRGPLQISWNYNYGPAGQSIGFDGLGDPDAVARSAV  204

Query  653  ISFKTALWFWMNNCHS-LITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQL  829
            ++F+ ALW+WMNN H  L+ SG GFGATIRAING LEC G NP  V  RV YY Q+CQ  
Sbjct  205  VAFRAALWYWMNNVHEPLLASGGGFGATIRAINGALECGGKNPTAVNSRVGYYKQFCQDF  264

Query  830  GVDPGNNLEC  859
            GVDPG+NL C
Sbjct  265  GVDPGSNLTC  274



>gb|AAT40041.1| chitinase [Zea mays subsp. parviglumis]
Length=276

 Score =   327 bits (837),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 161/252 (64%), Positives = 192/252 (76%), Gaps = 6/252 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC---YHppsppsgggsVADIVSDAFFNG  283
            QNCGC    CCS++GYCGT D YCG+GC+ GPC          SGG +VA++VSDAFFNG
Sbjct  28   QNCGCQPNFCCSKFGYCGTTDAYCGDGCQSGPCRSGGGGGGGGSGGANVANVVSDAFFNG  87

Query  284  IADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYI  463
            I +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHETGH CYI
Sbjct  88   IKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETGHFCYI  147

Query  464  KEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVAT  643
             EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ VA 
Sbjct  148  SEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNRVAQ  206

Query  644  DPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQ  823
            D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY QYCQ
Sbjct  207  DAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQYCQ  264

Query  824  QLGVDPGNNLEC  859
            QL VDPG NL C
Sbjct  265  QLRVDPGPNLTC  276



>gb|AAT40047.1| chitinase [Zea mays subsp. parviglumis]
 gb|AAT40048.1| chitinase [Zea mays subsp. parviglumis]
Length=278

 Score =   326 bits (836),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 161/255 (63%), Positives = 192/255 (75%), Gaps = 9/255 (4%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC------YHppsppsgggsVADIVSDAF  274
            QNCGC    CCS++GYCGT DDYCG+GC+ GPC             SGG +VA++V+DAF
Sbjct  27   QNCGCQPNFCCSKFGYCGTTDDYCGDGCQSGPCRSGGGGGGGGGGGSGGANVANVVTDAF  86

Query  275  FNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHM  454
            FNGI +QA S CEGK FYTR++FL AVN YP F   G+  + KREIAAFFAHVTHETGH 
Sbjct  87   FNGIKNQAGSGCEGKNFYTRSAFLSAVNKYPGFAHGGTEVEGKREIAAFFAHVTHETGHF  146

Query  455  CYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDV  634
            CYI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ 
Sbjct  147  CYISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNR  205

Query  635  VATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQ  814
            VA D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY Q
Sbjct  206  VAQDAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQ  263

Query  815  YCQQLGVDPGNNLEC  859
            YCQQL VDPG NL C
Sbjct  264  YCQQLRVDPGPNLTC  278



>gb|AAT40042.1| chitinase [Zea mays subsp. parviglumis]
Length=279

 Score =   326 bits (836),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 160/255 (63%), Positives = 192/255 (75%), Gaps = 9/255 (4%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgg------gsVADIVSDAF  274
            QNCGC    CCS++GYCGT D YCG+GC+ GPC+       GG       +VA++VSDAF
Sbjct  28   QNCGCQPNFCCSKFGYCGTTDAYCGDGCQSGPCHSGGGGGGGGGGGSGGANVANVVSDAF  87

Query  275  FNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHM  454
            FNGI +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHETGH 
Sbjct  88   FNGIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETGHF  147

Query  455  CYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDV  634
            CYI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ 
Sbjct  148  CYISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNR  206

Query  635  VATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQ  814
            VA D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY Q
Sbjct  207  VAQDAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQ  264

Query  815  YCQQLGVDPGNNLEC  859
            YCQQL VDPG NL C
Sbjct  265  YCQQLRVDPGPNLTC  279



>ref|XP_007223824.1| hypothetical protein PRUPE_ppa010731mg [Prunus persica]
 gb|EMJ25023.1| hypothetical protein PRUPE_ppa010731mg [Prunus persica]
Length=238

 Score =   324 bits (831),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 173/204 (85%), Gaps = 2/204 (1%)
 Frame = +2

Query  248  VADIVSDAFFNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFA  427
            VADIV+  FFNGI  QAD+SC GK FY+R +FL+A+ SY QFG +GS DDSKREIAAFFA
Sbjct  37   VADIVTPEFFNGIIGQADASCAGKNFYSRATFLEALKSYDQFGKIGSIDDSKREIAAFFA  96

Query  428  HVTHETGHMCYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIG  607
            HVTHET H CYI+EIDG S+DYCD+TNTQYPC   K YYGRGPIQLSWNFNYGPAG+SIG
Sbjct  97   HVTHETFHFCYIEEIDGPSKDYCDETNTQYPCKSNKGYYGRGPIQLSWNFNYGPAGESIG  156

Query  608  FDGLNNPDVVATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTV  787
            FDGLN+P+ VA DPII+FKTALW+WM +   +I  G+GFGATIRAING LECDG NPDTV
Sbjct  157  FDGLNSPETVANDPIIAFKTALWYWMTHVRPVI--GEGFGATIRAINGALECDGGNPDTV  214

Query  788  RKRVEYYTQYCQQLGVDPGNNLEC  859
            +KRVEY+T+YC QLG+ PG+NL C
Sbjct  215  QKRVEYFTEYCNQLGIAPGDNLTC  238



>gb|ACJ61928.1| chitinase [Zea mays subsp. parviglumis]
Length=276

 Score =   326 bits (835),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 161/254 (63%), Positives = 192/254 (76%), Gaps = 8/254 (3%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC-----YHppsppsgggsVADIVSDAFF  277
            QNCGC    CCS++GYCGT DDYCG+GC+ GPC            SGG +VA++V+DAFF
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDDYCGDGCQSGPCRSGGGGGGGGGGSGGANVANVVTDAFF  85

Query  278  NGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMC  457
            NGI +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHETG  C
Sbjct  86   NGIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETGRFC  145

Query  458  YIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVV  637
            YI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ V
Sbjct  146  YISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNRV  204

Query  638  ATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQY  817
            A D +I+FKTALWFWMNN H L+   QGFGATIRAING LEC+G NP  +  RV YY QY
Sbjct  205  AQDAVIAFKTALWFWMNNVHRLMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQY  262

Query  818  CQQLGVDPGNNLEC  859
            CQQL VDPG NL C
Sbjct  263  CQQLRVDPGPNLTC  276



>gb|AAT40046.1| chitinase [Zea mays subsp. parviglumis]
Length=277

 Score =   325 bits (834),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 161/255 (63%), Positives = 192/255 (75%), Gaps = 9/255 (4%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC------YHppsppsgggsVADIVSDAF  274
            QNCGC    CCS++GYCGT D YCG+GC+ GPC             SGG +VA++VSDAF
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDAYCGDGCQSGPCRSGGGGGGGGGGGSGGANVANVVSDAF  85

Query  275  FNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHM  454
            FNGI +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHETGH 
Sbjct  86   FNGIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETGHF  145

Query  455  CYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDV  634
            CYI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ 
Sbjct  146  CYISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNR  204

Query  635  VATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQ  814
            VA D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY Q
Sbjct  205  VAQDAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQ  262

Query  815  YCQQLGVDPGNNLEC  859
            YCQQL VDPG NL C
Sbjct  263  YCQQLRVDPGPNLTC  277



>gb|ACJ61916.1| chitinase [Zea mays subsp. parviglumis]
Length=279

 Score =   325 bits (834),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 161/255 (63%), Positives = 192/255 (75%), Gaps = 9/255 (4%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC------YHppsppsgggsVADIVSDAF  274
            QNCGC    CCS++GYCGT DDYCG+GC+ GPC             SGG +VA++VSDAF
Sbjct  28   QNCGCQPNFCCSKFGYCGTTDDYCGDGCQSGPCRSGGGGGGGGGGGSGGANVANVVSDAF  87

Query  275  FNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHM  454
            FNGI +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHETG  
Sbjct  88   FNGIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETGRF  147

Query  455  CYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDV  634
            CYI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ 
Sbjct  148  CYISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLGDPNR  206

Query  635  VATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQ  814
            VA D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY Q
Sbjct  207  VAQDAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQ  264

Query  815  YCQQLGVDPGNNLEC  859
            YCQQL VDPG NL C
Sbjct  265  YCQQLRVDPGPNLTC  279



>gb|AAT40039.1| chitinase [Zea mays subsp. parviglumis]
Length=278

 Score =   325 bits (833),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 161/256 (63%), Positives = 192/256 (75%), Gaps = 10/256 (4%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC-------YHppsppsgggsVADIVSDA  271
            QNCGC    CCS++GYCGT D YCG+GC+ GPC              SGG +VA++V+DA
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDAYCGDGCQSGPCRSGGGGGGSGGGGGSGGANVANVVTDA  85

Query  272  FFNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGH  451
            FFNGI +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHETGH
Sbjct  86   FFNGIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETGH  145

Query  452  MCYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPD  631
             CYI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+
Sbjct  146  FCYISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPN  204

Query  632  VVATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYT  811
             VA D +I+FKTALWFWMNN H L+   QGFGATIRAING LEC+G NP  +  RV YY 
Sbjct  205  RVAQDAVIAFKTALWFWMNNVHRLMP--QGFGATIRAINGALECNGNNPAQMNARVGYYK  262

Query  812  QYCQQLGVDPGNNLEC  859
            QYCQQL VDPG NL C
Sbjct  263  QYCQQLRVDPGPNLTC  278



>ref|XP_008222566.1| PREDICTED: endochitinase PR4-like [Prunus mume]
Length=238

 Score =   323 bits (829),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 149/204 (73%), Positives = 174/204 (85%), Gaps = 2/204 (1%)
 Frame = +2

Query  248  VADIVSDAFFNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFA  427
            VADIV+  FFNGI DQAD+SC GK FY+R +FL+A+ SY QFG +GS DDSKREIAAFFA
Sbjct  37   VADIVTPKFFNGIIDQADASCVGKNFYSRATFLEALKSYDQFGKIGSIDDSKREIAAFFA  96

Query  428  HVTHETGHMCYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIG  607
            HVTHET H CYI+EIDG S+DYCD++NTQYPC P K YYGRGPIQLSWNFNYGPAG++IG
Sbjct  97   HVTHETFHFCYIEEIDGPSKDYCDESNTQYPCKPNKGYYGRGPIQLSWNFNYGPAGENIG  156

Query  608  FDGLNNPDVVATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTV  787
            FDGLN+P+ VA DPII+FKTALW+WM +   +I  G+GFGATIRAING LECDG NP TV
Sbjct  157  FDGLNSPETVANDPIIAFKTALWYWMTHVRPVI--GEGFGATIRAINGALECDGGNPATV  214

Query  788  RKRVEYYTQYCQQLGVDPGNNLEC  859
            +KRVEY+T+YC QLG+ PG+NL C
Sbjct  215  QKRVEYFTEYCNQLGIAPGDNLTC  238



>gb|ACJ61920.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ61924.1| chitinase [Zea mays subsp. parviglumis]
Length=277

 Score =   325 bits (833),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 161/255 (63%), Positives = 192/255 (75%), Gaps = 9/255 (4%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC------YHppsppsgggsVADIVSDAF  274
            QNCGC    CCS++GYCGT DDYCG+GC+ GPC             SGG +VA++VSDAF
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDDYCGDGCQSGPCRSGGGGGGGGGGGSGGANVANVVSDAF  85

Query  275  FNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHM  454
            FNGI +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHETG  
Sbjct  86   FNGIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETGRF  145

Query  455  CYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDV  634
            CYI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ 
Sbjct  146  CYISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNR  204

Query  635  VATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQ  814
            VA D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY Q
Sbjct  205  VAQDAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQ  262

Query  815  YCQQLGVDPGNNLEC  859
            YCQQL VDPG NL C
Sbjct  263  YCQQLRVDPGPNLTC  277



>gb|AAK92198.1|AF402937_1 chitinase-B [Saccharum officinarum]
Length=261

 Score =   324 bits (831),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 159/249 (64%), Positives = 193/249 (78%), Gaps = 5/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC    CCS++GYCGT DDYCG+GC+ GPC       SGGG+VA +V+DAFFNGI +
Sbjct  18   QNCGCQPNYCCSKFGYCGTTDDYCGDGCQSGPCRSGGGASSGGGNVASVVTDAFFNGIKN  77

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA + CEGK FYTR++FL A +SY  FG  G + + KREIAAFFAHVTHETGH CYI EI
Sbjct  78   QAGNGCEGKNFYTRSAFLSAADSYKGFG--GGSVEGKREIAAFFAHVTHETGHFCYISEI  135

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            + ++  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ VA D +
Sbjct  136  N-KNNAYCDSSNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLGDPNRVAQDAV  194

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            I+FKTALWFW NN H +++  QGFGATIRAING LEC+G NP  +  RV YY QYCQQLG
Sbjct  195  IAFKTALWFWTNNVHRVMS--QGFGATIRAINGALECNGNNPAQMNARVGYYKQYCQQLG  252

Query  833  VDPGNNLEC  859
            VDPG NL C
Sbjct  253  VDPGPNLTC  261



>gb|AAT40040.1| chitinase [Zea mays subsp. parviglumis]
Length=276

 Score =   325 bits (832),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 160/254 (63%), Positives = 192/254 (76%), Gaps = 8/254 (3%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC-----YHppsppsgggsVADIVSDAFF  277
            QNCGC    CCS++GYCGT D YCG+GC+ GPC            SGG +VA++V+DAFF
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDAYCGDGCQSGPCRSGGGGGGGGGGSGGANVANVVTDAFF  85

Query  278  NGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMC  457
            NGI +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHETGH C
Sbjct  86   NGIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETGHFC  145

Query  458  YIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVV  637
            YI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ V
Sbjct  146  YISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNRV  204

Query  638  ATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQY  817
            A D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY QY
Sbjct  205  AQDAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQY  262

Query  818  CQQLGVDPGNNLEC  859
            CQQL VDPG NL C
Sbjct  263  CQQLRVDPGPNLTC  276



>gb|ACJ61895.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ61898.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ61899.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ61901.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ61902.1| chitinase [Zea mays subsp. parviglumis]
Length=276

 Score =   325 bits (832),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 160/252 (63%), Positives = 191/252 (76%), Gaps = 6/252 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC---YHppsppsgggsVADIVSDAFFNG  283
            QNCGC    CCS++GYCGT DDYCG+GC+ GPC          SGG +VA++V+DAFFNG
Sbjct  28   QNCGCQPNFCCSKFGYCGTTDDYCGDGCQSGPCRSGGGGGGGGSGGANVANVVTDAFFNG  87

Query  284  IADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYI  463
            I +QA S CEGK FYTR++FL AVN YP F   G+  + KREIAAFFAHVTHETG  CYI
Sbjct  88   IKNQAGSGCEGKNFYTRSAFLSAVNKYPGFAHGGTEVEGKREIAAFFAHVTHETGRFCYI  147

Query  464  KEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVAT  643
             EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ VA 
Sbjct  148  SEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNRVAQ  206

Query  644  DPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQ  823
            D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY QYCQ
Sbjct  207  DAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQYCQ  264

Query  824  QLGVDPGNNLEC  859
            QL VDPG NL C
Sbjct  265  QLRVDPGPNLTC  276



>gb|ACJ61887.1| chitinase [Zea mays subsp. parviglumis]
Length=275

 Score =   325 bits (832),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 160/253 (63%), Positives = 192/253 (76%), Gaps = 7/253 (3%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC----YHppsppsgggsVADIVSDAFFN  280
            QNCGC    CCS++GYCGT DDYCG+GC+ GPC           SGG +VA++V+DAFFN
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDDYCGDGCQSGPCRSGGGGGGGGGSGGANVANVVTDAFFN  85

Query  281  GIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCY  460
            GI +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHETG  CY
Sbjct  86   GIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETGRFCY  145

Query  461  IKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVA  640
            I EI+ ++  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ VA
Sbjct  146  ISEIN-KNNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNRVA  204

Query  641  TDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYC  820
             D +I+FKTALWFWMNN H L+   QGFGATIRAING LEC+G NP  +  RV YY QYC
Sbjct  205  QDAVIAFKTALWFWMNNVHRLMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQYC  262

Query  821  QQLGVDPGNNLEC  859
            QQL VDPG NL C
Sbjct  263  QQLRVDPGPNLTC  275



>ref|XP_010687455.1| PREDICTED: endochitinase A-like [Beta vulgaris subsp. vulgaris]
Length=267

 Score =   324 bits (831),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 156/249 (63%), Positives = 192/249 (77%), Gaps = 6/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            Q CGCA GLCCS+WGYCGT   YCG+GC++GPCY   + PSG  SV ++V+DAFFN I +
Sbjct  25   QKCGCASGLCCSRWGYCGTTAAYCGDGCQQGPCY-SSTTPSGSVSVPNLVTDAFFNRIIN  83

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA S C GK FYTR++FL A+ SYPQFG+ GS+D  +RE+AAFFAH+TH+TGH CYI+EI
Sbjct  84   QASSGCAGKRFYTRSAFLSALRSYPQFGS-GSSDAVRREVAAFFAHLTHKTGHFCYIEEI  142

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
               +  YC  + T +PC P K YYGRGP+Q++WN+NYG AG+SIGFDGLN P++V  + +
Sbjct  143  AKAT--YCQSSRT-WPCNPNKKYYGRGPLQITWNYNYGAAGRSIGFDGLNKPEIVVNNAV  199

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            I+FKTA WFWMNN HS I SGQGF ++IRAING  EC+G N   V  RV+YYTQYC QLG
Sbjct  200  IAFKTAFWFWMNNVHSRIVSGQGFASSIRAINGG-ECNGGNKRAVNARVKYYTQYCNQLG  258

Query  833  VDPGNNLEC  859
            V PGNNL C
Sbjct  259  VSPGNNLSC  267



>gb|ACJ61917.1| chitinase [Zea mays subsp. parviglumis]
Length=278

 Score =   325 bits (832),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 161/256 (63%), Positives = 192/256 (75%), Gaps = 10/256 (4%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC-------YHppsppsgggsVADIVSDA  271
            QNCGC    CCS++GYCGT DDYCG+GC+ GPC              SGG +VA++VSDA
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDDYCGDGCQSGPCRSGGGGGGGGGGGGSGGANVANVVSDA  85

Query  272  FFNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGH  451
            FFNGI +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHETG 
Sbjct  86   FFNGIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETGR  145

Query  452  MCYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPD  631
             CYI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+
Sbjct  146  FCYISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPN  204

Query  632  VVATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYT  811
             VA D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY 
Sbjct  205  RVAQDAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYK  262

Query  812  QYCQQLGVDPGNNLEC  859
            QYCQQL VDPG NL C
Sbjct  263  QYCQQLRVDPGPNLTC  278



>gb|AAT40049.1| chitinase [Zea mays subsp. parviglumis]
Length=277

 Score =   325 bits (832),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 160/255 (63%), Positives = 192/255 (75%), Gaps = 9/255 (4%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC------YHppsppsgggsVADIVSDAF  274
            QNCGC    CCS++GYCGT D YCG+GC+ GPC             SGG +VA++V+DAF
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDAYCGDGCQSGPCRSGGGGGGGGGGGSGGANVANVVTDAF  85

Query  275  FNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHM  454
            FNGI +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHETGH 
Sbjct  86   FNGIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETGHF  145

Query  455  CYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDV  634
            CYI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ 
Sbjct  146  CYISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLGDPNR  204

Query  635  VATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQ  814
            VA D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY Q
Sbjct  205  VAQDAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQ  262

Query  815  YCQQLGVDPGNNLEC  859
            YCQQL VDPG NL C
Sbjct  263  YCQQLRVDPGPNLTC  277



>gb|ACJ61921.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ61925.1| chitinase [Zea mays subsp. parviglumis]
Length=278

 Score =   325 bits (832),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 161/255 (63%), Positives = 191/255 (75%), Gaps = 9/255 (4%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC------YHppsppsgggsVADIVSDAF  274
            QNCGC    CCS++GYCGT DDYCG+GC+ GPC             SGG +VA++VSDAF
Sbjct  27   QNCGCQPNFCCSKFGYCGTTDDYCGDGCQSGPCRSGGGGGGGGGGGSGGANVANVVSDAF  86

Query  275  FNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHM  454
            FNGI +QA S CEGK FYTR++FL AVN YP F   G+  + KREIAAFFAHVTHETG  
Sbjct  87   FNGIKNQAGSGCEGKNFYTRSAFLSAVNKYPGFAHGGTEVEGKREIAAFFAHVTHETGRF  146

Query  455  CYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDV  634
            CYI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ 
Sbjct  147  CYISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNR  205

Query  635  VATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQ  814
            VA D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY Q
Sbjct  206  VAQDAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQ  263

Query  815  YCQQLGVDPGNNLEC  859
            YCQQL VDPG NL C
Sbjct  264  YCQQLRVDPGPNLTC  278



>gb|ACJ61904.1| chitinase [Zea mays subsp. parviglumis]
Length=277

 Score =   325 bits (832),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 161/255 (63%), Positives = 192/255 (75%), Gaps = 9/255 (4%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC------YHppsppsgggsVADIVSDAF  274
            QNCGC    CCS++GYCGT DDYCG+GC+ GPC             SGG +VA++VSDAF
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDDYCGDGCQSGPCRSGGGGGGGGGGGSGGANVANVVSDAF  85

Query  275  FNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHM  454
            FNGI +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHETG  
Sbjct  86   FNGIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETGRF  145

Query  455  CYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDV  634
            CYI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ 
Sbjct  146  CYISEIN-KSNAYCDASNGQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNR  204

Query  635  VATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQ  814
            VA D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY Q
Sbjct  205  VAQDAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQ  262

Query  815  YCQQLGVDPGNNLEC  859
            YCQQL VDPG NL C
Sbjct  263  YCQQLRVDPGPNLTC  277



>ref|XP_010268234.1| PREDICTED: endochitinase PR4-like [Nelumbo nucifera]
Length=272

 Score =   324 bits (831),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 157/249 (63%), Positives = 186/249 (75%), Gaps = 4/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCA   CCS+ GYCG GDDYCG GC+EGPC       S G SV D+V+  FFNGI  
Sbjct  28   QNCGCAPDKCCSKHGYCGLGDDYCGSGCQEGPC---TPVTSNGVSVGDLVTPDFFNGIIG  84

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA ++CEGK FYTR +FL+A+  YP FG  G+ DDSKREIAAFFAH THETG+ C+I E 
Sbjct  85   QAAANCEGKNFYTRDAFLNALAPYPGFGQTGTPDDSKREIAAFFAHATHETGYFCFINEK  144

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +   +DYCD + TQYPCAPGK Y+GRGP+QLSWN+NYG AG+SI FDGL +P+ VATD +
Sbjct  145  EETRKDYCDPSYTQYPCAPGKQYFGRGPLQLSWNYNYGGAGKSIKFDGLGSPETVATDVV  204

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            +SFK ALWFWM N HS+ITSGQGFGATI+ IN   EC G   D V+ R+ +YT YC Q G
Sbjct  205  VSFKAALWFWMENVHSIITSGQGFGATIKKINSG-ECSGGASDKVQSRIGFYTGYCNQFG  263

Query  833  VDPGNNLEC  859
            V PG+NL C
Sbjct  264  VSPGDNLSC  272



>gb|ACJ61859.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ61863.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ61869.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ61870.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ61877.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ61880.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ61883.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ61930.1| chitinase [Zea mays subsp. parviglumis]
Length=276

 Score =   324 bits (831),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 160/254 (63%), Positives = 192/254 (76%), Gaps = 8/254 (3%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC-----YHppsppsgggsVADIVSDAFF  277
            QNCGC    CCS++GYCGT DDYCG+GC+ GPC            SGG +VA++V+DAFF
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDDYCGDGCQSGPCRSGGGGGGGGGGSGGANVANVVTDAFF  85

Query  278  NGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMC  457
            NGI +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHETG  C
Sbjct  86   NGIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETGRFC  145

Query  458  YIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVV  637
            YI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ V
Sbjct  146  YISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNRV  204

Query  638  ATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQY  817
            A D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY QY
Sbjct  205  AQDAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQY  262

Query  818  CQQLGVDPGNNLEC  859
            CQQL VDPG NL C
Sbjct  263  CQQLRVDPGPNLTC  276



>gb|AAT40051.1| chitinase [Zea diploperennis]
Length=274

 Score =   324 bits (831),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 159/253 (63%), Positives = 192/253 (76%), Gaps = 7/253 (3%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC----YHppsppsgggsVADIVSDAFFN  280
            QNCGC    CCS++G+CGT DDYCG+GC+ GPC           SGG +VA++V+DAFFN
Sbjct  25   QNCGCQPNFCCSKFGFCGTTDDYCGDGCQSGPCRSGGGGGGGGGSGGANVANVVTDAFFN  84

Query  281  GIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCY  460
            GI +QA S CEGK FYTR++FL AV +YP F   G+  + KREIAAFFAHVTHETGH CY
Sbjct  85   GIKNQAGSGCEGKNFYTRSAFLSAVKAYPGFAHGGTEVEGKREIAAFFAHVTHETGHFCY  144

Query  461  IKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVA  640
            I EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ VA
Sbjct  145  ISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNRVA  203

Query  641  TDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYC  820
             D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY QYC
Sbjct  204  QDAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQYC  261

Query  821  QQLGVDPGNNLEC  859
            QQL VDPG NL C
Sbjct  262  QQLRVDPGPNLTC  274



>gb|ACJ61874.1| chitinase [Zea mays subsp. parviglumis]
Length=276

 Score =   324 bits (830),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 160/254 (63%), Positives = 191/254 (75%), Gaps = 8/254 (3%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC-----YHppsppsgggsVADIVSDAFF  277
            QNCGC    CCS++GYCGT DDYCG+GC+ GPC            SGG +VA++V+DAFF
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDDYCGDGCQSGPCRSGGGGGGGGGGSGGANVANVVTDAFF  85

Query  278  NGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMC  457
            NGI +QA S CEGK FYTR++FL AVN YP F   G+  + KREIAAFFAHVTHETG  C
Sbjct  86   NGIKNQAGSGCEGKNFYTRSAFLSAVNKYPGFAHGGTEVEGKREIAAFFAHVTHETGRFC  145

Query  458  YIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVV  637
            YI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ V
Sbjct  146  YISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLGDPNRV  204

Query  638  ATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQY  817
            A D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY QY
Sbjct  205  AQDAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQY  262

Query  818  CQQLGVDPGNNLEC  859
            CQQL VDPG NL C
Sbjct  263  CQQLRVDPGPNLTC  276



>gb|AAT40037.1| chitinase [Zea mays subsp. parviglumis]
Length=278

 Score =   324 bits (830),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 160/256 (63%), Positives = 192/256 (75%), Gaps = 10/256 (4%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC-------YHppsppsgggsVADIVSDA  271
            QNCGC    CCS++GYCGT D YCG+GC+ GPC              SGG +VA++V+DA
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDAYCGDGCQSGPCRSGGGGGGSGGGGGSGGANVANVVTDA  85

Query  272  FFNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGH  451
            FFNGI +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHETGH
Sbjct  86   FFNGIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETGH  145

Query  452  MCYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPD  631
             CYI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+
Sbjct  146  FCYISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPN  204

Query  632  VVATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYT  811
             VA D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY 
Sbjct  205  RVAQDAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYK  262

Query  812  QYCQQLGVDPGNNLEC  859
            QYCQQL VDPG NL C
Sbjct  263  QYCQQLRVDPGPNLTC  278



>gb|AAT40036.1| chitinase [Tripsacum dactyloides]
Length=277

 Score =   324 bits (830),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 156/253 (62%), Positives = 193/253 (76%), Gaps = 7/253 (3%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgg----gsVADIVSDAFFN  280
            QNCGC    CCS++GYCGT D+YCG+GC+ GPC+       GG     +VA++V+DAFFN
Sbjct  28   QNCGCQPNFCCSKYGYCGTSDEYCGDGCRSGPCHSGGGGGGGGGGSGANVANVVTDAFFN  87

Query  281  GIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCY  460
            GI +QA S CEGK FYTR++FL+AVN+YP F   G+  + KREIAAFFAHVTHETGH CY
Sbjct  88   GIKNQAGSGCEGKNFYTRSAFLNAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETGHFCY  147

Query  461  IKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVA  640
            I EI+ ++  YCD +N Q+PCAPG+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ VA
Sbjct  148  ISEIN-KNNAYCDASNKQWPCAPGQKYYGRGPLQISWNYNYGPAGKDIGFNGLGDPNSVA  206

Query  641  TDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYC  820
             D +I+FKTALWFWM + H ++   QGFGATIRAING LEC+G N   +  RV YY QYC
Sbjct  207  QDVVIAFKTALWFWMKSVHQVMP--QGFGATIRAINGALECNGKNTAEMNARVGYYKQYC  264

Query  821  QQLGVDPGNNLEC  859
            QQL VDPG NL C
Sbjct  265  QQLRVDPGPNLTC  277



>gb|KEH39504.1| class I chitinase [Medicago truncatula]
Length=254

 Score =   323 bits (828),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/228 (68%), Positives = 181/228 (79%), Gaps = 6/228 (3%)
 Frame = +2

Query  191  GCKEGPCYHppsppsg-----ggsVADIVSDAFFNGIADQADSSCEGKGFYTRTSFLDAV  355
            GCK+GPCY     PS        +VADIV+  FFN I DQADSSC GK FY+R  FLDA+
Sbjct  28   GCKQGPCYAGQISPSTPGPSNDVNVADIVTQEFFNSIIDQADSSCAGKNFYSRAVFLDAL  87

Query  356  NSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEIDGESRDYCDKTNTQYPCAPGK  535
             SY QFG VGS DDSKREIAA FAH THETGH CYI+E DG S+DYCD++NT+YPCAP K
Sbjct  88   GSYNQFGRVGSVDDSKREIAAAFAHFTHETGHFCYIEEKDGASKDYCDESNTEYPCAPNK  147

Query  536  MYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPIISFKTALWFWMNNCHSLITSG  715
             YYGRGPIQLSWNFNYGPAG+  GFD LN+P+ VA DP++SFKTALW+WMN+ H+++   
Sbjct  148  GYYGRGPIQLSWNFNYGPAGKDSGFDELNSPETVANDPLVSFKTALWYWMNHVHNVMNQ-  206

Query  716  QGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLGVDPGNNLEC  859
            QGFGAT+RAING+LECDG +P+TV+ RV+YYTQYC QLGV PG+ L C
Sbjct  207  QGFGATVRAINGRLECDGVDPNTVKARVDYYTQYCSQLGVAPGDKLNC  254



>gb|ACJ61914.1| chitinase [Zea mays subsp. parviglumis]
Length=276

 Score =   324 bits (830),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 160/252 (63%), Positives = 191/252 (76%), Gaps = 6/252 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC---YHppsppsgggsVADIVSDAFFNG  283
            QNCGC    CCS++GYCGT D YCG+GC+ GPC          SGG +VA++VSDAFFNG
Sbjct  28   QNCGCQPNFCCSKFGYCGTTDAYCGDGCQSGPCRSGGGGGGGGSGGANVANVVSDAFFNG  87

Query  284  IADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYI  463
            I +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHETG  CYI
Sbjct  88   IKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETGRFCYI  147

Query  464  KEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVAT  643
             EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ VA 
Sbjct  148  SEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNRVAQ  206

Query  644  DPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQ  823
            D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY QYCQ
Sbjct  207  DAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQYCQ  264

Query  824  QLGVDPGNNLEC  859
            QL VDPG NL C
Sbjct  265  QLRVDPGPNLTC  276



>gb|ACJ61934.1| chitinase [Zea mays subsp. parviglumis]
Length=277

 Score =   324 bits (830),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 161/255 (63%), Positives = 191/255 (75%), Gaps = 9/255 (4%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC------YHppsppsgggsVADIVSDAF  274
            QNCGC    CCS++GYCGT D YCG+GC+ GPC             SGG +VA++VSDAF
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDAYCGDGCQSGPCRSGGGGGGGGGGGSGGANVANVVSDAF  85

Query  275  FNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHM  454
            FNGI +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHETG  
Sbjct  86   FNGIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETGRF  145

Query  455  CYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDV  634
            CYI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ 
Sbjct  146  CYISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNR  204

Query  635  VATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQ  814
            VA D +I+FKTALWFWMNN H L+   QGFGATIRAING LEC+G NP  +  RV YY Q
Sbjct  205  VAQDAVIAFKTALWFWMNNVHRLMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQ  262

Query  815  YCQQLGVDPGNNLEC  859
            YCQQL VDPG NL C
Sbjct  263  YCQQLRVDPGPNLTC  277



>gb|EMS68176.1| Chitinase 6 [Triticum urartu]
Length=250

 Score =   323 bits (827),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 151/249 (61%), Positives = 181/249 (73%), Gaps = 3/249 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC    CCS+WG+CGT  +YCG GC+ GPC     P +   SV  IV+ AFF  +  
Sbjct  5    QNCGCGATECCSRWGFCGTTGEYCGTGCRSGPC---TVPVTNNVSVPAIVTPAFFGALVA  61

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA   C  KGFYTR +FL A+  YP FG  GS DDSKREIAAFFAHV HET   CYI EI
Sbjct  62   QAADDCAAKGFYTRDAFLTALGGYPAFGRTGSDDDSKREIAAFFAHVNHETIKFCYIDEI  121

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            +G S++YCD T  ++PCA GK YYGRG +Q+SWN+NYG AGQS+GFDGLN+PD VA  P+
Sbjct  122  NGPSKNYCDPTTAEWPCAAGKGYYGRGSLQISWNYNYGAAGQSLGFDGLNDPDAVARSPV  181

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ++F+ ALW+WMN+ H +I SGQGFGATIRAING LEC+G NP  V  RV +Y Q+CQQ G
Sbjct  182  LAFQAALWYWMNSVHDIIVSGQGFGATIRAINGALECNGKNPSAVNDRVAFYKQFCQQFG  241

Query  833  VDPGNNLEC  859
            VDPG +L C
Sbjct  242  VDPGTSLTC  250



>gb|AAT40043.1| chitinase [Zea mays subsp. parviglumis]
Length=280

 Score =   324 bits (830),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 160/256 (63%), Positives = 192/256 (75%), Gaps = 10/256 (4%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC-------YHppsppsgggsVADIVSDA  271
            QNCGC    CCS++GYCGT D YCG+GC+ GPC              SGG +VA++V+DA
Sbjct  28   QNCGCQPNFCCSKFGYCGTTDAYCGDGCQSGPCRSGGGGGGGGGGGGSGGANVANVVTDA  87

Query  272  FFNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGH  451
            FFNGI +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHETGH
Sbjct  88   FFNGIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETGH  147

Query  452  MCYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPD  631
             CYI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+
Sbjct  148  FCYISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPN  206

Query  632  VVATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYT  811
             VA D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY 
Sbjct  207  RVAQDAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYK  264

Query  812  QYCQQLGVDPGNNLEC  859
            QYCQQL VDPG NL C
Sbjct  265  QYCQQLRVDPGPNLTC  280



>gb|ACJ61937.1| chitinase [Zea mays subsp. parviglumis]
Length=273

 Score =   323 bits (829),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 160/251 (64%), Positives = 190/251 (76%), Gaps = 5/251 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC--YHppsppsgggsVADIVSDAFFNGI  286
            QNCGC    CCS++GYCGT D YCG+GC+ GPC         SGG +VA++VSDAFFNGI
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDAYCGDGCQSGPCRSGGGGGGGSGGANVANVVSDAFFNGI  85

Query  287  ADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIK  466
             +QA S CEGK FYTR++FL AVN YP F   G+  + KREIAAFFAHVTHETG  CYI 
Sbjct  86   KNQAGSGCEGKNFYTRSAFLSAVNKYPGFAHGGTEVEGKREIAAFFAHVTHETGRFCYIS  145

Query  467  EIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATD  646
            EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ VA D
Sbjct  146  EIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNRVAQD  204

Query  647  PIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQ  826
             +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY QYCQQ
Sbjct  205  AVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQYCQQ  262

Query  827  LGVDPGNNLEC  859
            L VDPG NL C
Sbjct  263  LRVDPGPNLTC  273



>gb|ACJ61918.1| chitinase [Zea mays subsp. parviglumis]
Length=278

 Score =   323 bits (829),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 160/256 (63%), Positives = 192/256 (75%), Gaps = 10/256 (4%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC-------YHppsppsgggsVADIVSDA  271
            QNCGC    CCS++GYCGT DDYCG+GC+ GPC              SGG +VA++V+DA
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDDYCGDGCQSGPCRSGGGGGGGGGGGGSGGANVANVVTDA  85

Query  272  FFNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGH  451
            FFNGI +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHETG 
Sbjct  86   FFNGIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETGR  145

Query  452  MCYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPD  631
             CYI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+
Sbjct  146  FCYISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPN  204

Query  632  VVATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYT  811
             VA D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY 
Sbjct  205  RVAQDAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYK  262

Query  812  QYCQQLGVDPGNNLEC  859
            QYCQQL VDPG NL C
Sbjct  263  QYCQQLRVDPGPNLTC  278



>gb|ACJ61858.1| chitinase [Zea mays subsp. parviglumis]
Length=276

 Score =   323 bits (829),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 160/254 (63%), Positives = 191/254 (75%), Gaps = 8/254 (3%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC-----YHppsppsgggsVADIVSDAFF  277
            QNCGC    CCS++GYCGT DDYCG+GC+ GPC            SGG +VA++V+DAFF
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDDYCGDGCQSGPCRSGGGGGGGGGGSGGANVANVVTDAFF  85

Query  278  NGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMC  457
            NGI +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHETG  C
Sbjct  86   NGIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETGRFC  145

Query  458  YIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVV  637
            YI EI+ +S  YCD +N Q+PCA G  YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ V
Sbjct  146  YISEIN-KSNAYCDASNRQWPCAAGPKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNRV  204

Query  638  ATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQY  817
            A D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY QY
Sbjct  205  AQDAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQY  262

Query  818  CQQLGVDPGNNLEC  859
            CQQL VDPG NL C
Sbjct  263  CQQLRVDPGPNLTC  276



>gb|ACL00870.1| chitinase B [Saccharum hybrid cultivar Co 93009]
Length=279

 Score =   323 bits (829),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 160/252 (63%), Positives = 194/252 (77%), Gaps = 5/252 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC    CCS++GYCGT DDYCG+GC+ GPC       SGGG+VA +V+DAFFNGI +
Sbjct  33   QNCGCQPNYCCSKFGYCGTTDDYCGDGCQSGPCRSGGGASSGGGNVASVVTDAFFNGIKN  92

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA + CEGK FYTR++FL A +SY  FG  G + + KREIAAFFAHVTHETGH CYI EI
Sbjct  93   QAGNGCEGKNFYTRSAFLSAADSYKGFG--GGSVEGKREIAAFFAHVTHETGHFCYISEI  150

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            + ++  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ VA D +
Sbjct  151  N-KNNAYCDSSNRQWPCAAGQKYYGRGPLQISWNYNYGPAGKDIGFNGLGDPNRVAQDAV  209

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            I+FKTALWFW NN H +++  QGFGATIRAING LEC+G NP  +  RV YY QYCQQLG
Sbjct  210  IAFKTALWFWTNNVHRVMS--QGFGATIRAINGALECNGNNPAQMNARVGYYKQYCQQLG  267

Query  833  VDPGNNLEC*DI  868
            VDPG NL C  I
Sbjct  268  VDPGPNLTCLKI  279



>gb|AAT40045.1| chitinase [Zea mays subsp. parviglumis]
Length=276

 Score =   323 bits (829),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 160/254 (63%), Positives = 191/254 (75%), Gaps = 8/254 (3%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC-----YHppsppsgggsVADIVSDAFF  277
            QNCGC    CCS++GYCGT D YCG+GC+ GPC            SGG +VA++VSDAFF
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDAYCGDGCQSGPCRSGGGGGGGGGGSGGANVANVVSDAFF  85

Query  278  NGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMC  457
            N I +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHETGH C
Sbjct  86   NSIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETGHFC  145

Query  458  YIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVV  637
            YI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ V
Sbjct  146  YISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNRV  204

Query  638  ATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQY  817
            A D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY QY
Sbjct  205  AQDAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQY  262

Query  818  CQQLGVDPGNNLEC  859
            CQQL VDPG NL C
Sbjct  263  CQQLRVDPGPNLTC  276



>gb|AAT40050.1| chitinase [Zea diploperennis]
 gb|AAT40052.1| chitinase [Zea diploperennis]
 gb|AAT40053.1| chitinase [Zea diploperennis]
 gb|AAT40054.1| chitinase [Zea diploperennis]
 gb|AAT40055.1| chitinase [Zea diploperennis]
 gb|AAT40056.1| chitinase [Zea diploperennis]
 gb|AAT40057.1| chitinase [Zea diploperennis]
Length=276

 Score =   323 bits (829),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 159/255 (62%), Positives = 192/255 (75%), Gaps = 9/255 (4%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC------YHppsppsgggsVADIVSDAF  274
            QNCGC    CCS++G+CGT DDYCG+GC+ GPC             SGG +VA++V+DAF
Sbjct  25   QNCGCQPNFCCSKFGFCGTTDDYCGDGCQSGPCRSGGGGGGGGGGGSGGANVANVVTDAF  84

Query  275  FNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHM  454
            FNGI +QA S CEGK FYTR++FL AV +YP F   G+  + KREIAAFFAHVTHETGH 
Sbjct  85   FNGIKNQAGSGCEGKNFYTRSAFLSAVKAYPGFAHGGTEVEGKREIAAFFAHVTHETGHF  144

Query  455  CYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDV  634
            CYI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ 
Sbjct  145  CYISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNR  203

Query  635  VATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQ  814
            VA D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY Q
Sbjct  204  VAQDAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQ  261

Query  815  YCQQLGVDPGNNLEC  859
            YCQQL VDPG NL C
Sbjct  262  YCQQLRVDPGPNLTC  276



>ref|NP_001158904.1| endochitinase A precursor [Zea mays]
 gb|ACF85519.1| unknown [Zea mays]
 gb|ACF88402.1| unknown [Zea mays]
 tpg|DAA37155.1| TPA: chitinase A1 [Zea mays]
Length=280

 Score =   323 bits (828),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 160/258 (62%), Positives = 192/258 (74%), Gaps = 12/258 (5%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC---------YHppsppsgggsVADIVS  265
            QNCGC    CCS++GYCGT D YCG+GC+ GPC                SGG +VA++V+
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDAYCGDGCQSGPCRSGGGGGGGGGGGGGGSGGANVANVVT  85

Query  266  DAFFNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHET  445
            DAFFNGI +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHET
Sbjct  86   DAFFNGIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHET  145

Query  446  GHMCYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNN  625
            GH CYI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +
Sbjct  146  GHFCYISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLAD  204

Query  626  PDVVATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEY  805
            P+ VA D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV Y
Sbjct  205  PNRVAQDAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGY  262

Query  806  YTQYCQQLGVDPGNNLEC  859
            Y QYCQQL VDPG NL C
Sbjct  263  YKQYCQQLRVDPGPNLTC  280



>gb|AAT40044.1| chitinase [Zea mays subsp. parviglumis]
Length=280

 Score =   323 bits (828),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 160/258 (62%), Positives = 192/258 (74%), Gaps = 12/258 (5%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC---------YHppsppsgggsVADIVS  265
            QNCGC    CCS++GYCGT D YCG+GC+ GPC                SGG +VA++V+
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDAYCGDGCQSGPCRSGGGGGGGGGGGGGGSGGANVANVVT  85

Query  266  DAFFNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHET  445
            DAFFNGI +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHET
Sbjct  86   DAFFNGIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHET  145

Query  446  GHMCYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNN  625
            GH CYI EI+ ++  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +
Sbjct  146  GHFCYISEIN-KNNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLAD  204

Query  626  PDVVATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEY  805
            P+ VA D +I+FKTALWFWMNN H L+   QGFGATIRAING LEC+G NP  +  RV Y
Sbjct  205  PNRVAQDAVIAFKTALWFWMNNVHRLMP--QGFGATIRAINGALECNGNNPAQMNARVGY  262

Query  806  YTQYCQQLGVDPGNNLEC  859
            Y QYCQQL VDPG NL C
Sbjct  263  YKQYCQQLRVDPGPNLTC  280



>ref|XP_002273248.1| PREDICTED: endochitinase PR4 [Vitis vinifera]
Length=271

 Score =   323 bits (827),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 162/251 (65%), Positives = 195/251 (78%), Gaps = 6/251 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgg--gsVADIVSDAFFNGI  286
            QN  C  GLCCSQ+G+CGTG  YCG+GC+ GPCY PPS    G   SV D+V++ FF+GI
Sbjct  25   QNYSCNAGLCCSQFGFCGTGVRYCGDGCQAGPCYSPPSGGGDGGCISVEDVVTEDFFDGI  84

Query  287  ADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIK  466
             +Q D+SC GK FYTR +FLDA+NSYP+FG  G A+DSKREIAAFFAH THETG  CYI+
Sbjct  85   INQVDASCTGKNFYTRRAFLDALNSYPEFGQGGYANDSKREIAAFFAHATHETGCFCYIE  144

Query  467  EIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATD  646
            EIDG S++YC + +T+YPC PGK YYGRGP+Q++WNFNYGPAG+SIGF+G NNP++VA D
Sbjct  145  EIDGPSKNYCVE-DTRYPCVPGKGYYGRGPLQITWNFNYGPAGESIGFNGSNNPEIVAND  203

Query  647  PIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQ  826
            P+ISFKTA WFWM N H ++   +GF ATI AING  EC+G N D V  RVEYY  YC Q
Sbjct  204  PVISFKTAFWFWMKNVHDIVN--RGFSATIHAINGA-ECNGGNRDAVSARVEYYEDYCNQ  260

Query  827  LGVDPGNNLEC  859
            LGV PG+NL C
Sbjct  261  LGVFPGDNLPC  271



>gb|ACJ61875.1| chitinase [Zea mays subsp. parviglumis]
Length=276

 Score =   323 bits (828),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 159/252 (63%), Positives = 191/252 (76%), Gaps = 6/252 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC---YHppsppsgggsVADIVSDAFFNG  283
            QNCGC    CCS++GYCGT D YCG+GC+ GPC          SGG +VA++V+DAFFNG
Sbjct  28   QNCGCQPNFCCSKFGYCGTTDAYCGDGCQSGPCRSGGGGGGGGSGGANVANVVTDAFFNG  87

Query  284  IADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYI  463
            I +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHETG  CYI
Sbjct  88   IKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETGRFCYI  147

Query  464  KEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVAT  643
             EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ VA 
Sbjct  148  SEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNRVAQ  206

Query  644  DPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQ  823
            D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY QYCQ
Sbjct  207  DAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQYCQ  264

Query  824  QLGVDPGNNLEC  859
            QL VDPG NL C
Sbjct  265  QLRVDPGPNLTC  276



>gb|AAK92200.1|AF402939_1 chitinase-B, partial [Sorghum halepense]
Length=261

 Score =   322 bits (826),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 160/249 (64%), Positives = 192/249 (77%), Gaps = 6/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC  G CCS++GYCGT D+YCG+GC+ GPC       SGGG+VA +V+DAFFNGI +
Sbjct  19   QNCGCQAGYCCSKFGYCGTTDEYCGDGCQSGPC-RSGGGSSGGGNVASVVTDAFFNGIKN  77

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA + CEGK FYTR++FL A ++Y  FG  G +   KREIAAFFAHVTHETGH CYI EI
Sbjct  78   QAGNGCEGKNFYTRSAFLSAADAYKGFG--GGSVQGKREIAAFFAHVTHETGHFCYISEI  135

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            + ++  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGFDGL NPD VA D +
Sbjct  136  N-KNNAYCDSSNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFDGLRNPDRVAQDAV  194

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            I+FKTALWFW NN H +++  QGFGATIRAING LEC+G N   +  RV YY QYCQQLG
Sbjct  195  IAFKTALWFWTNNVHGVMS--QGFGATIRAINGALECNGKNTAQMNARVGYYRQYCQQLG  252

Query  833  VDPGNNLEC  859
            VDPG NL C
Sbjct  253  VDPGPNLTC  261



>gb|ACJ61923.1| chitinase [Zea mays subsp. parviglumis]
Length=277

 Score =   323 bits (827),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 160/255 (63%), Positives = 192/255 (75%), Gaps = 9/255 (4%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC------YHppsppsgggsVADIVSDAF  274
            QNCGC    CCS++GYCGT DDYCG+GC+ GPC             SGG +VA++VSDAF
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDDYCGDGCQSGPCRSGGGGGGGGGGGSGGANVANVVSDAF  85

Query  275  FNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHM  454
            FNGI +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFA+VTHETG  
Sbjct  86   FNGIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAYVTHETGRF  145

Query  455  CYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDV  634
            CYI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ 
Sbjct  146  CYISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNR  204

Query  635  VATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQ  814
            VA D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY Q
Sbjct  205  VAQDAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQ  262

Query  815  YCQQLGVDPGNNLEC  859
            YCQQL VDPG NL C
Sbjct  263  YCQQLRVDPGPNLTC  277



>gb|ACJ61926.1| chitinase [Zea mays subsp. parviglumis]
Length=278

 Score =   323 bits (827),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 160/256 (63%), Positives = 192/256 (75%), Gaps = 10/256 (4%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC-------YHppsppsgggsVADIVSDA  271
            QNCGC    CCS++GYCGT DDYCG+GC+ GPC              SGG +VA++V+DA
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDDYCGDGCQSGPCRSGGGGGGGGGGGGSGGANVANVVTDA  85

Query  272  FFNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGH  451
            FFNGI +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHETG 
Sbjct  86   FFNGIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETGR  145

Query  452  MCYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPD  631
             CYI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+
Sbjct  146  FCYISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPN  204

Query  632  VVATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYT  811
             VA D +I+FKTALWFWMNN H ++   QGFGATIRAI+G LECDG NP  +  RV YY 
Sbjct  205  RVAQDAVIAFKTALWFWMNNVHRVMP--QGFGATIRAIDGALECDGNNPAQMNARVGYYK  262

Query  812  QYCQQLGVDPGNNLEC  859
            QYCQQL VDPG NL C
Sbjct  263  QYCQQLRVDPGPNLTC  278



>gb|ACJ61879.1| chitinase [Zea mays subsp. parviglumis]
Length=276

 Score =   323 bits (827),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 160/255 (63%), Positives = 191/255 (75%), Gaps = 9/255 (4%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC------YHppsppsgggsVADIVSDAF  274
            QNCGC    CCS++GYCGT D YCG+GC+ GPC             SGG +VA++VSDAF
Sbjct  25   QNCGCQPNFCCSKFGYCGTTDAYCGDGCQSGPCRSGGGGGGGGGGGSGGANVANVVSDAF  84

Query  275  FNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHM  454
            FNGI +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHETG  
Sbjct  85   FNGIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETGRF  144

Query  455  CYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDV  634
            CYI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ 
Sbjct  145  CYISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNR  203

Query  635  VATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQ  814
            VA D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY Q
Sbjct  204  VAQDAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQ  261

Query  815  YCQQLGVDPGNNLEC  859
            YCQQL VDPG NL C
Sbjct  262  YCQQLRVDPGPNLTC  276



>gb|ACJ61911.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ61931.1| chitinase [Zea mays subsp. parviglumis]
Length=279

 Score =   323 bits (827),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 160/255 (63%), Positives = 191/255 (75%), Gaps = 9/255 (4%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC------YHppsppsgggsVADIVSDAF  274
            QNCGC    CCS++GYCGT D YCG+GC+ GPC             SGG +VA++VSDAF
Sbjct  28   QNCGCQPNFCCSKFGYCGTTDAYCGDGCQSGPCRSGGGGGGGGGGGSGGANVANVVSDAF  87

Query  275  FNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHM  454
            FNGI +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHETG  
Sbjct  88   FNGIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETGRF  147

Query  455  CYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDV  634
            CYI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ 
Sbjct  148  CYISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNR  206

Query  635  VATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQ  814
            VA D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY Q
Sbjct  207  VAQDAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQ  264

Query  815  YCQQLGVDPGNNLEC  859
            YCQQL VDPG NL C
Sbjct  265  YCQQLRVDPGPNLTC  279



>ref|NP_001149472.1| endochitinase A precursor [Zea mays]
 gb|ACG35543.1| endochitinase A precursor [Zea mays]
Length=280

 Score =   323 bits (827),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 159/258 (62%), Positives = 190/258 (74%), Gaps = 12/258 (5%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYH---------ppsppsgggsVADIVS  265
            QNCGC    CCS++GYCGT D YCG+GC+ GPC                S G +VA++V+
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDAYCGDGCQSGPCRSDGXGGGGGGGXXGXSXGANVANVVT  85

Query  266  DAFFNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHET  445
            DAFFNGI +QA S CEGK FYTR++FL AVN YP F   G+  + KREIAAFFAHVTHET
Sbjct  86   DAFFNGIKNQAGSGCEGKNFYTRSAFLSAVNKYPGFAHGGTEVEGKREIAAFFAHVTHET  145

Query  446  GHMCYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNN  625
            GH CYI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +
Sbjct  146  GHFCYISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLAD  204

Query  626  PDVVATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEY  805
            P+ VA D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV Y
Sbjct  205  PNRVAQDAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGY  262

Query  806  YTQYCQQLGVDPGNNLEC  859
            Y QYCQQL VDPG NL C
Sbjct  263  YKQYCQQLRVDPGPNLTC  280



>gb|ACJ61862.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ61892.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ61894.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ61897.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ61903.1| chitinase [Zea mays subsp. parviglumis]
Length=277

 Score =   323 bits (827),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 160/255 (63%), Positives = 191/255 (75%), Gaps = 9/255 (4%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC------YHppsppsgggsVADIVSDAF  274
            QNCGC    CCS++GYCGT D YCG+GC+ GPC             SGG +VA++VSDAF
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDAYCGDGCQSGPCRSGGGGGGGGGGGSGGANVANVVSDAF  85

Query  275  FNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHM  454
            FNGI +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHETG  
Sbjct  86   FNGIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETGRF  145

Query  455  CYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDV  634
            CYI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ 
Sbjct  146  CYISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNR  204

Query  635  VATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQ  814
            VA D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY Q
Sbjct  205  VAQDAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQ  262

Query  815  YCQQLGVDPGNNLEC  859
            YCQQL VDPG NL C
Sbjct  263  YCQQLRVDPGPNLTC  277



>gb|ACJ61919.1| chitinase [Zea mays subsp. parviglumis]
Length=278

 Score =   323 bits (827),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 161/255 (63%), Positives = 190/255 (75%), Gaps = 9/255 (4%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC------YHppsppsgggsVADIVSDAF  274
            QNCGC    CCS++GYCGT DDYCG+GC+ GPC             SGG +VA++VSDAF
Sbjct  27   QNCGCQPNFCCSKFGYCGTTDDYCGDGCQSGPCRSGGGGGGGGGGGSGGANVANVVSDAF  86

Query  275  FNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHM  454
            FNGI +QA S CEGK FYTR++FL AVN YP F   G+  + KREIAAFFAHVTHETG  
Sbjct  87   FNGIKNQAGSGCEGKNFYTRSAFLSAVNKYPGFAHGGTEVEGKREIAAFFAHVTHETGRF  146

Query  455  CYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDV  634
            CYI EI+ +S  YCD +N Q PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ 
Sbjct  147  CYISEIN-KSNAYCDASNRQCPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNR  205

Query  635  VATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQ  814
            VA D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY Q
Sbjct  206  VAQDAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQ  263

Query  815  YCQQLGVDPGNNLEC  859
            YCQQL VDPG NL C
Sbjct  264  YCQQLRVDPGPNLTC  278



>gb|ACJ61905.1| chitinase [Zea mays subsp. parviglumis]
Length=276

 Score =   322 bits (826),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 159/252 (63%), Positives = 190/252 (75%), Gaps = 6/252 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC---YHppsppsgggsVADIVSDAFFNG  283
            QNCGC    CCS++GYCGT DDYCG+GC+ GPC          SGG +VA++V+DAFFNG
Sbjct  28   QNCGCQPNFCCSKFGYCGTTDDYCGDGCQSGPCRSGGGGGGGGSGGANVANVVTDAFFNG  87

Query  284  IADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYI  463
            I +QA S CEGK FYTR++FL AVN YP F   G+  + KREIAAFFAHVTHETG  CYI
Sbjct  88   IKNQAGSGCEGKNFYTRSAFLSAVNKYPGFAHGGTEVEGKREIAAFFAHVTHETGRFCYI  147

Query  464  KEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVAT  643
             EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ VA 
Sbjct  148  SEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNRVAQ  206

Query  644  DPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQ  823
            D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY QYCQ
Sbjct  207  DAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQYCQ  264

Query  824  QLGVDPGNNLEC  859
            QL V PG NL C
Sbjct  265  QLRVGPGPNLTC  276



>gb|AET44160.1| class IV chitinase [Fragaria x ananassa]
Length=275

 Score =   322 bits (826),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 159/251 (63%), Positives = 188/251 (75%), Gaps = 6/251 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgg--gsVADIVSDAFFNGI  286
            QNCGCA  LCCS++GYCGTGD YCG+GC+ GPC    +P       SVADIV+  FFNGI
Sbjct  29   QNCGCAADLCCSEFGYCGTGDAYCGKGCQAGPCTTTTTPTPTTGGSSVADIVTTDFFNGI  88

Query  287  ADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIK  466
             +QA S C GK FYTR +FLDA+ SY  F T GSADD+KREIAAFFAHVTHETGH CY++
Sbjct  89   INQAGSDCAGKSFYTRQAFLDALGSYTDFATTGSADDNKREIAAFFAHVTHETGHFCYVE  148

Query  467  EIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATD  646
            EI  E   YCD + T YPC P K YYGRGP+QL+WN+NYG AG +IGFDG ++P+ VA+D
Sbjct  149  EI--EKATYCDTSFTNYPCNPAKQYYGRGPLQLTWNYNYGAAGNAIGFDGQSSPETVASD  206

Query  647  PIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQ  826
             +++FKT LWFWMNN HS+I+  QGFGAT RAING +ECDG  PD V+ R+ YY  YC Q
Sbjct  207  SVVAFKTGLWFWMNNVHSVIS--QGFGATTRAINGAVECDGKAPDKVQARINYYKDYCTQ  264

Query  827  LGVDPGNNLEC  859
            L V PG NL C
Sbjct  265  LNVSPGENLYC  275



>gb|ACJ61915.1| chitinase [Zea mays subsp. parviglumis]
Length=278

 Score =   322 bits (826),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 160/256 (63%), Positives = 191/256 (75%), Gaps = 10/256 (4%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC-------YHppsppsgggsVADIVSDA  271
            QNCGC    CCS++GYCGT D YCG+GC+ GPC              SGG +VA++VSDA
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDAYCGDGCQSGPCRSGGGGGGGGGGGGSGGANVANVVSDA  85

Query  272  FFNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGH  451
            FFNGI +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHETG 
Sbjct  86   FFNGIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETGR  145

Query  452  MCYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPD  631
             CYI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+
Sbjct  146  FCYISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPN  204

Query  632  VVATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYT  811
             VA D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY 
Sbjct  205  RVAQDAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYK  262

Query  812  QYCQQLGVDPGNNLEC  859
            QYCQQL VDPG NL C
Sbjct  263  QYCQQLRVDPGPNLTC  278



>ref|XP_010036822.1| PREDICTED: chitinase 6-like [Eucalyptus grandis]
Length=278

 Score =   322 bits (826),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 159/253 (63%), Positives = 191/253 (75%), Gaps = 5/253 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVA-DIVSDAFFNGIA  289
            QNCGCA GLCCSQ+GYCGTG DYCG GC+ GPC    +PP+    V  DIV++AFFNGI 
Sbjct  27   QNCGCAAGLCCSQYGYCGTGRDYCGVGCQAGPCDPAAAPPATNAVVVGDIVTNAFFNGII  86

Query  290  DQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKE  469
            +QA +SC GK FY+R +FLDA+  +P+FG VGS DDSKREIAAFFAH THETG  C+I+E
Sbjct  87   NQAAASCAGKRFYSRQAFLDALGKFPRFGRVGSVDDSKREIAAFFAHATHETGRFCFIEE  146

Query  470  IDGES---RDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVA  640
            IDG +   + YCD    QYPC PG+ Y+GRGP+QLSWN+NYGPAG+S+GFDGLN+P+ VA
Sbjct  147  IDGRTDPKKTYCDPNVPQYPCKPGRKYFGRGPLQLSWNYNYGPAGESLGFDGLNSPETVA  206

Query  641  TDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYC  820
             +P+I+FK ALWFW  N      SGQGFGATIR IN  +EC+G NP   + RV YYT YC
Sbjct  207  NNPVIAFKAALWFWSTNNIQSKLSGQGFGATIRTIN-SIECNGRNPGAAQARVTYYTNYC  265

Query  821  QQLGVDPGNNLEC  859
            +Q GV PG NL C
Sbjct  266  KQFGVAPGGNLNC  278



>gb|AGS80332.1| chitinase protein [Actinidia eriantha]
Length=328

 Score =   324 bits (830),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 158/289 (55%), Positives = 190/289 (66%), Gaps = 45/289 (16%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            Q CGCA GLCCSQ+GYC TG++YCG GC+ GPC       S G  VA+IV+ AFFN I +
Sbjct  30   QRCGCAAGLCCSQYGYCNTGNEYCGTGCQSGPC-----TGSNGVVVANIVTQAFFNSIIN  84

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETG--------  448
            QA + C GK FYTR++FL+A++ +  FGT+G+ DDSKREIAAFFAH +HETG        
Sbjct  85   QASAGCVGKSFYTRSAFLNALSLFTAFGTIGTVDDSKREIAAFFAHASHETGCKISIYFF  144

Query  449  --------------------------------HMCYIKEIDGESRDYCDKTNTQYPCAPG  532
                                             +C I+E  G S+DYCD+T T YPCAP 
Sbjct  145  PASFLKDRKTVRKQKIYIEKSVNQSIYLFFLCTLCKIEEDGGASKDYCDETRTDYPCAPN  204

Query  533  KMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPIISFKTALWFWMNNCHSLITS  712
            K YYGRGP+QLSWN+NYG AG  +GF+GLNNP++VA D  +SFK ALWFWM N HSL+T+
Sbjct  205  KNYYGRGPLQLSWNYNYGAAGDFLGFNGLNNPEIVANDSFVSFKAALWFWMRNVHSLMTT  264

Query  713  GQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLGVDPGNNLEC  859
            GQGFGATIRAING +ECD   PD V  RV  Y  +C QLGV PGNNL C
Sbjct  265  GQGFGATIRAINGAIECDNKRPDLVTARVNLYKNFCSQLGVAPGNNLRC  313



>gb|ACJ61896.1| chitinase [Zea mays subsp. parviglumis]
Length=276

 Score =   322 bits (825),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 159/252 (63%), Positives = 190/252 (75%), Gaps = 6/252 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC---YHppsppsgggsVADIVSDAFFNG  283
            QNCGC    CCS++GYCGT DDYCG+GC+ GPC          SGG +VA++V+DAFFNG
Sbjct  28   QNCGCQPNFCCSKFGYCGTTDDYCGDGCQSGPCRSGGGGGGGGSGGANVANVVTDAFFNG  87

Query  284  IADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYI  463
            I +QA S CEGK FYTR++FL AVN YP F   G+  + KREIAAFFAHVTHETG  CYI
Sbjct  88   IKNQAGSGCEGKNFYTRSAFLSAVNKYPGFAHGGTEVEGKREIAAFFAHVTHETGRFCYI  147

Query  464  KEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVAT  643
             EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ VA 
Sbjct  148  SEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNRVAQ  206

Query  644  DPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQ  823
            D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +   V YY QYCQ
Sbjct  207  DAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNAHVGYYKQYCQ  264

Query  824  QLGVDPGNNLEC  859
            QL VDPG NL C
Sbjct  265  QLRVDPGPNLTC  276



>gb|ACJ61876.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ61878.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ61909.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ61913.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ61933.1| chitinase [Zea mays subsp. parviglumis]
Length=276

 Score =   322 bits (825),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 159/254 (63%), Positives = 191/254 (75%), Gaps = 8/254 (3%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC-----YHppsppsgggsVADIVSDAFF  277
            QNCGC    CCS++GYCGT D YCG+GC+ GPC            SGG +VA++V+DAFF
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDAYCGDGCQSGPCRSGGGGGGGGGGSGGANVANVVTDAFF  85

Query  278  NGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMC  457
            NGI +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHETG  C
Sbjct  86   NGIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETGRFC  145

Query  458  YIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVV  637
            YI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ V
Sbjct  146  YISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNRV  204

Query  638  ATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQY  817
            A D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY QY
Sbjct  205  AQDAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQY  262

Query  818  CQQLGVDPGNNLEC  859
            CQQL VDPG NL C
Sbjct  263  CQQLRVDPGPNLTC  276



>gb|AAT39997.1| chitinase [Zea mays subsp. parviglumis]
Length=279

 Score =   322 bits (826),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 153/249 (61%), Positives = 186/249 (75%), Gaps = 3/249 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC   +CCS++GYCGT D+YCG+GC+ GPC       +GG +VA +V+ +FFNGI +
Sbjct  34   QNCGCQPNVCCSKFGYCGTTDEYCGDGCQSGPCRSGGGSGAGGANVASVVTSSFFNGIKN  93

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA S CEGK FYTR++FL AV +YP F   GS    KREIAAFFAH THETGH CYI EI
Sbjct  94   QAGSGCEGKNFYTRSAFLSAVKAYPGFAHGGSQVQGKREIAAFFAHATHETGHFCYISEI  153

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            + +S  YCD T  Q+PCA G+ YYGRGP+Q+SWN+NYGPAG++IGFDGL +P  VA D +
Sbjct  154  N-KSNAYCDPTKRQWPCAAGQKYYGRGPLQISWNYNYGPAGRAIGFDGLGDPGRVARDAV  212

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ++FK ALWFWMN+ H ++   QGFGAT RAING LEC G NP  +  RV YY QYC+QLG
Sbjct  213  VAFKAALWFWMNSVHGVVP--QGFGATTRAINGALECGGNNPAQMNARVGYYRQYCRQLG  270

Query  833  VDPGNNLEC  859
            VDPG NL C
Sbjct  271  VDPGPNLTC  279



>sp|P29022.1|CHIA_MAIZE RecName: Full=Endochitinase A; AltName: Full=Seed chitinase A; 
Flags: Precursor [Zea mays]
 gb|AAA33444.1| chitinase A [Zea mays]
Length=280

 Score =   322 bits (826),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 160/258 (62%), Positives = 192/258 (74%), Gaps = 12/258 (5%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC---------YHppsppsgggsVADIVS  265
            QNCGC    CCS++GYCGT D YCG+GC+ GPC                SGG +VA++V+
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDAYCGDGCQSGPCRSGGGGGGGGGGGGGGSGGANVANVVT  85

Query  266  DAFFNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHET  445
            DAFFNGI +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHET
Sbjct  86   DAFFNGIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHET  145

Query  446  GHMCYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNN  625
            GH CYI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +
Sbjct  146  GHFCYISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLAD  204

Query  626  PDVVATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEY  805
            P+ VA D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV Y
Sbjct  205  PNRVAQDAVIAFKTALWFWMNNVHGVMP--QGFGATIRAINGALECNGNNPAQMNARVGY  262

Query  806  YTQYCQQLGVDPGNNLEC  859
            Y QYCQQL VDPG NL C
Sbjct  263  YKQYCQQLRVDPGPNLIC  280



>gb|ACJ61907.1| chitinase [Zea mays subsp. parviglumis]
Length=277

 Score =   322 bits (825),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 159/255 (62%), Positives = 191/255 (75%), Gaps = 9/255 (4%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC------YHppsppsgggsVADIVSDAF  274
            QNCGC    CCS++GYCGT D YCG+GC+ GPC             SGG +VA++VSDAF
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDAYCGDGCQSGPCRSGGGGGGGGGGGSGGANVANVVSDAF  85

Query  275  FNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHM  454
            FNGI +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHETG  
Sbjct  86   FNGIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETGRF  145

Query  455  CYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDV  634
            CYI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ 
Sbjct  146  CYISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNR  204

Query  635  VATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQ  814
            VA D +I+FKTALWFWMNN H ++   QGFGATIRA+NG LEC+G NP  +  RV YY Q
Sbjct  205  VAQDAVIAFKTALWFWMNNVHRVMP--QGFGATIRAVNGALECNGNNPAQMNARVGYYKQ  262

Query  815  YCQQLGVDPGNNLEC  859
            YCQQL VDPG NL C
Sbjct  263  YCQQLRVDPGPNLTC  277



>gb|ACJ61861.1| chitinase [Zea mays subsp. parviglumis]
Length=277

 Score =   322 bits (825),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/255 (63%), Positives = 191/255 (75%), Gaps = 9/255 (4%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC------YHppsppsgggsVADIVSDAF  274
            QNCGC    CCS++GYCGT D YCG+GC+ GPC             SGG +VA++VSDAF
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDAYCGDGCQSGPCRSGGGGGGGGGGGSGGANVANVVSDAF  85

Query  275  FNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHM  454
            FNGI +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHETG  
Sbjct  86   FNGIKNQAGSGCEGKDFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETGRF  145

Query  455  CYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDV  634
            CYI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ 
Sbjct  146  CYISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNR  204

Query  635  VATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQ  814
            VA D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY Q
Sbjct  205  VAQDAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQ  262

Query  815  YCQQLGVDPGNNLEC  859
            YCQQL VDPG NL C
Sbjct  263  YCQQLRVDPGPNLTC  277



>gb|ACJ61908.1| chitinase [Zea mays subsp. parviglumis]
Length=279

 Score =   322 bits (825),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/257 (62%), Positives = 191/257 (74%), Gaps = 11/257 (4%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC--------YHppsppsgggsVADIVSD  268
            QNCGC    CCS++GYCGT D YCG+GC+ GPC               SGG +VA++VSD
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDAYCGDGCQSGPCRSGGGGGGGGGGGGGSGGANVANVVSD  85

Query  269  AFFNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETG  448
            AFFNGI +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHETG
Sbjct  86   AFFNGIKNQAGSGCEGKSFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETG  145

Query  449  HMCYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNP  628
              CYI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P
Sbjct  146  RFCYISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADP  204

Query  629  DVVATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYY  808
            + VA D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY
Sbjct  205  NRVAQDAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYY  262

Query  809  TQYCQQLGVDPGNNLEC  859
             QYCQQL VDPG NL C
Sbjct  263  KQYCQQLRVDPGPNLTC  279



>gb|ACJ61867.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ61881.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ61884.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ61888.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ61893.1| chitinase [Zea mays subsp. parviglumis]
Length=279

 Score =   322 bits (825),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/257 (62%), Positives = 191/257 (74%), Gaps = 11/257 (4%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC--------YHppsppsgggsVADIVSD  268
            QNCGC    CCS++GYCGT D YCG+GC+ GPC               SGG +VA++VSD
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDAYCGDGCQSGPCRSGGGGGGGGGGGGGSGGANVANVVSD  85

Query  269  AFFNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETG  448
            AFFNGI +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHETG
Sbjct  86   AFFNGIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETG  145

Query  449  HMCYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNP  628
              CYI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P
Sbjct  146  RFCYISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADP  204

Query  629  DVVATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYY  808
            + VA D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY
Sbjct  205  NRVAQDAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYY  262

Query  809  TQYCQQLGVDPGNNLEC  859
             QYCQQL VDPG NL C
Sbjct  263  KQYCQQLRVDPGPNLTC  279



>ref|XP_004976078.1| PREDICTED: endochitinase A-like [Setaria italica]
Length=284

 Score =   322 bits (825),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 158/261 (61%), Positives = 188/261 (72%), Gaps = 15/261 (6%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgg------------gsVAD  256
            QNCGC    CCS++G+CGT D YCG+GC+ GPC        GG             +VA 
Sbjct  27   QNCGCQPNFCCSKFGFCGTSDAYCGDGCQSGPCRSGGGGGGGGGGGGGGGGGGRGANVAS  86

Query  257  IVSDAFFNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVT  436
            +V+DAFFNGI +QA   CEG+ FYTR++FL+A N Y  F   GS  + KREIAAFFAHVT
Sbjct  87   VVTDAFFNGIKNQAGGGCEGRNFYTRSAFLEAANKYSGFAHGGSEVEGKREIAAFFAHVT  146

Query  437  HETGHMCYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDG  616
            HETGH CYI EI+ ++ +YCD  N Q+PCA GK YYGRGP+Q+SWN+NYGPAG+ IGFDG
Sbjct  147  HETGHFCYISEIN-KNNNYCDANNRQWPCAAGKKYYGRGPLQISWNYNYGPAGRDIGFDG  205

Query  617  LNNPDVVATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKR  796
            L NPD+VA +  I+FKTALWFWMNN H ++   QGFGAT RAING LEC+G NP  +  R
Sbjct  206  LGNPDIVAQNAGIAFKTALWFWMNNVHRVMP--QGFGATTRAINGALECNGNNPAQMNAR  263

Query  797  VEYYTQYCQQLGVDPGNNLEC  859
            V YY QYCQQLGVDPGNNL C
Sbjct  264  VGYYRQYCQQLGVDPGNNLTC  284



>gb|ACJ61889.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ61890.1| chitinase [Zea mays subsp. parviglumis]
Length=279

 Score =   322 bits (824),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/257 (62%), Positives = 190/257 (74%), Gaps = 11/257 (4%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC--------YHppsppsgggsVADIVSD  268
            QNCGC    CCS++GYCGT D YCG+GC+ GPC               SGG +VA++V+D
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDAYCGDGCQSGPCRSGGGGSSGGGGGGGSGGANVANVVTD  85

Query  269  AFFNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETG  448
            AFFNGI  QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHETG
Sbjct  86   AFFNGIKSQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETG  145

Query  449  HMCYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNP  628
              CYI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P
Sbjct  146  RFCYISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADP  204

Query  629  DVVATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYY  808
            + VA D +I+FKTALWFWMNN H L+   QGFGATIRAING LEC+G NP  +  RV YY
Sbjct  205  NRVAQDAVIAFKTALWFWMNNVHRLMP--QGFGATIRAINGALECNGNNPAQMNARVGYY  262

Query  809  TQYCQQLGVDPGNNLEC  859
             QYCQQL VDPG NL C
Sbjct  263  KQYCQQLRVDPGPNLTC  279



>ref|XP_002448109.1| hypothetical protein SORBIDRAFT_06g021260 [Sorghum bicolor]
 gb|EES12437.1| hypothetical protein SORBIDRAFT_06g021260 [Sorghum bicolor]
Length=272

 Score =   322 bits (824),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/251 (64%), Positives = 189/251 (75%), Gaps = 7/251 (3%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYC-GEGCKEGPCYHppsppsgggsVADIVSDAFFNGIA  289
            QNC C  G CCSQ+GYCGT  DYC G  C+ GPC    S  S G +V+ +V+DAFFNGI 
Sbjct  27   QNCSCPPGYCCSQFGYCGTSFDYCNGNTCQSGPC--TGSGGSSGANVSGVVTDAFFNGIK  84

Query  290  DQADSSCEGKGFYTRTSFLDAVNS-YPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIK  466
             QA S CEG  FY+R +FL A +S YP F   G+  D KREIAAFFAHVTHET H+CYI 
Sbjct  85   SQAGSGCEGSNFYSRRAFLRAASSSYPAFAHGGTEADGKREIAAFFAHVTHETRHLCYIS  144

Query  467  EIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATD  646
            EI+ E+  YC+ +N Q+PCAPGK YYGRGP+Q+SWN+NYGPAG+ IGFDGL NPD+VA D
Sbjct  145  EIN-ENSAYCNSSNAQWPCAPGKKYYGRGPLQISWNYNYGPAGREIGFDGLGNPDMVAQD  203

Query  647  PIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQ  826
            P+I+FKTALWFWMNN H ++   QGFGATIRAI+G LEC+G NP  +  RV YY QYCQQ
Sbjct  204  PVIAFKTALWFWMNNVHGVMP--QGFGATIRAIDGALECNGNNPAQMNARVGYYKQYCQQ  261

Query  827  LGVDPGNNLEC  859
             GVDPGN+L C
Sbjct  262  FGVDPGNSLTC  272



>gb|ACJ61922.1| chitinase [Zea mays subsp. parviglumis]
Length=277

 Score =   322 bits (824),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/255 (63%), Positives = 191/255 (75%), Gaps = 9/255 (4%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC------YHppsppsgggsVADIVSDAF  274
            QNCGC    CCS++GYCGT DDYCG+GC+ GPC             SGG +VA++VSDAF
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDDYCGDGCQSGPCRSGGGGGGGGGGGSGGANVANVVSDAF  85

Query  275  FNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHM  454
            FNGI +QA S CEGK FYTR++ L AVN+YP F   G+  + KREIAAFFAHVTHETG  
Sbjct  86   FNGIKNQAGSGCEGKNFYTRSASLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETGRF  145

Query  455  CYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDV  634
            CYI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ 
Sbjct  146  CYISEIN-KSNAYCDASNGQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNR  204

Query  635  VATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQ  814
            VA D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY Q
Sbjct  205  VAQDAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQ  262

Query  815  YCQQLGVDPGNNLEC  859
            YCQQL VDPG NL C
Sbjct  263  YCQQLRVDPGPNLTC  277



>gb|ACJ61865.1| chitinase [Zea mays subsp. parviglumis]
Length=276

 Score =   322 bits (824),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 159/254 (63%), Positives = 191/254 (75%), Gaps = 8/254 (3%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC-----YHppsppsgggsVADIVSDAFF  277
            QNCGC    CCS++GYCGT D YCG+GC+ GPC            SGG +VA++V+DAFF
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDAYCGDGCQSGPCRSGGGGGGGGGGSGGANVANVVTDAFF  85

Query  278  NGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMC  457
            NGI +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHETG  C
Sbjct  86   NGIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETGRFC  145

Query  458  YIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVV  637
            YI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ V
Sbjct  146  YISEIN-KSNAYCDASNGQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNRV  204

Query  638  ATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQY  817
            A D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY QY
Sbjct  205  AQDAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQY  262

Query  818  CQQLGVDPGNNLEC  859
            CQQL VDPG NL C
Sbjct  263  CQQLRVDPGPNLTC  276



>gb|ACJ61873.1| chitinase [Zea mays subsp. parviglumis]
Length=278

 Score =   322 bits (824),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 159/254 (63%), Positives = 191/254 (75%), Gaps = 10/254 (4%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC-------YHppsppsgggsVADIVSDA  271
            QNCGC    CCS++GYCGT DDYCG+GC+ GPC              SGG +VA++V+DA
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDDYCGDGCQSGPCRSGGGGGGGGGGGGSGGANVANVVTDA  85

Query  272  FFNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGH  451
            FFNGI +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHETG 
Sbjct  86   FFNGIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETGR  145

Query  452  MCYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPD  631
             CYI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+
Sbjct  146  FCYISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPN  204

Query  632  VVATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYT  811
             VA D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY 
Sbjct  205  RVAQDAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYK  262

Query  812  QYCQQLGVDPGNNL  853
            QYCQQL VDPG NL
Sbjct  263  QYCQQLRVDPGPNL  276



>gb|ACJ61886.1| chitinase [Zea mays subsp. parviglumis]
Length=279

 Score =   321 bits (823),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 160/257 (62%), Positives = 191/257 (74%), Gaps = 11/257 (4%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC--------YHppsppsgggsVADIVSD  268
            Q+CGC    CCS++GYCGT D YCG+GC+ GPC               SGG +VA++VSD
Sbjct  26   QSCGCQPNFCCSKFGYCGTTDAYCGDGCQSGPCRSGGGGGGGGGGGGGSGGANVANVVSD  85

Query  269  AFFNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETG  448
            AFFNGI +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHETG
Sbjct  86   AFFNGIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETG  145

Query  449  HMCYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNP  628
              CYI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P
Sbjct  146  RFCYISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADP  204

Query  629  DVVATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYY  808
            + VA D +I+FKTALWFWMNN H L+   QGFGATIRAING LEC+G NP  +  RV YY
Sbjct  205  NRVAQDAVIAFKTALWFWMNNVHRLMP--QGFGATIRAINGALECNGNNPAQMNARVGYY  262

Query  809  TQYCQQLGVDPGNNLEC  859
             QYCQQL VDPG NL C
Sbjct  263  KQYCQQLRVDPGPNLTC  279



>gb|ACJ61932.1| chitinase [Zea mays subsp. parviglumis]
Length=275

 Score =   321 bits (822),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 158/253 (62%), Positives = 190/253 (75%), Gaps = 7/253 (3%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC----YHppsppsgggsVADIVSDAFFN  280
            QNCGC    CCS++GYCGT D YCG+GC+ GPC           SGG +VA++V+DAFFN
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDAYCGDGCQSGPCRSGGGGGGGGGSGGANVANVVTDAFFN  85

Query  281  GIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCY  460
            GI +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHETG  CY
Sbjct  86   GIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETGRFCY  145

Query  461  IKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVA  640
            I EI+ ++  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ VA
Sbjct  146  ISEIN-KNNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNRVA  204

Query  641  TDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYC  820
             D +I+FKTALWFWMNN H L+   QGFG TIRAING LEC+G NP  +  RV YY QYC
Sbjct  205  QDAVIAFKTALWFWMNNVHRLMP--QGFGVTIRAINGALECNGNNPAQMNARVGYYKQYC  262

Query  821  QQLGVDPGNNLEC  859
            QQL VDPG NL C
Sbjct  263  QQLRVDPGPNLTC  275



>gb|ACJ61868.1| chitinase [Zea mays subsp. parviglumis]
Length=277

 Score =   321 bits (822),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 159/255 (62%), Positives = 190/255 (75%), Gaps = 9/255 (4%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC------YHppsppsgggsVADIVSDAF  274
            QNCGC    CCS++GYCGT D YCG+GC+ GPC             SGG +VA++VSDAF
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDAYCGDGCQSGPCRSGGGGGGGGGGGSGGANVANVVSDAF  85

Query  275  FNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHM  454
            FNGI +QA   CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHETG  
Sbjct  86   FNGIKNQAGGGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETGRF  145

Query  455  CYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDV  634
            CYI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ 
Sbjct  146  CYISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNR  204

Query  635  VATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQ  814
            VA D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY Q
Sbjct  205  VAQDAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQ  262

Query  815  YCQQLGVDPGNNLEC  859
            YCQQL VDPG NL C
Sbjct  263  YCQQLRVDPGPNLTC  277



>gb|ABP37821.1| chitinase B [Saccharum officinarum]
Length=259

 Score =   320 bits (821),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 161/253 (64%), Positives = 193/253 (76%), Gaps = 9/253 (4%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC----YHppsppsgggsVADIVSDAFFN  280
            QNCGC    CCS++GYCGT DDYCG+GC+ GPC      P    SG G+VA +V+DAFFN
Sbjct  12   QNCGCQPNYCCSKFGYCGTTDDYCGDGCQSGPCRSGGGSPGGGSSGVGNVAGVVTDAFFN  71

Query  281  GIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCY  460
            GI +QA + CEGK FYTR++FL A +SY  FG  G + + KREIAAFFAHVTHETGH CY
Sbjct  72   GIKNQAGNGCEGKNFYTRSAFLSAADSYKGFG--GGSVEGKREIAAFFAHVTHETGHFCY  129

Query  461  IKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVA  640
            I EI+ ++  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL NPD VA
Sbjct  130  ISEIN-KNNAYCDSSNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLGNPDRVA  188

Query  641  TDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYC  820
             D +I+FKTALWFW NN H +++  QGFGATIRAING LEC+G NP  +  RV YY QYC
Sbjct  189  QDAVIAFKTALWFWTNNVHRVMS--QGFGATIRAINGVLECNGNNPAQMNARVGYYKQYC  246

Query  821  QQLGVDPGNNLEC  859
            QQLGVDPG NL C
Sbjct  247  QQLGVDPGPNLTC  259



>gb|ACJ61970.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ61972.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ61975.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ61991.1| chitinase [Zea mays subsp. parviglumis]
Length=277

 Score =   321 bits (822),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 152/249 (61%), Positives = 185/249 (74%), Gaps = 3/249 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC   +CCS++GYCGT D+YCG+GC+ GPC        GG +VA +V+ +FFNGI +
Sbjct  32   QNCGCQPNVCCSKFGYCGTTDEYCGDGCQSGPCRSGGGSGGGGANVASVVTGSFFNGIKN  91

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA S CEGK FYTR++FL AV +YP F   GS    KREIAAFFAH THETGH CYI EI
Sbjct  92   QAGSGCEGKNFYTRSAFLSAVKAYPGFAHGGSQVQGKREIAAFFAHATHETGHFCYISEI  151

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            + +S  YCD +  Q+PCA G+ YYGRGP+Q+SWN+NYGPAG++IGFDGL +P  VA D +
Sbjct  152  N-KSNAYCDPSKRQWPCAAGQKYYGRGPLQISWNYNYGPAGRAIGFDGLGDPGRVARDAV  210

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ++FK ALWFWMN+ H ++   QGFGAT RAING LEC G NP  +  RV YY QYC+QLG
Sbjct  211  VAFKAALWFWMNSVHGVVP--QGFGATTRAINGALECGGNNPAQMNARVGYYRQYCRQLG  268

Query  833  VDPGNNLEC  859
            VDPG NL C
Sbjct  269  VDPGPNLTC  277



>gb|ACJ61927.1| chitinase [Zea mays subsp. parviglumis]
Length=276

 Score =   321 bits (822),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 158/254 (62%), Positives = 191/254 (75%), Gaps = 8/254 (3%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC-----YHppsppsgggsVADIVSDAFF  277
            QNCGC    CCS++GYCGT D YCG+GC+ GPC            SGG +VA++V+DAFF
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDAYCGDGCQSGPCRSGGGGGGGGGGSGGANVANVVTDAFF  85

Query  278  NGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMC  457
            NGI +QA S CEGK FYTR++FL AVN+YP F   G+  + KR+IAAFFAHVTHETG  C
Sbjct  86   NGIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKRKIAAFFAHVTHETGRFC  145

Query  458  YIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVV  637
            YI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ V
Sbjct  146  YISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNRV  204

Query  638  ATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQY  817
            A D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY QY
Sbjct  205  AQDAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQY  262

Query  818  CQQLGVDPGNNLEC  859
            CQQL VDPG NL C
Sbjct  263  CQQLRVDPGPNLTC  276



>gb|ACJ61885.1| chitinase [Zea mays subsp. parviglumis]
Length=275

 Score =   320 bits (821),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 157/253 (62%), Positives = 189/253 (75%), Gaps = 7/253 (3%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgg----gsVADIVSDAFFN  280
            QNCGC    CCS++GYCGT DDYCG+GC+ GPC        GG     +VA++ +DAFFN
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDDYCGDGCQSGPCRSGGGGGGGGGSGGANVANVATDAFFN  85

Query  281  GIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCY  460
            GI +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHETG  CY
Sbjct  86   GIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETGRFCY  145

Query  461  IKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVA  640
            I EI+ ++  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ VA
Sbjct  146  ISEIN-KNNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNRVA  204

Query  641  TDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYC  820
             D +I+FKTALWFWMNN   L+   QGFGATIRAING LEC+G NP  +  RV YY QYC
Sbjct  205  QDAVIAFKTALWFWMNNVRRLMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQYC  262

Query  821  QQLGVDPGNNLEC  859
            QQL VDPG NL C
Sbjct  263  QQLRVDPGPNLTC  275



>ref|XP_004976080.1| PREDICTED: endochitinase A-like [Setaria italica]
Length=270

 Score =   320 bits (821),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 156/249 (63%), Positives = 187/249 (75%), Gaps = 7/249 (3%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC    CCS++G+CG   +YCG+GC+ GPC       +    VA++V+DAFFNGI +
Sbjct  29   QNCGCQPNFCCSRFGFCGQTTEYCGDGCQSGPCIRGGGGAN----VANVVTDAFFNGIKN  84

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA SSCEGK FYTR +FL+AVNSY  F   GS  + KREIAAFFAHVTHETG+ CYI EI
Sbjct  85   QAPSSCEGKNFYTRGAFLNAVNSYSGFARGGSEVEGKREIAAFFAHVTHETGYFCYISEI  144

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            + ++  YC+ + TQ+PCA GK YYGRGP+QLSWN+NYG AG+ I FDGL NPDVVA DP+
Sbjct  145  N-KNDPYCNPSYTQWPCAAGKKYYGRGPLQLSWNYNYGAAGRDIKFDGLGNPDVVAQDPV  203

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            I+FK ALW+WMNN H ++   +GFGAT RAING LECDG N D +  RV YY QYCQQLG
Sbjct  204  IAFKAALWYWMNNVHGVMP--RGFGATTRAINGDLECDGKNTDKMNARVGYYRQYCQQLG  261

Query  833  VDPGNNLEC  859
            VDPG NL C
Sbjct  262  VDPGGNLTC  270



>gb|ACJ61857.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ61860.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ61872.1| chitinase [Zea mays subsp. parviglumis]
Length=280

 Score =   320 bits (821),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 159/258 (62%), Positives = 191/258 (74%), Gaps = 12/258 (5%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC---------YHppsppsgggsVADIVS  265
            QNCGC    CCS++GYCGT D YCG+GC+ GPC                SGG +VA++V+
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDAYCGDGCQSGPCRSGGGGGGGGGGGGGGSGGANVANVVT  85

Query  266  DAFFNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHET  445
            DAFFNGI +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHET
Sbjct  86   DAFFNGIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHET  145

Query  446  GHMCYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNN  625
            G  CYI EI+ ++  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +
Sbjct  146  GRFCYISEIN-KNNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLAD  204

Query  626  PDVVATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEY  805
            P+ VA D +I+FKTALWFWMNN H L+   QGFGATIRAING LEC+G NP  +  RV Y
Sbjct  205  PNRVAQDAVIAFKTALWFWMNNVHRLMP--QGFGATIRAINGALECNGNNPAQMNARVGY  262

Query  806  YTQYCQQLGVDPGNNLEC  859
            Y QYCQQL VDPG NL C
Sbjct  263  YKQYCQQLRVDPGPNLTC  280



>gb|ACJ61973.1| chitinase [Zea mays subsp. parviglumis]
Length=277

 Score =   320 bits (821),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 152/249 (61%), Positives = 185/249 (74%), Gaps = 3/249 (1%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC   +CCS++GYCGT D+YCG+GC+ GPC        GG +VA +V+ +FFNGI +
Sbjct  32   QNCGCQPNVCCSKFGYCGTTDEYCGDGCQSGPCRSGGGSGGGGANVASVVTGSFFNGIKN  91

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA S CEGK FYTR++FL AV +YP F   GS    KREIAAFFAH THETGH CYI EI
Sbjct  92   QAGSGCEGKNFYTRSAFLSAVKAYPGFAHGGSQVQGKREIAAFFAHATHETGHSCYISEI  151

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            + +S  YCD +  Q+PCA G+ YYGRGP+Q+SWN+NYGPAG++IGFDGL +P  VA D +
Sbjct  152  N-KSNAYCDPSKRQWPCAAGQKYYGRGPLQISWNYNYGPAGRAIGFDGLGDPGRVARDAV  210

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ++FK ALWFWMN+ H ++   QGFGAT RAING LEC G NP  +  RV YY QYC+QLG
Sbjct  211  VAFKAALWFWMNSVHGVVP--QGFGATTRAINGALECGGNNPAQMNARVGYYRQYCRQLG  268

Query  833  VDPGNNLEC  859
            VDPG NL C
Sbjct  269  VDPGPNLTC  277



>gb|ACJ61906.1| chitinase [Zea mays subsp. parviglumis]
Length=277

 Score =   320 bits (821),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 158/255 (62%), Positives = 189/255 (74%), Gaps = 9/255 (4%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgg------gsVADIVSDAF  274
            QNCGC    CCS++GYCGT D YCG+GC+ GPC        GG       +VA++VSDAF
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDAYCGDGCQSGPCRSGGGGGGGGGGGSGGANVANVVSDAF  85

Query  275  FNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHM  454
            FNGI +QA S CEGK FYTR++FL AVN YP F   G+  + KREIAAFFAHVTHETG  
Sbjct  86   FNGIKNQAGSGCEGKNFYTRSAFLSAVNKYPGFAHGGTEVEGKREIAAFFAHVTHETGRF  145

Query  455  CYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDV  634
            C+I EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ 
Sbjct  146  CHISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNR  204

Query  635  VATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQ  814
            VA D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY Q
Sbjct  205  VAQDAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQ  262

Query  815  YCQQLGVDPGNNLEC  859
            YCQQL VDPG NL C
Sbjct  263  YCQQLRVDPGPNLTC  277



>gb|ACJ61900.1| chitinase [Zea mays subsp. parviglumis]
Length=276

 Score =   320 bits (820),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 156/252 (62%), Positives = 188/252 (75%), Gaps = 6/252 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgg---gsVADIVSDAFFNG  283
            QNCGC    CCS++GYCGT DDYCG+GC+ GPC        GG    +VA++V+DAF NG
Sbjct  28   QNCGCQPNFCCSKFGYCGTTDDYCGDGCQSGPCRSGGGGGGGGSGGANVANVVTDAFLNG  87

Query  284  IADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYI  463
            I +QA S CEGK FYTR++FL AVN YP F   G+  + KREIAAFFAHVTHETG  CYI
Sbjct  88   IKNQAGSGCEGKNFYTRSAFLSAVNKYPGFAHGGTEVEGKREIAAFFAHVTHETGRFCYI  147

Query  464  KEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVAT  643
             EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+G+ +P+ VA 
Sbjct  148  SEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGIADPNRVAQ  206

Query  644  DPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQ  823
            D +I+ KTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY QYCQ
Sbjct  207  DAVIALKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQYCQ  264

Query  824  QLGVDPGNNLEC  859
            QL VDPG NL C
Sbjct  265  QLRVDPGPNLTC  276



>gb|ACJ61864.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ61935.1| chitinase [Zea mays subsp. parviglumis]
Length=280

 Score =   320 bits (821),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 159/258 (62%), Positives = 191/258 (74%), Gaps = 12/258 (5%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC---------YHppsppsgggsVADIVS  265
            QNCGC    CCS++GYCGT DDYCG+GC+ GPC                SGG +VA++V+
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDDYCGDGCQSGPCRSGGGGGGGGGGGGGGSGGANVANVVT  85

Query  266  DAFFNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHET  445
            DAFFNGI +QA S CEGK FYTR++F  AVN+YP F   G+  + KREIAAFFAHVTHET
Sbjct  86   DAFFNGIKNQAGSGCEGKNFYTRSAFQSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHET  145

Query  446  GHMCYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNN  625
            G  CYI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +
Sbjct  146  GRFCYISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLAD  204

Query  626  PDVVATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEY  805
            P+ VA D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV Y
Sbjct  205  PNRVAQDAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGY  262

Query  806  YTQYCQQLGVDPGNNLEC  859
            Y QYCQQL VDPG NL C
Sbjct  263  YKQYCQQLRVDPGPNLTC  280



>ref|XP_010687453.1| PREDICTED: endochitinase A-like [Beta vulgaris subsp. vulgaris]
Length=265

 Score =   320 bits (819),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 159/249 (64%), Positives = 196/249 (79%), Gaps = 8/249 (3%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCA  LCCSQ+G+CG+ D YCGEGC+EGPC    SP SGGGSV+ +V+DAFFN I +
Sbjct  25   QNCGCASNLCCSQFGFCGSTDAYCGEGCREGPC---RSPSSGGGSVSSLVTDAFFNRIIN  81

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA +SC GK FYTR +FL A+  YPQFG+ GS+D  +RE+AAFFAHVTHETGH CYI+EI
Sbjct  82   QASASCAGKRFYTRAAFLSALRFYPQFGS-GSSDVVRREVAAFFAHVTHETGHFCYIEEI  140

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
               +  YC +++  +PC P K YYGRGP+Q++WN+NY PAG+SIGFDGLN P+ VA + +
Sbjct  141  AKST--YC-QSSAAFPCNPNKQYYGRGPLQITWNYNYIPAGRSIGFDGLNAPETVANNAV  197

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
             +F+TA WFWMNN HS+I +GQGFG++IRAING +EC+G N   V  RV YYTQYCQQLG
Sbjct  198  TAFRTAFWFWMNNVHSVIVNGQGFGSSIRAING-IECNGGNSAAVTARVGYYTQYCQQLG  256

Query  833  VDPGNNLEC  859
            V PGNNL C
Sbjct  257  VSPGNNLRC  265



>gb|ACJ61910.1| chitinase [Zea mays subsp. parviglumis]
Length=281

 Score =   320 bits (820),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 157/257 (61%), Positives = 191/257 (74%), Gaps = 11/257 (4%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgg--------gsVADIVSD  268
            QNCGC    CCS++GYCGT D YCG+GC+ GPC+       GG         +VA++V+D
Sbjct  28   QNCGCQPNFCCSKFGYCGTTDAYCGDGCQSGPCHSGGGGGGGGGGGGGSGGANVANVVTD  87

Query  269  AFFNGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETG  448
            AFF+GI +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHETG
Sbjct  88   AFFSGIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETG  147

Query  449  HMCYIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNP  628
              CYI EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P
Sbjct  148  RFCYISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLGDP  206

Query  629  DVVATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYY  808
            + VA D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY
Sbjct  207  NRVAQDAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYY  264

Query  809  TQYCQQLGVDPGNNLEC  859
             QYCQQL VDPG NL C
Sbjct  265  KQYCQQLRVDPGPNLTC  281



>emb|CAA53544.1| chitinase [Beta vulgaris subsp. vulgaris]
Length=265

 Score =   319 bits (818),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 159/249 (64%), Positives = 196/249 (79%), Gaps = 8/249 (3%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGCA  LCCS++G+CG+ D YCGEGC+EGPC    SP SGGGSV+ +V+DAFFN I +
Sbjct  25   QNCGCASNLCCSRFGFCGSTDAYCGEGCREGPC---RSPSSGGGSVSSLVTDAFFNRIIN  81

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA +SC GK FYTR +FL A+  YPQFG+ GS+D  +RE+AAFFAHVTHETGH CYI+EI
Sbjct  82   QASASCAGKRFYTRAAFLSALRFYPQFGS-GSSDVVRREVAAFFAHVTHETGHFCYIEEI  140

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
               +  YC +++  +PC P K YYGRGP+Q++WN+NY PAG+SIGFDGLN P+ VA + +
Sbjct  141  AKST--YC-QSSAAFPCNPSKQYYGRGPLQITWNYNYIPAGRSIGFDGLNAPETVANNAV  197

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
             +F+TA WFWMNN HS+I +GQGFGA+IRAING +EC+G N   V  RV YYTQYCQQLG
Sbjct  198  TAFRTAFWFWMNNVHSVIVNGQGFGASIRAING-IECNGGNSAAVTARVGYYTQYCQQLG  256

Query  833  VDPGNNLEC  859
            V PGNNL C
Sbjct  257  VSPGNNLRC  265



>gb|ACJ61988.1| chitinase [Zea mays subsp. parviglumis]
Length=280

 Score =   320 bits (820),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 154/252 (61%), Positives = 186/252 (74%), Gaps = 6/252 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC---YHppsppsgggsVADIVSDAFFNG  283
            QNCGC   +CCS++GYCGT D+YCG+GC+ GPC           GG +VA +V+ +FFNG
Sbjct  32   QNCGCQPNVCCSKFGYCGTTDEYCGDGCQSGPCRSGGGGGGSGGGGANVASVVTSSFFNG  91

Query  284  IADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYI  463
            I +QA S CEGK FYTR++FL AV +YP F   GSA   KREIAAFFAH THETGH CYI
Sbjct  92   IKNQAGSGCEGKNFYTRSAFLSAVKAYPGFAHGGSAVQGKREIAAFFAHATHETGHFCYI  151

Query  464  KEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVAT  643
             EI+ +S  YCD T  Q+PCA G+ YYGRGP+Q+SWN+NYGPAG++IGFDGL +P  VA 
Sbjct  152  SEIN-KSNAYCDPTKKQWPCAAGQKYYGRGPLQISWNYNYGPAGRAIGFDGLRDPGRVAR  210

Query  644  DPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQ  823
            D +++FK ALWFWMN+ H ++   QGFGAT RAING LEC G NP  +  RV YY QYC+
Sbjct  211  DAVVAFKAALWFWMNSVHGVVP--QGFGATTRAINGALECGGNNPAQMNARVGYYRQYCR  268

Query  824  QLGVDPGNNLEC  859
            QLGVDPG NL C
Sbjct  269  QLGVDPGPNLTC  280



>gb|AAK97762.1| chitinase-B, partial [Sorghum bicolor]
Length=262

 Score =   319 bits (817),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 160/249 (64%), Positives = 193/249 (78%), Gaps = 5/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC  G CCS++GYCGT DDYCG+GC+ GPC    S  SGGG+V  +V+DAFFNGI +
Sbjct  19   QNCGCQAGYCCSKFGYCGTTDDYCGDGCQSGPCRSSGSSSSGGGNVGSVVTDAFFNGIKN  78

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA S CEGK FYTR++FL A NSY  FG  G +   KREIAAFFAHVTHETGH CYI EI
Sbjct  79   QAASGCEGKNFYTRSAFLSAANSYKSFG--GGSVAGKREIAAFFAHVTHETGHFCYISEI  136

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            + ++  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG++IGF+GL NP+ VA D +
Sbjct  137  N-KNNAYCDSSNKQWPCAAGQKYYGRGPLQISWNYNYGPAGKAIGFNGLANPNKVAQDAV  195

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            I+FKTALW+W NN H +++  QGFGATIRAING LEC+G N   +  RV YY QYC+QLG
Sbjct  196  IAFKTALWYWTNNVHGVMS--QGFGATIRAINGALECNGKNTAQMNARVGYYKQYCRQLG  253

Query  833  VDPGNNLEC  859
            VDPG NL C
Sbjct  254  VDPGPNLTC  262



>ref|XP_002448106.1| hypothetical protein SORBIDRAFT_06g021230 [Sorghum bicolor]
 gb|EES12434.1| hypothetical protein SORBIDRAFT_06g021230 [Sorghum bicolor]
Length=266

 Score =   319 bits (817),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 157/249 (63%), Positives = 191/249 (77%), Gaps = 6/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC  G CCS++GYCGT D+YCG+GC+ GPC       SGGG+VA +V+DAFFN I +
Sbjct  24   QNCGCQAGYCCSKFGYCGTTDEYCGDGCQSGPC-RSGGGSSGGGNVAGVVTDAFFNSIKN  82

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA + CEGK FYTR++FL A ++Y  FG  G +   KREIAAFFAH+THETGH CYI EI
Sbjct  83   QAGNGCEGKNFYTRSAFLSAADAYKGFG--GRSVQGKREIAAFFAHITHETGHFCYISEI  140

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            + ++  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGFDGL NPD VA D +
Sbjct  141  N-KNNAYCDSSNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFDGLRNPDRVAQDAV  199

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            ++FKTALWFW NN H +++  QGFGATIRAING LEC+G N   +  RV YY QYCQQLG
Sbjct  200  VAFKTALWFWTNNVHGVMS--QGFGATIRAINGALECNGKNTAQMNARVGYYRQYCQQLG  257

Query  833  VDPGNNLEC  859
            VDPG NL C
Sbjct  258  VDPGPNLTC  266



>gb|AAT39999.1| chitinase [Zea mays subsp. parviglumis]
Length=282

 Score =   320 bits (819),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/252 (61%), Positives = 186/252 (74%), Gaps = 6/252 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC---YHppsppsgggsVADIVSDAFFNG  283
            QNCGC   +CCS++GYCGT D+YCG+GC+ GPC           GG +VA +V+ +FFNG
Sbjct  34   QNCGCQPNVCCSKFGYCGTTDEYCGDGCQSGPCRSGGGGGGSGGGGANVASVVTSSFFNG  93

Query  284  IADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYI  463
            I +QA S CEGK FYTR++FL AV +YP F   GSA   KREIAAFFAH THETGH CYI
Sbjct  94   IKNQAGSGCEGKNFYTRSAFLSAVKAYPGFAHGGSAVQGKREIAAFFAHATHETGHFCYI  153

Query  464  KEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVAT  643
             EI+ +S  YCD T  Q+PCA G+ YYGRGP+Q+SWN+NYGPAG++IGFDGL +P  VA 
Sbjct  154  SEIN-KSNAYCDPTKRQWPCAAGQKYYGRGPLQISWNYNYGPAGRAIGFDGLGDPGRVAR  212

Query  644  DPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQ  823
            D +++FK ALWFWMN+ H ++   QGFGAT RAING LEC G NP  +  RV YY QYC+
Sbjct  213  DAVVAFKAALWFWMNSVHGVVP--QGFGATTRAINGALECGGNNPAQMNARVGYYRQYCR  270

Query  824  QLGVDPGNNLEC  859
            QLGVDPG NL C
Sbjct  271  QLGVDPGPNLTC  282



>gb|ACJ61866.1| chitinase [Zea mays subsp. parviglumis]
Length=276

 Score =   319 bits (818),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 158/254 (62%), Positives = 190/254 (75%), Gaps = 8/254 (3%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC-----YHppsppsgggsVADIVSDAFF  277
            QNCGC    CCS++GYCGT DDYCG+GC+ GPC            SGG +VA++V+DAFF
Sbjct  26   QNCGCQPNFCCSKFGYCGTTDDYCGDGCQSGPCRSGGGGGGGGGGSGGANVANVVTDAFF  85

Query  278  NGIADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMC  457
            NGI +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFFAHVTHETG   
Sbjct  86   NGIKNQAGSGCEGKNFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFAHVTHETGRFL  145

Query  458  YIKEIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVV  637
             I EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ V
Sbjct  146  LISEIN-KSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNRV  204

Query  638  ATDPIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQY  817
            A D +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY QY
Sbjct  205  AQDAVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQY  262

Query  818  CQQLGVDPGNNLEC  859
            CQQL VDPG NL C
Sbjct  263  CQQLRVDPGPNLTC  276



>gb|ACJ61871.1| chitinase [Zea mays subsp. parviglumis]
Length=273

 Score =   319 bits (817),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 158/251 (63%), Positives = 189/251 (75%), Gaps = 5/251 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPC--YHppsppsgggsVADIVSDAFFNGI  286
            QNCGC    C S++GYCGT D YCG+GC+ GPC         SGG +VA++VSDAFFNGI
Sbjct  26   QNCGCQPNFCYSKFGYCGTTDAYCGDGCQSGPCRSGGGGGGGSGGANVANVVSDAFFNGI  85

Query  287  ADQADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIK  466
             +QA S CEGK FYTR++FL AVN+YP F   G+  + KREIAAFF HVTHETG  CYI 
Sbjct  86   KNQAGSGCEGKSFYTRSAFLSAVNAYPGFAHGGTEVEGKREIAAFFTHVTHETGRFCYIS  145

Query  467  EIDGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATD  646
            EI+ +S  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG+ IGF+GL +P+ VA D
Sbjct  146  EIN-KSNAYCDASNKQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNRVAQD  204

Query  647  PIISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQ  826
             +I+FKTALWFWMNN H ++   QGFGATIRAING LEC+G NP  +  RV YY QYCQQ
Sbjct  205  AVIAFKTALWFWMNNVHRVMP--QGFGATIRAINGALECNGNNPAQMNARVGYYKQYCQQ  262

Query  827  LGVDPGNNLEC  859
            L VDPG NL C
Sbjct  263  LRVDPGPNLTC  273



>ref|XP_002448107.1| hypothetical protein SORBIDRAFT_06g021240 [Sorghum bicolor]
 gb|EES12435.1| hypothetical protein SORBIDRAFT_06g021240 [Sorghum bicolor]
Length=273

 Score =   319 bits (817),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/249 (64%), Positives = 193/249 (78%), Gaps = 5/249 (2%)
 Frame = +2

Query  113  QNCGCAEGLCCSQWGYCGTGDDYCGEGCKEGPCYHppsppsgggsVADIVSDAFFNGIAD  292
            QNCGC  G CCS++GYCGT DDYCG+GC+ GPC    S  SGGG+V  +V+DAFFNGI +
Sbjct  30   QNCGCQAGYCCSKFGYCGTTDDYCGDGCQSGPCRSSGSSSSGGGNVGSVVTDAFFNGIKN  89

Query  293  QADSSCEGKGFYTRTSFLDAVNSYPQFGTVGSADDSKREIAAFFAHVTHETGHMCYIKEI  472
            QA S CEGK FYTR++FL A NSY  FG  G +   KREIAAFFAHVTHETGH CYI EI
Sbjct  90   QAASGCEGKNFYTRSAFLSAANSYKSFG--GGSVAGKREIAAFFAHVTHETGHFCYISEI  147

Query  473  DGESRDYCDKTNTQYPCAPGKMYYGRGPIQLSWNFNYGPAGQSIGFDGLNNPDVVATDPI  652
            + ++  YCD +N Q+PCA G+ YYGRGP+Q+SWN+NYGPAG++IGF+GL NP+ VA D +
Sbjct  148  N-KNNAYCDSSNKQWPCAAGQKYYGRGPLQISWNYNYGPAGKAIGFNGLANPNKVAQDAV  206

Query  653  ISFKTALWFWMNNCHSLITSGQGFGATIRAINGQLECDGANPDTVRKRVEYYTQYCQQLG  832
            I+FKTALW+W NN H +++  QGFGATIRAING LEC+G N   +  RV YY QYC+QLG
Sbjct  207  IAFKTALWYWTNNVHGVMS--QGFGATIRAINGALECNGKNTAQMNARVGYYKQYCRQLG  264

Query  833  VDPGNNLEC  859
            VDPG NL C
Sbjct  265  VDPGPNLTC  273



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2058090802196