BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24092_g2_i1 len=2279 path=[1:0-648 650:649-668 670:669-715
5743:716-815 817:816-839 841:840-1037 1039:1038-1098 1100:1099-1145
1147:1146-2278]

Length=2279
                                                                      Score     E

ref|XP_006351761.1|  PREDICTED: ABC transporter G family member 1...    797   0.0      
ref|XP_004230551.1|  PREDICTED: ABC transporter G family member 1...    786   0.0      
ref|XP_009610194.1|  PREDICTED: ABC transporter G family member 1...    785   0.0      
gb|AFC36404.1|  ABCG1                                                   781   0.0      
ref|XP_009763606.1|  PREDICTED: ABC transporter G family member 1...    770   0.0      
ref|XP_009611614.1|  PREDICTED: ABC transporter G family member 1...    771   0.0      
ref|XP_002270647.1|  PREDICTED: ABC transporter G family member 11      770   0.0      Vitis vinifera
emb|CAN60999.1|  hypothetical protein VITISV_012972                     764   0.0      Vitis vinifera
ref|XP_010267240.1|  PREDICTED: ABC transporter G family member 1...    761   0.0      
ref|XP_006492628.1|  PREDICTED: ABC transporter G family member 1...    758   0.0      
ref|XP_010267226.1|  PREDICTED: ABC transporter G family member 1...    759   0.0      
ref|XP_010258617.1|  PREDICTED: ABC transporter G family member 1...    758   0.0      
ref|XP_009784909.1|  PREDICTED: ABC transporter G family member 1...    754   0.0      
ref|XP_010273011.1|  PREDICTED: ABC transporter G family member 1...    756   0.0      
ref|XP_006423805.1|  hypothetical protein CICLE_v10027954mg             753   0.0      
ref|XP_007207212.1|  hypothetical protein PRUPE_ppa001905mg             753   0.0      
ref|XP_006423808.1|  hypothetical protein CICLE_v10027953mg             750   0.0      
ref|XP_009767616.1|  PREDICTED: ABC transporter G family member 1...    749   0.0      
ref|XP_007047882.1|  White-brown complex protein 11 isoform 1           750   0.0      
ref|XP_007047885.1|  White-brown complex protein 11 isoform 4           749   0.0      
ref|XP_003635438.1|  PREDICTED: ABC transporter G family member 1...    748   0.0      
ref|XP_002300189.2|  hypothetical protein POPTR_0001s31880g             746   0.0      Populus trichocarpa [western balsam poplar]
gb|KDP40917.1|  hypothetical protein JCGZ_24916                         744   0.0      
ref|XP_002531674.1|  ATP-binding cassette transporter, putative         744   0.0      Ricinus communis
ref|XP_006351854.1|  PREDICTED: ABC transporter G family member 1...    741   0.0      
ref|XP_008381985.1|  PREDICTED: ABC transporter G family member 1...    744   0.0      
ref|XP_011003862.1|  PREDICTED: ABC transporter G family member 1...    741   0.0      
ref|XP_009611610.1|  PREDICTED: ABC transporter G family member 1...    739   0.0      
ref|XP_006373046.1|  hypothetical protein POPTR_0017s07820g             738   0.0      
ref|XP_007042908.1|  White-brown complex protein 11                     748   0.0      
ref|XP_006492644.1|  PREDICTED: ABC transporter G family member 1...    738   0.0      
gb|KDP29717.1|  hypothetical protein JCGZ_18652                         739   0.0      
ref|XP_002267117.3|  PREDICTED: ABC transporter G family member 1...    736   0.0      Vitis vinifera
ref|XP_007201742.1|  hypothetical protein PRUPE_ppa002207mg             738   0.0      
ref|XP_009760682.1|  PREDICTED: ABC transporter G family member 1...    739   0.0      
ref|XP_009337870.1|  PREDICTED: ABC transporter G family member 1...    736   0.0      
ref|XP_008237167.1|  PREDICTED: ABC transporter G family member 1...    737   0.0      
emb|CBI33134.3|  unnamed protein product                                733   0.0      
ref|XP_010648172.1|  PREDICTED: ABC transporter G family member 1...    735   0.0      
ref|XP_004288174.1|  PREDICTED: ABC transporter G family member 1...    736   0.0      
gb|AIU41648.1|  ABC transporter family protein                          733   0.0      
ref|XP_010030026.1|  PREDICTED: ABC transporter G family member 1...    734   0.0      
ref|XP_010030024.1|  PREDICTED: ABC transporter G family member 1...    734   0.0      
ref|XP_008373271.1|  PREDICTED: ABC transporter G family member 1...    733   0.0      
ref|XP_002525837.1|  ATP-binding cassette transporter, putative         734   0.0      Ricinus communis
ref|XP_007201741.1|  hypothetical protein PRUPE_ppa002200mg             733   0.0      
ref|XP_008358343.1|  PREDICTED: ABC transporter G family member 1...    732   0.0      
ref|XP_006366225.1|  PREDICTED: ABC transporter G family member 1...    733   0.0      
ref|XP_002270573.2|  PREDICTED: ABC transporter G family member 11      730   0.0      Vitis vinifera
emb|CBI35723.3|  unnamed protein product                                736   0.0      
ref|XP_011043109.1|  PREDICTED: ABC transporter G family member 1...    728   0.0      
ref|XP_006366235.1|  PREDICTED: ABC transporter G family member 1...    727   0.0      
ref|XP_011031060.1|  PREDICTED: ABC transporter G family member 1...    728   0.0      
emb|CBI34070.3|  unnamed protein product                                722   0.0      
ref|XP_002306299.2|  hypothetical protein POPTR_0005s07420g             726   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010937385.1|  PREDICTED: ABC transporter G family member 1...    721   0.0      
ref|XP_010937388.1|  PREDICTED: ABC transporter G family member 1...    721   0.0      
ref|XP_006426350.1|  hypothetical protein CICLE_v10025064mg             719   0.0      
ref|XP_010937387.1|  PREDICTED: ABC transporter G family member 1...    721   0.0      
ref|XP_009609769.1|  PREDICTED: ABC transporter G family member 1...    717   0.0      
gb|KCW54566.1|  hypothetical protein EUGRSUZ_I00526                     715   0.0      
ref|XP_008791489.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    717   0.0      
ref|XP_006426351.1|  hypothetical protein CICLE_v10025117mg             714   0.0      
ref|XP_010030453.1|  PREDICTED: ABC transporter G family member 1...    713   0.0      
ref|XP_006466253.1|  PREDICTED: ABC transporter G family member 1...    714   0.0      
dbj|BAL46500.1|  ABC transporter                                        717   0.0      
ref|XP_004288175.1|  PREDICTED: ABC transporter G family member 1...    716   0.0      
gb|KCW54564.1|  hypothetical protein EUGRSUZ_I00523                     713   0.0      
ref|XP_009344594.1|  PREDICTED: ABC transporter G family member 1...    715   0.0      
ref|XP_009387386.1|  PREDICTED: ABC transporter G family member 1...    715   0.0      
ref|XP_010030454.1|  PREDICTED: ABC transporter G family member 1...    713   0.0      
ref|XP_004504817.1|  PREDICTED: ABC transporter G family member 1...    710   0.0      
ref|XP_004289302.1|  PREDICTED: ABC transporter G family member 1...    711   0.0      
ref|XP_010094142.1|  ABC transporter G family member 11                 709   0.0      
ref|XP_007159121.1|  hypothetical protein PHAVU_002G210400g             709   0.0      
ref|XP_004289305.1|  PREDICTED: ABC transporter G family member 1...    710   0.0      
ref|XP_010030452.1|  PREDICTED: ABC transporter G family member 1...    709   0.0      
ref|XP_009403077.1|  PREDICTED: ABC transporter G family member 1...    706   0.0      
ref|XP_010030023.1|  PREDICTED: ABC transporter G family member 1...    706   0.0      
ref|XP_003608431.1|  White-brown-complex ABC transporter family         704   0.0      
ref|XP_010939685.1|  PREDICTED: ABC transporter G family member 1...    706   0.0      
ref|XP_010680511.1|  PREDICTED: ABC transporter G family member 1...    703   0.0      
ref|XP_008790912.1|  PREDICTED: ABC transporter G family member 1...    703   0.0      
ref|XP_004306292.1|  PREDICTED: ABC transporter G family member 1...    702   0.0      
ref|XP_010648248.1|  PREDICTED: ABC transporter G family member 1...    699   0.0      
gb|EYU23963.1|  hypothetical protein MIMGU_mgv1a018782mg                700   0.0      
gb|KCW56964.1|  hypothetical protein EUGRSUZ_I02638                     698   0.0      
gb|EYU23962.1|  hypothetical protein MIMGU_mgv1a002102mg                700   0.0      
emb|CAN72387.1|  hypothetical protein VITISV_025427                     695   0.0      Vitis vinifera
ref|XP_010094141.1|  ABC transporter G family member 11                 697   0.0      
gb|EYU18458.1|  hypothetical protein MIMGU_mgv1a018793mg                693   0.0      
ref|XP_011097541.1|  PREDICTED: ABC transporter G family member 1...    695   0.0      
gb|AES90632.2|  white-brown-complex ABC transporter family protein      695   0.0      
emb|CBI25872.3|  unnamed protein product                                689   0.0      
ref|XP_011097542.1|  PREDICTED: ABC transporter G family member 1...    693   0.0      
ref|XP_003532610.1|  PREDICTED: ABC transporter G family member 1...    692   0.0      
gb|KHN26508.1|  ABC transporter G family member 11                      692   0.0      
ref|XP_003532607.1|  PREDICTED: ABC transporter G family member 1...    692   0.0      
ref|XP_010652672.1|  PREDICTED: ABC transporter G family member 1...    688   0.0      
ref|XP_009611615.1|  PREDICTED: ABC transporter G family member 1...    689   0.0      
ref|XP_003543926.1|  PREDICTED: ABC transporter G family member 1...    690   0.0      
ref|XP_011087908.1|  PREDICTED: ABC transporter G family member 1...    689   0.0      
gb|AES90633.2|  white-brown-complex ABC transporter family protein      688   0.0      
ref|XP_003608435.1|  White-brown-complex ABC transporter family         689   0.0      
ref|XP_009767617.1|  PREDICTED: ABC transporter G family member 1...    685   0.0      
gb|KHN28203.1|  ABC transporter G family member 11                      686   0.0      
emb|CDO97684.1|  unnamed protein product                                685   0.0      
gb|KHN28204.1|  ABC transporter G family member 11                      684   0.0      
ref|XP_006593746.1|  PREDICTED: ABC transporter G family member 1...    685   0.0      
ref|XP_003608436.1|  White-brown-complex ABC transporter family         685   0.0      
gb|KHN26506.1|  ABC transporter G family member 11                      684   0.0      
ref|XP_009784910.1|  PREDICTED: ABC transporter G family member 1...    679   0.0      
ref|XP_010690532.1|  PREDICTED: ABC transporter G family member 1...    679   0.0      
ref|XP_006827842.1|  hypothetical protein AMTR_s00008p00021210          681   0.0      
ref|XP_009802842.1|  PREDICTED: ABC transporter G family member 1...    678   0.0      
ref|XP_004957093.1|  PREDICTED: ABC transporter G family member 1...    681   0.0      
ref|XP_010029396.1|  PREDICTED: ABC transporter G family member 1...    679   0.0      
emb|CDO97424.1|  unnamed protein product                                694   0.0      
gb|KHN26507.1|  ABC transporter G family member 11                      676   0.0      
gb|EEC84739.1|  hypothetical protein OsI_31728                          675   0.0      Oryza sativa Indica Group [Indian rice]
ref|NP_001063446.1|  Os09g0472100                                       675   0.0      Oryza sativa Japonica Group [Japonica rice]
emb|CDP20625.1|  unnamed protein product                                669   0.0      
ref|XP_009611611.1|  PREDICTED: ABC transporter G family member 1...    671   0.0      
ref|XP_006661337.1|  PREDICTED: ABC transporter G family member 1...    671   0.0      
ref|XP_007159122.1|  hypothetical protein PHAVU_002G210500g             672   0.0      
ref|XP_010690527.1|  PREDICTED: ABC transporter G family member 1...    669   0.0      
dbj|BAJ94888.1|  predicted protein                                      673   0.0      
ref|XP_002300188.2|  hypothetical protein POPTR_0001s31890g             668   0.0      Populus trichocarpa [western balsam poplar]
emb|CBI34071.3|  unnamed protein product                                691   0.0      
ref|XP_003541427.1|  PREDICTED: ABC transporter G family member 1...    671   0.0      
ref|XP_002460384.1|  hypothetical protein SORBIDRAFT_02g027350          670   0.0      Sorghum bicolor [broomcorn]
emb|CAN82969.1|  hypothetical protein VITISV_013416                     667   0.0      Vitis vinifera
ref|XP_010106269.1|  ABC transporter G family member 11                 665   0.0      
ref|XP_009387395.1|  PREDICTED: ABC transporter G family member 1...    661   0.0      
ref|XP_008652824.1|  PREDICTED: ABC transporter G family member 1...    665   0.0      
ref|XP_006353283.1|  PREDICTED: ABC transporter G family member 1...    660   0.0      
gb|EAZ09459.1|  hypothetical protein OsI_31729                          664   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_010937486.1|  PREDICTED: ABC transporter G family member 1...    656   0.0      
ref|NP_001063447.1|  Os09g0472200                                       660   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_003578275.1|  PREDICTED: ABC transporter G family member 1...    661   0.0      
gb|KDP40918.1|  hypothetical protein JCGZ_24917                         655   0.0      
gb|EAZ45082.1|  hypothetical protein OsJ_29720                          655   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_009405050.1|  PREDICTED: ABC transporter G family member 1...    651   0.0      
tpg|DAA61896.1|  TPA: hypothetical protein ZEAMMB73_054499              654   0.0      
ref|XP_010312634.1|  PREDICTED: ABC transporter G family member 1...    647   0.0      
gb|EMS61063.1|  ABC transporter G family member 11                      645   0.0      
gb|EAZ43810.1|  hypothetical protein OsJ_28429                          643   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EEC84114.1|  hypothetical protein OsI_30441                          642   0.0      Oryza sativa Indica Group [Indian rice]
emb|CAN81791.1|  hypothetical protein VITISV_020569                     646   0.0      Vitis vinifera
ref|XP_009393641.1|  PREDICTED: ABC transporter G family member 1...    636   0.0      
ref|XP_011087909.1|  PREDICTED: ABC transporter G family member 1...    632   0.0      
emb|CAN81792.1|  hypothetical protein VITISV_020570                     629   0.0      Vitis vinifera
ref|XP_002438349.1|  hypothetical protein SORBIDRAFT_10g013313          633   0.0      Sorghum bicolor [broomcorn]
ref|XP_004962534.1|  PREDICTED: ABC transporter G family member 1...    626   0.0      
gb|KHN41484.1|  ABC transporter G family member 11                      621   0.0      
ref|XP_003543921.2|  PREDICTED: ABC transporter G family member 1...    620   0.0      
ref|XP_010676592.1|  PREDICTED: ABC transporter G family member 1...    618   0.0      
gb|KHN41485.1|  ABC transporter G family member 11                      618   0.0      
gb|KHN26505.1|  ABC transporter G family member 11                      615   0.0      
ref|XP_008652262.1|  PREDICTED: ABC transporter G family member 1...    620   0.0      
ref|XP_011043123.1|  PREDICTED: ABC transporter G family member 1...    615   0.0      
dbj|BAJ97265.1|  predicted protein                                      617   0.0      
dbj|BAJ86940.1|  predicted protein                                      616   0.0      
ref|XP_008652263.1|  PREDICTED: ABC transporter G family member 1...    615   0.0      
ref|XP_002451306.1|  hypothetical protein SORBIDRAFT_05g027420          613   0.0      Sorghum bicolor [broomcorn]
ref|XP_007047884.1|  White-brown complex protein 11 isoform 3           605   0.0      
emb|CBI25874.3|  unnamed protein product                                607   0.0      
ref|XP_008677842.1|  PREDICTED: ABC transporter G family member 1...    608   0.0      
ref|XP_010647257.1|  PREDICTED: ABC transporter G family member 1...    598   0.0      
ref|XP_003575559.1|  PREDICTED: ABC transporter G family member 1...    600   0.0      
ref|XP_004955969.1|  PREDICTED: ABC transporter G family member 1...    600   0.0      
ref|XP_007159118.1|  hypothetical protein PHAVU_002G210100g             597   0.0      
gb|KHN01282.1|  ABC transporter G family member 11                      597   0.0      
ref|NP_001066644.1|  Os12g0411700                                       598   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_003543927.2|  PREDICTED: ABC transporter G family member 1...    597   0.0      
gb|AES88369.2|  white-brown-complex ABC transporter family protei...    593   0.0      
ref|XP_004504818.1|  PREDICTED: ABC transporter G family member 1...    595   0.0      
ref|XP_004504819.1|  PREDICTED: ABC transporter G family member 1...    594   0.0      
ref|XP_003580980.1|  PREDICTED: ABC transporter G family member 1...    595   0.0      
ref|XP_003580981.1|  PREDICTED: ABC transporter G family member 1...    590   0.0      
ref|XP_003606172.1|  White-brown-complex ABC transporter family         585   0.0      
tpg|DAA60273.1|  TPA: hypothetical protein ZEAMMB73_786491              588   0.0      
ref|XP_007159124.1|  hypothetical protein PHAVU_002G210700g             585   0.0      
ref|XP_002323751.2|  hypothetical protein POPTR_0017s07790g             579   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010321482.1|  PREDICTED: ABC transporter G family member 1...    578   0.0      
dbj|BAJ96411.1|  predicted protein                                      582   0.0      
gb|AES90636.2|  white-brown-complex ABC transporter family protein      580   0.0      
ref|XP_006584974.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    600   0.0      
ref|XP_006657617.1|  PREDICTED: ABC transporter G family member 1...    579   0.0      
ref|NP_001059389.1|  Os07g0288700                                       575   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EEC81874.1|  hypothetical protein OsI_25665                          576   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_006663977.1|  PREDICTED: ABC transporter G family member 1...    568   0.0      
ref|XP_006661036.1|  PREDICTED: ABC transporter G family member 1...    566   0.0      
ref|XP_002970205.1|  ATP-binding cassette transporter                   570   0.0      
ref|XP_002978369.1|  hypothetical protein SELMODRAFT_443862             570   0.0      
ref|XP_006665060.1|  PREDICTED: ABC transporter G family member 1...    565   0.0      
gb|AAP80385.1|  ABC transporter                                         567   0.0      Gossypium hirsutum [American cotton]
ref|XP_010069548.1|  PREDICTED: ABC transporter G family member 1...    566   0.0      
ref|XP_008245603.1|  PREDICTED: ABC transporter G family member 11      564   0.0      
ref|XP_001775949.1|  ATP-binding cassette transporter, subfamily ...    563   0.0      
ref|XP_007159123.1|  hypothetical protein PHAVU_002G210600g             559   0.0      
ref|XP_003608439.1|  ABC transporter G family member                    580   0.0      
ref|XP_001782003.1|  ATP-binding cassette transporter, subfamily ...    560   0.0      
ref|XP_002968809.1|  ATP-binding cassette transporter                   559   0.0      
ref|XP_003574118.1|  PREDICTED: ABC transporter G family member 1...    559   0.0      
gb|EMS64568.1|  ABC transporter G family member 11                      555   0.0      
ref|XP_006665061.1|  PREDICTED: ABC transporter G family member 1...    553   0.0      
ref|XP_010933306.1|  PREDICTED: ABC transporter G family member 1...    556   0.0      
gb|KEH31211.1|  white-brown-complex ABC transporter family protein      556   0.0      
ref|XP_010933304.1|  PREDICTED: ABC transporter G family member 1...    558   0.0      
tpg|DAA49491.1|  TPA: hypothetical protein ZEAMMB73_694244              558   0.0      
ref|XP_008664814.1|  PREDICTED: ABC transporter G family member 1...    558   0.0      
ref|XP_002985191.1|  hypothetical protein SELMODRAFT_122027             556   0.0      
ref|XP_006478168.1|  PREDICTED: ABC transporter G family member 1...    557   0.0      
gb|KHN26510.1|  ABC transporter G family member 11                      551   0.0      
ref|XP_001782684.1|  ATP-binding cassette transporter, subfamily ...    555   0.0      
gb|KDO56026.1|  hypothetical protein CISIN_1g005142mg                   555   0.0      
ref|XP_006423807.1|  hypothetical protein CICLE_v10027954mg             546   0.0      
ref|XP_009760683.1|  PREDICTED: ABC transporter G family member 1...    549   0.0      
ref|XP_006441509.1|  hypothetical protein CICLE_v10019080mg             554   0.0      
ref|XP_002969857.1|  ATP-binding cassette transporter                   554   0.0      
ref|XP_010322516.1|  PREDICTED: ABC transporter G family member 1...    552   0.0      
ref|XP_010476947.1|  PREDICTED: ABC transporter G family member 11      552   0.0      
ref|XP_010459397.1|  PREDICTED: ABC transporter G family member 1...    552   0.0      
ref|XP_010498161.1|  PREDICTED: ABC transporter G family member 1...    551   0.0      
ref|XP_002983318.1|  ATP-binding cassette transporter                   550   0.0      
ref|XP_006416662.1|  hypothetical protein EUTSA_v10006960mg             551   0.0      
ref|XP_002987629.1|  hypothetical protein SELMODRAFT_183315             550   0.0      
ref|XP_008388513.1|  PREDICTED: ABC transporter G family member 11      550   0.0      
ref|XP_006306902.1|  hypothetical protein CARUB_v10008462mg             551   0.0      
ref|XP_006347487.1|  PREDICTED: ABC transporter G family member 1...    549   0.0      
gb|KDP46471.1|  hypothetical protein JCGZ_08443                         550   0.0      
gb|AAY28856.1|  white-brown complex protein 11                          549   0.0      Arabidopsis halleri subsp. gemmifera
ref|XP_002890251.1|  abc transporter family protein                     549   0.0      
ref|XP_010274916.1|  PREDICTED: ABC transporter G family member 11      549   0.0      
ref|XP_002525670.1|  ATP-binding cassette transporter, putative         549   0.0      Ricinus communis
ref|NP_173226.2|  ABC transporter G family member 11                    548   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KDO56025.1|  hypothetical protein CISIN_1g005142mg                   548   0.0      
gb|KHN26509.1|  ABC transporter G family member 11                      545   0.0      
ref|XP_007208437.1|  hypothetical protein PRUPE_ppa002298mg             547   0.0      
ref|XP_002459718.1|  hypothetical protein SORBIDRAFT_02g009310          545   0.0      Sorghum bicolor [broomcorn]
ref|XP_009401807.1|  PREDICTED: ABC transporter G family member 1...    548   0.0      
ref|XP_010687272.1|  PREDICTED: ABC transporter G family member 11      548   0.0      
ref|XP_008370410.1|  PREDICTED: ABC transporter G family member 1...    547   0.0      
gb|KFK42295.1|  hypothetical protein AALP_AA2G237200                    546   0.0      
ref|XP_010537533.1|  PREDICTED: ABC transporter G family member 11      546   1e-180   
ref|XP_006848619.1|  hypothetical protein AMTR_s00171p00031180          545   3e-180   
ref|NP_001147125.1|  ATP-binding cassette sub-family G member 2         544   6e-180   Zea mays [maize]
gb|AFW68510.1|  ATP-binding cassette sub-family G member 2              544   7e-180   
ref|XP_009149237.1|  PREDICTED: ABC transporter G family member 11      543   1e-179   
ref|XP_007037082.1|  White-brown complex protein 11                     543   2e-179   
ref|XP_004516742.1|  PREDICTED: ABC transporter G family member 1...    541   6e-179   
emb|CDP18516.1|  unnamed protein product                                540   7e-179   
ref|XP_007152500.1|  hypothetical protein PHAVU_004G135400g             541   9e-179   
ref|XP_004495239.1|  PREDICTED: ABC transporter G family member 1...    540   2e-178   
ref|XP_006351519.1|  PREDICTED: ABC transporter G family member 1...    540   2e-178   
ref|XP_004982746.1|  PREDICTED: ABC transporter G family member 1...    540   3e-178   
ref|XP_009110383.1|  PREDICTED: ABC transporter G family member 1...    540   4e-178   
gb|KHG12988.1|  ABC transporter G family member 11                      538   4e-178   
ref|XP_009602146.1|  PREDICTED: ABC transporter G family member 11      540   4e-178   
ref|XP_008806677.1|  PREDICTED: ABC transporter G family member 1...    540   4e-178   
ref|XP_009781344.1|  PREDICTED: ABC transporter G family member 11      539   6e-178   
ref|XP_011046116.1|  PREDICTED: ABC transporter G family member 1...    538   7e-178   
ref|XP_003548275.1|  PREDICTED: ABC transporter G family member 1...    539   8e-178   
ref|XP_011046113.1|  PREDICTED: ABC transporter G family member 1...    538   8e-178   
gb|KEH26658.1|  white-brown-complex ABC transporter family protei...    538   1e-177   
ref|XP_011046115.1|  PREDICTED: ABC transporter G family member 1...    538   1e-177   
ref|XP_010037061.1|  PREDICTED: ABC transporter G family member 1...    538   1e-177   
ref|XP_010918473.1|  PREDICTED: ABC transporter G family member 1...    538   1e-177   
ref|XP_003534067.1|  PREDICTED: ABC transporter G family member 1...    538   1e-177   
ref|XP_009400415.1|  PREDICTED: ABC transporter G family member 1...    538   2e-177   
ref|XP_009599105.1|  PREDICTED: ABC transporter G family member 1...    531   2e-177   
ref|XP_004152433.1|  PREDICTED: ABC transporter G family member 1...    537   3e-177   
gb|KHG29858.1|  ABC transporter G family member 15                      536   4e-177   
ref|XP_004234313.1|  PREDICTED: ABC transporter G family member 1...    537   4e-177   
ref|XP_008437286.1|  PREDICTED: ABC transporter G family member 11      536   4e-177   
ref|XP_002967985.1|  ATP-binding cassette transporter                   536   6e-177   
ref|XP_006347488.1|  PREDICTED: ABC transporter G family member 1...    534   1e-176   
ref|XP_002262619.1|  PREDICTED: ABC transporter G family member 11      536   1e-176   Vitis vinifera
emb|CAN69297.1|  hypothetical protein VITISV_006943                     535   2e-176   
ref|XP_011072099.1|  PREDICTED: ABC transporter G family member 11      535   4e-176   
ref|XP_011018196.1|  PREDICTED: ABC transporter G family member 1...    533   4e-176   
ref|XP_003580184.1|  PREDICTED: ABC transporter G family member 1...    534   5e-176   
gb|EYU22324.1|  hypothetical protein MIMGU_mgv1a002042mg                533   2e-175   
ref|XP_002446827.1|  hypothetical protein SORBIDRAFT_06g023280          533   2e-175   
gb|EPS70875.1|  hypothetical protein M569_03882                         531   3e-175   
ref|NP_001064944.1|  Os10g0494300                                       532   4e-175   
gb|EAY79050.1|  hypothetical protein OsI_34160                          532   5e-175   
dbj|BAJ88522.1|  predicted protein                                      532   5e-175   
gb|EEE53098.1|  hypothetical protein OsJ_35866                          526   5e-175   
ref|NP_001147877.1|  LOC100281487                                       530   2e-174   
ref|XP_004302267.1|  PREDICTED: ABC transporter G family member 1...    530   2e-174   
gb|KDO56028.1|  hypothetical protein CISIN_1g005142mg                   526   2e-174   
gb|EMS59162.1|  ABC transporter G family member 15                      530   2e-174   
gb|EAZ31411.1|  hypothetical protein OsJ_15543                          528   3e-174   
ref|XP_004976309.1|  PREDICTED: ABC transporter G family member 1...    530   5e-174   
tpg|DAA36732.1|  TPA: ABC transporter C05D10.3 in III                   531   6e-174   
ref|XP_002274109.2|  PREDICTED: ABC transporter G family member 15      528   6e-174   
gb|KCW54565.1|  hypothetical protein EUGRSUZ_I00524                     522   7e-174   
gb|EAZ08291.1|  hypothetical protein OsI_30543                          522   9e-174   
ref|NP_001053375.1|  Os04g0528300                                       528   9e-174   
emb|CAD41191.1|  OSJNBa0074L08.3                                        528   1e-173   
emb|CBG76424.1|  OO_Ba0013J05-OO_Ba0033A15.11                           528   1e-173   
dbj|BAJ91212.1|  predicted protein                                      528   1e-173   
ref|XP_006652549.1|  PREDICTED: ABC transporter G family member 1...    528   2e-173   
gb|KDO50222.1|  hypothetical protein CISIN_1g044030mg                   518   2e-173   
ref|XP_008385742.1|  PREDICTED: ABC transporter G family member 1...    526   2e-173   
ref|XP_009366090.1|  PREDICTED: ABC transporter G family member 1...    526   3e-173   
ref|XP_006423802.1|  hypothetical protein CICLE_v10030355mg             517   4e-173   
ref|XP_004242154.2|  PREDICTED: ABC transporter G family member 1...    525   4e-173   
ref|XP_007015111.1|  ABC-2 type transporter family protein isoform 1    525   1e-172   
ref|NP_001062680.1|  Os09g0250800                                       519   1e-172   
ref|XP_009338224.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    525   1e-172   
ref|XP_008776721.1|  PREDICTED: ABC transporter G family member 1...    525   2e-172   
ref|XP_006372283.1|  ABC transporter family protein                     525   2e-172   
ref|XP_010908351.1|  PREDICTED: ABC transporter G family member 1...    523   4e-172   
ref|XP_009350583.1|  PREDICTED: ABC transporter G family member 1...    522   8e-172   
emb|CDY19179.1|  BnaC05g13800D                                          522   8e-172   
ref|XP_009600485.1|  PREDICTED: ABC transporter G family member 1...    516   1e-171   
ref|XP_008790946.1|  PREDICTED: ABC transporter G family member 1...    521   2e-171   
emb|CDY26211.1|  BnaA06g12060D                                          520   9e-171   
ref|XP_009374924.1|  PREDICTED: ABC transporter G family member 1...    520   1e-170   
ref|XP_008375841.1|  PREDICTED: ABC transporter G family member 1...    519   2e-170   
ref|XP_004291764.1|  PREDICTED: ABC transporter G family member 1...    518   3e-170   
emb|CDX83888.1|  BnaC08g17570D                                          518   5e-170   
ref|XP_007131554.1|  hypothetical protein PHAVU_011G023000g             517   8e-170   
ref|XP_008227201.1|  PREDICTED: ABC transporter G family member 1...    517   1e-169   
ref|XP_010466325.1|  PREDICTED: ABC transporter G family member 15      517   1e-169   
ref|XP_006406322.1|  hypothetical protein EUTSA_v10020189mg             517   2e-169   
emb|CDX96749.1|  BnaA08g22920D                                          516   2e-169   
ref|XP_010488094.1|  PREDICTED: ABC transporter G family member 1...    516   3e-169   
gb|AIU41649.1|  ABC transporter family protein                          517   3e-169   
ref|XP_010269756.1|  PREDICTED: ABC transporter G family member 1...    516   5e-169   
ref|XP_006297105.1|  hypothetical protein CARUB_v10013106mg             515   6e-169   
ref|XP_002885419.1|  abc transporter family protein                     515   8e-169   
ref|XP_009145524.1|  PREDICTED: ABC transporter G family member 15      514   1e-168   
gb|EYU46234.1|  hypothetical protein MIMGU_mgv1a002325mg                514   1e-168   
ref|NP_188746.2|  ABC transporter G family member 15                    514   1e-168   
ref|XP_010509664.1|  PREDICTED: ABC transporter G family member 1...    514   1e-168   
gb|AAM13053.1|  unknown protein                                         514   2e-168   
gb|KHG09028.1|  ABC transporter G family member 11                      514   2e-168   
emb|CDY06406.1|  BnaC05g31240D                                          513   3e-168   
emb|CDP09283.1|  unnamed protein product                                513   4e-168   
ref|XP_006661900.1|  PREDICTED: ABC transporter G family member 1...    509   2e-167   
ref|XP_002979728.1|  ATP-binding cassette transporter                   508   3e-167   
ref|XP_002314083.2|  hypothetical protein POPTR_0009s05580g             511   3e-167   
gb|KDO61202.1|  hypothetical protein CISIN_1g045930mg                   509   4e-167   
ref|XP_006446166.1|  hypothetical protein CICLE_v10014529mg             509   5e-167   
gb|KDP22115.1|  hypothetical protein JCGZ_25946                         511   6e-167   
gb|KFK39417.1|  hypothetical protein AALP_AA3G242100                    510   8e-167   
gb|KHG11916.1|  ABC transporter G family member 13                      509   1e-166   
ref|XP_006470649.1|  PREDICTED: ABC transporter G family member 1...    509   1e-166   
ref|XP_002467016.1|  hypothetical protein SORBIDRAFT_01g018360          506   1e-166   
gb|KHN20635.1|  ABC transporter G family member 15                      508   2e-166   
ref|XP_003540615.1|  PREDICTED: ABC transporter G family member 1...    508   3e-166   
ref|XP_010102371.1|  ABC transporter G family member 15                 508   5e-166   
ref|XP_010102372.1|  ABC transporter G family member 15                 507   5e-166   
ref|XP_002988371.1|  hypothetical protein SELMODRAFT_128045             504   8e-166   
gb|AAF97264.1|AC034106_7  Contains similarity to ATP dependent tr...    506   8e-166   
ref|XP_006837421.1|  hypothetical protein AMTR_s00107p00013610          506   2e-165   
ref|XP_006423803.1|  hypothetical protein CICLE_v10027954mg             496   4e-165   
ref|XP_002988380.1|  ATP-binding cassette transporter                   503   4e-165   
ref|XP_003607361.1|  ABC transporter G family member                    505   5e-165   
ref|XP_002988377.1|  ATP-binding cassette transporter                   503   5e-165   
ref|XP_004975139.1|  PREDICTED: ABC transporter G family member 1...    501   5e-165   
gb|KHN05511.1|  ABC transporter G family member 15                      504   1e-164   
ref|XP_002440818.1|  hypothetical protein SORBIDRAFT_09g007330          504   1e-164   
ref|XP_002298391.1|  ABC transporter-related family protein             503   1e-164   
ref|XP_003537732.1|  PREDICTED: ABC transporter G family member 1...    504   1e-164   
gb|EMT30837.1|  ABC transporter G family member 11                      497   2e-164   
ref|XP_008227333.1|  PREDICTED: ABC transporter G family member 1...    503   2e-164   
ref|XP_011032054.1|  PREDICTED: ABC transporter G family member 1...    504   3e-164   
ref|XP_011032053.1|  PREDICTED: ABC transporter G family member 1...    503   3e-164   
ref|XP_002513520.1|  ATP-binding cassette transporter, putative         504   3e-164   
ref|XP_002513519.1|  ATP-binding cassette transporter, putative         503   3e-164   
ref|XP_007131552.1|  hypothetical protein PHAVU_011G022900g             503   3e-164   
ref|XP_010544179.1|  PREDICTED: ABC transporter G family member 12      503   4e-164   
ref|XP_002979735.1|  ATP-binding cassette transporter                   500   4e-164   
ref|XP_010031767.1|  PREDICTED: ABC transporter G family member 1...    502   7e-164   
ref|XP_011045407.1|  PREDICTED: ABC transporter G family member 1...    503   7e-164   
ref|XP_002988372.1|  ATP-binding cassette transporter                   499   1e-163   
ref|XP_010031768.1|  PREDICTED: ABC transporter G family member 1...    501   2e-163   
ref|XP_011045408.1|  PREDICTED: ABC transporter G family member 1...    501   3e-163   
ref|XP_007015108.1|  ABC-2 type transporter family protein isoform 1    501   3e-163   
ref|XP_006664909.1|  PREDICTED: ABC transporter G family member 1...    501   4e-163   
ref|XP_009374925.1|  PREDICTED: ABC transporter G family member 1...    500   7e-163   
gb|ABW96353.1|  CER5-like protein                                       499   1e-162   
emb|CAN77224.1|  hypothetical protein VITISV_002210                     499   1e-162   
gb|AFW82088.1|  CER5                                                    499   1e-162   
ref|XP_008363334.1|  PREDICTED: ABC transporter G family member 1...    499   1e-162   
ref|NP_001147301.1|  LOC100280909                                       499   1e-162   
ref|XP_002979726.1|  ATP-binding cassette transporter                   496   2e-162   
ref|XP_002274038.1|  PREDICTED: ABC transporter G family member 15      498   2e-162   
gb|EEE62790.1|  hypothetical protein OsJ_17593                          499   2e-162   
ref|NP_001054952.1|  Os05g0222200                                       498   3e-162   
gb|KDP22114.1|  hypothetical protein JCGZ_25945                         498   3e-162   
ref|XP_004505642.1|  PREDICTED: ABC transporter G family member 1...    498   4e-162   
ref|XP_006365197.1|  PREDICTED: ABC transporter G family member 1...    497   4e-162   
ref|XP_009610303.1|  PREDICTED: ABC transporter G family member 1...    497   5e-162   
emb|CDX87823.1|  BnaC06g08850D                                          497   5e-162   
ref|XP_001782413.1|  ATP-binding cassette transporter, subfamily ...    495   6e-162   
ref|XP_006365203.1|  PREDICTED: ABC transporter G family member 1...    497   6e-162   
ref|XP_010279501.1|  PREDICTED: ABC transporter G family member 1...    497   7e-162   
ref|XP_009803746.1|  PREDICTED: ABC transporter G family member 1...    497   7e-162   
ref|XP_002314084.1|  ABC transporter-related family protein             497   9e-162   
ref|XP_009381814.1|  PREDICTED: ABC transporter G family member 1...    490   9e-162   
ref|XP_006372653.1|  hypothetical protein POPTR_0017s03590g             495   1e-161   
gb|KFK35851.1|  hypothetical protein AALP_AA4G045100                    496   1e-161   
ref|XP_004250920.1|  PREDICTED: ABC transporter G family member 1...    496   2e-161   
ref|XP_003607359.1|  ABC transporter G family member                    495   3e-161   
ref|XP_006393048.1|  hypothetical protein EUTSA_v10011278mg             495   5e-161   
ref|XP_004960643.1|  PREDICTED: ABC transporter G family member 1...    494   7e-161   
ref|XP_009144898.1|  PREDICTED: ABC transporter G family member 12      494   8e-161   
gb|KEH30628.1|  white-brown-complex ABC transporter family protein      496   9e-161   
ref|XP_011090130.1|  PREDICTED: ABC transporter G family member 1...    494   1e-160   
emb|CBI17179.3|  unnamed protein product                                491   1e-160   
ref|XP_011080364.1|  PREDICTED: ABC transporter G family member 1...    494   1e-160   
gb|EEC69144.1|  hypothetical protein OsI_38077                          487   2e-160   
dbj|BAJ95256.1|  predicted protein                                      493   3e-160   
gb|KGN48121.1|  hypothetical protein Csa_6G434400                       493   3e-160   
gb|EYU46235.1|  hypothetical protein MIMGU_mgv1a002239mg                492   5e-160   
ref|XP_008449695.1|  PREDICTED: ABC transporter G family member 1...    492   6e-160   
ref|XP_006393051.1|  hypothetical protein EUTSA_v10011282mg             491   1e-159   
ref|XP_011080436.1|  PREDICTED: ABC transporter G family member 1...    489   2e-159   
emb|CDP09281.1|  unnamed protein product                                491   2e-159   
ref|XP_011090129.1|  PREDICTED: ABC transporter G family member 1...    491   2e-159   
ref|XP_002894320.1|  hypothetical protein ARALYDRAFT_892122             490   3e-159   
ref|XP_010673684.1|  PREDICTED: ABC transporter G family member 1...    490   4e-159   
ref|XP_006306920.1|  hypothetical protein CARUB_v10008484mg             490   4e-159   
ref|XP_006446165.1|  hypothetical protein CICLE_v10014463mg             490   5e-159   
ref|NP_175561.1|  ABC transporter G family member 12                    489   6e-159   
ref|XP_010500724.1|  PREDICTED: ABC transporter G family member 1...    488   1e-158   
ref|XP_010479632.1|  PREDICTED: ABC transporter G family member 1...    488   2e-158   
ref|XP_003540269.1|  PREDICTED: ABC transporter G family member 1...    488   3e-158   
gb|EMT16398.1|  ABC transporter G family member 11                      489   3e-158   
ref|XP_003568727.1|  PREDICTED: ABC transporter G family member 1...    487   4e-158   
dbj|BAB01452.1|  ABC transporter-like protein                           484   4e-158   
ref|XP_004250922.1|  PREDICTED: ABC transporter G family member 1...    487   4e-158   
ref|XP_003537734.1|  PREDICTED: ABC transporter G family member 1...    486   9e-158   
ref|XP_002894318.1|  abc transporter family protein                     484   3e-157   
ref|XP_010461981.1|  PREDICTED: ABC transporter G family member 12      484   4e-157   
gb|KDO56029.1|  hypothetical protein CISIN_1g005142mg                   479   6e-157   
ref|XP_004293165.1|  PREDICTED: ABC transporter G family member 1...    484   6e-157   
gb|KCW56967.1|  hypothetical protein EUGRSUZ_I02640                     475   6e-157   
ref|XP_004505644.1|  PREDICTED: ABC transporter G family member 1...    483   1e-156   
ref|XP_009147764.1|  PREDICTED: ABC transporter G family member 13      483   1e-156   
ref|XP_009610305.1|  PREDICTED: ABC transporter G family member 1...    483   2e-156   
gb|EYU31390.1|  hypothetical protein MIMGU_mgv1a002406mg                482   3e-156   
gb|ABA97845.1|  ABC-2 type transporter family protein                   478   3e-156   
ref|NP_175557.1|  ABC transporter G family member 13                    482   4e-156   
gb|ABG65929.1|  ABC-2 type transporter family protein                   475   5e-156   
gb|KCW51150.1|  hypothetical protein EUGRSUZ_J00745                     478   5e-156   
ref|XP_010279500.1|  PREDICTED: ABC transporter G family member 1...    481   9e-156   
ref|XP_009395140.1|  PREDICTED: ABC transporter G family member 1...    481   1e-155   
ref|XP_009803749.1|  PREDICTED: ABC transporter G family member 1...    481   1e-155   
dbj|BAC43047.1|  putative ATP-dependent transmembrane transporter       480   1e-155   
ref|XP_010269759.1|  PREDICTED: ABC transporter G family member 1...    480   2e-155   
ref|XP_010479628.1|  PREDICTED: ABC transporter G family member 13      479   3e-155   
ref|XP_010461977.1|  PREDICTED: ABC transporter G family member 1...    479   3e-155   
gb|EPS70703.1|  hypothetical protein M569_04057                         474   4e-155   
ref|XP_004505643.1|  PREDICTED: ABC transporter G family member 1...    476   4e-155   
ref|XP_008449694.1|  PREDICTED: ABC transporter G family member 1...    478   3e-154   
gb|AES89553.2|  white-brown-complex ABC transporter family protein      477   3e-154   
dbj|BAJ88327.1|  predicted protein                                      474   3e-154   
ref|XP_011045409.1|  PREDICTED: ABC transporter G family member 1...    474   3e-154   
ref|XP_009803750.1|  PREDICTED: ABC transporter G family member 1...    477   4e-154   
gb|KFK35849.1|  hypothetical protein AALP_AA4G044900                    476   7e-154   
ref|XP_004140211.1|  PREDICTED: ABC transporter G family member 1...    476   9e-154   
ref|XP_010500721.1|  PREDICTED: ABC transporter G family member 1...    475   1e-153   
gb|KCW51148.1|  hypothetical protein EUGRSUZ_J00745                     475   1e-153   
ref|XP_006304939.1|  hypothetical protein CARUB_v10011425mg             475   2e-153   
ref|XP_007131555.1|  hypothetical protein PHAVU_011G023100g             474   8e-153   
ref|XP_010534741.1|  PREDICTED: ABC transporter G family member 1...    473   1e-152   
ref|XP_010534742.1|  PREDICTED: ABC transporter G family member 1...    473   1e-152   
gb|KHN05510.1|  ABC transporter G family member 15                      471   2e-152   
ref|NP_001066642.1|  Os12g0409700                                       465   9e-152   
gb|EAY82863.1|  hypothetical protein OsI_38074                          464   1e-151   
ref|XP_009395259.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    472   1e-151   
emb|CBI17178.3|  unnamed protein product                                499   1e-151   
gb|EMS63612.1|  ABC transporter G family member 15                      463   4e-151   
ref|XP_006833568.1|  hypothetical protein AMTR_s00216p00024260          458   5e-150   
ref|XP_010269761.1|  PREDICTED: ABC transporter G family member 1...    466   7e-150   
ref|XP_010269760.1|  PREDICTED: ABC transporter G family member 1...    463   3e-149   
ref|XP_010461976.1|  PREDICTED: ABC transporter G family member 1...    459   6e-149   
emb|CDY49810.1|  BnaC06g04590D                                          461   8e-149   
ref|XP_003632263.2|  PREDICTED: ABC transporter G family member 1...    464   1e-148   
ref|XP_004960641.1|  PREDICTED: ABC transporter G family member 1...    465   2e-148   
emb|CDY61513.1|  BnaAnng17530D                                          459   6e-148   
gb|KCW51151.1|  hypothetical protein EUGRSUZ_J00745                     455   7e-148   
ref|XP_007015112.1|  ABC-2 type transporter family protein isoform 2    453   6e-147   
gb|EEE51200.1|  hypothetical protein OsJ_32013                          458   8e-147   
emb|CDY22844.1|  BnaA06g02330D                                          454   3e-146   
ref|XP_010279497.1|  PREDICTED: ABC transporter G family member 1...    456   6e-146   
ref|XP_010240161.1|  PREDICTED: ABC transporter G family member 1...    451   4e-145   
gb|EPS62736.1|  hypothetical protein M569_12052                         450   7e-145   
gb|ADN33920.1|  white-brown-complex ABC transporter family protein      453   1e-144   
gb|KCW51153.1|  hypothetical protein EUGRSUZ_J00746                     451   2e-144   
gb|KDO36064.1|  hypothetical protein CISIN_1g016271mg                   441   3e-144   
ref|XP_010651814.1|  PREDICTED: ABC transporter G family member 1...    449   7e-144   
gb|KDO36455.1|  hypothetical protein CISIN_1g016275mg                   438   4e-143   



>ref|XP_006351761.1| PREDICTED: ABC transporter G family member 11-like [Solanum tuberosum]
Length=629

 Score =   797 bits (2058),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/610 (70%), Positives = 511/610 (84%), Gaps = 6/610 (1%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             FLTWEDLWVT S  + GNKAILKGLTGYARPGELLAIMGPSGCGKSTLLD +AGRL  +T
Sbjct  12    FLTWEDLWVTASSLKDGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDTIAGRLGSST  71

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             RQSGDI+INGR QTLAYGTSAYVTQEDTL ATLTV+EAVYYSA+LQLP+S+P+SEKK+IA
Sbjct  72    RQSGDIIINGRKQTLAYGTSAYVTQEDTLMATLTVKEAVYYSAELQLPNSMPKSEKKQIA  131

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             +MT+KEMGLQDAM TRIGG  G     G QKRRVSICLEILTRPKLLFLDEP+SGLDSAA
Sbjct  132   DMTMKEMGLQDAMETRIGGWIGKGISGG-QKRRVSICLEILTRPKLLFLDEPTSGLDSAA  190

Query  763   SFYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETN  942
             S+YVM  I     +GRT++ASIHQPSTEVFSLF SLCLLSSGR VYFGPASAAI+FF  +
Sbjct  191   SYYVMKTIAS-QCQGRTIIASIHQPSTEVFSLFHSLCLLSSGRTVYFGPASAAIEFFALS  249

Query  943   GFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREVQ  1122
             G+PCPTLQNPSDHFLKTIN DFD   +D+E+G      TEEVINIL+ SY    +YR VQ
Sbjct  250   GYPCPTLQNPSDHFLKTINSDFD---QDIEEGPTSRKSTEEVINILIKSYSDSDKYRAVQ  306

Query  1123  GQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLGY  1302
              QVAEI KQEGEVL+K SRA F TQS+VLT+RSF+NM RDLGYYWLRLG+YI +AVGLG 
Sbjct  307   SQVAEICKQEGEVLEKRSRASFTTQSLVLTKRSFVNMSRDLGYYWLRLGVYIVIAVGLGT  366

Query  1303  MYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFAI  1482
             +Y DVG+  +SIQ+R S+L F+A+F TFMAIGGF SFVE++KVF++E LNGHYG G+F I
Sbjct  367   IYYDVGFSYTSIQSRGSMLMFVATFITFMAIGGFSSFVEELKVFQREKLNGHYGSGSFVI  426

Query  1483  ANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLVP  1662
             ANTLS+LPYL+L+S IPG IAYF  GLQ  F HF  FALV+   M+LVESLMMI+AS+VP
Sbjct  427   ANTLSALPYLVLVSFIPGAIAYFLTGLQGGFEHFMCFALVLFTCMMLVESLMMIVASIVP  486

Query  1663  NYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGLR  1842
             N+LMG+I+GAG+QALM L GG+FRLP DLP++FW+YP++Y+ FHKYAYQGL+KNEF+GL+
Sbjct  487   NFLMGLISGAGIQALMCLSGGFFRLPNDLPRVFWKYPLHYVAFHKYAYQGLFKNEFEGLK  546

Query  1843  LPEETGQ-IITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAKHVV  2019
             + +E  + +I GE++L+   ++++ +SKW+DL +L+ M ++ R++FLL VKA EK K  V
Sbjct  547   IHDENMKGLIKGEDILKYKWEMDIDYSKWVDLAILLGMIILYRLLFLLFVKAGEKVKPAV  606

Query  2020  KAVMRVSPKQ  2049
             +A+M  SPKQ
Sbjct  607   RAIMSNSPKQ  616



>ref|XP_004230551.1| PREDICTED: ABC transporter G family member 11-like [Solanum lycopersicum]
Length=627

 Score =   786 bits (2029),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/610 (69%), Positives = 507/610 (83%), Gaps = 6/610 (1%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
              LTWEDLWVT S  + GNKAILKGLTGYA+PG+LLAIMGPSGCGKSTLLD +AGRL  +T
Sbjct  10    LLTWEDLWVTASSLKDGNKAILKGLTGYAKPGQLLAIMGPSGCGKSTLLDTIAGRLGSST  69

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             RQ GDILINGR QTLAYGTSAYVTQEDTL ATLTV+EAVYYSA+LQLP+S+P+SEKK+IA
Sbjct  70    RQKGDILINGRKQTLAYGTSAYVTQEDTLMATLTVKEAVYYSAELQLPNSMPKSEKKQIA  129

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             +MT+KEMGLQDAM TRIGG  G     G QKRRVSICLEILTRPKLLFLDEP+SGLDSAA
Sbjct  130   DMTMKEMGLQDAMETRIGGWSGKGISGG-QKRRVSICLEILTRPKLLFLDEPTSGLDSAA  188

Query  763   SFYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETN  942
             S+YVM  I     +GRT++ASIHQPSTEVFSLF SLCLLSSGR VYFGPA+AAI+FF  +
Sbjct  189   SYYVMKTIAS-QCQGRTIIASIHQPSTEVFSLFHSLCLLSSGRTVYFGPANAAIEFFALS  247

Query  943   GFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREVQ  1122
             G+PCPTLQNPSDHFLKTIN DFD   +D+E+G      TEEVINIL+ SY    +YR VQ
Sbjct  248   GYPCPTLQNPSDHFLKTINSDFD---QDIEEGQTSRKSTEEVINILIKSYSDSDKYRAVQ  304

Query  1123  GQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLGY  1302
              QVAEI KQEGEVL+K SRA F TQS+VLTRRSF+NM RDLGYYWLRL +YI +AVGLG 
Sbjct  305   SQVAEICKQEGEVLEKRSRASFTTQSLVLTRRSFVNMSRDLGYYWLRLAVYIVIAVGLGT  364

Query  1303  MYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFAI  1482
             +Y DVG+  +SIQ+R S+L F+A+F TFMAIGGF SFVE++KVF++E LNGHYG G+F I
Sbjct  365   IYYDVGFSYTSIQSRGSMLMFVATFITFMAIGGFSSFVEELKVFQREKLNGHYGSGSFVI  424

Query  1483  ANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLVP  1662
             ANTLS++PYL+L+S IPG IAYF  GLQ  F HF  FALV+   M+LVESLMMI+AS+VP
Sbjct  425   ANTLSAIPYLVLVSFIPGAIAYFLTGLQGGFEHFMCFALVLFTCMMLVESLMMIVASIVP  484

Query  1663  NYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGLR  1842
             N+LMG+I GAG+QA+M L GG+FRL  +LP++FW+YP++Y+ FHKYAYQGL+KNEF+GL+
Sbjct  485   NFLMGLITGAGIQAVMCLSGGFFRLSNELPRVFWKYPLHYVAFHKYAYQGLFKNEFEGLK  544

Query  1843  LPEET-GQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAKHVV  2019
             + +E   ++I GE++L+   +++M +SKW+DL +L+ M ++ R++FLL+VKA EK K  V
Sbjct  545   IHDENMKRLIKGEDILKYKWEMDMDYSKWVDLAILLGMIILYRLLFLLLVKAGEKVKPAV  604

Query  2020  KAVMRVSPKQ  2049
             +A+M  SP+Q
Sbjct  605   RAIMSNSPQQ  614



>ref|XP_009610194.1| PREDICTED: ABC transporter G family member 11-like [Nicotiana 
tomentosiformis]
Length=641

 Score =   785 bits (2027),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/614 (69%), Positives = 503/614 (82%), Gaps = 10/614 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             FLTWEDLWV  S+ + G KAILKGLTGYARPGELLAIMGPSGCGKSTLLD +AGRL  +T
Sbjct  20    FLTWEDLWVRASNMKDGGKAILKGLTGYARPGELLAIMGPSGCGKSTLLDTIAGRLGSST  79

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             RQSGDILINGR QTLAYGTSAYVTQ+DTL ATLTV+EA+YYSA+LQLP+S+P+SEKKEIA
Sbjct  80    RQSGDILINGRKQTLAYGTSAYVTQDDTLIATLTVKEAIYYSAELQLPNSMPKSEKKEIA  139

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             ++TIKEMGLQDAM TRIGG  G     G QKRRVSIC+E LTRPKLLFLDEP+SGLDSAA
Sbjct  140   DITIKEMGLQDAMETRIGGWSGKGISGG-QKRRVSICMEFLTRPKLLFLDEPTSGLDSAA  198

Query  763   SFYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETN  942
             S+YVM  I     +GRT++ASIHQPS EVFSLF SLCLLSSGR VYFGPASAAI+FF  +
Sbjct  199   SYYVMKTIAS-RCKGRTIIASIHQPSAEVFSLFHSLCLLSSGRTVYFGPASAAIEFFALS  257

Query  943   GFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREVQ  1122
             GFPCPTLQNPSDHFLKTIN DFD   +D+E+G      TEEVINILV SYKS  +YR VQ
Sbjct  258   GFPCPTLQNPSDHFLKTINSDFD---QDIEEGSTGRKSTEEVINILVKSYKSSDKYRAVQ  314

Query  1123  GQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLGY  1302
              QVAEI K+EGE+L+K S + F TQS+VLTRRSF+NM RDLGYYWLRL +Y+ +AVGLG 
Sbjct  315   SQVAEICKEEGEILEKRSHSSFTTQSLVLTRRSFVNMCRDLGYYWLRLAVYVAIAVGLGT  374

Query  1303  MYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFAI  1482
             +Y DVG+  +S+QAR ++L F+ASF TFMAIGGFPSFVED+KVF++E LNGHYG G+F I
Sbjct  375   IYYDVGFSTASVQARGTMLMFVASFITFMAIGGFPSFVEDLKVFQQEKLNGHYGSGSFVI  434

Query  1483  ANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLVP  1662
             ANTLS++PYLLL+SLIPG+IAYF  GLQ    HF YF LV+   M+LVESLMMI+AS+VP
Sbjct  435   ANTLSAMPYLLLVSLIPGVIAYFLTGLQNGLEHFIYFVLVLFTCMMLVESLMMIVASIVP  494

Query  1663  NYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGLR  1842
             N+LMGII GAG+QALMIL GG+FRLP DLP  FW+YP++Y+ FHKYA++GL+KNE +GL+
Sbjct  495   NFLMGIITGAGIQALMILSGGFFRLPNDLPNPFWKYPLHYVAFHKYAFEGLFKNELEGLK  554

Query  1843  LPEETG----QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAK  2010
             +  E      Q+I GE++LR T Q+ M +SKW DL +L+ M V+ R++FLL VKA EK K
Sbjct  555   IHNEDKLGKVQMINGEDILRNTWQMNMDYSKWADLAILLGMVVLYRLLFLLFVKAGEKVK  614

Query  2011  HVV-KAVMRVSPKQ  2049
               + +A +  SP Q
Sbjct  615   PAIRRAFISTSPNQ  628



>gb|AFC36404.1| ABCG1 [Petunia x hybrida]
Length=633

 Score =   781 bits (2016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/609 (69%), Positives = 503/609 (83%), Gaps = 10/609 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             FLTWEDLWVT S  + G+KAILKGLTGYA PGELLAIMGPSG GKSTLLD +AGRL  +T
Sbjct  22    FLTWEDLWVTASSVKDGSKAILKGLTGYAMPGELLAIMGPSGSGKSTLLDTIAGRLGSST  81

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             RQSGDILINGR QTLAYG+SAYVTQ+DTL ATLT++EAVYYSA+LQLP+S+ +SEKKEIA
Sbjct  82    RQSGDILINGRRQTLAYGSSAYVTQDDTLLATLTIKEAVYYSAELQLPNSMSKSEKKEIA  141

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             ++T+K MGLQDAM TRIGG  G     G QKRRVSICLEILTRPKLLFLDEP+SGLDSAA
Sbjct  142   DVTLKGMGLQDAMETRIGGWSGKGISGG-QKRRVSICLEILTRPKLLFLDEPTSGLDSAA  200

Query  763   SFYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETN  942
             S+YVM  I     +GRT++ASIHQPS +VFSLF SLCLLSSGR VYFGPASAA +FF  +
Sbjct  201   SYYVMKAIAS-QCQGRTIIASIHQPSVDVFSLFHSLCLLSSGRTVYFGPASAANEFFALS  259

Query  943   GFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREVQ  1122
             GFPCPTLQNPSDHFLKTIN DFD   +D+E+G  R   TEEVI+IL+ SYK+  +Y  VQ
Sbjct  260   GFPCPTLQNPSDHFLKTINSDFD---QDIEEGSTRRKSTEEVIDILIKSYKASDKYNAVQ  316

Query  1123  GQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLGY  1302
              QVAEI +QEGE+L K S A F TQS+VLTRRSF+NM RDLGYYWLRL +Y+ +AVGLG 
Sbjct  317   SQVAEICQQEGEMLDKRSHASFITQSLVLTRRSFINMSRDLGYYWLRLAVYVVIAVGLGS  376

Query  1303  MYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFAI  1482
             +Y DVG+  +S+QAR S+L F+ASF TFMAIGGFPSFVEDMKVF++E LNGHYG G+F I
Sbjct  377   LYYDVGFSAASVQARGSMLMFVASFITFMAIGGFPSFVEDMKVFQREKLNGHYGSGSFVI  436

Query  1483  ANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLVP  1662
             ANTLS++PYLLL+SLIPG IAYF  GLQ  F HF YFALV+   M++VESLMMI+AS+VP
Sbjct  437   ANTLSAMPYLLLVSLIPGAIAYFMTGLQNGFEHFIYFALVLFTCMMIVESLMMIVASMVP  496

Query  1663  NYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGLR  1842
             N+LMG+IAGAG+QALM+L GG+FRLP DLPK FW+YP++Y+ FHKYAY+G++KNEF+GL+
Sbjct  497   NFLMGLIAGAGIQALMLLSGGFFRLPNDLPKPFWKYPLHYVAFHKYAYEGMFKNEFEGLK  556

Query  1843  LPEETGQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAKHVVK  2022
             + +     + GE++LR T Q+ M +SKWIDL++L+ M V+ RV+FLLVVKA E  K  ++
Sbjct  557   IHD-----VNGEDILRNTWQMNMDYSKWIDLVILLGMLVLYRVLFLLVVKAGEIVKPAIR  611

Query  2023  AVMRVSPKQ  2049
             A M  SP Q
Sbjct  612   AFMSHSPNQ  620



>ref|XP_009763606.1| PREDICTED: ABC transporter G family member 11-like [Nicotiana 
sylvestris]
Length=632

 Score =   770 bits (1988),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/613 (68%), Positives = 495/613 (81%), Gaps = 9/613 (1%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             FLTWEDLWV VS+ + G+ AILKGLTGYARPGELLAIMGPSGCGKSTLLD +AGRL   T
Sbjct  12    FLTWEDLWVRVSNMKDGSNAILKGLTGYARPGELLAIMGPSGCGKSTLLDTIAGRLGSGT  71

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             RQSGDILING  QTL YGT AYVTQ+DTL ATLTV+EA+YYSA+LQLP+S+P+SE+K+IA
Sbjct  72    RQSGDILINGHKQTLEYGTCAYVTQDDTLLATLTVKEAIYYSAELQLPNSMPKSERKKIA  131

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             ++TIKEMGLQDAM TRIGG  G     G QKRRVSIC+EILTRPKLLFLDEP+SGLDSAA
Sbjct  132   DITIKEMGLQDAMETRIGGWSGKGISGG-QKRRVSICMEILTRPKLLFLDEPTSGLDSAA  190

Query  763   SFYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETN  942
             S+YVM  I     +GRT+VASIHQPS EVF+LF SLCLLSSGR VYFGPASAAI+FF  +
Sbjct  191   SYYVMKTIAS-QCKGRTIVASIHQPSAEVFALFHSLCLLSSGRTVYFGPASAAIEFFALS  249

Query  943   GFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREVQ  1122
             GFPCPTLQNPSDHFLKTIN DFD   +D+E+G      TEEVINIL+ SYKS  +Y  VQ
Sbjct  250   GFPCPTLQNPSDHFLKTINSDFD---QDIEEGSTGRKSTEEVINILIKSYKSSDKYNAVQ  306

Query  1123  GQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLGY  1302
              QVAEI KQEGE+L+K S   F TQS VLTRRSF+NM  DLGYYWLRL +Y+ +A+GLG 
Sbjct  307   SQVAEICKQEGEILEKRSHVRFTTQSFVLTRRSFVNMSYDLGYYWLRLAVYVVIAIGLGT  366

Query  1303  MYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFAI  1482
             +Y DVG+  +S+QAR ++L F+ASF TFMAIGGFPSFVED+KVF+ E LNGHYG G+F I
Sbjct  367   IYYDVGFSTASVQARGTMLMFVASFITFMAIGGFPSFVEDLKVFQLEKLNGHYGSGSFVI  426

Query  1483  ANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLVP  1662
             ANTLSS+PYLLL+SLIPG IAYF  GLQ E  HF YF LV+   M+LVESLMMI+AS+VP
Sbjct  427   ANTLSSIPYLLLVSLIPGAIAYFLTGLQNELEHFIYFVLVLFTCMMLVESLMMIVASIVP  486

Query  1663  NYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGLR  1842
             N+LMGII GAG+QALMIL GG+FRLP DLPK FW+YP++Y+ FH YA++GL+KNE +GL+
Sbjct  487   NFLMGIITGAGIQALMILSGGFFRLPSDLPKPFWKYPLHYVAFHTYAFEGLFKNELEGLK  546

Query  1843  LPEETG---QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAKH  2013
             +  E     QII GE +L++  Q+ M +SKW+DL +L+ M V  R++FLL VKA EK K 
Sbjct  547   IHNEDKGKRQIINGEVILKDEWQMNMDYSKWVDLAILLWMVVFYRLLFLLFVKAGEKVKP  606

Query  2014  VVKA-VMRVSPKQ  2049
              ++A +   SP Q
Sbjct  607   AIRAFISSTSPNQ  619



>ref|XP_009611614.1| PREDICTED: ABC transporter G family member 11-like isoform X1 
[Nicotiana tomentosiformis]
Length=660

 Score =   771 bits (1990),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/617 (66%), Positives = 495/617 (80%), Gaps = 8/617 (1%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW DLWVTVS  + G KAIL+GLTGYARP ELLA+MGPSGCGKST LDALAGRL+ +TR
Sbjct  40    LTWNDLWVTVSTRKSGRKAILQGLTGYARPSELLAVMGPSGCGKSTFLDALAGRLDFSTR  99

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             QSGDILING  Q L+YGTSAY+TQ++TL ATLTV+EAVYYSAQLQLP S+ +SEK +IAE
Sbjct  100   QSGDILINGHKQKLSYGTSAYLTQDETLLATLTVKEAVYYSAQLQLPDSMTKSEKIQIAE  159

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TIKEMGLQDAMNTRIGG        G +KRR+SIC+EILTRPKLLFLDEP+SGLDSAAS
Sbjct  160   QTIKEMGLQDAMNTRIGGWGNKGISGG-EKRRLSICMEILTRPKLLFLDEPTSGLDSAAS  218

Query  766   FYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             +YVMS I     EGRT++ASIHQPS EVF+LF SLCLLSSGR+VYFGPASAAIQFF  NG
Sbjct  219   YYVMSGI-SRQKEGRTIIASIHQPSAEVFNLFHSLCLLSSGRIVYFGPASAAIQFFARNG  277

Query  946   FPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREVQG  1125
             FPCPTLQNPSDHFLKTINKDFD   ED+EQG A  IPTEEVI++LVNS+KS   Y E+Q 
Sbjct  278   FPCPTLQNPSDHFLKTINKDFD---EDIEQGSAGRIPTEEVIDLLVNSFKSSEEYHEIQN  334

Query  1126  QVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLGYM  1305
             QVAEI +Q GE+L+K S A+F TQS+VLTRRS +NMFRDLGYYW+R   Y+ +A+GLG +
Sbjct  335   QVAEICEQGGEILEKRSHANFTTQSLVLTRRSSVNMFRDLGYYWMRFATYVAIALGLGSI  394

Query  1306  YNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFAIA  1485
             Y D+G    SI+ R  ++AF+ SF TFM +GGFPSFVEDMKVF++E LNGHYGC  F I 
Sbjct  395   YYDLGSNYRSIEERGLMVAFVVSFMTFMTVGGFPSFVEDMKVFQRENLNGHYGCCTFVIG  454

Query  1486  NTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLVPN  1665
             NTLSS+PY+LLIS +PG IAY   G Q  FGHF YFALV+  +M++VESLMM +A++VPN
Sbjct  455   NTLSSIPYVLLISFVPGAIAYLLSGFQNGFGHFIYFALVLFTSMMIVESLMMNVAAIVPN  514

Query  1666  YLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGLRL  1845
             +LMGI+AGAG+Q L IL GGYF+LP +LP   W+YP+YY+ FHKYAYQG++KNEF+GL+ 
Sbjct  515   FLMGIVAGAGIQGLQILSGGYFQLPSELPNPIWKYPLYYMSFHKYAYQGMFKNEFEGLKF  574

Query  1846  PEE---TGQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAKHV  2016
              ++     + ++GE++LRE  + EM +SKWIDL +LV   ++ R+VFLL++K +EK  H 
Sbjct  575   TDDLFGNNRTMSGEDILRERWEAEMAYSKWIDLAILVSTLILYRLVFLLIIKTNEKVVHA  634

Query  2017  VKAVMRVSPKQSHQVVA  2067
              KA   V   +S Q++A
Sbjct  635   RKASTSVLSNRSSQIMA  651



>ref|XP_002270647.1| PREDICTED: ABC transporter G family member 11 [Vitis vinifera]
Length=676

 Score =   770 bits (1988),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/619 (67%), Positives = 495/619 (80%), Gaps = 8/619 (1%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             FLTWEDLWVTVS+G+ G ++IL+GLTGYARPGE+LAIMGPSGCGKSTLLDALAGRL   T
Sbjct  46    FLTWEDLWVTVSNGKSGCRSILQGLTGYARPGEVLAIMGPSGCGKSTLLDALAGRLGSNT  105

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
              QSG IL+NG  Q L+YGTSAYVTQ+DTL  TLTV EAVYYSA LQLP S+ +SEKKE A
Sbjct  106   SQSGIILVNGHKQALSYGTSAYVTQDDTLITTLTVGEAVYYSALLQLPDSMSKSEKKERA  165

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             +MTI+EMGLQD++NTRIGG        G QKRRVSIC+EILT PKLLFLDEP+SGLDSAA
Sbjct  166   DMTIREMGLQDSINTRIGGWGVKGISGG-QKRRVSICIEILTHPKLLFLDEPTSGLDSAA  224

Query  763   SFYVMSKIMDLASE-GRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             S+YVMS+I  L  + GRT++ SIHQPS+EVF+LF +LCLLSSGR VYFGPA  A +FF +
Sbjct  225   SYYVMSRIAGLDRQHGRTIITSIHQPSSEVFALFNNLCLLSSGRTVYFGPAHGADEFFSS  284

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREV  1119
             NGFPCPT QNPSDHFLKTINKDF+   ED+EQG       EE I+IL  +YKS   +++V
Sbjct  285   NGFPCPTHQNPSDHFLKTINKDFE---EDIEQGFGGKKSKEEAIDILTKAYKSSDNFQQV  341

Query  1120  QGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLG  1299
             Q QV+EI KQ+G  LKK S A F  Q +VLTRRSF+NM+RDLGYYWLRL IY+ L V LG
Sbjct  342   QTQVSEIYKQDGGALKKRSHASFLNQCLVLTRRSFVNMYRDLGYYWLRLAIYVALTVALG  401

Query  1300  YMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFA  1479
              ++++VGY NSSI+ R S+L ++ASF TFM+IGGFPSFVEDMKVF +E LNGHYG  +F 
Sbjct  402   TIFHNVGYSNSSIKDRGSMLMYVASFLTFMSIGGFPSFVEDMKVFGRERLNGHYGSSSFL  461

Query  1480  IANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLV  1659
             + NTLSS+PYLL+ISLIPG IAYF  GLQ+E+ HF Y+ALV+   M+LVESLMMI+AS+V
Sbjct  462   VGNTLSSVPYLLVISLIPGAIAYFLTGLQKEYAHFIYYALVLFTCMMLVESLMMIVASVV  521

Query  1660  PNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGL  1839
             PN+LMGII GAG+Q L+ILGGG+FRLP DLP +FWRYP+YYI F++YAYQGLYKNEF GL
Sbjct  522   PNFLMGIITGAGIQGLLILGGGFFRLPNDLPNVFWRYPLYYISFNRYAYQGLYKNEFLGL  581

Query  1840  RLPEETG---QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAK  2010
               P       ++ITGEEVLRET Q+EM +SKW+DL +L+ M V+ R +F + +K +EK  
Sbjct  582   TFPSNIAGGPRVITGEEVLRETWQMEMAYSKWVDLSILIGMVVLYRFLFFIFIKTTEKVI  641

Query  2011  HVVKAVMRVSPKQSHQVVA  2067
               VKA M   PKQ+ QV+A
Sbjct  642   PTVKAFMSRPPKQTKQVMA  660



>emb|CAN60999.1| hypothetical protein VITISV_012972 [Vitis vinifera]
Length=691

 Score =   764 bits (1973),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/634 (65%), Positives = 497/634 (78%), Gaps = 23/634 (4%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAG------  384
             FLTWEDLWVTVS+G+ G+++IL+GLTGYARPGE+LAIMGPSGCGKSTLLDALAG      
Sbjct  46    FLTWEDLWVTVSNGKSGSRSILQGLTGYARPGEVLAIMGPSGCGKSTLLDALAGAMNVES  105

Query  385   -----------RLELTTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSA  531
                        RL   T QSG IL+NG  Q L+YGTSAYVTQ+DTL  TLTV EAVYYSA
Sbjct  106   EATSVVPRINRRLGSNTSQSGIILVNGHKQALSYGTSAYVTQDDTLITTLTVGEAVYYSA  165

Query  532   QLQLPSSLPRSEKKEIAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTR  711
              LQLP S+ +S KKE A+MTI+EMGLQD++NTRIGG        G QKRRVSIC+EILT 
Sbjct  166   LLQLPDSMSKSXKKERADMTIREMGLQDSINTRIGGWGVKGISGG-QKRRVSICIEILTH  224

Query  712   PKLLFLDEPSSGLDSAASFYVMSKIMDLASE-GRTVVASIHQPSTEVfslftslcllssG  888
             PKLLFLDEP+SGLDSAAS+YVMS+I  L  + GRT++ SIHQPS+EVF+LF +LCLLSSG
Sbjct  225   PKLLFLDEPTSGLDSAASYYVMSRIAGLDRQHGRTIITSIHQPSSEVFALFDNLCLLSSG  284

Query  889   RVVYFGPASAAIQFFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEV  1068
             R VYFGPA AA +FF +NGFPCPT QNPSDHFLKTINKDF+   ED+EQG       EE 
Sbjct  285   RTVYFGPAHAADEFFSSNGFPCPTHQNPSDHFLKTINKDFE---EDIEQGFGGKKSKEEA  341

Query  1069  INILVNSYKSYHRYREVQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLG  1248
             I+IL  +YKS   +++VQ QV+EI KQ+G  LKK S A F  Q +VLTRRSF+NM+RDLG
Sbjct  342   IDILTKAYKSSDNFQQVQTQVSEIYKQDGGALKKRSHASFLNQCLVLTRRSFVNMYRDLG  401

Query  1249  YYWLRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMK  1428
             YYWLRL IY+ L V LG ++++VGY NSSI+ R S+L ++ASF TFM+IGGFPSFVEDMK
Sbjct  402   YYWLRLAIYVALTVALGTIFHNVGYSNSSIKDRGSMLMYVASFLTFMSIGGFPSFVEDMK  461

Query  1429  VFKKETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVIL  1608
             VF +E LNGHYG  +F + NTLSS+PYLL+ISLIPG IAYF  GLQ+E+ HF Y+ALV+ 
Sbjct  462   VFGRERLNGHYGSSSFVVGNTLSSVPYLLVISLIPGAIAYFLTGLQKEYAHFIYYALVLF  521

Query  1609  MNMLLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYID  1788
               M+LVESLMMI+AS+VPN+LMGII GAG+Q L+ILGGG+FRLP DLP +FWRYP+YYI 
Sbjct  522   TCMMLVESLMMIVASVVPNFLMGIITGAGIQGLLILGGGFFRLPNDLPNVFWRYPLYYIS  581

Query  1789  FHKYAYQGLYKNEFQGLRLPEE-TGQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvc  1965
             F++YAYQGLYKNEF GL  P    G++ITGEEVLRET Q+EM +SKW+DL +L+ M V+ 
Sbjct  582   FNRYAYQGLYKNEFLGLTFPSNIAGRVITGEEVLRETWQMEMAYSKWVDLSILIGMVVLY  641

Query  1966  rvvfllvvKASEKAKHVVKAVMRVSPKQSHQVVA  2067
             R +F + +K +EK    VKA M   PKQ+ QV+A
Sbjct  642   RFLFFIFIKTTEKVIPTVKAFMSRPPKQTKQVMA  675



>ref|XP_010267240.1| PREDICTED: ABC transporter G family member 11-like [Nelumbo nucifera]
Length=743

 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/619 (65%), Positives = 498/619 (80%), Gaps = 9/619 (1%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             +LTW+DL VTVS+ + G +AIL+ LTGYA+PGE+LAIMGPSGCGKSTLLDALAGRL   T
Sbjct  123   YLTWKDLCVTVSNAKTGTRAILQDLTGYAQPGEVLAIMGPSGCGKSTLLDALAGRLGSNT  182

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             RQSGDIL+NGR + LA+GTSAYVTQ+DTL  TLTV+E VYYSAQLQLP S+P SEKKE  
Sbjct  183   RQSGDILVNGRREALAFGTSAYVTQDDTLMMTLTVKEVVYYSAQLQLPDSMPLSEKKERT  242

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             EMT++EMGLQDAMNTRIGG        G QKRRVSIC+EILTRPKLLFLDEP+SGLDSAA
Sbjct  243   EMTLREMGLQDAMNTRIGGWGHKGISGG-QKRRVSICIEILTRPKLLFLDEPTSGLDSAA  301

Query  763   SFYVMSKIMDLA-SEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             S++VM++I+ LA   GRTV+ASIHQPS+EVF LF +LCLLSSG+ VYFGPAS A +FF  
Sbjct  302   SYHVMNRIVGLARHHGRTVIASIHQPSSEVFELFHNLCLLSSGKTVYFGPASEATEFFAV  361

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGC-ARGIPTEEVINILVNSYKSYHRYRE  1116
             NGFPCP+L+NPSDH+L+TINKDFD D   +EQG   + I TE VINILV +YKS H  ++
Sbjct  362   NGFPCPSLRNPSDHYLRTINKDFDTD---IEQGLDGQKIATEAVINILVQAYKSSHTSQQ  418

Query  1117  VQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGL  1296
             V  +VAE+SK+EGE+L+K S+A F TQS+VLT+RSF+NM+RDLGYYWLRL IYI L + +
Sbjct  419   VNTRVAELSKREGEILEKGSQASFLTQSLVLTKRSFVNMYRDLGYYWLRLAIYIALCLCV  478

Query  1297  GYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAF  1476
             G +++D+G    SIQAR S+L F+A+F TFMAIGGFPSFVEDMK+F++E LNGHYG GAF
Sbjct  479   GTIFHDIGSSFGSIQARGSMLMFVAAFLTFMAIGGFPSFVEDMKIFQRERLNGHYGVGAF  538

Query  1477  AIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASL  1656
              + N+ SS+PYLLLISL PG IAY+ VGLQ+  GHF YFALV+ + MLLVESLMMI+AS+
Sbjct  539   VVGNSFSSIPYLLLISLAPGAIAYYLVGLQKGAGHFVYFALVLFVCMLLVESLMMIVASV  598

Query  1657  VPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQG  1836
             VP++LMGII GAG+Q +M+L GG+FRLP DLPK  W+YP+YYI FHKYA QG YKNEF+G
Sbjct  599   VPDFLMGIITGAGIQGVMMLNGGFFRLPDDLPKPVWKYPMYYIAFHKYANQGFYKNEFEG  658

Query  1837  LRLPEETG---QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKA  2007
             L  P         I+GEE+LR T QVEMG+SKW+DL +L  M ++ R++F  ++K  EK 
Sbjct  659   LTFPNNLAGGPATISGEEILRNTWQVEMGYSKWVDLAILFGMVILYRLMFWAIIKTVEKL  718

Query  2008  KHVVKAVMRVSPKQSHQVV  2064
             K +++A +   P Q  Q++
Sbjct  719   KPIIRAFLAAPPNQMAQIM  737



>ref|XP_006492628.1| PREDICTED: ABC transporter G family member 11-like [Citrus sinensis]
Length=673

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/622 (67%), Positives = 490/622 (79%), Gaps = 16/622 (3%)
 Frame = +1

Query  223   FLTWEDLWVTVSDG-RKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELT  399
             FLTW+DLWVTV DG +KGN++IL+GLTGYARPGELLAIMGPSGCGKSTLLDALAGRL   
Sbjct  44    FLTWQDLWVTVPDGQKKGNRSILQGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLGSN  103

Query  400   TRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEI  579
             TRQ+G+ILINGR + LAYGTSAYVTQ+D L  TLTV EAVYYSAQLQLP ++ + +KKE 
Sbjct  104   TRQAGEILINGRKRALAYGTSAYVTQDDALITTLTVSEAVYYSAQLQLPDTMTKLQKKER  163

Query  580   AEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSA  759
             AEMTIKEMGLQDAMNTRIGG        G QKRRVSIC+E+LTRPKLLFLDEP+SGLDSA
Sbjct  164   AEMTIKEMGLQDAMNTRIGGWGAKGLSGG-QKRRVSICIEMLTRPKLLFLDEPTSGLDSA  222

Query  760   ASFYVMSKIMDLASE-----GRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAI  924
             AS+YVMS+I  L         RT++ASIHQPS+EVF LF +LCLLSSG+ VYFGPASAA 
Sbjct  223   ASYYVMSRIAKLDQRDHGVGSRTIIASIHQPSSEVFQLFHNLCLLSSGQTVYFGPASAAN  282

Query  925   QFFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYH  1104
             +FF  NGFPCPTLQNPSDHFLKTINKDF    ED+E+G A  IPTEE I+IL  SYKS  
Sbjct  283   EFFALNGFPCPTLQNPSDHFLKTINKDFQ---EDIEEGLAGVIPTEEAIDILTKSYKSSD  339

Query  1105  RYREVQGQVAEISKQE--GEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYI  1278
              Y +V+ QVAEI K +  G + KKS+ ADF TQ IVLT RSF+NM+RDLGYYW RLG+Y+
Sbjct  340   NYLQVRSQVAEICKAQDSGALEKKSAHADFLTQCIVLTSRSFVNMYRDLGYYWFRLGVYV  399

Query  1279  TLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGH  1458
              L +GL  +++++G  N+SIQAR S+L F+AS+ TFM IGGFPSFVEDMKVF++E LNGH
Sbjct  400   LLGIGLATVFSNLGTDNNSIQARGSLLMFVASYLTFMTIGGFPSFVEDMKVFERERLNGH  459

Query  1459  YGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLM  1638
             YG  AF   NT S+LPYL LISLIPG I Y+  GL   + HF YF L++   MLLVESLM
Sbjct  460   YGATAFVFGNTFSALPYLALISLIPGAIVYYLPGLHEGYQHFIYFVLLLFACMLLVESLM  519

Query  1639  MIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLY  1818
             MI+ASLVPNYL GII GAG+Q LMILGGG+FRLP DLP  FW+YP+YYI FHKYAYQG++
Sbjct  520   MIVASLVPNYLTGIITGAGIQGLMILGGGFFRLPNDLPHPFWKYPLYYIAFHKYAYQGMF  579

Query  1819  KNEFQGLRLPEETGQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKAS  1998
             KNEF+GL+        + GE+VLR+  Q++MG+SKW+DL +L  M V  R+VFL ++K  
Sbjct  580   KNEFEGLKFDNN----LDGEQVLRDKWQLQMGYSKWVDLAILFGMVVFYRLVFLGIIKTV  635

Query  1999  EKAKHVVKAVMRVSPKQSHQVV  2064
             EK K VVKA M V  KQ+ Q++
Sbjct  636   EKMKPVVKAFMSVPMKQTTQIM  657



>ref|XP_010267226.1| PREDICTED: ABC transporter G family member 11-like [Nelumbo nucifera]
Length=749

 Score =   759 bits (1961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/620 (66%), Positives = 496/620 (80%), Gaps = 10/620 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             +LTW+DL+VTVS+G+ G +AIL+ LTGYA+PGE+LAIMGPSGCGKSTLLD LAGRL   T
Sbjct  128   YLTWKDLYVTVSNGKSGTRAILQDLTGYAQPGEVLAIMGPSGCGKSTLLDTLAGRLGSNT  187

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             RQ GDIL+NGR Q LA+GTSAYVTQ+DTL  TLTVREAVYYSAQLQLP S+P SEK+E A
Sbjct  188   RQCGDILVNGRRQALAFGTSAYVTQDDTLMMTLTVREAVYYSAQLQLPDSMPLSEKRERA  247

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             EMTI+EMGLQDAMNTRIGG        G QKRRVSIC+EILTRPKLLFLDEP+SGLDSAA
Sbjct  248   EMTIREMGLQDAMNTRIGGWGHKGLSGG-QKRRVSICIEILTRPKLLFLDEPTSGLDSAA  306

Query  763   SFYVMSKIMDLASE-GRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             S++VM++I+ LA + GRTVVASIHQPS+EVF LF +LCLLS+G+ VYFGPASAA QFF +
Sbjct  307   SYHVMNRIVGLAQQDGRTVVASIHQPSSEVFELFHNLCLLSAGKTVYFGPASAASQFFSS  366

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGC-ARGIPTEEVINILVNSYKSYHRYRE  1116
             NGFPCP+ +NPSDH+L+TINKDFD D   VEQG   +   T+EVIN+L  SYKS    ++
Sbjct  367   NGFPCPSRRNPSDHYLRTINKDFDTD---VEQGFNGQTTTTDEVINVLAQSYKSSETCQQ  423

Query  1117  VQGQVAEISKQEGEVL-KKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             VQ +VAEI K+EG  L KK S+A F TQS VLTRRSF+NM+RDLGYYWLRL IYI+L + 
Sbjct  424   VQRRVAEICKREGAPLEKKGSQASFLTQSFVLTRRSFVNMYRDLGYYWLRLAIYISLCLC  483

Query  1294  LGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGA  1473
             +G +Y D+G    SIQAR S+L F+A+F TFMAIGGFPSFVEDMK+F +E LNGHYG GA
Sbjct  484   VGTIYFDIGSSFGSIQARGSMLMFVAAFLTFMAIGGFPSFVEDMKIFTRERLNGHYGVGA  543

Query  1474  FAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIAS  1653
             F + N+ SS+PYLLL SLIPG IAY+ VGLQ+   HF YF LV+ + M+LVESLMMI+AS
Sbjct  544   FVLGNSFSSIPYLLLTSLIPGAIAYYLVGLQKGAEHFVYFGLVLFVCMMLVESLMMIVAS  603

Query  1654  LVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQ  1833
             +VP++LMGII GAG+Q +M+L GG+FRLP DLPK FW+YP+YYI FHKYA QG YKNEF+
Sbjct  604   VVPDFLMGIITGAGIQGVMMLNGGFFRLPDDLPKPFWKYPMYYIAFHKYANQGFYKNEFE  663

Query  1834  GLRLPEETG---QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEK  2004
             GL  P         ITGEE+LR T QVEMG+SKW+DL +L  M V+ R +F  ++K +EK
Sbjct  664   GLTFPNNLAGGPATITGEEILRNTWQVEMGYSKWVDLAILFGMVVLYRFMFWAIIKTAEK  723

Query  2005  AKHVVKAVMRVSPKQSHQVV  2064
              K +++A +   PKQ  Q++
Sbjct  724   VKPIIRAFLATPPKQKAQIM  743



>ref|XP_010258617.1| PREDICTED: ABC transporter G family member 11-like [Nelumbo nucifera]
Length=722

 Score =   758 bits (1957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/620 (66%), Positives = 504/620 (81%), Gaps = 10/620 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             FLTWEDLWVTVS+G+   +++L+GLTGYA+PGE LAIMGPSGCGKSTLLDALAGRL   T
Sbjct  94    FLTWEDLWVTVSNGKTKCRSLLQGLTGYAQPGEFLAIMGPSGCGKSTLLDALAGRLSSNT  153

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             RQSG+ILINGR QTLA+GTSAYVTQ+DTL  TLTVREAVYYSAQLQLP S+ RSEKKE A
Sbjct  154   RQSGEILINGRKQTLAFGTSAYVTQDDTLMTTLTVREAVYYSAQLQLPDSMSRSEKKERA  213

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             EMT++E+GLQD MNTRIGG        G QKRRVSIC+EILTRPKLLFLDEP+SGLDSAA
Sbjct  214   EMTMRELGLQDTMNTRIGGWGSKGLSGG-QKRRVSICIEILTRPKLLFLDEPTSGLDSAA  272

Query  763   SFYVMSKIMDLASEG-RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             S++V+ +I DLA +  RT++ASIHQPS+EVF LF +LCLLSSGR VYFGPASAA +FF  
Sbjct  273   SYHVIKRIADLAQQDERTIIASIHQPSSEVFELFHNLCLLSSGRTVYFGPASAANEFFAL  332

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGC-ARGIPTEEVINILVNSYKSYHRYRE  1116
             NGFPCPTL+NPSDHFL+TINKDFD   +D+EQG     + TEE INILV SYKS    ++
Sbjct  333   NGFPCPTLRNPSDHFLRTINKDFD---QDIEQGSDGLKMTTEEAINILVRSYKSSEICQQ  389

Query  1117  VQGQVAEISKQEGEVL-KKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             V+ +VAE+ K+ G+ L KK S+A FFTQS+VLTRRSF+NM+RD+GYYWLR  +YI+L + 
Sbjct  390   VRTRVAELYKKGGKTLEKKGSQASFFTQSLVLTRRSFVNMYRDVGYYWLRFAVYISLCLC  449

Query  1294  LGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGA  1473
             +G ++  +G+   SIQAR SVL +IASF TFMAIGGFPSFVEDMK+F++E LNGHYG GA
Sbjct  450   VGTVFYKIGHSYGSIQARSSVLMYIASFITFMAIGGFPSFVEDMKIFERERLNGHYGVGA  509

Query  1474  FAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIAS  1653
             + + NTLSS+PYLLL+S  PG IAY+ VGLQR   HF YF L++ +  LLVESLMMIIAS
Sbjct  510   YVMGNTLSSIPYLLLVSAAPGAIAYYLVGLQRGIEHFVYFTLLLFICTLLVESLMMIIAS  569

Query  1654  LVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQ  1833
             +VPN+LMGII+GAG+Q LM+L GG+FRL  D+P  FWRYPIYYI FHKYA++G YKNEF+
Sbjct  570   VVPNFLMGIISGAGIQGLMMLNGGFFRLRDDIPNPFWRYPIYYISFHKYAFEGFYKNEFE  629

Query  1834  GLRLPEETGQ---IITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEK  2004
             GL  P   G    +++G E+LR+TLQ++M +SKW+DL VL+ M V+ R++FL ++K  EK
Sbjct  630   GLTFPSNQGGQPILMSGNEILRKTLQMDMDYSKWVDLAVLLGMVVLYRLIFLGIIKFVEK  689

Query  2005  AKHVVKAVMRVSPKQSHQVV  2064
              K +++A+  +SPKQ+ QV+
Sbjct  690   FKPIIRALGTISPKQTTQVM  709



>ref|XP_009784909.1| PREDICTED: ABC transporter G family member 11-like isoform X1 
[Nicotiana sylvestris]
Length=673

 Score =   754 bits (1947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/617 (65%), Positives = 489/617 (79%), Gaps = 8/617 (1%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW DLWVTVS  + G KAIL+GLTGYARP ELLA+MGPSGCGKSTLLDALAGRL+ +TR
Sbjct  40    LTWNDLWVTVSTRKSGRKAILQGLTGYARPSELLAVMGPSGCGKSTLLDALAGRLDFSTR  99

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             QSGDILING  Q L+YGT AY+TQ++TL ATLTV+EAVYYSAQLQLP S+ +SEK +IAE
Sbjct  100   QSGDILINGHKQKLSYGTCAYLTQDETLLATLTVKEAVYYSAQLQLPDSMKKSEKIQIAE  159

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TIKEMGLQDAMNTRIGG        G +KRR+SIC+EILTRPKLLFLDEP+SGLDSAAS
Sbjct  160   QTIKEMGLQDAMNTRIGGWGTKGISGG-EKRRLSICMEILTRPKLLFLDEPTSGLDSAAS  218

Query  766   FYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             +YVMS+I     EGRT++ASIHQPS EVF+LF SLCLLSSG++VYFGPASAAIQFF  NG
Sbjct  219   YYVMSEI-SRQKEGRTIIASIHQPSAEVFNLFHSLCLLSSGKIVYFGPASAAIQFFARNG  277

Query  946   FPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREVQG  1125
             F CP LQNPSDHFLKT+NKDFD   ED+EQG A   P EEVI++LVNS+KS   Y EVQ 
Sbjct  278   FSCPHLQNPSDHFLKTVNKDFD---EDIEQGSAGRKPIEEVIDLLVNSFKSSKEYHEVQN  334

Query  1126  QVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLGYM  1305
             Q+ EI +Q GE+L+K SRA+F TQS+VLTRRS +NMFRDLGYYW+R   Y+ +A+GLG +
Sbjct  335   QIVEICQQGGEILEKRSRANFTTQSLVLTRRSSVNMFRDLGYYWMRFATYVAIALGLGSI  394

Query  1306  YNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFAIA  1485
             Y D+G    SI+ R  ++ F+ SF TFM +GGFPSFVEDMKVF++E LNGHYGC  F I 
Sbjct  395   YYDLGSNYHSIEERGLMVTFVVSFMTFMTVGGFPSFVEDMKVFQRENLNGHYGCCTFVIG  454

Query  1486  NTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLVPN  1665
             N LSS PY++LIS +PG IAY   GLQ  FGHF YFALV+  ++++VESLMM +A++V N
Sbjct  455   NILSSTPYVILISFVPGAIAYLLSGLQNGFGHFIYFALVLFTSIMIVESLMMNVAAIVSN  514

Query  1666  YLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGLRL  1845
             +LMGI+ GAG+Q L IL GGYF+LP +LP   W+YP+YY+ FHKYAYQG++KNEF+GL+ 
Sbjct  515   FLMGIVIGAGIQGLQILSGGYFQLPSELPNPIWKYPLYYVSFHKYAYQGMFKNEFKGLKF  574

Query  1846  PEE---TGQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAKHV  2016
              ++     Q ++GE++LRE  QVEM +SKW+DL +LV   ++ R+VFLL++K +EK  H 
Sbjct  575   TDDQFGNNQTMSGEDILRERWQVEMAYSKWVDLAILVGTLILYRLVFLLIIKTNEKIVHA  634

Query  2017  VKAVMRVSPKQSHQVVA  2067
              KA   V   Q+ Q++A
Sbjct  635   RKASTSVLSNQNSQIMA  651



>ref|XP_010273011.1| PREDICTED: ABC transporter G family member 11-like [Nelumbo nucifera]
Length=749

 Score =   756 bits (1953),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/620 (66%), Positives = 501/620 (81%), Gaps = 10/620 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             +LTW+DL VTVSD + G +AIL+GLTGYA+PGE+LAIMGPSGCGKSTLLD LAGRL   T
Sbjct  128   YLTWKDLCVTVSDAKSGTRAILQGLTGYAQPGEVLAIMGPSGCGKSTLLDTLAGRLGSNT  187

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             RQSGDIL+NGR Q LA+GTSAYVTQ+DTL  TLTVREAVYYSAQLQLP S+P SEK+E A
Sbjct  188   RQSGDILVNGRRQALAFGTSAYVTQDDTLMMTLTVREAVYYSAQLQLPDSMPLSEKRERA  247

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             E+TI+EMGLQDAMNTRIGG        G QKRRVSIC+EILTRPKLLFLDEP+SGLDSAA
Sbjct  248   EITIREMGLQDAMNTRIGGWGHKGLSGG-QKRRVSICIEILTRPKLLFLDEPTSGLDSAA  306

Query  763   SFYVMSKIMDLASE-GRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             S++VM++I+ LA + GRTVVASIHQPS+EVF LF +LCLLS+G+ VYFG ASAA +FF +
Sbjct  307   SYHVMNRIVRLAQQDGRTVVASIHQPSSEVFELFHNLCLLSAGKTVYFGQASAASEFFSS  366

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGC-ARGIPTEEVINILVNSYKSYHRYRE  1116
             NGFPCP+L+NPSDH+L+TINKDFD D   VEQG   + I T+EVINILV SYKS    ++
Sbjct  367   NGFPCPSLRNPSDHYLRTINKDFDTD---VEQGFDGKTISTDEVINILVKSYKSSETCQQ  423

Query  1117  VQGQVAEISKQEGEVL-KKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             V+ +VAEI K+EG  L KK S+A F +QS VLT+RSF+NM+RDLGYYWLRL IYI L + 
Sbjct  424   VKRRVAEICKREGAPLEKKGSQASFLSQSFVLTKRSFVNMYRDLGYYWLRLAIYIALCLC  483

Query  1294  LGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGA  1473
             +G +Y D+G+   SIQAR S+L F+A+F TFMAIGGFPSFVEDMK+F++E LNGHYG GA
Sbjct  484   VGTIYFDIGHSFGSIQARGSMLMFVAAFLTFMAIGGFPSFVEDMKIFQRERLNGHYGVGA  543

Query  1474  FAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIAS  1653
             F + N+ SS+PYLLLISLIPG IAY+ VGLQ+   HF YFALV+ + MLLVESLMMI+AS
Sbjct  544   FVLGNSFSSIPYLLLISLIPGAIAYYLVGLQKGAEHFVYFALVLFVCMLLVESLMMIVAS  603

Query  1654  LVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQ  1833
             +VP++LMGII GAG+Q +M+L GG+FRLP DLPK FW+YP+YYI FHKYA QG YKNEF+
Sbjct  604   VVPDFLMGIITGAGIQGVMMLNGGFFRLPDDLPKPFWKYPMYYIAFHKYANQGFYKNEFE  663

Query  1834  GLRLPEETG---QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEK  2004
             GL  P         ITG+E+LR+T QVEMG+SKW+DL +L+ M ++ R +F  ++K  EK
Sbjct  664   GLTFPNNLAGGPPTITGDEILRDTWQVEMGYSKWVDLAILLGMVILYRFMFWAIIKTVEK  723

Query  2005  AKHVVKAVMRVSPKQSHQVV  2064
              K +++A +   P Q  Q++
Sbjct  724   MKPMIRAFLATPPNQMAQIM  743



>ref|XP_006423805.1| hypothetical protein CICLE_v10027954mg [Citrus clementina]
 gb|ESR37045.1| hypothetical protein CICLE_v10027954mg [Citrus clementina]
Length=673

 Score =   753 bits (1945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/622 (66%), Positives = 489/622 (79%), Gaps = 16/622 (3%)
 Frame = +1

Query  223   FLTWEDLWVTVSDG-RKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELT  399
             FLTW+DLWVTV DG +KGN++IL+GLTGYARPGELLAIMGPSGCGKSTLLDALAGRL   
Sbjct  44    FLTWQDLWVTVPDGQKKGNRSILQGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLGSN  103

Query  400   TRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEI  579
             TRQ+G+ILINGR + LAYGTSAYVTQ+D L  TLTV EAVYYSAQLQLP ++ + +KKE 
Sbjct  104   TRQAGEILINGRKRALAYGTSAYVTQDDALITTLTVSEAVYYSAQLQLPDTMTKLQKKER  163

Query  580   AEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSA  759
             AEMTIKEMGLQDAMNTRIGG        G QKRRVSIC+E+LTRPKLLFLDEP+SGLDSA
Sbjct  164   AEMTIKEMGLQDAMNTRIGGWGAKGLSGG-QKRRVSICIEMLTRPKLLFLDEPTSGLDSA  222

Query  760   ASFYVMSKIMDLASE-----GRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAI  924
             AS+YVMS+I  L         RT++ SIHQPS+EVF LF +LCLLSSG+ VYFGPASAA 
Sbjct  223   ASYYVMSRIAKLDQRDHGVGSRTIITSIHQPSSEVFQLFHNLCLLSSGQTVYFGPASAAN  282

Query  925   QFFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYH  1104
             +FF  NGFPCPTLQNPSDHFLKTINKDF    ED+E+G A  +PT+E I+IL  SYKS  
Sbjct  283   EFFALNGFPCPTLQNPSDHFLKTINKDFQ---EDIEKGLAGVVPTQEAIDILTKSYKSSD  339

Query  1105  RYREVQGQVAEISKQE--GEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYI  1278
              Y +V+ QVAEI K +  G + KKS+ ADF TQ IVLT RSF+NM+RDLGYYW RLG+Y+
Sbjct  340   SYLQVRSQVAEICKAQDSGALEKKSTHADFLTQCIVLTSRSFVNMYRDLGYYWFRLGVYV  399

Query  1279  TLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGH  1458
              L VGL  +++++G  N+SIQAR S+L F+ASF TFM IGGFPSFVEDMKVF++E LNGH
Sbjct  400   LLGVGLATVFSNLGTDNNSIQARGSLLMFVASFLTFMTIGGFPSFVEDMKVFERERLNGH  459

Query  1459  YGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLM  1638
             YG  AF   NT S+LPYL LISLIPG I Y   GL + + HF YF L++   MLLVESLM
Sbjct  460   YGATAFVFGNTFSALPYLALISLIPGAIVYDLPGLHKGYQHFTYFVLLLFACMLLVESLM  519

Query  1639  MIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLY  1818
             MI+ASLVPNYL GII GAG+Q LMILGGG+FRLP DLP  FW+YP+YYI FHKYAYQG++
Sbjct  520   MIVASLVPNYLTGIITGAGIQGLMILGGGFFRLPNDLPHPFWKYPLYYIAFHKYAYQGMF  579

Query  1819  KNEFQGLRLPEETGQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKAS  1998
             KNEF+GL+        + GE+VLR+  Q++MG+SKW+DL +L  M V  R+VFL +VK  
Sbjct  580   KNEFEGLKFDNN----LDGEQVLRDNWQLQMGYSKWVDLAILFGMVVFYRLVFLGIVKTV  635

Query  1999  EKAKHVVKAVMRVSPKQSHQVV  2064
             EK K VVKA M V  K++ Q++
Sbjct  636   EKMKPVVKAFMSVPMKRTTQIM  657



>ref|XP_007207212.1| hypothetical protein PRUPE_ppa001905mg [Prunus persica]
 gb|EMJ08411.1| hypothetical protein PRUPE_ppa001905mg [Prunus persica]
Length=744

 Score =   753 bits (1945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/613 (65%), Positives = 497/613 (81%), Gaps = 8/613 (1%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW+DLWV VSDG+ G + IL+ LTG+A+PGE+LAIMGPSG GKSTLLDALAGRL   T+
Sbjct  135   LTWKDLWVGVSDGKNGKRMILQELTGFAQPGEMLAIMGPSGSGKSTLLDALAGRLSSDTQ  194

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             Q+G+ILINGR +TLA+GTSAYVTQ+DTL  TLTVREAVYYSAQLQLP S+ + EKKE AE
Sbjct  195   QTGEILINGRRETLAFGTSAYVTQDDTLMTTLTVREAVYYSAQLQLPDSMSKVEKKERAE  254

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
             MTI+EMGLQD+M+TRIGG        G QKRRVSIC+EILTRPKLLFLDEP+SGLDSAAS
Sbjct  255   MTIREMGLQDSMDTRIGGWSVKGLSGG-QKRRVSICIEILTRPKLLFLDEPTSGLDSAAS  313

Query  766   FYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETN  942
             ++VM++I+ LA  +GRTV+ASIHQPS+EVF LF +LCLLSSGR VYFGPAS A QFF +N
Sbjct  314   YHVMNRIVKLAHRDGRTVIASIHQPSSEVFELFQNLCLLSSGRTVYFGPASMAEQFFASN  373

Query  943   GFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREVQ  1122
             GFPCPTL+NP+DH+L+TINKDFD    D+EQG      TEE INIL  SYKS + +++VQ
Sbjct  374   GFPCPTLRNPADHYLRTINKDFD---VDIEQGFDGKTSTEEAINILTQSYKSSNHFQQVQ  430

Query  1123  GQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLGY  1302
              QVAEI +Q+G  L+K S+A+F TQ +VLTRRSF+NM+RDLGYYWLRL IYI L + +G 
Sbjct  431   KQVAEICQQKGGALEKGSQANFITQCLVLTRRSFVNMYRDLGYYWLRLAIYIALCLCVGT  490

Query  1303  MYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFAI  1482
             ++ D+G    SIQAR ++L F+ +F TFMAIGGFPSFVEDMK+F +E LNGHYG  AF +
Sbjct  491   IFYDIGSTFGSIQARGAMLMFVGAFLTFMAIGGFPSFVEDMKIFGRERLNGHYGVSAFVV  550

Query  1483  ANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLVP  1662
              NT SS+PYLL+ISLIPG IAY+ VGLQ+ F HFAYFAL++ ++M+LVESLMMI+AS+VP
Sbjct  551   GNTFSSIPYLLIISLIPGAIAYYMVGLQKSFEHFAYFALLLFVSMMLVESLMMIVASIVP  610

Query  1663  NYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGLR  1842
             ++LMGII GAG+Q +M+L GG+FRLP DLPK FWRYP+YYI FHKYA +G YKNEF+GL 
Sbjct  611   DFLMGIITGAGIQGVMMLNGGFFRLPNDLPKPFWRYPMYYIAFHKYANEGFYKNEFEGLT  670

Query  1843  LPEETG---QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAKH  2013
              P +       ITGEE+LR   QV+MG+SKW+DL +L  M +V R++FL ++K +EK   
Sbjct  671   FPNDQAARPSTITGEEILRSIWQVQMGYSKWVDLAILFGMVIVYRLMFLGIIKTTEKFVP  730

Query  2014  VVKAVMRVSPKQS  2052
             ++KA++  +PK S
Sbjct  731   IIKALLVGTPKHS  743



>ref|XP_006423808.1| hypothetical protein CICLE_v10027953mg [Citrus clementina]
 gb|ESR37048.1| hypothetical protein CICLE_v10027953mg [Citrus clementina]
Length=673

 Score =   750 bits (1936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/622 (66%), Positives = 490/622 (79%), Gaps = 16/622 (3%)
 Frame = +1

Query  223   FLTWEDLWVTVSDG-RKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELT  399
             FLTW+DLWVTV DG +KGN++IL+GLTGYARPGELLAIMGPSGCGKSTLLDALAGRL   
Sbjct  44    FLTWQDLWVTVPDGQKKGNRSILQGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLGSN  103

Query  400   TRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEI  579
             TRQ+G+ILINGR + LAYGTSAYVTQ+D L  TLTV EAVYYSAQLQLP ++ + +KKE 
Sbjct  104   TRQAGEILINGRKRALAYGTSAYVTQDDALITTLTVSEAVYYSAQLQLPDTMTKLQKKER  163

Query  580   AEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSA  759
             AEMTIKEMGLQDAMNTRIGG        G QKRRVSIC+E+LTRPKLLFLDEP+SGLDSA
Sbjct  164   AEMTIKEMGLQDAMNTRIGGWGAKGLSGG-QKRRVSICIEMLTRPKLLFLDEPTSGLDSA  222

Query  760   ASFYVMSKIMDLASE-----GRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAI  924
             AS+YVMS+I  L         RT++ASIHQPS+EVF LF +LCLLSSG+ VYFGPASAA 
Sbjct  223   ASYYVMSRIAKLDQRDHGVGSRTMIASIHQPSSEVFQLFHNLCLLSSGQTVYFGPASAAN  282

Query  925   QFFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYH  1104
             +FF  NGFPCP LQNPSDHFLKTINKDF    +D+E+G A  IPTEE I+IL  SYKS  
Sbjct  283   EFFALNGFPCPALQNPSDHFLKTINKDFQ---KDIEEGLAGVIPTEEAIDILTKSYKSSD  339

Query  1105  RYREVQGQVAEISKQE--GEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYI  1278
              Y +++ QVAEI K +  G + KKS+ ADF TQ IVLT RSF+NM+RDLGYYW RLG+Y+
Sbjct  340   NYLQLRSQVAEICKAQDSGALEKKSTHADFLTQCIVLTSRSFVNMYRDLGYYWFRLGVYV  399

Query  1279  TLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGH  1458
              L +GL  +++++G  ++SIQAR S+L F+AS+ TFM IGGFPSFVEDMKVF++E LNGH
Sbjct  400   LLGIGLATVFSNLGTDDNSIQARGSLLMFVASYLTFMTIGGFPSFVEDMKVFERERLNGH  459

Query  1459  YGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLM  1638
             YG  AF   NT S+LPYL LISLIPG I Y+  GL + + HF YF L++   MLLVESLM
Sbjct  460   YGATAFVFGNTFSALPYLALISLIPGAIVYYLPGLHKGYQHFIYFVLLLFACMLLVESLM  519

Query  1639  MIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLY  1818
             MI+ASLVPNYL GII GAG+Q LMILGGG+FRLP DLP  FW+YP+YYI FHKYAYQG++
Sbjct  520   MIVASLVPNYLTGIITGAGIQGLMILGGGFFRLPNDLPHPFWKYPLYYIAFHKYAYQGMF  579

Query  1819  KNEFQGLRLPEETGQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKAS  1998
             KNEF+GL+        + GE+VLR+  Q++MG+SKW+DL +L  M V  R+VFL ++K  
Sbjct  580   KNEFEGLKFDNN----LDGEQVLRDKWQLQMGYSKWVDLAILFGMVVFYRLVFLGIIKTV  635

Query  1999  EKAKHVVKAVMRVSPKQSHQVV  2064
             +K K VVKA M V  KQ+ Q++
Sbjct  636   KKMKPVVKAFMSVPMKQTTQIM  657



>ref|XP_009767616.1| PREDICTED: ABC transporter G family member 11-like isoform X1 
[Nicotiana sylvestris]
Length=674

 Score =   749 bits (1934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/618 (65%), Positives = 490/618 (79%), Gaps = 9/618 (1%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW DLWVTVS  + G KAIL+GLTGYARP ELLA+MGPSGCGKSTLLDALAGRL+ +TR
Sbjct  40    LTWNDLWVTVSTRKSGRKAILQGLTGYARPSELLAVMGPSGCGKSTLLDALAGRLDFSTR  99

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             QSGDILING  Q L+YGT AY+TQ++TL ATLTV+EAVYYSAQLQLP S+ +SEK +IAE
Sbjct  100   QSGDILINGHKQKLSYGTCAYLTQDETLLATLTVKEAVYYSAQLQLPDSMKKSEKIQIAE  159

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TIKEMGLQDAMNTRIGG        G +KRR+SIC+EILTRPKLLFLDEP+SGLDSAAS
Sbjct  160   QTIKEMGLQDAMNTRIGGWGTKGISGG-EKRRLSICMEILTRPKLLFLDEPTSGLDSAAS  218

Query  766   FYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             +YVMS I     EGRT++ASIHQPS EVF+LF SLCLLSSG++VYFGPASAAIQFF  NG
Sbjct  219   YYVMSGI-SRQKEGRTIIASIHQPSAEVFNLFHSLCLLSSGKIVYFGPASAAIQFFARNG  277

Query  946   FPCPTLQNPSDHFLKTINKDFDNDDEDVEQGC-ARGIPTEEVINILVNSYKSYHRYREVQ  1122
             FPCP LQNPSDHFLKT+NKDFD   ED+EQG   R   TEEVI++LVNS+K    Y EVQ
Sbjct  278   FPCPHLQNPSDHFLKTVNKDFD---EDIEQGLDGRKPNTEEVIDLLVNSFKLSKEYHEVQ  334

Query  1123  GQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLGY  1302
              QVAEI +Q GE+L+K S A+F TQS+VLTRRS +NMFRDLGYYW+R   Y+ +A+GLG 
Sbjct  335   NQVAEICQQGGEILEKRSHANFTTQSLVLTRRSSVNMFRDLGYYWMRFATYVGIALGLGS  394

Query  1303  MYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFAI  1482
             +Y D+G    SI+ R  ++AF+ SF TFM +GGFPSFVEDMKVF++E LNGHYGC  F I
Sbjct  395   IYYDLGSNYHSIEERGLMVAFVVSFMTFMTVGGFPSFVEDMKVFQRENLNGHYGCCTFVI  454

Query  1483  ANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLVP  1662
              NTLSS+PY+LLIS +PG IAY   G Q   GHF YFALV+  +M++VESLMM +A++VP
Sbjct  455   GNTLSSIPYVLLISFVPGAIAYLLSGFQNGSGHFIYFALVLFTSMMIVESLMMNVAAIVP  514

Query  1663  NYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGLR  1842
             N+LMGI+ GAG+Q L IL GGYF+LP +LP   W+YP+YY+ FHKYAYQG++KNEF+GL+
Sbjct  515   NFLMGIVIGAGIQGLQILSGGYFQLPSELPNPIWKYPLYYMSFHKYAYQGMFKNEFEGLK  574

Query  1843  LPEE---TGQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAKH  2013
               ++     + ++GE++LRE  QVEM +SKW+DL +LV   ++ R+VFLL++K +EK  H
Sbjct  575   FTDDQFGNNRTMSGEDILRERWQVEMAYSKWVDLAILVGTLILYRLVFLLIIKTNEKVVH  634

Query  2014  VVKAVMRVSPKQSHQVVA  2067
               KA   V   +S Q++A
Sbjct  635   ARKASTSVLSNRSSQIMA  652



>ref|XP_007047882.1| White-brown complex protein 11 isoform 1 [Theobroma cacao]
 ref|XP_007047883.1| White-brown complex protein 11 isoform 1 [Theobroma cacao]
 gb|EOX92039.1| White-brown complex protein 11 isoform 1 [Theobroma cacao]
 gb|EOX92040.1| White-brown complex protein 11 isoform 1 [Theobroma cacao]
Length=715

 Score =   750 bits (1936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/672 (63%), Positives = 508/672 (76%), Gaps = 38/672 (6%)
 Frame = +1

Query  70    DSRIRQCDSNRINIVPLDMETAGGVSSMPKDKRPgggaeaakvdvgggggvFLTWEDLWV  249
             DS I    S RI + P+D  T G                          G+FLTW DL V
Sbjct  66    DSGIHGVPSLRIEMEPVDCTTQG-------------------------DGIFLTWTDLLV  100

Query  250   TVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTRQSGDILIN  429
             TVS G+KG +AIL+GLTGYA+PGE+LAIMGPSGCGKSTLLDALAGRL   TRQ G+ILIN
Sbjct  101   TVSGGKKGPRAILQGLTGYAQPGEVLAIMGPSGCGKSTLLDALAGRLSSNTRQIGEILIN  160

Query  430   GRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAEMTIKEMGL  609
             GR +TLA+GTSAYVTQ+DTL  TLTVREA+YYSAQLQLP S+ +SEKKE AEMTI+EMGL
Sbjct  161   GRKETLAFGTSAYVTQDDTLMTTLTVREAIYYSAQLQLPDSMSKSEKKERAEMTIREMGL  220

Query  610   QDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAASFYVMSKIM  789
             QD+M+TRIGG        G QKRRVSIC+EILTRPKLLFLDEP+SGLDSAAS++VMS+I+
Sbjct  221   QDSMDTRIGGWSTKGLSGG-QKRRVSICIEILTRPKLLFLDEPTSGLDSAASYHVMSRIV  279

Query  790   DLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNGFPCPTLQ  966
              LA  +GRTV+ASIHQPS+EVF LF  LCLLSSG+ VYFGP S A QFF TNGFPCP L+
Sbjct  280   KLARRDGRTVIASIHQPSSEVFQLFHDLCLLSSGKTVYFGPISMAEQFFATNGFPCPVLR  339

Query  967   NPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREVQGQVAEISK  1146
             NPSDH+L+TINKDFD   ED+EQG    I TE+VI+ LV SYKS   +++V+  V +IS+
Sbjct  340   NPSDHYLRTINKDFD---EDIEQGKG-SINTEKVIDTLVKSYKSSEIWKQVEQHVLKISQ  395

Query  1147  QEGEVL-KKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLGYMYNDVGY  1323
               G  L KK S+A F TQSIVLT+RSF+NM+RDLGYYWLRL IYI L + +G ++ D+G 
Sbjct  396   NRGGPLEKKGSQASFITQSIVLTKRSFVNMYRDLGYYWLRLAIYIALCLCVGTIFFDIGL  455

Query  1324  GNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFAIANTlssl  1503
                SIQAR S+L F+A+F TFMAIGGFPSFVEDMK+F +E LNGHYG GAF I NTLSS+
Sbjct  456   TFGSIQARGSMLMFVAAFLTFMAIGGFPSFVEDMKIFGRERLNGHYGVGAFVIGNTLSSV  515

Query  1504  pylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLVPNYLMGII  1683
             PYL LISLIPG +AY+ VGLQ+ F HFAYF +++   M+LVESLMM +AS+VP++LMGII
Sbjct  516   PYLFLISLIPGALAYYLVGLQKSFEHFAYFVILLFTCMMLVESLMMTVASIVPDFLMGII  575

Query  1684  AGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGLRLPEETG-  1860
              GAG+Q +M+L GG+FRLP DLPK FWRYP+YYI FHKYA QG YKNEFQGL  P     
Sbjct  576   TGAGIQGVMMLNGGFFRLPDDLPKPFWRYPMYYIAFHKYANQGFYKNEFQGLTFPNNQAG  635

Query  1861  --QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAKHVVKAVM-  2031
                 ITG+E+LR   QVEMG+SKWID+ +L  M V+ R++F  ++K  EK K ++KA M 
Sbjct  636   GPPTITGDEILRNFWQVEMGYSKWIDIAILFGMVVIYRLIFWGIIKTVEKVKPLIKAYMA  695

Query  2032  --RVSPKQSHQV  2061
                V+P QS Q+
Sbjct  696   GKSVAPTQSSQI  707



>ref|XP_007047885.1| White-brown complex protein 11 isoform 4 [Theobroma cacao]
 gb|EOX92042.1| White-brown complex protein 11 isoform 4 [Theobroma cacao]
Length=715

 Score =   749 bits (1935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/672 (63%), Positives = 508/672 (76%), Gaps = 38/672 (6%)
 Frame = +1

Query  70    DSRIRQCDSNRINIVPLDMETAGGVSSMPKDKRPgggaeaakvdvgggggvFLTWEDLWV  249
             DS I    S RI + P+D  T G                          G+FLTW DL V
Sbjct  66    DSGIHGVPSLRIEMEPVDCTTQG-------------------------DGIFLTWTDLLV  100

Query  250   TVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTRQSGDILIN  429
             TVS G+KG +AIL+GLTGYA+PGE+LAIMGPSGCGKSTLLDALAGRL   TRQ G+ILIN
Sbjct  101   TVSGGKKGPRAILQGLTGYAQPGEVLAIMGPSGCGKSTLLDALAGRLSSNTRQIGEILIN  160

Query  430   GRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAEMTIKEMGL  609
             GR +TLA+GTSAYVTQ+DTL  TLTVREA+YYSAQLQLP S+ +SEKKE AEMTI+EMGL
Sbjct  161   GRKETLAFGTSAYVTQDDTLMTTLTVREAIYYSAQLQLPDSMSKSEKKERAEMTIREMGL  220

Query  610   QDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAASFYVMSKIM  789
             QD+M+TRIGG        G QKRRVSIC+EILTRPKLLFLDEP+SGLDSAAS++VMS+I+
Sbjct  221   QDSMDTRIGGWSTKGLSGG-QKRRVSICIEILTRPKLLFLDEPTSGLDSAASYHVMSRIV  279

Query  790   DLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNGFPCPTLQ  966
              LA  +GRTV+ASIHQPS+EVF LF  LCLLSSG+ VYFGP S A QFF TNGFPCP L+
Sbjct  280   KLARRDGRTVIASIHQPSSEVFQLFHDLCLLSSGKTVYFGPISMAEQFFATNGFPCPVLR  339

Query  967   NPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREVQGQVAEISK  1146
             NPSDH+L+TINKDFD   ED+EQG    I TE+VI+ LV SYKS   +++V+  V +IS+
Sbjct  340   NPSDHYLRTINKDFD---EDIEQGKG-SINTEKVIDTLVKSYKSSEIWKQVEQHVLKISQ  395

Query  1147  QEGEVL-KKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLGYMYNDVGY  1323
               G  L KK S+A F TQSIVLT+RSF+NM+RDLGYYWLRL IYI L + +G ++ D+G 
Sbjct  396   NRGGPLEKKGSQASFITQSIVLTKRSFVNMYRDLGYYWLRLAIYIALCLCVGTIFFDIGL  455

Query  1324  GNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFAIANTlssl  1503
                SIQAR S+L F+A+F TFMAIGGFPSFVEDMK+F +E LNGHYG GAF I NTLSS+
Sbjct  456   TFGSIQARGSMLMFVAAFLTFMAIGGFPSFVEDMKIFGRERLNGHYGVGAFVIGNTLSSV  515

Query  1504  pylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLVPNYLMGII  1683
             PYL LISLIPG +AY+ VGLQ+ F HFAYF +++   M+LVESLMM +AS+VP++LMGII
Sbjct  516   PYLFLISLIPGALAYYLVGLQKSFEHFAYFVILLFTCMMLVESLMMTVASIVPDFLMGII  575

Query  1684  AGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGLRLPEETG-  1860
              GAG+Q +M+L GG+FRLP DLPK FWRYP+YYI FHKYA QG YKNEFQGL  P     
Sbjct  576   TGAGIQGVMMLNGGFFRLPDDLPKPFWRYPMYYIAFHKYANQGFYKNEFQGLTFPNNQAG  635

Query  1861  --QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAKHVVKAVM-  2031
                 ITG+E+LR   QVEMG+SKWID+ +L  M V+ R++F  ++K  EK K ++KA M 
Sbjct  636   GPPTITGDEILRNFWQVEMGYSKWIDIAILFGMVVIYRLIFWGIIKTVEKVKPLIKAYMA  695

Query  2032  --RVSPKQSHQV  2061
                V+P QS Q+
Sbjct  696   GKSVAPTQSSQI  707



>ref|XP_003635438.1| PREDICTED: ABC transporter G family member 11-like [Vitis vinifera]
Length=741

 Score =   748 bits (1931),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/619 (65%), Positives = 493/619 (80%), Gaps = 9/619 (1%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             FLTW+DLWVTVSD   G +AIL+GL GYA+PGE+LAIMGPSGCGKSTLLDALAGRL   T
Sbjct  113   FLTWKDLWVTVSDDESGRRAILQGLAGYAQPGEVLAIMGPSGCGKSTLLDALAGRLASNT  172

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             RQSG+IL+NG  Q LA+GTSAYVTQ+DTL  TLTVREAVYYSAQLQLP S+ RSEKKE A
Sbjct  173   RQSGEILVNGSKQRLAFGTSAYVTQDDTLMTTLTVREAVYYSAQLQLPDSMSRSEKKERA  232

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             EMTI+EMGLQDAMNTRIGG        G QKRRVSIC+EILTRP+LLFLDEP+SGLDSAA
Sbjct  233   EMTIREMGLQDAMNTRIGGWSVKGLSGG-QKRRVSICIEILTRPRLLFLDEPTSGLDSAA  291

Query  763   SFYVMSKIMDLA-SEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             S++VMS+I+ LA  +G TV+ASIHQPS+EVF +F +LCLLSSG+ VYFG AS A +FF++
Sbjct  292   SYHVMSRIVKLARHDGITVIASIHQPSSEVFEVFHNLCLLSSGKTVYFGSASMAKEFFDS  351

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREV  1119
             NGFPCP L+NPSDH+L+TINKDFD+D    EQG      TEE IN L+ SYKS    ++V
Sbjct  352   NGFPCPALRNPSDHYLRTINKDFDSD---TEQGHGGTTNTEEAINTLIKSYKSSEICQQV  408

Query  1120  QGQVAEISKQEGEVL-KKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGL  1296
             Q +V EI + +G +L KK S+A F TQ +VLTRRS +NM+RDLGYYWLRL IYI L + +
Sbjct  409   QCRVYEICQLKGGLLEKKGSQASFITQCLVLTRRSSVNMYRDLGYYWLRLAIYIALCLCV  468

Query  1297  GYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAF  1476
             G ++ D+G+   SIQAR S+L F+A+F TFMAIGGFPSFVEDMK+F +E LNGHYG GAF
Sbjct  469   GTIFYDIGFSYGSIQARGSMLMFVAAFLTFMAIGGFPSFVEDMKIFGRERLNGHYGVGAF  528

Query  1477  AIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASL  1656
              + NT SS+PYLL+ISLIPG+IAY+ VGL + F HF YFAL++ + M+LVESLMMI+AS+
Sbjct  529   VVGNTFSSIPYLLMISLIPGVIAYYLVGLHKGFEHFVYFALMLFVCMMLVESLMMIVASI  588

Query  1657  VPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQG  1836
             VP++LMGII GAG+Q +M+L GG+FRLP DLPK FWRYP+YYI FHKYA QG YKNEFQG
Sbjct  589   VPDFLMGIITGAGIQGVMMLNGGFFRLPNDLPKPFWRYPMYYIAFHKYANQGFYKNEFQG  648

Query  1837  LRLPEETG---QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKA  2007
             L  P         ITGEE+L+   QVE G+SKW+D+ +L  M V+ R++FL ++K  EK 
Sbjct  649   LTFPNNQAGGPPTITGEEILQNVWQVETGYSKWVDVAILFGMVVLYRLLFLGIIKTVEKV  708

Query  2008  KHVVKAVMRVSPKQSHQVV  2064
             K ++K +M  SP++S Q++
Sbjct  709   KPMIKGLMVASPEKSKQII  727



>ref|XP_002300189.2| hypothetical protein POPTR_0001s31880g [Populus trichocarpa]
 gb|EEE84994.2| hypothetical protein POPTR_0001s31880g [Populus trichocarpa]
Length=691

 Score =   746 bits (1926),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/620 (65%), Positives = 489/620 (79%), Gaps = 10/620 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             FLTWEDLWVTVS+G+KG+K+IL+GLTGYA+PGELLAIMGPSGCGKSTLLD LAGRL   T
Sbjct  61    FLTWEDLWVTVSNGKKGSKSILQGLTGYAQPGELLAIMGPSGCGKSTLLDTLAGRLGSNT  120

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             RQ+GDILING  Q LAYGTSAYVTQ++TL  TLTV+EAVYYSAQLQLP S+ R+EKKE A
Sbjct  121   RQTGDILINGHKQRLAYGTSAYVTQDETLITTLTVKEAVYYSAQLQLPDSMSRAEKKERA  180

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             E+TI+EMGLQDAMNTRIGG        G QKRRVSIC+EILT PKLLFLDEP+SGLDSAA
Sbjct  181   EVTIREMGLQDAMNTRIGGWGSKGLSGG-QKRRVSICIEILTHPKLLFLDEPTSGLDSAA  239

Query  763   SFYVMSKIM--DLASEGR-TVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFF  933
             S+YVMS+I+  D   E R TV+ASIHQPS EVF LF SLCLLS+G+VVYFGPAS A +FF
Sbjct  240   SYYVMSRIVRFDRKDENRRTVIASIHQPSGEVFQLFDSLCLLSAGKVVYFGPASQANEFF  299

Query  934   ETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYR  1113
               NGFPCPTLQNPSDHFLKTINKDF+ D E   QG    I  E  IN L  +YKS   Y+
Sbjct  300   ALNGFPCPTLQNPSDHFLKTINKDFETDPE---QGLEDAITAEVAINTLTKAYKSSDHYQ  356

Query  1114  EVQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             +V+  V EI +++   L++ S + F TQ +VLTRRSF+NM+RDLGYYWLR+ IY+ LA+G
Sbjct  357   QVKRLVTEICEKDCGTLEERSHSSFLTQCLVLTRRSFVNMYRDLGYYWLRVAIYVALALG  416

Query  1294  LGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGA  1473
             L  ++ ++G  N SIQ R S+L FIASF TFM IGGFPSFVEDMKVF++E LNGHYG  A
Sbjct  417   LATLFYNLGSDNDSIQDRGSLLMFIASFLTFMTIGGFPSFVEDMKVFERERLNGHYGATA  476

Query  1474  FAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIAS  1653
             F   NT S+ PYLLLIS+IPG I Y+  GL + + HF YF LV+   M+LVESLMM +AS
Sbjct  477   FVFGNTFSAFPYLLLISVIPGAITYYLPGLHKGYEHFIYFVLVLFACMMLVESLMMTVAS  536

Query  1654  LVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQ  1833
             +VPN+LMGII GAG+QA M+LGGG+FRLP DLP+ FW+YP+YYI FHKYAYQG++KNEF+
Sbjct  537   VVPNFLMGIITGAGIQAFMVLGGGFFRLPNDLPQPFWKYPMYYIAFHKYAYQGMFKNEFE  596

Query  1834  GLRLPEETG---QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEK  2004
             GL  P       + I GE++LR+  QVEMG SKW+DL +L+ M V+ R++FL+++K +EK
Sbjct  597   GLTFPSNQAGGPRTIPGEQILRDRWQVEMGVSKWVDLAILLGMVVLYRILFLVIIKTTEK  656

Query  2005  AKHVVKAVMRVSPKQSHQVV  2064
              K ++ A++ V PKQ+ Q++
Sbjct  657   IKPIITAIVSVRPKQTTQIM  676



>gb|KDP40917.1| hypothetical protein JCGZ_24916 [Jatropha curcas]
Length=662

 Score =   744 bits (1921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/622 (65%), Positives = 490/622 (79%), Gaps = 13/622 (2%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTWEDLWVTVS G+K +KAIL+G+TG A+PG+LLAIMGPSGCGKSTLLDALAGRL  +T+
Sbjct  32    LTWEDLWVTVSCGKKSSKAILQGVTGCAQPGQLLAIMGPSGCGKSTLLDALAGRLSSSTK  91

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             Q+GDILING  + LAYGTSAYVTQ+DTL  TLTV+EAVYYSAQLQLP S+ + EKKE AE
Sbjct  92    QTGDILINGHKERLAYGTSAYVTQDDTLITTLTVKEAVYYSAQLQLPDSMSKKEKKERAE  151

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI+EMGLQD++NTRIGG        G QKRRVSIC+EILT PKLLFLDEP+SGLDSAAS
Sbjct  152   RTIREMGLQDSVNTRIGGWGAKGLSGG-QKRRVSICIEILTHPKLLFLDEPTSGLDSAAS  210

Query  766   FYVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFE  936
             +YVMS+I  L  +    RT++ASIHQPSTEVF LF +LCLLSSG+VVYFGPASAA QFF 
Sbjct  211   YYVMSRIATLEQKDGIRRTIIASIHQPSTEVFELFNTLCLLSSGKVVYFGPASAANQFFA  270

Query  937   TNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYRE  1116
              NGFPCPTL+NPSDHFLKTINKDF+ D E+   G    + TEE I IL  SYKS +  +E
Sbjct  271   LNGFPCPTLRNPSDHFLKTINKDFEKDPEE---GLGGAMTTEEAITILTKSYKSSNNCQE  327

Query  1117  VQGQVAEISKQE---GEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLA  1287
             V+ QVAEI K +   G + KK  RA FF Q +VLT+RS +NMFRDLGYYWLRL IYI LA
Sbjct  328   VRRQVAEICKHKQDFGALEKKRQRASFFIQCVVLTKRSSINMFRDLGYYWLRLAIYIALA  387

Query  1288  VGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGC  1467
             +GL  +++ +G+  +SI+ RCS+LAFIASF TFM IGGFPSFVEDMKVF++ETLNGHYG 
Sbjct  388   IGLATLFSHLGFSYNSIKDRCSLLAFIASFLTFMTIGGFPSFVEDMKVFQRETLNGHYGT  447

Query  1468  GAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMII  1647
              AF + NT S +PYL+LISLIPG + Y+  GLQR   HF +F L IL  ++LVESLMMI+
Sbjct  448   IAFVVGNTFSGIPYLVLISLIPGAVTYYLPGLQRGIEHFIFFILAILACLMLVESLMMIV  507

Query  1648  ASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNE  1827
             A LVPN+LMGII GAGLQ LM+L GG+FRLP DLP  FW+YP+YYI FH+YAYQGL+KNE
Sbjct  508   AGLVPNFLMGIITGAGLQGLMMLAGGFFRLPNDLPIPFWKYPMYYIAFHRYAYQGLFKNE  567

Query  1828  FQGLRLPEETG---QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKAS  1998
             F+GL+         ++I+GEE+LR+  QVE+ +SKW+DL +L  M V+ RV+FL+++K  
Sbjct  568   FEGLKFANYISGGPKMISGEEILRDDWQVELSYSKWVDLAILFGMVVLYRVLFLVIIKIK  627

Query  1999  EKAKHVVKAVMRVSPKQSHQVV  2064
             EK K ++   M V PKQ+ QV+
Sbjct  628   EKVKPLISDFMSVPPKQTIQVM  649



>ref|XP_002531674.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF30718.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=712

 Score =   744 bits (1921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/652 (64%), Positives = 502/652 (77%), Gaps = 19/652 (3%)
 Frame = +1

Query  88    CDSNRINIVPLDMETAGGVSSMPKDKRPgggaeaakvdvgggggvFLTWEDLWVTVSDGR  267
             CD    ++  ++ME AGG +   KD+             G   G+FLTW+DLWVTV DGR
Sbjct  66    CDDRPPSLRSMEMEPAGGDNKQCKDE--------GLTSKGNSNGIFLTWKDLWVTVPDGR  117

Query  268   KGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTRQSGDILINGRTQTL  447
              G + IL+GLTGYA PG +LAIMGPSGCGKSTLLDALAGRL   T+Q+G+ILINGR +TL
Sbjct  118   NGRRPILQGLTGYAEPGMVLAIMGPSGCGKSTLLDALAGRLSSNTQQAGEILINGRKETL  177

Query  448   AYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAEMTIKEMGLQDAMNT  627
             A+GTSAYVTQ+DTL  TLTV EAVYYSAQLQLP S+ RSEKKE AE TI+EMGLQD++NT
Sbjct  178   AFGTSAYVTQDDTLMTTLTVVEAVYYSAQLQLPDSMSRSEKKERAEETIREMGLQDSVNT  237

Query  628   RigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAASFYVMSKIMDLASEG  807
             RIGG        G QKRRVSIC+EILTRPKLLFLDEP+SGLDSAAS++VM++I+ LA + 
Sbjct  238   RIGGWSTKGLSGG-QKRRVSICIEILTRPKLLFLDEPTSGLDSAASYHVMNRIVKLAKQD  296

Query  808   -RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNGFPCPTLQNPSDHF  984
              RTVVASIHQPS+EVF LF +LCLLSSGR VYFGP S A QFF +NGFPCPTL+NPSDH+
Sbjct  297   QRTVVASIHQPSSEVFELFQNLCLLSSGRTVYFGPVSKAEQFFSSNGFPCPTLRNPSDHY  356

Query  985   LKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREVQGQVAEI--SKQEGE  1158
             L+TINKDFD    D+EQG   G  TEE INILV SY+S    + VQ QVA+I   K+ G 
Sbjct  357   LRTINKDFD---VDIEQGLG-GCTTEEAINILVKSYQSSEISQHVQKQVADIIHEKKGGS  412

Query  1159  VLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLGYMYNDVGYGNSSI  1338
             + K+ S+A F TQ +VLT+RSF+NM+RDLGYYWLRL IYI L + +G +++D+G+   SI
Sbjct  413   LEKRGSQASFITQCVVLTKRSFVNMYRDLGYYWLRLAIYIALCLCVGTIFHDIGFTFGSI  472

Query  1339  QARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFAIANTlsslpylll  1518
             QAR S+L F+A+F TFMAIGGFPSFVEDMK+F  E LNGHYG GAF + NT SS+PYLL+
Sbjct  473   QARGSMLMFVAAFLTFMAIGGFPSFVEDMKIFGGERLNGHYGVGAFVVGNTFSSIPYLLM  532

Query  1519  islipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLVPNYLMGIIAGAGL  1698
             +SLIPG IAY+ VGLQ+ F HF YFALV+ + M+LVESLMMI+ASLVP++LMGII GAG+
Sbjct  533   VSLIPGAIAYYLVGLQKGFEHFVYFALVLFVTMMLVESLMMIVASLVPDFLMGIITGAGI  592

Query  1699  QALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGLRLPEETG---QII  1869
             Q +M+L GG+FRLP DLP  FWRYP+YYI FHKYA QG YKNEF+GL  P         I
Sbjct  593   QGVMMLNGGFFRLPDDLPDPFWRYPMYYIAFHKYANQGFYKNEFEGLTFPNNQAGGPPTI  652

Query  1870  TGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAKHVVKA  2025
             TGEE+L    QVEMG+SKW+DL VL  M V+ R++FL ++K  EK K ++K+
Sbjct  653   TGEEILTGFWQVEMGYSKWVDLAVLFGMVVLYRLMFLGIIKVVEKVKPIIKS  704



>ref|XP_006351854.1| PREDICTED: ABC transporter G family member 11-like [Solanum tuberosum]
Length=647

 Score =   741 bits (1914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/616 (65%), Positives = 493/616 (80%), Gaps = 6/616 (1%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             FLTW DL V+VS  R G+K I++G+TGYARP ELLA+MGPSG GKSTLLDALAGRL+ +T
Sbjct  20    FLTWNDLCVSVSISRIGSKNIIEGVTGYARPSELLAVMGPSGSGKSTLLDALAGRLDFST  79

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             RQSGDILING  Q L+YGTSAYVTQ++TL ATLTV+EAVYYSAQLQLP S+ +SEK +IA
Sbjct  80    RQSGDILINGHKQKLSYGTSAYVTQDETLIATLTVKEAVYYSAQLQLPDSMLKSEKIQIA  139

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             E TIK+MGLQDAMNTRIGG        G +KRR+SIC+EILTRPKLLFLDEP+SGLDSAA
Sbjct  140   EQTIKDMGLQDAMNTRIGGFGNKGISGG-EKRRLSICIEILTRPKLLFLDEPTSGLDSAA  198

Query  763   SFYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETN  942
             S+YVMS I      GRT++ASIHQPS EVFSLF SLC+LSSGR VYFGPA+ AI+FF TN
Sbjct  199   SYYVMSGI-SRQRGGRTIIASIHQPSAEVFSLFHSLCILSSGRTVYFGPANVAIEFFRTN  257

Query  943   GFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREVQ  1122
             GFPCP LQNPSDHFLKTINKDFD   ED+E G A  +PTEEV + L+NSYKS   Y +VQ
Sbjct  258   GFPCPLLQNPSDHFLKTINKDFD---EDIEHGLAGRMPTEEVTDFLINSYKSSEEYHKVQ  314

Query  1123  GQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLGY  1302
              QVAEI +Q GE+L+K S A+F TQS+VLTRRS +NMFRDLGYYW+R   Y+ LA+GLG 
Sbjct  315   NQVAEICQQGGEILEKRSHANFITQSLVLTRRSSVNMFRDLGYYWMRSVSYVILALGLGT  374

Query  1303  MYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFAI  1482
             +Y +V     SI+ R  ++AF+ SF TFM +GGFPSFVEDMKVF++E LNGHYG  AF I
Sbjct  375   IYYNVDLSYRSIEERGLMVAFVVSFMTFMTVGGFPSFVEDMKVFQRENLNGHYGSSAFVI  434

Query  1483  ANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLVP  1662
              NT+SS+PYLLLISL+PG IAYF  G Q  F HF YFALV+ ++M++VESLM  +A++VP
Sbjct  435   GNTVSSMPYLLLISLVPGSIAYFLTGFQPGFEHFIYFALVLFISMMIVESLMTNVAAIVP  494

Query  1663  NYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGLR  1842
             N+LMGI+ GAG+Q LMIL GG+F++P +LPK+ W+YP+YYI FH+YAYQG++KNEF+GL 
Sbjct  495   NFLMGIVVGAGIQGLMILSGGFFQIPNELPKIIWKYPLYYISFHRYAYQGMFKNEFEGLF  554

Query  1843  LPEETGQI-ITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAKHVV  2019
               +    + I+GE+VLRE  QVEMG+SKW+DL++LVV+ ++ R+VF L+VK +EK  H  
Sbjct  555   FTDNGINVTISGEDVLREKWQVEMGYSKWVDLVILVVILILYRMVFFLIVKTNEKFVHAR  614

Query  2020  KAVMRVSPKQSHQVVA  2067
             K    V  K+S Q++A
Sbjct  615   KTSTSVLSKKSRQIMA  630



>ref|XP_008381985.1| PREDICTED: ABC transporter G family member 11-like [Malus domestica]
Length=740

 Score =   744 bits (1921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/616 (65%), Positives = 493/616 (80%), Gaps = 8/616 (1%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW+DLWV V+DG+ G + IL+ +TGYA+PGE+LAIMGPSG GKSTLLDALAGRL   T+
Sbjct  119   LTWKDLWVGVADGKNGQRMILQEVTGYAQPGEMLAIMGPSGSGKSTLLDALAGRLSSNTQ  178

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             Q+G+ILINGR +TLA+GTSAYVTQ+DTL  TLTVREAVYYSAQLQLP S+ ++EKKE AE
Sbjct  179   QTGEILINGRKETLAFGTSAYVTQDDTLMTTLTVREAVYYSAQLQLPDSMSQAEKKERAE  238

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
             MTI+EMGLQD+M+TRIGG        G QKRRVSIC+EILTRPKLLFLDEP+SGLDSAAS
Sbjct  239   MTIREMGLQDSMDTRIGGWSIKGLSGG-QKRRVSICIEILTRPKLLFLDEPTSGLDSAAS  297

Query  766   FYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETN  942
             ++VM++I+ LA  +GRTV+ASIHQPS+EVF LF +LCLLSS R VYFG AS A QFF +N
Sbjct  298   YHVMNRIVKLAHRDGRTVIASIHQPSSEVFDLFQNLCLLSSSRTVYFGLASMAEQFFASN  357

Query  943   GFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREVQ  1122
             GFPCPTL+NPSDH+L+TINKDFD    D+EQG      TEE INIL+ SYK  +  ++VQ
Sbjct  358   GFPCPTLRNPSDHYLRTINKDFD---VDIEQGLGGKTSTEEAINILIQSYKYSNINKQVQ  414

Query  1123  GQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLGY  1302
              QVA IS+Q+G  L+K S+A F  Q +VLTRRSF+NM+RDLGYYWLRL IYI L + +G 
Sbjct  415   LQVASISQQKGGTLEKGSQASFVXQCLVLTRRSFVNMYRDLGYYWLRLAIYIALCLCVGT  474

Query  1303  MYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFAI  1482
             ++ D+G    SIQAR S+L F+ +F TFMAIGGFPSFVEDMK+F +E LNGHYG  AF +
Sbjct  475   IFYDIGSTFGSIQARGSMLMFVGAFLTFMAIGGFPSFVEDMKIFGRERLNGHYGVSAFVV  534

Query  1483  ANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLVP  1662
              NT SS+PYLL+ISLIPG IAY+ VGLQ+ F HFAYFAL++ + M+LVESLMMI+AS+VP
Sbjct  535   GNTFSSIPYLLIISLIPGAIAYYLVGLQKSFDHFAYFALLLFVTMMLVESLMMIVASVVP  594

Query  1663  NYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGLR  1842
             ++LMGII GAG+Q +M+L GG+FRLP DLPK FWRYP+YYI FHKYA +G YKNEF+GL 
Sbjct  595   DFLMGIITGAGIQGVMMLNGGFFRLPNDLPKPFWRYPMYYIAFHKYANEGFYKNEFEGLT  654

Query  1843  LPEETGQ---IITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAKH  2013
              P    +    I GEE+LR   QV+MG+SKW+DL +L  M +V R++FL ++K +EK   
Sbjct  655   FPNNQAEGYSTINGEEILRSVWQVQMGYSKWVDLAILFGMVIVYRLMFLGIIKFTEKVVP  714

Query  2014  VVKAVMRVSPKQSHQV  2061
             ++KA++  +PK S Q+
Sbjct  715   IIKALIVATPKHSKQI  730



>ref|XP_011003862.1| PREDICTED: ABC transporter G family member 11-like [Populus euphratica]
Length=691

 Score =   741 bits (1913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/620 (65%), Positives = 489/620 (79%), Gaps = 10/620 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             FLTWEDLWVTVS G+KG+K+IL+GLTGYA+PGELLAIMGPSGCGKSTLLD LAGRL   T
Sbjct  61    FLTWEDLWVTVSIGKKGSKSILQGLTGYAQPGELLAIMGPSGCGKSTLLDTLAGRLGSNT  120

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             RQ+GDILING  Q LAYGTSAYVTQ++TL  TLTV+EAVYYSAQLQLP S+ R+EKKE A
Sbjct  121   RQTGDILINGHKQRLAYGTSAYVTQDETLITTLTVKEAVYYSAQLQLPDSMSRAEKKERA  180

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             E+TI+EMGLQDAMNTRIGG        G QKRRVSIC+EILT PKLLFLDEP+SGLDSAA
Sbjct  181   EVTIREMGLQDAMNTRIGGWGSKGLSGG-QKRRVSICIEILTHPKLLFLDEPTSGLDSAA  239

Query  763   SFYVMSKIM--DLASEGR-TVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFF  933
             S++VMS+I+  D   E R TV+ASIHQPS EVF LF SLCLLS+G+VVYFGPAS A +FF
Sbjct  240   SYHVMSRIVRFDRKDENRRTVIASIHQPSGEVFQLFDSLCLLSAGKVVYFGPASQANEFF  299

Query  934   ETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYR  1113
               NGFPCPTLQNPSDHFLKTINKDF+   E   QG    I  E  IN L  +YKS   Y+
Sbjct  300   ALNGFPCPTLQNPSDHFLKTINKDFETVPE---QGLEDAITAEVAINTLTKAYKSSDHYQ  356

Query  1114  EVQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             +V+  V EI +++   L++ S ++F TQ +VLTRRSF+NM+RDLGYYWLR+ IY++LA+G
Sbjct  357   QVKRLVTEICEKDCGTLEERSHSNFLTQCLVLTRRSFVNMYRDLGYYWLRVAIYVSLALG  416

Query  1294  LGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGA  1473
             L  ++ ++G  N SIQ R S+L FIASF TFM IGGFPSFVEDMKVF++E LNGHYG  A
Sbjct  417   LATLFYNLGSDNDSIQDRGSLLMFIASFLTFMTIGGFPSFVEDMKVFERERLNGHYGATA  476

Query  1474  FAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIAS  1653
             F   NT S+ PYLLLIS+IPG I Y+  GL + + HF YF LV+   M+LVESLMM +AS
Sbjct  477   FVFGNTFSAFPYLLLISVIPGAITYYLPGLHKGYEHFIYFILVLFACMMLVESLMMTVAS  536

Query  1654  LVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQ  1833
             +VPN+LMGII GAG+QA M+LGGG+FRLP DLP+ FW+YP+YYI FHKYAYQGL+KNEF+
Sbjct  537   MVPNFLMGIITGAGIQAFMVLGGGFFRLPNDLPQPFWKYPMYYIAFHKYAYQGLFKNEFE  596

Query  1834  GLRLPEETG---QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEK  2004
             GL  P       + I GE++LR+  QVEMG SKW+DL +L+ M V+ R++FL+++K +EK
Sbjct  597   GLTFPSNQAGEPRTIPGEQILRDRWQVEMGVSKWVDLAILLGMVVLYRILFLVIIKTTEK  656

Query  2005  AKHVVKAVMRVSPKQSHQVV  2064
              K ++ A++ V PKQ+ Q++
Sbjct  657   IKPIITAIVSVPPKQTTQIM  676



>ref|XP_009611610.1| PREDICTED: ABC transporter G family member 11-like isoform X1 
[Nicotiana tomentosiformis]
Length=662

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/620 (65%), Positives = 491/620 (79%), Gaps = 9/620 (1%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGN-KAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELT  399
             FLTW DLWVTVS+ + G+ K +L+GLTGYARP ELLAIMGPSGCGKSTLLDALAGRL+ +
Sbjct  25    FLTWNDLWVTVSNRKSGSCKNLLEGLTGYARPSELLAIMGPSGCGKSTLLDALAGRLDFS  84

Query  400   TRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEI  579
             TRQSGDILING  Q L+YGTSAYVTQ++TL ATLTV+EAVYYSAQLQLP S+ +SEK +I
Sbjct  85    TRQSGDILINGHKQELSYGTSAYVTQDETLLATLTVKEAVYYSAQLQLPDSMTKSEKIQI  144

Query  580   AEMTIKEMGLQDAMNTRigg-gwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDS  756
             AE TIKEMGLQDAMNTRIGG G   KGISGG+KRR+SIC+EILTRPKLLFLDEP+SGLDS
Sbjct  145   AEQTIKEMGLQDAMNTRIGGWGTKGKGISGGEKRRLSICMEILTRPKLLFLDEPTSGLDS  204

Query  757   AASFYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFE  936
             AAS+YVM+ I      GRT++ SIHQPS EVF+LF +LCL+SSGR VYFGPASAAI+ F 
Sbjct  205   AASYYVMNGI-SRQRLGRTIITSIHQPSAEVFNLFHNLCLMSSGRTVYFGPASAAIELFG  263

Query  937   TNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYRE  1116
             TNGFPCPTLQNPSDHFLKTINKDF    ED+E G A   PTEEV+++L+NSYKS   Y +
Sbjct  264   TNGFPCPTLQNPSDHFLKTINKDFY---EDIEHGLAGRKPTEEVVDLLINSYKSSEGYHK  320

Query  1117  VQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGL  1296
             +Q QV EI +Q GE+L+K S A+F TQS+VLTRRS +NMFRDLGYYW+R   Y+ +A+GL
Sbjct  321   IQNQVLEICQQGGEILEKRSHANFTTQSLVLTRRSSVNMFRDLGYYWMRFASYVVIALGL  380

Query  1297  GYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAF  1476
             G +Y +V     SI  R  ++AF+ SF TFM +GGFPSFVEDMKVF++E LNGHYGC AF
Sbjct  381   GSIYYNVDSSYGSIVERGLMVAFVVSFMTFMTVGGFPSFVEDMKVFQRENLNGHYGCCAF  440

Query  1477  AIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASL  1656
              I NTLSS+PYLLLISL+PG IAYF  G Q  FGHF YFALV+  +M++VESLM  +A++
Sbjct  441   VIGNTLSSMPYLLLISLVPGAIAYFLTGFQNGFGHFIYFALVLFTSMMIVESLMANVAAI  500

Query  1657  VPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQG  1836
             VPN+LMGI+ GAG+Q L IL GG+F+ P +LPK  W+YP+YY+ FHKYAYQG++KNEF G
Sbjct  501   VPNFLMGIVIGAGIQGLQILSGGFFQTPNELPKPIWKYPLYYLSFHKYAYQGMFKNEFDG  560

Query  1837  LRLPEE---TGQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKA  2007
             L   +        I+GE+VLR+  QVEM +SKWIDL +LV   +V R+VF L++K +EK 
Sbjct  561   LTFTDNLNGNNHTISGEDVLRDKWQVEMAYSKWIDLSILVGTLIVYRLVFFLIIKTNEKV  620

Query  2008  KHVVKAVMRVSPKQSHQVVA  2067
              H  KA   +   +S Q++ 
Sbjct  621   VHTRKASTSILSNRSRQIMG  640



>ref|XP_006373046.1| hypothetical protein POPTR_0017s07820g [Populus trichocarpa]
 gb|ERP50843.1| hypothetical protein POPTR_0017s07820g [Populus trichocarpa]
Length=648

 Score =   738 bits (1906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/620 (65%), Positives = 489/620 (79%), Gaps = 10/620 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             FLTW+DLWVTV + + G+K IL+GLTGYA+PGELLAIMGPSGCGKSTLLDALAGRL    
Sbjct  31    FLTWDDLWVTVPNRKHGSKPILQGLTGYAQPGELLAIMGPSGCGKSTLLDALAGRLGSNA  90

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             RQ G+ILING  Q LAYGTSAYVTQ+DTL  TLTVREAVYYSAQLQLP S+ + EK E A
Sbjct  91    RQVGEILINGHKQALAYGTSAYVTQDDTLVTTLTVREAVYYSAQLQLPDSMSKLEKMERA  150

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             EMTI+EMGLQDAMNTRIGG        G QKRRVSIC+EILT PKLLFLDEP+SGLDSAA
Sbjct  151   EMTIREMGLQDAMNTRIGGWGVKGLSGG-QKRRVSICIEILTHPKLLFLDEPTSGLDSAA  209

Query  763   SFYVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFF  933
             S+YVM  I  L  +    RTV+ASIHQPS+EVF LF++LCLLSSG+ VYFGPASAA +FF
Sbjct  210   SYYVMRGIARLDHKDGVRRTVIASIHQPSSEVFQLFSNLCLLSSGQTVYFGPASAANEFF  269

Query  934   ETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYR  1113
               N FPCP LQNPSDHFL TINKDF+   +D+EQG    IPTEEVINILV SYKS   ++
Sbjct  270   ALNSFPCPPLQNPSDHFLNTINKDFE---KDLEQGLDDAIPTEEVINILVKSYKSSDYWQ  326

Query  1114  EVQGQVAEISKQEGEVLK-KSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAV  1290
             +VQ +V EI K+  E L+ +   A F TQS+VLT+RSF+NMFRDLGYYWLRL IY+ L  
Sbjct  327   QVQVKVEEICKEHFEALESRRDHAGFLTQSLVLTKRSFVNMFRDLGYYWLRLAIYVGLGY  386

Query  1291  GLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCG  1470
             GL  +Y+D+G    SIQAR S+L F+++F TFMAIGGFPSFVE+MKVF++E LNGHYG  
Sbjct  387   GLSSIYHDLGSSYGSIQARGSLLMFVSTFLTFMAIGGFPSFVEEMKVFERERLNGHYGAT  446

Query  1471  AFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIA  1650
             +FAI NT S++P+L+LISLIPG IAY+P GL + + HF YFA  +   +LLVES+MM +A
Sbjct  447   SFAIGNTFSAIPFLVLISLIPGAIAYYPSGLHKGYEHFLYFASTLFACLLLVESMMMAVA  506

Query  1651  SLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEF  1830
             S+VPN+LMGII GAG+Q LM+LGGG+FRLP DLPK FW+YP+YY+ FH+YAYQG++KNEF
Sbjct  507   SIVPNFLMGIITGAGIQGLMVLGGGFFRLPDDLPKPFWKYPLYYVAFHRYAYQGMFKNEF  566

Query  1831  QGLRLPEETGQ-IITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKA  2007
             +GL+     G  +I GEE+LR+  Q+EMG SKW+DL +L+ M V  R++FL ++K +E  
Sbjct  567   EGLKFTNYQGNGLIKGEEILRDFWQMEMGSSKWVDLAILLGMVVFYRLLFLAIIKTTETI  626

Query  2008  KHVVKAVMR-VSPKQSHQVV  2064
             K ++  +M  V+PKQ+ Q++
Sbjct  627   KPIIPGLMSYVNPKQTFQIM  646



>ref|XP_007042908.1| White-brown complex protein 11 [Theobroma cacao]
 gb|EOX98739.1| White-brown complex protein 11 [Theobroma cacao]
Length=904

 Score =   748 bits (1930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/620 (65%), Positives = 491/620 (79%), Gaps = 11/620 (2%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTWEDLWVTV  G+ G+++IL+GLTGYARPGELLAIMGPSGCGKS+LLD LAGRL   TR
Sbjct  269   LTWEDLWVTVPGGKNGSRSILQGLTGYARPGELLAIMGPSGCGKSSLLDTLAGRLGPNTR  328

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             Q+GDILINGR Q LAYGTSAYVTQ+D+L  TLTVREAVYYSAQLQLP ++  SEKKE AE
Sbjct  329   QAGDILINGRKQALAYGTSAYVTQDDSLITTLTVREAVYYSAQLQLPDTISMSEKKERAE  388

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
             MTI EMGL+DAMNTRIGG        G QKRRVSIC+EILTRPKLLFLDEP+SGLDSAAS
Sbjct  389   MTITEMGLKDAMNTRIGGWGAKGLSGG-QKRRVSICIEILTRPKLLFLDEPTSGLDSAAS  447

Query  766   FYVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFE  936
             +YVMS+I  L  +    RT++ASIHQPS+EVF LF +L LLS+G+ VYFGP SAA +FF 
Sbjct  448   YYVMSRIASLNQKDGIRRTIIASIHQPSSEVFQLFHNLYLLSAGKTVYFGPVSAANEFFA  507

Query  937   TNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYRE  1116
              NGFPCP LQNPSDHFLKTINKDF+   +D+EQG A GIP EEVINILV SYKS   Y+ 
Sbjct  508   LNGFPCPNLQNPSDHFLKTINKDFE---KDIEQGFANGIPAEEVINILVKSYKSSDVYQT  564

Query  1117  VQGQVAEISKQEGEVLKKS-SRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             VQ +VA+I KQ+   L+K+ S A FFTQ  VLT+RSF+NM+RDLGYYWLRLG+YI LAV 
Sbjct  565   VQREVAQICKQDARALEKNESHAGFFTQCHVLTKRSFINMYRDLGYYWLRLGVYIALAVV  624

Query  1294  LGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGA  1473
             L  +++ +G    SIQAR S++ F+ASF TFMAIGGFPSFVE+MKVF++E LNGHYG  A
Sbjct  625   LATVFSHIGMSYGSIQARGSLIMFVASFLTFMAIGGFPSFVEEMKVFERERLNGHYGVTA  684

Query  1474  FAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIAS  1653
             F I NTLS+LP+L L++LIPG I YF  GL + + +F +F L +   M+LVESLMMI+AS
Sbjct  685   FVIGNTLSALPFLALVALIPGSITYFLPGLHKGYENFLFFVLTLFACMMLVESLMMIVAS  744

Query  1654  LVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQ  1833
             +VPNYLMGIIAGAG+Q LMIL GG+FRLP DLPK   +YP+YYI FHKYAYQGL+KNEF+
Sbjct  745   MVPNYLMGIIAGAGIQGLMILVGGFFRLPADLPKPILKYPLYYIAFHKYAYQGLFKNEFE  804

Query  1834  GLRLP-EETG--QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEK  2004
             GL  P  + G    +TGEE+L+ T  VEM +SKW+DL +L+ M V+ R +FL+++KA+EK
Sbjct  805   GLTFPISQAGGPPSLTGEEILKMTWNVEMAYSKWVDLAILLAMVVLYRFLFLIIIKATEK  864

Query  2005  AKHVVKAVMRVSPKQSHQVV  2064
              K ++  +   + K+  QV+
Sbjct  865   VKPMIAKLKSAALKEREQVM  884


 Score =   177 bits (448),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 127/173 (73%), Gaps = 4/173 (2%)
 Frame = +1

Query  1423  MKVFKKETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALV  1602
             ++VF++E LNGHYG  AF   NT S+LP++ LI+LIPG+I YF  GL + F  F +F L 
Sbjct  7     IQVFERERLNGHYGVTAFVFGNTFSALPFVALIALIPGIITYFLPGLHKGFESF-FFVLT  65

Query  1603  ILMNMLLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYY  1782
             +   MLLVESLMMI+AS+VPN+ MGIIAG G+Q LM+L  G+FRLP DL K   +YP+Y+
Sbjct  66    LFACMLLVESLMMIVASIVPNFQMGIIAGTGIQGLMVLVDGFFRLPTDLRKPMLKYPLYH  125

Query  1783  IDFHKYAYQGLYKNEFQGLRLPE-ETG--QIITGEEVLRETLQVEMGHSKWID  1932
             I F KYAYQGL+KNEF+GL  P  + G    +TGEE+L+ T  V+M +SKW+D
Sbjct  126   IPFRKYAYQGLFKNEFEGLTFPNIQAGGPPSLTGEEILKNTWNVKMAYSKWVD  178



>ref|XP_006492644.1| PREDICTED: ABC transporter G family member 11-like [Citrus sinensis]
Length=641

 Score =   738 bits (1904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/620 (64%), Positives = 489/620 (79%), Gaps = 19/620 (3%)
 Frame = +1

Query  223   FLTWEDLWVT-VSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELT  399
             FLTW+DL VT VS+G+KG+ +IL+ LTGYA+PG LLAIMGPSG GK+TLLDALAGRL   
Sbjct  21    FLTWKDLTVTIVSNGKKGSSSILEDLTGYAKPGHLLAIMGPSGSGKTTLLDALAGRLGSD  80

Query  400   TRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEI  579
             TRQ+G ILING  + +AYGTSAYVTQ+DTL  TLTV+EAVYYSAQLQLP ++P+S+KKE 
Sbjct  81    TRQTGKILINGHKKAMAYGTSAYVTQDDTLITTLTVKEAVYYSAQLQLPDTMPKSDKKER  140

Query  580   AEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSA  759
             AE+TI+EMGLQDAMNTRI    G       QKRRVSI +EILTRPKLLFLDEP+SGLDSA
Sbjct  141   AEVTIREMGLQDAMNTRIRRLSGG------QKRRVSISIEILTRPKLLFLDEPTSGLDSA  194

Query  760   ASFYVMSKIMDLASE---GRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQF  930
             AS+YVMS+I  L      GRT++ASIHQPS+EV  LF +L LLS+G+ VYFGPA+AA +F
Sbjct  195   ASYYVMSRIAKLGQRDGIGRTIIASIHQPSSEVCQLFHNLYLLSAGQTVYFGPATAANEF  254

Query  931   FETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARG-IPTEEVINILVNSYKSYHR  1107
             F  NGFPCPT QNPSDHFLKTINKDF    +D E+G A G IPTEEVINIL  SYKS   
Sbjct  255   FAFNGFPCPTHQNPSDHFLKTINKDFQ---KDAEEGLADGEIPTEEVINILKRSYKSCGI  311

Query  1108  YREVQGQVAEISKQE-GEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITL  1284
             Y +V  QVAEI KQ  G + KK   A F TQ  VLTRRSF+NM+RDLGYYW RL IYI++
Sbjct  312   YEQVGSQVAEICKQNYGTLEKKRKHASFLTQCHVLTRRSFVNMYRDLGYYWFRLAIYISM  371

Query  1285  AVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYG  1464
             A+GL  +++++G G  SIQAR S+L F+ASF TFM IGGFPSFVEDMKVF++E LNGHYG
Sbjct  372   ALGLATLFSNLGTGYRSIQARGSLLMFVASFITFMTIGGFPSFVEDMKVFERERLNGHYG  431

Query  1465  CGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMI  1644
               AF + N+ S++PYL+++SL+PG I Y+  GL + + HF YF L++   M+LVESLMMI
Sbjct  432   ATAFVVGNSFSAVPYLIIVSLVPGAIVYYLPGLHKGYQHFFYFVLLLFACMMLVESLMMI  491

Query  1645  IASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKN  1824
             +ASLVPNYL+GII G+G+Q +MILGGG+F+LP D+PK+FW+YP+YYI FHKYAYQG++KN
Sbjct  492   VASLVPNYLLGIITGSGIQGMMILGGGFFQLPNDIPKIFWKYPLYYIVFHKYAYQGMFKN  551

Query  1825  EFQGLRLPEETGQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEK  2004
             EF+GL+          GE++LR+T Q+E+G+SKW+DL +L  M VV R+VFL ++KA+EK
Sbjct  552   EFEGLKFDNNQ----DGEQILRDTWQLELGYSKWVDLAILFGMVVVYRLVFLGIIKATEK  607

Query  2005  AKHVVKAVMRVSPKQSHQVV  2064
              K VVKA M V PK + Q++
Sbjct  608   LKPVVKAFMDVPPKPTTQII  627



>gb|KDP29717.1| hypothetical protein JCGZ_18652 [Jatropha curcas]
Length=690

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/607 (65%), Positives = 490/607 (81%), Gaps = 10/607 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVS-DGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELT  399
             FLTW DLWVTV+ D R   + IL+GLTGYA+PGE+LAIMGPSGCGKSTLLDALAGRL   
Sbjct  82    FLTWNDLWVTVAGDRRNVRRPILQGLTGYAQPGEVLAIMGPSGCGKSTLLDALAGRLTSN  141

Query  400   TRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEI  579
              +QSG IL+NGR +TLA+GTSAYVTQ+DTL +TLTV+EAVYYSAQLQLP+S+ +SEKKE 
Sbjct  142   VKQSGKILVNGRQETLAFGTSAYVTQDDTLMSTLTVKEAVYYSAQLQLPNSMSKSEKKER  201

Query  580   AEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSA  759
             AE TI+EMGLQD++NTRIGG        G QKRRVSIC+EILTRPKLLFLDEP+SGLDSA
Sbjct  202   AETTIREMGLQDSVNTRIGGWSSKGLSGG-QKRRVSICIEILTRPKLLFLDEPTSGLDSA  260

Query  760   ASFYVMSKIMDLASE-GRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFE  936
             AS++VM++I+ +A + G+TV+ASIHQPSTEVF LF +LCLLSSGR VYFGP + A QFF 
Sbjct  261   ASYHVMNRIVKIAKQDGKTVIASIHQPSTEVFELFHNLCLLSSGRTVYFGPVTMAEQFFS  320

Query  937   TNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYRE  1116
             +NGFPCPTL+NPSDH+L+TINKDFD    D+EQG      TE+VIN+L+ SYKS   Y +
Sbjct  321   SNGFPCPTLRNPSDHYLRTINKDFD---VDIEQGLRGSRSTEDVINMLIKSYKSSEIYHD  377

Query  1117  VQGQVAEISKQEGEVL-KKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             VQ QVA ISK+ GE+L KK S+A F TQ +VLT+RSF+NM+RDLGYYWLRL IYI L + 
Sbjct  378   VQHQVAYISKKNGEILGKKGSQASFITQCVVLTKRSFINMYRDLGYYWLRLAIYIALCLC  437

Query  1294  LGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGA  1473
             +G +++D+G+   SIQAR S+L F+A+F TFMAIGGFPSFVEDMK+F +E LNGHYG GA
Sbjct  438   VGTIFHDIGFTYGSIQARGSMLMFVAAFLTFMAIGGFPSFVEDMKIFGRERLNGHYGVGA  497

Query  1474  FAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIAS  1653
             F I NT SSLPYL +ISLIPG IAY+ VGLQ+   HF YF L++ + M+LVESLMM++AS
Sbjct  498   FVIGNTFSSLPYLFMISLIPGAIAYYLVGLQKSIDHFVYFTLLLFICMMLVESLMMMVAS  557

Query  1654  LVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQ  1833
             +VP++LMGII GAG+Q +M+L GG+FRLP+DLPK FWRYP+YYI FHKYA +G YKNEF+
Sbjct  558   IVPDFLMGIITGAGIQGVMMLNGGFFRLPEDLPKPFWRYPMYYIAFHKYANEGFYKNEFE  617

Query  1834  GLRLPEET---GQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEK  2004
             GL  P +       ++GEE+L    QVEMG+SKWIDL +L  M ++ R++FL ++K  EK
Sbjct  618   GLTFPNDKVGGPATVSGEEILTSFWQVEMGYSKWIDLTILFGMVILYRLMFLGIIKLVEK  677

Query  2005  AKHVVKA  2025
              K ++KA
Sbjct  678   LKPIIKA  684



>ref|XP_002267117.3| PREDICTED: ABC transporter G family member 11-like [Vitis vinifera]
Length=634

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/619 (65%), Positives = 492/619 (79%), Gaps = 9/619 (1%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             FLTW+DLWVTV D + G + IL+ LTGYA+PGE+LAIMGPSGCGKSTLLDALAGRL   T
Sbjct  11    FLTWKDLWVTVPDQQSGRRPILQRLTGYAQPGEVLAIMGPSGCGKSTLLDALAGRLGSNT  70

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             RQ+G+ILINGR Q LA+GTSAYVTQ+DTL  TLTVREAV+YSAQLQLP S+P S KKE A
Sbjct  71    RQAGEILINGRKQRLAFGTSAYVTQDDTLMTTLTVREAVHYSAQLQLPGSMPTSAKKERA  130

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             EMTI EMGLQD + TRIGG        G QKRRVSIC+EILTRPKLLFLDEP+SGLDSAA
Sbjct  131   EMTICEMGLQDCIETRIGGWGKKGLSGG-QKRRVSICIEILTRPKLLFLDEPTSGLDSAA  189

Query  763   SFYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             S++VM +I+ LA  EG TV+ASIHQPS+EVF LF +LCLLSSG+ VYFGPAS A +FF  
Sbjct  190   SYHVMDRIVKLAHREGITVIASIHQPSSEVFELFHNLCLLSSGKTVYFGPASMANEFFAK  249

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREV  1119
             NGFPCP+L+NPSDH+L+TINKDFD    D+E+G      TEE INILV +YKS    ++V
Sbjct  250   NGFPCPSLRNPSDHYLRTINKDFD---LDIEEGLGGATSTEEAINILVRAYKSSETCQQV  306

Query  1120  QGQVAEISKQEGEVL-KKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGL  1296
             QG+V+EI +Q+G VL KK S+A F TQ +VLT+RSF+NM+RDLGYYWLRL IYI L + +
Sbjct  307   QGRVSEICQQKGGVLEKKGSQASFATQCLVLTKRSFVNMYRDLGYYWLRLAIYIALCLCV  366

Query  1297  GYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAF  1476
             G ++ D+G+   SIQAR S+L F+A+F TFMAIGGFPSFVEDMK+F +E LNGHYG GAF
Sbjct  367   GTIFYDIGFSYGSIQARGSMLMFVAAFLTFMAIGGFPSFVEDMKIFGRERLNGHYGVGAF  426

Query  1477  AIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASL  1656
              I N+LSS+PYLL+ISLIPG IAY+ V LQ+ F HF YFA+++ + M+LVESLMM++AS+
Sbjct  427   VIGNSLSSIPYLLMISLIPGAIAYYLVHLQKGFEHFVYFAILLFVCMMLVESLMMMVASI  486

Query  1657  VPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQG  1836
             VP++LMGII GAG+Q +M+L GG+FRLP DLP  FW+YP+YYI FHKYA QG YKNEF+G
Sbjct  487   VPDFLMGIITGAGIQGVMMLCGGFFRLPNDLPNPFWKYPMYYIAFHKYANQGFYKNEFEG  546

Query  1837  LRLPEET---GQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKA  2007
             L  P         ITGEE+L+   QVEMG+SKWIDL +L  M V+ R++FL ++K  EK 
Sbjct  547   LTFPNNQVGGAPTITGEEILQNVWQVEMGYSKWIDLAILFGMVVLYRLMFLGIIKTVEKV  606

Query  2008  KHVVKAVMRVSPKQSHQVV  2064
             K +++ +  V P++S Q++
Sbjct  607   KPMIRGLFAVPPEKSKQIL  625



>ref|XP_007201742.1| hypothetical protein PRUPE_ppa002207mg [Prunus persica]
 gb|EMJ02941.1| hypothetical protein PRUPE_ppa002207mg [Prunus persica]
Length=701

 Score =   738 bits (1905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/627 (64%), Positives = 493/627 (79%), Gaps = 17/627 (3%)
 Frame = +1

Query  223   FLTWEDLWVTV-----SDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGR  387
             FLTWEDLWVTV     S+    +++IL+G+TGYARPGELLAIMGPSGCGKSTLLDAL GR
Sbjct  66    FLTWEDLWVTVVSKAKSENGSRSRSILQGVTGYARPGELLAIMGPSGCGKSTLLDALGGR  125

Query  388   LELTTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSE  567
             L   TR++G +LING+ Q LAYGTSAYVTQ+DTL  TLTV EAVYYSAQLQLP S+ ++E
Sbjct  126   LSSNTRKTGKVLINGQKQALAYGTSAYVTQDDTLITTLTVSEAVYYSAQLQLPDSMSKAE  185

Query  568   KKEIAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSG  747
             KKE AE+TI+EMGLQDAMNTRIGG        G QKRRVSIC+E+LTRP LLFLDEP+SG
Sbjct  186   KKERAEITIREMGLQDAMNTRIGGWGSKGLSGG-QKRRVSICIELLTRPNLLFLDEPTSG  244

Query  748   LDSAASFYVMSKIMDL-ASEG--RTVVASIHQPSTEVfslftslcllssGRVVYFGPASA  918
             LDSAAS+YVMS+I +L  ++G  RTV+ SIHQPS+EVF LF +LCLLS+GR VYFGPASA
Sbjct  245   LDSAASYYVMSRIANLDKTDGTPRTVITSIHQPSSEVFQLFDNLCLLSAGRTVYFGPASA  304

Query  919   AIQFFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKS  1098
             A QFF   GFPCPTLQNPSDHFLKTINKDF+   +D+EQG     PTE  I+ LV SYK 
Sbjct  305   ANQFFSLCGFPCPTLQNPSDHFLKTINKDFE---QDIEQGMVGRTPTEVAIDTLVKSYKE  361

Query  1099  YHRYREVQGQVAEISKQE-GEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIY  1275
                Y++VQ QVAE+ KQ+ GE L+K S A F TQS VLTRRSF+NM+RD GYYWLRL +Y
Sbjct  362   SESYQQVQRQVAELCKQDFGEELEKRSHAGFLTQSFVLTRRSFMNMYRDRGYYWLRLAVY  421

Query  1276  ITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNG  1455
             IT+A+GLG +Y D+G+   SIQAR S+L F++SF TFMAIGGFPSFVEDMKVF++E LNG
Sbjct  422   ITMALGLGTIYQDLGHSYESIQARGSLLMFVSSFLTFMAIGGFPSFVEDMKVFERERLNG  481

Query  1456  HYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESL  1635
             HYG  AF  ANT SS+P+L+LIS+IPG I Y+  GL + F HF YFA V+   M+LVESL
Sbjct  482   HYGVSAFVFANTFSSVPFLILISVIPGTITYYVAGLHKGFEHFVYFACVLFACMMLVESL  541

Query  1636  MMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGL  1815
             MMI+AS+VPN+LMGIIAGAG+Q LM++ GG+FRLP D+PK  W++P+YYI FHKYAYQGL
Sbjct  542   MMIVASIVPNFLMGIIAGAGIQGLMLMCGGFFRLPNDIPKPLWKFPLYYIAFHKYAYQGL  601

Query  1816  YKNEFQGLRLP--EETGQI--ITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfll  1983
             +KNEF G   P  ++ G+   + GE +LR+  QVEMG+S+W+DL +LV M ++ R +FL+
Sbjct  602   FKNEFIGTTFPSSDQGGKTSSLGGEHILRDIWQVEMGYSEWVDLAILVGMILLYRFLFLV  661

Query  1984  vvKASEKAKHVVKAVMRVSPKQSHQVV  2064
             ++KA+EK K +   +     K+S QV+
Sbjct  662   IIKATEKVKTITTLLAMSLNKRSMQVL  688



>ref|XP_009760682.1| PREDICTED: ABC transporter G family member 11-like [Nicotiana 
sylvestris]
Length=741

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/617 (64%), Positives = 487/617 (79%), Gaps = 10/617 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             +LTW+DLWVTV D + G +AIL+GLTGY +PG++LAIMGPSGCGKSTLLD LAGR++  T
Sbjct  118   YLTWKDLWVTVPDKKTGRRAILQGLTGYVQPGQVLAIMGPSGCGKSTLLDTLAGRVDSNT  177

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             RQ+G+ILINGR Q LA+GTSAYVTQ+DTL  TLTVREA+YYSAQLQLP S+ RSEKKE A
Sbjct  178   RQTGEILINGRRQALAFGTSAYVTQDDTLMTTLTVREAIYYSAQLQLPDSMSRSEKKERA  237

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             E TI+EMGLQDAMNTRIGG        G QKRRVSIC+EILTRPKLLFLDEP+SGLDSAA
Sbjct  238   EATIREMGLQDAMNTRIGGWSVKGLSGG-QKRRVSICIEILTRPKLLFLDEPTSGLDSAA  296

Query  763   SFYVMSKIMDLASE-GRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             S++VM++I+ LA + GRTVVASIHQPS+EVF LF +LCLLSSGR VYFG  SAA +FF  
Sbjct  297   SYHVMNRIVQLAKQDGRTVVASIHQPSSEVFELFHNLCLLSSGRTVYFGSISAANEFFAV  356

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREV  1119
             NGFPCPT++NPSDH+L+TINKDFD    D+E+G +      E INILV SYK+    ++V
Sbjct  357   NGFPCPTMRNPSDHYLRTINKDFD---ADIEKGVSGKATATEAINILVKSYKTSQGCQQV  413

Query  1120  QGQVAEISKQEG-EVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGL  1296
             Q +V EI +Q G +  KK ++A F TQ  VLTRRSF+NM+RDLGYYWLR  IYI L + +
Sbjct  414   QRRVLEICQQNGGQEAKKGNQASFITQCTVLTRRSFVNMYRDLGYYWLRFAIYIALCLCV  473

Query  1297  GYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAF  1476
             G +++D+G+G  SIQAR S+L F+A+F TFMAIGGFPSFVEDMK+F +E LNGHYG  A+
Sbjct  474   GTIFHDIGHGYGSIQARGSMLMFVAAFLTFMAIGGFPSFVEDMKIFTRERLNGHYGVAAY  533

Query  1477  AIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASL  1656
              I NT SS+PYL +IS+IPG +AY+ VGLQ+EF HFAYFAL++   M+LVESLMMI+AS+
Sbjct  534   VIGNTFSSIPYLAMISVIPGAMAYYLVGLQKEFDHFAYFALMLFTTMMLVESLMMIVASI  593

Query  1657  VPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQG  1836
             VP++LMGII GAG+Q +M+L GG+FRLP DLP  FW+YP+YYI FHKYA QG YKNEF G
Sbjct  594   VPDFLMGIITGAGIQGVMMLNGGFFRLPNDLPNPFWKYPMYYIAFHKYANQGFYKNEFLG  653

Query  1837  LRLPEET---GQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKA  2007
             L  P E       ITG+E+LR   QV+MG+SKW+D+ ++  M ++ R +FL ++K  EK 
Sbjct  654   LTFPNEQIGGPATITGDEILRNIWQVQMGYSKWVDVAIVFGMVILYRFMFLGIIKIVEKV  713

Query  2008  KHVVKAVM-RVSPKQSH  2055
             K +++A M R S   +H
Sbjct  714   KPMIRAFMARTSKNPTH  730



>ref|XP_009337870.1| PREDICTED: ABC transporter G family member 11-like [Pyrus x bretschneideri]
Length=686

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/624 (65%), Positives = 491/624 (79%), Gaps = 16/624 (3%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKG----NKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRL  390
              LTWEDLWVTV   +      +++IL+GLTGYA+PGELLAIMGPSGCGKSTLLDAL GRL
Sbjct  56    LLTWEDLWVTVVSKKNSIGSSSRSILQGLTGYAKPGELLAIMGPSGCGKSTLLDALGGRL  115

Query  391   ELTTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEK  570
                TRQ+G ILINGR Q LAYGTSAYVTQ+DTL  TLTV+EAVYYSAQLQLP  + +SEK
Sbjct  116   SSNTRQTGKILINGRKQALAYGTSAYVTQDDTLMTTLTVKEAVYYSAQLQLPDFMTKSEK  175

Query  571   KEIAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGL  750
             KE AE+TI+EMGLQDAMNTRIGG        G QKRRVSIC+E+LTRPKLLFLDEP+SGL
Sbjct  176   KERAEVTIREMGLQDAMNTRIGGWGAKGLSGG-QKRRVSICIELLTRPKLLFLDEPTSGL  234

Query  751   DSAASFYVMSKIMDL-ASEG--RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAA  921
             DSAAS+YVMS+I +L   +G  RT+V SIHQPS+EVF LF SLCLLSSGR VYFGPASAA
Sbjct  235   DSAASYYVMSRIANLDKGDGTPRTIVTSIHQPSSEVFQLFDSLCLLSSGRTVYFGPASAA  294

Query  922   IQFFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSY  1101
               FF   GFPCPTLQNPSDHFLKTINKDF+   +D+EQG     PTE  I+ L+ SYK  
Sbjct  295   NHFFTLTGFPCPTLQNPSDHFLKTINKDFE---QDIEQGVT--TPTEVAIDTLITSYKES  349

Query  1102  HRYREVQGQVAEISKQE-GEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYI  1278
               +++VQ QVAE+ KQ+ GE L+K SRA F TQS++LTRRSF+NM RD GYYWLRL IYI
Sbjct  350   ETFQQVQRQVAELCKQDSGEKLEKRSRAGFLTQSLILTRRSFVNMHRDRGYYWLRLAIYI  409

Query  1279  TLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGH  1458
             ++ +GLG +Y+D+G+G  SIQAR  +L +I+SF TFMAIGGFPSFVEDMKVF++E LNGH
Sbjct  410   SMTLGLGTIYHDLGHGYRSIQARVLLLTYISSFLTFMAIGGFPSFVEDMKVFERERLNGH  469

Query  1459  YGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLM  1638
             YG  AFA  NT SS+P+L++IS+IPG I Y+  GL     HF YF+ V+L  M+LVESLM
Sbjct  470   YGVCAFAFGNTFSSVPFLIMISVIPGAITYYLAGLHTGLEHFVYFSCVLLACMMLVESLM  529

Query  1639  MIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLY  1818
             MI+AS+VPNYLMGIIAGAG+Q L++L GG+F+LP DLP   W+YP+YYI FHKYAYQGL+
Sbjct  530   MIVASIVPNYLMGIIAGAGIQGLLMLCGGFFQLPSDLPTPVWKYPMYYIAFHKYAYQGLF  589

Query  1819  KNEFQGLRLP--EETGQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvK  1992
             KNEFQG   P  E  G +I+GE++LRE  QVEM +SKW+++ VL  M V+ RV+FL+++K
Sbjct  590   KNEFQGTMFPSSEAGGPLISGEQILRERWQVEMRYSKWVNVAVLFGMVVLYRVMFLVIIK  649

Query  1993  ASEKAKHVVKAVMRVSPKQSHQVV  2064
              +EK K    A++ +  K++ QV+
Sbjct  650   TTEKVKTSTTALLSMPTKRNLQVL  673



>ref|XP_008237167.1| PREDICTED: ABC transporter G family member 11-like [Prunus mume]
Length=702

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/628 (64%), Positives = 496/628 (79%), Gaps = 18/628 (3%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKG-----NKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGR  387
             FLTWEDLWVTV    K      +++IL+G+TGYARPGELLAIMGPSGCGKSTLLDAL GR
Sbjct  66    FLTWEDLWVTVVSKAKNENGSRSRSILQGVTGYARPGELLAIMGPSGCGKSTLLDALGGR  125

Query  388   LELTTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSE  567
             L   TR++G ILING+ Q LAYGTSAYVTQ+DTL  TLTV EAVYYSAQLQLP S+ ++E
Sbjct  126   LSSNTRKTGKILINGQKQALAYGTSAYVTQDDTLITTLTVSEAVYYSAQLQLPDSMSKAE  185

Query  568   KKEIAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSG  747
             KKE AE+TI+EMGLQDAMNTRIGG        G QKRRVSIC+E+LTRP LLFLDEP+SG
Sbjct  186   KKERAEITIREMGLQDAMNTRIGGWGSKGLSGG-QKRRVSICIELLTRPNLLFLDEPTSG  244

Query  748   LDSAASFYVMSKIMDL-ASEG--RTVVASIHQPSTEVfslftslcllssGRVVYFGPASA  918
             LDSAAS+YVMS+I +L  ++G  RTV+ SIHQPS+EVF LF +LCLLS+GR VYFGPASA
Sbjct  245   LDSAASYYVMSRIANLDKTDGIPRTVITSIHQPSSEVFQLFDNLCLLSAGRTVYFGPASA  304

Query  919   AIQFFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKS  1098
             A QFF   GFPCPTLQNPSDHFLKTINKDF+   +D+EQG     PTE  I+ L+ SYK 
Sbjct  305   ANQFFSLCGFPCPTLQNPSDHFLKTINKDFE---QDIEQGMVGRTPTEVAIDTLIKSYKE  361

Query  1099  YHRYREVQGQVAEISKQE-GEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIY  1275
                Y++VQGQVAE+ KQ+ GE L+K S A F TQS VLTRRSF+NM+RD GYYWLRL IY
Sbjct  362   SESYQQVQGQVAELCKQDFGEELEKRSHAGFLTQSFVLTRRSFMNMYRDRGYYWLRLAIY  421

Query  1276  ITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNG  1455
             IT+A+GLG +Y D+G+   SIQAR S++ F++SF TFMAIGGFPSFVEDMKVF++E LNG
Sbjct  422   ITIALGLGTVYQDLGHSYESIQARSSLIMFVSSFLTFMAIGGFPSFVEDMKVFERERLNG  481

Query  1456  HYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESL  1635
             HYG  AF  ANT SS+P+L+LIS+IP  I Y+  GL + F HF YFA V+   M+LVESL
Sbjct  482   HYGVSAFVFANTFSSVPFLILISVIPAAITYYVAGLHKGFEHFFYFACVLFACMMLVESL  541

Query  1636  MMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGL  1815
             MMI+AS+VPN+LMGIIAGAG+Q LMI+ GG+F+LP D+PK  W++P+YYI FHKYAYQGL
Sbjct  542   MMIVASIVPNFLMGIIAGAGIQGLMIMCGGFFQLPNDIPKPLWKFPLYYIAFHKYAYQGL  601

Query  1816  YKNEFQGLRLP--EETGQI--ITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfll  1983
             +KNEF G   P  ++ G+   ++GE +LR+  QVEMG+SKW+DL +LV M ++ RV+FL+
Sbjct  602   FKNEFIGTTFPSSDQGGKTSSLSGEHILRDKWQVEMGYSKWVDLAILVGMILLYRVLFLV  661

Query  1984  vvKASEKAKHVVKAVMRVS-PKQSHQVV  2064
             ++KA+EK K +   ++ +   K+S Q++
Sbjct  662   IIKATEKVKTIGTTLLAMPLNKRSMQIL  689



>emb|CBI33134.3| unnamed protein product [Vitis vinifera]
Length=629

 Score =   733 bits (1893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/613 (65%), Positives = 487/613 (79%), Gaps = 9/613 (1%)
 Frame = +1

Query  241   LWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTRQSGDI  420
             LWVTVSD   G +AIL+GL GYA+PGE+LAIMGPSGCGKSTLLDALAGRL   TRQSG+I
Sbjct  7     LWVTVSDDESGRRAILQGLAGYAQPGEVLAIMGPSGCGKSTLLDALAGRLASNTRQSGEI  66

Query  421   LINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAEMTIKE  600
             L+NG  Q LA+GTSAYVTQ+DTL  TLTVREAVYYSAQLQLP S+ RSEKKE AEMTI+E
Sbjct  67    LVNGSKQRLAFGTSAYVTQDDTLMTTLTVREAVYYSAQLQLPDSMSRSEKKERAEMTIRE  126

Query  601   MGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAASFYVMS  780
             MGLQDAMNTRIGG        G QKRRVSIC+EILTRP+LLFLDEP+SGLDSAAS++VMS
Sbjct  127   MGLQDAMNTRIGGWSVKGLSGG-QKRRVSICIEILTRPRLLFLDEPTSGLDSAASYHVMS  185

Query  781   KIMDLA-SEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNGFPCP  957
             +I+ LA  +G TVVASIHQPS+EVF +F +LCLLSSG+ VYFG AS A +FF++NGFPCP
Sbjct  186   RIVKLARHDGITVVASIHQPSSEVFEVFHNLCLLSSGKTVYFGSASMAKEFFDSNGFPCP  245

Query  958   TLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREVQGQVAE  1137
              L+NPSDH+L+TINKDFD+D    EQG      TEE IN L+ SYKS    ++VQ +V E
Sbjct  246   ALRNPSDHYLRTINKDFDSD---TEQGHGGTTNTEEAINTLIKSYKSSEICQQVQCRVYE  302

Query  1138  ISKQEGEVL-KKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLGYMYND  1314
             I + +G +L KK S+A F TQ +VLTRRS +NM+RDLGYYWLRL IYI L + +G ++ D
Sbjct  303   ICQLKGGLLEKKGSQASFITQCLVLTRRSSVNMYRDLGYYWLRLAIYIALCLCVGTIFYD  362

Query  1315  VGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFAIANTl  1494
             +G+   SIQAR S+L F+A+F TFMAIGGFPSFVEDMK+F +E LNGHYG GAF + NT 
Sbjct  363   IGFSYGSIQARGSMLMFVAAFLTFMAIGGFPSFVEDMKIFGRERLNGHYGVGAFVVGNTF  422

Query  1495  sslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLVPNYLM  1674
             SS+PYLL+ISLIPG+IAY+ VGL + F HF YFAL++ + M+LVESLMMI+AS+VP++LM
Sbjct  423   SSIPYLLMISLIPGVIAYYLVGLHKGFEHFVYFALMLFVCMMLVESLMMIVASIVPDFLM  482

Query  1675  GIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGLRLPEE  1854
             GII GAG+Q +M+L GG+FRLP DLPK FWRYP+YYI FHKYA QG YKNEFQGL  P  
Sbjct  483   GIITGAGIQGVMMLNGGFFRLPNDLPKPFWRYPMYYIAFHKYANQGFYKNEFQGLTFPNN  542

Query  1855  TG---QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAKHVVKA  2025
                    I+GEE+L+   QVE G+SKW+D+ +L  M V+ R++FL ++K  EK K ++K 
Sbjct  543   QAGGPPTISGEEILQNVWQVETGYSKWVDVAILFGMVVLYRLLFLGIIKTVEKVKLMIKD  602

Query  2026  VMRVSPKQSHQVV  2064
             +M  SP++S Q++
Sbjct  603   LMVASPEKSKQII  615



>ref|XP_010648172.1| PREDICTED: ABC transporter G family member 11-like [Vitis vinifera]
Length=691

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/621 (64%), Positives = 496/621 (80%), Gaps = 12/621 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             +LTWE+LWVTVS+G+ G+++IL+ LTGYARPGE+LAIMGPSGCGKSTLLDALAGRLE   
Sbjct  57    YLTWENLWVTVSNGKGGSRSILQDLTGYARPGEVLAIMGPSGCGKSTLLDALAGRLE--A  114

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
              QSG IL+NGR QTLAYGTSAYVTQ+DTL  TLTV EAVYYSAQLQLP S+ + EKKE A
Sbjct  115   NQSGSILVNGRKQTLAYGTSAYVTQDDTLLTTLTVGEAVYYSAQLQLPDSMSKQEKKERA  174

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             +MTIKEMGLQD++NTRIGG        G QKRRVSIC+EILT P LLFLDEP+SGLDSAA
Sbjct  175   DMTIKEMGLQDSINTRIGGWGAKGISGG-QKRRVSICVEILTHPNLLFLDEPTSGLDSAA  233

Query  763   SFYVMSKIMDLA-SEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             S+YVMS+I       GRT++ SIHQPS+EVF+LF +LCLLSSGR VYFGPA AA + F  
Sbjct  234   SYYVMSRIAGPDFRHGRTIITSIHQPSSEVFALFDNLCLLSSGRTVYFGPARAANELFSR  293

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREV  1119
             NGFPCPTLQNPSDHFLKTINKDF+   ED+EQG     P EEVI+IL+ +YKS    ++V
Sbjct  294   NGFPCPTLQNPSDHFLKTINKDFE---EDIEQGLGGKKPKEEVIDILIKAYKSSGSCQQV  350

Query  1120  QGQVAEISKQEGEVLKKSSR--ADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             Q QV EI KQEG+   + SR  A F  Q ++LT+RS++NM RDLGYYW+RLG+YI ++  
Sbjct  351   QAQVTEICKQEGDQALQKSRDHAGFVNQCLILTKRSYVNMSRDLGYYWMRLGVYIMVSFA  410

Query  1294  LGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGA  1473
             LG ++ D+G+ NSSIQ R S+L F+ASF TFM+IGGFPSFVEDMKVF +E LNGHYG GA
Sbjct  411   LGTIFYDLGFSNSSIQDRGSMLMFVASFLTFMSIGGFPSFVEDMKVFGRERLNGHYGTGA  470

Query  1474  FAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIAS  1653
             F + NTLSS+P+LLLISLIPG IAY+  GLQ+   +F Y+ALV+   M+LVES+MMI+AS
Sbjct  471   FVVGNTLSSVPFLLLISLIPGAIAYYLAGLQKGCEYFIYYALVLFACMMLVESIMMIVAS  530

Query  1654  LVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQ  1833
             LVPN+L+GII GAG+Q L+IL GG+FRLP +LP + WRYP+YY+ F++YAYQG+YKNEF 
Sbjct  531   LVPNFLVGIITGAGIQGLLILSGGFFRLPDNLPNILWRYPLYYVSFNRYAYQGMYKNEFT  590

Query  1834  GLRLP-EETG--QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEK  2004
             GL  P +++G    I+GEE+LR+  QVEMG+SKW+DL +LV M  + R++FL+++K +EK
Sbjct  591   GLTFPGDQSGGPATISGEEILRKRWQVEMGYSKWVDLAILVGMIALYRLLFLIIIKTTEK  650

Query  2005  AKHVVKAVMRVSPKQSHQVVA  2067
                ++KA M   PK ++QV++
Sbjct  651   VMPLIKAFMSRPPKHTNQVMS  671



>ref|XP_004288174.1| PREDICTED: ABC transporter G family member 11-like [Fragaria 
vesca subsp. vesca]
Length=711

 Score =   736 bits (1899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/616 (65%), Positives = 492/616 (80%), Gaps = 9/616 (1%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTWEDLW+ VSD + G K IL+GLTG+A+PGE+LAIMGPSGCGK+TLLDALAGRL  +T+
Sbjct  99    LTWEDLWIGVSDKKGGQKMILQGLTGFAQPGEVLAIMGPSGCGKTTLLDALAGRLSSSTQ  158

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             Q G ILINGR   LA+GTSAYVTQ+DTL  TLTVRE VYYSAQLQLP+S+ ++EKKE AE
Sbjct  159   QRGKILINGRKVKLAFGTSAYVTQDDTLMTTLTVREVVYYSAQLQLPNSMSKAEKKERAE  218

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI+EMGLQ  M+TRIGG        G QKRRVSIC+EILTRP+LLFLDEP+SGLDSAAS
Sbjct  219   TTIREMGLQACMDTRIGGWSRKGLSGG-QKRRVSICIEILTRPRLLFLDEPTSGLDSAAS  277

Query  766   FYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETN  942
             ++VM++I+ LA  +GRT++ASIHQPS+EV+ LF +LCLLSSGR VYFGPAS A QFF +N
Sbjct  278   YHVMNRIVKLAHRDGRTIIASIHQPSSEVYELFQNLCLLSSGRTVYFGPASQAEQFFASN  337

Query  943   GFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIP-TEEVINILVNSYKSYHRYREV  1119
             GFPCPTL+NPSDH L+TINKDFD D   +EQG   GIP TEEVIN L+ SY+S +  ++V
Sbjct  338   GFPCPTLRNPSDHCLRTINKDFDID---IEQG-HDGIPSTEEVINTLIRSYESSNTSKQV  393

Query  1120  QGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLG  1299
                VAEI +Q+G  L+K S A+F TQ +VLTRRSF+NM+RDLGYYWLRL IYI L + +G
Sbjct  394   HHSVAEIFQQKGGALEKGSHANFITQCLVLTRRSFVNMYRDLGYYWLRLAIYIALCLCVG  453

Query  1300  YMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFA  1479
              +++D+G    SIQAR S+L F+ASF TFMAIGGFPSFVEDMK+F +E LNGHYG  A+ 
Sbjct  454   TIFHDIGSTFGSIQARGSMLMFVASFLTFMAIGGFPSFVEDMKIFGRERLNGHYGVAAYV  513

Query  1480  IANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLV  1659
             + NT SS+PYLL+ISLIPG +AY+ VGLQ+   HF YFALV+ + M+LVESLMMI+AS+V
Sbjct  514   MGNTFSSIPYLLIISLIPGALAYYLVGLQKSLEHFIYFALVLFVCMMLVESLMMIVASIV  573

Query  1660  PNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGL  1839
             P++LMGII GAG+Q +M+L GG+FRLP DLPK FWRYP+YYI FHKYA+QG YKNEF+ L
Sbjct  574   PDFLMGIITGAGIQGVMMLTGGFFRLPDDLPKPFWRYPMYYIAFHKYAFQGFYKNEFEEL  633

Query  1840  RLPEETG--QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAKH  2013
               P + G    ITGE++L+   QVEMG+SKWIDL +L  M +V R +FL ++K SEK   
Sbjct  634   TFPNDQGGAPTITGEDILKSIWQVEMGYSKWIDLAILFGMVIVYRFMFLGIIKFSEKVVP  693

Query  2014  VVKAVMRVSPKQSHQV  2061
             ++KAV+   PK+S  V
Sbjct  694   MIKAVLVGVPKRSPTV  709



>gb|AIU41648.1| ABC transporter family protein [Hevea brasiliensis]
Length=649

 Score =   733 bits (1892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/620 (64%), Positives = 487/620 (79%), Gaps = 14/620 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             FL+W+DLWVTV DGR G+++IL+GLT YA+PGELLAIMGPSGCGKSTLLDALAGRL   T
Sbjct  28    FLSWKDLWVTVRDGRHGSRSILQGLTAYAQPGELLAIMGPSGCGKSTLLDALAGRLNSNT  87

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
              Q+G++LING  Q LAYGT+AYVTQ++ L ATLTVREAVYYSAQLQLP S+  SEKKE A
Sbjct  88    IQAGEVLINGHKQALAYGTTAYVTQDNNLVATLTVREAVYYSAQLQLPDSMSNSEKKERA  147

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             E TI+EMGLQDA NTRIGG        G QKRRVSIC+EILT PKLLFLDEP+SGLDSAA
Sbjct  148   ERTIREMGLQDARNTRIGGWGAKGLSGG-QKRRVSICIEILTHPKLLFLDEPTSGLDSAA  206

Query  763   SFYVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFF  933
             S+Y+MS+I  L       RT++ SIHQPS+EVF LF +LCLLSSG++VYFGPASAA +FF
Sbjct  207   SYYIMSRIASLGRNDGIRRTIIFSIHQPSSEVFQLFNNLCLLSSGKMVYFGPASAANEFF  266

Query  934   ETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYR  1113
               NGFPCPT QN SDHFLKTINKDF+    D+EQG +   PTEEVIN L+ SY S   Y+
Sbjct  267   TLNGFPCPTYQNHSDHFLKTINKDFE---RDLEQGMSDATPTEEVINTLIQSYTSSETYQ  323

Query  1114  EVQGQVAEISKQE-GEVL-KKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLA  1287
             EV+ +VAEI+K++ G +L KK S A F  Q +VLTRRSF+NM+RD+GYY LRL +Y+ LA
Sbjct  324   EVRKKVAEINKEDYGAILEKKRSHASFLNQFLVLTRRSFVNMYRDIGYYRLRLFVYVGLA  383

Query  1288  VGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGC  1467
              GL  +Y D+G    SIQAR S+L FI++F TFMAIGGFPSFVE+MKVF +E LNGHYG 
Sbjct  384   FGLATIYYDLGSSYGSIQARGSLLMFISTFLTFMAIGGFPSFVEEMKVFVRERLNGHYGT  443

Query  1468  GAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMII  1647
              AF  ANT SS P+LL+ISLIPG IAY+  GLQ+ F HF  FA +I  +M+LVES+MM++
Sbjct  444   TAFIFANTFSSKPFLLVISLIPGAIAYYLTGLQKGFDHFLCFASIIFASMILVESVMMVV  503

Query  1648  ASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNE  1827
             AS+VPN+LMGIIAGAG+Q LMILGGG+FRLP DLPK FW+YP+YYI FHKYAYQG++KNE
Sbjct  504   ASIVPNFLMGIIAGAGIQGLMILGGGFFRLPNDLPKPFWKYPLYYIAFHKYAYQGMFKNE  563

Query  1828  FQGLRLPEETG-----QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvK  1992
             F+GL+L          ++I GEE+LR+  QVEMG+SKW+D+++L+ M +  R +FL+++K
Sbjct  564   FEGLKLQSNQAAGGIPRMINGEEILRDVWQVEMGYSKWVDVVILLGMAIFYRFLFLIIIK  623

Query  1993  ASEKAKHVVKAVMRVSPKQS  2052
              SE  K V+ A   V P ++
Sbjct  624   TSETIKPVIIAATEVPPNET  643



>ref|XP_010030026.1| PREDICTED: ABC transporter G family member 11-like [Eucalyptus 
grandis]
 gb|KCW56965.1| hypothetical protein EUGRSUZ_I02639 [Eucalyptus grandis]
Length=685

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/620 (65%), Positives = 484/620 (78%), Gaps = 11/620 (2%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTWED+WV VS+  KG K IL+G+TGYA+PGELLAIMGPSGCGKSTLLDALAGRL   TR
Sbjct  58    LTWEDVWVMVSNKSKGVKPILQGVTGYAQPGELLAIMGPSGCGKSTLLDALAGRLSSNTR  117

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             Q+GD+L+NGR Q LAYGTSAYV Q+D L ATLTVREAVYY+AQLQLP  +P SEK+E AE
Sbjct  118   QTGDVLVNGRKQALAYGTSAYVMQDDVLIATLTVREAVYYTAQLQLPDYMPISEKRERAE  177

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
               IKEMGLQDAM+TRIGG        G QKRRVSICLEI+TRPKLLFLDEP+SGLDSAAS
Sbjct  178   TAIKEMGLQDAMDTRIGGWGTKGLSGG-QKRRVSICLEIVTRPKLLFLDEPTSGLDSAAS  236

Query  766   FYVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFE  936
             +YVMS+I  L       RT++ASIHQPS+EVF LF +LCLLSSGR VYFGPASAA +FF 
Sbjct  237   YYVMSRIASLGERDGIRRTIIASIHQPSSEVFQLFHNLCLLSSGRTVYFGPASAATEFFT  296

Query  937   TNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYRE  1116
              NG+PCPTLQNPSDHFLKTINKDFD    D+EQG    I TEEVIN LV SY+S    + 
Sbjct  297   LNGYPCPTLQNPSDHFLKTINKDFD---VDIEQGATGKISTEEVINTLVKSYRSSPNCQV  353

Query  1117  VQGQVAEISKQ-EGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             V G+VA+I+KQ  G   K  S A F TQ +VLTRRS +NM RD GYYWLRL +YI +A G
Sbjct  354   VLGEVAKINKQGHGAPAKGGSHAKFLTQCLVLTRRSSVNMSRDRGYYWLRLAVYIIVAFG  413

Query  1294  LGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGA  1473
             LG +Y+++G   SSIQAR S L F+ASF TFMAIGGFPSFVEDMKVF +E LNGHYG GA
Sbjct  414   LGTIYSNIGSTYSSIQARGSFLVFVASFLTFMAIGGFPSFVEDMKVFARERLNGHYGTGA  473

Query  1474  FAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIAS  1653
             F IANTLSS+PYLLLISLIPG IAY+  GLQR + HF +F  V+   M+LVESLMM +AS
Sbjct  474   FMIANTLSSIPYLLLISLIPGAIAYYLTGLQRGWEHFLFFVAVLFTCMMLVESLMMTVAS  533

Query  1654  LVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQ  1833
             +VP +LMGII GAG+QALMILGGG+FRLP DLP L W+YP+YYI FH+YAY+GL+KNEF+
Sbjct  534   IVPTFLMGIITGAGIQALMILGGGFFRLPNDLPLLIWKYPLYYIAFHRYAYEGLFKNEFK  593

Query  1834  GLRLPEETG---QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEK  2004
             GL+ P + G     I+G+++L E  Q+ M ++KW+DL+VL+ M ++ RV+F  +VK +E 
Sbjct  594   GLKFPSQPGYKTPFISGDQILTEFWQMNMEYTKWVDLVVLIGMVILYRVMFWAIVKGTEV  653

Query  2005  AKHVVKAVMRVSPKQSHQVV  2064
              K  +     ++P+Q+ QV+
Sbjct  654   VKPAMVGCTSLTPEQTKQVL  673



>ref|XP_010030024.1| PREDICTED: ABC transporter G family member 11-like [Eucalyptus 
grandis]
 gb|KCW56966.1| hypothetical protein EUGRSUZ_I02640 [Eucalyptus grandis]
Length=685

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/620 (65%), Positives = 483/620 (78%), Gaps = 11/620 (2%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTWED+WV VS+  KG K IL+G+TGYARPGELLAIMGPSGCGKSTLLDALAGRL   TR
Sbjct  58    LTWEDVWVMVSNKSKGVKPILQGVTGYARPGELLAIMGPSGCGKSTLLDALAGRLSSNTR  117

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             Q+GDIL+NG  Q LAYGTSAYV Q+D L ATLTVREAVYY+AQLQLP  +P SEK+E AE
Sbjct  118   QTGDILVNGHKQALAYGTSAYVMQDDVLIATLTVREAVYYTAQLQLPDYIPISEKRERAE  177

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
               IKEMGLQDAM+TRIGG        G QKRRVSICLEI+TRPKLLFLDEP+SGLDSAAS
Sbjct  178   TAIKEMGLQDAMDTRIGGWGTKGLSGG-QKRRVSICLEIVTRPKLLFLDEPTSGLDSAAS  236

Query  766   FYVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFE  936
             +YVMS+I  L       R ++ASIHQPS+EVF LF +LCLLSSGR VYFGPASAA +FF 
Sbjct  237   YYVMSRIASLGQRDGIRRLIIASIHQPSSEVFQLFHNLCLLSSGRTVYFGPASAATEFFA  296

Query  937   TNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYRE  1116
              NG+PCP+LQNPSDHFLKTINKDFD    D+EQG    I TEEVIN LV SY+S    + 
Sbjct  297   LNGYPCPSLQNPSDHFLKTINKDFD---VDIEQGATGKISTEEVINTLVKSYRSSPNCKV  353

Query  1117  VQGQVAEISKQ-EGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             V G+VA+I+KQ  G   K  S A+F TQ +VLTRRS +NM RD GYYWLRL +YI +A G
Sbjct  354   VLGEVAKINKQGHGAPAKGGSHANFLTQCLVLTRRSSVNMSRDRGYYWLRLAVYIIVAFG  413

Query  1294  LGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGA  1473
             LG +YN++G   SSIQAR S L F+ASF TFMAIGGFPSFVEDMKVF +E LNGHYG G+
Sbjct  414   LGTIYNNIGSTYSSIQARGSFLVFVASFLTFMAIGGFPSFVEDMKVFARERLNGHYGTGS  473

Query  1474  FAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIAS  1653
             F IANTLSS+PYLLLISLIPG IAY+  GLQR + HF +F  V+   M+LVESLMM +AS
Sbjct  474   FMIANTLSSVPYLLLISLIPGAIAYYLTGLQRGWEHFLFFVAVLFTCMMLVESLMMTVAS  533

Query  1654  LVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQ  1833
             +VP +LMGII GAG+QALMILGGG+FRLP DLP + W+YP+YYI FH+YAY+GL+KNEF+
Sbjct  534   IVPTFLMGIITGAGIQALMILGGGFFRLPNDLPLVIWKYPLYYIAFHRYAYEGLFKNEFK  593

Query  1834  GLRLPEETGQ---IITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEK  2004
             GL+ P + G     I+GEE L +  Q++M +SKW DL+VL+ M ++ RV+FL +VK +E 
Sbjct  594   GLKFPSQPGHKASFISGEEALTKFWQMDMEYSKWFDLVVLIGMVILYRVMFLAIVKGTEV  653

Query  2005  AKHVVKAVMRVSPKQSHQVV  2064
              K  +     ++P+Q+ QV+
Sbjct  654   VKPAIVGCTSLTPEQTKQVL  673



>ref|XP_008373271.1| PREDICTED: ABC transporter G family member 11-like [Malus domestica]
Length=694

 Score =   733 bits (1893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/627 (64%), Positives = 493/627 (79%), Gaps = 18/627 (3%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGN-----KAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGR  387
              LTWEDLWVTV   +  +     ++IL+GLTGYA+PGELLAIMGPSGCGKSTLLDAL GR
Sbjct  62    LLTWEDLWVTVVSKKNNSTGSSSRSILQGLTGYAKPGELLAIMGPSGCGKSTLLDALGGR  121

Query  388   LELTTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSE  567
             L   TRQ+G ILING  Q L YGTSAYVTQ+DTL  TLTV+EAVYYSAQLQLP S+ +SE
Sbjct  122   LNSNTRQTGKILINGHKQALTYGTSAYVTQDDTLMTTLTVKEAVYYSAQLQLPDSMTKSE  181

Query  568   KKEIAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSG  747
             KKE AE+TI+EMGLQDAMNTRIGG        G QKRRVSIC+E+LTRPKLLFLDEP+SG
Sbjct  182   KKERAEVTIREMGLQDAMNTRIGGWGVKGLSGG-QKRRVSICIELLTRPKLLFLDEPTSG  240

Query  748   LDSAASFYVMSKIMDL-ASEG--RTVVASIHQPSTEVfslftslcllssGRVVYFGPASA  918
             LDSAAS+YVMS+I +L   +G  RT+V SIHQPS+EVF LF SL LLSSGR VYFGPASA
Sbjct  241   LDSAASYYVMSRIANLDKGDGTPRTIVTSIHQPSSEVFQLFDSLFLLSSGRTVYFGPASA  300

Query  919   AIQFFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKS  1098
             A QFF   GFPCPTLQNPSDHFLKTINKDF+   +D+EQG     P E  I+ L+ SYK 
Sbjct  301   ANQFFTLTGFPCPTLQNPSDHFLKTINKDFE---QDIEQGVT--TPAEIAIDTLIRSYKE  355

Query  1099  YHRYREVQGQVAEISKQE-GEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIY  1275
                ++ VQ QVAE+ KQ+ GE L+K +RA F TQ +VLT+RSF+NM RD GYYWLRL IY
Sbjct  356   SETFQHVQRQVAELCKQDFGEKLEKRNRAGFLTQCLVLTKRSFVNMHRDRGYYWLRLAIY  415

Query  1276  ITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNG  1455
             I++A+GLG +Y+++G+G  SIQAR S+L FI++F TFMAIGGFPSFVEDMKVF++E LNG
Sbjct  416   ISIALGLGTVYHELGHGYRSIQARGSLLMFISTFLTFMAIGGFPSFVEDMKVFERERLNG  475

Query  1456  HYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESL  1635
             HYG  AFA  NT SS+P+L++IS+IPG I Y+  GLQ  F HF +F+ V+   M+LVESL
Sbjct  476   HYGVCAFAFGNTFSSVPFLVMISVIPGAIVYYLAGLQTGFEHFVFFSCVLFACMMLVESL  535

Query  1636  MMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGL  1815
             MMI+AS+VPNYLMGIIAGAG+Q LM+L GG+F+LP D+P   W+YP+Y+I FHKYAYQGL
Sbjct  536   MMIVASIVPNYLMGIIAGAGIQGLMMLSGGFFQLPSDIPGPVWKYPMYHIAFHKYAYQGL  595

Query  1816  YKNEFQGLRLP-EETGQ--IITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllv  1986
             +KNEF+G   P  E G    ++GE++LRE  QVEMG+SKW+++ VL+ M V+ R++FL++
Sbjct  596   FKNEFKGTMFPASEAGGPFTLSGEQILRERWQVEMGYSKWVNVAVLLGMVVLYRILFLVI  655

Query  1987  vKASEKAKHVVKAVMRVSPKQSHQVVA  2067
             +K +EK K +  A++   PK+S QV+A
Sbjct  656   IKTTEKVKTIKTALLSTPPKRSLQVLA  682



>ref|XP_002525837.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF36531.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=701

 Score =   734 bits (1894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/623 (63%), Positives = 489/623 (78%), Gaps = 15/623 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             FL WEDLWV VS+G+KG+K+IL+G+TGYA+PGEL+ IMGPSGCGKSTLLDALAGRL   T
Sbjct  71    FLAWEDLWVNVSNGKKGSKSILQGVTGYAKPGELMVIMGPSGCGKSTLLDALAGRLGSNT  130

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
              QSG ILING  Q LAYGTSAYVTQ+DTL  TLTVREAV+YSAQLQLP S+ +S+KKE A
Sbjct  131   SQSGSILINGHKQRLAYGTSAYVTQDDTLMTTLTVREAVHYSAQLQLPDSMSKSKKKERA  190

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             EMTI+EMGLQD+  TRIGG        G Q+RRVSIC+E+LTRP+LLFLDEP+SGLDSAA
Sbjct  191   EMTIQEMGLQDSTETRIGGWGAKGLSGG-QRRRVSICIEMLTRPRLLFLDEPTSGLDSAA  249

Query  763   SFYVMSKIMDLASE---GRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFF  933
             SFYV+S+I  L  +   GRT++ASIHQPSTEVF LF  LCLLSSG+VV+FGPASAA +FF
Sbjct  250   SFYVLSRIASLDQKDGIGRTIIASIHQPSTEVFQLFHCLCLLSSGKVVFFGPASAANEFF  309

Query  934   ETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYR  1113
               NGFPCPTLQNPSDHFLKTINKDF+   +D+E+G   G   EE I  LV SYKS H Y+
Sbjct  310   ALNGFPCPTLQNPSDHFLKTINKDFE---KDLERGLGYGTTAEEAIATLVKSYKSSHNYQ  366

Query  1114  EVQGQVAEISKQE-GEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAV  1290
             +V+  VAEI KQ+ G + K+ +RA F TQS++LTRRS +NMFRDLGYYWLRL IY+ LAV
Sbjct  367   QVRRHVAEICKQDSGALQKERTRASFITQSLILTRRSSVNMFRDLGYYWLRLAIYVALAV  426

Query  1291  GLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCG  1470
             GL  ++ ++G   +SI+ R S+L FIASF TFMAIGGFPSFVEDMK+F++E LNGHYG  
Sbjct  427   GLATVFGNLGSSYASIKDRGSLLMFIASFLTFMAIGGFPSFVEDMKIFQRERLNGHYGTA  486

Query  1471  AFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIA  1650
             AF + NT S++P+LLLISL+PG I YF  GL     HF YF   +   M+LVESLMM +A
Sbjct  487   AFVLGNTFSAIPFLLLISLVPGAITYFLPGLHGGAEHFLYFICSLFACMMLVESLMMTVA  546

Query  1651  SLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEF  1830
             S+VPN+LMGII GAG+Q+LMIL GG+FRLP+DLP  FW+YP++YI FH+YAYQG++KNEF
Sbjct  547   SIVPNFLMGIITGAGIQSLMILAGGFFRLPRDLPAPFWKYPMHYIAFHRYAYQGMFKNEF  606

Query  1831  QGLRLPEETGQI-----ITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKA  1995
             +GL  P    QI     ++GEE+LR   QV++ +SKW+DL +L+ M VV R++FL ++  
Sbjct  607   EGLTFPNN--QIGGPSEVSGEEILRNIWQVDLSYSKWVDLAILLGMVVVYRLLFLGIISI  664

Query  1996  SEKAKHVVKAVMRVSPKQSHQVV  2064
              EK K ++ A++  SPKQ+ Q++
Sbjct  665   KEKVKPMITALISASPKQTTQIM  687



>ref|XP_007201741.1| hypothetical protein PRUPE_ppa002200mg [Prunus persica]
 gb|EMJ02940.1| hypothetical protein PRUPE_ppa002200mg [Prunus persica]
Length=702

 Score =   733 bits (1893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/628 (64%), Positives = 496/628 (79%), Gaps = 18/628 (3%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKG-----NKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGR  387
             FLTWEDLWVTV    K      +++IL+G+TGYARPGELLAIMGPSGCGKSTLLDAL GR
Sbjct  66    FLTWEDLWVTVVSKAKNENGSRSRSILQGVTGYARPGELLAIMGPSGCGKSTLLDALGGR  125

Query  388   LELTTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSE  567
             L   TR++G+ILING+ Q LAYGTSAYVTQ+DTL  TLTV EAVYYSAQLQLP S+ ++E
Sbjct  126   LSSNTRKTGNILINGQKQALAYGTSAYVTQDDTLITTLTVSEAVYYSAQLQLPDSMSKAE  185

Query  568   KKEIAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSG  747
             KKE AE+TI+EMGLQDAMNTRIGG        G QKRRVSIC+E+LTRP LLFLDEP+SG
Sbjct  186   KKERAEITIREMGLQDAMNTRIGGWGSKGLSGG-QKRRVSICIELLTRPNLLFLDEPTSG  244

Query  748   LDSAASFYVMSKIMDL-ASEG--RTVVASIHQPSTEVfslftslcllssGRVVYFGPASA  918
             LDSAAS+YVMS+I +L  ++G  RTV+ SIHQPS+EVF LF +LCLLS+GR VYFGPASA
Sbjct  245   LDSAASYYVMSRIANLDKTDGTPRTVITSIHQPSSEVFQLFDNLCLLSAGRTVYFGPASA  304

Query  919   AIQFFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKS  1098
             A QFF   GFPCPTLQNPSDHFLKTINKDF+   +D+EQG     PTE  I+ L+ SYK 
Sbjct  305   ANQFFSLCGFPCPTLQNPSDHFLKTINKDFE---QDIEQGMVGRTPTEVAIDTLIKSYKE  361

Query  1099  YHRYREVQGQVAEISKQE-GEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIY  1275
                Y++VQ QVAE+ KQ+ GE L+K S A F TQS VLTRRSF+NM+RD GYYWLRL +Y
Sbjct  362   SESYQQVQRQVAELCKQDFGEELEKRSHAGFLTQSFVLTRRSFMNMYRDRGYYWLRLAVY  421

Query  1276  ITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNG  1455
             IT+A+GLG +Y D+G+   SIQAR S++ F++SF TFMAIGGFPSFVEDMKVF++E LNG
Sbjct  422   ITIALGLGTIYQDLGHSYESIQARGSLIMFVSSFLTFMAIGGFPSFVEDMKVFERERLNG  481

Query  1456  HYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESL  1635
             HYG  AF  ANT SSLP+L+LIS+IPG I Y+  GL + F HF YFA V+   M+LVESL
Sbjct  482   HYGVSAFVFANTFSSLPFLILISVIPGAITYYVAGLHKGFEHFVYFACVLFACMMLVESL  541

Query  1636  MMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGL  1815
             MMI+AS+VPN+LMGIIAGAG+Q LMI+ GG+F+LP ++PK  W++P+YYI FHKYAYQGL
Sbjct  542   MMIVASIVPNFLMGIIAGAGIQGLMIMCGGFFQLPNNIPKPLWKFPLYYIAFHKYAYQGL  601

Query  1816  YKNEFQGLRLP--EETGQI--ITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfll  1983
             +KNEF G   P  ++ G+   ++GE +LR+  QVEMG+SKW+DL +LV M ++ RV+FL+
Sbjct  602   FKNEFMGTTFPSSDQGGKTSSLSGEHILRDKWQVEMGYSKWVDLAILVGMILLYRVLFLV  661

Query  1984  vvKASEKAKHVVKAVMRVS-PKQSHQVV  2064
             ++KA EK K +   ++ +   K+S Q++
Sbjct  662   IIKAIEKVKTIGTTLLAMPLNKRSMQIL  689



>ref|XP_008358343.1| PREDICTED: ABC transporter G family member 11-like [Malus domestica]
 ref|XP_008358344.1| PREDICTED: ABC transporter G family member 11-like [Malus domestica]
Length=685

 Score =   732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/624 (64%), Positives = 486/624 (78%), Gaps = 16/624 (3%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKG----NKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRL  390
             FLTWEDLWVTV   +      +++IL+GLTGYA+PGELLAIMGPSGCGKSTLLDAL GRL
Sbjct  55    FLTWEDLWVTVVSKKNSIGSSSRSILQGLTGYAKPGELLAIMGPSGCGKSTLLDALGGRL  114

Query  391   ELTTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEK  570
                 RQ+G ILING  Q LAYGTSAYVTQ+DTL  TLTV+EAVYYSAQLQLP  + +SEK
Sbjct  115   SSNARQTGXILINGHKQALAYGTSAYVTQDDTLMTTLTVKEAVYYSAQLQLPDFMTKSEK  174

Query  571   KEIAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGL  750
             KE AE+TI+EMGLQDAMNTRIGG        G QKRRVSIC+E+LT PKLLFLDEP+SGL
Sbjct  175   KERAEVTIREMGLQDAMNTRIGGWGAKGLSGG-QKRRVSICIELLTSPKLLFLDEPTSGL  233

Query  751   DSAASFYVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAA  921
             DSAAS+YVMS+I +L       RT+V SIHQPS+EVF LF SLCLLSSGR VYFGPASAA
Sbjct  234   DSAASYYVMSRIANLDKXDGTPRTIVTSIHQPSSEVFQLFDSLCLLSSGRTVYFGPASAA  293

Query  922   IQFFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSY  1101
               FF   GFPCPTLQNPSDHFL+TINKDF+   +D+EQG     PTE  I+ L+ SYK  
Sbjct  294   NHFFTLTGFPCPTLQNPSDHFLRTINKDFE---QDIEQGAT--TPTEVAIDTLIRSYKES  348

Query  1102  HRYREVQGQVAEISKQE-GEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYI  1278
               +++VQ QVAE+ KQ+ GE L+K SRA F TQS+VLTRRSF+NM RD GYYWLRL IYI
Sbjct  349   ETFQQVQRQVAELCKQDSGEKLEKRSRAGFLTQSLVLTRRSFVNMHRDRGYYWLRLAIYI  408

Query  1279  TLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGH  1458
             ++ +GLG +Y+++G+G  SIQAR  +L +I+SF TFMAIGGFPSFVEDMKVF++E LNGH
Sbjct  409   SMTLGLGTIYHELGHGYRSIQARVXLLTYISSFLTFMAIGGFPSFVEDMKVFERERLNGH  468

Query  1459  YGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLM  1638
             YG  AFA  NT SS+P+L++IS+IPG I Y+  GL     HF YF+ VIL  M+LVESLM
Sbjct  469   YGVCAFAFGNTFSSVPFLIMISVIPGAIXYYLAGLHTGLEHFVYFSCVILACMMLVESLM  528

Query  1639  MIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLY  1818
             MI+AS+VPNYLMGIIAGAG+Q L++L GG+F+LP DLPK  W+YP+YYI FHKYAYQGL+
Sbjct  529   MIVASIVPNYLMGIIAGAGIQGLLMLCGGFFQLPSDLPKPVWKYPMYYIAFHKYAYQGLF  588

Query  1819  KNEFQGLRLP--EETGQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvK  1992
             KNEFQG   P  E  G  I+GE++LR   QVEM +SKW+D+ VL  M V+ RV+FL+++K
Sbjct  589   KNEFQGTMFPXSEAGGXFISGEQILRXRXQVEMRYSKWVDVAVLFGMIVLYRVMFLVILK  648

Query  1993  ASEKAKHVVKAVMRVSPKQSHQVV  2064
              +EK K    A++ +  K++ QV+
Sbjct  649   TTEKVKTSTTALLSMPTKRNMQVL  672



>ref|XP_006366225.1| PREDICTED: ABC transporter G family member 11-like [Solanum tuberosum]
Length=733

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/614 (64%), Positives = 489/614 (80%), Gaps = 9/614 (1%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             +LTW+DLWVTV D + G +AIL+GLTGY +PGE+LAIMGPSGCGKSTLLD LAGRL+  T
Sbjct  115   YLTWKDLWVTVPDKKSGRRAILQGLTGYVQPGEVLAIMGPSGCGKSTLLDTLAGRLDSNT  174

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             RQ+G+ILINGR Q+LA+GTSAYVTQ+DTL  TLTV+EA+YYSAQLQLP S+ RSEK+E A
Sbjct  175   RQTGEILINGRRQSLAFGTSAYVTQDDTLMTTLTVKEAIYYSAQLQLPDSMSRSEKRERA  234

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             E TI+EMGLQDAMNTRIGG        G QKRRVSIC+EIL RPKLLFLDEP+SGLDSAA
Sbjct  235   EQTIREMGLQDAMNTRIGGWSVKGLSGG-QKRRVSICIEILKRPKLLFLDEPTSGLDSAA  293

Query  763   SFYVMSKIMDLASE-GRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             S++VM+KI+ LA + GRT+VASIHQPS+EVF LF +LCLLSSGR+VYFG  S A ++F  
Sbjct  294   SYHVMNKIVQLAKQDGRTIVASIHQPSSEVFQLFHNLCLLSSGRIVYFGNISNANEYFAL  353

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREV  1119
             NGFPCPT++NPSDH+L+TINKDFD    D+E+G        E I+ILV SYK+    ++V
Sbjct  354   NGFPCPTMRNPSDHYLRTINKDFD---IDIEKGVGGKATATEAIDILVKSYKTSQGCQQV  410

Query  1120  QGQVAEISKQEG-EVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGL  1296
             Q +V++I +Q G E  KK S+A F TQ +VLTRRSF+NM+RDLGYYWLR  IYI L + +
Sbjct  411   QRKVSKICQQSGGEEAKKGSQAGFVTQCMVLTRRSFVNMYRDLGYYWLRFAIYIALCLCV  470

Query  1297  GYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAF  1476
             G +++D+G+   SIQAR S+L F+A+F TFMAIGGFPSFVEDMK+F +E LNGHYG  A+
Sbjct  471   GTIFHDIGHDYGSIQARGSMLMFVAAFLTFMAIGGFPSFVEDMKLFTRERLNGHYGVAAY  530

Query  1477  AIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASL  1656
              + NT SS+PYL+LIS++PG +AY+ VGLQ+ F HFAYFALV+   M+LVESLMMI+AS+
Sbjct  531   VVGNTFSSIPYLILISVVPGALAYYLVGLQKGFDHFAYFALVLFATMMLVESLMMIVASI  590

Query  1657  VPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQG  1836
             VP++LMGII GAG+Q +M+L GG+FRLP DLPK FW+YP+YYI FHKYA QG YKNEF G
Sbjct  591   VPDFLMGIITGAGIQGVMMLNGGFFRLPNDLPKPFWKYPMYYIAFHKYANQGFYKNEFLG  650

Query  1837  LRLPEETGQ---IITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKA  2007
             L  P E  +   II+GEE+LR   QV+MG+SKW+D+ +L  M ++ R++FL ++K  EK 
Sbjct  651   LNFPNEQIRGPAIISGEEILRNVWQVQMGYSKWVDVAILFGMVILYRLMFLGIIKTVEKI  710

Query  2008  KHVVKAVMRVSPKQ  2049
             K +++A M  S K 
Sbjct  711   KPMIRAFMARSSKN  724



>ref|XP_002270573.2| PREDICTED: ABC transporter G family member 11 [Vitis vinifera]
Length=687

 Score =   730 bits (1885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/670 (62%), Positives = 506/670 (76%), Gaps = 19/670 (3%)
 Frame = +1

Query  70    DSRIRQCDSNRINIVPLDMETAGGVSSMPKDKRPgggaeaakvdvgggggvFLTWEDLWV  249
             DS   Q  +  I   PL+MET            P          V   GG+FLTWEDL V
Sbjct  17    DSAYLQSQNKPITRGPLEMETV-----------PRPRPREVLGGVDKEGGIFLTWEDLSV  65

Query  250   TVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTRQSGDILIN  429
             T S+G+ G++ +L+GLTG+ARPGE+LAIMGPSGCGKSTLLDALAGRL     QSG +L+N
Sbjct  66    TASNGKGGSRLLLQGLTGFARPGEVLAIMGPSGCGKSTLLDALAGRLGSNISQSGMVLVN  125

Query  430   GRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAEMTIKEMGL  609
             G  QTLAYGTSAYVTQ+DTL  TLTV EAV YSA LQLP S+ +SEKKE A+MTI+EMGL
Sbjct  126   GHQQTLAYGTSAYVTQDDTLITTLTVGEAVCYSALLQLPDSMSKSEKKERADMTIREMGL  185

Query  610   QDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAASFYVMSKIM  789
             QDA+NTRIGG        G QKRRVSIC+EILT PKLLFLDEP+SGLDSAAS+YVMS+I 
Sbjct  186   QDAVNTRIGGWGVKGISGG-QKRRVSICIEILTHPKLLFLDEPTSGLDSAASYYVMSRIT  244

Query  790   DLASE-GRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNGFPCPTLQ  966
              L  + GRT++ SIHQPS EVF+LF +LCLLSSGR VYFGPA AA +FF +NGFPCPT Q
Sbjct  245   GLDRQHGRTIITSIHQPSCEVFALFDNLCLLSSGRTVYFGPAHAADEFFSSNGFPCPTHQ  304

Query  967   NPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREVQGQVAEISK  1146
             NPSDHFLKTINKDF+   +D+EQG       EE I+IL  +YKS   +++VQ QVA+I K
Sbjct  305   NPSDHFLKTINKDFE---QDIEQGFGGKKSKEEAIDILTKAYKSSGNFQQVQSQVAKIHK  361

Query  1147  QEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLGYMYNDVGYG  1326
             +EG  LKK S A F  Q +VLTRRSF+NM+RDLGYYWLRL +YI L + LG ++ +VG+ 
Sbjct  362   KEGGALKKRSHASFLNQCLVLTRRSFVNMYRDLGYYWLRLAVYIALTIALGTIFYNVGHS  421

Query  1327  NSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFAIANTlsslp  1506
             NSSI+ R ++L ++ASF TFM IGGFPSFVEDMKVF +E LNGHYG  AF + NTLSS+P
Sbjct  422   NSSIKDRGAMLMYVASFLTFMTIGGFPSFVEDMKVFGRERLNGHYGSSAFVVGNTLSSIP  481

Query  1507  ylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLVPNYLMGIIA  1686
             YLL+ISLIPG IAY+  GLQ+   H  Y+ALV+   M+LVE LMMI+AS+VPN+LMGII 
Sbjct  482   YLLVISLIPGAIAYYLTGLQKGCEHSIYYALVLFTCMILVEGLMMIVASIVPNFLMGIIT  541

Query  1687  GAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGLRLP-EETG-  1860
             GAG+Q L++L GG+FRLP D PK FWRYP+YY+ F+KYAYQGLYKNEFQGL+ P +E G 
Sbjct  542   GAGIQGLLMLSGGFFRLPDDFPKPFWRYPLYYLSFNKYAYQGLYKNEFQGLKFPNDEAGG  601

Query  1861  -QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAKHVVKAVMRV  2037
               II+GEE+LR+  QVEM +SKWIDL +L+ M V+ R++FL+ +K +EK   +VKA++  
Sbjct  602   PPIISGEEILRKRWQVEMVYSKWIDLAILLGMAVLYRLLFLITIKTTEKVIPLVKALVSR  661

Query  2038  SPKQSHQVVA  2067
               K+S QV+A
Sbjct  662   PSKRSKQVMA  671



>emb|CBI35723.3| unnamed protein product [Vitis vinifera]
Length=891

 Score =   736 bits (1900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/619 (65%), Positives = 492/619 (79%), Gaps = 9/619 (1%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             FLTW+DLWVTV D + G + IL+ LTGYA+PGE+LAIMGPSGCGKSTLLDALAGRL   T
Sbjct  268   FLTWKDLWVTVPDQQSGRRPILQRLTGYAQPGEVLAIMGPSGCGKSTLLDALAGRLGSNT  327

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             RQ+G+ILINGR Q LA+GTSAYVTQ+DTL  TLTVREAV+YSAQLQLP S+P S KKE A
Sbjct  328   RQAGEILINGRKQRLAFGTSAYVTQDDTLMTTLTVREAVHYSAQLQLPGSMPTSAKKERA  387

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             EMTI EMGLQD + TRIGG        G QKRRVSIC+EILTRPKLLFLDEP+SGLDSAA
Sbjct  388   EMTICEMGLQDCIETRIGGWGKKGLSGG-QKRRVSICIEILTRPKLLFLDEPTSGLDSAA  446

Query  763   SFYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             S++VM +I+ LA  EG TV+ASIHQPS+EVF LF +LCLLSSG+ VYFGPAS A +FF  
Sbjct  447   SYHVMDRIVKLAHREGITVIASIHQPSSEVFELFHNLCLLSSGKTVYFGPASMANEFFAK  506

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREV  1119
             NGFPCP+L+NPSDH+L+TINKDFD    D+E+G      TEE INILV +YKS    ++V
Sbjct  507   NGFPCPSLRNPSDHYLRTINKDFD---LDIEEGLGGATSTEEAINILVRAYKSSETCQQV  563

Query  1120  QGQVAEISKQEGEVL-KKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGL  1296
             QG+V+EI +Q+G VL KK S+A F TQ +VLT+RSF+NM+RDLGYYWLRL IYI L + +
Sbjct  564   QGRVSEICQQKGGVLEKKGSQASFATQCLVLTKRSFVNMYRDLGYYWLRLAIYIALCLCV  623

Query  1297  GYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAF  1476
             G ++ D+G+   SIQAR S+L F+A+F TFMAIGGFPSFVEDMK+F +E LNGHYG GAF
Sbjct  624   GTIFYDIGFSYGSIQARGSMLMFVAAFLTFMAIGGFPSFVEDMKIFGRERLNGHYGVGAF  683

Query  1477  AIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASL  1656
              I N+LSS+PYLL+ISLIPG IAY+ V LQ+ F HF YFA+++ + M+LVESLMM++AS+
Sbjct  684   VIGNSLSSIPYLLMISLIPGAIAYYLVHLQKGFEHFVYFAILLFVCMMLVESLMMMVASI  743

Query  1657  VPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQG  1836
             VP++LMGII GAG+Q +M+L GG+FRLP DLP  FW+YP+YYI FHKYA QG YKNEF+G
Sbjct  744   VPDFLMGIITGAGIQGVMMLCGGFFRLPNDLPNPFWKYPMYYIAFHKYANQGFYKNEFEG  803

Query  1837  LRLPEET---GQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKA  2007
             L  P         ITGEE+L+   QVEMG+SKWIDL +L  M V+ R++FL ++K  EK 
Sbjct  804   LTFPNNQVGGAPTITGEEILQNVWQVEMGYSKWIDLAILFGMVVLYRLMFLGIIKTVEKV  863

Query  2008  KHVVKAVMRVSPKQSHQVV  2064
             K +++ +  V P++S Q++
Sbjct  864   KPMIRGLFAVPPEKSKQIL  882



>ref|XP_011043109.1| PREDICTED: ABC transporter G family member 11-like [Populus euphratica]
Length=670

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/620 (64%), Positives = 485/620 (78%), Gaps = 10/620 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             FLTW DL VTV + + G++ IL+GLTGYA+PGELLAIMGPSGCGKSTLLDALAGRL   T
Sbjct  50    FLTWNDLCVTVPNRKHGSRPILQGLTGYAQPGELLAIMGPSGCGKSTLLDALAGRLGSNT  109

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             RQ G+ILING  Q LAYGTSAYVTQ+DTL  TLTVREAVYYSAQLQLP S+ + EK E A
Sbjct  110   RQVGEILINGHKQALAYGTSAYVTQDDTLVTTLTVREAVYYSAQLQLPDSMSQVEKMERA  169

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             EMTI+EMGLQDAMNTRIGG        G QKRRVSIC+EILT PKLLFLDEP+SGLDSAA
Sbjct  170   EMTIREMGLQDAMNTRIGGWGVKGLSGG-QKRRVSICIEILTHPKLLFLDEPTSGLDSAA  228

Query  763   SFYVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFF  933
             S+YVM  I  L  +    RTV+ASIHQP +EVF LF++LCLLSSG+ VYFGPASAA +FF
Sbjct  229   SYYVMRGIARLDHKDGVRRTVIASIHQPGSEVFQLFSNLCLLSSGKTVYFGPASAANEFF  288

Query  934   ETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYR  1113
               N FPCP LQNPSDHFL TINKDF+   +D+EQG    IP EEVINILV SYKS   ++
Sbjct  289   ALNSFPCPPLQNPSDHFLNTINKDFE---KDLEQGLDDAIPKEEVINILVKSYKSSDYWQ  345

Query  1114  EVQGQVAEISKQEGEVLK-KSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAV  1290
             +VQ +V EI K+  E L+ +   A F TQS+VLT+RSF+NMFRDLGYYWLRL IY+ L  
Sbjct  346   QVQVKVEEICKEHFEALESRRDHAGFLTQSLVLTKRSFVNMFRDLGYYWLRLAIYVGLGY  405

Query  1291  GLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCG  1470
             GL  +Y+D+G    SIQAR S+L F+++F TFMAIGGFPSFVE+MKVF++E LNGHYG  
Sbjct  406   GLSSIYHDLGSSYGSIQARGSLLMFVSTFLTFMAIGGFPSFVEEMKVFERERLNGHYGAT  465

Query  1471  AFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIA  1650
             +FAI NT S++P+LLLISLIPG IAY+P GL + + HF YFA  +   +L+VES+MM +A
Sbjct  466   SFAIGNTFSAIPFLLLISLIPGAIAYYPSGLHKGYEHFLYFASTLFACLLMVESMMMAVA  525

Query  1651  SLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEF  1830
             S+VPN+LMGII GAG+Q LM+LGGG+FRLP DLPK FW+YP+YY+ FH+YAYQG++KNEF
Sbjct  526   SIVPNFLMGIITGAGIQGLMVLGGGFFRLPDDLPKPFWKYPLYYVAFHRYAYQGMFKNEF  585

Query  1831  QGLRLPEETGQ-IITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKA  2007
             +GL+     G  +I GEE+LR+  Q+EMG SKW+DL +L+ M V  R++FL ++K +E  
Sbjct  586   EGLKFSNYQGNGLINGEEILRDVWQMEMGSSKWVDLAILLGMVVFYRLLFLAIIKTTETI  645

Query  2008  KHVVKAVM-RVSPKQSHQVV  2064
             K ++  +M  V+P Q+ Q++
Sbjct  646   KPIIPGLMPYVNPNQTFQIM  665



>ref|XP_006366235.1| PREDICTED: ABC transporter G family member 11-like [Solanum tuberosum]
Length=660

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/616 (63%), Positives = 488/616 (79%), Gaps = 10/616 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             +LTW+DLWVTV D + G +AIL+GLTGY +PGE+LAIMGPSGCGKSTLLD LAGRL+  T
Sbjct  41    YLTWKDLWVTVPDKKSGRRAILQGLTGYVQPGEVLAIMGPSGCGKSTLLDTLAGRLDSNT  100

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             RQ+G+ILINGR Q+L++GTSAYVTQ+D L  TLTV+EA+YYSAQLQLP S+ RSEK+E A
Sbjct  101   RQTGEILINGRRQSLSFGTSAYVTQDDILMTTLTVKEAIYYSAQLQLPDSMSRSEKRERA  160

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             E TI+EMGLQDAMNTRIGG        G QKRRVSIC+EIL RPKLLFLDEP+SGLDSAA
Sbjct  161   EQTIREMGLQDAMNTRIGGWSVKGLSGG-QKRRVSICIEILKRPKLLFLDEPTSGLDSAA  219

Query  763   SFYVMSKIMDLASE-GRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             S++VM+KI+ LA + GRT+VASIHQPS+EVF LF +LCLLSSGR+VYFG  S A ++F  
Sbjct  220   SYHVMNKIVQLAKQDGRTIVASIHQPSSEVFQLFHNLCLLSSGRIVYFGNISNANEYFAL  279

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTE-EVINILVNSYKSYHRYRE  1116
             NGFPCPT++NPSDH+L+TINKDFD    D+E+G   G  T  E I+ILV SYK+    ++
Sbjct  280   NGFPCPTMRNPSDHYLRTINKDFD---VDIEKGVGGGKATATEAIDILVKSYKTSQGCQQ  336

Query  1117  VQGQVAEISKQEG-EVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             VQ +V+EI +Q G E   K S+A F TQ +VLTRRSF+NM+RDLGYYWLR  IYI L + 
Sbjct  337   VQRKVSEICQQSGGEEANKGSQAGFVTQCMVLTRRSFVNMYRDLGYYWLRFAIYIALCLC  396

Query  1294  LGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGA  1473
             +G +++++G+   SIQAR S+L F+A+F TFMAIGGFPSFVEDMK+F +E LNGHYG  A
Sbjct  397   VGTIFHNIGHDYGSIQARGSMLMFVAAFLTFMAIGGFPSFVEDMKIFTRERLNGHYGVAA  456

Query  1474  FAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIAS  1653
             + + NT SS+PYL+LIS+IPG IAY+ VGLQ+ F HF +F+LV+ + M+LVESLMMI+AS
Sbjct  457   YVVGNTFSSIPYLILISVIPGAIAYYLVGLQKGFDHFVHFSLVLFVTMMLVESLMMIVAS  516

Query  1654  LVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQ  1833
             +VP++LMGII GAG+Q +M+L GG+FRLP DLPK FW+YP+YYI FHKY  QG YKNEF 
Sbjct  517   IVPDFLMGIITGAGIQGVMMLNGGFFRLPNDLPKPFWKYPMYYIAFHKYVNQGFYKNEFL  576

Query  1834  GLRLPEETGQ---IITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEK  2004
             GL  P E  +   II+GEE+LR   QV+MG+SKW+D+ +L  M ++ R +FL ++K  EK
Sbjct  577   GLNFPNEQIRGPAIISGEEILRNVWQVQMGYSKWVDVAILFGMVILYRFMFLGMIKTVEK  636

Query  2005  AKHVVKAVMRVSPKQS  2052
              K +++A M  S K S
Sbjct  637   VKPIIRAFMARSSKNS  652



>ref|XP_011031060.1| PREDICTED: ABC transporter G family member 11-like [Populus euphratica]
Length=729

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/618 (64%), Positives = 488/618 (79%), Gaps = 11/618 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
              +TW DLWVTV DG+ G + IL GLTGYA+PGE+LAIMGPSG GK+TLLDALAGRL   T
Sbjct  118   LMTWIDLWVTVPDGKNGGQPILHGLTGYAQPGEVLAIMGPSGSGKTTLLDALAGRLSSNT  177

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             +Q+G+ILINGR +TLA+GTSAYVTQ+DTL  TLTVREAVYYSAQLQLP  +  SEKKE A
Sbjct  178   QQTGEILINGRKETLAFGTSAYVTQDDTLMTTLTVREAVYYSAQLQLPDFMSTSEKKERA  237

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             E+TI+EMGLQ + +TRIGG        G QKRRVSIC+EILT+PKLLFLDEP+SGLDSAA
Sbjct  238   EITIREMGLQGSADTRIGGWGMKGISGG-QKRRVSICIEILTQPKLLFLDEPTSGLDSAA  296

Query  763   SFYVMSKIMDLA-SEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             S++VM+ I+ LA  EGRT+VASIHQPS+EVF LF +LCLLSSGR VYFGP S A QFF +
Sbjct  297   SYHVMNHIVKLARQEGRTIVASIHQPSSEVFELFHNLCLLSSGRTVYFGPVSMAEQFFSS  356

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREV  1119
             NGFPC  L+NPSDH+L+TIN DFD    D+EQG   G  TEE IN+LV SYKS   + +V
Sbjct  357   NGFPCAPLRNPSDHYLRTINADFD---MDIEQG--NGGSTEEAINVLVKSYKSSEIFLQV  411

Query  1120  QGQVAEISKQEGEVL-KKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGL  1296
             + +VA I +Q+G +L KK S+A F TQ +VLTRRSF+NM+RDLGYYWLRL IYI L + +
Sbjct  412   RQRVASICEQKGGILEKKGSQASFITQCLVLTRRSFVNMYRDLGYYWLRLAIYIALCLCV  471

Query  1297  GYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAF  1476
             G ++ D+G    SIQAR S+L F+A+F TFMAIGGFPSFVEDMK+F +E LNGHYG GAF
Sbjct  472   GTIFYDIGLTFGSIQARGSMLMFVAAFLTFMAIGGFPSFVEDMKIFGRERLNGHYGVGAF  531

Query  1477  AIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASL  1656
              + NTLSS+PYLL+IS+IPG +AY+ VGLQ+   HF  FAL++ + M+LVESLMMI+AS+
Sbjct  532   VVGNTLSSIPYLLMISIIPGAMAYYLVGLQKSLEHFVCFALLLFVCMMLVESLMMIVASI  591

Query  1657  VPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQG  1836
             VP++LMGII GAG+Q +M+L GG+FRLP DLPK FWRYP+YYI FHKYA QG YKNEFQG
Sbjct  592   VPDFLMGIITGAGIQGVMMLNGGFFRLPDDLPKPFWRYPMYYIAFHKYANQGFYKNEFQG  651

Query  1837  LRLPEETG---QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKA  2007
             L  P         ITGEE+L+ T QVEMG+SKWID+ +L+ M ++ R++FL ++K  EK 
Sbjct  652   LTFPNNLAGGPPTITGEEILKNTWQVEMGYSKWIDIAILLGMVILYRLMFLGIIKLVEKV  711

Query  2008  KHVVKAVMRVSPKQSHQV  2061
             K +++A   V+P+QS  V
Sbjct  712   KPIIRAAFAVAPRQSKHV  729



>emb|CBI34070.3| unnamed protein product [Vitis vinifera]
Length=608

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/545 (69%), Positives = 445/545 (82%), Gaps = 5/545 (1%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             FLTWEDLWVTVS+G+ G ++IL+GLTGYARPGE+LAIMGPSGCGKSTLLDALAGRL   T
Sbjct  46    FLTWEDLWVTVSNGKSGCRSILQGLTGYARPGEVLAIMGPSGCGKSTLLDALAGRLGSNT  105

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
              QSG IL+NG  Q L+YGTSAYVTQ+DTL  TLTV EAVYYSA LQLP S+ +SEKKE A
Sbjct  106   SQSGIILVNGHKQALSYGTSAYVTQDDTLITTLTVGEAVYYSALLQLPDSMSKSEKKERA  165

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             +MTI+EMGLQD++NTRIGG        G QKRRVSIC+EILT PKLLFLDEP+SGLDSAA
Sbjct  166   DMTIREMGLQDSINTRIGGWGVKGISGG-QKRRVSICIEILTHPKLLFLDEPTSGLDSAA  224

Query  763   SFYVMSKIMDLASE-GRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             S+YVMS+I  L  + GRT++ SIHQPS+EVF+LF +LCLLSSGR VYFGPA  A +FF +
Sbjct  225   SYYVMSRIAGLDRQHGRTIITSIHQPSSEVFALFNNLCLLSSGRTVYFGPAHGADEFFSS  284

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREV  1119
             NGFPCPT QNPSDHFLKTINKDF+   ED+EQG       EE I+IL  +YKS   +++V
Sbjct  285   NGFPCPTHQNPSDHFLKTINKDFE---EDIEQGFGGKKSKEEAIDILTKAYKSSDNFQQV  341

Query  1120  QGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLG  1299
             Q QV+EI KQ+G  LKK S A F  Q +VLTRRSF+NM+RDLGYYWLRL IY+ L V LG
Sbjct  342   QTQVSEIYKQDGGALKKRSHASFLNQCLVLTRRSFVNMYRDLGYYWLRLAIYVALTVALG  401

Query  1300  YMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFA  1479
              ++++VGY NSSI+ R S+L ++ASF TFM+IGGFPSFVEDMKVF +E LNGHYG  +F 
Sbjct  402   TIFHNVGYSNSSIKDRGSMLMYVASFLTFMSIGGFPSFVEDMKVFGRERLNGHYGSSSFL  461

Query  1480  IANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLV  1659
             + NTLSS+PYLL+ISLIPG IAYF  GLQ+E+ HF Y+ALV+   M+LVESLMMI+AS+V
Sbjct  462   VGNTLSSVPYLLVISLIPGAIAYFLTGLQKEYAHFIYYALVLFTCMMLVESLMMIVASVV  521

Query  1660  PNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGL  1839
             PN+LMGII GAG+Q L+ILGGG+FRLP DLP +FWRYP+YYI F++YAYQGLYKNEF GL
Sbjct  522   PNFLMGIITGAGIQGLLILGGGFFRLPNDLPNVFWRYPLYYISFNRYAYQGLYKNEFLGL  581

Query  1840  RLPEE  1854
               P  
Sbjct  582   TFPSN  586



>ref|XP_002306299.2| hypothetical protein POPTR_0005s07420g [Populus trichocarpa]
 gb|EEE93295.2| hypothetical protein POPTR_0005s07420g [Populus trichocarpa]
Length=729

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/618 (64%), Positives = 486/618 (79%), Gaps = 11/618 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
              +TW DLWVTV DG+ G + IL GLTGYA+PG +LAIMGPSG GK+TLLDALAGRL   T
Sbjct  118   LMTWNDLWVTVPDGKSGGRPILHGLTGYAQPGGVLAIMGPSGSGKTTLLDALAGRLSSNT  177

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             +Q+G+ILINGR +TLA+GTSAYVTQ+DTL  TLTVREAVYYSAQLQLP S+  SEKKE A
Sbjct  178   QQTGEILINGRKETLAFGTSAYVTQDDTLMTTLTVREAVYYSAQLQLPDSMSTSEKKERA  237

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             E+TI+EMGLQ + +TRIGG        G QKRRVSIC+EILT+PKLLFLDEP+SGLDSAA
Sbjct  238   EITIREMGLQGSADTRIGGWSVKGISGG-QKRRVSICIEILTQPKLLFLDEPTSGLDSAA  296

Query  763   SFYVMSKIMDLA-SEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             S++VM+ I+ LA  EGRT+VASIHQPS+EVF LF +LCLLSSGR VYFGP S A QFF +
Sbjct  297   SYHVMNHIVKLARQEGRTIVASIHQPSSEVFELFHNLCLLSSGRTVYFGPVSMAEQFFSS  356

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREV  1119
             NGFPC  L+NPSDH+L+TIN DFD    D+EQG   G  TEE IN+LV SYKS   + +V
Sbjct  357   NGFPCAPLRNPSDHYLRTINADFD---MDIEQG--HGGSTEEAINVLVKSYKSSEIFLQV  411

Query  1120  QGQVAEISKQEGEVL-KKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGL  1296
               +VA I +Q+G +L KK S+A F TQ +VLTRRSF+NM+RDLGYYWLRL IYI L + +
Sbjct  412   SQRVASICEQKGGILEKKGSQASFITQCLVLTRRSFVNMYRDLGYYWLRLAIYIALCLCV  471

Query  1297  GYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAF  1476
             G ++ D+G    SIQAR S+L F+A+F TFMAIGGFPSFVEDMK+F +E LNGHYG GA+
Sbjct  472   GTIFYDIGLTFGSIQARGSMLMFVAAFLTFMAIGGFPSFVEDMKIFGRERLNGHYGVGAY  531

Query  1477  AIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASL  1656
              + NTLSS+PYLL+ISLIPG +AY+ VGLQ+   HF  FAL++ + M+LVESLMMI+AS+
Sbjct  532   VVGNTLSSIPYLLMISLIPGAMAYYLVGLQKSLEHFVCFALILFVCMMLVESLMMIVASI  591

Query  1657  VPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQG  1836
             VP++LMGII GAG+Q +M+L GG+FRLP DLPK FWRYP+YYI FHKYA QG YKNEFQG
Sbjct  592   VPDFLMGIITGAGIQGVMMLNGGFFRLPDDLPKPFWRYPMYYIAFHKYANQGFYKNEFQG  651

Query  1837  LRLPEETG---QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKA  2007
             L  P         ITGEE+L+ T QVEMG+SKWID+ +L+ M ++ R++FL ++K  EK 
Sbjct  652   LTFPNNLAGGPPTITGEEILKNTWQVEMGYSKWIDIAILLGMVILYRLMFLGIIKLVEKV  711

Query  2008  KHVVKAVMRVSPKQSHQV  2061
             K +++A    +P+QS  V
Sbjct  712   KPIIRAAFAGAPRQSKHV  729



>ref|XP_010937385.1| PREDICTED: ABC transporter G family member 11-like isoform X1 
[Elaeis guineensis]
Length=668

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/619 (63%), Positives = 487/619 (79%), Gaps = 7/619 (1%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             +LTWEDLWVT ++G   ++ IL GLTGYARPGE+LAIMGPSGCGKSTLL+ALAGRL+  T
Sbjct  42    YLTWEDLWVTATNGEGSSRVILAGLTGYARPGEVLAIMGPSGCGKSTLLNALAGRLDSGT  101

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
              QSG +L+NG  Q LA+GTSAYVTQ+D L  TLTVREAVYYSAQLQLP S+ +SEKKE A
Sbjct  102   NQSGHVLVNGWRQRLAFGTSAYVTQDDILMTTLTVREAVYYSAQLQLPDSMTKSEKKERA  161

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             EMTI+EMGLQ+AMNTRIGG        G QKRRVSIC+EILTRPKLLFLDEP+SGLDSAA
Sbjct  162   EMTIREMGLQEAMNTRIGGQASKGISGG-QKRRVSICIEILTRPKLLFLDEPTSGLDSAA  220

Query  763   SFYVMSKIMDLA-SEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             S++VM++I++LA  +GRT++ASIHQPS+EVF LF +LCLLSSG+ VYFGPAS   +FF  
Sbjct  221   SYHVMNRIVNLARHDGRTIIASIHQPSSEVFELFDNLCLLSSGKTVYFGPASLTNEFFAQ  280

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREV  1119
             NGFPCP+L+NPSDH+L+TINKDFD  +E V    ++   T E I+ILV SYK  +  +EV
Sbjct  281   NGFPCPSLRNPSDHYLRTINKDFD--EETVRGSSSQSKTTAEAIDILVKSYKLSNIRQEV  338

Query  1120  QGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLG  1299
             + +VAE+ + EG+V+K  S+A F TQ IVLT+RSF+NM RDLGYYWLRL IY+ L + +G
Sbjct  339   ERRVAEMHRLEGDVVKTRSQASFTTQCIVLTKRSFINMSRDLGYYWLRLAIYVILCLCIG  398

Query  1300  YMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFA  1479
              M+ D+G+  +SIQAR SVL FI++F TFMAIGGFPSFVE+MK+F++E LNGHYG  AF 
Sbjct  399   TMFYDIGHSYASIQARGSVLLFISAFLTFMAIGGFPSFVEEMKIFQRERLNGHYGVTAFM  458

Query  1480  IANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLV  1659
             I+N LSS PYL L+S+IPG +AY+ VGLQ    HF +F +V+  +MLLVE LMMI+AS+V
Sbjct  459   ISNMLSSAPYLALVSIIPGAMAYYLVGLQHGVDHFIFFVVVLYASMLLVEGLMMIVASIV  518

Query  1660  PNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGL  1839
             PNYLMGIIAGAG+QA+MIL  G+FRLP D+PK  WRYPIY+I FHKY  Q  YKNEF GL
Sbjct  519   PNYLMGIIAGAGIQAMMILAAGFFRLPNDIPKPVWRYPIYHIAFHKYTNQAYYKNEFIGL  578

Query  1840  RLPE---ETGQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAK  2010
               P      G  ITGEEV+++  Q+E+G+SKW+DL +L  M ++ RV+FL++VK  EK K
Sbjct  579   TFPNIQAGRGATITGEEVVKDFWQMEVGYSKWVDLAILFGMVILYRVLFLVIVKTGEKVK  638

Query  2011  HVVKAVMRVSPKQSHQVVA  2067
              +++AV+   PK   QV+ 
Sbjct  639   PMIRAVLNGPPKHGIQVMG  657



>ref|XP_010937388.1| PREDICTED: ABC transporter G family member 11-like isoform X2 
[Elaeis guineensis]
Length=704

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/619 (64%), Positives = 477/619 (77%), Gaps = 9/619 (1%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             FLTWEDLWV+ SDG+ G   IL+GL GYA PGE+LAIMGPSGCGKSTLLD LAGRL    
Sbjct  81    FLTWEDLWVSASDGKGGRVPILRGLNGYASPGEVLAIMGPSGCGKSTLLDTLAGRLGSNV  140

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
              Q G+ILING+ Q LA+GTSAYVTQ+D L  TLT+REAVYYSAQLQLP S+ R+EK+E A
Sbjct  141   GQRGEILINGQKQKLAFGTSAYVTQDDVLMTTLTIREAVYYSAQLQLPESMSRAEKRERA  200

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             E TI+EMGL  AM+TRIGG        G QKRRVSIC+EILTRP+LLFLDEP+SGLDSAA
Sbjct  201   EATIREMGLGGAMDTRIGGWASKGISGG-QKRRVSICMEILTRPELLFLDEPTSGLDSAA  259

Query  763   SFYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             S++VM++I  LA  EG TVVA+IHQPS+EVF LF  LCLL+ G  VYFGPAS   +FF  
Sbjct  260   SYHVMNRISRLARREGMTVVAAIHQPSSEVFDLFHGLCLLAYGETVYFGPASTTSEFFAL  319

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGC-ARGIPTEEVINILVNSYKSYHRYRE  1116
             NGFPCP  +NPSDH+L+TINKDF+   +D+E+G     I T EVI  LV SYKS    ++
Sbjct  320   NGFPCPPHRNPSDHYLRTINKDFE---KDIEEGPKVNPITTAEVIETLVKSYKSSIISQQ  376

Query  1117  VQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGL  1296
             V  Q+AEI  + G ++KK S+A F TQS+VLTRRSF+NM+RDLGYYWLR  IYI L + +
Sbjct  377   VAQQIAEIRGRGGALVKKGSQASFLTQSLVLTRRSFVNMYRDLGYYWLRFAIYIALCLCV  436

Query  1297  GYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAF  1476
             G +Y+DVG+   SIQAR S+L FIA+F TFMAIGGFPSFVEDMKVF +E LNGHYG  AF
Sbjct  437   GTIYHDVGHTYGSIQARGSMLMFIAAFLTFMAIGGFPSFVEDMKVFGRERLNGHYGVTAF  496

Query  1477  AIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASL  1656
              IANTLS+ PYL LIS+ PG +AY+ VGLQR   HFAYFALV+ M M+LVE LMMI+AS+
Sbjct  497   VIANTLSATPYLALISVAPGAMAYYLVGLQRRIDHFAYFALVLFMCMMLVEGLMMIVASI  556

Query  1657  VPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQG  1836
             VP++LMGII GAG+Q +M+L GG+FRLP DLPK  WRYP+YYI FHKYA QG YKNEF G
Sbjct  557   VPDFLMGIITGAGIQGVMMLNGGFFRLPDDLPKPVWRYPMYYIAFHKYANQGFYKNEFLG  616

Query  1837  LRLPEETG---QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKA  2007
             L  P         ITGEE+LR+T QVEMG+SKWIDL +L  M ++ RV+FLL+VK +EK 
Sbjct  617   LTFPNNQAGGPPTITGEEILRDTWQVEMGYSKWIDLAILFGMVILYRVLFLLIVKITEKV  676

Query  2008  KHVVKAVMRVSPKQSHQVV  2064
             K ++ A++   PKQS  V+
Sbjct  677   KPMMNALLVKPPKQSTHVM  695



>ref|XP_006426350.1| hypothetical protein CICLE_v10025064mg [Citrus clementina]
 gb|ESR39590.1| hypothetical protein CICLE_v10025064mg [Citrus clementina]
Length=678

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/619 (63%), Positives = 481/619 (78%), Gaps = 11/619 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNK--AILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLEL  396
             FLTW+DL V V  G+K N+  AIL+ LTGY  PG++LAIMGPSGCGKSTLLDALAGRL  
Sbjct  65    FLTWKDLSVVVPSGKKENRKHAILQELTGYVEPGQILAIMGPSGCGKSTLLDALAGRLSS  124

Query  397   TTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKE  576
              T Q+G+ILINGR +TLA+GTSAYVTQEDTL  TLTV EA+YYSAQLQLP S+ RS+K+E
Sbjct  125   NTEQTGEILINGRKETLAFGTSAYVTQEDTLMTTLTVMEAIYYSAQLQLPDSMSRSQKRE  184

Query  577   IAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDS  756
              AEMTI+EMGLQDAM+TRIGG        G QKRRVSIC+EILT PKLLFLDEP+SGLDS
Sbjct  185   RAEMTIREMGLQDAMDTRIGGWNVRGISGG-QKRRVSICIEILTCPKLLFLDEPTSGLDS  243

Query  757   AASFYVMSKIMDLASE-GRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFF  933
             AAS++VM +I++LA E G TVVASIHQPS++VF LF +LCLL+ G+ +YFGPAS   Q F
Sbjct  244   AASYHVMKRIVNLAHEDGITVVASIHQPSSDVFELFHNLCLLAYGKTIYFGPASMTEQLF  303

Query  934   ETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYR  1113
              +NGFPCP+L+NPSDH+L+TINKDF+   ED+E+G  R   TEEVINILVNSYKS   Y 
Sbjct  304   ASNGFPCPSLRNPSDHYLRTINKDFE---EDIEEGIGR-TSTEEVINILVNSYKSSDTYS  359

Query  1114  EVQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             EVQ +V+ I + + E L+K ++A F TQS+VLT+RSF+NM+RDLGYYWLR  IYI L + 
Sbjct  360   EVQERVSIICQHKRETLEKENQASFITQSLVLTKRSFVNMYRDLGYYWLRFAIYIALGLC  419

Query  1294  LGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGA  1473
             +G +++D+G    SIQAR S+L FIA+F TFMAIGGFPSFVEDMK+F +E LNGHYG  +
Sbjct  420   IGTIFHDIGSSYGSIQARGSMLMFIAAFLTFMAIGGFPSFVEDMKIFGRERLNGHYGVAS  479

Query  1474  FAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIAS  1653
             F ++N+ SS PYLLLISLIPG IAY+  GLQ+  GHF YF L + ++M+LVESLMMI+AS
Sbjct  480   FVLSNSFSSTPYLLLISLIPGAIAYYLTGLQKNIGHFLYFVLELFVSMMLVESLMMIVAS  539

Query  1654  LVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQ  1833
             +VP++LMGII GAG+Q +M+L GG+FRLP DLPK  W+YP+YYI FH+Y +QG YKNEF+
Sbjct  540   IVPDFLMGIITGAGIQGIMMLNGGFFRLPNDLPKPVWKYPMYYIAFHRYTFQGFYKNEFE  599

Query  1834  GLRLPEETG---QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEK  2004
             GL  P         ITG+EVL    QV+MGH+KW+DL +L  M    R +F  ++K +EK
Sbjct  600   GLTFPNNQAGGPPTITGKEVLTNIWQVDMGHTKWVDLAILFGMLFFYRFLFWAIIKTTEK  659

Query  2005  AKHVVKAVMRVSPKQSHQV  2061
              K ++K+   VS K   Q+
Sbjct  660   FKPIIKSFRFVSFKPCRQM  678



>ref|XP_010937387.1| PREDICTED: ABC transporter G family member 11-like isoform X1 
[Elaeis guineensis]
Length=735

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/619 (64%), Positives = 477/619 (77%), Gaps = 9/619 (1%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             FLTWEDLWV+ SDG+ G   IL+GL GYA PGE+LAIMGPSGCGKSTLLD LAGRL    
Sbjct  112   FLTWEDLWVSASDGKGGRVPILRGLNGYASPGEVLAIMGPSGCGKSTLLDTLAGRLGSNV  171

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
              Q G+ILING+ Q LA+GTSAYVTQ+D L  TLT+REAVYYSAQLQLP S+ R+EK+E A
Sbjct  172   GQRGEILINGQKQKLAFGTSAYVTQDDVLMTTLTIREAVYYSAQLQLPESMSRAEKRERA  231

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             E TI+EMGL  AM+TRIGG        G QKRRVSIC+EILTRP+LLFLDEP+SGLDSAA
Sbjct  232   EATIREMGLGGAMDTRIGGWASKGISGG-QKRRVSICMEILTRPELLFLDEPTSGLDSAA  290

Query  763   SFYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             S++VM++I  LA  EG TVVA+IHQPS+EVF LF  LCLL+ G  VYFGPAS   +FF  
Sbjct  291   SYHVMNRISRLARREGMTVVAAIHQPSSEVFDLFHGLCLLAYGETVYFGPASTTSEFFAL  350

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGC-ARGIPTEEVINILVNSYKSYHRYRE  1116
             NGFPCP  +NPSDH+L+TINKDF+   +D+E+G     I T EVI  LV SYKS    ++
Sbjct  351   NGFPCPPHRNPSDHYLRTINKDFE---KDIEEGPKVNPITTAEVIETLVKSYKSSIISQQ  407

Query  1117  VQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGL  1296
             V  Q+AEI  + G ++KK S+A F TQS+VLTRRSF+NM+RDLGYYWLR  IYI L + +
Sbjct  408   VAQQIAEIRGRGGALVKKGSQASFLTQSLVLTRRSFVNMYRDLGYYWLRFAIYIALCLCV  467

Query  1297  GYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAF  1476
             G +Y+DVG+   SIQAR S+L FIA+F TFMAIGGFPSFVEDMKVF +E LNGHYG  AF
Sbjct  468   GTIYHDVGHTYGSIQARGSMLMFIAAFLTFMAIGGFPSFVEDMKVFGRERLNGHYGVTAF  527

Query  1477  AIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASL  1656
              IANTLS+ PYL LIS+ PG +AY+ VGLQR   HFAYFALV+ M M+LVE LMMI+AS+
Sbjct  528   VIANTLSATPYLALISVAPGAMAYYLVGLQRRIDHFAYFALVLFMCMMLVEGLMMIVASI  587

Query  1657  VPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQG  1836
             VP++LMGII GAG+Q +M+L GG+FRLP DLPK  WRYP+YYI FHKYA QG YKNEF G
Sbjct  588   VPDFLMGIITGAGIQGVMMLNGGFFRLPDDLPKPVWRYPMYYIAFHKYANQGFYKNEFLG  647

Query  1837  LRLPEETG---QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKA  2007
             L  P         ITGEE+LR+T QVEMG+SKWIDL +L  M ++ RV+FLL+VK +EK 
Sbjct  648   LTFPNNQAGGPPTITGEEILRDTWQVEMGYSKWIDLAILFGMVILYRVLFLLIVKITEKV  707

Query  2008  KHVVKAVMRVSPKQSHQVV  2064
             K ++ A++   PKQS  V+
Sbjct  708   KPMMNALLVKPPKQSTHVM  726



>ref|XP_009609769.1| PREDICTED: ABC transporter G family member 11-like [Nicotiana 
tomentosiformis]
Length=662

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/622 (63%), Positives = 488/622 (78%), Gaps = 20/622 (3%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKG---NKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLE  393
             FLTW DLWVTVS+ + G   N  +L+GLTGYARP ELLA+MGPSG GKSTLL+ALAGRL+
Sbjct  32    FLTWNDLWVTVSNRKLGGSKNILLLQGLTGYARPSELLAVMGPSGSGKSTLLNALAGRLD  91

Query  394   LTTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKK  573
              +TRQSGDILING  Q L+YGTSAYVTQ++ L ATLTV+EAVYYSAQLQL  S  +SEKK
Sbjct  92    FSTRQSGDILINGHKQKLSYGTSAYVTQDEMLIATLTVKEAVYYSAQLQLSDSTTKSEKK  151

Query  574   EIAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLD  753
              IAE +IKEMGLQDAMNTRI G  G       +K+R+SIC+EILT+PKLLFLDEP+SGLD
Sbjct  152   RIAEKSIKEMGLQDAMNTRIVGISGG------EKKRLSICMEILTQPKLLFLDEPTSGLD  205

Query  754   SAASFYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFF  933
             SAAS+YVM++I      G+T++ASIHQPS EVF+LF +LCLLSSGR+VYFGPASAAI+FF
Sbjct  206   SAASYYVMNRI-SRQRFGKTIIASIHQPSAEVFNLFQNLCLLSSGRMVYFGPASAAIEFF  264

Query  934   ETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARG-IPTEEVINILVNSYKSYHRY  1110
              +NGFPCP LQNP DHFLKTINKDFD   ED+EQG + G  PTEEV+++L+ S++SY + 
Sbjct  265   ASNGFPCPPLQNPPDHFLKTINKDFD---EDIEQGSSTGRKPTEEVVDLLIKSFESYQK-  320

Query  1111  REVQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAV  1290
               VQ  V EI ++ GEVL+K S A+F TQ +VLTRRS +NMFRDLGYYW+RL  YI LA+
Sbjct  321   --VQNHVVEICQRGGEVLEKRSNANFTTQCLVLTRRSAVNMFRDLGYYWMRLATYIALAL  378

Query  1291  GLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCG  1470
             G+G +Y DVG    SI+ R  ++AFI SF TFMAIGGFPSFVEDMKVF++E LNGHYGC 
Sbjct  379   GIGSIYYDVGTSYRSIEERGFMVAFIVSFMTFMAIGGFPSFVEDMKVFQRENLNGHYGCF  438

Query  1471  AFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIA  1650
             AF I+NTLSS+PYLLL SL+PG IAYF  G Q  FGHF+YF L++   M++VE+LMM +A
Sbjct  439   AFVISNTLSSIPYLLLNSLVPGAIAYFITGFQSGFGHFSYFTLILFTCMMIVETLMMNVA  498

Query  1651  SLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEF  1830
             ++VPN+L GI+ GA ++ LMIL GG+F+LP  LPK FW+YP+YYI F KYAYQG++KNEF
Sbjct  499   AIVPNFLTGIVIGAAIEGLMILTGGFFQLPDKLPKPFWKYPLYYISFQKYAYQGMFKNEF  558

Query  1831  QGLRLPEE---TGQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASE  2001
             +GL+  +      Q ++GE+VLR+  QVEM +SKWIDL +LVV  ++ R+VF L++K +E
Sbjct  559   EGLKFVDYLNGNNQTMSGEDVLRDRWQVEMTYSKWIDLAILVVTLILYRLVFFLIIKTNE  618

Query  2002  KAKHVVKAVMRVSPKQSHQVVA  2067
             K  + VK  +     ++ Q++ 
Sbjct  619   KVMYAVKRSISDLSNKNRQIMT  640



>gb|KCW54566.1| hypothetical protein EUGRSUZ_I00526 [Eucalyptus grandis]
Length=622

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/618 (64%), Positives = 482/618 (78%), Gaps = 10/618 (2%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW+DLWVTV D   G   IL+GLTGYA PG +LA+MGPSG GKSTLLDAL GRL  +T+
Sbjct  3     LTWKDLWVTVLDRGNGTHPILQGLTGYAEPGRMLAVMGPSGSGKSTLLDALGGRLSSSTQ  62

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             Q+G+ILINGR Q L++GTSAYVTQ+DTL  TLTVREAVYYSAQLQLP S+  SEKKE AE
Sbjct  63    QTGEILINGRKQPLSFGTSAYVTQDDTLITTLTVREAVYYSAQLQLPESMSNSEKKERAE  122

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI+EMGLQDA +TRIGGG       G QKRRVSIC+EILTRP LLFLDEP+SGLDSAAS
Sbjct  123   ATIREMGLQDARDTRIGGGSAKGLSGG-QKRRVSICIEILTRPMLLFLDEPTSGLDSAAS  181

Query  766   FYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETN  942
             ++VM +I  LAS + RTV+ASIHQPS+EVF LF +LCLLSSG+ V+FG  S A QFF +N
Sbjct  182   YHVMKRIAKLASHDQRTVIASIHQPSSEVFELFHNLCLLSSGKTVFFGLRSVAEQFFASN  241

Query  943   GFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREVQ  1122
             GFPCPTL+NPSDH+L+TINKDFD    D+EQG + G+  EE I+ LV SY S     +VQ
Sbjct  242   GFPCPTLRNPSDHYLRTINKDFD---ADIEQG-SNGMDAEEAIDTLVKSYLSSLMCHQVQ  297

Query  1123  GQVAEISKQE--GEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGL  1296
              QV++IS +   G + +  S+A F TQS+VLT+RSF+NM+RDLGYYWLRL IYI L + +
Sbjct  298   QQVSKISGKNVGGNLERNGSQASFLTQSLVLTKRSFVNMYRDLGYYWLRLAIYIALCLCV  357

Query  1297  GYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAF  1476
             G ++ D+G+   SIQAR S+L FIA+F TFMAIGGFPSFVEDMKVF +E LNGHYG  AF
Sbjct  358   GTIFYDIGFTYGSIQARGSMLMFIAAFLTFMAIGGFPSFVEDMKVFGRERLNGHYGVAAF  417

Query  1477  AIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASL  1656
              + NT SS+PYLL+ISLIPG IAY+ VGLQ+ F HF YFALV+   MLLVESLMMI+AS+
Sbjct  418   VVGNTFSSIPYLLIISLIPGAIAYYLVGLQKSFEHFVYFALVLFACMLLVESLMMIVASV  477

Query  1657  VPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQG  1836
             VP++LMGII GAG+Q +M+L GG+FRLP DLPK FWRYP+YYI FHKYA QG +KNEF+G
Sbjct  478   VPDFLMGIITGAGIQGVMMLNGGFFRLPDDLPKAFWRYPMYYISFHKYANQGFFKNEFEG  537

Query  1837  LRLPE--ETGQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAK  2010
             L  P   E    I+GEE+LR   QVEMG+SKW+DL +L+ M VV R++FL ++KA+EK K
Sbjct  538   LIFPNQMEGSPTISGEEILRNYWQVEMGYSKWVDLAILLGMVVVYRLMFLGIIKAAEKMK  597

Query  2011  HVVKAVMRVSPKQSHQVV  2064
              +VK     SP+    V+
Sbjct  598   PLVKNFRAKSPRHPKHVM  615



>ref|XP_008791489.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter G family member 
11-like [Phoenix dactylifera]
Length=706

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/618 (64%), Positives = 475/618 (77%), Gaps = 7/618 (1%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             FLTWEDL V+ SDG  G   IL+GL GYARPGE+LAIMGPSGCGKSTLLD LAGRL    
Sbjct  83    FLTWEDLCVSASDGNGGRVPILRGLNGYARPGEVLAIMGPSGCGKSTLLDTLAGRLGSNV  142

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
              Q G+ILING+ Q LA+GTSAYVTQ+D L  TLTVREAVY+SAQLQLP S+ R+EK+E A
Sbjct  143   GQRGEILINGQKQKLAFGTSAYVTQDDVLMTTLTVREAVYFSAQLQLPESMSRAEKRERA  202

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             E TI+EMGL  AM+TRIGG        G QKRRVSICLEILTRPKLLFLDEP+SGLDSAA
Sbjct  203   EATIREMGLGGAMDTRIGGWASKGISGG-QKRRVSICLEILTRPKLLFLDEPTSGLDSAA  261

Query  763   SFYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             S++VM++I  LA  EG TVVA+IHQPS+EVF LF  LCLL+ G+ VYFG AS   +FF  
Sbjct  262   SYHVMNRIARLARLEGMTVVAAIHQPSSEVFELFHGLCLLAYGKTVYFGLASTTSEFFAL  321

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREV  1119
             NGFPCP  +NPSDH+L+TINKDF+ D E+  +   + I T EVI  LV SYKS    ++V
Sbjct  322   NGFPCPPHRNPSDHYLRTINKDFEKDIEEGPE--VQQITTAEVIETLVKSYKSSTISQQV  379

Query  1120  QGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLG  1299
               Q+AEI  + G ++KK S+A F TQS+VLTRRSF+NM+RDLGYYWLR  IYI L + +G
Sbjct  380   AQQIAEIRGKGGALVKKGSQASFLTQSLVLTRRSFINMYRDLGYYWLRFAIYIALCLCVG  439

Query  1300  YMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFA  1479
              +Y+DVG+   SIQAR S+L FIA+F TFMAIGGFPSFVEDMKVF +E +NGHYG  AF 
Sbjct  440   TIYHDVGHTYGSIQARGSMLMFIAAFLTFMAIGGFPSFVEDMKVFGRERMNGHYGVTAFV  499

Query  1480  IANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLV  1659
             IANTLS+ PYL LIS+ PG +AY+ VGLQR   HFAYFALV+ M M+LVE LMMI+AS+V
Sbjct  500   IANTLSATPYLALISVAPGAMAYYLVGLQRGIDHFAYFALVLFMCMMLVEGLMMIVASIV  559

Query  1660  PNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGL  1839
             P++LMGII GAG+Q +M+L GG+FRLP DLPK  WRYP+YYI FHKYA QG YKNEF GL
Sbjct  560   PDFLMGIITGAGIQGVMMLNGGFFRLPDDLPKPVWRYPMYYIAFHKYANQGFYKNEFLGL  619

Query  1840  RLPEETG---QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAK  2010
               P         ITGEE+LR T QVEMG+SKWIDL VL  M ++ RV+FL++VK +EK K
Sbjct  620   TFPNNQAGGPPTITGEEILRGTWQVEMGYSKWIDLAVLFGMVILYRVLFLVIVKITEKVK  679

Query  2011  HVVKAVMRVSPKQSHQVV  2064
              ++KA++   PKQS  V+
Sbjct  680   PMMKALLVKPPKQSTHVM  697



>ref|XP_006426351.1| hypothetical protein CICLE_v10025117mg [Citrus clementina]
 gb|ESR39591.1| hypothetical protein CICLE_v10025117mg [Citrus clementina]
Length=647

 Score =   714 bits (1844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/621 (62%), Positives = 485/621 (78%), Gaps = 12/621 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRK--GNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLEL  396
             FLTW+DL V V  G+K  G +AIL+ LTGY  PG++LAIMGPSGCGKSTLLDALAGRL  
Sbjct  25    FLTWKDLSVVVPSGKKENGKRAILQELTGYVEPGQILAIMGPSGCGKSTLLDALAGRLSA  84

Query  397   TTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKE  576
              T+Q+G+ILINGR + LA+GTSAYVTQED L  TLTV EA+YYSAQLQLP S+ RSEKKE
Sbjct  85    NTQQTGEILINGRKEMLAFGTSAYVTQEDILMTTLTVMEAIYYSAQLQLPDSMSRSEKKE  144

Query  577   IAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDS  756
              AEMTI+EMGLQDAM+TRIGG       SG QKRRVSIC+EILTRPKLLFLDEP+SGLDS
Sbjct  145   RAEMTIREMGLQDAMDTRIGGWNVKGISSG-QKRRVSICIEILTRPKLLFLDEPTSGLDS  203

Query  757   AASFYVMSKIMDLASE-GRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFF  933
             AAS++VM +I++LA E GRTV+ASIHQP+++VF LF +LCLL+ G+ +YFGP+S A Q F
Sbjct  204   AASYHVMKRIVNLAREDGRTVLASIHQPNSDVFELFHNLCLLAYGKTIYFGPSSMAEQLF  263

Query  934   ETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYR  1113
              +NGFPCP+L+NPSDH+L+ INKDF+   E++E+G  R   TEEVINILVNSYKS   Y 
Sbjct  264   ASNGFPCPSLRNPSDHYLRIINKDFE---ENIEEGTGR-TSTEEVINILVNSYKSSDTYN  319

Query  1114  EVQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             EV+ +V+ I +Q+G  L+K ++A F TQS+VLT+RSF+NM+RDLGYYWLR  IY+ L + 
Sbjct  320   EVKERVSIICQQKGGTLEKGNQASFITQSLVLTKRSFVNMYRDLGYYWLRFAIYVALGLC  379

Query  1294  LGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGA  1473
             +G +++D+G    SIQAR S+L FIA+F TFMAIGGFPSFVEDMK+F +E LNGHYG  +
Sbjct  380   IGTIFHDIGSSYGSIQARGSMLMFIAAFLTFMAIGGFPSFVEDMKIFGRERLNGHYGVAS  439

Query  1474  FAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIAS  1653
             F ++N+ SS PYLLLISLIPG IAY+  GLQ+  GHF YF L + ++M+LVESLMMI+AS
Sbjct  440   FVLSNSFSSTPYLLLISLIPGAIAYYLTGLQKNIGHFLYFVLGLFVSMMLVESLMMIVAS  499

Query  1654  LVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQ  1833
             +VP++LMGII GAG+Q +M+L GG+FRLP DLPK  W+YP+YYI FH+YA+QG YKNEF+
Sbjct  500   IVPDFLMGIITGAGIQGIMMLNGGFFRLPNDLPKPVWKYPMYYIAFHRYAFQGFYKNEFE  559

Query  1834  GLRLPEETG---QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEK  2004
             GL  P         ITG+EVL    QV+MGH+KW+DL +L  M    R +F +++K +E 
Sbjct  560   GLTFPNNQAGGPPTITGKEVLTNIWQVDMGHTKWVDLAILFGMLFFYRFLFWVIIKTTEN  619

Query  2005  AKHVVKAVMRVSPKQSHQVVA  2067
              K ++++  R+     H ++ 
Sbjct  620   LKPIIRS-FRIPLPPKHNLLG  639



>ref|XP_010030453.1| PREDICTED: ABC transporter G family member 11-like [Eucalyptus 
grandis]
Length=646

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/618 (64%), Positives = 482/618 (78%), Gaps = 10/618 (2%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW+DLWVTV D R G   IL+GLTGYA PG +LA+MGPSG GKSTLLDAL GRL  +T+
Sbjct  27    LTWKDLWVTVLDRRNGTHPILQGLTGYAEPGRMLAVMGPSGSGKSTLLDALGGRLSSSTQ  86

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             Q+G+ILINGR Q L++GTSAYVTQ+DTL  TLTVREAVYYSAQLQLP S+  SEKKE AE
Sbjct  87    QTGEILINGRKQPLSFGTSAYVTQDDTLITTLTVREAVYYSAQLQLPESMSNSEKKERAE  146

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI+EMGLQDA +TRIGGG       G QKRRVSIC+EILTRP LLFLDEP+SGLDSAAS
Sbjct  147   ATIREMGLQDARDTRIGGGSAKGLSGG-QKRRVSICIEILTRPMLLFLDEPTSGLDSAAS  205

Query  766   FYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETN  942
             ++VM++I  LAS + RTV+ASIHQPS+EVF LF +LCLLSSG+ V+FG  S A QFF + 
Sbjct  206   YHVMNRIAKLASHDQRTVIASIHQPSSEVFELFHNLCLLSSGKTVFFGLRSVAEQFFTSK  265

Query  943   GFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREVQ  1122
             GFPCPTL+NPSDH+L+TINKDFD    D+EQG + G+  EE I+ LV SY S     +VQ
Sbjct  266   GFPCPTLRNPSDHYLRTINKDFD---ADIEQGSS-GMNAEEAIDTLVKSYLSSLICHQVQ  321

Query  1123  GQVAEISKQE--GEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGL  1296
              QV++IS +   G + +  S+A F TQS+VLT+RSF+NM+RDLGYYWLRL IYI L + +
Sbjct  322   QQVSKISGKNVGGNLERNGSQASFLTQSLVLTKRSFVNMYRDLGYYWLRLAIYIALCLCV  381

Query  1297  GYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAF  1476
             G ++ D+G    SIQAR S+L F+A+F TFMAIGGFPSFVEDMKVF +E LNGHYG  AF
Sbjct  382   GTIFYDIGLTYGSIQARGSMLMFVAAFLTFMAIGGFPSFVEDMKVFGRERLNGHYGVAAF  441

Query  1477  AIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASL  1656
              I NT SS+PYLL+ISLIPG IAY+ VGL++ F HFAYFALV+   MLLVESLMMI+AS+
Sbjct  442   VIGNTFSSIPYLLIISLIPGAIAYYLVGLEKSFEHFAYFALVLFACMLLVESLMMIVASV  501

Query  1657  VPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQG  1836
             VP++LMGII GAG+Q +M+L GG+FRLP DLPK FWRYP+YYI FHKYA QG +KNEF+G
Sbjct  502   VPDFLMGIITGAGIQGVMMLNGGFFRLPNDLPKPFWRYPMYYISFHKYANQGFFKNEFEG  561

Query  1837  LRLPEETG--QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAK  2010
             L  P + G    I+GEE+LR   QVEMG+SKW+DL  L+ M VV R++FL ++KA EK K
Sbjct  562   LIFPNQMGGSPTISGEEILRNYWQVEMGYSKWVDLATLLGMVVVYRLMFLGIIKAVEKMK  621

Query  2011  HVVKAVMRVSPKQSHQVV  2064
              +VK     SP+    V+
Sbjct  622   PMVKIFRAKSPRHPKHVM  639



>ref|XP_006466253.1| PREDICTED: ABC transporter G family member 11-like [Citrus sinensis]
Length=675

 Score =   714 bits (1844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/616 (62%), Positives = 482/616 (78%), Gaps = 11/616 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRK--GNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLEL  396
             FLTW+DL V V  G+K  G +AIL+ LTGY  PG++LAIMGPSGCGKSTLLDALAGRL  
Sbjct  65    FLTWKDLSVVVPSGKKENGKRAILQELTGYVEPGQILAIMGPSGCGKSTLLDALAGRLSA  124

Query  397   TTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKE  576
              T+Q+G+ILINGR + LA+GTSAYVTQED L  TLTV EA+YYSAQLQLP S+ RSEKKE
Sbjct  125   NTQQTGEILINGRKEMLAFGTSAYVTQEDILMTTLTVMEAIYYSAQLQLPDSMSRSEKKE  184

Query  577   IAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDS  756
              AEMTI+EMGLQDAM+TRIGG       SG QKRRVSIC+EILTRPKLLFLDEP+SGLDS
Sbjct  185   RAEMTIREMGLQDAMDTRIGGWNVRGISSG-QKRRVSICIEILTRPKLLFLDEPTSGLDS  243

Query  757   AASFYVMSKIMDLASE-GRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFF  933
             AAS++VM +I++LA E GRTV+ASIHQP+++VF LF +LCLL+ G+ +YFGP+S A Q F
Sbjct  244   AASYHVMKRIVNLAREDGRTVLASIHQPNSDVFELFQNLCLLAYGKTIYFGPSSMAEQLF  303

Query  934   ETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYR  1113
              +NGFPCP+L+NPSDH+L+ INKDF+   E++E+G  R   TEEVINILVNSYKS   Y+
Sbjct  304   ASNGFPCPSLRNPSDHYLRIINKDFE---ENIEEGTGR-TSTEEVINILVNSYKSSDTYK  359

Query  1114  EVQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             EV+  V+ I +Q+G  L+K ++A F TQS+VLT+RSF+NM+RDLGYYWLR  IY+ L + 
Sbjct  360   EVKEHVSIICQQKGGTLEKGNQASFITQSLVLTKRSFVNMYRDLGYYWLRFVIYVALGLC  419

Query  1294  LGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGA  1473
             +G +++D+G    SIQAR S+L FIA+F TFMAIGGFPSFVEDMK+F +E LNGHYG  +
Sbjct  420   IGTIFHDIGSSYGSIQARGSMLMFIAAFLTFMAIGGFPSFVEDMKIFGRERLNGHYGVAS  479

Query  1474  FAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIAS  1653
             F ++N+ SS PYLLLISLIPG IAY+  GLQ+  GHF YF L + ++M+LVESLMMI+AS
Sbjct  480   FVLSNSFSSTPYLLLISLIPGAIAYYLTGLQKNIGHFLYFVLGLFVSMMLVESLMMIVAS  539

Query  1654  LVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQ  1833
             +VP++LMGII GAG+Q +M+L GG+FRLP DLPK  W+YP+YYI FH+YA+QG YKNEF+
Sbjct  540   IVPDFLMGIITGAGIQGIMMLNGGFFRLPNDLPKPVWKYPMYYIAFHRYAFQGFYKNEFE  599

Query  1834  GLRLPEETG---QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEK  2004
             GL  P         ITG+EVL    QV+MGH+KW DL +L  M    R +F +++K +E 
Sbjct  600   GLTFPNNQAGGPPTITGKEVLTNIWQVDMGHTKWADLAILFGMLFFYRFLFWVIIKTTEN  659

Query  2005  AKHVVKAVMRVSPKQS  2052
              K ++++    S + S
Sbjct  660   LKPIIRSFRFASSEPS  675



>dbj|BAL46500.1| ABC transporter [Diospyros kaki]
Length=738

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/615 (64%), Positives = 486/615 (79%), Gaps = 9/615 (1%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             FLTW DL VTV   + G ++IL+G+ GY  PGE+LA+MGPSGCGKSTLLDALAGRL   T
Sbjct  126   FLTWRDLSVTVPGSKGGRRSILEGVNGYVEPGEVLAVMGPSGCGKSTLLDALAGRLGSKT  185

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             +Q+G+ILINGR QTLA+GTSAYVTQ+DTL  TLTV+EAVYYSAQLQLP S+ R++KK+ A
Sbjct  186   KQTGEILINGRKQTLAFGTSAYVTQDDTLMTTLTVQEAVYYSAQLQLPDSMSRAQKKQRA  245

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             E TI+EMGLQDA+NTRIGG        G QKRRVSIC+EILTRPKLLFLDEP+SGLDSAA
Sbjct  246   EATIREMGLQDAINTRIGGWSSKGLSGG-QKRRVSICIEILTRPKLLFLDEPTSGLDSAA  304

Query  763   SFYVMSKIMDLASEGR-TVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             S++VM++I+ LA + R TV+ASIHQPS+EVF LF +LCLLSSGR+VYFG  SA  +FF  
Sbjct  305   SYHVMNRIIKLAQQDRRTVIASIHQPSSEVFELFHNLCLLSSGRLVYFGSTSATNEFFSL  364

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREV  1119
             NGFPCPT++NPSDH+L+TINKDFDND   VEQG  + + T +VI++LV SYKS    + V
Sbjct  365   NGFPCPTMRNPSDHYLRTINKDFDND---VEQGLGQSMTTVQVIDVLVKSYKSSEYLQHV  421

Query  1120  QGQVAEISKQEGEVLKKS-SRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGL  1296
                + EI +Q+GE L+K  S+A F TQS+VLT+RSF+NM+RDLGYYWLRL IYI L + +
Sbjct  422   SKTMYEICQQKGETLEKGGSQAGFITQSLVLTKRSFVNMYRDLGYYWLRLAIYIALCLCV  481

Query  1297  GYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAF  1476
             G ++ ++G    SIQAR S+L F+ASF TF+AIGGFPSFVEDMK+F +E LNGHYG GAF
Sbjct  482   GTIFYNIGSSFGSIQARGSMLMFVASFLTFVAIGGFPSFVEDMKIFTRERLNGHYGVGAF  541

Query  1477  AIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASL  1656
              + NTLSS+PYL LIS++PG +AY+ VGLQ+   HF  FALV+   MLLVESLMMI+AS+
Sbjct  542   VVGNTLSSIPYLFLISVLPGAMAYYLVGLQKTLDHFLCFALVLFACMLLVESLMMIVASV  601

Query  1657  VPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQG  1836
             VP++LMGII GAG+Q +++L GG+FRLP DLP+ FWRYP+YYI FHKYAYQG YKNEF+G
Sbjct  602   VPDFLMGIITGAGIQGVLMLNGGFFRLPNDLPEPFWRYPMYYISFHKYAYQGFYKNEFEG  661

Query  1837  LRLP-EETGQ--IITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKA  2007
             L  P  E  Q   ITGEE+LR T QV MG+SKW+DL +L+ M V+ R +FL +VK  EK 
Sbjct  662   LIFPNNEVRQPATITGEEILRNTWQVGMGYSKWVDLAILLGMVVLYRFMFLGIVKFIEKV  721

Query  2008  KHVVKAVMRVSPKQS  2052
             K ++++      KQS
Sbjct  722   KPILRSADAAPSKQS  736



>ref|XP_004288175.1| PREDICTED: ABC transporter G family member 11-like [Fragaria 
vesca subsp. vesca]
Length=715

 Score =   716 bits (1847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/606 (62%), Positives = 479/606 (79%), Gaps = 8/606 (1%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW+DLWV VSDG+ G K IL+GLTG+A+PGE+LAIMGPSGCGKSTLLDAL GRL  +T+
Sbjct  114   LTWDDLWVGVSDGKGGQKMILQGLTGFAQPGEVLAIMGPSGCGKSTLLDALGGRLSSSTQ  173

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             Q G ILINGR +TLA+ TSAYV Q+DTL  TLTV+E VYYSAQLQLP+S+ ++EKK  AE
Sbjct  174   QKGKILINGRKETLAFRTSAYVAQDDTLMTTLTVKEVVYYSAQLQLPNSMSKAEKKVRAE  233

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TIKEMGL+D+M+TRIGG        G QKRRVSIC+EILTRPKLLFLDEP+SGLDSAAS
Sbjct  234   TTIKEMGLRDSMDTRIGGWGKKGLSGG-QKRRVSICIEILTRPKLLFLDEPTSGLDSAAS  292

Query  766   FYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETN  942
             ++VM++I+ LA  +G TVVASIHQPS+EVF LF +LCLLSSGR VYFGPAS A +FF +N
Sbjct  293   YHVMNRIIKLAHHDGMTVVASIHQPSSEVFELFQNLCLLSSGRTVYFGPASQAEEFFVSN  352

Query  943   GFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREVQ  1122
             GFPCPTL+NPSDH+L+TINKDFD D   +EQG      TEE I+IL+NSYKS   ++++ 
Sbjct  353   GFPCPTLRNPSDHYLRTINKDFDTD---IEQGLGGKTRTEEAIDILINSYKSSSTFKQLH  409

Query  1123  GQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLGY  1302
              QVA+I +++   L+K S+A+F TQ +VLTRRSF+NM+RDLGYYWLRL IYI+L + +G 
Sbjct  410   DQVAKICQEKRGALEKGSQANFMTQCLVLTRRSFVNMYRDLGYYWLRLFIYISLCLCVGT  469

Query  1303  MYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFAI  1482
             +Y+++     SIQ R + L F+A+F TFMAIGGFPS+VEDMK+F++E LNGHYG  +F +
Sbjct  470   IYHEIDTSYDSIQDRATSLMFVAAFLTFMAIGGFPSYVEDMKIFERERLNGHYGVASFVV  529

Query  1483  ANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLVP  1662
              N+ SS+PYLL+ISLIPG IAYF VG QR F HFAYFAL + + ++LVESLMMI+AS+VP
Sbjct  530   GNSFSSVPYLLMISLIPGAIAYFLVGFQRTFDHFAYFALALFVALMLVESLMMIVASIVP  589

Query  1663  NYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGLR  1842
             ++LMG+I G+G+  +M+L GG+FR P D+PK FWRYP+YYI FH Y  QGLYKNEF+GL 
Sbjct  590   DFLMGVITGSGILGVMLLNGGFFRKPNDMPKPFWRYPMYYIGFHNYVNQGLYKNEFEGLT  649

Query  1843  LPEET---GQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAKH  2013
              P         ITGEE+L+   Q+EMGHSKW+D  +L  M +V R++F  ++K +EK   
Sbjct  650   FPNNQVGGPPTITGEEILKSMWQMEMGHSKWVDFAILFGMVIVYRLMFFGIIKTNEKLSP  709

Query  2014  VVKAVM  2031
             ++KA +
Sbjct  710   IIKAFL  715



>gb|KCW54564.1| hypothetical protein EUGRSUZ_I00523, partial [Eucalyptus grandis]
Length=665

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/618 (64%), Positives = 482/618 (78%), Gaps = 10/618 (2%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW+DLWVTV D R G   IL+GLTGYA PG +LA+MGPSG GKSTLLDAL GRL  +T+
Sbjct  46    LTWKDLWVTVLDRRNGTHPILQGLTGYAEPGRMLAVMGPSGSGKSTLLDALGGRLSSSTQ  105

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             Q+G+ILINGR Q L++GTSAYVTQ+DTL  TLTVREAVYYSAQLQLP S+  SEKKE AE
Sbjct  106   QTGEILINGRKQPLSFGTSAYVTQDDTLITTLTVREAVYYSAQLQLPESMSNSEKKERAE  165

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI+EMGLQDA +TRIGGG       G QKRRVSIC+EILTRP LLFLDEP+SGLDSAAS
Sbjct  166   ATIREMGLQDARDTRIGGGSAKGLSGG-QKRRVSICIEILTRPMLLFLDEPTSGLDSAAS  224

Query  766   FYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETN  942
             ++VM++I  LAS + RTV+ASIHQPS+EVF LF +LCLLSSG+ V+FG  S A QFF + 
Sbjct  225   YHVMNRIAKLASHDQRTVIASIHQPSSEVFELFHNLCLLSSGKTVFFGLRSVAEQFFTSK  284

Query  943   GFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREVQ  1122
             GFPCPTL+NPSDH+L+TINKDFD    D+EQG + G+  EE I+ LV SY S     +VQ
Sbjct  285   GFPCPTLRNPSDHYLRTINKDFD---ADIEQGSS-GMNAEEAIDTLVKSYLSSLICHQVQ  340

Query  1123  GQVAEISKQE--GEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGL  1296
              QV++IS +   G + +  S+A F TQS+VLT+RSF+NM+RDLGYYWLRL IYI L + +
Sbjct  341   QQVSKISGKNVGGNLERNGSQASFLTQSLVLTKRSFVNMYRDLGYYWLRLAIYIALCLCV  400

Query  1297  GYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAF  1476
             G ++ D+G    SIQAR S+L F+A+F TFMAIGGFPSFVEDMKVF +E LNGHYG  AF
Sbjct  401   GTIFYDIGLTYGSIQARGSMLMFVAAFLTFMAIGGFPSFVEDMKVFGRERLNGHYGVAAF  460

Query  1477  AIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASL  1656
              I NT SS+PYLL+ISLIPG IAY+ VGL++ F HFAYFALV+   MLLVESLMMI+AS+
Sbjct  461   VIGNTFSSIPYLLIISLIPGAIAYYLVGLEKSFEHFAYFALVLFACMLLVESLMMIVASV  520

Query  1657  VPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQG  1836
             VP++LMGII GAG+Q +M+L GG+FRLP DLPK FWRYP+YYI FHKYA QG +KNEF+G
Sbjct  521   VPDFLMGIITGAGIQGVMMLNGGFFRLPNDLPKPFWRYPMYYISFHKYANQGFFKNEFEG  580

Query  1837  LRLPEETG--QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAK  2010
             L  P + G    I+GEE+LR   QVEMG+SKW+DL  L+ M VV R++FL ++KA EK K
Sbjct  581   LIFPNQMGGSPTISGEEILRNYWQVEMGYSKWVDLATLLGMVVVYRLMFLGIIKAVEKMK  640

Query  2011  HVVKAVMRVSPKQSHQVV  2064
              +VK     SP+    V+
Sbjct  641   PMVKIFRAKSPRHPKHVM  658



>ref|XP_009344594.1| PREDICTED: ABC transporter G family member 11-like [Pyrus x bretschneideri]
Length=702

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/582 (66%), Positives = 461/582 (79%), Gaps = 18/582 (3%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGN-----KAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGR  387
              LTWED+WVTV   +  +     ++IL+GLTGYA+PGELLAIMGPSGCGKSTLLDAL GR
Sbjct  62    LLTWEDVWVTVVSKKNNSIGSSSRSILQGLTGYAKPGELLAIMGPSGCGKSTLLDALGGR  121

Query  388   LELTTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSE  567
             L   TRQ+G ILING  Q L YGTSAYV Q+DTL  TLTV+EAVYYSAQLQLP S+ +SE
Sbjct  122   LNSNTRQTGKILINGHKQALTYGTSAYVAQDDTLITTLTVKEAVYYSAQLQLPDSMTKSE  181

Query  568   KKEIAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSG  747
             KKE AE+TI+EMGLQDAMNTRIGG        G QKRRVSIC+E+LTRPKLLFLDEP+SG
Sbjct  182   KKERAEVTIREMGLQDAMNTRIGGWGVKGISGG-QKRRVSICIELLTRPKLLFLDEPTSG  240

Query  748   LDSAASFYVMSKIMDL-ASEG--RTVVASIHQPSTEVfslftslcllssGRVVYFGPASA  918
             LDSAAS++VMS+I +L   +G  RT+V SIHQPS+EVF LF SLCLLSSGR VYFGPASA
Sbjct  241   LDSAASYFVMSRIANLDKGDGTPRTIVTSIHQPSSEVFQLFDSLCLLSSGRTVYFGPASA  300

Query  919   AIQFFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKS  1098
             A QFF   GFPCPTLQNPSDHFLKTINKDF+   +D+EQG     PTE  I+ L+ SYK 
Sbjct  301   ANQFFTLTGFPCPTLQNPSDHFLKTINKDFE---QDIEQGVT--TPTEIAIDTLIRSYKE  355

Query  1099  YHRYREVQGQVAEISKQE-GEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIY  1275
                +++V  QVAE+ KQ+ GE L+K SRA F TQ +VLT+RSF+NM RD GYYWLRL IY
Sbjct  356   SETFQQVHRQVAELCKQDFGEKLEKRSRAGFLTQCLVLTKRSFVNMHRDQGYYWLRLAIY  415

Query  1276  ITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNG  1455
             I +A+GLG +Y+++G+G  SIQAR S+L FI++F TFMAIGGFPSFVEDMKVF++E LNG
Sbjct  416   IFMALGLGTVYHELGHGYRSIQARGSLLMFISTFLTFMAIGGFPSFVEDMKVFERERLNG  475

Query  1456  HYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESL  1635
             HYG  AFA  NT SS+P+L++IS+IPG I Y+  GLQ  F HF +F+ V+   M+LVESL
Sbjct  476   HYGVCAFAFGNTFSSVPFLVMISVIPGAIVYYLAGLQTGFEHFVFFSCVLFACMMLVESL  535

Query  1636  MMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGL  1815
             MMI+AS+VPNYLMGIIAGAG+Q LM+L GG+F+LP D+P   W+YP+Y+I FHKYAYQGL
Sbjct  536   MMIVASIVPNYLMGIIAGAGIQGLMMLSGGFFQLPSDIPGPVWKYPMYHIAFHKYAYQGL  595

Query  1816  YKNEFQGLRLP-EETGQ--IITGEEVLRETLQVEMGHSKWID  1932
             +KNEF+G   P  E G    ++GE++LRE  QVEMG+SKW++
Sbjct  596   FKNEFKGTMFPASEAGGPFTLSGEQILRERWQVEMGYSKWVN  637



>ref|XP_009387386.1| PREDICTED: ABC transporter G family member 11-like [Musa acuminata 
subsp. malaccensis]
Length=709

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/615 (63%), Positives = 475/615 (77%), Gaps = 9/615 (1%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             FLTWEDLWV+  D + G  +IL  +TGYARPGE+LAIMGPSGCGKSTLLDALAGRL    
Sbjct  97    FLTWEDLWVSAMDRKGGRVSILSAVTGYARPGEVLAIMGPSGCGKSTLLDALAGRLGSAV  156

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
              Q GDILING+ Q LA+G SAYVTQ+D L  T+TVRE VYYSAQLQLP S+ RSEK+E A
Sbjct  157   SQKGDILINGQRQKLAFGASAYVTQDDVLMTTMTVREVVYYSAQLQLPDSMSRSEKRERA  216

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             E TI+EMGL+ AM+TRIGG        G QKRRVSIC+E+LTRP+LLFLDEP+SGLDSAA
Sbjct  217   EATIREMGLERAMDTRIGGWASKGISGG-QKRRVSICIELLTRPQLLFLDEPTSGLDSAA  275

Query  763   SFYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             S++VM +I  LA  EG TVVA+IHQPS+EVF LF  LCLL++GR V+FGPAS   +FF +
Sbjct  276   SYHVMDRITRLARLEGMTVVAAIHQPSSEVFELFHGLCLLANGRTVFFGPASMTNEFFAS  335

Query  940   NGFPCPTLQNPSDHFLKTINKDFDND-DEDVEQGCARGIPTEEVINILVNSYKSYHRYRE  1116
             NGFPCP+L+NPSDH+L+TINKDF+ D +ED+E   ++   T E I+ILV SY+S    ++
Sbjct  336   NGFPCPSLRNPSDHYLRTINKDFEQDIEEDLE---SKPRSTSEAIDILVKSYRSSATLQQ  392

Query  1117  VQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGL  1296
             V  Q+AEI    G+V+KK ++A F TQS+VLT RSF+NM+RDLGYYWLR  IYI L + +
Sbjct  393   VAQQIAEIRDMGGDVVKKRNQASFMTQSLVLTGRSFVNMYRDLGYYWLRFAIYIALCLCV  452

Query  1297  GYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAF  1476
             G +Y+DVG+   SIQAR S+L F A+F TFMAIGGFPSFVEDMK+F +E LNGHYG  AF
Sbjct  453   GTIYHDVGHSFGSIQARGSMLMFTAAFLTFMAIGGFPSFVEDMKIFGRERLNGHYGVTAF  512

Query  1477  AIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASL  1656
              IANTLS+ PYL LIS+IPG IAY+ VGLQ    HF YFALV+ M M+LVE LMMI+AS+
Sbjct  513   TIANTLSATPYLALISVIPGAIAYYLVGLQTSIDHFIYFALVLFMCMMLVEGLMMIVASI  572

Query  1657  VPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQG  1836
             VP++LMGII GAG+Q +M+L GG+FRLP DLPK  WRYP+YYI FHKYA QG YKNEF G
Sbjct  573   VPDFLMGIITGAGIQGVMMLNGGFFRLPNDLPKPVWRYPMYYIAFHKYANQGFYKNEFLG  632

Query  1837  LRLPEETG---QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKA  2007
             L  P         ITG+E+LRET QVEMG+SKWIDL +L  M ++ R++FL +VK  EK 
Sbjct  633   LIFPNNQAGGPPTITGDEILRETWQVEMGYSKWIDLAILFGMVILYRLMFLGIVKTVEKL  692

Query  2008  KHVVKAVMRVSPKQS  2052
             K + K++M   P++S
Sbjct  693   KPIFKSLMARVPQKS  707



>ref|XP_010030454.1| PREDICTED: ABC transporter G family member 11-like [Eucalyptus 
grandis]
Length=713

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/618 (64%), Positives = 482/618 (78%), Gaps = 10/618 (2%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW+DLWVTV D   G   IL+GLTGYA PG +LA+MGPSG GKSTLLDAL GRL  +T+
Sbjct  94    LTWKDLWVTVLDRGNGTHPILQGLTGYAEPGRMLAVMGPSGSGKSTLLDALGGRLSSSTQ  153

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             Q+G+ILINGR Q L++GTSAYVTQ+DTL  TLTVREAVYYSAQLQLP S+  SEKKE AE
Sbjct  154   QTGEILINGRKQPLSFGTSAYVTQDDTLITTLTVREAVYYSAQLQLPESMSNSEKKERAE  213

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI+EMGLQDA +TRIGGG       G QKRRVSIC+EILTRP LLFLDEP+SGLDSAAS
Sbjct  214   ATIREMGLQDARDTRIGGGSAKGLSGG-QKRRVSICIEILTRPMLLFLDEPTSGLDSAAS  272

Query  766   FYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETN  942
             ++VM +I  LAS + RTV+ASIHQPS+EVF LF +LCLLSSG+ V+FG  S A QFF +N
Sbjct  273   YHVMKRIAKLASHDQRTVIASIHQPSSEVFELFHNLCLLSSGKTVFFGLRSVAEQFFASN  332

Query  943   GFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREVQ  1122
             GFPCPTL+NPSDH+L+TINKDFD    D+EQG + G+  EE I+ LV SY S     +VQ
Sbjct  333   GFPCPTLRNPSDHYLRTINKDFD---ADIEQG-SNGMDAEEAIDTLVKSYLSSLMCHQVQ  388

Query  1123  GQVAEISKQE--GEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGL  1296
              QV++IS +   G + +  S+A F TQS+VLT+RSF+NM+RDLGYYWLRL IYI L + +
Sbjct  389   QQVSKISGKNVGGNLERNGSQASFLTQSLVLTKRSFVNMYRDLGYYWLRLAIYIALCLCV  448

Query  1297  GYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAF  1476
             G ++ D+G+   SIQAR S+L FIA+F TFMAIGGFPSFVEDMKVF +E LNGHYG  AF
Sbjct  449   GTIFYDIGFTYGSIQARGSMLMFIAAFLTFMAIGGFPSFVEDMKVFGRERLNGHYGVAAF  508

Query  1477  AIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASL  1656
              + NT SS+PYLL+ISLIPG IAY+ VGLQ+ F HF YFALV+   MLLVESLMMI+AS+
Sbjct  509   VVGNTFSSIPYLLIISLIPGAIAYYLVGLQKSFEHFVYFALVLFACMLLVESLMMIVASV  568

Query  1657  VPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQG  1836
             VP++LMGII GAG+Q +M+L GG+FRLP DLPK FWRYP+YYI FHKYA QG +KNEF+G
Sbjct  569   VPDFLMGIITGAGIQGVMMLNGGFFRLPDDLPKAFWRYPMYYISFHKYANQGFFKNEFEG  628

Query  1837  LRLPE--ETGQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAK  2010
             L  P   E    I+GEE+LR   QVEMG+SKW+DL +L+ M VV R++FL ++KA+EK K
Sbjct  629   LIFPNQMEGSPTISGEEILRNYWQVEMGYSKWVDLAILLGMVVVYRLMFLGIIKAAEKMK  688

Query  2011  HVVKAVMRVSPKQSHQVV  2064
              +VK     SP+    V+
Sbjct  689   PLVKNFRAKSPRHPKHVM  706



>ref|XP_004504817.1| PREDICTED: ABC transporter G family member 11-like [Cicer arietinum]
Length=673

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/625 (62%), Positives = 483/625 (77%), Gaps = 13/625 (2%)
 Frame = +1

Query  226   LTWEDLWVTVS--DGR-KGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLEL  396
             LTW+DLWVTVS   G+ K +K+IL+GL GYA+PG+LLAIMGPSGCGKSTLLD+LAGRL  
Sbjct  37    LTWKDLWVTVSVSTGKIKESKSILEGLNGYAKPGQLLAIMGPSGCGKSTLLDSLAGRLGS  96

Query  397   TTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKE  576
              TRQSG+ILING  Q LAYGTSAYVTQ+DTL  TLTV+EAVYYSAQLQLP S+ + EKK+
Sbjct  97    NTRQSGEILINGNKQALAYGTSAYVTQDDTLLKTLTVKEAVYYSAQLQLPDSMSKEEKKQ  156

Query  577   IAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDS  756
              A+ TIKEMGLQDA+NTRIGG        G QKRRVSIC+EILTRP+LLFLDEP+SGLDS
Sbjct  157   RADFTIKEMGLQDAINTRIGGWGVKGISGG-QKRRVSICIEILTRPRLLFLDEPTSGLDS  215

Query  757   AASFYVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQ  927
             AAS+YVM +I  L  +    RT+VASIHQPSTEVF LF +LCLLSSG+ VYFGPASAA +
Sbjct  216   AASYYVMKRIASLDKKDGIQRTIVASIHQPSTEVFQLFHNLCLLSSGKTVYFGPASAACK  275

Query  928   FFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHR  1107
             FF +NGFPCP LQNPSDH LKTINKDFD D E         I TE+ INILV+SY S  R
Sbjct  276   FFASNGFPCPPLQNPSDHLLKTINKDFDEDIEIALAEMNGTISTEQAINILVSSYTSSER  335

Query  1108  YREVQGQVAEISKQEGE-VLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITL  1284
              ++V+ +VA +SK++     K+   A F  Q +VLTRRSF+NMFRDLGYYWLRLGIY+ L
Sbjct  336   NQQVKDEVAILSKKDNNSTYKREKHAGFLNQCLVLTRRSFVNMFRDLGYYWLRLGIYVAL  395

Query  1285  AVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYG  1464
             A  L  ++ D+G    SIQ R S L F++SF TFM IGGFPS+VEDMKVF++E LNGHYG
Sbjct  396   ATSLATVFYDLGTSYGSIQDRGSFLMFVSSFLTFMTIGGFPSYVEDMKVFERERLNGHYG  455

Query  1465  CGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMI  1644
               A+ I NT SS+PYL+++S+IPG IAY+P GLQ+ + HF YF   +   ++LVESLMMI
Sbjct  456   VTAYVIGNTFSSIPYLVVVSVIPGAIAYYPPGLQKGYDHFLYFICNLFACLMLVESLMMI  515

Query  1645  IASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKN  1824
             +AS+VP++LMGII GAG+Q +M+L GG+FRLP DLPK FW YP++YI FH+YA+QG+YKN
Sbjct  516   VASIVPDFLMGIITGAGIQGIMMLAGGFFRLPIDLPKPFWTYPMFYIAFHRYAFQGMYKN  575

Query  1825  EFQGLRLPEE---TGQI--ITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvv  1989
             EFQGL+   +    G +  I+GE++LR    V+M +SKW+D  +L+ M V+ R++F +++
Sbjct  576   EFQGLKFDRDGDAAGSLNYISGEQILRNKWHVDMSYSKWVDFGILLGMIVLYRLLFFIII  635

Query  1990  KASEKAKHVVKAVMRVSPKQSHQVV  2064
             K +EK K +V ++M VSPKQ+ QV+
Sbjct  636   KTTEKLKPIVLSLMSVSPKQTIQVL  660



>ref|XP_004289302.1| PREDICTED: ABC transporter G family member 11-like [Fragaria 
vesca subsp. vesca]
Length=726

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/614 (63%), Positives = 484/614 (79%), Gaps = 9/614 (1%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW+DLWV VSDG+ G K IL+GLTG+A+PGE+LAIMGPSGCGKSTLLDAL GRL  +T+
Sbjct  114   LTWDDLWVGVSDGKGGQKMILQGLTGFAQPGEVLAIMGPSGCGKSTLLDALGGRLSSSTQ  173

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             Q G ILING  +TLA+GTSAYVTQ+DTL  TLTV E VYYSAQLQLP+S+ ++EKK  AE
Sbjct  174   QKGKILINGHKETLAFGTSAYVTQDDTLMTTLTVTEVVYYSAQLQLPNSMSKTEKKVRAE  233

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TIKEMGLQD+M+TRIGG        G QKRRVSIC+EILTRPKLLFLDEP+SGLDSAAS
Sbjct  234   TTIKEMGLQDSMDTRIGGWGKKSLSGG-QKRRVSICIEILTRPKLLFLDEPTSGLDSAAS  292

Query  766   FYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETN  942
             ++VMS+I+ LA  +G T+VASIHQPS+EVF LF +LCLLSSGR+VYFGPAS A +FF +N
Sbjct  293   YHVMSRIIKLAHHDGMTIVASIHQPSSEVFELFQNLCLLSSGRIVYFGPASQAEEFFASN  352

Query  943   GFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREVQ  1122
             GFPCPTL+NPSDH+L+TINKDFD D   +EQG      TEE I+IL+NSYKS   ++++ 
Sbjct  353   GFPCPTLRNPSDHYLRTINKDFDTD---IEQGLGGKTRTEEAIDILINSYKSSSTFKQLH  409

Query  1123  GQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLGY  1302
              QVA+I +Q+   L+K S+A+F TQ +VLTRRSF+NM+RDLGYYWLRL IYI+L + +G 
Sbjct  410   DQVAKICQQKRGALEKGSQANFMTQCLVLTRRSFVNMYRDLGYYWLRLFIYISLCLCVGT  469

Query  1303  MYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFAI  1482
             +Y+++     SIQ R + L F+A+F TFMAIGGFPS+VEDMK+F++E LNGHYG  AF +
Sbjct  470   IYHEIDTSYDSIQDRATSLMFVAAFLTFMAIGGFPSYVEDMKIFRRERLNGHYGVAAFVV  529

Query  1483  ANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLVP  1662
              N+ SS+PYLL+ S+IPG I +F VGLQ+ F HFAYFALV+ + +LLVESLMMI+AS+VP
Sbjct  530   GNSFSSIPYLLMNSVIPGAIVFFLVGLQQTFDHFAYFALVLFVTLLLVESLMMIVASIVP  589

Query  1663  NYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGLR  1842
             ++LMG+I G+G+   M+L GG FR P DLP  FWRYP+YYI FHKY  QG YKNEF+GL 
Sbjct  590   DFLMGVITGSGILGKMLLAGGLFRKPHDLPNFFWRYPMYYIGFHKYVSQGFYKNEFEGLT  649

Query  1843  LPEETGQ---IITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAKH  2013
              P        IITGEE+L+   ++EM +SKW+DL +L  M ++ R++F  ++KASEK   
Sbjct  650   FPNNQAGGSLIITGEEILKNIWEMEMSYSKWVDLAILFGMVILYRLLFFGIIKASEKVTP  709

Query  2014  VVKAVM-RVSPKQS  2052
             ++KA M RV+ K +
Sbjct  710   IIKAFMVRVTVKDN  723



>ref|XP_010094142.1| ABC transporter G family member 11 [Morus notabilis]
 gb|EXB55275.1| ABC transporter G family member 11 [Morus notabilis]
Length=697

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/624 (64%), Positives = 479/624 (77%), Gaps = 14/624 (2%)
 Frame = +1

Query  226   LTWEDLWVTVSD--GRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELT  399
             LTWEDLWVTVS   G+  N+ IL+GLTGYARPGELLAIMGPSG GKSTLLDALAGRL   
Sbjct  65    LTWEDLWVTVSSRAGKNRNRPILQGLTGYARPGELLAIMGPSGSGKSTLLDALAGRLSSK  124

Query  400   TRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEI  579
             TRQSG+ILING  QTLAYGTSAYVTQ+DTL  TLTV EAV+YSAQLQLP S+P SEKKE 
Sbjct  125   TRQSGEILINGHKQTLAYGTSAYVTQDDTLMTTLTVGEAVHYSAQLQLPDSMPLSEKKER  184

Query  580   AEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSA  759
             A  TIKEMGLQDA+NTRIGG        G QKRRVSIC+EILTRPKLLFLDEP+SGLDSA
Sbjct  185   ANGTIKEMGLQDAINTRIGGWGAKGISGG-QKRRVSICIEILTRPKLLFLDEPTSGLDSA  243

Query  760   ASFYVMSKIMDL-ASEG--RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQF  930
             AS+YVMS+I  L  S+G  RT+VASIHQPS+EVF LF SLCLLS+G+ VYFGPAS A +F
Sbjct  244   ASYYVMSRIAGLDQSDGVRRTIVASIHQPSSEVFQLFDSLCLLSAGKTVYFGPASEANEF  303

Query  931   FETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRY  1110
             F ++GFPCPTLQNPSDHFLKTINKDF+ D E    G       EE I+ L+ SYK+   Y
Sbjct  304   FASSGFPCPTLQNPSDHFLKTINKDFEQDIESGMVGVT--CTVEEAIDTLMKSYKASEGY  361

Query  1111  REVQGQVAEISKQE---GEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYIT  1281
             ++V+  VA+IS ++      +K  S A F  Q +VLTRRSF NM RD GYYWLR+ IY++
Sbjct  362   KQVRRHVADISNKQDYRAVEIKIRSHASFLNQCLVLTRRSFKNMHRDWGYYWLRIVIYVS  421

Query  1282  LAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHY  1461
             L++GLG +Y ++G    SIQ+R S+L F+ASF TFM IGGFPSFVEDMKVF++E LNGHY
Sbjct  422   LSLGLGTLYYEIGSDYESIQSRGSLLMFVASFLTFMTIGGFPSFVEDMKVFERERLNGHY  481

Query  1462  GCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMM  1641
                AF I NTLSS PYLLLISLIPG + Y+  GL++++ HF+YF LV+ + M+LVESLMM
Sbjct  482   SATAFVIGNTLSSQPYLLLISLIPGALTYYLPGLRKDYQHFSYFILVLYVCMMLVESLMM  541

Query  1642  IIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYK  1821
             I+ASLVPN+LMGIIAG+G+Q  MILGGG+FRLP DLPK FWRYP++Y+ FH+YAYQGL+K
Sbjct  542   IVASLVPNFLMGIIAGSGIQCFMILGGGFFRLPGDLPKQFWRYPLFYVAFHRYAYQGLFK  601

Query  1822  NEFQGLRLPEET---GQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvK  1992
             NEF+GL  P      G  ITGEE+L+   QV M +SKW+DL VL+ M V  RV+FL +VK
Sbjct  602   NEFEGLVFPNNELGGGATITGEEILKSKWQVNMSYSKWVDLAVLLGMVVFYRVLFLAIVK  661

Query  1993  ASEKAKHVVKAVMRVSPKQSHQVV  2064
              +E+ K    +   +    S Q+V
Sbjct  662   TAERVKSFNMSFPTIRRNHSIQIV  685



>ref|XP_007159121.1| hypothetical protein PHAVU_002G210400g [Phaseolus vulgaris]
 gb|ESW31115.1| hypothetical protein PHAVU_002G210400g [Phaseolus vulgaris]
Length=691

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/622 (62%), Positives = 479/622 (77%), Gaps = 13/622 (2%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW+D+WVT S G  G+K+IL+GLTGYA+PG+LLAIMGPSG GKSTLLDALAGRL   TR
Sbjct  60    LTWKDVWVTASVGNNGSKSILQGLTGYAKPGQLLAIMGPSGSGKSTLLDALAGRLGSNTR  119

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             Q+G+IL+NG  Q LAYGTSAYVTQ+DTL  TLTV EAV+YSAQLQLP ++ + EKKE A+
Sbjct  120   QTGEILVNGNKQALAYGTSAYVTQDDTLLTTLTVGEAVHYSAQLQLPDTMSKQEKKERAD  179

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI+EMGLQDA+NTRIGG        G QKRRVSIC+EILTRPKLLFLDEP+SGLDSAAS
Sbjct  180   FTIREMGLQDAINTRIGGWGCKGISGG-QKRRVSICIEILTRPKLLFLDEPTSGLDSAAS  238

Query  766   FYVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFE  936
             +YVM +I  L       RTV+ASIHQPS+EVF LF +LCLLSSGR VYFGPASAA +FF 
Sbjct  239   YYVMKRIATLDKRDDIHRTVIASIHQPSSEVFQLFNNLCLLSSGRTVYFGPASAASEFFA  298

Query  937   TNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYRE  1116
             +NGFPCP+L NPSDH LKTIN DFD D+E    G    IPT EVI ILVNSYKS   +++
Sbjct  299   SNGFPCPSLMNPSDHMLKTINTDFDQDNE---LGGNETIPTTEVIQILVNSYKSSEMHQD  355

Query  1117  VQGQVAEISKQEG-EVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             V+ +VAE+++++     KK S A F +Q   LT+RS +NM+RDLGYYWLRLGIYI LA+ 
Sbjct  356   VEKEVAELTEKDSCSTNKKRSHAGFLSQCFALTKRSSINMYRDLGYYWLRLGIYIALAIS  415

Query  1294  LGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGA  1473
             L  ++ D+G    SIQ R S L F++SF TFM IGGFPSFVEDMKVF++E LNGHY   A
Sbjct  416   LATIFYDLGTSQRSIQDRGSFLMFVSSFITFMTIGGFPSFVEDMKVFERERLNGHYSVSA  475

Query  1474  FAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIAS  1653
             + I NT SS+P+LLL+S+IPG IAY+  GLQ+ F HF YF  V+   ++LVESLMMI+AS
Sbjct  476   YVIGNTFSSIPFLLLVSVIPGSIAYYLPGLQKGFEHFVYFICVLFSCLMLVESLMMIVAS  535

Query  1654  LVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQ  1833
             +VPN+LMGII GAG+Q +MILGGG+FRLP DLP+ FW+YP++Y  FH+YAYQGL+KNEF 
Sbjct  536   IVPNFLMGIITGAGIQGMMILGGGFFRLPSDLPRPFWKYPMFYFAFHRYAYQGLFKNEFI  595

Query  1834  GLRLPEET---GQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEK  2004
             GLR   +    G  +TGEEVL  T QV M +SKW+DL +LV M ++ RV+FL+ +K +EK
Sbjct  596   GLRFASDNVQGGSYVTGEEVLTNTWQVNMSYSKWVDLGILVGMIILYRVLFLVNIKTTEK  655

Query  2005  AKHVVKAVM--RVSPKQSHQVV  2064
              K ++ + M  R SPK++  ++
Sbjct  656   LKPIIVSFMSSRNSPKRTVSIM  677



>ref|XP_004289305.1| PREDICTED: ABC transporter G family member 11-like [Fragaria 
vesca subsp. vesca]
Length=732

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/604 (63%), Positives = 477/604 (79%), Gaps = 6/604 (1%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTWEDLWV V +G+ G K IL+G+TG+A+PGE+LAIMGPSGCGKSTLLDALAGRL  +T+
Sbjct  110   LTWEDLWVGVRNGKSGQKMILQGITGFAQPGEVLAIMGPSGCGKSTLLDALAGRLNSSTQ  169

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             Q G ILINGR + LA+GTSAYVTQ+DTL  TLTVRE VYYSAQLQLP+S+ ++ KKE AE
Sbjct  170   QRGKILINGRKEKLAFGTSAYVTQDDTLMTTLTVREVVYYSAQLQLPNSMSKAAKKERAE  229

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI+EMGLQD+M+TRIGG        G QKRRVSICLEILTRP+LLFLDEP+SGLDSAAS
Sbjct  230   TTIREMGLQDSMDTRIGGWSRKGLSGG-QKRRVSICLEILTRPQLLFLDEPTSGLDSAAS  288

Query  766   FYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETN  942
             ++VM+ I+ LA  +G TVVASIHQPS+EVF LF +LCLLSSG  VYFGPAS A QFF +N
Sbjct  289   YHVMNHIIKLAHHDGTTVVASIHQPSSEVFELFQNLCLLSSGSTVYFGPASQAEQFFASN  348

Query  943   GFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREVQ  1122
             GFPCPTL+NPSDH+L+TINKDFD    D+EQG      TEE INIL+ SYKS    ++V 
Sbjct  349   GFPCPTLRNPSDHYLRTINKDFD---VDIEQGHEGKSNTEEAINILIGSYKSSSTLKQVL  405

Query  1123  GQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLGY  1302
               V EI +Q+G  L K S+A+F TQ +VLT+RSF+NM+RDLGYYWLRL IYI L + +G 
Sbjct  406   HNVTEIHQQKGGALVKGSQANFITQCLVLTKRSFVNMYRDLGYYWLRLAIYIALCLCVGT  465

Query  1303  MYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFAI  1482
             +++ +G    SIQAR S+L F++ F TFM+IGGFPSFVEDMK+F++E LNGHYG  AF +
Sbjct  466   IFHHIGSNYGSIQARASMLMFVSGFLTFMSIGGFPSFVEDMKIFERERLNGHYGAAAFVV  525

Query  1483  ANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLVP  1662
              NT SS+PYLL+IS IPG IAY+ VGL+  F HF YFALV+ + ++LVESLMMI+AS+VP
Sbjct  526   GNTFSSIPYLLMISSIPGAIAYYLVGLRNSFEHFVYFALVLFVCLILVESLMMIVASIVP  585

Query  1663  NYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGLR  1842
             ++LMGII GAG+Q +M+L GG+FR P DLP+ FW+YP+Y+I F KY+ QG YKN F GL 
Sbjct  586   DFLMGIITGAGIQGVMMLNGGFFRKPDDLPEAFWKYPMYHIGFPKYSNQGYYKNAFIGLT  645

Query  1843  LPEET-GQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAKHVV  2019
              P +  G IITGE++L+   QVE+G+SKW+DL +L  M +V R++FL ++K  EK   ++
Sbjct  646   FPNDLGGGIITGEDILKNIWQVELGYSKWVDLAILFGMVIVYRLMFLGIIKFCEKVVPMI  705

Query  2020  KAVM  2031
             KA++
Sbjct  706   KALL  709



>ref|XP_010030452.1| PREDICTED: ABC transporter G family member 11-like [Eucalyptus 
grandis]
 gb|KCW54562.1| hypothetical protein EUGRSUZ_I00521 [Eucalyptus grandis]
Length=709

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/619 (64%), Positives = 477/619 (77%), Gaps = 10/619 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             FLTW+DLWVT  D R G   IL+GLTGYA PG +LA+MGPSGCGKSTLLDAL GRL  +T
Sbjct  89    FLTWKDLWVTAPDQRNGTHPILQGLTGYAEPGRMLAVMGPSGCGKSTLLDALGGRLNSST  148

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             +Q G+ILINGR Q L++GTSAYVTQ+DTL  TLTVREAV YSAQLQLP S+ +SEKKE A
Sbjct  149   QQKGEILINGRKQPLSFGTSAYVTQDDTLITTLTVREAVCYSAQLQLPESMSKSEKKERA  208

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             E TI+EMGLQDA +TRIGGG       G QKRRVSIC+EILTRPKLLFLDEP+SGLDSAA
Sbjct  209   EATIREMGLQDARDTRIGGGSTKGLSGG-QKRRVSICIEILTRPKLLFLDEPTSGLDSAA  267

Query  763   SFYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             S++VM++I  LA  + RTV+ASIHQPS+EVF LF +LCLLSSG+ VYFG  S A QFF +
Sbjct  268   SYHVMNRIAKLAQHDRRTVIASIHQPSSEVFELFHNLCLLSSGKTVYFGLRSGAEQFFAS  327

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREV  1119
             NGFPCPTL NPSDH+L+TINKDF     D+EQG   G+  EEVI  LV SY+S     +V
Sbjct  328   NGFPCPTLTNPSDHYLRTINKDFK---LDIEQG-GHGMNAEEVIETLVKSYESSLMRHQV  383

Query  1120  QGQVAEISKQE--GEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
               QV++IS +   G + +  S+A F TQSIVLT+RSF+NM+RDLGYYWLRL IYI L + 
Sbjct  384   WWQVSKISGKNVGGNLGRNGSQASFITQSIVLTKRSFVNMYRDLGYYWLRLAIYIALCLC  443

Query  1294  LGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGA  1473
             +G ++ D+G    SIQAR S+L F+A+F TFMAIGGFPSFVEDMKVF +E LNGHYG  A
Sbjct  444   VGTIFYDIGSTYGSIQARGSMLMFVAAFLTFMAIGGFPSFVEDMKVFGRERLNGHYGVAA  503

Query  1474  FAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIAS  1653
             F I NT SS+PYLL+ISLIPG IAY+ VGLQ+ F HFAYFA V+   MLLVESLMMI+AS
Sbjct  504   FVIGNTFSSIPYLLIISLIPGAIAYYLVGLQKSFEHFAYFASVLFACMLLVESLMMIVAS  563

Query  1654  LVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQ  1833
             +VP++LMGI+ GAG+Q +M+L GG+FRLP DLPK FWRYP+YYI FHKYA QG +KNEF+
Sbjct  564   IVPDFLMGIVTGAGIQGVMMLNGGFFRLPDDLPKPFWRYPMYYISFHKYANQGFFKNEFE  623

Query  1834  GLRLPEETG--QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKA  2007
             GL  P +      I GEE+LR   QVEMG+SKW+DL +L+ M V+ R++FL ++KA+EK 
Sbjct  624   GLMFPNQMAGSPTIGGEEILRNYWQVEMGYSKWVDLAILLGMVVIYRLMFLGIIKAAEKM  683

Query  2008  KHVVKAVMRVSPKQSHQVV  2064
             K +VK     SP     V 
Sbjct  684   KPLVKNFRAKSPNHPIHVT  702



>ref|XP_009403077.1| PREDICTED: ABC transporter G family member 11-like [Musa acuminata 
subsp. malaccensis]
Length=658

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/619 (61%), Positives = 482/619 (78%), Gaps = 9/619 (1%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             +LTWEDLWVT S+GR  +  IL GLTGYA+PGE+ AIMGPSGCGKSTLLDALAGRL  +T
Sbjct  32    YLTWEDLWVTASNGRSASHVILAGLTGYAQPGEVTAIMGPSGCGKSTLLDALAGRLGSST  91

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             RQSG IL+NGR Q L++GTSAYVTQ+D L  TLTVREAVYYSA+LQLP ++ +SEK+E A
Sbjct  92    RQSGHILVNGRRQRLSFGTSAYVTQDDILMTTLTVREAVYYSAELQLPKTMTKSEKRERA  151

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             +MTI EMGLQDAM+TRIGG        G QKRRVSIC+EILTRPKLLFLDEP+SGLDSAA
Sbjct  152   DMTIGEMGLQDAMDTRIGGYSSKGISGG-QKRRVSICVEILTRPKLLFLDEPTSGLDSAA  210

Query  763   SFYVMSKIMDLA-SEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             S++VM +I++LA  +G T++ASIHQPS+EVF LF +LCLLSSGR VYFGP S   +FF +
Sbjct  211   SYHVMHRIVNLARHDGMTILASIHQPSSEVFELFDNLCLLSSGRTVYFGPTSRTNEFFAS  270

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPT-EEVINILVNSYKSYHRYRE  1116
             NGFPCPT +NPSDH+L+TINKDFD + +   +GC+  +    + I++L  SYK     + 
Sbjct  271   NGFPCPTFRNPSDHYLRTINKDFDKESK---EGCSERLNNANKAIDVLTMSYKQSETCKH  327

Query  1117  VQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGL  1296
             V  +V+EI   EG+++K   +A F  Q +VLT+RSF+NM+RDLGYYWLRL IYI L + +
Sbjct  328   VARRVSEICNTEGDLVKNKRQASFAVQCVVLTKRSFVNMYRDLGYYWLRLAIYIMLCLCI  387

Query  1297  GYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAF  1476
             G ++ DVG    SIQAR S+L F+A F TFMAIGGFPSFVEDMK+F++E LNGHYG  AF
Sbjct  388   GTVFYDVGLSYGSIQARGSMLMFVAGFLTFMAIGGFPSFVEDMKIFRRERLNGHYGVAAF  447

Query  1477  AIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASL  1656
              I+NTLSS PYL L+SL+P  +AY+  GLQR F HF +F+LV+ M MLLVE LMMI+AS+
Sbjct  448   VISNTLSSAPYLALVSLLPAAMAYYLAGLQRGFEHFIFFSLVLYMCMLLVEGLMMIVASI  507

Query  1657  VPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQG  1836
             VPN+LMGII GAG+QA+MIL  G+FRLP+DLPK  W+YP+Y+I FHKYA QG +KNEF G
Sbjct  508   VPNFLMGIITGAGIQAVMILSSGFFRLPRDLPKPVWKYPVYHIAFHKYANQGYFKNEFIG  567

Query  1837  LRLP-EETG--QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKA  2007
             L  P  E G    +TGE V+R+  Q+E+G+SKW+DL +L +M ++ R++FL+++K SEKA
Sbjct  568   LTFPGSEAGGAAAVTGETVVRDYWQMEVGYSKWVDLAILFLMVILYRLLFLVIIKVSEKA  627

Query  2008  KHVVKAVMRVSPKQSHQVV  2064
             K ++  ++   PK+  QV+
Sbjct  628   KPMLMELLNAPPKKVMQVM  646



>ref|XP_010030023.1| PREDICTED: ABC transporter G family member 11-like [Eucalyptus 
grandis]
Length=687

 Score =   706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/607 (64%), Positives = 477/607 (79%), Gaps = 9/607 (1%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTWEDLWVTV+D + G  +IL+GLTG ARPGE+LAIMGPSGCGKSTLLDALAGR+   T+
Sbjct  56    LTWEDLWVTVADKQHGCISILQGLTGCARPGEVLAIMGPSGCGKSTLLDALAGRISGKTK  115

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             ++G IL+NGR + LAYGTSAYVTQ+D LT TLTVREA+Y SAQLQLP S+P  EKK+ A+
Sbjct  116   RTGQILLNGRKEPLAYGTSAYVTQDDVLTWTLTVREAIYLSAQLQLPDSMPLLEKKQRAD  175

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TIKEMGL DA++TRIGG       +G QKRRVSICLEILT PKLLFLDEP+SGLDSAAS
Sbjct  176   TTIKEMGLHDAIDTRIGGWGNKGLSNG-QKRRVSICLEILTHPKLLFLDEPTSGLDSAAS  234

Query  766   FYVMSKIMDLASEGR-TVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETN  942
             +YVM +I+ LA +   TV+ASIHQPS+EVF LF SLCLLS GR VYFG +S A QFF  N
Sbjct  235   YYVMRRIVSLAQQNEMTVLASIHQPSSEVFELFKSLCLLSLGRTVYFGLSSEATQFFALN  294

Query  943   GFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREVQ  1122
             GFPCP+LQNPSDH+L+ IN DFD   ED+E+G      TEEVI +LV+SY S + YR++Q
Sbjct  295   GFPCPSLQNPSDHYLRIINTDFD---EDIERGFGGKQSTEEVIKLLVSSYVSSNTYRQIQ  351

Query  1123  GQVAEISKQ-EGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLG  1299
              Q++EI +Q +  VL +  +A FFTQ  VLTRRSF+NM+RD GYYWLRL IYI L  GLG
Sbjct  352   LQISEIHRQVDRNVLDQEGQACFFTQFPVLTRRSFINMYRDPGYYWLRLIIYIALGFGLG  411

Query  1300  YMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFA  1479
              ++ ++G G+SSIQAR S+L F+ASF T +AIGGFPSFVED+KVF++E LNGHY   AF 
Sbjct  412   TVFCNIGSGDSSIQARGSMLMFVASFLTILAIGGFPSFVEDLKVFERERLNGHYRTSAFV  471

Query  1480  IANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLV  1659
             + NTLSS+P+LL+ISLIPG I Y+ VGLQR   HF YFA  +   M+LVESLMMI+AS++
Sbjct  472   LGNTLSSMPFLLIISLIPGAITYYLVGLQRSLEHFMYFASTLFACMMLVESLMMIVASVM  531

Query  1660  PNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGL  1839
             PN+L+G+I GAG+Q LMILGGG+FRLP DLPK+FWRYP+YY+ FHKYAYQGLYKNEF+GL
Sbjct  532   PNFLLGLITGAGIQGLMILGGGFFRLPNDLPKVFWRYPLYYLSFHKYAYQGLYKNEFEGL  591

Query  1840  RLPEET---GQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAK  2010
              LP         I+GE +LR+  QVEMG+SKW +L +L  M V+ R++F  V+K +EK K
Sbjct  592   TLPGNPLIGESAISGEGILRDIWQVEMGYSKWTNLTILFGMMVLYRLIFFGVLKMTEKFK  651

Query  2011  HVVKAVM  2031
              ++  +M
Sbjct  652   PIIGEIM  658



>ref|XP_003608431.1| White-brown-complex ABC transporter family [Medicago truncatula]
 gb|AES90628.1| white-brown-complex ABC transporter family protein, putative 
[Medicago truncatula]
Length=665

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/628 (63%), Positives = 482/628 (77%), Gaps = 18/628 (3%)
 Frame = +1

Query  226   LTWEDLWVTVS--DGRKG-NKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLEL  396
             LTW+DLWVTVS   G+   +K+IL+GLTGYA+P +LLAIMGPSGCGKSTLLDALAGRL  
Sbjct  28    LTWKDLWVTVSASTGKTNESKSILQGLTGYAKPAQLLAIMGPSGCGKSTLLDALAGRLGS  87

Query  397   TTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKE  576
              TRQSGDILING  Q LAYGTSAYVTQ+DTL  TLTV+EAVYYSAQLQLP ++   EKKE
Sbjct  88    NTRQSGDILINGNKQALAYGTSAYVTQDDTLLTTLTVKEAVYYSAQLQLPDTMSNEEKKE  147

Query  577   IAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDS  756
              A+ TI+EMGLQDA+NTRIGG        G QKRRVSI +EILTRP+LLFLDEP+SGLDS
Sbjct  148   RADFTIREMGLQDAINTRIGGWGVKGISGG-QKRRVSISIEILTRPRLLFLDEPTSGLDS  206

Query  757   AASFYVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQ  927
             AAS+YVM +I  L  +    RT+VASIHQPSTEVF LF +LCLLSSG+ VYFGPASAA +
Sbjct  207   AASYYVMKRIASLDKKDGIQRTIVASIHQPSTEVFQLFHNLCLLSSGKTVYFGPASAASE  266

Query  928   FFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHR  1107
             FF +NGFPCP LQNPSDH LKTINKDFD D E ++      I  E+ I+ILV+SY S  R
Sbjct  267   FFASNGFPCPPLQNPSDHLLKTINKDFDQDIE-MDLSETGTISIEQAIDILVSSYSSSER  325

Query  1108  YREVQGQVAEIS-----KQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGI  1272
              +E++ +V+ +S     K      KK   A F  Q +VLTRRSF+NMFRDLGYYWLRLGI
Sbjct  326   NQEIKNEVSVLSIVLSLKDNNSTYKKK-HAGFLNQCLVLTRRSFVNMFRDLGYYWLRLGI  384

Query  1273  YITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLN  1452
             YI LA+ L  ++ND+   N SIQ R S+L F+ SF TFM IGGFPS+VEDMKVF++E LN
Sbjct  385   YIALAISLATVFNDLDKSNGSIQDRGSLLMFVFSFLTFMTIGGFPSYVEDMKVFERERLN  444

Query  1453  GHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVES  1632
             GHYG  A+ I NTLS++PYLL+ISLIPG IAY+P GLQ+ F HF YF   +   ++LVES
Sbjct  445   GHYGVTAYVIGNTLSAIPYLLMISLIPGAIAYYPPGLQKGFEHFIYFICALFSCLMLVES  504

Query  1633  LMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQG  1812
             LMMI+AS+VP++LMGII GAG+Q +M+L GG+FRLP DLP  FWRYP++YI FH+YA+QG
Sbjct  505   LMMIVASIVPDFLMGIITGAGIQGIMMLAGGFFRLPNDLPNPFWRYPMFYISFHRYAFQG  564

Query  1813  LYKNEFQGLRLP-EETG---QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfl  1980
              YKNEF+GL+   +E G     I+GEE+LR    V+M +SKW+DL VL+ M V+ RVVFL
Sbjct  565   SYKNEFEGLKFERDEIGGSLNYISGEEILRNKFHVDMSYSKWVDLGVLLGMIVLYRVVFL  624

Query  1981  lvvKASEKAKHVVKAVMRVSPKQSHQVV  2064
             +++K +EK K +V + M VSP+Q+ Q++
Sbjct  625   IIIKTTEKLKPIVMSFMSVSPRQTRQIL  652



>ref|XP_010939685.1| PREDICTED: ABC transporter G family member 11-like [Elaeis guineensis]
Length=745

 Score =   706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/618 (63%), Positives = 473/618 (77%), Gaps = 9/618 (1%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW+DLWV+ SDG+ G   IL GL GYA+PGE+LAIMGPSGCGKSTLLD LAGRL     
Sbjct  113   LTWKDLWVSASDGKGGRAPILCGLNGYAKPGEILAIMGPSGCGKSTLLDTLAGRLGSNVS  172

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             QSG+ILING+ Q LA+GTSAYVTQ+D L  TLTVREAVYYSAQLQLP S+ R EK+E AE
Sbjct  173   QSGEILINGQKQKLAFGTSAYVTQDDVLMTTLTVREAVYYSAQLQLPDSMSRKEKRERAE  232

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI+EMGL  AM+TRIGG        G QKRRVSIC+EILTRP+LLFLDEP+SGLDSAAS
Sbjct  233   ETIREMGLGGAMDTRIGGWASKGISGG-QKRRVSICMEILTRPELLFLDEPTSGLDSAAS  291

Query  766   FYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETN  942
             ++VM +I  LA  EG TVVA+IHQPS+EVF LF  LCLL+ G+ VYFG A+A  +FF  N
Sbjct  292   YHVMERIASLARREGMTVVAAIHQPSSEVFELFHGLCLLAYGKTVYFGRAAATSEFFALN  351

Query  943   GFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGC-ARGIPTEEVINILVNSYKSYHRYREV  1119
             GFPCP L+NPSDHFL+TINKDF+   +D+E+G     I T E I ILV SYKS    ++V
Sbjct  352   GFPCPPLRNPSDHFLRTINKDFE---KDIEEGPDVNPITTAEAIEILVKSYKSSTISQQV  408

Query  1120  QGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLG  1299
               Q+AEIS+  G ++KK S+A F TQS+VLT RSF+NM+RDLGYYWLR  IYI L + +G
Sbjct  409   VQQIAEISEMGGALVKKGSQASFLTQSLVLTSRSFVNMYRDLGYYWLRFAIYIALCLCVG  468

Query  1300  YMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFA  1479
              +Y DVG+   SIQAR S+L F A+F TFMAIGGFPSFVEDMK+F +E LNGHYG  AF 
Sbjct  469   TIYYDVGHSYGSIQARGSMLMFTAAFLTFMAIGGFPSFVEDMKIFGRERLNGHYGVTAFV  528

Query  1480  IANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLV  1659
             IANTLS+ PYL LIS+ PG +AY+ VGLQR   HFAYFALV+ M M+LVE LMMI+AS+V
Sbjct  529   IANTLSATPYLALISVAPGAMAYYLVGLQRRIDHFAYFALVLFMCMMLVEGLMMIVASIV  588

Query  1660  PNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGL  1839
             P++LMGII GAG+Q +M+L GG+FRLP DLPK  WRYP+YYI FH YA QG YKNEF GL
Sbjct  589   PDFLMGIITGAGIQGVMMLNGGFFRLPDDLPKPVWRYPMYYIAFHTYANQGFYKNEFLGL  648

Query  1840  RLPEETG---QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAK  2010
               P +       I+GEE+LR+  QVEM +SKW++L +L  M ++ R++FL++VK +EK K
Sbjct  649   TFPNDQAGGPPTISGEEILRDIWQVEMSYSKWVNLAILFGMVILYRILFLVIVKITEKVK  708

Query  2011  HVVKAVMRVSPKQSHQVV  2064
              ++KA++   P +S  V+
Sbjct  709   PMIKALLVKPPVKSIHVL  726



>ref|XP_010680511.1| PREDICTED: ABC transporter G family member 11-like [Beta vulgaris 
subsp. vulgaris]
Length=706

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/617 (63%), Positives = 481/617 (78%), Gaps = 20/617 (3%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKG-----------NKAILKGLTGYARPGELLAIMGPSGCGKSTLLD  372
             LTW+DL VTV+  + G            + IL+G++G+A PGE+LA+MGPSGCGKSTLLD
Sbjct  85    LTWKDLCVTVNGAKGGGGGGGGGDGGRRRTILEGVSGFAEPGEVLAVMGPSGCGKSTLLD  144

Query  373   ALAGRLELTTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSS  552
             ALAGRL   TRQ+G+ILINGR QTLA+GTSAYVTQ+DTL  TLTV+EA+YYSAQLQLP S
Sbjct  145   ALAGRLGSKTRQTGEILINGRKQTLAFGTSAYVTQDDTLMTTLTVKEAIYYSAQLQLPDS  204

Query  553   LPRSEKKEIAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLD  732
             + +SEK   A   IK+MGLQ  +NTRIGG        G QKRRVSIC+EILTRP+LLFLD
Sbjct  205   MTKSEKLARANDAIKDMGLQGCVNTRIGGWRVKGLSGG-QKRRVSICIEILTRPRLLFLD  263

Query  733   EPSSGLDSAASFYVMSKIMDLASEG-RTVVASIHQPSTEVfslftslcllssGRVVYFGP  909
             EP+SGLDSAAS++VMS+I+ LA +  RT+VASIHQPS+EVF LF +LCLLSSG++VYFGP
Sbjct  264   EPTSGLDSAASYHVMSRIIKLAKQDHRTIVASIHQPSSEVFELFHNLCLLSSGKLVYFGP  323

Query  910   ASAAIQFFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNS  1089
             AS AI+FF  +GFPCPT++NPSDHFL+TINKDF+ D   +EQG      TEE IN LVNS
Sbjct  324   ASTAIEFFSLSGFPCPTMRNPSDHFLRTINKDFETD---IEQGLDGMKSTEEAINTLVNS  380

Query  1090  YKSYHRYREVQGQVAEISKQEGEVLK-KSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRL  1266
             YKS   Y EVQ  ++ I +  G   + K   A F TQS VLTRRSF+NM+RDLGYYWLRL
Sbjct  381   YKSSQTYIEVQHHISTICQLGGSSTESKRKNAGFITQSFVLTRRSFVNMYRDLGYYWLRL  440

Query  1267  GIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKET  1446
              +YI L + +G ++ D+G+   SIQAR S+L F+A+F TFMAIGGFPSFVEDMK+F++E 
Sbjct  441   AVYIALCLCVGTIFYDIGHSYGSIQARGSMLMFVAAFLTFMAIGGFPSFVEDMKIFERER  500

Query  1447  LNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLV  1626
             LNGHY  GA+ I NTLSS+PYLL+ISLIPG IAY+ V LQ EF HF YFALV+ + M+LV
Sbjct  501   LNGHYSVGAYTIGNTLSSIPYLLIISLIPGAIAYYLVHLQTEFSHFVYFALVLFVCMMLV  560

Query  1627  ESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAY  1806
             ESLMMI+ASLVP++LMGII GAG+Q +M+L GG+FRLP DLPK FWRYP+YYI FHKYA 
Sbjct  561   ESLMMIVASLVPDFLMGIITGAGIQGVMMLNGGFFRLPNDLPKPFWRYPMYYIAFHKYAN  620

Query  1807  QGLYKNEFQGLRLPEET---GQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvf  1977
             QG YKNEF+GLR P +    G  I+GEEVL+   QVEMG+SKW+DL +L+ M VV R++F
Sbjct  621   QGFYKNEFEGLRFPNDLVGGGATISGEEVLKSFWQVEMGYSKWVDLAILIGMVVVYRLMF  680

Query  1978  llvvKASEKAKHVVKAV  2028
             L ++K +EK K +++++
Sbjct  681   LGIIKLAEKIKPMIRSL  697



>ref|XP_008790912.1| PREDICTED: ABC transporter G family member 11-like [Phoenix dactylifera]
Length=708

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/618 (62%), Positives = 470/618 (76%), Gaps = 7/618 (1%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             FLTWEDLWV+ SDG+ G   IL GL GYA+PGE+LAIMGPSGCGKSTLLD LA RL    
Sbjct  80    FLTWEDLWVSASDGKGGRVPILCGLNGYAKPGEILAIMGPSGCGKSTLLDTLAERLGSNV  139

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
              QSG+IL+NGR Q LA+GTSAYVTQ+D L  TLTV EAV YSAQLQLP S+ R+EK+E A
Sbjct  140   SQSGEILVNGRKQKLAFGTSAYVTQDDVLMTTLTVGEAVCYSAQLQLPDSMSRAEKRERA  199

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             E TI EMGL  AMNTRIGG        G QKRRVSIC+EILTRP+LLFLDEP+SGLDSAA
Sbjct  200   EATIWEMGLGGAMNTRIGGWASKGISGG-QKRRVSICMEILTRPELLFLDEPTSGLDSAA  258

Query  763   SFYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             SF+VM +I  LA  EG TVVA+IHQPS+EVF LF  LCLL+ GR VYFGPASA  +FF  
Sbjct  259   SFHVMDRIAWLARREGMTVVAAIHQPSSEVFELFHGLCLLAYGRTVYFGPASATSEFFAL  318

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREV  1119
             NGFPCP L+NPSDH+L+TINKDFD D E+  +   + + T E I  LV SYKS    ++V
Sbjct  319   NGFPCPPLRNPSDHYLRTINKDFDKDIEEGPE--VKPMTTAEAIETLVKSYKSSTISQQV  376

Query  1120  QGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLG  1299
               Q+AEI    G ++ K ++A F TQS+VLTRRSF+NM+RDLGYYWLR  IYI L + +G
Sbjct  377   VQQIAEIRLMGGALVTKGNQASFLTQSLVLTRRSFVNMYRDLGYYWLRFAIYIALCLCVG  436

Query  1300  YMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFA  1479
              +Y+DVG+   SIQAR S+L F A+F TFMAIGGFPSFVEDMK+F +E LNGHYG  +F 
Sbjct  437   TIYHDVGHSYGSIQARGSMLMFTAAFLTFMAIGGFPSFVEDMKIFGRERLNGHYGVTSFV  496

Query  1480  IANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLV  1659
             IANTLS+ PYL LIS+ PG +AY+ VGLQ+   HFAYFALV+ M M+LVE LMMI+AS+V
Sbjct  497   IANTLSATPYLALISVAPGAMAYYLVGLQKGIDHFAYFALVLFMCMMLVEGLMMIVASIV  556

Query  1660  PNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGL  1839
             P++LMGII GAG+Q +M+L GG+FRLP DLPK  WRYP+YY+ FH YA QG YKNEF GL
Sbjct  557   PDFLMGIITGAGIQGVMMLNGGFFRLPDDLPKPVWRYPMYYVAFHTYANQGFYKNEFLGL  616

Query  1840  RLPEETG---QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAK  2010
               P +       I+GEE+LR+  QVEM +SKW++L +L  M ++ RV+FL++VK +EK K
Sbjct  617   TFPNDQAGGPPTISGEEILRDIWQVEMSYSKWVNLAILFGMVILYRVLFLVIVKITEKVK  676

Query  2011  HVVKAVMRVSPKQSHQVV  2064
              ++KA++   P++S  V+
Sbjct  677   PMIKALLVKPPEKSTHVM  694



>ref|XP_004306292.1| PREDICTED: ABC transporter G family member 11-like [Fragaria 
vesca subsp. vesca]
Length=707

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/632 (62%), Positives = 477/632 (75%), Gaps = 22/632 (3%)
 Frame = +1

Query  223   FLTWEDLWVTV----------SDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLD  372
             FLTWEDLWV V          S   +  ++IL+G+TG A+PG+LLAIMGPSGCGKSTLLD
Sbjct  67    FLTWEDLWVRVASNLNEREKHSSDERNCRSILRGVTGCAKPGQLLAIMGPSGCGKSTLLD  126

Query  373   ALAGRLELTTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSS  552
             ALAGRL   TRQ+GDILING  Q LAYGTSAYVTQ+DTL  TLTV+EAVYYSAQLQLP S
Sbjct  127   ALAGRLSSNTRQTGDILINGHKQALAYGTSAYVTQDDTLMTTLTVKEAVYYSAQLQLPDS  186

Query  553   LPRSEKKEIAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLD  732
             +   +K E A++TI+EMGLQ+ MNTRIGG        G +KRRVSIC+E+LT+PKLLFLD
Sbjct  187   MTMLKKIERAQVTIREMGLQNVMNTRIGGWGAKGLSGG-EKRRVSICIELLTQPKLLFLD  245

Query  733   EPSSGLDSAASFYVMSKIMDLA--SEGRTVVASIHQPSTEVfslftslcllssGRVVYFG  906
             EP+SGLDSAAS+YVMS+I +L   S  RT+VASIHQPS EVF LF +LCLLS G  VYFG
Sbjct  246   EPTSGLDSAASYYVMSRIANLGHKSSQRTIVASIHQPSYEVFQLFDNLCLLSCGETVYFG  305

Query  907   PASAAIQFFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVN  1086
             PASAA +FF   G PCP L  PSDHFLKTINKDF+    +++QG A   PTEE I+ L+ 
Sbjct  306   PASAANEFFAACGCPCPPLLYPSDHFLKTINKDFE---LNIKQGLAGRTPTEEAIHTLIK  362

Query  1087  SYKSYHRYREVQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRL  1266
             SYK+   YR++Q Q++EI K++ E  +K S A F TQ  VLTRRSF+NM+RD GYYWLRL
Sbjct  363   SYKTSDNYRQLQIQISEIYKKDCEASEKRSHAGFLTQCFVLTRRSFVNMYRDRGYYWLRL  422

Query  1267  GIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKET  1446
              IYI LA GLG +Y D+GY  +SIQAR S+LAF+ SF TFMAIGGFPSFVEDMKVF++E 
Sbjct  423   FIYIALAAGLGTIYYDLGYTFASIQARGSLLAFVVSFLTFMAIGGFPSFVEDMKVFERER  482

Query  1447  LNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLV  1626
             LNGHYG  AF  ANT SS+P L+LISLIPG   Y+   L   F HF YFA  +   M+LV
Sbjct  483   LNGHYGVIAFVFANTFSSMPLLMLISLIPGATIYYLARLHSGFEHFFYFASALFACMMLV  542

Query  1627  ESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAY  1806
             ESLMMI+AS+VPN+LMGII G+GLQ +M+L GGYFRLP DLP L W+YP+Y+I FHKYA+
Sbjct  543   ESLMMIVASIVPNFLMGIIVGSGLQGIMLLCGGYFRLPNDLPNLVWKYPLYHIAFHKYAF  602

Query  1807  QGLYKNEFQGLRLPE------ETGQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcr  1968
             QG++KNEF+G   P          + ++GE +LR+ LQVEMG+SKW+DL VL+ M V+ R
Sbjct  603   QGMFKNEFEGTTFPNAQLGIGNNSKKLSGERILRDILQVEMGYSKWVDLGVLLGMIVLYR  662

Query  1969  vvfllvvKASEKAKHVVKAVMRVSPKQSHQVV  2064
              +FL+++K +EK K +  A++ V+PK+S QV+
Sbjct  663   ALFLVIIKINEKGKTITFALLSVAPKRSMQVL  694



>ref|XP_010648248.1| PREDICTED: ABC transporter G family member 11-like [Vitis vinifera]
 emb|CBI34073.3| unnamed protein product [Vitis vinifera]
Length=645

 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/576 (66%), Positives = 458/576 (80%), Gaps = 13/576 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             ++TW++L VTVS+G   +K IL+GLTGYA+P ++LAIMGPSG GKSTLLDALAGRL+  T
Sbjct  25    YVTWKELSVTVSNG---SKFILQGLTGYAQPSQVLAIMGPSGSGKSTLLDALAGRLDSRT  81

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             R +G+ILINGR Q  AYGT AYVTQ+DTLT TLTVREAV+YSAQLQLP S+  SEKKE +
Sbjct  82    RHTGEILINGRKQWSAYGTMAYVTQDDTLTWTLTVREAVFYSAQLQLPKSMSISEKKERS  141

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             E TI+EMGLQD+M+TRIGG        G QKRRVSIC+EILTRPKLLFLDEP+SGLDSAA
Sbjct  142   ETTIREMGLQDSMDTRIGGWGSKGLSGG-QKRRVSICIEILTRPKLLFLDEPTSGLDSAA  200

Query  763   SFYVMSKIMDLASE-GRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             S++VM +I+DLA + G T++ASIHQPS+EVF LF +LCLLSSGR +YFGP+  A +FF  
Sbjct  201   SYFVMRRIVDLAQQNGMTIIASIHQPSSEVFELFPNLCLLSSGRTIYFGPSHCANEFFAL  260

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREV  1119
             NGFPCP LQNPSDH+L+TIN DFD   ED+EQG +    TEEVIN+L  SY+     +++
Sbjct  261   NGFPCPVLQNPSDHYLRTINTDFD---EDIEQGISGKKTTEEVINMLAKSYELSDTCKQI  317

Query  1120  QGQVAEISKQEG-EVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGL  1296
             + QVAEI +Q G E+ KK S+A F TQ ++LTRRSFLNM RDLGYYWLRL IY+TL +GL
Sbjct  318   KRQVAEICRQGGGELEKKGSQASFITQCLILTRRSFLNMHRDLGYYWLRLVIYVTLGLGL  377

Query  1297  GYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAF  1476
             G ++ DVG G  SI+AR S++ F+ SF T MAIGGFPSFVE+MKVF++E LNGHYG GAF
Sbjct  378   GTVFYDVGAGYESIRARGSMIMFVVSFLTIMAIGGFPSFVEEMKVFRRERLNGHYGPGAF  437

Query  1477  AIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASL  1656
              I NT SS+P+LL+ISLIPG I Y+ VGLQ+    F YF  V+   MLLVESLMMI+AS+
Sbjct  438   VIGNTFSSMPFLLIISLIPGAITYYLVGLQQGGKCFVYFVTVLFTCMLLVESLMMIVASI  497

Query  1657  VPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQG  1836
             +PN+LMG+I GAG+Q LMIL  G+FRLP DLPKL WRYP+YYI FHKYAYQGLYKNEF+G
Sbjct  498   MPNFLMGLITGAGIQGLMILSAGFFRLPSDLPKLLWRYPLYYIAFHKYAYQGLYKNEFEG  557

Query  1837  LRLP--EETGQ--IITGEEVLRETLQVEMGHSKWID  1932
             L  P  E  G    I G+++LR+  QVEMG+SKWID
Sbjct  558   LTFPSNEALGHPTTINGDKILRDIWQVEMGYSKWID  593



>gb|EYU23963.1| hypothetical protein MIMGU_mgv1a018782mg [Erythranthe guttata]
Length=687

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/618 (62%), Positives = 477/618 (77%), Gaps = 13/618 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGR----KGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRL  390
             +LTW+DLWVTV + +    +G + IL G++GY  PGE+LA+MGPSGCGKSTLL+ALAGRL
Sbjct  74    YLTWKDLWVTVPEKKAAAAEGRRPILMGVSGYVEPGEVLAVMGPSGCGKSTLLNALAGRL  133

Query  391   ELTTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEK  570
             +  TRQ GDILINGR + LA+GTSAYVTQ+DTL  TLTVREAV+YSA LQLP+++  SEK
Sbjct  134   DSNTRQKGDILINGRKKALAFGTSAYVTQDDTLMTTLTVREAVHYSALLQLPNTMSNSEK  193

Query  571   KEIAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGL  750
             K+ AE TIKEMGLQDA++TRIGG        G QKRRVSIC+EILTRPKLLFLDEP+SGL
Sbjct  194   KKRAEDTIKEMGLQDAVDTRIGGWSVKGLSGG-QKRRVSICIEILTRPKLLFLDEPTSGL  252

Query  751   DSAASFYVMSKIMDLASEGR-TVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQ  927
             DSA+S++VMS+I+ +  + R TVV SIHQPS EVF LF +LCLLSSGRVVYFG  SAA  
Sbjct  253   DSASSYHVMSRIIKIVRQDRRTVVVSIHQPSGEVFDLFHNLCLLSSGRVVYFGSTSAANS  312

Query  928   FFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHR  1107
             FF +NGFPCP+++NPSDH+L+TINKDFD    D+EQG    I   E +N+L +SYKS + 
Sbjct  313   FFASNGFPCPSMRNPSDHYLRTINKDFD---VDIEQGLDGTITATEAVNVLSDSYKSSNA  369

Query  1108  YREVQGQVAEISKQEGEVL-KKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITL  1284
             Y  VQ +V +I  + GE L KK S A F TQ +VLT+RSF+NM+RDLGYYWLRL IYI L
Sbjct  370   YDHVQKRVQDICLKSGEALEKKGSHAGFITQCVVLTQRSFMNMYRDLGYYWLRLAIYIAL  429

Query  1285  AVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYG  1464
              + +G +Y D+G+   SIQAR S+L F+A+F TFMAIGGFPSFVEDMK+F +E LNGHYG
Sbjct  430   CLCVGTIYYDIGHSYGSIQARGSMLFFVAAFLTFMAIGGFPSFVEDMKIFTRERLNGHYG  489

Query  1465  CGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMI  1644
               AF + NT+SS+PYLLLISL+PG +AY+ VGLQ+   HF  F LV+   M+LVESLMMI
Sbjct  490   VAAFVVGNTISSIPYLLLISLLPGAMAYYLVGLQKSIDHFVCFLLVLFTCMMLVESLMMI  549

Query  1645  IASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKN  1824
             +AS+VP++LMGII GAG+Q +M+L GG+FRLP DLPK FWRYP+Y I FHKYA QG +KN
Sbjct  550   VASVVPDFLMGIITGAGIQGVMMLNGGFFRLPDDLPKPFWRYPMYNIAFHKYADQGFFKN  609

Query  1825  EFQGLRLPEET---GQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKA  1995
             EF+GL  P E       ITGEE+LR   QVEMG+SKWID+ +L  M V+ R +FL ++KA
Sbjct  610   EFEGLTFPNELAGGAATITGEEILRNVWQVEMGYSKWIDVAILFGMVVLYRFMFLGIIKA  669

Query  1996  SEKAKHVVKAVMRVSPKQ  2049
              EK + +++A +  + K 
Sbjct  670   KEKFRPMIRAFLAGNAKD  687



>gb|KCW56964.1| hypothetical protein EUGRSUZ_I02638, partial [Eucalyptus grandis]
Length=648

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/605 (64%), Positives = 472/605 (78%), Gaps = 16/605 (3%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTWEDLWVTV+D + G  +IL+GLTG ARPGE+LAIMGPSGCGKSTLLDALAGR+   T+
Sbjct  56    LTWEDLWVTVADKQHGCISILQGLTGCARPGEVLAIMGPSGCGKSTLLDALAGRISGKTK  115

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             ++G IL+NGR + LAYGTSAYVTQ+D LT TLTVREA+Y SAQLQLP S+P  EKK+ A+
Sbjct  116   RTGQILLNGRKEPLAYGTSAYVTQDDVLTWTLTVREAIYLSAQLQLPDSMPLLEKKQRAD  175

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TIKEMGL DA++TRIGG       +G QKRRVSICLEILT PKLLFLDEP+SGLDSAAS
Sbjct  176   TTIKEMGLHDAIDTRIGGWGNKGLSNG-QKRRVSICLEILTHPKLLFLDEPTSGLDSAAS  234

Query  766   FYVMSKIMDLASEGR-TVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETN  942
             +YVM +I+ LA +   TV+ASIHQPS+EVF LF SLCLLS GR VYFG +S A QFF  N
Sbjct  235   YYVMRRIVSLAQQNEMTVLASIHQPSSEVFELFKSLCLLSLGRTVYFGLSSEATQFFALN  294

Query  943   GFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREVQ  1122
             GFPCP+LQNPSDH+L+ IN DFD   ED+E+G      TEEVI +LV+SY S + YR++Q
Sbjct  295   GFPCPSLQNPSDHYLRIINTDFD---EDIERGFGGKQSTEEVIKLLVSSYVSSNTYRQIQ  351

Query  1123  GQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLGY  1302
              Q++EI +Q         +A FFTQ  VLTRRSF+NM+RD GYYWLRL IYI L  GLG 
Sbjct  352   LQISEIHRQ--------GQACFFTQFPVLTRRSFINMYRDPGYYWLRLIIYIALGFGLGT  403

Query  1303  MYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFAI  1482
             ++ ++G G+SSIQAR S+L F+ASF T +AIGGFPSFVED+KVF++E LNGHY   AF +
Sbjct  404   VFCNIGSGDSSIQARGSMLMFVASFLTILAIGGFPSFVEDLKVFERERLNGHYRTSAFVL  463

Query  1483  ANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLVP  1662
              NTLSS+P+LL+ISLIPG I Y+ VGLQR   HF YFA  +   M+LVESLMMI+AS++P
Sbjct  464   GNTLSSMPFLLIISLIPGAITYYLVGLQRSLEHFMYFASTLFACMMLVESLMMIVASVMP  523

Query  1663  NYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGLR  1842
             N+L+G+I GAG+Q LMILGGG+FRLP DLPK+FWRYP+YY+ FHKYAYQGLYKNEF+GL 
Sbjct  524   NFLLGLITGAGIQGLMILGGGFFRLPNDLPKVFWRYPLYYLSFHKYAYQGLYKNEFEGLT  583

Query  1843  LPEET---GQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAKH  2013
             LP         I+GE +LR+  QVEMG+SKW +L +L  M V+ R++F  V+K +EK K 
Sbjct  584   LPGNPLIGESAISGEGILRDIWQVEMGYSKWTNLTILFGMMVLYRLIFFGVLKMTEKFKP  643

Query  2014  VVKAV  2028
             ++  +
Sbjct  644   IIGEI  648



>gb|EYU23962.1| hypothetical protein MIMGU_mgv1a002102mg [Erythranthe guttata]
Length=714

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/620 (62%), Positives = 477/620 (77%), Gaps = 15/620 (2%)
 Frame = +1

Query  223   FLTWEDLWVTV------SDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAG  384
             +LTW+DLWVTV      +   +G + IL G++GY  PGE+LA+MGPSGCGKSTLLDALAG
Sbjct  99    YLTWKDLWVTVPEKKKEAAAAEGRRPILAGVSGYVEPGEVLAVMGPSGCGKSTLLDALAG  158

Query  385   RLELTTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRS  564
             RL+  TRQ G+ILINGR Q LA+GTSAYVTQ+DTL  TLTVREAV+YSA LQLP+++  S
Sbjct  159   RLDSNTRQKGEILINGRKQALAFGTSAYVTQDDTLMTTLTVREAVHYSALLQLPNTMSNS  218

Query  565   EKKEIAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSS  744
             EKK+ AE TIKEMGLQDA++TRIGG        G QKRRVSIC+EILTRPKLLFLDEP+S
Sbjct  219   EKKKRAEDTIKEMGLQDAVDTRIGGWSVKGLSGG-QKRRVSICIEILTRPKLLFLDEPTS  277

Query  745   GLDSAASFYVMSKIMDLASEGR-TVVASIHQPSTEVfslftslcllssGRVVYFGPASAA  921
             GLDSA+S++VMS+I+ +A + R TVV SIHQPS EVF LF +LCLLSSGRVVYFG  SAA
Sbjct  278   GLDSASSYHVMSRIIKIARQDRRTVVVSIHQPSGEVFDLFHNLCLLSSGRVVYFGSTSAA  337

Query  922   IQFFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSY  1101
               FF +NGFPCP+++NPSDH+L+TINKDFD    D+EQG    I   E + IL +SYKS 
Sbjct  338   NSFFASNGFPCPSMRNPSDHYLRTINKDFD---VDIEQGLDGTITATEAVKILADSYKSS  394

Query  1102  HRYREVQGQVAEISKQEGEVL-KKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYI  1278
             + +  VQ +V +I  + GE L KK S A F TQ IVLT+RSF+NM+RDLGYYWLRL IYI
Sbjct  395   NAFDHVQKRVQDICLKSGEALEKKGSHAGFITQCIVLTQRSFVNMYRDLGYYWLRLAIYI  454

Query  1279  TLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGH  1458
              L + +G +Y D+G+   SIQAR S+L F+A+F TFMAIGGFPSFVEDMK+F +E LNGH
Sbjct  455   ALCLCVGTIYYDIGHSYGSIQARGSMLFFVAAFLTFMAIGGFPSFVEDMKIFTRERLNGH  514

Query  1459  YGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLM  1638
             YG  AF + NT+SS+PYLLLISL+PG +AY+ VGLQ+   HF  F LV+   M+LVESLM
Sbjct  515   YGVAAFVVGNTISSIPYLLLISLLPGAMAYYLVGLQKSIDHFVCFLLVLFTCMMLVESLM  574

Query  1639  MIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLY  1818
             MI+AS+VP++LMGII GAG+Q +M+L GG+FRLP DLPK FWRYP+YYI FHKYA QG +
Sbjct  575   MIVASVVPDFLMGIITGAGIQGVMMLNGGFFRLPDDLPKPFWRYPMYYIAFHKYADQGFF  634

Query  1819  KNEFQGLRLPEET---GQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvv  1989
             KNEF+GL  P E       ITGEE+LR   QVEMG+SKWID+ +L  M V+ R +FL ++
Sbjct  635   KNEFEGLTFPNELAGGAATITGEEILRNVWQVEMGYSKWIDVAILFGMVVLYRFMFLGII  694

Query  1990  KASEKAKHVVKAVMRVSPKQ  2049
             KA EK + +++A +  + K 
Sbjct  695   KAKEKFRPMIRAFLAGNAKD  714



>emb|CAN72387.1| hypothetical protein VITISV_025427 [Vitis vinifera]
Length=645

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/576 (65%), Positives = 456/576 (79%), Gaps = 13/576 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             ++ W++L VT+ +G   +K IL+GLTGYA+P ++LAIMGPSG GKSTLLDALAGRL+  T
Sbjct  25    YVAWKELSVTIXNG---SKFILQGLTGYAQPSQVLAIMGPSGSGKSTLLDALAGRLDSRT  81

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             R +G+ILINGR Q  AYGT AYVTQ+DTLT TLTVREAV+YSAQLQLP S+  SEKKE +
Sbjct  82    RHTGEILINGRKQWSAYGTMAYVTQDDTLTWTLTVREAVFYSAQLQLPKSMSISEKKERS  141

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             E TI+EMGLQD+M+TRIGG        G QKRRVSIC+EILTRPKLLFLDEP+SGLDSAA
Sbjct  142   ETTIREMGLQDSMDTRIGGWGSKGLSGG-QKRRVSICIEILTRPKLLFLDEPTSGLDSAA  200

Query  763   SFYVMSKIMDLASE-GRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             S++VM +I+DLA + G T++ASIHQPS+EVF LF +LCLLSSGR +YFGP+  A +FF  
Sbjct  201   SYFVMRRIVDLAQQNGMTIIASIHQPSSEVFXLFPNLCLLSSGRTIYFGPSHCANEFFAL  260

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREV  1119
             NGFPCP LQNPSDH+L+TIN DFD   ED+EQG +    TEEVIN+L  SY+     +++
Sbjct  261   NGFPCPALQNPSDHYLRTINTDFD---EDIEQGISGKKTTEEVINMLAKSYELSDTCKQI  317

Query  1120  QGQVAEISKQEG-EVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGL  1296
             + QVAEI +Q G E+ KK S+A F TQ ++LTRRSFLNM RDLGYYWLRL IY+TL +GL
Sbjct  318   KRQVAEICRQGGGELEKKGSQASFITQCLILTRRSFLNMHRDLGYYWLRLVIYVTLGLGL  377

Query  1297  GYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAF  1476
             G ++ DVG G  SI+AR S++ F+ SF T MAIGGFPSFVE+MKVF++E LNGHYG GAF
Sbjct  378   GTVFYDVGAGYESIRARGSMIMFVVSFLTIMAIGGFPSFVEEMKVFRRERLNGHYGPGAF  437

Query  1477  AIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASL  1656
              I NT SS+P+LL+ISLIPG I Y+ VGLQ+    F YF  V+   MLLVESLMMI+AS+
Sbjct  438   VIGNTFSSMPFLLIISLIPGAITYYLVGLQQGGKCFVYFVTVLFTCMLLVESLMMIVASI  497

Query  1657  VPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQG  1836
             +PN+LMG+I GAG+Q LMIL  G+FRLP DLPKL WRYP+YYI FHKYAYQGLYKNEF+G
Sbjct  498   MPNFLMGLITGAGIQGLMILSAGFFRLPSDLPKLLWRYPLYYIAFHKYAYQGLYKNEFEG  557

Query  1837  LRLP--EETGQ--IITGEEVLRETLQVEMGHSKWID  1932
             L  P  E  G    I G+++LR+  QVEMG+SKWID
Sbjct  558   LTFPSNEALGHPTTINGDKILRDIWQVEMGYSKWID  593



>ref|XP_010094141.1| ABC transporter G family member 11 [Morus notabilis]
 gb|EXB55274.1| ABC transporter G family member 11 [Morus notabilis]
Length=709

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/638 (63%), Positives = 482/638 (76%), Gaps = 41/638 (6%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             FLTW+DLWVTVS  R   K IL+GLTGYA+PGELLA+MGPSG GKSTLLDALAGRL L  
Sbjct  64    FLTWDDLWVTVSGRRNDEKPILQGLTGYAKPGELLAVMGPSGSGKSTLLDALAGRLSLKM  123

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             RQ+G+ILING+ QTLAYG SAYV Q+D LT TLTV EAV Y+AQLQLP S+  SEKKE A
Sbjct  124   RQTGEILINGQKQTLAYGASAYVAQDDVLTTTLTVGEAVNYAAQLQLPDSMSASEKKERA  183

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             + TI+EMGLQ A+NT   GGWG +GISGGQKRRVSIC+EILTR KLLFLDEP+SGLDSAA
Sbjct  184   DATIREMGLQSAINT-PIGGWGVRGISGGQKRRVSICVEILTRSKLLFLDEPTSGLDSAA  242

Query  763   SFYVMSKIMDLAS---EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFF  933
             S+YVM+ I  L     + RT+VASIHQPS+EVF LF SLCLL +G+ VY GPAS A +FF
Sbjct  243   SYYVMNGIAGLDQRDGDRRTIVASIHQPSSEVFQLFDSLCLLCAGKTVYLGPASGANEFF  302

Query  934   ETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIP-TEEVINILVNSYKSYHRY  1110
              ++GFPCPTLQNPSDHFLKTINKDF+   +D+EQG    +P  ++ I+ L  SY++   Y
Sbjct  303   ASSGFPCPTLQNPSDHFLKTINKDFE---QDIEQGIDGAVPRVQDAIDTLTKSYRASVTY  359

Query  1111  REVQGQVAEISKQE-GEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLA  1287
             R+V+ +VAEI KQ+ G V KK S A F TQ +VLTRRSF NM RDLGYYWLR+ IYI +A
Sbjct  360   RQVRTEVAEICKQDCGAVEKKRSHASFLTQCLVLTRRSFKNMNRDLGYYWLRIAIYILVA  419

Query  1288  VGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMK-------------  1428
             +GLG +Y D+G    SIQAR S++ FIASF TFMAIGGFPSFVEDMK             
Sbjct  420   LGLGTIYYDIGTNYGSIQARGSLIMFIASFLTFMAIGGFPSFVEDMKARCCNARLSCCSM  479

Query  1429  ----------------VFKKETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVG  1560
                             VF++E LNGHYG  +F I NTLSS PYL L+S+IPG +AYF  G
Sbjct  480   PFAATSVFSLVNPLQRVFERERLNGHYGATSFVIGNTLSSQPYLFLVSVIPGALAYFLSG  539

Query  1561  LQREFGHFAYFALVILMNMLLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLP  1740
             L+++  HF YF  V+  +M+LVESLMMI+AS+VPN+LMGII GAG+Q LMILGGG+FRLP
Sbjct  540   LRKDHEHFLYFVSVLYASMILVESLMMIVASIVPNFLMGIITGAGIQGLMILGGGFFRLP  599

Query  1741  KDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGLRLPEETG---QIITGEEVLRETLQVEM  1911
             +DLP +FWRYP+YY+ FH+YAYQG++KNEF GL  P E G    IITGEE+LR+  +V+M
Sbjct  600   RDLPVVFWRYPLYYVAFHRYAYQGMFKNEFDGLSFPNEEGGGRAIITGEEILRDKWEVDM  659

Query  1912  GHSKWIDllvlvvmgvvcrvvfllvvKASEKAKHVVKA  2025
              +SKW+DL VL+ M V  RV+FL++VK SE  K ++ A
Sbjct  660   SYSKWVDLAVLLGMVVFYRVLFLVIVKTSEIFKSMISA  697



>gb|EYU18458.1| hypothetical protein MIMGU_mgv1a018793mg [Erythranthe guttata]
Length=635

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/577 (63%), Positives = 453/577 (79%), Gaps = 11/577 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRK--GNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLEL  396
             +LTWEDLWVTV   ++  G K+IL+GLTGYA PGE+LA+MGPSGCGKSTLLD+LAGRL  
Sbjct  22    YLTWEDLWVTVPTVKEHHGTKSILQGLTGYACPGEVLAVMGPSGCGKSTLLDSLAGRLSS  81

Query  397   TTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKE  576
              T+Q G+ILINGR Q LAYGTSAYVTQEDTLT TLTVREAVY+SAQLQLP  + +SEK+E
Sbjct  82    RTKQKGEILINGRKQKLAYGTSAYVTQEDTLTWTLTVREAVYFSAQLQLPVKMSKSEKRE  141

Query  577   IAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDS  756
             IAE TI+EMGLQD+++TRIG        SG QKRRVSIC+E+L RPKLLFLDEP+SGLDS
Sbjct  142   IAERTIREMGLQDSLDTRIGEWGRKGLSSG-QKRRVSICIELLKRPKLLFLDEPTSGLDS  200

Query  757   AASFYVMSKIMDLASE-GRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFF  933
             AAS++VM++I+ LA E G T+++SIHQP +EVF L  +LCLLSSGR++YFGP+S A +FF
Sbjct  201   AASYFVMNRIVKLAREYGMTIISSIHQPISEVFQLLHNLCLLSSGRMIYFGPSSLANEFF  260

Query  934   ETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYR  1113
               NGFPCP LQNP+DH+LK IN DFD   ED+E G       EE+IN+L+ SY S +   
Sbjct  261   ALNGFPCPALQNPADHYLKMINTDFD---EDIEWGAGDKFTAEEIINLLIRSYVSSNTCD  317

Query  1114  EVQGQVAEISKQEG-EVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAV  1290
             +++  V+EI K+EG  V KK S+A+ FTQ  +LT+RSF+NMFRDLGYYWLRL IY+ L  
Sbjct  318   QMKTLVSEIRKREGGPVEKKESQANLFTQCQILTKRSFINMFRDLGYYWLRLAIYVALGF  377

Query  1291  GLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCG  1470
             GLG ++ +VG   SSI  R S+L F+AS  T MAIGGFPSFVED+KVF++E LNGHYG  
Sbjct  378   GLGSVFYNVGSSYSSIHERGSLLMFVASLLTIMAIGGFPSFVEDLKVFRRERLNGHYGAA  437

Query  1471  AFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIA  1650
             AF I NT+SS P+LLLIS IPG I YF  GL +    F+YF LV+   M+LVESLMMI+A
Sbjct  438   AFVIGNTISSTPFLLLISAIPGAITYFLAGLHQGNLEFSYFTLVLFSCMMLVESLMMIVA  497

Query  1651  SLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEF  1830
             S++PN+L+G+I GAG+Q LM+L GG+F+LP DLPK+FW+YP+YY+ FHKYAYQGLYKNEF
Sbjct  498   SIMPNFLLGLIVGAGVQGLMMLSGGFFQLPNDLPKIFWKYPMYYVAFHKYAYQGLYKNEF  557

Query  1831  QGLRL-PEETGQIIT--GEEVLRETLQVEMGHSKWID  1932
             +G +   +  G  +T  GE VLRE  QVEMG+SKW+D
Sbjct  558   EGRKFDSDRIGGALTVDGETVLREIWQVEMGYSKWVD  594



>ref|XP_011097541.1| PREDICTED: ABC transporter G family member 11-like [Sesamum indicum]
Length=701

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/610 (61%), Positives = 472/610 (77%), Gaps = 13/610 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGN---KAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLE  393
             +LTW+DLWVTV+D        + IL G+TGYA PGE+LAIMGPSGCGKSTLLDALAGRL+
Sbjct  89    YLTWKDLWVTVADKTAPEGERRHILHGVTGYAEPGEVLAIMGPSGCGKSTLLDALAGRLD  148

Query  394   LTTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKK  573
               TRQ GDILINGR Q+LA+GTSAYVTQ+DTL  TLTVREAVYYSA LQLP ++ +S+K+
Sbjct  149   SNTRQKGDILINGRKQSLAFGTSAYVTQDDTLMTTLTVREAVYYSAFLQLPDTMSKSDKQ  208

Query  574   EIAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLD  753
             E AE TIKEMGLQD+ +TRIGG        G QKRRVSIC+EILTRPKLLFLDEP+SGLD
Sbjct  209   ERAEATIKEMGLQDSTDTRIGGWHVKGLSGG-QKRRVSICIEILTRPKLLFLDEPTSGLD  267

Query  754   SAASFYVMSKIMDLASEGR-TVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQF  930
             SAAS++VMS+I+ +A + R TVVASIHQPS EVF LF +LCLLSSGR++YFG  S A +F
Sbjct  268   SAASYHVMSRIISVAQQDRRTVVASIHQPSGEVFELFHNLCLLSSGRIIYFGSVSTANEF  327

Query  931   FETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRY  1110
             F  NGFPCP ++NPSDH+L+TINKDFD    D+EQG    +  +E I++L  SYKS   +
Sbjct  328   FALNGFPCPPMRNPSDHYLRTINKDFD---ADIEQGLGGRVTADEAISVLAKSYKSSEAH  384

Query  1111  REVQGQVAEISKQEGEVL-KKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLA  1287
             ++VQ +V  I  + G  L KK S+A F TQ ++LT+RSF+NM RD+GYYW RL IY+ L+
Sbjct  385   QQVQTRVNNICHENGGPLEKKGSQAGFITQCLILTQRSFINMHRDVGYYWFRLAIYVALS  444

Query  1288  VGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGC  1467
             + +G ++  +G+   SIQAR SVL F+ +F TFMAIGGFPSFVEDMK+F +E LNGHYG 
Sbjct  445   MCVGTIFYKIGHSYGSIQARGSVLMFVGTFMTFMAIGGFPSFVEDMKIFTRERLNGHYGV  504

Query  1468  GAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMII  1647
              AF + NT+SS+PYL L+S+IPG IAY+ VG Q+   HF YF L++   M+LVESLMM+I
Sbjct  505   VAFVVGNTISSIPYLFLVSIIPGAIAYYLVGFQKGIDHFIYFTLLLFGCMMLVESLMMVI  564

Query  1648  ASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNE  1827
             AS+VPN+LMGIIAGAG+Q +MIL GG+FRLP D+PK FW+YP++YI FHKYA QG YKNE
Sbjct  565   ASVVPNFLMGIIAGAGIQGVMILNGGFFRLPHDIPKPFWKYPVFYITFHKYANQGFYKNE  624

Query  1828  FQGLRLPEETG----QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKA  1995
             F+GL  P +        I+G+E+LR   QVEMG+SKWIDL +++ M V+ RV+F  ++KA
Sbjct  625   FEGLNFPNQVQVGGPSTISGDEILRNIWQVEMGYSKWIDLAIILGMVVMYRVMFWGIIKA  684

Query  1996  SEKAKHVVKA  2025
              EK K +++A
Sbjct  685   QEKLKPMIRA  694



>gb|AES90632.2| white-brown-complex ABC transporter family protein [Medicago 
truncatula]
Length=705

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/628 (61%), Positives = 480/628 (76%), Gaps = 19/628 (3%)
 Frame = +1

Query  226   LTWEDLWV-TVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             LTW+D+WV T+S+G+ G+K+IL+GLTGYA+PG+LLAIMGPSGCGKSTLLD LAGRL   T
Sbjct  53    LTWKDIWVNTISNGKNGSKSILQGLTGYAKPGQLLAIMGPSGCGKSTLLDTLAGRLSSNT  112

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             RQ G+ILING  Q L+YGTSAYVTQ+D L  TLTVREAVYYSAQLQLP+++ + EKKE A
Sbjct  113   RQIGEILINGHKQELSYGTSAYVTQDDILLTTLTVREAVYYSAQLQLPNTMSKEEKKERA  172

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             ++TIKEMGLQDAMNTRIGG        G QKRRVSIC+EILTRP+LLFLDEP+SGLDSAA
Sbjct  173   DITIKEMGLQDAMNTRIGGWGVKGISGG-QKRRVSICIEILTRPRLLFLDEPTSGLDSAA  231

Query  763   SFYVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFF  933
             S+YVM +I  L  +    RT++ SIHQPSTEVF LF +LCLLSSGR VYFGPA AA +FF
Sbjct  232   SYYVMKRIASLDKKDGIQRTIITSIHQPSTEVFQLFHNLCLLSSGRTVYFGPAYAACEFF  291

Query  934   ETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARG--IPTEEVINILVNSYKSYHR  1107
               NGFPCP LQNPSDH LKTINKDFD   +D+E G A    IPTEE I ILV+SYKS   
Sbjct  292   ALNGFPCPPLQNPSDHLLKTINKDFD---QDIETGLAGTGTIPTEEAICILVSSYKSSEM  348

Query  1108  YREVQGQVAEISKQEGEVL--KKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYIT  1281
              ++VQ +VA +S +    +  KK   A F  Q ++L  RS +NMFRDLGYYWLRL IY+ 
Sbjct  349   SQDVQNEVAVLSNKHTSSMDHKKKGHAGFLNQCLILIERSSMNMFRDLGYYWLRLVIYVA  408

Query  1282  LAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHY  1461
             LA+ LG +Y D+G    SI+ R S+L+FI+ F TFM IGGFPSFVEDMKVF++E  NGHY
Sbjct  409   LAISLGTVYYDLGTSYDSIKDRGSLLSFISGFLTFMTIGGFPSFVEDMKVFQRERQNGHY  468

Query  1462  GCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMM  1641
             G  A+ I NT SS+P++LL+++IP  I Y+  GLQ+ F HF YFA V+  +++LVE LMM
Sbjct  469   GVIAYVIGNTFSSIPFILLVTIIPAAITYYLPGLQKGFEHFLYFASVLFSSLMLVEGLMM  528

Query  1642  IIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYK  1821
             I+AS+VPNYLMGII GAG+Q +M+L GG+F+LP ++PK FWRYP++Y+ FH Y ++GL+K
Sbjct  529   IVASIVPNYLMGIITGAGIQGIMMLVGGFFKLPHEIPKPFWRYPLHYVAFHSYVFEGLFK  588

Query  1822  NEFQGLRLPEETGQ----IITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvv  1989
             NE++GLR   + GQ     ITGEEVLR+T Q  M +SKW+DL +L+ M V+ RV+FL+++
Sbjct  589   NEYEGLRFDIKNGQGTNSYITGEEVLRDTWQSNMSYSKWVDLAILLGMIVLYRVLFLIII  648

Query  1990  KASEKAKHVVKAV---MRVSPKQSHQVV  2064
             K +EK K +V ++   M VSP  +  VV
Sbjct  649   KVTEKVKPIVGSLLSCMVVSPNTTIHVV  676



>emb|CBI25872.3| unnamed protein product [Vitis vinifera]
Length=592

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/582 (65%), Positives = 461/582 (79%), Gaps = 9/582 (2%)
 Frame = +1

Query  334   MGPSGCGKSTLLDALAGRLELTTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVRE  513
             MGPSGCGKSTLLDALAGRL   TRQSG+IL+NG  Q LA+GTSAYVTQ+DTL  TLTVRE
Sbjct  1     MGPSGCGKSTLLDALAGRLASNTRQSGEILVNGSKQRLAFGTSAYVTQDDTLMTTLTVRE  60

Query  514   AVYYSAQLQLPSSLPRSEKKEIAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSIC  693
             AVYYSAQLQLP S+ RSEKKE AEMTI+EMGLQDAMNTRIGG        G QKRRVSIC
Sbjct  61    AVYYSAQLQLPDSMSRSEKKERAEMTIREMGLQDAMNTRIGGWSVKGLSGG-QKRRVSIC  119

Query  694   LEILTRPKLLFLDEPSSGLDSAASFYVMSKIMDLA-SEGRTVVASIHQPSTEVfslftsl  870
             +EILTRP+LLFLDEP+SGLDSAAS++VMS+I+ LA  +G TV+ASIHQPS+EVF +F +L
Sbjct  120   IEILTRPRLLFLDEPTSGLDSAASYHVMSRIVKLARHDGITVIASIHQPSSEVFEVFHNL  179

Query  871   cllssGRVVYFGPASAAIQFFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARG  1050
             CLLSSG+ VYFG AS A +FF++NGFPCP L+NPSDH+L+TINKDFD+D    EQG    
Sbjct  180   CLLSSGKTVYFGSASMAKEFFDSNGFPCPALRNPSDHYLRTINKDFDSD---TEQGHGGT  236

Query  1051  IPTEEVINILVNSYKSYHRYREVQGQVAEISKQEGEVL-KKSSRADFFTQSIVLTRRSFL  1227
               TEE IN L+ SYKS    ++VQ +V EI + +G +L KK S+A F TQ +VLTRRS +
Sbjct  237   TNTEEAINTLIKSYKSSEICQQVQCRVYEICQLKGGLLEKKGSQASFITQCLVLTRRSSV  296

Query  1228  NMFRDLGYYWLRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFP  1407
             NM+RDLGYYWLRL IYI L + +G ++ D+G+   SIQAR S+L F+A+F TFMAIGGFP
Sbjct  297   NMYRDLGYYWLRLAIYIALCLCVGTIFYDIGFSYGSIQARGSMLMFVAAFLTFMAIGGFP  356

Query  1408  SFVEDMKVFKKETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFA  1587
             SFVEDMK+F +E LNGHYG GAF + NT SS+PYLL+ISLIPG+IAY+ VGL + F HF 
Sbjct  357   SFVEDMKIFGRERLNGHYGVGAFVVGNTFSSIPYLLMISLIPGVIAYYLVGLHKGFEHFV  416

Query  1588  YFALVILMNMLLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWR  1767
             YFAL++ + M+LVESLMMI+AS+VP++LMGII GAG+Q +M+L GG+FRLP DLPK FWR
Sbjct  417   YFALMLFVCMMLVESLMMIVASIVPDFLMGIITGAGIQGVMMLNGGFFRLPNDLPKPFWR  476

Query  1768  YPIYYIDFHKYAYQGLYKNEFQGLRLPEETG---QIITGEEVLRETLQVEMGHSKWIDll  1938
             YP+YYI FHKYA QG YKNEFQGL  P         ITGEE+L+   QVE G+SKW+D+ 
Sbjct  477   YPMYYIAFHKYANQGFYKNEFQGLTFPNNQAGGPPTITGEEILQNVWQVETGYSKWVDVA  536

Query  1939  vlvvmgvvcrvvfllvvKASEKAKHVVKAVMRVSPKQSHQVV  2064
             +L  M V+ R++FL ++K  EK K ++K +M  SP++S Q++
Sbjct  537   ILFGMVVLYRLLFLGIIKTVEKVKPMIKGLMVASPEKSKQII  578



>ref|XP_011097542.1| PREDICTED: ABC transporter G family member 11-like [Sesamum indicum]
Length=697

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/610 (61%), Positives = 469/610 (77%), Gaps = 13/610 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGN---KAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLE  393
             +LTW+DLWVTV+D        + IL G+TGYA PGE L IMGPSGCGKSTLLDALAGRL+
Sbjct  85    YLTWKDLWVTVADKTAPEGERRPILHGVTGYAEPGEALTIMGPSGCGKSTLLDALAGRLD  144

Query  394   LTTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKK  573
                RQ GDILINGR Q+LA+GTSAYVTQ+D L  TLTVREAV YSA LQLP ++ +SEK+
Sbjct  145   SNARQKGDILINGRKQSLAFGTSAYVTQDDALMTTLTVREAVCYSAFLQLPDTMSKSEKQ  204

Query  574   EIAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLD  753
             E AE TIKEMGLQD+++TRIGG        G QKRRVSIC+EILTRPKLLFLDEP+SGLD
Sbjct  205   ERAEATIKEMGLQDSIDTRIGGWHVKGLSGG-QKRRVSICIEILTRPKLLFLDEPTSGLD  263

Query  754   SAASFYVMSKIMDLASEGR-TVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQF  930
             SAAS++VMS+I+ +A + R TVVASIHQPS EVF LF +LCLLSSGR++YFG  S A +F
Sbjct  264   SAASYHVMSRIIKVAQQDRRTVVASIHQPSGEVFELFHNLCLLSSGRMIYFGSVSTANEF  323

Query  931   FETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRY  1110
             F +NGFPCP ++NPSDH+L+TINKDFD    D+EQG    +  +E IN+L  SYKS   +
Sbjct  324   FTSNGFPCPPMRNPSDHYLRTINKDFD---ADIEQGLYGTVSADEAINVLAKSYKSSEAH  380

Query  1111  REVQGQVAEISKQEGEVL-KKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLA  1287
             ++VQ +  +I  + G +L KK S+A F TQ ++LT+RSF+NM RD+GYYW RL IY+ L 
Sbjct  381   QQVQTRANDICHENGGLLEKKGSQAGFITQCLILTQRSFINMHRDVGYYWFRLAIYVALC  440

Query  1288  VGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGC  1467
             + +G ++  +G+   SIQAR SVL F+A+  TFMAIGGFPSFVEDMK+F +E LNGHYG 
Sbjct  441   ICIGTIFYKIGHSYGSIQARGSVLMFVATLMTFMAIGGFPSFVEDMKIFTRERLNGHYGV  500

Query  1468  GAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMII  1647
              AF + NT+SS+PYL  IS+IPG IAY+ VGLQ+   HF YF L++   M+LVESLMM+I
Sbjct  501   VAFVVGNTISSIPYLFFISIIPGPIAYYLVGLQKSIDHFIYFTLLLFGCMMLVESLMMVI  560

Query  1648  ASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNE  1827
             AS+VPN+LMGIIAGAG+Q +MIL GG+FRLP DLPK FW+YP++YI FHKYA QG YKNE
Sbjct  561   ASVVPNFLMGIIAGAGIQGVMILNGGFFRLPHDLPKPFWKYPVFYISFHKYANQGFYKNE  620

Query  1828  FQGLRLPEETG----QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKA  1995
             F+GL  P +        I+G+E+LR   QVEMG+SKWIDL +++ M VV RV+F  ++KA
Sbjct  621   FEGLNFPNQVQVGGPSTISGDEILRNVWQVEMGYSKWIDLAIILGMVVVYRVMFWGIIKA  680

Query  1996  SEKAKHVVKA  2025
              EK K +++A
Sbjct  681   QEKFKPMIRA  690



>ref|XP_003532610.1| PREDICTED: ABC transporter G family member 11-like [Glycine max]
Length=695

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/617 (62%), Positives = 467/617 (76%), Gaps = 10/617 (2%)
 Frame = +1

Query  226   LTWEDLWVTVSDGR-KGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             LTW+D+WVT S G+ + +K+IL+GLTGYA+PG+LLAIMGPSGCGKS LLD LAGRL   T
Sbjct  63    LTWKDVWVTASVGKNEMSKSILEGLTGYAKPGQLLAIMGPSGCGKSALLDTLAGRLGSNT  122

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             RQ+G+ILINGR Q LAYGTSAYVTQ+DTL  TLTV EAV+YSAQLQLP ++ + EKKE A
Sbjct  123   RQTGEILINGRKQALAYGTSAYVTQDDTLLTTLTVGEAVHYSAQLQLPDTMSKEEKKERA  182

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             + TI+EMGLQDA+NTRIGG        G QKRRVSIC+EILTRP LLFLDEP+SGLDSAA
Sbjct  183   DFTIREMGLQDAINTRIGGWGVKGISGG-QKRRVSICIEILTRPGLLFLDEPTSGLDSAA  241

Query  763   SFYVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFF  933
             S+YVM +I  L  +    RTV+ASIHQPS+EVF LF +LCLLSSGR VYFGPASAA +FF
Sbjct  242   SYYVMKRIATLDKKDDVHRTVIASIHQPSSEVFQLFDNLCLLSSGRTVYFGPASAAKEFF  301

Query  934   ETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYR  1113
              +N FPCP L NPSDH LKTINKDFD D E   QG    IPTEE I ILVNSYKS    +
Sbjct  302   ASNDFPCPPLMNPSDHLLKTINKDFDQDTELNLQG-TETIPTEEAIRILVNSYKSSEMNQ  360

Query  1114  EVQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             EVQ QVA ++++      K   A F  Q   LT+RS +NM+RDLGYYW RL IYI LA+ 
Sbjct  361   EVQKQVAILTEKSTSSTNKRRHAGFLNQCFALTKRSCVNMYRDLGYYWFRLAIYIALAIS  420

Query  1294  LGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGA  1473
             L  ++ D+G    SIQ R S L F++SF TFM IGGFPSFVEDMKVF++E LNGHY   A
Sbjct  421   LATIFCDLGSSYRSIQERGSFLMFVSSFMTFMTIGGFPSFVEDMKVFERERLNGHYSVTA  480

Query  1474  FAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIAS  1653
             F I NT SS+PYLLL+S+IPG+IAYF  GLQ++F HF YF  V+   ++LVE LMMI+AS
Sbjct  481   FVIGNTFSSIPYLLLVSIIPGVIAYFLPGLQKDFEHFVYFICVLFACLMLVEGLMMIVAS  540

Query  1654  LVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQ  1833
             +VPN+L GII GAG+Q +MILG G+FRLP DLPK FW+YP++YI FH+Y YQG++KNEF+
Sbjct  541   IVPNFLTGIITGAGIQGIMILGAGFFRLPNDLPKPFWKYPMFYIAFHRYVYQGMFKNEFE  600

Query  1834  GLRLPEET--GQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKA  2007
             GLR       G  I+GEE+LR+  QV   +SKW+DL +++ M +V RV+FL+ +K +EK 
Sbjct  601   GLRFATNNVGGGYISGEEILRDVWQVNTSYSKWVDLGIVLGMIIVYRVLFLINIKTTEKL  660

Query  2008  KHVVKAVMR--VSPKQS  2052
             K ++ + M    SPK++
Sbjct  661   KPIIVSFMSSWSSPKRT  677



>gb|KHN26508.1| ABC transporter G family member 11 [Glycine soja]
Length=678

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/608 (60%), Positives = 472/608 (78%), Gaps = 10/608 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             FLTWEDLWVTVS+G+ G K IL+GL GYA+PG+LLAIMGPSGCGKSTLLDALAGRL   T
Sbjct  56    FLTWEDLWVTVSNGKNGRKPILQGLKGYAKPGKLLAIMGPSGCGKSTLLDALAGRLGSKT  115

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             +Q+G ILINGR Q LAYG SAYVT++DT+  TLTV+EAVYYSA LQLP S+ +SEK+E A
Sbjct  116   KQTGKILINGRKQALAYGASAYVTEDDTILTTLTVKEAVYYSANLQLPDSMSKSEKQERA  175

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             + TI+EMGLQDA+NTRIGG        G QKRRVSIC+EILT P+LLFLDEP+SGLDSAA
Sbjct  176   DFTIREMGLQDAINTRIGGWGSKGASGG-QKRRVSICIEILTHPRLLFLDEPTSGLDSAA  234

Query  763   SFYVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFF  933
             S++VMS+I +L  +    RT++ASIHQPS E+F LF +LCLLSSG+ VYFGP SAA +FF
Sbjct  235   SYHVMSRISNLNKKDGIQRTIIASIHQPSNEIFKLFPNLCLLSSGKTVYFGPTSAANKFF  294

Query  934   ETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYR  1113
              +NGFPC +L +PSDHF+KTINKDF+ D E   +G A G+ TEE I++L  SY S     
Sbjct  295   SSNGFPCSSLHSPSDHFVKTINKDFERDPE---KGLAGGLSTEEAIHVLAKSYDSSEICH  351

Query  1114  EVQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             +VQ ++A+I K++ + + K   ADF TQ ++LTRRSFLNM+R++GYYWLRL IY  LA+ 
Sbjct  352   QVQNEIAQIKKRDSDAMDKKCHADFSTQCLILTRRSFLNMYREVGYYWLRLLIYGALALS  411

Query  1294  LGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGA  1473
             LG ++ D+G  + SIQAR S+L F+ +F TF+ +GGFPSFVE+MKVF++E LNGHYG  A
Sbjct  412   LGTLFFDIGSSSESIQARGSLLVFVVTFLTFITVGGFPSFVEEMKVFERERLNGHYGVTA  471

Query  1474  FAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIAS  1653
             F I NTLSS+P+LLL+SLIPG + Y+ VGL +   HF YF  ++  ++ LVE LMMI+AS
Sbjct  472   FTIGNTLSSVPFLLLMSLIPGALVYYLVGLHQGHEHFVYFIFMLFTSLFLVEGLMMIVAS  531

Query  1654  LVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQ  1833
             +VPN+LMGII G+G+  +M+L GG++RLP D+PK FWRYP++YI FHKYAYQGL+KNEFQ
Sbjct  532   MVPNFLMGIIVGSGILGIMMLDGGFYRLPSDIPKPFWRYPLHYISFHKYAYQGLFKNEFQ  591

Query  1834  GLRLPEE---TGQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEK  2004
             GL  P         I+GE +LR   Q+E+ +SKW+D+ +LV M V+ R++F++++K+ EK
Sbjct  592   GLTFPSNQVGAHMTISGEHILRHIWQMEVNYSKWVDVGILVGMAVLYRILFMVIIKSFEK  651

Query  2005  AKHVVKAV  2028
              K V  A+
Sbjct  652   LKSVATAI  659



>ref|XP_003532607.1| PREDICTED: ABC transporter G family member 11-like [Glycine max]
Length=678

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/608 (60%), Positives = 472/608 (78%), Gaps = 10/608 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             FLTWEDLWVTVS+G+ G K IL+GL GYA+PG+LLAIMGPSGCGKSTLLDALAGRL   T
Sbjct  56    FLTWEDLWVTVSNGKNGRKPILQGLKGYAKPGKLLAIMGPSGCGKSTLLDALAGRLGSKT  115

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             +Q+G ILINGR Q LAYG SAYVT++DT+  TLTV+EAVYYSA LQLP S+ +SEK+E A
Sbjct  116   KQTGKILINGRKQALAYGASAYVTEDDTILTTLTVKEAVYYSANLQLPDSMSKSEKQERA  175

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             + TI+EMGLQDA+NTRIGG        G QKRRVSIC+EILT P+LLFLDEP+SGLDSAA
Sbjct  176   DFTIREMGLQDAINTRIGGWGSKGASGG-QKRRVSICIEILTHPRLLFLDEPTSGLDSAA  234

Query  763   SFYVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFF  933
             S++VMS+I +L  +    RT++ASIHQPS E+F LF +LCLLSSG+ VYFGP SAA +FF
Sbjct  235   SYHVMSRISNLNKKDGIQRTIIASIHQPSNEIFKLFPNLCLLSSGKTVYFGPTSAANKFF  294

Query  934   ETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYR  1113
              +NGFPC +L +PSDHF+KTINKDF+ D E   +G A G+ TEE I++L  SY S     
Sbjct  295   SSNGFPCSSLHSPSDHFVKTINKDFERDPE---KGIAGGLSTEEAIHVLAKSYDSSEICH  351

Query  1114  EVQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             +VQ ++A+I K++ + + K   ADF TQ ++LTRRSFLNM+R++GYYWLRL IY  LA+ 
Sbjct  352   QVQNEIAQIKKRDSDAMDKKCHADFSTQCLILTRRSFLNMYREVGYYWLRLLIYGALALS  411

Query  1294  LGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGA  1473
             LG ++ D+G  + SIQAR S+L F+ +F TF+ +GGFPSFVE+MKVF++E LNGHYG  A
Sbjct  412   LGTLFFDIGSSSESIQARGSLLVFVVTFLTFITVGGFPSFVEEMKVFERERLNGHYGVTA  471

Query  1474  FAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIAS  1653
             F I NTLSS+P+LLL+SLIPG + Y+ VGL +   HF YF  ++  ++ LVE LMMI+AS
Sbjct  472   FTIGNTLSSVPFLLLMSLIPGALVYYLVGLHQGHEHFVYFIFMLFTSLFLVEGLMMIVAS  531

Query  1654  LVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQ  1833
             +VPN+LMGII G+G+  +M+L GG++RLP D+PK FWRYP++YI FHKYAYQGL+KNEFQ
Sbjct  532   MVPNFLMGIIVGSGILGIMMLDGGFYRLPSDIPKPFWRYPLHYISFHKYAYQGLFKNEFQ  591

Query  1834  GLRLPEE---TGQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEK  2004
             GL  P         I+GE +LR   Q+E+ +SKW+D+ +LV M V+ R++F++++K+ EK
Sbjct  592   GLTFPSNQVGAHMTISGEHILRHIWQMEVNYSKWVDVGILVGMAVLYRILFMVIIKSFEK  651

Query  2005  AKHVVKAV  2028
              K V  A+
Sbjct  652   LKSVATAI  659



>ref|XP_010652672.1| PREDICTED: ABC transporter G family member 11-like [Vitis vinifera]
Length=592

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/582 (65%), Positives = 461/582 (79%), Gaps = 9/582 (2%)
 Frame = +1

Query  334   MGPSGCGKSTLLDALAGRLELTTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVRE  513
             MGPSGCGKSTLLDALAGRL   TRQSG+IL+NG  Q LA+GTSAYVTQ+DTL  TLTVRE
Sbjct  1     MGPSGCGKSTLLDALAGRLASNTRQSGEILVNGSKQRLAFGTSAYVTQDDTLMTTLTVRE  60

Query  514   AVYYSAQLQLPSSLPRSEKKEIAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSIC  693
             AVYYSAQLQLP S+ RSEKKE AEMTI+EMGLQDAMNTRIGG        G QKRRVSIC
Sbjct  61    AVYYSAQLQLPDSMSRSEKKERAEMTIREMGLQDAMNTRIGGWSVKGLSGG-QKRRVSIC  119

Query  694   LEILTRPKLLFLDEPSSGLDSAASFYVMSKIMDLA-SEGRTVVASIHQPSTEVfslftsl  870
             +EILTRP+LLFLDEP+SGLDSAAS++VMS+I+ LA  +G TVVASIHQPS+EVF +F +L
Sbjct  120   IEILTRPRLLFLDEPTSGLDSAASYHVMSRIVKLARHDGITVVASIHQPSSEVFEVFHNL  179

Query  871   cllssGRVVYFGPASAAIQFFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARG  1050
             CLLSSG+ VYFG AS A +FF++NGFPCP L+NPSDH+L+TINKDFD+D    EQG    
Sbjct  180   CLLSSGKTVYFGSASMAKEFFDSNGFPCPALRNPSDHYLRTINKDFDSD---TEQGHGGT  236

Query  1051  IPTEEVINILVNSYKSYHRYREVQGQVAEISKQEGEVL-KKSSRADFFTQSIVLTRRSFL  1227
               TEE IN L+ SYKS    ++VQ +V EI + +G +L KK S+A F TQ +VLTRRS +
Sbjct  237   TNTEEAINTLIKSYKSSEICQQVQCRVYEICQLKGGLLEKKGSQASFITQCLVLTRRSSV  296

Query  1228  NMFRDLGYYWLRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFP  1407
             NM+RDLGYYWLRL IYI L + +G ++ D+G+   SIQAR S+L F+A+F TFMAIGGFP
Sbjct  297   NMYRDLGYYWLRLAIYIALCLCVGTIFYDIGFSYGSIQARGSMLMFVAAFLTFMAIGGFP  356

Query  1408  SFVEDMKVFKKETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFA  1587
             SFVEDMK+F +E LNGHYG GAF + NT SS+PYLL+ISLIPG+IAY+ VGL + F HF 
Sbjct  357   SFVEDMKIFGRERLNGHYGVGAFVVGNTFSSIPYLLMISLIPGVIAYYLVGLHKGFEHFV  416

Query  1588  YFALVILMNMLLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWR  1767
             YFAL++ + M+LVESLMMI+AS+VP++LMGII GAG+Q +M+L GG+FRLP DLPK FWR
Sbjct  417   YFALMLFVCMMLVESLMMIVASIVPDFLMGIITGAGIQGVMMLNGGFFRLPNDLPKPFWR  476

Query  1768  YPIYYIDFHKYAYQGLYKNEFQGLRLPEETG---QIITGEEVLRETLQVEMGHSKWIDll  1938
             YP+YYI FHKYA QG YKNEFQGL  P         I+GEE+L+   QVE G+SKW+D+ 
Sbjct  477   YPMYYIAFHKYANQGFYKNEFQGLTFPNNQAGGPPTISGEEILQNVWQVETGYSKWVDVA  536

Query  1939  vlvvmgvvcrvvfllvvKASEKAKHVVKAVMRVSPKQSHQVV  2064
             +L  M V+ R++FL ++K  EK K ++K +M  SP++S Q++
Sbjct  537   ILFGMVVLYRLLFLGIIKTVEKVKLMIKDLMVASPEKSKQII  578



>ref|XP_009611615.1| PREDICTED: ABC transporter G family member 11-like isoform X2 
[Nicotiana tomentosiformis]
Length=609

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/617 (62%), Positives = 460/617 (75%), Gaps = 59/617 (10%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW DLWVTVS  + G KAIL+GLTGYARP ELLA+MGPSGCGKST LDALAGRL+ +TR
Sbjct  40    LTWNDLWVTVSTRKSGRKAILQGLTGYARPSELLAVMGPSGCGKSTFLDALAGRLDFSTR  99

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             QSGDILING  Q L+YGTSAY+TQ++TL ATLTV+EAVYYSAQLQLP S+ +SEK +IAE
Sbjct  100   QSGDILINGHKQKLSYGTSAYLTQDETLLATLTVKEAVYYSAQLQLPDSMTKSEKIQIAE  159

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TIKEMGLQDAMNTR  GGWG+KGISGG+KRR+SIC+EILTRPKLLFLDEP+SGLDSAAS
Sbjct  160   QTIKEMGLQDAMNTR-IGGWGNKGISGGEKRRLSICMEILTRPKLLFLDEPTSGLDSAAS  218

Query  766   FYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             +YVMS I     EGRT++ASIHQPS EVF+LF SLCLLSSGR+VYFGPASAAIQFF  NG
Sbjct  219   YYVMSGI-SRQKEGRTIIASIHQPSAEVFNLFHSLCLLSSGRIVYFGPASAAIQFFARNG  277

Query  946   FPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREVQG  1125
             FPCPTLQNPSDHFLKTINKDF   DED+EQG A  IPTEEVI++LVNS+KS   Y E+Q 
Sbjct  278   FPCPTLQNPSDHFLKTINKDF---DEDIEQGSAGRIPTEEVIDLLVNSFKSSEEYHEIQN  334

Query  1126  QVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLGYM  1305
             QVAEI +Q GE+L+K S A+F TQS+VLTRRS +NMFRDLGYYW+R   Y+ +A+GLG +
Sbjct  335   QVAEICEQGGEILEKRSHANFTTQSLVLTRRSSVNMFRDLGYYWMRFATYVAIALGLGSI  394

Query  1306  YNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFAIA  1485
             Y D+G    SI+ R  ++AF+ SF TFM +GGFPSFVEDMKVF++E LNGHYGC  F I 
Sbjct  395   YYDLGSNYRSIEERGLMVAFVVSFMTFMTVGGFPSFVEDMKVFQRENLNGHYGCCTFVIG  454

Query  1486  NTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLVPN  1665
             NTLSS             I Y                              +++ S VP 
Sbjct  455   NTLSS-------------IPY------------------------------VLLISFVP-  470

Query  1666  YLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGLRL  1845
                    GAG+Q L IL GGYF+LP +LP   W+YP+YY+ FHKYAYQG++KNEF+GL+ 
Sbjct  471   -------GAGIQGLQILSGGYFQLPSELPNPIWKYPLYYMSFHKYAYQGMFKNEFEGLKF  523

Query  1846  PEE---TGQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAKHV  2016
              ++     + ++GE++LRE  + EM +SKWIDL +LV   ++ R+VFLL++K +EK  H 
Sbjct  524   TDDLFGNNRTMSGEDILRERWEAEMAYSKWIDLAILVSTLILYRLVFLLIIKTNEKVVHA  583

Query  2017  VKAVMRVSPKQSHQVVA  2067
              KA   V   +S Q++A
Sbjct  584   RKASTSVLSNRSSQIMA  600



>ref|XP_003543926.1| PREDICTED: ABC transporter G family member 11-like isoform X1 
[Glycine max]
 gb|KHN01283.1| ABC transporter G family member 11 [Glycine soja]
Length=676

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/608 (60%), Positives = 472/608 (78%), Gaps = 10/608 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             FLTWEDLWVTVS+G+ G K IL+GL GYA+PG+LLAIMGPSGCGKSTLLDALAGRL   T
Sbjct  54    FLTWEDLWVTVSNGKNGRKPILQGLKGYAKPGKLLAIMGPSGCGKSTLLDALAGRLGSKT  113

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             +Q+G ILINGR Q LAYG SAYVT++DT+  TLTV+EAVYYSA LQLP S+ +SEK+E A
Sbjct  114   KQTGKILINGRKQALAYGASAYVTEDDTILTTLTVKEAVYYSAYLQLPDSMSKSEKQERA  173

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             + TI+EMGL DA+NTRIGG        G QKRRVSIC+EILT P+LLFLDEP+SGLDSAA
Sbjct  174   DFTIREMGLHDAINTRIGGWGSKGASGG-QKRRVSICIEILTHPRLLFLDEPTSGLDSAA  232

Query  763   SFYVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFF  933
             S++VMS+I +L  +    RT++ASIHQPS E+F LF +LCLLSSG+ VYFGP SAA +FF
Sbjct  233   SYHVMSRISNLNKKDGIQRTIIASIHQPSNEIFQLFHNLCLLSSGKTVYFGPTSAANKFF  292

Query  934   ETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYR  1113
              +NGFPCP+L +PSDHF+KTINKDF+   +D E+G A G+ TEE I++L  SY S     
Sbjct  293   SSNGFPCPSLHSPSDHFVKTINKDFE---QDPEKGLAGGLSTEEAIHVLAKSYDSSKICH  349

Query  1114  EVQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             +VQ ++A+  K++ + + +   ADFFTQ ++LTRRSF+NM+R++GYYWLRL IY  LA+ 
Sbjct  350   QVQKEIAQTKKRDSDTMDEKCHADFFTQCLILTRRSFVNMYREVGYYWLRLLIYGALALS  409

Query  1294  LGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGA  1473
             LG M+ D+G  + SIQAR S+L F+ +F TF+ +GGFPSFVE+MKVF++E LNGHYG  A
Sbjct  410   LGTMFFDIGSSSESIQARGSLLVFVVTFLTFITVGGFPSFVEEMKVFERERLNGHYGVTA  469

Query  1474  FAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIAS  1653
             F I NTLSS+P+LLL+SLIPG + Y+ VGL +   HF YF  ++  ++ LVE LMMI+AS
Sbjct  470   FTIGNTLSSVPFLLLMSLIPGALVYYLVGLHQGHEHFVYFIFMLFTSVFLVEGLMMIVAS  529

Query  1654  LVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQ  1833
             +VPN+LMGII G+G+  +M+L GG++RLP D+PK FWRYP++YI FHKYAYQGL+KNEFQ
Sbjct  530   MVPNFLMGIIVGSGILGIMMLDGGFYRLPSDIPKPFWRYPLHYISFHKYAYQGLFKNEFQ  589

Query  1834  GLRLPEE---TGQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEK  2004
             GL  P         I GE +LR   Q+E+ +SKW+D+ +LV M V+ R++FL+++K+ EK
Sbjct  590   GLTFPSNQVGAHMTIHGEHILRHIWQMEVNYSKWVDVGILVGMAVLYRILFLVIIKSFEK  649

Query  2005  AKHVVKAV  2028
              K +  A+
Sbjct  650   VKPISSAL  657



>ref|XP_011087908.1| PREDICTED: ABC transporter G family member 11-like isoform X1 
[Sesamum indicum]
Length=660

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/610 (62%), Positives = 467/610 (77%), Gaps = 10/610 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDG-RKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELT  399
             +LTWE+LWVTVS G R G K+IL+GLTGYA PGE+LAIMGPSGCGKSTLLDALAGRL   
Sbjct  49    YLTWEELWVTVSTGKRDGAKSILRGLTGYACPGEVLAIMGPSGCGKSTLLDALAGRLSSR  108

Query  400   TRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEI  579
             TRQ G+ILING+ Q LAYGTSAYVTQEDTLT TLTVREAVYYSAQLQLP ++ + EK+EI
Sbjct  109   TRQKGEILINGQKQKLAYGTSAYVTQEDTLTWTLTVREAVYYSAQLQLPITMSKFEKREI  168

Query  580   AEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSA  759
             AE TI+EMGLQD+M+TRIG         G QKRRVSIC E+L RPKLLFLDEP+SGLDSA
Sbjct  169   AERTIREMGLQDSMDTRIGEWGRKGLSGG-QKRRVSICTELLKRPKLLFLDEPTSGLDSA  227

Query  760   ASFYVMSKIMDLASE-GRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFE  936
             AS++VM++I+ LA E G TV+ SIHQP++EVF L  +LCLLSSGR++YFGP+  A QFF 
Sbjct  228   ASYFVMNRIVKLAREYGMTVILSIHQPTSEVFQLLHNLCLLSSGRMIYFGPSWLANQFFA  287

Query  937   TNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYRE  1116
              NG+ CP LQNP+DH LK IN DFD   ED+EQG       EEVI++L+ SY S    ++
Sbjct  288   VNGYACPPLQNPADHCLKMINTDFD---EDIEQGTGSKFTVEEVIDLLIASYNSSDTCKK  344

Query  1117  VQGQVAEISKQEG-EVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             ++  VAEI K+EG    KK+S+A+  TQ ++LT+RSF+NM+RDLGYYWLRL IY+ L  G
Sbjct  345   MKTLVAEIHKREGGPTEKKASQANLLTQCLILTKRSFVNMYRDLGYYWLRLAIYVALGFG  404

Query  1294  LGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGA  1473
             LG ++ +VG   +SI  R S+L FIAS  T MAIGGFPSFVED+KVF++E LNGHYG  A
Sbjct  405   LGSVFYNVGSSYNSIHERGSLLMFIASLLTIMAIGGFPSFVEDLKVFRRERLNGHYGAAA  464

Query  1474  FAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIAS  1653
             F +A+T+SS P+LLLIS IPG I YF  GL      F YF LV+L  M+LVESLMMI+A+
Sbjct  465   FVVAHTVSSTPFLLLISAIPGAITYFLSGLHPGNIEFMYFTLVLLACMMLVESLMMIVAT  524

Query  1654  LVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQ  1833
             ++PN+L+G+I GAG+Q LM+L GG+F+LPKDLP LFW+YP+YY+ FHKYAYQGLYKNEF+
Sbjct  525   IMPNFLLGLIVGAGIQGLMMLSGGFFQLPKDLPTLFWKYPMYYVAFHKYAYQGLYKNEFE  584

Query  1834  GLRLPEET---GQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEK  2004
             G R   +       I GE +LR+  QVEMG+SKW DL VL  M VV RV+F + VK  EK
Sbjct  585   GRRFRNDQLGGPSTIEGETILRDIWQVEMGYSKWTDLAVLFGMVVVYRVLFFVTVKIDEK  644

Query  2005  AKHVVKAVMR  2034
                V+  +++
Sbjct  645   MNSVLAKIVK  654



>gb|AES90633.2| white-brown-complex ABC transporter family protein [Medicago 
truncatula]
Length=687

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/626 (60%), Positives = 479/626 (77%), Gaps = 17/626 (3%)
 Frame = +1

Query  226   LTWEDLWV-TVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             LTW+D+WV T+S+G+ G+K+IL+GLTGYA+PG+LLAIMGPSGCGKSTLLD LAGRL   T
Sbjct  53    LTWKDIWVNTISNGKNGSKSILQGLTGYAKPGQLLAIMGPSGCGKSTLLDTLAGRLGSNT  112

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             RQ+G+ILING  Q L+YGTSAYVTQ+DTL  TLTVREAV+YSAQLQLP+++ + EKKE A
Sbjct  113   RQTGEILINGHKQELSYGTSAYVTQDDTLLTTLTVREAVFYSAQLQLPNTMSKEEKKERA  172

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             ++TIKEMGLQDAMNTRIGG        G QKRRVSIC+EILTRP+LLFLDEP+SGLDSAA
Sbjct  173   DITIKEMGLQDAMNTRIGGWGVKGISGG-QKRRVSICIEILTRPRLLFLDEPTSGLDSAA  231

Query  763   SFYVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFF  933
             S+YVM +I  L  +    RT++ SIHQPSTEVF LF +LCLLSSGR VYFGPAS A +FF
Sbjct  232   SYYVMKRIATLDHKDGIRRTIITSIHQPSTEVFQLFHNLCLLSSGRTVYFGPASTACEFF  291

Query  934   ETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARG--IPTEEVINILVNSYKSYHR  1107
               NGFPCP LQNPSDH LKTINKDFD   +D+E G A    IPTE+ I ILV+SYKS   
Sbjct  292   ALNGFPCPPLQNPSDHLLKTINKDFD---QDIETGLAGTGTIPTEKAICILVSSYKSSEM  348

Query  1108  YREVQGQVAEISKQEGEVL--KKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYIT  1281
              ++VQ +VA +S +    +  +K     F  Q  VL  RS +NMFRD GYYWLRL IY+ 
Sbjct  349   RQDVQNEVAVLSNKHTSSMDHRKKGHVGFLNQCSVLIERSSINMFRDPGYYWLRLVIYVA  408

Query  1282  LAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHY  1461
             LA+ LG +Y D+G  N SI+ R S+L+FIA F TFM+IGGFPSFVEDMKVF++E  NGHY
Sbjct  409   LAISLGTIYYDLGTNNDSIKNRGSLLSFIAGFLTFMSIGGFPSFVEDMKVFQRERQNGHY  468

Query  1462  GCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMM  1641
             G  A+ I NT SS+P++LL+++IP  I Y+  GLQ+ F HF YFA V+  +++LVESLMM
Sbjct  469   GVIAYVIGNTFSSIPFILLVTIIPAAITYYLPGLQKGFEHFLYFASVLFSSLMLVESLMM  528

Query  1642  IIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYK  1821
             I+AS+VPNYLMGII GAG+Q +MIL GG+F+LP ++PK FWRYP++Y+ FH Y ++GL+K
Sbjct  529   IVASIVPNYLMGIITGAGIQGIMILVGGFFKLPHEIPKPFWRYPLHYVAFHTYGFEGLFK  588

Query  1822  NEFQGLRLPEETGQ----IITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvv  1989
             NE++GL    + GQ     I+GEEVLR+  Q  M +SKW+DL +L+ M V+ RV+FL+++
Sbjct  589   NEYEGLIFSTKNGQGTNGYISGEEVLRDIWQSNMSYSKWVDLAILLGMIVLYRVLFLVII  648

Query  1990  KASEKAKHVVKAVMR-VSPKQSHQVV  2064
             K +EK K ++  ++  +SP  +  VV
Sbjct  649   KITEKVKPIIGPLLSCMSPNTTIHVV  674



>ref|XP_003608435.1| White-brown-complex ABC transporter family [Medicago truncatula]
Length=716

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/640 (60%), Positives = 481/640 (75%), Gaps = 32/640 (5%)
 Frame = +1

Query  226   LTWEDLWV-TVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             LTW+D+WV T+S+G+ G+K+IL+GLTGYA+PG+LLAIMGPSGCGKSTLLD LAGRL   T
Sbjct  53    LTWKDIWVNTISNGKNGSKSILQGLTGYAKPGQLLAIMGPSGCGKSTLLDTLAGRLSSNT  112

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             RQ G+ILING  Q L+YGTSAYVTQ+D L  TLTVREAVYYSAQLQLP+++ + EKKE A
Sbjct  113   RQIGEILINGHKQELSYGTSAYVTQDDILLTTLTVREAVYYSAQLQLPNTMSKEEKKERA  172

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             ++TIKEMGLQDAMNTRIGG        G QKRRVSIC+EILTRP+LLFLDEP+SGLDSAA
Sbjct  173   DITIKEMGLQDAMNTRIGGWGVKGISGG-QKRRVSICIEILTRPRLLFLDEPTSGLDSAA  231

Query  763   SFYVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFF  933
             S+YVM +I  L  +    RT++ SIHQPSTEVF LF +LCLLSSGR VYFGPA AA +FF
Sbjct  232   SYYVMKRIASLDKKDGIQRTIITSIHQPSTEVFQLFHNLCLLSSGRTVYFGPAYAACEFF  291

Query  934   ETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARG--IPTEEVINILVNSYKSYHR  1107
               NGFPCP LQNPSDH LKTINKDFD   +D+E G A    IPTEE I ILV+SYKS   
Sbjct  292   ALNGFPCPPLQNPSDHLLKTINKDFD---QDIETGLAGTGTIPTEEAICILVSSYKSSEM  348

Query  1108  YREVQGQVAEISKQEGEVL--------------KKSSRADFFTQSIVLTRRSFLNMFRDL  1245
              ++VQ +VA +S +  E +              KK   A F  Q ++L  RS +NMFRDL
Sbjct  349   SQDVQNEVAVLSNKV-ECMAYHIMRKHTSSMDHKKKGHAGFLNQCLILIERSSMNMFRDL  407

Query  1246  GYYWLRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDM  1425
             GYYWLRL IY+ LA+ LG +Y D+G    SI+ R S+L+FI+ F TFM IGGFPSFVEDM
Sbjct  408   GYYWLRLVIYVALAISLGTVYYDLGTSYDSIKDRGSLLSFISGFLTFMTIGGFPSFVEDM  467

Query  1426  KVFKKETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVI  1605
             KVF++E  NGHYG  A+ I NT SS+P++LL+++IP  I Y+  GLQ+ F HF YFA V+
Sbjct  468   KVFQRERQNGHYGVIAYVIGNTFSSIPFILLVTIIPAAITYYLPGLQKGFEHFLYFASVL  527

Query  1606  LMNMLLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYI  1785
               +++LVE LMMI+AS+VPNYLMGII GAG+Q +M+L GG+F+LP ++PK FWRYP++Y+
Sbjct  528   FSSLMLVEGLMMIVASIVPNYLMGIITGAGIQGIMMLVGGFFKLPHEIPKPFWRYPLHYV  587

Query  1786  DFHKYAYQGLYKNEFQGLRLPEETGQ----IITGEEVLRETLQVEMGHSKWIDllvlvvm  1953
              FH Y ++GL+KNE++GLR   + GQ     ITGEEVLR+T Q  M +SKW+DL +L+ M
Sbjct  588   AFHSYVFEGLFKNEYEGLRFDIKNGQGTNSYITGEEVLRDTWQSNMSYSKWVDLAILLGM  647

Query  1954  gvvcrvvfllvvKASEKAKHVVKAV---MRVSPKQSHQVV  2064
              V+ RV+FL+++K +EK K +V ++   M VSP  +  VV
Sbjct  648   IVLYRVLFLIIIKVTEKVKPIVGSLLSCMVVSPNTTIHVV  687



>ref|XP_009767617.1| PREDICTED: ABC transporter G family member 11-like isoform X2 
[Nicotiana sylvestris]
Length=631

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/617 (62%), Positives = 465/617 (75%), Gaps = 50/617 (8%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW DLWVTVS  + G KAIL+GLTGYARP ELLA+MGPSGCGKSTLLDALAGRL+ +TR
Sbjct  40    LTWNDLWVTVSTRKSGRKAILQGLTGYARPSELLAVMGPSGCGKSTLLDALAGRLDFSTR  99

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             QSGDILING  Q L+YGT AY+TQ++TL ATLTV+EAVYYSAQLQLP S+ +SEK +IAE
Sbjct  100   QSGDILINGHKQKLSYGTCAYLTQDETLLATLTVKEAVYYSAQLQLPDSMKKSEKIQIAE  159

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TIKEMGLQDAMNTR  GGWG+KGISGG+KRR+SIC+EILTRPKLLFLDEP+SGLDSAAS
Sbjct  160   QTIKEMGLQDAMNTR-IGGWGTKGISGGEKRRLSICMEILTRPKLLFLDEPTSGLDSAAS  218

Query  766   FYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             +YVMS I     EGRT++ASIHQPS EVF+LF SLCLLSSG++VYFGPASAAIQFF  NG
Sbjct  219   YYVMSGI-SRQKEGRTIIASIHQPSAEVFNLFHSLCLLSSGKIVYFGPASAAIQFFARNG  277

Query  946   FPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREVQG  1125
             FPCP LQNPSDHFLKT+NKDFD   E                                  
Sbjct  278   FPCPHLQNPSDHFLKTVNKDFDEGGE----------------------------------  303

Query  1126  QVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLGYM  1305
                        +L+K S A+F TQS+VLTRRS +NMFRDLGYYW+R   Y+ +A+GLG +
Sbjct  304   -----------ILEKRSHANFTTQSLVLTRRSSVNMFRDLGYYWMRFATYVGIALGLGSI  352

Query  1306  YNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFAIA  1485
             Y D+G    SI+ R  ++AF+ SF TFM +GGFPSFVEDMKVF++E LNGHYGC  F I 
Sbjct  353   YYDLGSNYHSIEERGLMVAFVVSFMTFMTVGGFPSFVEDMKVFQRENLNGHYGCCTFVIG  412

Query  1486  NTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLVPN  1665
             NTLSS+PY+LLIS +PG IAY   G Q   GHF YFALV+  +M++VESLMM +A++VPN
Sbjct  413   NTLSSIPYVLLISFVPGAIAYLLSGFQNGSGHFIYFALVLFTSMMIVESLMMNVAAIVPN  472

Query  1666  YLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGLRL  1845
             +LMGI+ GAG+Q L IL GGYF+LP +LP   W+YP+YY+ FHKYAYQG++KNEF+GL+ 
Sbjct  473   FLMGIVIGAGIQGLQILSGGYFQLPSELPNPIWKYPLYYMSFHKYAYQGMFKNEFEGLKF  532

Query  1846  PEE---TGQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAKHV  2016
              ++     + ++GE++LRE  QVEM +SKW+DL +LV   ++ R+VFLL++K +EK  H 
Sbjct  533   TDDQFGNNRTMSGEDILRERWQVEMAYSKWVDLAILVGTLILYRLVFLLIIKTNEKVVHA  592

Query  2017  VKAVMRVSPKQSHQVVA  2067
              KA   V   +S Q++A
Sbjct  593   RKASTSVLSNRSSQIMA  609



>gb|KHN28203.1| ABC transporter G family member 11 [Glycine soja]
Length=646

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/623 (61%), Positives = 480/623 (77%), Gaps = 14/623 (2%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW+D+WVT S+ + G+K+IL+ LTGYA+PG+LLAIMGPSGCGKSTLLD LAGRL   TR
Sbjct  19    LTWKDVWVTASNKKNGSKSILQRLTGYAKPGQLLAIMGPSGCGKSTLLDTLAGRLGSNTR  78

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             Q+G+ILING  Q L+YGTSAYVTQ+DTL  TLTVREAV+YSAQLQLP ++ + EKKE A+
Sbjct  79    QAGEILINGHKQALSYGTSAYVTQDDTLLTTLTVREAVHYSAQLQLPDTMSKEEKKERAD  138

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI+EMGLQDA+NTRIGG        G QK+RVSIC+EILTRPKLLFLDEP+SGLDSAAS
Sbjct  139   FTIREMGLQDAINTRIGGWGCKGISGG-QKKRVSICIEILTRPKLLFLDEPTSGLDSAAS  197

Query  766   FYVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFE  936
             +YVM +I+ LA      RTV+ASIHQPS+EVF LF +LCLLSSG+ VYFGPASAA +FF 
Sbjct  198   YYVMKRIVALAQNDHIQRTVIASIHQPSSEVFQLFNNLCLLSSGKTVYFGPASAASEFFA  257

Query  937   TNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCA--RGIPTEEVINILVNSYKSYHRY  1110
             ++GFPC +L NPSDH LKTINKDFD   +D+E G A  R IPTEEVI+ILVNSYKS  R 
Sbjct  258   SSGFPCSSLMNPSDHLLKTINKDFD---QDIEVGLAGTRNIPTEEVIHILVNSYKSSERN  314

Query  1111  REVQGQVAEISKQE-GEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLA  1287
             +EV  +VA +SK++ G +  K   A F  Q +VLT+RSF+NM RDLGYYWLR  IY+ LA
Sbjct  315   QEVHNEVAVLSKKDIGSLDIKRGNAGFLNQCLVLTKRSFINMHRDLGYYWLRFVIYVALA  374

Query  1288  VGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGC  1467
             + L  ++ D+G    SI+ R S++AFI  F TFM IGGFPSFVE MKV+++E  NGHYG 
Sbjct  375   ITLASVFYDLGKSYDSIKDRGSLVAFINGFITFMTIGGFPSFVEVMKVYQRERQNGHYGV  434

Query  1468  GAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMII  1647
              AF I NTLSS+PYLLL++ IPG I+Y+  GLQ+   HF YF  V+  +++LVESLMMI+
Sbjct  435   TAFVIGNTLSSVPYLLLVTFIPGAISYYLPGLQKGCQHFLYFICVLFSSLMLVESLMMIV  494

Query  1648  ASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNE  1827
             AS VPN+LMGII G+G+Q +M+L  G+F+LP  +PK  W+YP++Y+ FH YA QG++KNE
Sbjct  495   ASAVPNFLMGIITGSGIQGIMLLLCGFFKLPNHIPKPVWKYPLHYVAFHTYANQGMFKNE  554

Query  1828  FQGLRLP--EETGQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASE  2001
             ++GLR    E  G  I+GEEVLR T QV+M +SKW+DL +L+ M VV RV+ L+++K  E
Sbjct  555   YEGLRFASNEVGGGYISGEEVLRNTWQVDMSYSKWVDLAILIGMIVVYRVLLLVIIKVKE  614

Query  2002  KAKHVVKAV--MRVSPKQSHQVV  2064
             K K VV ++  M  SPK++ QV+
Sbjct  615   KMKPVVVSISCMSSSPKKTTQVM  637



>emb|CDO97684.1| unnamed protein product [Coffea canephora]
Length=675

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/607 (61%), Positives = 462/607 (76%), Gaps = 11/607 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             FLTW+DLWV+V +G+KG KAIL+GLTGYARPGELLAIMGPSGCGKSTLLDALAGRL+  +
Sbjct  65    FLTWDDLWVSVPNGKKGCKAILQGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLDTKS  124

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             +Q G+IL+NGR Q LAYGTSAYVTQ++ LT TLT REAVYYSAQLQLP+++ ++EK + A
Sbjct  125   KQMGEILVNGRMQQLAYGTSAYVTQDNILTWTLTTREAVYYSAQLQLPNTMSKAEKIDRA  184

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             + TI+EMGLQ  ++TRIGG        G QKR VSIC+EILTRPKLLFLDEP+SGLDSAA
Sbjct  185   DRTIREMGLQSCIDTRIGGWGSKGLSGGQQKR-VSICIEILTRPKLLFLDEPTSGLDSAA  243

Query  763   SFYVMSKIMDLASE-GRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             S+YVM++I +LA E G TVVAS+HQPSTEV  L  +LCLLS GR +YFGP+ A  QFF  
Sbjct  244   SYYVMNRIAELAKEYGMTVVASMHQPSTEVCKLLDNLCLLSLGRTIYFGPSIAVNQFFAR  303

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREV  1119
             NGF  P LQNP DH+L+ IN DFD   ED+E        T+EVI+ LV SY S   Y  +
Sbjct  304   NGFLSPGLQNPVDHYLRMINTDFD---EDIESAADGKTTTKEVIDKLVESYTSSDTYDLI  360

Query  1120  QGQVAEISKQE-GEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGL  1296
               +VA+I+ Q+ G V +K  R  FF Q +VLT RSF+NM RDLGYYWLRL IYITLA GL
Sbjct  361   LREVAQINGQQIGVVEEKRRRGSFFIQCLVLTERSFVNMHRDLGYYWLRLAIYITLAFGL  420

Query  1297  GYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAF  1476
             G ++ +VG   +SI AR S+L F+AS  T M+IGGFPSFVE++KVF++E LNGHYG  AF
Sbjct  421   GTVFYNVGNSYTSINARASMLMFVASLLTLMSIGGFPSFVEEIKVFQRERLNGHYGVAAF  480

Query  1477  AIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASL  1656
              ++NT SS+ +L LI++IPG+I Y+ VGLQR    F YF +V+  +++LVE LMMI+ASL
Sbjct  481   VVSNTASSVLFLCLIAVIPGVIVYYLVGLQRGTERFLYFIMVLFASIMLVEGLMMIVASL  540

Query  1657  VPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQG  1836
             VPN+LMG+I GAG Q +M+L GG+FRLP DLP +FW+YPIYY  FH+YAYQGLYKNEF+G
Sbjct  541   VPNFLMGLIIGAGTQGVMMLSGGFFRLPHDLPSIFWKYPIYYTSFHRYAYQGLYKNEFEG  600

Query  1837  LRLPEET-----GQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASE  2001
             L+ P           I GE +LR T QVEMG+SKWIDL VL +M ++ R++F  ++K  E
Sbjct  601   LKFPSNELMKGGSSSIDGETILRHTWQVEMGYSKWIDLAVLFLMVILYRLLFFGIIKVGE  660

Query  2002  KAKHVVK  2022
             + K +VK
Sbjct  661   RIKPLVK  667



>gb|KHN28204.1| ABC transporter G family member 11 [Glycine soja]
Length=655

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/577 (63%), Positives = 450/577 (78%), Gaps = 12/577 (2%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             +TW+D+WVT S+ + G+K+IL+GLTGYA+PG+LLAIMGPSGCGKSTLLD LAGRL   TR
Sbjct  62    MTWKDVWVTASNRKNGSKSILQGLTGYAKPGQLLAIMGPSGCGKSTLLDTLAGRLGSNTR  121

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             Q+G+ILING  Q L+YGTSAYVTQ+DTL  TLTVREAV+YSAQLQLP ++ + EKKE A+
Sbjct  122   QTGEILINGHKQALSYGTSAYVTQDDTLLTTLTVREAVHYSAQLQLPDTMSKEEKKERAD  181

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI+EMGLQDA+NTRIGG        G Q+RRVSIC+EILTRPKLLFLDEP+SGLDSAAS
Sbjct  182   FTIREMGLQDAINTRIGGWGCKGISGG-QERRVSICIEILTRPKLLFLDEPTSGLDSAAS  240

Query  766   FYVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFE  936
             +YVM +I  LA      RTV+ SIHQPS+EVF LF SLCLLS G+ VYFGPASAA +FF 
Sbjct  241   YYVMRRIATLAQNDHIQRTVIVSIHQPSSEVFQLFNSLCLLSLGKTVYFGPASAATEFFA  300

Query  937   TNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCA--RGIPTEEVINILVNSYKSYHRY  1110
             +NGFPCP L NPSDH LKTINKDFD   +D+E G A  + +PTEEVI+IL+NSYKS  R 
Sbjct  301   SNGFPCPPLMNPSDHLLKTINKDFD---QDIEVGLAGTKSMPTEEVIHILLNSYKSSERN  357

Query  1111  REVQGQVAEISKQEGEVLK-KSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLA  1287
             +EVQ +VA +SK++   L  K   A F  Q +VLT+RSF+NM+RDLGYYWLRL IYI LA
Sbjct  358   QEVQNEVAVLSKKDTSSLDMKRGNAGFLNQCLVLTKRSFINMYRDLGYYWLRLVIYIALA  417

Query  1288  VGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGC  1467
             + L  ++ D+G    SI+ R S++AFI  F TFM IGGFPSFVE MKV+++E  NGHYG 
Sbjct  418   ITLATVFYDLGTSYDSIKDRGSLVAFINGFITFMTIGGFPSFVEVMKVYQRERQNGHYGV  477

Query  1468  GAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMII  1647
              AF I NTLSS+PYLLL++ IPG I+Y+  GLQ+   HF YF  V+  +++LVESLMMI+
Sbjct  478   TAFVIGNTLSSIPYLLLVTFIPGAISYYLPGLQKGCEHFLYFICVLFSSLMLVESLMMIV  537

Query  1648  ASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNE  1827
             AS+VPNYLMGII G+G+Q +M+L  G+F+LP  +PK  W+YP++Y+ FH YA QG++KNE
Sbjct  538   ASVVPNYLMGIITGSGIQGIMLLLCGFFKLPNHIPKPVWKYPLHYVAFHTYANQGMFKNE  597

Query  1828  FQGLRLP--EETGQIITGEEVLRETLQVEMGHSKWID  1932
             ++GLR    E  G  I+GEEVLR T QV+M +SKW+D
Sbjct  598   YEGLRFASNEVGGGYISGEEVLRNTWQVDMSYSKWVD  634



>ref|XP_006593746.1| PREDICTED: ABC transporter G family member 11-like isoform X2 
[Glycine max]
Length=690

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/619 (59%), Positives = 472/619 (76%), Gaps = 18/619 (3%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             FLTWEDLWVTVS+G+ G K IL+GL GYA+PG+LLAIMGPSGCGKSTLLDALAGRL   T
Sbjct  54    FLTWEDLWVTVSNGKNGRKPILQGLKGYAKPGKLLAIMGPSGCGKSTLLDALAGRLGSKT  113

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             +Q+G ILINGR Q LAYG SAYVT++DT+  TLTV+EAVYYSA LQLP S+ +SEK+E A
Sbjct  114   KQTGKILINGRKQALAYGASAYVTEDDTILTTLTVKEAVYYSAYLQLPDSMSKSEKQERA  173

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             + TI+EMGL DA+NTRIGG        G QKRRVSIC+EILT P+LLFLDEP+SGLDSAA
Sbjct  174   DFTIREMGLHDAINTRIGGWGSKGASGG-QKRRVSICIEILTHPRLLFLDEPTSGLDSAA  232

Query  763   SFYVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFF  933
             S++VMS+I +L  +    RT++ASIHQPS E+F LF +LCLLSSG+ VYFGP SAA +FF
Sbjct  233   SYHVMSRISNLNKKDGIQRTIIASIHQPSNEIFQLFHNLCLLSSGKTVYFGPTSAANKFF  292

Query  934   ETNGFPCPTLQNPSDHFLKTINKDFDNDD-----------EDVEQGCARGIPTEEVINIL  1080
              +NGFPCP+L +PSDHF+KTINKDF+              +D E+G A G+ TEE I++L
Sbjct  293   SSNGFPCPSLHSPSDHFVKTINKDFEQFSAGSINRFTLHLQDPEKGLAGGLSTEEAIHVL  352

Query  1081  VNSYKSYHRYREVQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWL  1260
               SY S     +VQ ++A+  K++ + + +   ADFFTQ ++LTRRSF+NM+R++GYYWL
Sbjct  353   AKSYDSSKICHQVQKEIAQTKKRDSDTMDEKCHADFFTQCLILTRRSFVNMYREVGYYWL  412

Query  1261  RLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKK  1440
             RL IY  LA+ LG M+ D+G  + SIQAR S+L F+ +F TF+ +GGFPSFVE+MKVF++
Sbjct  413   RLLIYGALALSLGTMFFDIGSSSESIQARGSLLVFVVTFLTFITVGGFPSFVEEMKVFER  472

Query  1441  ETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNML  1620
             E LNGHYG  AF I NTLSS+P+LLL+SLIPG + Y+ VGL +   HF YF  ++  ++ 
Sbjct  473   ERLNGHYGVTAFTIGNTLSSVPFLLLMSLIPGALVYYLVGLHQGHEHFVYFIFMLFTSVF  532

Query  1621  LVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKY  1800
             LVE LMMI+AS+VPN+LMGII G+G+  +M+L GG++RLP D+PK FWRYP++YI FHKY
Sbjct  533   LVEGLMMIVASMVPNFLMGIIVGSGILGIMMLDGGFYRLPSDIPKPFWRYPLHYISFHKY  592

Query  1801  AYQGLYKNEFQGLRLPEE---TGQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrv  1971
             AYQGL+KNEFQGL  P         I GE +LR   Q+E+ +SKW+D+ +LV M V+ R+
Sbjct  593   AYQGLFKNEFQGLTFPSNQVGAHMTIHGEHILRHIWQMEVNYSKWVDVGILVGMAVLYRI  652

Query  1972  vfllvvKASEKAKHVVKAV  2028
             +FL+++K+ EK K +  A+
Sbjct  653   LFLVIIKSFEKVKPISSAL  671



>ref|XP_003608436.1| White-brown-complex ABC transporter family [Medicago truncatula]
Length=691

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/630 (60%), Positives = 479/630 (76%), Gaps = 21/630 (3%)
 Frame = +1

Query  226   LTWEDLWV-TVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             LTW+D+WV T+S+G+ G+K+IL+GLTGYA+PG+LLAIMGPSGCGKSTLLD LAGRL   T
Sbjct  53    LTWKDIWVNTISNGKNGSKSILQGLTGYAKPGQLLAIMGPSGCGKSTLLDTLAGRLGSNT  112

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             RQ+G+ILING  Q L+YGTSAYVTQ+DTL  TLTVREAV+YSAQLQLP+++ + EKKE A
Sbjct  113   RQTGEILINGHKQELSYGTSAYVTQDDTLLTTLTVREAVFYSAQLQLPNTMSKEEKKERA  172

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             ++TIKEMGLQDAMNTRIGG        G QKRRVSIC+EILTRP+LLFLDEP+SGLDSAA
Sbjct  173   DITIKEMGLQDAMNTRIGGWGVKGISGG-QKRRVSICIEILTRPRLLFLDEPTSGLDSAA  231

Query  763   SFYVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFF  933
             S+YVM +I  L  +    RT++ SIHQPSTEVF LF +LCLLSSGR VYFGPAS A +FF
Sbjct  232   SYYVMKRIATLDHKDGIRRTIITSIHQPSTEVFQLFHNLCLLSSGRTVYFGPASTACEFF  291

Query  934   ETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARG--IPTEEVINILVNSYKSYHR  1107
               NGFPCP LQNPSDH LKTINKDFD   +D+E G A    IPTE+ I ILV+SYKS   
Sbjct  292   ALNGFPCPPLQNPSDHLLKTINKDFD---QDIETGLAGTGTIPTEKAICILVSSYKSSEM  348

Query  1108  YREVQGQVAEISKQEGEVL------KKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLG  1269
              ++VQ +VA +S +   V       +K     F  Q  VL  RS +NMFRD GYYWLRL 
Sbjct  349   RQDVQNEVAVLSNKVHYVHTSSMDHRKKGHVGFLNQCSVLIERSSINMFRDPGYYWLRLV  408

Query  1270  IYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETL  1449
             IY+ LA+ LG +Y D+G  N SI+ R S+L+FIA F TFM+IGGFPSFVEDMKVF++E  
Sbjct  409   IYVALAISLGTIYYDLGTNNDSIKNRGSLLSFIAGFLTFMSIGGFPSFVEDMKVFQRERQ  468

Query  1450  NGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVE  1629
             NGHYG  A+ I NT SS+P++LL+++IP  I Y+  GLQ+ F HF YFA V+  +++LVE
Sbjct  469   NGHYGVIAYVIGNTFSSIPFILLVTIIPAAITYYLPGLQKGFEHFLYFASVLFSSLMLVE  528

Query  1630  SLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQ  1809
             SLMMI+AS+VPNYLMGII GAG+Q +MIL GG+F+LP ++PK FWRYP++Y+ FH Y ++
Sbjct  529   SLMMIVASIVPNYLMGIITGAGIQGIMILVGGFFKLPHEIPKPFWRYPLHYVAFHTYGFE  588

Query  1810  GLYKNEFQGLRLPEETGQ----IITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvf  1977
             GL+KNE++GL    + GQ     I+GEEVLR+  Q  M +SKW+DL +L+ M V+ RV+F
Sbjct  589   GLFKNEYEGLIFSTKNGQGTNGYISGEEVLRDIWQSNMSYSKWVDLAILLGMIVLYRVLF  648

Query  1978  llvvKASEKAKHVVKAVMR-VSPKQSHQVV  2064
             L+++K +EK K ++  ++  +SP  +  VV
Sbjct  649   LVIIKITEKVKPIIGPLLSCMSPNTTIHVV  678



>gb|KHN26506.1| ABC transporter G family member 11 [Glycine soja]
Length=699

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/628 (61%), Positives = 479/628 (76%), Gaps = 19/628 (3%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW+D+WVT S+ + G+K+IL  LTGYA+PG+LLAIMGPSGCGKSTLLD+LAGRL   TR
Sbjct  67    LTWKDVWVTASNRKSGSKSILHELTGYAKPGQLLAIMGPSGCGKSTLLDSLAGRLGSNTR  126

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             Q+G+ILING  Q L YGTSAYVTQ+DTL  TLTVREAV+YSAQLQLP ++ + EKKE A+
Sbjct  127   QTGEILINGHKQALCYGTSAYVTQDDTLLTTLTVREAVHYSAQLQLPDTMSKEEKKERAD  186

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI+EMGLQDA+NTRIGG        G QKRRVSIC+EILTRPKLLFLDEP+SGLDSAAS
Sbjct  187   FTIREMGLQDAINTRIGGWGCKGISGG-QKRRVSICIEILTRPKLLFLDEPTSGLDSAAS  245

Query  766   FYVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFE  936
             +YVM +I  LA      RTV+ASIHQPS+EVF LF SLCLLSSG+ VYFGPASAA +FF 
Sbjct  246   YYVMKRIAALAQNDHIQRTVIASIHQPSSEVFQLFHSLCLLSSGKTVYFGPASAAKEFFA  305

Query  937   TNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCA--RGIPTEEVINILVNSYKSYHRY  1110
             +NGFPCP L NPSDH LKTINKDFD   +D+E G A    I TEEVI+ILVNSYKS  R 
Sbjct  306   SNGFPCPPLMNPSDHLLKTINKDFD---QDIEAGLAGTENILTEEVIHILVNSYKSSERN  362

Query  1111  REVQGQVAEISKQEGEVLK-KSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLA  1287
             +EVQ +VA +SK++   L  K   A F  Q +VLT+RSF+NM+RDLGYYWLRL IYI LA
Sbjct  363   QEVQNEVALLSKKDTSSLDMKKGNAGFLNQCLVLTKRSFINMYRDLGYYWLRLVIYIALA  422

Query  1288  VGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGC  1467
             + L  ++ D+G    SI+ R S++A I  F TFM IGGFPSFVE MKV+++E  NGHYG 
Sbjct  423   ITLATVFYDLGTSYDSIKDRGSLVAIINGFITFMTIGGFPSFVEVMKVYQRERQNGHYGV  482

Query  1468  GAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMII  1647
              AF I NTLSS+PYLL+++ IPG I+Y+  GLQ    HF YF  V+  +++LVESLMMI+
Sbjct  483   TAFVIGNTLSSIPYLLMVTFIPGAISYYLPGLQNGCEHFLYFICVLFSSLMLVESLMMIV  542

Query  1648  ASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNE  1827
             AS+VPNYLMGIIAG+G+Q +M+L  G+F+LP D+PK  W+YP++Y+ FH YA QG++KNE
Sbjct  543   ASVVPNYLMGIIAGSGIQGIMLLLSGFFKLPNDIPKPVWKYPLHYVAFHTYANQGMFKNE  602

Query  1828  FQGLRLPEE-------TGQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllv  1986
             ++GLR   +       +   I+GEEVLR T QV+  +SKW+DL +L+ M VV RV+FL++
Sbjct  603   YKGLRFNTDHQVGSGGSHGYISGEEVLRNTWQVDTSYSKWVDLAILIGMIVVYRVLFLVI  662

Query  1987  vKASEKAKHVVKAV--MRVSPKQSHQVV  2064
             +K  EK K +V ++  M  SPK++ QV+
Sbjct  663   IKIKEKMKPLVVSLSCMSASPKRTMQVM  690



>ref|XP_009784910.1| PREDICTED: ABC transporter G family member 11-like isoform X2 
[Nicotiana sylvestris]
Length=622

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/617 (60%), Positives = 454/617 (74%), Gaps = 59/617 (10%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW DLWVTVS  + G KAIL+GLTGYARP ELLA+MGPSGCGKSTLLDALAGRL+ +TR
Sbjct  40    LTWNDLWVTVSTRKSGRKAILQGLTGYARPSELLAVMGPSGCGKSTLLDALAGRLDFSTR  99

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             QSGDILING  Q L+YGT AY+TQ++TL ATLTV+EAVYYSAQLQLP S+ +SEK +IAE
Sbjct  100   QSGDILINGHKQKLSYGTCAYLTQDETLLATLTVKEAVYYSAQLQLPDSMKKSEKIQIAE  159

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TIKEMGLQDAMNTR  GGWG+KGISGG+KRR+SIC+EILTRPKLLFLDEP+SGLDSAAS
Sbjct  160   QTIKEMGLQDAMNTR-IGGWGTKGISGGEKRRLSICMEILTRPKLLFLDEPTSGLDSAAS  218

Query  766   FYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             +YVMS+I     EGRT++ASIHQPS EVF+LF SLCLLSSG++VYFGPASAAIQFF  NG
Sbjct  219   YYVMSEI-SRQKEGRTIIASIHQPSAEVFNLFHSLCLLSSGKIVYFGPASAAIQFFARNG  277

Query  946   FPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREVQG  1125
             F CP LQNPSDHFLKT+NKDF   DED+EQG A   P EEVI++LVNS+KS   Y EVQ 
Sbjct  278   FSCPHLQNPSDHFLKTVNKDF---DEDIEQGSAGRKPIEEVIDLLVNSFKSSKEYHEVQN  334

Query  1126  QVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLGYM  1305
             Q+ EI +Q GE+L+K SRA+F TQS+VLTRRS +NMFRDLGYYW+R   Y+ +A+GLG +
Sbjct  335   QIVEICQQGGEILEKRSRANFTTQSLVLTRRSSVNMFRDLGYYWMRFATYVAIALGLGSI  394

Query  1306  YNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFAIA  1485
             Y D+G    SI+ R  ++ F+ SF TFM +GGFPSFVEDMKVF++E LNGHYGC  F I 
Sbjct  395   YYDLGSNYHSIEERGLMVTFVVSFMTFMTVGGFPSFVEDMKVFQRENLNGHYGCCTFVIG  454

Query  1486  NTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLVPN  1665
             N                                           +L  +  +I+ S VP 
Sbjct  455   N-------------------------------------------ILSSTPYVILISFVP-  470

Query  1666  YLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGLRL  1845
                    GAG+Q L IL GGYF+LP +LP   W+YP+YY+ FHKYAYQG++KNEF+GL+ 
Sbjct  471   -------GAGIQGLQILSGGYFQLPSELPNPIWKYPLYYVSFHKYAYQGMFKNEFKGLKF  523

Query  1846  PEE---TGQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAKHV  2016
              ++     Q ++GE++LRE  QVEM +SKW+DL +LV   ++ R+VFLL++K +EK  H 
Sbjct  524   TDDQFGNNQTMSGEDILRERWQVEMAYSKWVDLAILVGTLILYRLVFLLIIKTNEKIVHA  583

Query  2017  VKAVMRVSPKQSHQVVA  2067
              KA   V   Q+ Q++A
Sbjct  584   RKASTSVLSNQNSQIMA  600



>ref|XP_010690532.1| PREDICTED: ABC transporter G family member 11-like isoform X1 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010690533.1| PREDICTED: ABC transporter G family member 11-like isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=651

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/619 (61%), Positives = 477/619 (77%), Gaps = 13/619 (2%)
 Frame = +1

Query  226   LTWEDLWVTVSDGR-KGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             LTW+DL VTVSD   K  K IL+ +TGYA PG++LAIMGPSGCGKSTLLDALAGRL+L T
Sbjct  37    LTWQDLCVTVSDKEAKFTKNILQDVTGYACPGQVLAIMGPSGCGKSTLLDALAGRLDLNT  96

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
               +G ILING  Q LAYGTSAYVTQ+D L  TLTV+E VYYS++LQLPSS+ +SEK++ A
Sbjct  97    --NGHILINGCEQALAYGTSAYVTQDDILITTLTVKEIVYYSSELQLPSSMSKSEKRKRA  154

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             +  IKEMGLQD+++TR+GG        G QKRR+SIC+EILT+PKLLFLDEP+SGLDSAA
Sbjct  155   DDCIKEMGLQDSIDTRVGGWGVKGLSGG-QKRRLSICVEILTQPKLLFLDEPTSGLDSAA  213

Query  763   SFYVMSKIM-DLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             SF+VMS+I  +    GRT++ASIHQPS++VF LF +LCLLS+G+ VYFGPA  A++FF +
Sbjct  214   SFHVMSRIASNDRKNGRTIIASIHQPSSQVFGLFDNLCLLSAGKTVYFGPARGALEFFTS  273

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREV  1119
             NGFPCP+ QNPSD FL+ INKDFD   E +EQG +    TEE+++ILVNSYKS   Y+++
Sbjct  274   NGFPCPSQQNPSDFFLQMINKDFD---EGIEQGRSIKKSTEEIVDILVNSYKSSENYQQI  330

Query  1120  QGQVAEISKQEGEVLK-KSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGL  1296
             +  ++ I K +GE L+    RA F  Q  VLTRRSF+NM RD GYYWLRL IYI L +GL
Sbjct  331   EDVISTICKSKGERLEIGRKRASFLIQCQVLTRRSFVNMSRDWGYYWLRLAIYIILGLGL  390

Query  1297  GYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAF  1476
             G ++ D+G   SSIQ R S+L F+AS+ TFM IGGFPSFVEDMKVFK+E LNGHY   +F
Sbjct  391   GTLFYDIGLSKSSIQDRGSLLMFVASYLTFMTIGGFPSFVEDMKVFKRERLNGHYSTTSF  450

Query  1477  AIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASL  1656
              + NTLSS+P+LLL++LIPG I YF  GLQREF +F YF LV+   MLLVESLMMI+ASL
Sbjct  451   VVGNTLSSVPFLLLVALIPGAIVYFLPGLQREFPNFTYFILVLFACMLLVESLMMIVASL  510

Query  1657  VPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQG  1836
             VPN+LMGII GAG+Q  M+L GG+FRLP  LP +FWRYP+Y+I FHKYA+QGL+KNEF+G
Sbjct  511   VPNFLMGIITGAGVQGFMMLAGGFFRLPNQLPNIFWRYPLYHISFHKYAFQGLFKNEFEG  570

Query  1837  LRLPEETG---QIITGEEVLRETLQV-EMGHSKWIDllvlvvmgvvcrvvfllvvKASEK  2004
             L  P + G    + +G  +L+   QV + G+SKWI+L +L+ M V+ R +FL+++K SEK
Sbjct  571   LEFPTKKGSSLHMTSGVTILKNKWQVDDAGYSKWINLGILLGMVVLYRFMFLIIIKISEK  630

Query  2005  AKHVVKAVMRVSPKQSHQV  2061
             +K +++A+ R  PKQ  QV
Sbjct  631   SKPIIRALTRRPPKQVVQV  649



>ref|XP_006827842.1| hypothetical protein AMTR_s00008p00021210 [Amborella trichopoda]
 gb|ERM95258.1| hypothetical protein AMTR_s00008p00021210 [Amborella trichopoda]
Length=721

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/621 (63%), Positives = 473/621 (76%), Gaps = 16/621 (3%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW +L V V+ G+KG + IL+GL G A+ GE LAIMGPSGCGKSTLLDALAGRL     
Sbjct  105   LTWTNLCV-VAHGKKGARTILRGLNGCAQSGEFLAIMGPSGCGKSTLLDALAGRLSSNVV  163

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             Q G+ILINGR Q LAYGTSAYVTQ DTL +TLTV EAVYYSAQL LPS++  S+K E AE
Sbjct  164   QMGEILINGRKQALAYGTSAYVTQNDTLMSTLTVWEAVYYSAQLLLPSTMSSSQKIERAE  223

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
             +TI+EMGLQDA++TRIGG        G QKRRVSIC+EILTRP LLFLDEP+SGLDSAAS
Sbjct  224   ITIQEMGLQDAIHTRIGGWGVKGLSGG-QKRRVSICIEILTRPSLLFLDEPTSGLDSAAS  282

Query  766   FYVMSKIMDLA-SEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETN  942
             ++VM++I  LA  + RTVV SIHQPS EVF LF +LCLLS G+ +YFG AS A  FF  N
Sbjct  283   YHVMTRIACLARHDDRTVVTSIHQPSAEVFGLFNTLCLLSGGKTLYFGQASEANDFFTLN  342

Query  943   GFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGC-ARGIPTEEVINILVNSYKSYHRYREV  1119
             GFPCP+L+NPSDHFL TIN DFD   +D+EQG  A      +  +ILVNSY S     +V
Sbjct  343   GFPCPSLRNPSDHFLHTINTDFD---KDIEQGSDAEATEAGKATDILVNSYNSTIA-NQV  398

Query  1120  QGQVAEISKQEGEVL-KKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGL  1296
               +VA+IS +EGE L +K S+A FFTQ+  LTRRSF+NM+RD GYYWLRL IYI L V +
Sbjct  399   FARVADISNREGEALTRKGSQASFFTQASTLTRRSFVNMYRDFGYYWLRLAIYIALCVCI  458

Query  1297  GYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAF  1476
             G ++ D+G+   SIQAR S+L F+A+F TFMAIGGFPSFVEDMK+F +E LNGHYG G +
Sbjct  459   GTIFFDIGHSFGSIQARASMLMFVAAFLTFMAIGGFPSFVEDMKIFGRERLNGHYGVGTY  518

Query  1477  AIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASL  1656
              I NTLSS PYL L SLIPG IAY+ V L+    HF YFALV+ + M+LVESLMM++ASL
Sbjct  519   VIGNTLSSTPYLFLTSLIPGAIAYYLVHLRDGAEHFLYFALVLFVCMMLVESLMMLVASL  578

Query  1657  VPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQG  1836
             VPN+LMGII GAG+QA+MIL GG+FRLP DLPK FW+YP+YYI FHKYA QGLYKNEF+G
Sbjct  579   VPNFLMGIITGAGIQAIMILNGGFFRLPNDLPKPFWKYPMYYISFHKYANQGLYKNEFEG  638

Query  1837  LRLPEETGQI-----ITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASE  2001
             L  P   G +     ITGE +LRET Q+EMG+SKW+DL +L+ M V  R++FL ++K SE
Sbjct  639   LTFPN--GYVGGRATITGESILRETWQMEMGYSKWVDLGILMGMVVFYRLMFLGIIKLSE  696

Query  2002  KAKHVVKAVMRVSPKQSHQVV  2064
             KA+ VV++ +    KQ+ +V+
Sbjct  697   KARPVVRSFLVRHRKQATKVL  717



>ref|XP_009802842.1| PREDICTED: ABC transporter G family member 11-like [Nicotiana 
sylvestris]
Length=632

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/613 (60%), Positives = 470/613 (77%), Gaps = 9/613 (1%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             +LTW+DLWVTV D + G + IL+G+TGYA+PGE+LAIMGPSGCGKSTLLDALAGRL   T
Sbjct  25    YLTWKDLWVTVPDRKVGRRPILEGITGYAQPGEVLAIMGPSGCGKSTLLDALAGRLASNT  84

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             RQSGDIL+NGR Q LA+GTSAYVTQ+DTL  TLTV+E VYYSAQLQLP S+P SEKKE A
Sbjct  85    RQSGDILVNGRKQALAFGTSAYVTQDDTLMTTLTVKETVYYSAQLQLPESMPLSEKKERA  144

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             E TIKEMGLQ+AMNTRIGG        G QKRRVSIC+EILTRPKLLFLDEP+SGLDSAA
Sbjct  145   EATIKEMGLQEAMNTRIGGWSLKGLSGG-QKRRVSICIEILTRPKLLFLDEPTSGLDSAA  203

Query  763   SFYVMSKIMDLASEG-RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             S++VM++I+ +A +  RTVVASIHQPS+EVF LF +LCLLS G+ +YFG +SAA +FF  
Sbjct  204   SYHVMNRIIKIAQQDMRTVVASIHQPSSEVFELFDNLCLLSYGKTIYFGSSSAANEFFAI  263

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREV  1119
             NGFPCP L+NPSDH+L+TINKDFD    D+E+G  + I + + I+ L  SY++    R V
Sbjct  264   NGFPCPYLRNPSDHYLRTINKDFD----DIEEGFGKKISSGKAIDTLAMSYEASEACRNV  319

Query  1120  QGQVAEISKQEGEVL-KKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGL  1296
             + +V  I ++ G +L KK S+A F TQ  VLT+RSF+NM+RDLGYYWLR  IY+ L + +
Sbjct  320   RQRVFNICQKNGHLLEKKGSQAGFITQCRVLTQRSFVNMYRDLGYYWLRFLIYLALCLCI  379

Query  1297  GYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAF  1476
             G +++++G   SSIQAR S+L F+  F TFMAIGGFPSFVE+MK+F +E LNGHYG  AF
Sbjct  380   GTVFHEIGSDYSSIQARSSMLVFVVGFLTFMAIGGFPSFVEEMKLFTRERLNGHYGVSAF  439

Query  1477  AIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASL  1656
              I NTLSS P+LLLISL+PG +AY+   +Q+    FAYF L++   M+LVESLMMI+AS+
Sbjct  440   VIGNTLSSTPFLLLISLVPGAVAYYLADVQKGIDRFAYFFLMLFACMMLVESLMMIVASI  499

Query  1657  VPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQG  1836
             VP++LMGII GAG+Q +M+L GG+FRLPKDLP   W+YP+YY+ FHKYA QG YKNE++ 
Sbjct  500   VPDFLMGIITGAGIQGVMMLNGGFFRLPKDLPMPIWKYPVYYLAFHKYAIQGFYKNEYET  559

Query  1837  LRLPEETGQ--IITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAK  2010
                    G   I+T +E+LR+  QVE+ +SKW D+ ++  M ++ R++FL ++KA EK K
Sbjct  560   FTYFTNGGLAVIVTRDEILRDIFQVELNYSKWGDIAIVFGMVILYRLIFLSIIKAKEKFK  619

Query  2011  HVVKAVMRVSPKQ  2049
              +V+     S K 
Sbjct  620   PMVRGFKAHSCKH  632



>ref|XP_004957093.1| PREDICTED: ABC transporter G family member 11-like [Setaria italica]
Length=728

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/607 (62%), Positives = 459/607 (76%), Gaps = 11/607 (2%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNK--AILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELT  399
             ++WEDLWV+ S G KG     IL GL GYARPGE+LAIMGPSGCGKSTLLDALAGRL   
Sbjct  104   ISWEDLWVSASGGGKGGGRLPILCGLNGYARPGEVLAIMGPSGCGKSTLLDALAGRLGSN  163

Query  400   TRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEI  579
               Q GDILINGR Q L+YGTSAYVTQ+D L  TLTVREAV+YSAQLQLPS++  S K+E 
Sbjct  164   MSQKGDILINGRRQKLSYGTSAYVTQDDVLMTTLTVREAVHYSAQLQLPSAMSASAKRER  223

Query  580   AEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSA  759
             AE T++EMGL+ A +TRIGG        G Q+RRVSIC+EILTRP LLFLDEP+SGLDSA
Sbjct  224   AEETLREMGLEGAADTRIGGWMHKGISGG-QRRRVSICMEILTRPALLFLDEPTSGLDSA  282

Query  760   ASFYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFE  936
             AS++V+ +I  LA  EG TVVA++HQPSTEV+ LF  LCLL+ GR V+FGPA+   QFF 
Sbjct  283   ASYHVVGRIARLARREGMTVVAAVHQPSTEVYGLFAGLCLLAYGRTVFFGPAADTNQFFA  342

Query  937   TNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYRE  1116
              +GFPCP+L NPSDHFL+TINKDFD D E+   G    + T + I+ LVNSYKS     +
Sbjct  343   LSGFPCPSLMNPSDHFLRTINKDFDKDIEEGLDG--EKMTTAQAIDTLVNSYKSSAYMEK  400

Query  1117  VQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGL  1296
             V  Q+AEI +  G V+KK  +  F TQS+VLT+RSF+NM+RDLGYYWLR  IYI L + +
Sbjct  401   VTRQIAEIREIGGAVVKKEWQPSFVTQSLVLTKRSFVNMYRDLGYYWLRFAIYIMLCICV  460

Query  1297  GYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAF  1476
             G ++ DVG    SIQAR S+L F+A+F TFMAIGGFPSFVEDMK+F +E LNGHYG  +F
Sbjct  461   GTIFYDVGNSYGSIQARGSMLNFVAAFLTFMAIGGFPSFVEDMKIFGRERLNGHYGVASF  520

Query  1477  AIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASL  1656
             AIANT+S+ PYL LIS++PG +AY+ V LQ  FGHFAYFALV+   M++VE LMMI+AS 
Sbjct  521   AIANTVSAAPYLALISVVPGAMAYYMVSLQSSFGHFAYFALVLFAAMMVVEGLMMIVAST  580

Query  1657  VPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQG  1836
             VP++LMGII GAG+Q +M+L GG+FRLP DLPK FWRYP+YY+ FHKYA QG YKNEF G
Sbjct  581   VPDFLMGIITGAGIQGVMMLNGGFFRLPNDLPKPFWRYPMYYVAFHKYANQGFYKNEFLG  640

Query  1837  LRLPEE-----TGQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASE  2001
             L  P        G  I+G E+LR+  QVEMG+SKW+DL +L  M V+ R++FL +VK +E
Sbjct  641   LTFPSNQAAAGAGATISGREILRDYWQVEMGYSKWVDLAILCGMVVLYRLLFLAIVKLAE  700

Query  2002  KAKHVVK  2022
               K ++K
Sbjct  701   NVKPMIK  707



>ref|XP_010029396.1| PREDICTED: ABC transporter G family member 11-like [Eucalyptus 
grandis]
Length=706

 Score =   679 bits (1752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/610 (61%), Positives = 469/610 (77%), Gaps = 11/610 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             +LTW D+WVTV D   G   IL+GLTG+A+PGE+LAIMGPSGCGKSTLLDALAGRL+   
Sbjct  47    WLTWPDVWVTVGDHEDGCVPILQGLTGFAQPGEVLAIMGPSGCGKSTLLDALAGRLDSKR  106

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             R SG IL+NGR + LAYGTSAYVTQ+D LT+TLTV+EAVY+SAQLQLP ++  SEKK+ A
Sbjct  107   RLSGQILVNGRKEPLAYGTSAYVTQDDVLTSTLTVKEAVYFSAQLQLPDTMTPSEKKQRA  166

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             E TIKEMGL DA  TRIGG       +G Q+RRVSIC+EILTRPKLLFLDEP+SGLDSAA
Sbjct  167   EATIKEMGLHDAAGTRIGGWGNKGLSNG-QRRRVSICMEILTRPKLLFLDEPTSGLDSAA  225

Query  763   SFYVMSKIMDLASE-GRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             S+YVM +I+ LA +   TV+AS+HQPS+EVF LF  LCLLS GR VYFGP+S A +FF  
Sbjct  226   SYYVMRRIVGLAKQHDMTVLASVHQPSSEVFGLFHKLCLLSQGRTVYFGPSSNAPEFFSL  285

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREV  1119
             NGF CP+LQNPSDH+L+TIN DFD   ED++ G      T+EVI +L  SYKS   YR +
Sbjct  286   NGFRCPSLQNPSDHYLRTINTDFD---EDIDPGLGGKPRTQEVIKVLAESYKSSSCYRHI  342

Query  1120  QGQVAEISKQEG-EVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGL  1296
             Q Q+ +I + +  EV +K SRA FFTQ +VLT RSF+NM+RDLGYYW+RL +YI +A+ L
Sbjct  343   QQQIEDIHEMDNKEVHEKESRACFFTQLLVLTTRSFMNMYRDLGYYWMRLLMYIVIALSL  402

Query  1297  GYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAF  1476
             G ++  +G    SIQAR S++ F+ASF T MAIGGFPSFVED+KVF++E LNGHYG  AF
Sbjct  403   GTVFYRIGSDYHSIQARGSLITFVASFLTIMAIGGFPSFVEDLKVFERERLNGHYGSDAF  462

Query  1477  AIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASL  1656
              +ANTLSS+P+LL+ISLIPG I Y+ VGL+ E  HF YF   +   M+LVESLMMI+AS+
Sbjct  463   VLANTLSSVPFLLMISLIPGAITYYLVGLRGELEHFLYFTTTLFACMMLVESLMMIVASV  522

Query  1657  VPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQG  1836
             VP++LMG+ AG+G+Q LMILGGG+FRLP DLPK+FWRYP+YY+ F+KYA+ GL+KNEF+G
Sbjct  523   VPSFLMGLTAGSGIQGLMILGGGFFRLPHDLPKVFWRYPLYYLSFNKYAFHGLFKNEFEG  582

Query  1837  LRLPEETG-----QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASE  2001
             L  P++         I+GE+VL++  QVE  ++KW DL +L  M +V R++F  V+K +E
Sbjct  583   LTFPKDLACSAQNGSISGEDVLKDIWQVETRYTKWTDLAILFEMALVYRLIFFGVLKTTE  642

Query  2002  KAKHVVKAVM  2031
               K +VK +M
Sbjct  643   TLKPIVKEIM  652



>emb|CDO97424.1| unnamed protein product [Coffea canephora]
Length=1141

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/607 (61%), Positives = 470/607 (77%), Gaps = 9/607 (1%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             FLTW+DLWV+V +G+KG KAIL+GLTGYARPGELLAIMGPSGCGKSTLLDALAGRL+  +
Sbjct  526   FLTWDDLWVSVPNGKKGCKAILQGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLDSIS  585

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             +Q G+IL+NGR Q LAYGTSAYVTQ++ LT TLT REAVYYSAQLQLP+++ ++EK + A
Sbjct  586   KQRGEILVNGRMQQLAYGTSAYVTQDNILTWTLTTREAVYYSAQLQLPNTMSKAEKIDRA  645

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             + TI+EMGLQ  ++TRIGG        G QKRRVSIC+E+LTRPKLLFLDEP+SGLDSAA
Sbjct  646   DRTIREMGLQSCIDTRIGGWGSKGLSGG-QKRRVSICIEMLTRPKLLFLDEPTSGLDSAA  704

Query  763   SFYVMSKIMDLASE-GRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             S+YVM++I++LA E G TV+AS+HQPSTEV +L  +LCLLS GR +YFGP+ AA QFF  
Sbjct  705   SYYVMNRIVELAKEYGMTVIASMHQPSTEVCNLLDNLCLLSLGRTIYFGPSFAASQFFTR  764

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREV  1119
             NGF CP LQNP+DH+++ IN DFD +  D+E        T E I+ LV+SY S   Y   
Sbjct  765   NGFSCPGLQNPADHYIRMINTDFD-EASDIESAAEGKTTTREAIDKLVDSYTSSDIYNLT  823

Query  1120  QGQVAEISKQEGEVL-KKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGL  1296
                VA+I+ Q+  V+ KK  RA FF Q +VLT RSF+NM+RDLGYYWLRL IYITLA GL
Sbjct  824   LSVVAQINGQQLRVMAKKRRRASFFMQCLVLTERSFVNMYRDLGYYWLRLAIYITLAFGL  883

Query  1297  GYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAF  1476
             G ++ +VG   +SI AR S+L F+AS  T ++IGGFPSFVE++KVF++E LNGHYG  AF
Sbjct  884   GTVFYNVGNSYNSINARASMLMFVASLLTLLSIGGFPSFVEEIKVFQRERLNGHYGVAAF  943

Query  1477  AIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASL  1656
              I+NT+SS+ +L LI++IPG+IAY+ VGL R    F YF +V+  +++LVE LMMI+ASL
Sbjct  944   VISNTVSSVLFLFLIAVIPGVIAYYLVGLHRGTERFLYFTMVLFASIVLVEGLMMIVASL  1003

Query  1657  VPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQG  1836
             VPN+LMG+I GAG Q +M+L GG+FRLP DLPK+FW+YPIYYI FH+YAYQGLYKNEF+G
Sbjct  1004  VPNFLMGLIIGAGTQGVMMLSGGFFRLPDDLPKIFWKYPIYYISFHRYAYQGLYKNEFEG  1063

Query  1837  LRLPEETGQI-----ITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASE  2001
             L+ P     +     I GE +LR+T QVE G+SKWIDL +L +M ++ R++F  ++K  E
Sbjct  1064  LKFPSNELMMGGSSPIDGETILRDTWQVERGYSKWIDLAILFLMVIIYRLLFFGIIKVRE  1123

Query  2002  KAKHVVK  2022
               K +VK
Sbjct  1124  SIKPLVK  1130


 Score =   454 bits (1167),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 237/412 (58%), Positives = 307/412 (75%), Gaps = 12/412 (3%)
 Frame = +1

Query  694   LEILTRPKLLFLDEPSSGLDSAASFYVMSKIMDLASE-GRTVVASIHQPSTEVfslftsl  870
             +EILTRPKLLFLDEP+SGLDSAA++ ++++I+ LA   G TVVAS+HQPS+E F L  +L
Sbjct  1     MEILTRPKLLFLDEPTSGLDSAAAYCIVNRIVRLARHYGMTVVASLHQPSSEAFKLLDNL  60

Query  871   cllssGRVVYFGPASAAIQFFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARG  1050
             CLL  GR +YFGPA AA  FF  NGFPCP LQNP+DH+L+ +N DF    ED++ G    
Sbjct  61    CLLCLGRTIYFGPAYAANHFFAVNGFPCPALQNPADHYLRMVNSDFS---EDIQYGAGGK  117

Query  1051  IPTEEVINILVNSYKSYHRYREVQGQVAEISKQE---GEVLKKSSRADFFTQSIVLTRRS  1221
               T E I++L  SY+S   Y+++  Q AE+ KQ    G + KK   A FF   ++L  RS
Sbjct  118   TTTREAIDMLAESYRSSDAYKDILRQAAEMDKQLQSIGTMEKKGCPASFFIHCLILIERS  177

Query  1222  FLNMFRDLGYYWLRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGG  1401
             FLNM+RD+GYYWLRLGIYI L  GLG ++++VG   SSI AR S+L F+AS  T MAIGG
Sbjct  178   FLNMYRDVGYYWLRLGIYIALGFGLGTVFHNVGNSYSSINARGSMLMFVASLLTIMAIGG  237

Query  1402  FPSFVEDMKVFKKETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGH  1581
             FPS VED+KVFK+E LNGHYG  AF ++NT+SSLP+LLLIS+IPG I+Y+ VGLQ+    
Sbjct  238   FPSVVEDIKVFKRERLNGHYGVAAFVVSNTVSSLPFLLLISMIPGAISYYLVGLQQGSDR  297

Query  1582  FAYFALVILMNMLLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLF  1761
             F YF +V++  ++LVE+L+MI+A++VPN+LMG+I GAGLQ LM+L GG+FRLP DLPK+F
Sbjct  298   FLYFIMVLIACLMLVETLVMIVATIVPNFLMGLITGAGLQGLMMLSGGFFRLPSDLPKIF  357

Query  1762  WRYPIYYIDFHKYAYQGLYKNEFQGLRLPEE-----TGQIITGEEVLRETLQ  1902
             W+YP+YYI FHKYAYQGLYKNEFQGL  P+      +  ++ GE +LR+  Q
Sbjct  358   WKYPMYYIAFHKYAYQGLYKNEFQGLAFPKNLLAGGSSNLVGGETILRDIWQ  409



>gb|KHN26507.1| ABC transporter G family member 11 [Glycine soja]
Length=685

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/621 (61%), Positives = 471/621 (76%), Gaps = 10/621 (2%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW+D+WVT S+ + GN +ILKGLTGYA+PG+LLAIMGPSGCGKSTLLD LAGRL   TR
Sbjct  58    LTWKDVWVTASNRKSGNISILKGLTGYAKPGQLLAIMGPSGCGKSTLLDTLAGRLGSNTR  117

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             Q+G+ILING  Q+LAYGTSAYVTQ+DTL  TLTVREAV+YSAQLQLP ++P+ EKKE A+
Sbjct  118   QTGEILINGHKQSLAYGTSAYVTQDDTLLTTLTVREAVHYSAQLQLPDTMPKEEKKERAD  177

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI+EMGLQDA+N RIGG        G QKRRV+IC+EILTRPKLLFLDEP+SGLDSAAS
Sbjct  178   FTIREMGLQDAINKRIGGWGCKGISGG-QKRRVNICIEILTRPKLLFLDEPTSGLDSAAS  236

Query  766   FYVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFE  936
             +YVM +I  LA      RTV+ASIHQPS+EVF  F +LCLLSSG+ VYFGPAS   +FF 
Sbjct  237   YYVMRRIATLAQNDLIQRTVIASIHQPSSEVFQFFNNLCLLSSGKAVYFGPASGVSEFFA  296

Query  937   TNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYRE  1116
             +NGFPCP L NPSDHFLKTINKDFD D E V+    R IPTEE I+ILVNSY S    +E
Sbjct  297   SNGFPCPVLMNPSDHFLKTINKDFDQDIE-VDISGNRKIPTEEAIHILVNSYISSEMNQE  355

Query  1117  VQGQVAEISKQE-GEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             VQ +VA +S ++   +  K   A F  Q +VLT+RSF+NM RDLGYYWLRL I++ LA+ 
Sbjct  356   VQNEVAALSTKDISSIDWKRGHAGFLNQCLVLTKRSFVNMRRDLGYYWLRLAIFVALAIA  415

Query  1294  LGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGA  1473
             L  ++ D+G    SIQ R S++AFI  F TFM IGGFPSFVE MKVF++E  NGHYG  A
Sbjct  416   LATIFYDLGTSYVSIQDRGSLVAFINGFLTFMTIGGFPSFVEVMKVFQRERQNGHYGVTA  475

Query  1474  FAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIAS  1653
             F I NTLSS+PYLLLI++IPG IAY+  GL     HF YF  V+  +++LVESLMMI+AS
Sbjct  476   FVIGNTLSSIPYLLLITIIPGAIAYYLPGLHNGCEHFLYFICVLFSSLMLVESLMMIVAS  535

Query  1654  LVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQ  1833
             +VPN+LMGI+ GAG+  +M+L GG+F+LP D+P   WRYP++++ FH +A +G++KNE++
Sbjct  536   VVPNFLMGIMTGAGILGIMLLLGGFFKLPHDIPIPVWRYPLHFVAFHTFANRGMFKNEYE  595

Query  1834  GLRLP--EETGQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKA  2007
             GLR    E  G  I+GEEVLR   QV+M +SKW+DL +L+ M  + RV+FL+++K  EK 
Sbjct  596   GLRFASNEVGGGYISGEEVLRYAWQVDMSYSKWVDLAILIGMIFLYRVLFLVIIKVKEKV  655

Query  2008  KHVVKAV--MRVSPKQSHQVV  2064
             + VV ++  M  S K++ QV+
Sbjct  656   RPVVVSLSCMSASSKRTIQVM  676



>gb|EEC84739.1| hypothetical protein OsI_31728 [Oryza sativa Indica Group]
Length=721

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/604 (59%), Positives = 439/604 (73%), Gaps = 20/604 (3%)
 Frame = +1

Query  133   AGGVSSMPKDKRPgggaeaakvdvgggggvFLTWEDLWVTVSDGRKGNKAILKGLTGYAR  312
              GGV+  P  +RP  G               L WEDLWV+ + G+ G   IL GL GYAR
Sbjct  82    GGGVAREPSLRRPDQGVV-------------LAWEDLWVSAAGGKSGRVPILCGLNGYAR  128

Query  313   PGELLAIMGPSGCGKSTLLDALAGRLELTTRQSGDILINGRTQTLAYGTSAYVTQEDTLT  492
             PGE+LAIMGPSGCGKSTLLDALAGRL  +  Q GDILINGR Q LA+GTSAYVTQ+D L 
Sbjct  129   PGEVLAIMGPSGCGKSTLLDALAGRLGSSVSQKGDILINGRRQALAFGTSAYVTQDDVLM  188

Query  493   ATLTVREAVYYSAQLQLPSSLPRSEKKEIAEMTIKEMGLQDAMNTRigggwgskgisggQ  672
              TLTVREAV YSAQLQLPS +  + K+E AE T++EMGL+ A +TRIGG        G Q
Sbjct  189   NTLTVREAVRYSAQLQLPSGMSAAAKRERAEETLREMGLEGAADTRIGGWAHKGISGG-Q  247

Query  673   KRRVSICLEILTRPKLLFLDEPSSGLDSAASFYVMSKIMDLAS-EGRTVVASIHQPSTEV  849
             +RRVSIC+EILTRP LLFLDEP+SGLDSAAS++V+S+I  +A  EG TVVA++HQPSTEV
Sbjct  248   RRRVSICMEILTRPALLFLDEPTSGLDSAASYHVVSRIARMARREGMTVVAAVHQPSTEV  307

Query  850   fslftslcllssGRVVYFGPASAAIQFFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDV  1029
             F LF  LCLL+ G+ V+FGPA+   QFF  +GFPCP+L NPSDHFL+TINKDFD D E+ 
Sbjct  308   FGLFHGLCLLAYGKTVFFGPAADTAQFFALSGFPCPSLMNPSDHFLRTINKDFDKDIEEG  367

Query  1030  EQGCARGIPTEEVINILVNSYKSYHRYREVQGQVAEISKQEGEVLKKSSRADFFTQSIVL  1209
               G  + + T + I+ LVNSYKS     +V   + +I    G V+KK  R  F TQ+ VL
Sbjct  368   MDG--KKMTTAQAIDTLVNSYKSSVHLEKVTHHIQDIRATGGAVVKKEERPSFLTQTWVL  425

Query  1210  TRRSFLNMFRDLGYYWLRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFM  1389
             T+RSF+NM+RDLGYYWLR  IYI L + +G +Y ++G+   SIQAR S+L F+A+F TFM
Sbjct  426   TKRSFVNMYRDLGYYWLRFAIYIALCLCVGTIYYNIGHSYGSIQARGSMLMFVAAFLTFM  485

Query  1390  AIGGFPSFVEDMKVFKKETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQR  1569
             AIGGFPSFVEDMK+F +E LNGHYG G+F IANTLS+ PYL LIS+ PG I Y+  GLQ 
Sbjct  486   AIGGFPSFVEDMKIFGRERLNGHYGVGSFVIANTLSATPYLALISVAPGAIGYYLTGLQS  545

Query  1570  EFGHFAYFALVILMNMLLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDL  1749
                HFAYFA+V+   M++VE LMMI+AS VP++LMGII GAG+Q +M+L GG+FRLP DL
Sbjct  546   SIDHFAYFAVVLFTTMMVVEGLMMIVASAVPDFLMGIITGAGIQGVMMLNGGFFRLPDDL  605

Query  1750  PKLFWRYPIYYIDFHKYAYQGLYKNEFQGLRLPEET---GQIITGEEVLRETLQVEMGHS  1920
             PK  W+YP+YYI FHKYA QG YKNEF GL  P         ITG E+LR+  QV++G+S
Sbjct  606   PKPVWKYPMYYIAFHKYANQGFYKNEFLGLTFPNNQAGGAATITGHEILRDYWQVQLGYS  665

Query  1921  KWID  1932
             KW+D
Sbjct  666   KWVD  669



>ref|NP_001063446.1| Os09g0472100 [Oryza sativa Japonica Group]
 dbj|BAD22237.1| putative ABC transporter [Oryza sativa Japonica Group]
 dbj|BAF25360.1| Os09g0472100 [Oryza sativa Japonica Group]
 gb|EEE69893.1| hypothetical protein OsJ_29719 [Oryza sativa Japonica Group]
Length=721

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/604 (59%), Positives = 439/604 (73%), Gaps = 20/604 (3%)
 Frame = +1

Query  133   AGGVSSMPKDKRPgggaeaakvdvgggggvFLTWEDLWVTVSDGRKGNKAILKGLTGYAR  312
              GGV+  P  +RP  G               L WEDLWV+ + G+ G   IL GL GYAR
Sbjct  82    GGGVAREPSLRRPDQGVV-------------LAWEDLWVSAAGGKSGRVPILCGLNGYAR  128

Query  313   PGELLAIMGPSGCGKSTLLDALAGRLELTTRQSGDILINGRTQTLAYGTSAYVTQEDTLT  492
             PGE+LAIMGPSGCGKSTLLDALAGRL  +  Q GDILINGR Q LA+GTSAYVTQ+D L 
Sbjct  129   PGEVLAIMGPSGCGKSTLLDALAGRLGSSVSQKGDILINGRRQALAFGTSAYVTQDDVLM  188

Query  493   ATLTVREAVYYSAQLQLPSSLPRSEKKEIAEMTIKEMGLQDAMNTRigggwgskgisggQ  672
              TLTVREAV YSAQLQLPS +  + K+E AE T++EMGL+ A +TRIGG        G Q
Sbjct  189   NTLTVREAVRYSAQLQLPSGMSAAAKRERAEETLREMGLEGAADTRIGGWAHKGISGG-Q  247

Query  673   KRRVSICLEILTRPKLLFLDEPSSGLDSAASFYVMSKIMDLAS-EGRTVVASIHQPSTEV  849
             +RRVSIC+EILTRP LLFLDEP+SGLDSAAS++V+S+I  +A  EG TVVA++HQPSTEV
Sbjct  248   RRRVSICMEILTRPALLFLDEPTSGLDSAASYHVVSRIARMARREGMTVVAAVHQPSTEV  307

Query  850   fslftslcllssGRVVYFGPASAAIQFFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDV  1029
             F LF  LCLL+ G+ V+FGPA+   QFF  +GFPCP+L NPSDHFL+TINKDFD D E+ 
Sbjct  308   FGLFHGLCLLAYGKTVFFGPAADTAQFFALSGFPCPSLMNPSDHFLRTINKDFDKDIEEG  367

Query  1030  EQGCARGIPTEEVINILVNSYKSYHRYREVQGQVAEISKQEGEVLKKSSRADFFTQSIVL  1209
               G  + + T + I+ LVNSYKS     +V   + +I    G V+KK  R  F TQ+ VL
Sbjct  368   MDG--KKMTTAQAIDTLVNSYKSSVHLEKVTHHIQDIRATGGAVVKKEERPSFLTQTWVL  425

Query  1210  TRRSFLNMFRDLGYYWLRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFM  1389
             T+RSF+NM+RDLGYYWLR  IYI L + +G +Y ++G+   SIQAR S+L F+A+F TFM
Sbjct  426   TKRSFVNMYRDLGYYWLRFAIYIALCLCVGTIYYNIGHSYGSIQARGSMLMFVAAFLTFM  485

Query  1390  AIGGFPSFVEDMKVFKKETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQR  1569
             AIGGFPSFVEDMK+F +E LNGHYG G+F IANTLS+ PYL LIS+ PG I Y+  GLQ 
Sbjct  486   AIGGFPSFVEDMKIFGRERLNGHYGVGSFVIANTLSATPYLALISVAPGAIGYYLTGLQS  545

Query  1570  EFGHFAYFALVILMNMLLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDL  1749
                HFAYFA+V+   M++VE LMMI+AS VP++LMGII GAG+Q +M+L GG+FRLP DL
Sbjct  546   SIDHFAYFAVVLFTTMMVVEGLMMIVASAVPDFLMGIITGAGIQGVMMLNGGFFRLPDDL  605

Query  1750  PKLFWRYPIYYIDFHKYAYQGLYKNEFQGLRLPEET---GQIITGEEVLRETLQVEMGHS  1920
             PK  W+YP+YYI FHKYA QG YKNEF GL  P         ITG E+LR+  QV++G+S
Sbjct  606   PKPVWKYPMYYIAFHKYANQGFYKNEFLGLTFPNNQAGGAATITGHEILRDYWQVQLGYS  665

Query  1921  KWID  1932
             KW+D
Sbjct  666   KWVD  669



>emb|CDP20625.1| unnamed protein product [Coffea canephora]
Length=572

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/544 (68%), Positives = 437/544 (80%), Gaps = 16/544 (3%)
 Frame = +1

Query  334   MGPSGCGKSTLLDALAGRLELTTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVRE  513
             MGPSGCGKSTLLDALAGRL+  T QSGDIL+NGR Q LAYGTSAYVTQ+D L ATLTV+E
Sbjct  1     MGPSGCGKSTLLDALAGRLDSNTGQSGDILVNGRRQALAYGTSAYVTQDDALIATLTVKE  60

Query  514   AVYYSAQLQLPSSLPRSEKKEIAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSIC  693
             AVYYSAQLQLP+S+P+SEKKE AEMTI+EMGLQDAMNTR  GGWG KG+SGGQKRR+SIC
Sbjct  61    AVYYSAQLQLPNSMPKSEKKERAEMTIREMGLQDAMNTR-VGGWGQKGLSGGQKRRLSIC  119

Query  694   LEILTRPKLLFLDEPSSGLDSAASFYVMSKIMDLASEGRTVVASIHQPSTEVfslftslc  873
             +EILTRPKLLFLDEP+SGLDSAAS+YVMS+I      G+T++ASIHQPS EVFSLF ++C
Sbjct  120   IEILTRPKLLFLDEPTSGLDSAASYYVMSRIAR-QRAGKTILASIHQPSAEVFSLFQNVC  178

Query  874   llssGRVVYFGPASAAIQFFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGI  1053
             LLSSGR +YFGP +AA  FF +NGFPCPTLQNPSDHFLKTIN DF   DED+E+G    +
Sbjct  179   LLSSGRTIYFGPTNAANGFFASNGFPCPTLQNPSDHFLKTINTDF---DEDIEEGSTGKM  235

Query  1054  PTEEVINILVNSYKSYHRYREVQGQVAEISKQEGEVL-KKSSRADFFTQSIVLTRRSFLN  1230
              TEEVI+IL+ SYKS   Y+EVQ QV EI  + GE L K+   A+F +Q  VLTRRS +N
Sbjct  236   RTEEVISILIESYKSSINYQEVQRQVDEICSENGEELEKRRDNANFISQCSVLTRRSSVN  295

Query  1231  MFRDLGYYWLRLGIYITLAVGLGYMYNDVGYGNS--SIQARCSVLAFIASFFTFMAIGGF  1404
             MFRDLGYYW+RL +Y  LA+G+G +Y DVG G S  SIQAR S+L F+ASF TFMAIGGF
Sbjct  296   MFRDLGYYWMRLVVYTVLALGIGTIYYDVGSGKSYNSIQARGSMLMFVASFLTFMAIGGF  355

Query  1405  PSFVEDMKVFKKETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQR-----  1569
             PSFVE+MKVF++E LNGHY   AF I N +S+LPYLLL+SLIPG IAY+  GL++     
Sbjct  356   PSFVEEMKVFQRERLNGHYDSSAFVIGNIVSALPYLLLVSLIPGSIAYYLAGLEKGVGPG  415

Query  1570  -EFGHFAYFALVILMNMLLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKD  1746
               F HF YF  ++ ++M+LVESLMMI+AS+VPN+LMGII GAG+Q LM+L GG+FR P D
Sbjct  416   EAFEHFIYFCTILFVSMMLVESLMMIVASVVPNFLMGIIVGAGIQGLMVLSGGFFRYPND  475

Query  1747  LPKLFWRYPIYYIDFHKYAYQGLYKNEFQGLRL--PEETGQIITGEEVLRETLQVEMGHS  1920
             LP  FW+YP+YYI FHKYAYQGLYK+EF+G     P E    ++GE +LR T QVEM +S
Sbjct  476   LPAPFWKYPLYYIAFHKYAYQGLYKSEFEGRTFCRPGENLPTLSGESILRNTWQVEMTYS  535

Query  1921  KWID  1932
             KW+D
Sbjct  536   KWVD  539



>ref|XP_009611611.1| PREDICTED: ABC transporter G family member 11-like isoform X2 
[Nicotiana tomentosiformis]
Length=633

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/620 (61%), Positives = 465/620 (75%), Gaps = 38/620 (6%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGN-KAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELT  399
             FLTW DLWVTVS+ + G+ K +L+GLTGYARP ELLAIMGPSGCGKSTLLDALAGRL+ +
Sbjct  25    FLTWNDLWVTVSNRKSGSCKNLLEGLTGYARPSELLAIMGPSGCGKSTLLDALAGRLDFS  84

Query  400   TRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEI  579
             TRQSGDILING  Q L+YGTSAYVTQ++TL ATLTV+EAVYYSAQLQLP S+ +SEK +I
Sbjct  85    TRQSGDILINGHKQELSYGTSAYVTQDETLLATLTVKEAVYYSAQLQLPDSMTKSEKIQI  144

Query  580   AEMTIKEMGLQDAMNTRigg-gwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDS  756
             AE TIKEMGLQDAMNTRIGG G   KGISGG+KRR+SIC+EILTRPKLLFLDEP+SGLDS
Sbjct  145   AEQTIKEMGLQDAMNTRIGGWGTKGKGISGGEKRRLSICMEILTRPKLLFLDEPTSGLDS  204

Query  757   AASFYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFE  936
             AAS+YVM+ I      GRT++ SIHQPS EVF+LF +LCL+SSGR VYFGPASAAI    
Sbjct  205   AASYYVMNGI-SRQRLGRTIITSIHQPSAEVFNLFHNLCLMSSGRTVYFGPASAAI----  259

Query  937   TNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYRE  1116
                                         ED+E G A   PTEEV+++L+NSYKS   Y +
Sbjct  260   ----------------------------EDIEHGLAGRKPTEEVVDLLINSYKSSEGYHK  291

Query  1117  VQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGL  1296
             +Q QV EI +Q GE+L+K S A+F TQS+VLTRRS +NMFRDLGYYW+R   Y+ +A+GL
Sbjct  292   IQNQVLEICQQGGEILEKRSHANFTTQSLVLTRRSSVNMFRDLGYYWMRFASYVVIALGL  351

Query  1297  GYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAF  1476
             G +Y +V     SI  R  ++AF+ SF TFM +GGFPSFVEDMKVF++E LNGHYGC AF
Sbjct  352   GSIYYNVDSSYGSIVERGLMVAFVVSFMTFMTVGGFPSFVEDMKVFQRENLNGHYGCCAF  411

Query  1477  AIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASL  1656
              I NTLSS+PYLLLISL+PG IAYF  G Q  FGHF YFALV+  +M++VESLM  +A++
Sbjct  412   VIGNTLSSMPYLLLISLVPGAIAYFLTGFQNGFGHFIYFALVLFTSMMIVESLMANVAAI  471

Query  1657  VPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQG  1836
             VPN+LMGI+ GAG+Q L IL GG+F+ P +LPK  W+YP+YY+ FHKYAYQG++KNEF G
Sbjct  472   VPNFLMGIVIGAGIQGLQILSGGFFQTPNELPKPIWKYPLYYLSFHKYAYQGMFKNEFDG  531

Query  1837  LRLPEE---TGQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKA  2007
             L   +        I+GE+VLR+  QVEM +SKWIDL +LV   +V R+VF L++K +EK 
Sbjct  532   LTFTDNLNGNNHTISGEDVLRDKWQVEMAYSKWIDLSILVGTLIVYRLVFFLIIKTNEKV  591

Query  2008  KHVVKAVMRVSPKQSHQVVA  2067
              H  KA   +   +S Q++ 
Sbjct  592   VHTRKASTSILSNRSRQIMG  611



>ref|XP_006661337.1| PREDICTED: ABC transporter G family member 11-like, partial [Oryza 
brachyantha]
Length=656

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/572 (62%), Positives = 429/572 (75%), Gaps = 6/572 (1%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             L WEDLWV+ + G+ G   IL GL GYARPGE LAIMGPSGCGKSTLLDALAGRL  +  
Sbjct  36    LAWEDLWVSAAGGKGGRVPILCGLNGYARPGEGLAIMGPSGCGKSTLLDALAGRLGSSVS  95

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             Q GDILINGR Q LA+GTSAYVTQ+D L  TLTVREAV YSAQLQLPS +  + K+E AE
Sbjct  96    QKGDILINGRRQALAFGTSAYVTQDDVLMNTLTVREAVRYSAQLQLPSGMTAAAKRERAE  155

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              T++EMGL+ A +TRIGG        G Q+RRVSIC+EILTRP LLFLDEP+SGLDSAAS
Sbjct  156   ETLREMGLEGAADTRIGGWAHKGISGG-QRRRVSICIEILTRPALLFLDEPTSGLDSAAS  214

Query  766   FYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETN  942
             ++V+S+I  +A  EG TVVA++HQPSTEVF +F  LCLL+ GR V+FGPA+   QFF  +
Sbjct  215   YHVVSRIARMARREGMTVVAAVHQPSTEVFGVFHGLCLLAYGRTVFFGPAADTNQFFAMS  274

Query  943   GFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREVQ  1122
             GFPCP+L NPSDHFL+TINKDFD D E+   G  + + T E I+ LVNSYKS     +V 
Sbjct  275   GFPCPSLMNPSDHFLRTINKDFDKDIEEGMDG--KKMTTAEAIDTLVNSYKSSVHLEKVT  332

Query  1123  GQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLGY  1302
               + +I    G V+KK  R  F TQ+ VLT+RSF+NM+RDLGYYWLR  IYI L + +G 
Sbjct  333   RHIQDIRATGGAVVKKEERPSFLTQTWVLTKRSFVNMYRDLGYYWLRFAIYIALCLCVGT  392

Query  1303  MYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFAI  1482
             +Y +VG+   SIQAR S+L F+A+F TFMAIGGFPSFVEDMK+F +E LNGHYG G+F I
Sbjct  393   IYYNVGHSYGSIQARGSMLMFVAAFLTFMAIGGFPSFVEDMKIFGRERLNGHYGVGSFVI  452

Query  1483  ANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLVP  1662
             ANTLS+ PYL LIS+ PG I Y+  GLQ    HFAYFA+V+   M++VE LMMI+AS VP
Sbjct  453   ANTLSATPYLALISVAPGAIGYYLTGLQSSADHFAYFAVVLFTTMMVVEGLMMIVASAVP  512

Query  1663  NYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGLR  1842
             ++LMGII GAG+Q +M+L GG+FRLP DLP   W+YP+YYI FHKYA QG YKNEF GL 
Sbjct  513   DFLMGIITGAGIQGVMMLNGGFFRLPNDLPNPVWKYPMYYIAFHKYANQGFYKNEFLGLT  572

Query  1843  LP--EETGQIITGEEVLRETLQVEMGHSKWID  1932
              P  +     ITG E+LR+  QV++G+SKW+D
Sbjct  573   FPSNQPGSGTITGHEILRDYWQVQLGYSKWVD  604



>ref|XP_007159122.1| hypothetical protein PHAVU_002G210500g [Phaseolus vulgaris]
 gb|ESW31116.1| hypothetical protein PHAVU_002G210500g [Phaseolus vulgaris]
Length=664

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/622 (60%), Positives = 469/622 (75%), Gaps = 13/622 (2%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW+D+WVT S+   G+K+IL+GLTGYA+PG+LLAIMGPSGCGKSTLLD LAGRL    R
Sbjct  40    LTWKDVWVTASNRNNGSKSILEGLTGYAKPGQLLAIMGPSGCGKSTLLDTLAGRLGSKMR  99

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             Q+G+ILING  Q L YGTSAYVTQ+DTL  TLTV EAV+YSAQLQLP ++ + EKKE A+
Sbjct  100   QTGEILINGHKQILTYGTSAYVTQDDTLLTTLTVGEAVHYSAQLQLPDTMSKQEKKERAD  159

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI+EMGLQDA+NTRIGG        G QKRRVSIC+EILTRPKLLFLDEP+SGLDSAAS
Sbjct  160   FTIREMGLQDAINTRIGGWGCKGISGG-QKRRVSICIEILTRPKLLFLDEPTSGLDSAAS  218

Query  766   FYVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFE  936
             +YVM +I  LA      RTV+ASIHQPS+EVF LF +LCLLSSG+ VYFGPASAA +FF 
Sbjct  219   YYVMKRIASLAQNDHIKRTVIASIHQPSSEVFQLFNNLCLLSSGKTVYFGPASAATEFFA  278

Query  937   TNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYRE  1116
             + GFP P+L NPSDH LKTINKDFD D E V    +R +PTEEVI+ILV+SYK+  R +E
Sbjct  279   SYGFPSPSLMNPSDHLLKTINKDFDQDIE-VGISGSRNLPTEEVIDILVSSYKNSERNQE  337

Query  1117  VQGQVAEISKQEGEVLK-KSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             VQ +VA +SK+    L  K   A F  Q   LT+RS +NM+RDLGYYWLR+ IY+ LA+ 
Sbjct  338   VQSEVALLSKKVTSSLDVKRRHAGFLNQCFSLTQRSSINMYRDLGYYWLRMAIYVVLAIS  397

Query  1294  LGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGA  1473
             L  ++ ++G    SI+ R S++AFI  F TFM IGGFPSFVE MKVF++E  NGHYG  A
Sbjct  398   LATVFYNLGTSYDSIKDRGSLIAFINGFLTFMTIGGFPSFVEVMKVFQRERENGHYGVSA  457

Query  1474  FAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIAS  1653
             F I NTLSS+P+L+L++LIPG+IAYF  GLQ    H  YF  V+  +++LVESLMMI+AS
Sbjct  458   FVIGNTLSSIPFLVLVTLIPGVIAYFLPGLQNGCEHIVYFICVLFSSLMLVESLMMIVAS  517

Query  1654  LVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQ  1833
             +VPNYLMGII GAG+Q +M+L  G+F+LP D+PK  W+YP++YI FH +A QG++KNE++
Sbjct  518   IVPNYLMGIITGAGIQGIMLLLSGFFKLPNDIPKPVWKYPLHYIAFHTFANQGMFKNEYE  577

Query  1834  GLRLPEETG----QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASE  2001
             GLR     G       TGEEVLR   QV+M +SKW+DL +L+ M V+ R++FL+++K  E
Sbjct  578   GLRFATNHGGASHTYTTGEEVLRNIWQVDMSYSKWVDLAILLGMIVLYRLLFLVIIKIQE  637

Query  2002  KAKHVVKAVMRVSPKQSHQVVA  2067
             K K     V+ +S K+S Q++A
Sbjct  638   KLKTF---VLSLSSKRSSQIMA  656



>ref|XP_010690527.1| PREDICTED: ABC transporter G family member 11-like [Beta vulgaris 
subsp. vulgaris]
Length=637

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/622 (60%), Positives = 484/622 (78%), Gaps = 10/622 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             +LTW+ LW TVS      K IL+ ++GYA PG++LAIMGPSGCGKSTLLDALAGRL++ T
Sbjct  13    YLTWDHLWATVSHKEDTKKNILEEVSGYACPGQVLAIMGPSGCGKSTLLDALAGRLDMNT  72

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             +QSG IL+NG  Q LAYGT AYVTQ+D L  TLT++E VYYS++LQLP+S+ ++EK++ A
Sbjct  73    KQSGQILVNGHKQALAYGTLAYVTQDDALVTTLTLQETVYYSSELQLPASMSKAEKRKRA  132

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             +  IKEMGLQ A+NTRIGG       SG ++RR+SIC+EILT PKLLFLDEP+SGLDSAA
Sbjct  133   DDCIKEMGLQKAINTRIGGWGSKGLSSG-ERRRLSICIEILTHPKLLFLDEPTSGLDSAA  191

Query  763   SFYVMSKIM-DLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             SFYVMS+I+ +   +GRT++ASIHQPS++VF LF +LCLLS+G+ VYFGPA  A +FF  
Sbjct  192   SFYVMSRIVGNERRKGRTIIASIHQPSSQVFRLFDNLCLLSAGKTVYFGPAKEANEFFAA  251

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDED--VEQGCARG-IPTEEVINILVNSYKSYHRY  1110
              G+PCPTLQNP+DHFL+ INKDFD+ D D  +E+GC      TEE +NIL+NSYKS   +
Sbjct  252   QGYPCPTLQNPADHFLELINKDFDDYDVDEDIEEGCLLDRKSTEENVNILLNSYKSSENF  311

Query  1111  REVQGQVAEISKQEGEVLKKSSR-ADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLA  1287
             + V+G +A+IS Q GE L+ + R A F TQ  VLTRRSF+NM+RDLGYYW R  +Y+ LA
Sbjct  312   QRVRGIIAKISNQNGERLETNKRHASFSTQCQVLTRRSFVNMYRDLGYYWARFLVYLILA  371

Query  1288  VGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGC  1467
              GLG ++ D+G   +SIQA+  +L F++SF TFM+IGGFPSFVEDMKVFK+E LNGHYG 
Sbjct  372   FGLGTIFYDLGSTYNSIQAKGWLLMFVSSFLTFMSIGGFPSFVEDMKVFKRERLNGHYGT  431

Query  1468  GAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMII  1647
              +F +ANTLSS+PYLLL+SLIPG I Y+  GL+R++  F YFA+V+   MLLVESLMMI+
Sbjct  432   TSFVVANTLSSMPYLLLVSLIPGAITYYLPGLKRDYPDFLYFAMVLFSCMLLVESLMMIV  491

Query  1648  ASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNE  1827
             AS+VPN+LMGII GAG+Q LMILG G+FRLP DLPK FW+YP+YYI F KYAYQGL+KNE
Sbjct  492   ASIVPNFLMGIIVGAGVQGLMILGAGFFRLPNDLPKPFWKYPLYYISFTKYAYQGLFKNE  551

Query  1828  FQGLRLPEETG----QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKA  1995
             FQGL +P   G     +I+G+ +L++  QVE  +SKW++L +L+ M V+ R++FL+++K 
Sbjct  552   FQGLEIPNNQGTSPPSMISGDVILKDIWQVETSYSKWVNLAILLGMVVLYRLLFLIIIKL  611

Query  1996  SEKAKHVVKAVMRVSPKQSHQV  2061
             SE  K  +KA++  S +Q  QV
Sbjct  612   SETLKPAIKALVMRSSRQIMQV  633



>dbj|BAJ94888.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=734

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/617 (61%), Positives = 460/617 (75%), Gaps = 8/617 (1%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             L+WEDL V+ + G+ G   IL+GL+GYARPGE+LAIMGPSGCGKSTLLDALAGRL     
Sbjct  110   LSWEDLSVSAAGGKAGRVPILRGLSGYARPGEVLAIMGPSGCGKSTLLDALAGRLGSGVS  169

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             Q GDILINGR Q L+YGTSAYVTQ+D L  TLTVREAV YSA LQLPS +  + K+E AE
Sbjct  170   QKGDILINGRRQKLSYGTSAYVTQDDVLMTTLTVREAVRYSASLQLPSGMSAAAKRERAE  229

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              T++EMGL+ A +TRIGG        G Q+RRVSIC+EILTRP LLFLDEP+SGLDSAAS
Sbjct  230   ETLREMGLEGAADTRIGGWMHKGISGG-QRRRVSICMEILTRPALLFLDEPTSGLDSAAS  288

Query  766   FYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETN  942
             F+V+S+I  LA  EG TVVA++HQPSTEVF LF  LCLL+ G+ V+FGPA+   QFF  +
Sbjct  289   FHVVSRIARLARREGMTVVAAVHQPSTEVFGLFHGLCLLAYGKTVFFGPAAETNQFFALS  348

Query  943   GFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREVQ  1122
             GFPCP+L NPSDHFL+TINKDFDND E+   G  +   T E I+ L +SYKS     +V 
Sbjct  349   GFPCPSLMNPSDHFLRTINKDFDNDIEEGLSG--KKTTTAENIDALASSYKSSVHMDKVT  406

Query  1123  GQVAEISKQEGEVLK-KSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLG  1299
              Q+ +I    G+V+K    +  F TQS VLT+RSF+NM+RDLGYYWLR  IYI L +  G
Sbjct  407   RQIVDIRGIGGDVVKMDGQQPSFLTQSFVLTKRSFINMYRDLGYYWLRFAIYIALCLCCG  466

Query  1300  YMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFA  1479
              ++ D+G    SIQAR S+L F+ +F TFMAIGGFPSFVEDMK+F +E LNGHYG  +F 
Sbjct  467   TIFYDIGQNYGSIQARGSMLMFVGAFLTFMAIGGFPSFVEDMKIFGRERLNGHYGVSSFV  526

Query  1480  IANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLV  1659
             IANT+SS PYLLLISL+PG +AY+ VGLQ+ F HFAYFALV+ + M+LVE LMMI+AS+V
Sbjct  527   IANTVSSTPYLLLISLVPGAMAYYLVGLQKSFDHFAYFALVLFVTMMLVEGLMMIVASVV  586

Query  1660  PNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGL  1839
             P++LMGII GAG+Q +M+L GG+FRLP DLP   WRYP+YY+ FHKYA QG YKNEF GL
Sbjct  587   PDFLMGIITGAGIQGVMMLNGGFFRLPHDLPNPVWRYPMYYVAFHKYANQGFYKNEFLGL  646

Query  1840  RLPEET---GQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAK  2010
               P         ITG+E+LR+  QVEMG+SKW+DL VL  M ++ RV+FL ++K +EK K
Sbjct  647   TFPNNQVGGATTITGDEILRDYWQVEMGYSKWVDLAVLFGMVILYRVLFLAIMKLTEKVK  706

Query  2011  HVVKAVMRVSPKQSHQV  2061
              +VK +   S + S  V
Sbjct  707   PMVKGLGSRSTQPSVHV  723



>ref|XP_002300188.2| hypothetical protein POPTR_0001s31890g [Populus trichocarpa]
 gb|EEE84993.2| hypothetical protein POPTR_0001s31890g [Populus trichocarpa]
Length=611

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/597 (63%), Positives = 456/597 (76%), Gaps = 21/597 (4%)
 Frame = +1

Query  334   MGPSGCGKSTLLDALAGRLELTTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVRE  513
             MGPSGCGKSTLLD LAGRL   TRQ+GDILING  Q LAYGTSAYVTQ++TL  TLTV+E
Sbjct  1     MGPSGCGKSTLLDTLAGRLGSNTRQTGDILINGHKQRLAYGTSAYVTQDETLITTLTVKE  60

Query  514   AVYYSAQLQLPSSLPRSEKKEIAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSIC  693
             AVYYSAQLQLP S+ R+EKKE AE+TI+EMGLQDAMNTRIGG        G QKRRVSIC
Sbjct  61    AVYYSAQLQLPDSMSRAEKKERAEVTIREMGLQDAMNTRIGGWGSKGLSGG-QKRRVSIC  119

Query  694   LEILTRPKLLFLDEPSSGLDSAASFYVMSKIM--DLASEGR-TVVASIHQPSTEVfslft  864
             +EILT PKLLFLDEP+SGLDSAAS+YVMS I+  D   E R TV+ASIHQPS EVF LF 
Sbjct  120   IEILTHPKLLFLDEPTSGLDSAASYYVMSGIVRFDRKDENRRTVIASIHQPSGEVFQLFD  179

Query  865   slcllssGRVVYFGPASAAIQFFETNGFPCPTLQNPSDHFLKTINKDFDNDD--------  1020
             SLCLLS+G+VVYFGPAS A +FF  NGFPCPTLQNPSDHFLKTINKDF+           
Sbjct  180   SLCLLSAGKVVYFGPASQANEFFALNGFPCPTLQNPSDHFLKTINKDFETVCFLIQCLAL  239

Query  1021  ----EDVEQGCARGIPTEEVINILVNSYKSYHRYREVQGQVAEISK--QEGEVLKKSSRA  1182
                  D EQG    I  E  IN L  +YKS   Y++V+  V EI +  Q+   L++ S +
Sbjct  240   RYLWLDPEQGLEDAITAEVAINTLTKAYKSSDHYQKVKRLVTEIFRWIQDCGTLEERSHS  299

Query  1183  DFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLA  1362
              F TQ +VLTRRSF+NM+RDLGYYWLR+ IY++LA+GL  ++ ++G  N SIQ R S+L 
Sbjct  300   SFLTQCLVLTRRSFVNMYRDLGYYWLRVAIYVSLALGLATLFYNLGSDNDSIQDRGSLLM  359

Query  1363  FIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFAIANTlsslpylllislipGMI  1542
             FIASF TFM IGGFPSFVEDMKVF++E LNGHYG  AF + NT S+ PYLLLIS+IPG I
Sbjct  360   FIASFLTFMTIGGFPSFVEDMKVFERERLNGHYGATAFVLGNTFSAFPYLLLISVIPGAI  419

Query  1543  AYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLVPNYLMGIIAGAGLQALMILGG  1722
              Y+  GL + + HF YF LV+   M+LVESLMM +AS+VPN+LMGII GAG+QA MILGG
Sbjct  420   TYYLPGLHKGYEHFIYFVLVLFACMMLVESLMMTVASMVPNFLMGIITGAGIQAFMILGG  479

Query  1723  GYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGLRLP-EETG--QIITGEEVLRE  1893
             G+FRLP DLP+ FW+YP+YYI FHKYAYQG++KNEF+GL  P  +TG  + I GE++LR+
Sbjct  480   GFFRLPNDLPQPFWKYPMYYIAFHKYAYQGMFKNEFEGLTFPSNQTGGPRTIPGEQILRD  539

Query  1894  TLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAKHVVKAVMRVSPKQSHQVV  2064
               QVEMG SKW+DL +L+ M V+ R++FL+++K SEK K ++ A++ V PKQ+ +++
Sbjct  540   RWQVEMGVSKWVDLAILLGMVVLYRILFLVIIKTSEKIKPIIAAIVSVPPKQTTEIM  596



>emb|CBI34071.3| unnamed protein product [Vitis vinifera]
Length=1309

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/547 (67%), Positives = 442/547 (81%), Gaps = 9/547 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             +LTWE+LWVTVS+G+ G+++IL+ LTGYARPGE+LAIMGPSGCGKSTLLDALAGRLE   
Sbjct  57    YLTWENLWVTVSNGKGGSRSILQDLTGYARPGEVLAIMGPSGCGKSTLLDALAGRLE--A  114

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
              QSG IL+NGR QTLAYGTSAYVTQ+DTL  TLTV EAVYYSAQLQLP S+ + EKKE A
Sbjct  115   NQSGSILVNGRKQTLAYGTSAYVTQDDTLLTTLTVGEAVYYSAQLQLPDSMSKQEKKERA  174

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             +MTIKEMGLQD++NTRIGG        G QKRRVSIC+EILT P LLFLDEP+SGLDSAA
Sbjct  175   DMTIKEMGLQDSINTRIGGWGAKGISGG-QKRRVSICVEILTHPNLLFLDEPTSGLDSAA  233

Query  763   SFYVMSKIMDLA-SEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             S+YVMS+I       GRT++ SIHQPS+EVF+LF +LCLLSSGR VYFGPA AA + F  
Sbjct  234   SYYVMSRIAGPDFRHGRTIITSIHQPSSEVFALFDNLCLLSSGRTVYFGPARAANELFSR  293

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREV  1119
             NGFPCPTLQNPSDHFLKTINKDF+   ED+EQG     P EEVI+IL+ +YKS    ++V
Sbjct  294   NGFPCPTLQNPSDHFLKTINKDFE---EDIEQGLGGKKPKEEVIDILIKAYKSSGSCQQV  350

Query  1120  QGQVAEISKQEGEVLKKSSR--ADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             Q QV EI KQEG+   + SR  A F  Q ++LT+RS++NM RDLGYYW+RLG+YI ++  
Sbjct  351   QAQVTEICKQEGDQALQKSRDHAGFVNQCLILTKRSYVNMSRDLGYYWMRLGVYIMVSFA  410

Query  1294  LGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGA  1473
             LG ++ D+G+ NSSIQ R S+L F+ASF TFM+IGGFPSFVEDMKVF +E LNGHYG GA
Sbjct  411   LGTIFYDLGFSNSSIQDRGSMLMFVASFLTFMSIGGFPSFVEDMKVFGRERLNGHYGTGA  470

Query  1474  FAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIAS  1653
             F + NTLSS+P+LLLISLIPG IAY+  GLQ+   +F Y+ALV+   M+LVES+MMI+AS
Sbjct  471   FVVGNTLSSVPFLLLISLIPGAIAYYLAGLQKGCEYFIYYALVLFACMMLVESIMMIVAS  530

Query  1654  LVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQ  1833
             LVPN+L+GII GAG+Q L+IL GG+FRLP +LP + WRYP+YY+ F++YAYQG+YKNEF 
Sbjct  531   LVPNFLVGIITGAGIQGLLILSGGFFRLPDNLPNILWRYPLYYVSFNRYAYQGMYKNEFT  590

Query  1834  GLRLPEE  1854
             GL  P +
Sbjct  591   GLTFPGD  597


 Score =   679 bits (1752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/540 (67%), Positives = 432/540 (80%), Gaps = 5/540 (1%)
 Frame = +1

Query  238   DLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTRQSGD  417
             DL VT S+G+ G++ +L+GLTG+ARPGE+LAIMGPSGCGKSTLLDALAGRL     QSG 
Sbjct  756   DLSVTASNGKGGSRLLLQGLTGFARPGEVLAIMGPSGCGKSTLLDALAGRLGSNISQSGM  815

Query  418   ILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAEMTIK  597
             +L+NG  QTLAYGTSAYVTQ+DTL  TLTV EAV YSA LQLP S+ +SEKKE A+MTI+
Sbjct  816   VLVNGHQQTLAYGTSAYVTQDDTLITTLTVGEAVCYSALLQLPDSMSKSEKKERADMTIR  875

Query  598   EMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAASFYVM  777
             EMGLQDA+NTRIGG        G QKRRVSIC+EILT PKLLFLDEP+SGLDSAAS+YVM
Sbjct  876   EMGLQDAVNTRIGGWGVKGISGG-QKRRVSICIEILTHPKLLFLDEPTSGLDSAASYYVM  934

Query  778   SKIMDLASE-GRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNGFPC  954
             S+I  L  + GRT++ SIHQPS EVF+LF +LCLLSSGR VYFGPA AA +FF +NGFPC
Sbjct  935   SRITGLDRQHGRTIITSIHQPSCEVFALFDNLCLLSSGRTVYFGPAHAADEFFSSNGFPC  994

Query  955   PTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREVQGQVA  1134
             PT QNPSDHFLKTINKDF+   +D+EQG       EE I+IL  +YKS   +++VQ QVA
Sbjct  995   PTHQNPSDHFLKTINKDFE---QDIEQGFGGKKSKEEAIDILTKAYKSSGNFQQVQSQVA  1051

Query  1135  EISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLGYMYND  1314
             +I K+EG  LKK S A F  Q +VLTRRSF+NM+RDLGYYWLRL +YI L + LG ++ +
Sbjct  1052  KIHKKEGGALKKRSHASFLNQCLVLTRRSFVNMYRDLGYYWLRLAVYIALTIALGTIFYN  1111

Query  1315  VGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFAIANTl  1494
             VG+ NSSI+ R ++L ++ASF TFM IGGFPSFVEDMKVF +E LNGHYG  AF + NTL
Sbjct  1112  VGHSNSSIKDRGAMLMYVASFLTFMTIGGFPSFVEDMKVFGRERLNGHYGSSAFVVGNTL  1171

Query  1495  sslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLVPNYLM  1674
             SS+PYLL+ISLIPG IAY+  GLQ+   H  Y+ALV+   M+LVE LMMI+AS+VPN+LM
Sbjct  1172  SSIPYLLVISLIPGAIAYYLTGLQKGCEHSIYYALVLFTCMILVEGLMMIVASIVPNFLM  1231

Query  1675  GIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGLRLPEE  1854
             GII GAG+Q L++L GG+FRLP D PK FWRYP+YY+ F+KYAYQGLYKNEFQGL+ P +
Sbjct  1232  GIITGAGIQGLLMLSGGFFRLPDDFPKPFWRYPLYYLSFNKYAYQGLYKNEFQGLKFPND  1291



>ref|XP_003541427.1| PREDICTED: ABC transporter G family member 11-like [Glycine max]
Length=693

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/604 (63%), Positives = 465/604 (77%), Gaps = 8/604 (1%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             L+W+D+ VT S G+ G+K+IL+GLTGYA+PG+LLAIMGPSGCGKSTLLD LAGRL   TR
Sbjct  60    LSWKDVRVTASVGKNGSKSILEGLTGYAKPGQLLAIMGPSGCGKSTLLDTLAGRLGSNTR  119

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             Q+G+ILING+ Q LAYGTSAYVTQ+DTL  TLTV EAV+YSAQLQLP ++P+ EKKE A+
Sbjct  120   QTGEILINGKKQALAYGTSAYVTQDDTLLTTLTVGEAVHYSAQLQLPDTMPKEEKKERAD  179

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI+EMGLQDA+NTRIGG        G QKRRVSIC+EILTRP LLFLDEP+SGLDSAAS
Sbjct  180   FTIREMGLQDAINTRIGGWGVKGISGG-QKRRVSICIEILTRPGLLFLDEPTSGLDSAAS  238

Query  766   FYVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFE  936
             +YVM +I  L  +    RTVVASIHQPS+EVF LF +LCLLSSGR VYFGPASAA +FF 
Sbjct  239   YYVMKRIATLDKKDDVHRTVVASIHQPSSEVFQLFDNLCLLSSGRTVYFGPASAAKEFFA  298

Query  937   TNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYRE  1116
             +NGFPCP L NPSDH LKTINKDFD D E +  G    IPTEE I ILV+SYKS     E
Sbjct  299   SNGFPCPPLMNPSDHLLKTINKDFDQDTE-LNLGGTVTIPTEEAIRILVDSYKSSEMNHE  357

Query  1117  VQGQVAEIS-KQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             VQ +VA ++ K      KK   A F  Q   LT+RS +NM+RDLGYYWLRL IYI LA+ 
Sbjct  358   VQKEVAVLTEKNTSSTNKKRRHAGFLNQCFALTKRSSINMYRDLGYYWLRLAIYIALAIS  417

Query  1294  LGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGA  1473
             L  ++ D+G    SIQ R S L F++SF TFM IGGFPSFVEDMKVF++E LNGHY   A
Sbjct  418   LATIFYDLGTSYRSIQDRGSFLMFVSSFMTFMTIGGFPSFVEDMKVFERERLNGHYSVTA  477

Query  1474  FAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIAS  1653
             F I NT S++PYLLL+S+IPG IAY+  GLQ++F HF YF  V+   ++LVESLMMI+AS
Sbjct  478   FVIGNTFSAIPYLLLVSIIPGAIAYYLPGLQKDFEHFVYFICVLFACLMLVESLMMIVAS  537

Query  1654  LVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQ  1833
             +VPN+LMGII GAG+Q +MI+GGG+FRLP DLP+ FW+YP++Y+ FH+YAYQGL+KNEF+
Sbjct  538   IVPNFLMGIITGAGIQGIMIIGGGFFRLPNDLPRPFWKYPMFYVAFHRYAYQGLFKNEFE  597

Query  1834  GLRLPEET--GQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKA  2007
             GLR       G  I+GEE+LR+  QV M +SKW DL +L+ M ++ RV+FL+ +K +EK 
Sbjct  598   GLRFATNNVGGGYISGEEILRDMWQVNMSYSKWFDLGILLGMIILYRVLFLINIKTTEKL  657

Query  2008  KHVV  2019
             K ++
Sbjct  658   KPII  661



>ref|XP_002460384.1| hypothetical protein SORBIDRAFT_02g027350 [Sorghum bicolor]
 gb|EER96905.1| hypothetical protein SORBIDRAFT_02g027350 [Sorghum bicolor]
Length=729

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/604 (60%), Positives = 453/604 (75%), Gaps = 11/604 (2%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             ++WEDLWV+ + G+ G   IL GL GYARPGE+LAIMGPSGCGKSTLLDALAGRL     
Sbjct  113   ISWEDLWVSAAGGKGGRVPILCGLNGYARPGEVLAIMGPSGCGKSTLLDALAGRLGSNVS  172

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             Q GDILINGR Q LAYGTS     +D L  TLTVREAV+YSAQLQLPS++  S K+E AE
Sbjct  173   QKGDILINGRRQKLAYGTS-----DDVLMTTLTVREAVHYSAQLQLPSAMAASAKRERAE  227

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              T++EMGL+ A +TRIGG        G Q+RRVSIC+EILTRP LLFLDEP+SGLDSAAS
Sbjct  228   ETLREMGLEAAADTRIGGWMHKGISGG-QRRRVSICMEILTRPALLFLDEPTSGLDSAAS  286

Query  766   FYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETN  942
             ++V+ +I  LA  EG TVVA++HQPSTEV+ LF  LCLL+ GR V+FGPA+   QFF  +
Sbjct  287   YHVVGRIARLARREGMTVVAAVHQPSTEVYGLFHGLCLLAYGRTVFFGPAAETNQFFALS  346

Query  943   GFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREVQ  1122
             GFPCP+L NPSDHFL+TINKDFD D E+   G  + + T E I+ LVNSYK+     +V 
Sbjct  347   GFPCPSLMNPSDHFLRTINKDFDKDIEEGLNGEIK-MTTAEAIDTLVNSYKASAYMEKVT  405

Query  1123  GQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLGY  1302
              Q+A+I +  G V+KK     F TQS+VLT+RSF+NM+RDLGYYWLR  IYI L + +G 
Sbjct  406   RQIADIRENGGAVVKKEWHTSFLTQSLVLTKRSFVNMYRDLGYYWLRFAIYIMLCLCVGT  465

Query  1303  MYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFAI  1482
             ++ D+G+   SI AR S+L F+A+F TFMAIGGFPSFVEDMK+F +E LNGHYG  +F I
Sbjct  466   VFYDIGHSYGSILARGSLLNFVAAFLTFMAIGGFPSFVEDMKIFGRERLNGHYGASSFTI  525

Query  1483  ANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLVP  1662
             ANT+S+ PYL LIS++PG IAY+ VGLQ  FGHFAYFALV+   M++VE LMMI+AS VP
Sbjct  526   ANTVSAAPYLALISVVPGAIAYYLVGLQSSFGHFAYFALVLFTTMMVVEGLMMIVASAVP  585

Query  1663  NYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGLR  1842
             ++LMGII GAG+Q +M+L GG+FRLP DLPK  WRYP+YY+ FHKYA QGLYKNEF GL 
Sbjct  586   DFLMGIITGAGIQGVMMLNGGFFRLPNDLPKPVWRYPMYYVAFHKYANQGLYKNEFLGLT  645

Query  1843  LPEET---GQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAKH  2013
              P         ++G ++L +  QVEMG+SKW+DL +L  M V+ RV+FL +VK +EK K 
Sbjct  646   FPNNQAGGAATVSGGQILTDFWQVEMGYSKWVDLGILCGMVVLYRVLFLAIVKLTEKVKP  705

Query  2014  VVKA  2025
             ++K 
Sbjct  706   MIKG  709



>emb|CAN82969.1| hypothetical protein VITISV_013416 [Vitis vinifera]
Length=658

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/670 (58%), Positives = 480/670 (72%), Gaps = 48/670 (7%)
 Frame = +1

Query  70    DSRIRQCDSNRINIVPLDMETAGGVSSMPKDKRPgggaeaakvdvgggggvFLTWEDLWV  249
             DS   Q  +  I   PL+MET            P          V   GG+FLTWEDL V
Sbjct  17    DSAYLQSQNKPITRGPLEMETV-----------PRPRPREVLGGVDKEGGIFLTWEDLSV  65

Query  250   TVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTRQSGDILIN  429
             T S+G+ G++ +L+GLTG+ARPGE+LAIMGPSGCGKSTLLDALAGRL     QSG +L+N
Sbjct  66    TASNGKGGSRLLLQGLTGFARPGEVLAIMGPSGCGKSTLLDALAGRLGSNISQSGMVLVN  125

Query  430   GRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAEMTIKEMGL  609
             G  QTLAYGTSAYVTQ+DTL  TLTV EAVYYSA LQLP S+ +SEKKE A+MTI+EMGL
Sbjct  126   GHQQTLAYGTSAYVTQDDTLITTLTVGEAVYYSALLQLPDSMSKSEKKERADMTIREMGL  185

Query  610   QDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAASFYVMSKIM  789
             QDA+NTRIGG        G QKRRVSIC+EILT PKLLFLDEP+SGLDSAAS+YVMS+I 
Sbjct  186   QDAVNTRIGGWGVKGISGG-QKRRVSICIEILTHPKLLFLDEPTSGLDSAASYYVMSRIT  244

Query  790   DLASE-GRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNGFPCPTLQ  966
              L  + GRT++ SIHQPS EVF+LF +LCLLSSGR VYFGPA AA               
Sbjct  245   GLDRQHGRTIITSIHQPSCEVFALFDNLCLLSSGRTVYFGPAHAA---------------  289

Query  967   NPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREVQGQVAEISK  1146
                              DED+EQG       EE I+IL  +YKS   +++VQ QVA+I +
Sbjct  290   -----------------DEDIEQGFGGKKSKEEAIDILTKAYKSSGNFQQVQSQVAKIYR  332

Query  1147  QEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLGYMYNDVGYG  1326
             +EG  LKK S A F  Q +VLTRRSF+NM+RDLGYYWLRL +Y+ L + LG ++ +VG+ 
Sbjct  333   KEGGALKKRSHASFLNQCLVLTRRSFVNMYRDLGYYWLRLAVYVALTIALGTIFYNVGHS  392

Query  1327  NSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFAIANTlsslp  1506
             NSSI+ R ++L ++ASF TFM IGGFPSFVEDMKVF +E LNGHYG  AF + NTLSS+P
Sbjct  393   NSSIKDRGAMLMYVASFLTFMTIGGFPSFVEDMKVFGRERLNGHYGSSAFVVGNTLSSIP  452

Query  1507  ylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLVPNYLMGIIA  1686
             YLL+ISLIPG IAY+  GLQ+   H  Y+ALV+   M+LVE LMMI+AS+VPN+LMGII 
Sbjct  453   YLLVISLIPGAIAYYLTGLQKGCEHXIYYALVLFTCMILVEGLMMIVASIVPNFLMGIIT  512

Query  1687  GAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGLRLP-EETG-  1860
             GAG+Q L+ L GG+FRLP D PK FWRYP+YY+ F+KYAYQGLYKNEFQGL+ P +E G 
Sbjct  513   GAGIQGLLXLSGGFFRLPDDFPKPFWRYPLYYLSFNKYAYQGLYKNEFQGLKFPNDEAGG  572

Query  1861  -QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAKHVVKAVMRV  2037
               II+GEE+LR+  QVEM +SKWIDL +L+ M V+ R++FL+ +K +EK   +VKA++  
Sbjct  573   PPIISGEEILRKRWQVEMVYSKWIDLAILLGMAVLYRLLFLITIKTTEKVIPLVKALVSR  632

Query  2038  SPKQSHQVVA  2067
               K+S QV+A
Sbjct  633   PSKRSKQVMA  642



>ref|XP_010106269.1| ABC transporter G family member 11 [Morus notabilis]
 gb|EXC09686.1| ABC transporter G family member 11 [Morus notabilis]
Length=671

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/633 (59%), Positives = 456/633 (72%), Gaps = 40/633 (6%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGN----KAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLE  393
             LTWEDL V+V +G+K +    K IL+GLTGYA PGE+LAIMGPSG GKSTLLD LAGRL 
Sbjct  52    LTWEDLGVSV-EGKKSSSNRKKVILEGLTGYAEPGEVLAIMGPSGSGKSTLLDTLAGRLS  110

Query  394   LTTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKK  573
                +Q+G+ILINGR +TLAYGTSAYVTQ+DTL  TLTVRE VYYSA LQLP S+ RSEKK
Sbjct  111   SNAKQTGEILINGRKETLAYGTSAYVTQDDTLMTTLTVRETVYYSALLQLPDSMSRSEKK  170

Query  574   EIAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLD  753
             E AE TI+EMGLQ +M+TRIGG        G QKRRVSIC+EILTRPKLLFLDEP+SGLD
Sbjct  171   ERAETTIREMGLQSSMDTRIGGWSVKGLSGG-QKRRVSICIEILTRPKLLFLDEPTSGLD  229

Query  754   SAASFYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQF  930
             SAAS++VMS+I+ LA  +GRT+         +  S                        F
Sbjct  230   SAASYHVMSRIVKLARRDGRTISRLFINQVVKFSSSSIISAFSPL--------------F  275

Query  931   FETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRY  1110
             F +NGFPCP+L+NPSDH+L+TINKDFD    D+E G      TEE INILV SYKS    
Sbjct  276   FASNGFPCPSLRNPSDHYLRTINKDFD---ADIEHGFGAKTSTEEAINILVKSYKSSETS  332

Query  1111  REVQGQVAEISKQEGEVL-KKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLA  1287
              +V+ +V+EI +++G  L KK  +A F TQ +VLT+RSF+NM+RDLGYYWLRL IYI L 
Sbjct  333   EQVKRRVSEICQRKGRALEKKGGQASFITQCVVLTKRSFVNMYRDLGYYWLRLAIYIALC  392

Query  1288  VGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMK------------V  1431
             + +G ++ D+G    SIQAR S+L F+A+F TFMAIGGFPSFVEDMK            +
Sbjct  393   LCVGTIFYDIGKTYGSIQARGSMLMFVAAFLTFMAIGGFPSFVEDMKLSELEEETNKTHI  452

Query  1432  FKKETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILM  1611
             F +E LNGHYG  AF + NT SS+P+LLLISL+PG IAY+ VGLQ+ F HFAYFA+V+ M
Sbjct  453   FGRERLNGHYGVAAFVVGNTYSSIPFLLLISLVPGAIAYYLVGLQKGFEHFAYFAVVLFM  512

Query  1612  NMLLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDF  1791
              M+LVESLMMI+AS+VP++LMGII GAG+Q +M+L GG+FRLP DLPK FWRYP+YYI F
Sbjct  513   AMMLVESLMMIVASMVPDFLMGIITGAGIQGVMMLNGGFFRLPDDLPKPFWRYPMYYIAF  572

Query  1792  HKYAYQGLYKNEFQGLRLPEETG---QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvv  1962
             HKYA QG YKNEF+GL  P E      +ITGEE+LR   QVEMG+SKW+D+ +L  M VV
Sbjct  573   HKYANQGFYKNEFEGLVFPNEQAGGRALITGEEILRSVWQVEMGYSKWVDVAILFGMVVV  632

Query  1963  crvvfllvvKASEKAKHVVKAVMRVSPKQSHQV  2061
              R++FL ++KA EK K +++    V  K S  +
Sbjct  633   YRLMFLGILKAVEKVKPIIRGFSVVRSKHSKHI  665



>ref|XP_009387395.1| PREDICTED: ABC transporter G family member 11-like [Musa acuminata 
subsp. malaccensis]
Length=587

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/581 (63%), Positives = 443/581 (76%), Gaps = 7/581 (1%)
 Frame = +1

Query  334   MGPSGCGKSTLLDALAGRLELTTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVRE  513
             MGPSGCGKSTLLDALAGRL     Q GDILING+ Q LA+G+SAYVTQ+D L  TLTVRE
Sbjct  1     MGPSGCGKSTLLDALAGRLGSGVSQKGDILINGQRQKLAFGSSAYVTQDDVLMTTLTVRE  60

Query  514   AVYYSAQLQLPSSLPRSEKKEIAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSIC  693
             AVYYSAQLQLP S+ RSEK+E AE TI+EMGL+  MNTRIGG        G QKRRVSIC
Sbjct  61    AVYYSAQLQLPDSMSRSEKRERAEATIREMGLEGTMNTRIGGWASKGISGG-QKRRVSIC  119

Query  694   LEILTRPKLLFLDEPSSGLDSAASFYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftsl  870
             +E+LTRP+LLFLDEP+SGLDSAAS++VM +I  LA  EG TVVA+IHQPS+EVF LF  L
Sbjct  120   IELLTRPQLLFLDEPTSGLDSAASYHVMDRITRLARREGMTVVAAIHQPSSEVFELFHGL  179

Query  871   cllssGRVVYFGPASAAIQFFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARG  1050
             CLL+ GR V+FG AS A +FF +NGFPCP L+NPSDH+L+TINKDFD D E+  Q   R 
Sbjct  180   CLLAYGRTVFFGAASMANEFFASNGFPCPPLRNPSDHYLRTINKDFDKDIEEDYQSNPRS  239

Query  1051  IPTEEVINILVNSYKSYHRYREVQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLN  1230
               T E I ILV SY+S    ++V  Q+A+I    G ++KK + A F TQS+VLTRRSF+N
Sbjct  240   --TAEAIEILVKSYRSSVSSQQVTTQIADIRGMGGALVKKRNPASFITQSLVLTRRSFVN  297

Query  1231  MFRDLGYYWLRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPS  1410
             M+RDLGYYWLR  IYI L + +G +Y+DVG+   SIQAR S+L F A+F TFMAIGGFPS
Sbjct  298   MYRDLGYYWLRFAIYIALCLCVGTIYHDVGHSFGSIQARGSMLMFTAAFLTFMAIGGFPS  357

Query  1411  FVEDMKVFKKETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAY  1590
             FVEDMK+F +E LNGHYG  AF IANTLS+ PYL LIS+IPG IAY+ VGLQ    HF Y
Sbjct  358   FVEDMKIFGRERLNGHYGVTAFTIANTLSATPYLALISVIPGAIAYYLVGLQTSIDHFIY  417

Query  1591  FALVILMNMLLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRY  1770
             FALV+ M M+LVE LMMI+AS+VP++LMGII GAG+Q +M+L GG+FRLP DLPK  WRY
Sbjct  418   FALVLFMCMMLVEGLMMIVASIVPDFLMGIITGAGIQGVMMLNGGFFRLPNDLPKPVWRY  477

Query  1771  PIYYIDFHKYAYQGLYKNEFQGLRLPEETG---QIITGEEVLRETLQVEMGHSKWIDllv  1941
             P+Y+I FHKYA QG YKNEF GL  P         ITG+E+LRET QVEMG+SKW+DL +
Sbjct  478   PMYHIAFHKYANQGFYKNEFLGLIFPNNQAGGPPTITGDEILRETWQVEMGYSKWVDLAI  537

Query  1942  lvvmgvvcrvvfllvvKASEKAKHVVKAVMRVSPKQSHQVV  2064
             L  M ++ R++FL +VK  EK K + K++M  +P++S  V+
Sbjct  538   LFGMVILYRLMFLGIVKTVEKLKPIFKSLMVKAPEKSKHVM  578



>ref|XP_008652824.1| PREDICTED: ABC transporter G family member 11-like [Zea mays]
Length=736

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/621 (60%), Positives = 462/621 (74%), Gaps = 10/621 (2%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKA-ILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             ++WEDLWV+ + G KG +  IL GL GYARPGE+LAIMGPSGCGKSTLLDALAGRL    
Sbjct  111   VSWEDLWVSAAGGNKGGRVPILCGLNGYARPGEVLAIMGPSGCGKSTLLDALAGRLGSNV  170

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
              Q GDILING  Q LAYGTSAYVTQED L  TLTVREAV+YSAQLQLPS++    K+E A
Sbjct  171   SQKGDILINGLRQKLAYGTSAYVTQEDVLMTTLTVREAVHYSAQLQLPSAMAAPAKRERA  230

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             E T++EMGL+ A +TRIGG        G Q+RRVSIC+EILTRP LLFLDEP+SGLDSAA
Sbjct  231   EETLREMGLEAAADTRIGGWMHKGISGG-QRRRVSICMEILTRPALLFLDEPTSGLDSAA  289

Query  763   SFYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             S++V+S+I  LA  EG TVVA++HQPSTEV+ LF  LCLL+ GR V+FG A+   QFF  
Sbjct  290   SYHVVSRIARLARREGMTVVAAVHQPSTEVYGLFHGLCLLAYGRTVFFGAAAETNQFFAL  349

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREV  1119
             +GFPCP+L NPSDHFL+TINKDFD D E+   G  + + T E I+ LVNSYK+     +V
Sbjct  350   SGFPCPSLMNPSDHFLRTINKDFDKDIEEGLNGETK-MTTAEAIDTLVNSYKASAYMEKV  408

Query  1120  QGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLG  1299
               Q+A+  +  G V+KK  +A F TQS+VLT+RSF+NM+RDLGYYWLR  IYI L + +G
Sbjct  409   TRQIADTREAGGAVVKKEWQASFLTQSLVLTKRSFVNMYRDLGYYWLRFAIYIMLCLCVG  468

Query  1300  YMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFA  1479
              ++ DVG+   SI AR S+L F+A+F TFMAIGGFPSFVEDMK+F +E LNGHYG   F 
Sbjct  469   TVFYDVGHSYGSILARGSLLNFVAAFLTFMAIGGFPSFVEDMKIFGRERLNGHYGAAPFT  528

Query  1480  IANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLV  1659
             IANT+S+ PYL LIS++PG IAY+ VGLQ  FGHFAYFALV+   M++VE LMMI+AS V
Sbjct  529   IANTVSAAPYLALISVVPGAIAYYLVGLQSSFGHFAYFALVLFTTMMVVEGLMMIVASAV  588

Query  1660  PNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGL  1839
             P++LMGII G G+Q +M+L GG+FRLP DLPK  WRYP+YYI FHKYA QGLYKNEF GL
Sbjct  589   PDFLMGIITGGGIQGVMMLNGGFFRLPDDLPKPVWRYPMYYIAFHKYANQGLYKNEFLGL  648

Query  1840  RLPEE------TGQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASE  2001
               P        T   ++G ++L +  QVEMG+SKW+DL +L  M V+ R++FL +VK +E
Sbjct  649   TFPSNQAGGSATAATLSGGQILTDFWQVEMGYSKWVDLAILCGMVVLYRMLFLAIVKLTE  708

Query  2002  KAKHVVKAVMRVSPKQSHQVV  2064
             K K ++K     +  QS  VV
Sbjct  709   KVKPMIKGFRFRNTAQSVHVV  729



>ref|XP_006353283.1| PREDICTED: ABC transporter G family member 11-like [Solanum tuberosum]
Length=645

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/606 (59%), Positives = 468/606 (77%), Gaps = 10/606 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             +L+W+DLWV+V D + G + IL+G++GYA+PGE+LAIMGPSGCGKSTLLDAL+GRL   T
Sbjct  38    YLSWKDLWVSVPDKKLGRRPILEGISGYAQPGEVLAIMGPSGCGKSTLLDALSGRLASNT  97

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             RQSGDIL+NGR Q LA+GTSAYVTQ+DTL ATLTV+E VYYSAQLQLP S+   EKKE A
Sbjct  98    RQSGDILVNGRKQALAFGTSAYVTQDDTLMATLTVKETVYYSAQLQLPQSMSLHEKKERA  157

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             E TIKEMGLQ+AMNTRIGG        G QKRRVSIC+EILTRPKLLFLDEP+SGLDSAA
Sbjct  158   EETIKEMGLQEAMNTRIGGWSLKGLSGG-QKRRVSICIEILTRPKLLFLDEPTSGLDSAA  216

Query  763   SFYVMSKIMDLASEG-RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             S++VM++I+ +A +  RT+VASIHQPS+EVF LF +LCLLS G+ +YFG +S A +FF  
Sbjct  217   SYHVMNRIIKIAQQDMRTIVASIHQPSSEVFELFDNLCLLSYGKTIYFGSSSKANEFFAV  276

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTE-EVINILVNSYKSYHRYRE  1116
             NGFPCP ++NPSDH+L+TINKDFD    D+E+G  + I T  + I+ LV SY+S      
Sbjct  277   NGFPCPYMRNPSDHYLRTINKDFD----DIEEGFGKNIITSGKAIDTLVMSYESSEACLN  332

Query  1117  VQGQVAEISKQEGEVLK-KSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             V+ +V  I ++ G +L+ K S+A F TQ  VLT+RSF+NM+RDLGYYWLRL IY+ L + 
Sbjct  333   VRQKVLTICQKNGRLLENKGSQAGFITQCKVLTQRSFINMYRDLGYYWLRLLIYLALCLC  392

Query  1294  LGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGA  1473
             +G +++++G    SIQAR S+L F+  F TFMAIGGFPSFVE+MK+F +E LNGHYG GA
Sbjct  393   IGTIFHEIGSDYGSIQARSSMLVFVVGFLTFMAIGGFPSFVEEMKLFTRERLNGHYGVGA  452

Query  1474  FAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIAS  1653
             F I NTLSS P+LL+ISL+PG +AY+   +Q+    FAYF L++   M+LVESLMMI+AS
Sbjct  453   FVIGNTLSSTPFLLMISLVPGAVAYYLADVQKGIDKFAYFVLMLFACMMLVESLMMIVAS  512

Query  1654  LVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQ  1833
             +VP++LMGII GAG+Q +M+L GG+FRLP +LP   W+YP+YY+ FHKYA QG YKNE++
Sbjct  513   IVPDFLMGIITGAGIQGIMMLNGGFFRLPNELPMPIWKYPMYYLAFHKYAIQGFYKNEYE  572

Query  1834  GLRLPEETGQ--IITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKA  2007
                   ++G   I+T +E+LR+  QVE+ +SKW D++++  M ++ R++FL ++K  EK 
Sbjct  573   TFTYFTKSGLAIIVTRDEILRDIFQVELNYSKWGDIVIVFGMVILYRLIFLSIIKGKEKF  632

Query  2008  KHVVKA  2025
             + +V+ 
Sbjct  633   RPMVRG  638



>gb|EAZ09459.1| hypothetical protein OsI_31729 [Oryza sativa Indica Group]
Length=728

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/577 (61%), Positives = 434/577 (75%), Gaps = 12/577 (2%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             L WEDLWV+ + G +    IL GL GYARPGE+LAIMGPSGCGKSTLLD+LAGRL  +  
Sbjct  105   LAWEDLWVSTAGGSRRRVPILCGLNGYARPGEVLAIMGPSGCGKSTLLDSLAGRLGSSVS  164

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             Q GDILINGR Q LA+GTSAYVTQ+D L  TLTVREAV YSAQLQLPS +  + K+E AE
Sbjct  165   QKGDILINGRRQKLAFGTSAYVTQDDVLMNTLTVREAVRYSAQLQLPSGMSAAAKRERAE  224

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              T++EMGL+ A +TRIGG        G Q+RRVSIC+EILTRP LLFLDEP+SGLDSAAS
Sbjct  225   ETLREMGLEGAADTRIGGWAHKGISGG-QRRRVSICMEILTRPALLFLDEPTSGLDSAAS  283

Query  766   FYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETN  942
             ++V+S+I  +A  EG TVVA++HQPSTEVF LF  LCLL+ G+ V+FGPA+   QFF  +
Sbjct  284   YHVVSRIARMARREGMTVVAAVHQPSTEVFGLFHGLCLLAYGKTVFFGPAADTAQFFALS  343

Query  943   GFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGC-ARGIPTEEVINILVNSYKSYHRYREV  1119
             GFPCP+L NPSDHFL+TINKDFD   +D+E G   + + T + I+ LVNSYKS     +V
Sbjct  344   GFPCPSLMNPSDHFLRTINKDFD---KDIEVGLDGKTMTTTQAIDTLVNSYKSSVHLAKV  400

Query  1120  QGQVAEI-SKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGL  1296
               Q+ EI +  EG+++KK  +  F TQS VLT+RSF+NM+RDLGYYWLR  IY+ L + +
Sbjct  401   MHQIEEIRANNEGQLVKKERQPTFLTQSWVLTKRSFVNMYRDLGYYWLRFAIYVALCLCV  460

Query  1297  GYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAF  1476
             G +Y DVG+   SIQAR S+L F+A+F TFMAIGGFPSFVEDMK+F +E LNGHYG  +F
Sbjct  461   GTIYYDVGHSYGSIQARGSMLMFVAAFLTFMAIGGFPSFVEDMKIFGRERLNGHYGVASF  520

Query  1477  AIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASL  1656
              IANTLSS PYL LIS++PG IAY+  GLQ    HF YFA V+   M++VE LMMI+AS 
Sbjct  521   VIANTLSSTPYLALISVVPGAIAYYLTGLQSSGEHFGYFAAVLFTTMMVVEGLMMIVASA  580

Query  1657  VPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQG  1836
             VP++LMGII GAG+Q +M+L GG+FRLP DLPK  W+YP+YYI FHKYA QG YKNEF G
Sbjct  581   VPDFLMGIITGAGVQGVMMLNGGFFRLPNDLPKPVWKYPMYYIAFHKYANQGFYKNEFLG  640

Query  1837  LRLPE-----ETGQIITGEEVLRETLQVEMGHSKWID  1932
             L  P+       G +ITGEE+L    QV++G+SKW D
Sbjct  641   LTFPKYNDQAGAGTVITGEEILTNYWQVQLGYSKWAD  677



>ref|XP_010937486.1| PREDICTED: ABC transporter G family member 11-like [Elaeis guineensis]
Length=603

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/582 (63%), Positives = 453/582 (78%), Gaps = 9/582 (2%)
 Frame = +1

Query  334   MGPSGCGKSTLLDALAGRLELTTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVRE  513
             MGPSGCGKSTLLDALAGRL+  T+QSG +L+NG  Q LA+GTSAYVTQ+D L  TLTVRE
Sbjct  1     MGPSGCGKSTLLDALAGRLDSGTKQSGHVLVNGWRQRLAFGTSAYVTQDDILMTTLTVRE  60

Query  514   AVYYSAQLQLPSSLPRSEKKEIAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSIC  693
             AVYYSAQLQLP+S+ +SEKKE  EMTI+EMGLQ+AM+TRIGG        G QKRRVSIC
Sbjct  61    AVYYSAQLQLPNSMTKSEKKERVEMTIREMGLQEAMDTRIGGQVFKGISGG-QKRRVSIC  119

Query  694   LEILTRPKLLFLDEPSSGLDSAASFYVMSKIMDLA-SEGRTVVASIHQPSTEVfslftsl  870
             +EILTRPKLLFLDEP+SGLDSAAS++VM++I+DLA  +G T++ASIHQPS+EVF LF +L
Sbjct  120   VEILTRPKLLFLDEPTSGLDSAASYHVMNRIIDLARHDGMTIIASIHQPSSEVFELFDNL  179

Query  871   cllssGRVVYFGPASAAIQFFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARG  1050
             CLLSSG+ VYFGPAS   +FF  NGFPCP+L+NPSDH+L+TINKDFD   E++ +GC+  
Sbjct  180   CLLSSGKTVYFGPASLTNEFFAQNGFPCPSLRNPSDHYLRTINKDFD---EEILKGCSSQ  236

Query  1051  IPTEE-VINILVNSYKSYHRYREVQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFL  1227
               T    I+IL+ SYK  +  +EV+ +VAE+   EG  +K  S+A F TQ IVLT+RSF+
Sbjct  237   SKTAAGAIDILIKSYKLSNIRQEVERRVAEMRGSEGAAVKTRSQASFTTQCIVLTKRSFI  296

Query  1228  NMFRDLGYYWLRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFP  1407
             NM RDLGYYWLRL IY  L + +G M+ D+G+   SIQAR SVL FI++F TFMAIGGFP
Sbjct  297   NMHRDLGYYWLRLAIYAMLCLCIGTMFYDIGHSYGSIQARGSVLLFISAFLTFMAIGGFP  356

Query  1408  SFVEDMKVFKKETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFA  1587
             SFVEDMK+F++E LNGHY   AF I+N LSS P+L L+S+IP  +AY+ VGLQ    HF 
Sbjct  357   SFVEDMKIFRRERLNGHYDVTAFMISNMLSSAPHLALVSIIPAAMAYYLVGLQSGVDHFI  416

Query  1588  YFALVILMNMLLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWR  1767
             +FALV+  +MLLVE LMMI+AS+VPNYLMGII GAG+QA MIL  G+FRLP DLPK  WR
Sbjct  417   FFALVLYASMLLVEGLMMIVASIVPNYLMGIITGAGIQATMILSAGFFRLPNDLPKPVWR  476

Query  1768  YPIYYIDFHKYAYQGLYKNEFQGLRLPE-ETG--QIITGEEVLRETLQVEMGHSKWIDll  1938
             YP+Y+I FHKYA Q  YKNEF GL  P  + G    +TGEEVL++  Q+E+G+SKW+DL 
Sbjct  477   YPLYHIAFHKYANQAYYKNEFIGLTFPNIQAGGAATVTGEEVLKDFWQMEVGYSKWVDLA  536

Query  1939  vlvvmgvvcrvvfllvvKASEKAKHVVKAVMRVSPKQSHQVV  2064
             +L  M ++ RV+FL++VKASEK K +V+AV+   PK   QV+
Sbjct  537   ILFGMVILYRVLFLVIVKASEKVKPMVRAVLNRPPKHVIQVM  578



>ref|NP_001063447.1| Os09g0472200 [Oryza sativa Japonica Group]
 dbj|BAD22238.1| putative ABC transporter [Oryza sativa Japonica Group]
 dbj|BAF25361.1| Os09g0472200 [Oryza sativa Japonica Group]
Length=728

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/577 (61%), Positives = 433/577 (75%), Gaps = 12/577 (2%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             L WEDLWV+ + G +    IL GL GYARPGE+LAIMGPSGCGKSTLLD+LAGRL  +  
Sbjct  105   LAWEDLWVSTAGGSRRRVPILCGLNGYARPGEVLAIMGPSGCGKSTLLDSLAGRLGSSVS  164

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             Q GDILINGR Q LA+GTSAYVTQ+D L  TLTVREAV YSAQLQLPS +  + K+E AE
Sbjct  165   QKGDILINGRRQKLAFGTSAYVTQDDVLMNTLTVREAVRYSAQLQLPSGMSAAAKRERAE  224

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              T++EMGL+ A +TRIGG        G Q+RRVSIC+EILTRP LLFLDEP+SGLDSAAS
Sbjct  225   ETLREMGLEGAADTRIGGWAHKGISGG-QRRRVSICMEILTRPALLFLDEPTSGLDSAAS  283

Query  766   FYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETN  942
             ++V+S+I  +A  EG TVVA++HQPSTEVF LF  LCLL+ G+ V+FGPA+   QF   +
Sbjct  284   YHVVSRIARMARREGMTVVAAVHQPSTEVFGLFHGLCLLAYGKTVFFGPAADTAQFSALS  343

Query  943   GFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGC-ARGIPTEEVINILVNSYKSYHRYREV  1119
             GFPCP+L NPSDHFL+TINKDFD   +D+E G   + + T + I+ LVNSYKS     +V
Sbjct  344   GFPCPSLMNPSDHFLRTINKDFD---KDIEVGLDGKTMTTTQAIDTLVNSYKSSVHLAKV  400

Query  1120  QGQVAEI-SKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGL  1296
               Q+ EI +  EG+++KK  +  F TQS VLT+RSF+NM+RDLGYYWLR  IY+ L + +
Sbjct  401   MHQIEEIRANNEGQLVKKERQPTFLTQSWVLTKRSFVNMYRDLGYYWLRFAIYVALCLCV  460

Query  1297  GYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAF  1476
             G +Y DVG+   SIQAR S+L F+A+F TFMAIGGFPSFVEDMK+F +E LNGHYG  +F
Sbjct  461   GTIYYDVGHSYGSIQARGSMLMFVAAFLTFMAIGGFPSFVEDMKIFGRERLNGHYGVASF  520

Query  1477  AIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASL  1656
              IANTLSS PYL LIS++PG IAY+  GLQ    HF YFA V+   M++VE LMMI+AS 
Sbjct  521   VIANTLSSTPYLALISVVPGAIAYYLTGLQSSGEHFGYFAAVLFTTMMVVEGLMMIVASA  580

Query  1657  VPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQG  1836
             VP++LMGII GAG+Q +M+L GG+FRLP DLPK  W+YP+YYI FHKYA QG YKNEF G
Sbjct  581   VPDFLMGIITGAGVQGVMMLNGGFFRLPNDLPKPVWKYPMYYIAFHKYANQGFYKNEFLG  640

Query  1837  LRLPE-----ETGQIITGEEVLRETLQVEMGHSKWID  1932
             L  P+       G +ITGEE+L    QV++G+SKW D
Sbjct  641   LTFPKYNDQAGAGTVITGEEILTNYWQVQLGYSKWAD  677



>ref|XP_003578275.1| PREDICTED: ABC transporter G family member 11-like [Brachypodium 
distachyon]
Length=748

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/629 (59%), Positives = 463/629 (74%), Gaps = 21/629 (3%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKG--NKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELT  399
             L+WEDLWV+ + G  G   K IL+GL GYARPGE+LAIMGPSGCGKSTLLDALAGRL   
Sbjct  117   LSWEDLWVSAAGGGGGGTKKPILRGLNGYARPGEVLAIMGPSGCGKSTLLDALAGRLGSN  176

Query  400   TRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEI  579
               Q G+ILINGR Q L++GTSAYVTQ+D L  TLTVREAV+YSA LQLP+ +P + K+E 
Sbjct  177   VSQKGEILINGRRQKLSFGTSAYVTQDDVLMTTLTVREAVHYSASLQLPAHMPAAAKRER  236

Query  580   AEMTIKEMGL--QDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLD  753
             AE T++EMGL   +  +TRIGG        G QKRRVSIC+EILTRP LLFLDEP+SGLD
Sbjct  237   AEETLREMGLLEGNVADTRIGGWAHKGISGG-QKRRVSICMEILTRPALLFLDEPTSGLD  295

Query  754   SAASFYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQF  930
             SAAS++V+S+I  LA  EG  VVA++HQPSTEVF LF+ LCLL+ G  V+FGPA+ A QF
Sbjct  296   SAASYHVVSRIARLARREGMAVVAAVHQPSTEVFGLFSGLCLLAYGNTVFFGPAADANQF  355

Query  931   FETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCA-RGIPTEEVINILVNSYKSYHR  1107
             F  +GFPCP+L NPSDHFL+TINKDFDND   +E+G   +   T + I+ LV  Y+S   
Sbjct  356   FVLSGFPCPSLMNPSDHFLRTINKDFDND---IEEGLGGKKTTTAQAIDALVTLYRSSGH  412

Query  1108  YREVQGQVAEISKQEGEVLKK--SSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYIT  1281
               +V  Q+A+I    G  + K       F TQS+VLT+RSF+NM+RDLGYYWLR GIY+ 
Sbjct  413   MEKVTRQIADIRNGTGGPVVKMEGQHPSFLTQSLVLTKRSFVNMYRDLGYYWLRFGIYLA  472

Query  1282  LAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHY  1461
             L +  G ++ D+G+   SIQAR S+L F+ +F TFMAIGGFPSFVEDMK+F +E LNGHY
Sbjct  473   LCLCAGTIFYDIGHTYGSIQARGSILMFVGAFLTFMAIGGFPSFVEDMKIFGRERLNGHY  532

Query  1462  GCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMM  1641
             G  +F IANT+S+ PYLLLIS++PG +AY+ VGLQR F HFAYFALV+ M M+LVE LMM
Sbjct  533   GVSSFVIANTVSATPYLLLISVVPGALAYYLVGLQRSFDHFAYFALVLFMTMMLVEGLMM  592

Query  1642  IIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYK  1821
             I+AS VP++LMGII GAG+Q +M+L GG+FRLP+DLP+  WRYP+YY+ FHKYA QG YK
Sbjct  593   IVASAVPDFLMGIITGAGIQGVMMLNGGFFRLPRDLPRPVWRYPMYYVAFHKYANQGFYK  652

Query  1822  NEFQGLRLPEETG---------QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvv  1974
             NEF GL  P               +TG E+LR+  QVEMG+SKW+DL VL  M ++ RV+
Sbjct  653   NEFMGLTFPRANAAAQAGPGASATVTGGEILRDYWQVEMGYSKWVDLAVLFGMVIIYRVL  712

Query  1975  fllvvKASEKAKHVVKAVMRVSPKQSHQV  2061
             FL++VK +EK K +VK     S +QS  V
Sbjct  713   FLVIVKLTEKVKPMVKGFRFRSTQQSVHV  741



>gb|KDP40918.1| hypothetical protein JCGZ_24917 [Jatropha curcas]
Length=667

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/677 (57%), Positives = 484/677 (71%), Gaps = 41/677 (6%)
 Frame = +1

Query  46    LAMDSGNDDSRI--RQCDSNRINIVPLDMETAGGVSSMPKDKRPgggaeaakvdvggggg  219
             L MD   +D+ +     D+  +    LDME      S   D R                 
Sbjct  10    LEMDHHENDNNVLMSSLDAETVE-CSLDMENGHASISKFWDDR---------------ND  53

Query  220   vFLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELT  399
             VFLTWEDL V+V   + G K IL+GLTG+A+PGE+LA+MG               RL+  
Sbjct  54    VFLTWEDLGVSVPSRKHGCKCILEGLTGFAQPGEILAVMG---------------RLDSN  98

Query  400   TRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEI  579
             T+Q G ++ING  Q LAYGTSAYV Q+D +T TLTV EAVYYSAQLQLP+S+  +EKKE 
Sbjct  99    TKQIGQVMINGHKQPLAYGTSAYVAQDDVITWTLTVGEAVYYSAQLQLPNSMSMAEKKER  158

Query  580   AEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSA  759
             AE+TIKEMGLQD+M+T   GGWGSKG+SGGQKRRVSIC+EILTRPKLLFLDEP+SGLDSA
Sbjct  159   AEITIKEMGLQDSMDT-TIGGWGSKGLSGGQKRRVSICIEILTRPKLLFLDEPTSGLDSA  217

Query  760   ASFYVMSKIMDLASEGR-TVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFE  936
             AS+YVM K+  LA + R T++ASIHQP +EVF  F +LCLLSSGR +YFGP++AA +FFE
Sbjct  218   ASYYVMKKLAYLAKQHRMTIIASIHQPGSEVFQFFRNLCLLSSGRTIYFGPSTAASKFFE  277

Query  937   TNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYRE  1116
              NGFP P+ QNPSDH+L+TIN DF    ED+E+G +     EEVIN+LV SYKS     +
Sbjct  278   MNGFPIPSHQNPSDHYLRTINSDFY---EDMERGFSEKKNREEVINLLVRSYKSSVTCEQ  334

Query  1117  VQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGL  1296
             ++ ++ EI  QE   L +   ++F  Q +VL+RRSF+NM+RDLGYYWLRL IYI L +GL
Sbjct  335   IRSRIGEICSQERAELSEGRHSNFIMQCLVLSRRSFVNMYRDLGYYWLRLAIYIMLGLGL  394

Query  1297  GYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAF  1476
             G ++  +G G SSIQAR S+L FIAS  T MAIGGFPSFVEDMKVF++E LNGHY   AF
Sbjct  395   GSVFYSIGSGYSSIQARGSLLMFIASLLTIMAIGGFPSFVEDMKVFQRERLNGHYHSSAF  454

Query  1477  AIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASL  1656
              ++NTL+S PYLLLIS+IPG I Y+ VGLQ+E  HF YFAL +   M+LVE LM+I+AS+
Sbjct  455   VVSNTLASAPYLLLISIIPGAITYYLVGLQQESAHFIYFALTLFACMMLVEGLMLIVASI  514

Query  1657  VPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQG  1836
             VPN+LMG+I GAG+Q LM+L GG+FRLP DLP++ W+YP+YYI FHKYAYQGLYKNEF+G
Sbjct  515   VPNFLMGLITGAGIQGLMMLSGGFFRLPGDLPRILWKYPLYYIAFHKYAYQGLYKNEFEG  574

Query  1837  LRLPEETG---QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKA  2007
             L  P +       I GEE+LRE  QVEMG+SKWIDL++L  M  V RV+ L V++  EK 
Sbjct  575   LIFPSDHHGGPPYINGEEILREIWQVEMGYSKWIDLVILFGMVFVYRVLLLFVLEIIEKF  634

Query  2008  KHVVKAVMRVSPKQSHQ  2058
             K +V+ +  VS +QS +
Sbjct  635   KPLVREIKFVSFRQSKK  651



>gb|EAZ45082.1| hypothetical protein OsJ_29720 [Oryza sativa Japonica Group]
Length=728

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/576 (61%), Positives = 429/576 (74%), Gaps = 10/576 (2%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             L WEDLWV+ + G +    IL GL GYARPGE+LAIMGPSGCGKSTLLD+LAGRL  +  
Sbjct  105   LAWEDLWVSTAGGSRRRVPILCGLNGYARPGEVLAIMGPSGCGKSTLLDSLAGRLGSSVS  164

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             Q GDILINGR Q LA+GTSAYVTQ+D L  TLTVREAV YSAQLQLPS +  + K+E AE
Sbjct  165   QKGDILINGRRQKLAFGTSAYVTQDDVLMNTLTVREAVRYSAQLQLPSGMSAAAKRERAE  224

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              T++EMGL+ A +TRIGG        G Q+RRVSIC+EILTRP LLFLDEP+SGLDSAAS
Sbjct  225   ETLREMGLEGAADTRIGGWAHKGISGG-QRRRVSICMEILTRPALLFLDEPTSGLDSAAS  283

Query  766   FYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETN  942
             ++V+S+I  +A  EG TVVA++HQPSTEVF LF  LCLL+ G+ V+ GPA+   QF   +
Sbjct  284   YHVVSRIARMARREGMTVVAAVHQPSTEVFGLFHGLCLLAYGKTVFLGPAAETAQFSALS  343

Query  943   GFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREVQ  1122
             GFPCP+L NPSDHFL+TINKDFD D E    G  + + T + I+ LVNSYKS     +V 
Sbjct  344   GFPCPSLMNPSDHFLRTINKDFDKDIEVGLDG--KTMTTTQAIDTLVNSYKSSVHLAKVM  401

Query  1123  GQVAEI-SKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLG  1299
              Q+ EI +  EG+++KK  +  F TQS VLT+RSF+NM+RDLGYYWLR  IY+ L + +G
Sbjct  402   HQIEEIRANNEGQLVKKERQPTFLTQSWVLTKRSFVNMYRDLGYYWLRFAIYVALCLCVG  461

Query  1300  YMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFA  1479
              +Y DVG+   SIQAR S+L F+A+F TFMAIG FPSFVEDMK+F +E LNGHYG  +F 
Sbjct  462   TIYYDVGHSYGSIQARGSMLMFVAAFLTFMAIGCFPSFVEDMKIFGRERLNGHYGVASFV  521

Query  1480  IANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLV  1659
             IANTLSS PYL LIS++PG IAY+  GLQ    HF YFA V+   M++VE LMMI+AS V
Sbjct  522   IANTLSSTPYLALISVVPGAIAYYLTGLQSSGEHFGYFAAVLFTTMMVVEGLMMIVASAV  581

Query  1660  PNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGL  1839
             P++LMGII GAG+Q +M+L GG+FRLP DLPK  W+YP+YYI FHKYA QG YKNEF GL
Sbjct  582   PDFLMGIITGAGVQGVMMLNGGFFRLPNDLPKPVWKYPMYYIAFHKYANQGFYKNEFLGL  641

Query  1840  RLPE-----ETGQIITGEEVLRETLQVEMGHSKWID  1932
               P+       G +ITGEE+L    QV++G+SKW D
Sbjct  642   TFPKYNDQAGAGTVITGEEILTNYWQVQLGYSKWAD  677



>ref|XP_009405050.1| PREDICTED: ABC transporter G family member 11-like [Musa acuminata 
subsp. malaccensis]
Length=628

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/606 (59%), Positives = 443/606 (73%), Gaps = 19/606 (3%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             FLTWEDLWV+    + G+ +IL G+TG+ARPGE+LAIMGPSGCGKSTLLDALAGRL    
Sbjct  15    FLTWEDLWVSAPGRKGGHVSILCGITGFARPGEVLAIMGPSGCGKSTLLDALAGRLASNV  74

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
              Q GDILING+ Q LA+GTSAYVTQ+D L  TLT            LP S+ R+EK+  A
Sbjct  75    SQKGDILINGQKQKLAFGTSAYVTQDDVLMTTLT------------LPDSMSRAEKRARA  122

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             E TI+EMGL+ AM+TRIGG        G QKRRVSIC+E+LTRP+LLFLDEP+SGLDSAA
Sbjct  123   EATIREMGLESAMDTRIGGWASKGISGG-QKRRVSICVELLTRPRLLFLDEPTSGLDSAA  181

Query  763   SFYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             S+ VM++I  LA  E  TVVA+IHQPS+EVF LF  L LL+ GR VYFGP   A +FF +
Sbjct  182   SYVVMNRIARLARREAMTVVAAIHQPSSEVFELFHGLGLLAYGRTVYFGPPQMADEFFAS  241

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREV  1119
             N FPCP+  NPSDH+L+TINKDFD D+ED     +R     + I +LV SY S     EV
Sbjct  242   NVFPCPSPSNPSDHYLRTINKDFDMDNEDSLAHKSRS--ASQAIEVLVRSYSSSDISHEV  299

Query  1120  QGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLG  1299
               Q+A +    G ++KK S+A FFTQ+ VLTRRSF+NM+RD GYYWLR  IYI L + +G
Sbjct  300   TQQIALMRNTGGSLVKKRSQASFFTQTRVLTRRSFVNMYRDFGYYWLRFAIYIALCLCVG  359

Query  1300  YMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFA  1479
              +Y DVG+   SIQAR S+L F A+F TFMAIGGFPSFVEDMK+F +E LNGHYG  AF 
Sbjct  360   SIYYDVGHSFGSIQARGSMLMFTAAFLTFMAIGGFPSFVEDMKIFGRERLNGHYGATAFT  419

Query  1480  IANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLV  1659
             IAN LS+ PYL LIS++PG +AY+ VGLQR   HF YFALV+ + M++VE LMMI+ASLV
Sbjct  420   IANALSATPYLALISVVPGAMAYYLVGLQRPADHFVYFALVLFVCMMVVEGLMMIVASLV  479

Query  1660  PNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGL  1839
             P++LMGII G G+Q +M+L GG+FRLP+DLPK  WRYP++Y+ FHKYA QG YKNEF GL
Sbjct  480   PDFLMGIITGTGIQGIMMLNGGFFRLPQDLPKPVWRYPMHYMAFHKYANQGFYKNEFLGL  539

Query  1840  RLPEETG---QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAK  2010
               P        IITGEE+L+   QVEMG+SKW+DL +L+ M ++ R++FL  VK +EK K
Sbjct  540   TFPGNVAGGSPIITGEEILKGVWQVEMGYSKWVDLAILLAMVMLYRLMFLGAVKIAEKVK  599

Query  2011  HVVKAV  2028
               + A+
Sbjct  600   PKINAL  605



>tpg|DAA61896.1| TPA: hypothetical protein ZEAMMB73_054499 [Zea mays]
Length=752

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/637 (59%), Positives = 462/637 (73%), Gaps = 26/637 (4%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKA-ILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             ++WEDLWV+ + G KG +  IL GL GYARPGE+LAIMGPSGCGKSTLLDALAGRL    
Sbjct  111   VSWEDLWVSAAGGNKGGRVPILCGLNGYARPGEVLAIMGPSGCGKSTLLDALAGRLGSNV  170

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
              Q GDILING  Q LAYGTSAYVTQED L  TLTVREAV+YSAQLQLPS++    K+E A
Sbjct  171   SQKGDILINGLRQKLAYGTSAYVTQEDVLMTTLTVREAVHYSAQLQLPSAMAAPAKRERA  230

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             E T++EMGL+ A +TRIGG        G Q+RRVSIC+EILTRP LLFLDEP+SGLDSAA
Sbjct  231   EETLREMGLEAAADTRIGGWMHKGISGG-QRRRVSICMEILTRPALLFLDEPTSGLDSAA  289

Query  763   SFYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQ----  927
             S++V+S+I  LA  EG TVVA++HQPSTEV+ LF  LCLL+ GR V+FG A+   Q    
Sbjct  290   SYHVVSRIARLARREGMTVVAAVHQPSTEVYGLFHGLCLLAYGRTVFFGAAAETNQVNNC  349

Query  928   ------------FFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVI  1071
                         FF  +GFPCP+L NPSDHFL+TINKDFD D E+   G  + + T E I
Sbjct  350   QREVRIQQRSGTFFALSGFPCPSLMNPSDHFLRTINKDFDKDIEEGLNGETK-MTTAEAI  408

Query  1072  NILVNSYKSYHRYREVQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGY  1251
             + LVNSYK+     +V  Q+A+  +  G V+KK  +A F TQS+VLT+RSF+NM+RDLGY
Sbjct  409   DTLVNSYKASAYMEKVTRQIADTREAGGAVVKKEWQASFLTQSLVLTKRSFVNMYRDLGY  468

Query  1252  YWLRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKV  1431
             YWLR  IYI L + +G ++ DVG+   SI AR S+L F+A+F TFMAIGGFPSFVEDMK+
Sbjct  469   YWLRFAIYIMLCLCVGTVFYDVGHSYGSILARGSLLNFVAAFLTFMAIGGFPSFVEDMKI  528

Query  1432  FKKETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILM  1611
             F +E LNGHYG   F IANT+S+ PYL LIS++PG IAY+ VGLQ  FGHFAYFALV+  
Sbjct  529   FGRERLNGHYGAAPFTIANTVSAAPYLALISVVPGAIAYYLVGLQSSFGHFAYFALVLFT  588

Query  1612  NMLLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDF  1791
              M++VE LMMI+AS VP++LMGII G G+Q +M+L GG+FRLP DLPK  WRYP+YYI F
Sbjct  589   TMMVVEGLMMIVASAVPDFLMGIITGGGIQGVMMLNGGFFRLPDDLPKPVWRYPMYYIAF  648

Query  1792  HKYAYQGLYKNEFQGLRLPEE------TGQIITGEEVLRETLQVEMGHSKWIDllvlvvm  1953
             HKYA QGLYKNEF GL  P        T   ++G ++L +  QVEMG+SKW+DL +L  M
Sbjct  649   HKYANQGLYKNEFLGLTFPSNQAGGSATAATLSGGQILTDFWQVEMGYSKWVDLAILCGM  708

Query  1954  gvvcrvvfllvvKASEKAKHVVKAVMRVSPKQSHQVV  2064
              V+ R++FL +VK +EK K ++K     +  QS  VV
Sbjct  709   VVLYRMLFLAIVKLTEKVKPMIKGFRFRNTAQSVHVV  745



>ref|XP_010312634.1| PREDICTED: ABC transporter G family member 11-like [Solanum lycopersicum]
Length=649

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/573 (60%), Positives = 439/573 (77%), Gaps = 10/573 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             +L W+DLWV+V + + G + IL+G++GYA+PGE+LAIMGPSGCGKSTLLDALAGRL   T
Sbjct  40    YLCWKDLWVSVPNKKVGRRPILEGISGYAQPGEVLAIMGPSGCGKSTLLDALAGRLASNT  99

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             RQSGDIL+NGR Q LA+GTSAYVTQ+DTL  TLTV+E +YYSAQLQLP S+    KKE A
Sbjct  100   RQSGDILVNGRKQALAFGTSAYVTQDDTLMTTLTVKETIYYSAQLQLPQSMSLETKKERA  159

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             E TIKEMGLQ+AMNTRIGG        G QKRRVSIC+EILTRPKLLFLDEP+SGLDSAA
Sbjct  160   EETIKEMGLQEAMNTRIGGWSLKGLSGG-QKRRVSICIEILTRPKLLFLDEPTSGLDSAA  218

Query  763   SFYVMSKIMDLASEG-RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             S++VM++I+ +A +  RT+VASIHQPS+EVF LF +LCLLS G+ +YFG  S A +FF  
Sbjct  219   SYHVMNRIIKIAQQDMRTIVASIHQPSSEVFELFGNLCLLSYGKTIYFGSTSKANEFFAV  278

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTE-EVINILVNSYKSYHRYRE  1116
             +GFPCP ++NPSDH+L+TINKDFD    D+E+G  + I    + I+ LV SY+S      
Sbjct  279   SGFPCPFMRNPSDHYLRTINKDFD----DIEEGLGKNIINSGKAIDTLVMSYESSEACLN  334

Query  1117  VQGQVAEISKQEGEVLK-KSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             V+ +V  IS++ G  ++ K S+A F TQ  VLT+RSF+NM+RDLGYYWLRL IY+ L + 
Sbjct  335   VRQRVLTISQKNGRFIENKGSQAGFITQCRVLTQRSFVNMYRDLGYYWLRLLIYLALCLC  394

Query  1294  LGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGA  1473
             +G +++++G    SIQAR S+L F+  F TFMAIGGFPSFVE+MK F +E LNGHYG GA
Sbjct  395   IGTIFHEIGSDYGSIQARSSMLVFVVGFLTFMAIGGFPSFVEEMKFFTRERLNGHYGVGA  454

Query  1474  FAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIAS  1653
             F I NTLSS P+LLLISL+PG +AY+   +Q+    FAYF L++ + M+LVESLMMI+AS
Sbjct  455   FVIGNTLSSTPFLLLISLVPGAVAYYLADVQKGIDKFAYFFLMLFVCMMLVESLMMIVAS  514

Query  1654  LVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQ  1833
             +VP++LMGII GAG+Q +M+L GG+FRLP +LP   W+YP+YY+ FHKYA QG YKNEF+
Sbjct  515   IVPDFLMGIITGAGIQGIMMLNGGFFRLPNELPMPIWKYPLYYLSFHKYAIQGFYKNEFE  574

Query  1834  GLRLPEETGQII--TGEEVLRETLQVEMGHSKW  1926
                    +G  I  T +E+LR+  QVE+ +SKW
Sbjct  575   TFTYFTNSGLAIRVTRDEILRDIFQVELNYSKW  607



>gb|EMS61063.1| ABC transporter G family member 11 [Triticum urartu]
Length=697

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/616 (59%), Positives = 449/616 (73%), Gaps = 29/616 (5%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             L+WEDLWV+ + G+ G   IL+GL GYARPGE+LAIMGPSGCGKSTLLDALAGRL     
Sbjct  96    LSWEDLWVSAAGGKAGRVPILRGLNGYARPGEVLAIMGPSGCGKSTLLDALAGRLGSGVS  155

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             Q GDILINGR Q L+YGTSAYVTQ+D L  TLT            LPS +  + K++ AE
Sbjct  156   QKGDILINGRRQKLSYGTSAYVTQDDVLMTTLT------------LPSGMSAAAKRDRAE  203

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              T++EMGL+ A +TRIGG        G Q+RRVSIC+EILTRP LLFLDEP+SGLDSAAS
Sbjct  204   ETLREMGLEGAADTRIGGWMHKGISGG-QRRRVSICMEILTRPALLFLDEPTSGLDSAAS  262

Query  766   FYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETN  942
             F+V+S+I  LA  EG TVVA++HQPSTEV+ LF  LCLL+ G+ V+FGPA+   QFF  +
Sbjct  263   FHVVSRIARLARREGMTVVAAVHQPSTEVYGLFHGLCLLAYGKTVFFGPAAETNQFFALS  322

Query  943   GFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREVQ  1122
             GFPCP+L NPSDHFL+TINKDFDND E+   G  +   T E I+ LV SYKS   Y +  
Sbjct  323   GFPCPSLMNPSDHFLRTINKDFDNDIEEGLGG--KKTTTAENIDALVVSYKS-SVYMD--  377

Query  1123  GQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLGY  1302
              +V E+ K EG+      +  F  QS+VLT+RSF+NM+RDLGYYWLR  IYI L +  G 
Sbjct  378   -KVGEVVKMEGQ------QPSFLMQSLVLTKRSFINMYRDLGYYWLRFAIYIALCLCCGT  430

Query  1303  MYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFAI  1482
             ++ D+G+   SIQAR S+L F+ +F TFMAIGGFPSFVEDMK+F +E LNGHYG  +F I
Sbjct  431   IFYDIGHSYGSIQARGSMLMFVGAFLTFMAIGGFPSFVEDMKIFGRERLNGHYGVSSFVI  490

Query  1483  ANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLVP  1662
             ANT+S+ PYLLLISL+PG +AY+ VGLQR F HFAYFALV+ M M+LVE LMMI+AS VP
Sbjct  491   ANTVSATPYLLLISLVPGAMAYYLVGLQRSFDHFAYFALVLFMTMMLVEGLMMIVASAVP  550

Query  1663  NYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGLR  1842
             ++LMGII GAG+Q +M+L GG+FRLP DLPK  WRYP+YY+ FHKYA QG YKNEF GL 
Sbjct  551   DFLMGIITGAGIQGVMMLNGGFFRLPHDLPKPVWRYPMYYVAFHKYANQGFYKNEFLGLT  610

Query  1843  LPEET---GQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAKH  2013
              P         ITG+E+LRE  QVEMG++KW+DL VL  M ++ RV+FL ++K +EK K 
Sbjct  611   FPNNQVGGAATITGDEILREYWQVEMGYNKWVDLAVLFGMVILYRVLFLAIMKLTEKVKP  670

Query  2014  VVKAVMRVSPKQSHQV  2061
             +V  +   S + S  +
Sbjct  671   MVNGLRFRSTQPSVHI  686



>gb|EAZ43810.1| hypothetical protein OsJ_28429 [Oryza sativa Japonica Group]
Length=709

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/571 (58%), Positives = 432/571 (76%), Gaps = 5/571 (1%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             FLTWED+WVT  D       IL G++G ARPGE+LAIMGPSGCGK+TLLD LAGRL+   
Sbjct  92    FLTWEDVWVTAVDSGGKAATILNGVSGSARPGEVLAIMGPSGCGKTTLLDTLAGRLDSNL  151

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             +  G IL+NGR Q LA+GTSAYVTQE+ L ATLTVREA+YYSAQ+QLP ++  +EK   A
Sbjct  152   KMKGQILVNGRCQQLAFGTSAYVTQENVLMATLTVREAIYYSAQIQLPDTMTMAEKLRRA  211

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             + T++EMGL   ++TRIGG        G QKR +SICL+ILTRP+LLFLDEP+SGLDSAA
Sbjct  212   DETVREMGLTGTLDTRIGGRSSKGISGGQQKR-LSICLDILTRPRLLFLDEPTSGLDSAA  270

Query  763   SFYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             SF+VMS+I+ LA+ EG TVVA +HQP +EVF LF  LCLL++G  ++FGPAS A +FF +
Sbjct  271   SFHVMSRIIGLAAREGMTVVAVVHQPCSEVFELFHVLCLLAAGNTIFFGPASMAAEFFAS  330

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREV  1119
             NG+PCP ++NPSDHFL+T+NKDFD + ED  + C   +  +E I+ILVNSYKS +     
Sbjct  331   NGYPCPPMRNPSDHFLRTVNKDFDKESEDRLR-CMPAV-ADEAIDILVNSYKSSNTSEVA  388

Query  1120  QGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLG  1299
             +  +  I++ +  V    +RA F T+++VLTRRSF+NM+RD+GYYWLR+ IYI+++  LG
Sbjct  389   KQDMRHINEMD-RVTIGRNRAGFITKTLVLTRRSFVNMYRDIGYYWLRMAIYISISACLG  447

Query  1300  YMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFA  1479
              ++ ++GYG+ SI+AR S+L FI++  T MAIGGFPSFVEDMK+F +E LNGHYG   F 
Sbjct  448   TIFYNMGYGSDSIRARSSMLMFISTMLTLMAIGGFPSFVEDMKIFSRERLNGHYGVTTFV  507

Query  1480  IANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLV  1659
             I+NTLSS PYLLLI++IPG IAY+  GLQR+  HF YF LV+    +LVE LMMI+A++V
Sbjct  508   ISNTLSSTPYLLLIAIIPGAIAYYLSGLQRQIEHFVYFTLVLCSCTMLVEGLMMIVATIV  567

Query  1660  PNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGL  1839
             P++LMGII GAG+Q +M+L  G+F+LP  LP + W+YP+YYI FHKYA QG YKNEF GL
Sbjct  568   PDFLMGIITGAGIQGIMMLTSGFFQLPNSLPNIVWKYPMYYISFHKYALQGFYKNEFLGL  627

Query  1840  RLPEETGQIITGEEVLRETLQVEMGHSKWID  1932
              L  E    ++GE+V+ E  QVE GHSKW+D
Sbjct  628   VLNLEGPITVSGEKVIAELFQVETGHSKWVD  658



>gb|EEC84114.1| hypothetical protein OsI_30441 [Oryza sativa Indica Group]
Length=709

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/573 (58%), Positives = 432/573 (75%), Gaps = 9/573 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             FLTWED+WVT  D       IL G+ G ARPGE+LAIMGPSGCGK+TLLD LAGRL+   
Sbjct  92    FLTWEDVWVTAVDSGGKAATILNGVNGSARPGEVLAIMGPSGCGKTTLLDTLAGRLDSNL  151

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             +  G IL+NGR Q LA+GTSAYVTQE+ L ATLTVREA+YYSAQ+QLP ++  +EK   A
Sbjct  152   KMKGQILVNGRCQQLAFGTSAYVTQENVLMATLTVREAIYYSAQIQLPDTMTMAEKLRRA  211

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             + T++EMGL   ++TRIGG        G QKR +SICL+ILTRP+LLFLDEP+SGLDSAA
Sbjct  212   DETVREMGLTGTLDTRIGGRSSKGISGGQQKR-LSICLDILTRPRLLFLDEPTSGLDSAA  270

Query  763   SFYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             SF+VMS+I+ LA+ EG TVVA +HQP +EVF LF  LCLL++G  ++FGPAS A +FF +
Sbjct  271   SFHVMSRIIGLAAREGMTVVAVVHQPCSEVFELFHVLCLLAAGNTIFFGPASMAAEFFAS  330

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPT--EEVINILVNSYKSYHRYR  1113
             NG+PCP ++NPSDHFL+T+NKDFD + ED      R +P   +E I+ILVNSYKS +   
Sbjct  331   NGYPCPPMRNPSDHFLRTVNKDFDKESEDR----LRLMPAVADEAIDILVNSYKSSNTSE  386

Query  1114  EVQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
               +  +  I++ +   + ++ RA F T+++VLTRRSF+NM+RD+GYYWLR+ IYI+++  
Sbjct  387   VAKQDMRHINEMDRMTIGRN-RAGFITKTLVLTRRSFVNMYRDIGYYWLRMAIYISISAC  445

Query  1294  LGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGA  1473
             LG ++ +VGYG+ SI+AR S+L FI++  T MAIGGFPSFVEDMK+F +E LNGHYG   
Sbjct  446   LGTIFYNVGYGSDSIRARSSMLMFISTMLTLMAIGGFPSFVEDMKIFSRERLNGHYGVTT  505

Query  1474  FAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIAS  1653
             F I+NTLSS PYLLLI++IPG IAY+  GLQR+  HF YF LV+    +LVE LMMI+A+
Sbjct  506   FVISNTLSSTPYLLLIAIIPGAIAYYLSGLQRQIEHFVYFTLVLCSCTMLVEGLMMIVAT  565

Query  1654  LVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQ  1833
             +VP++LMGII GAG+Q +M+L  G+F+LP  LP + W+YP+YYI FHKYA QG YKNEF 
Sbjct  566   IVPDFLMGIITGAGIQGIMMLTSGFFQLPNSLPNIVWKYPMYYISFHKYALQGFYKNEFL  625

Query  1834  GLRLPEETGQIITGEEVLRETLQVEMGHSKWID  1932
             GL L  E    ++GE+V+ E  QVE GHSKW+D
Sbjct  626   GLVLNLEGPITVSGEKVIAELFQVETGHSKWVD  658



>emb|CAN81791.1| hypothetical protein VITISV_020569 [Vitis vinifera]
Length=857

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/618 (59%), Positives = 454/618 (73%), Gaps = 43/618 (7%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             FLTW+DLWVTV D + G + IL+ LTGYA+PGE+LAIMGPSGCGKSTLLDALAG      
Sbjct  268   FLTWKDLWVTVPDQQSGRRPILQRLTGYAQPGEVLAIMGPSGCGKSTLLDALAGEX----  323

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
                    I  RTQ       AYVTQ+DTL  TLTVREAV+YSAQLQLP S+P S KKE A
Sbjct  324   -------IFDRTQ-------AYVTQDDTLMTTLTVREAVHYSAQLQLPGSMPTSAKKERA  369

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             EMTI EMGLQD + TRIGG          ++                  DEP+SGLDSAA
Sbjct  370   EMTICEMGLQDCIETRIGGWGKKGLQWWTEEE-----------------DEPTSGLDSAA  412

Query  763   SFYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             S++VM +I+ LA  EG TV+ASIHQPS+EVF LF +LCLLSSG+ VYFGPAS A +FF  
Sbjct  413   SYHVMDRIVKLAHREGITVIASIHQPSSEVFELFHNLCLLSSGKTVYFGPASMANEFFAK  472

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREV  1119
             NGFPCP+L+NPSDH+L+TINKDFD    D+E+G      TEE INILV +YKS    ++V
Sbjct  473   NGFPCPSLRNPSDHYLRTINKDFD---LDIEEGLGGATSTEEAINILVRAYKSSETCQQV  529

Query  1120  QGQVAEISKQEGEVL-KKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGL  1296
             QG+V+EI +Q+G VL KK S+A F TQ +VLT+RSF+NM+RDLGYYWLRL IYI L + +
Sbjct  530   QGRVSEICQQKGGVLEKKGSQASFATQCLVLTKRSFVNMYRDLGYYWLRLAIYIALCLCV  589

Query  1297  GYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAF  1476
             G ++ D+G+   SIQAR S+L F+A+F TFMAIGGFPSFVEDMK+F +E LNGHYG GAF
Sbjct  590   GTIFYDIGFSYGSIQARGSMLMFVAAFLTFMAIGGFPSFVEDMKIFGRERLNGHYGVGAF  649

Query  1477  AIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASL  1656
              I N+LSS+PYLL+ISLIPG IAY+ V LQ+ F HF YFA+++ + M+LVESLMM++AS+
Sbjct  650   VIGNSLSSIPYLLMISLIPGAIAYYLVHLQKGFEHFVYFAILLFVCMMLVESLMMMVASI  709

Query  1657  VPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQG  1836
             VP++LMGII GAG+Q +M+L GG+FRLP DLP  FW+YP+YYI FHKYA QG YKNEF+G
Sbjct  710   VPDFLMGIITGAGIQGVMMLCGGFFRLPNDLPNPFWKYPMYYIAFHKYANQGFYKNEFEG  769

Query  1837  LRLPEET---GQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKA  2007
             L  P         ITGEE+L+   QVEMG+SKWIDL +L  M V+ R++F  ++K  EK 
Sbjct  770   LTFPNNQVGGAPTITGEEILQNVWQVEMGYSKWIDLAILFGMVVLYRLMFXGIIKTVEKV  829

Query  2008  KHVVKAVMRVSPKQSHQV  2061
             K +++ +  V P++S Q+
Sbjct  830   KPMIRGLFXVPPEKSKQI  847



>ref|XP_009393641.1| PREDICTED: ABC transporter G family member 11-like [Musa acuminata 
subsp. malaccensis]
Length=585

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/583 (60%), Positives = 446/583 (77%), Gaps = 8/583 (1%)
 Frame = +1

Query  334   MGPSGCGKSTLLDALAGRLELTTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVRE  513
             MGPSGCGK+TLL+ALAGRL   T+QSG IL+NGR Q L++G SAYVTQ+D L  TLTVRE
Sbjct  1     MGPSGCGKTTLLNALAGRLGARTKQSGHILVNGRRQRLSFGNSAYVTQDDILMTTLTVRE  60

Query  514   AVYYSAQLQLPSSLPRSEKKEIAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSIC  693
             AVYYSA+LQLP ++ RSEK+E AE TI++MGLQ AM+ RIGG + S GISGGQKRRVSIC
Sbjct  61    AVYYSAELQLPKTMTRSEKRERAETTIRDMGLQAAMDARIGGNFSSTGISGGQKRRVSIC  120

Query  694   LEILTRPKLLFLDEPSSGLDSAASFYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftsl  870
             ++ILT PKLLFLDEP+SGLDSAAS++VMS+I++LA  +GRTV+ASIHQP ++VF LF  L
Sbjct  121   IQILTHPKLLFLDEPTSGLDSAASYHVMSRIVNLAKHDGRTVLASIHQPGSDVFELFDDL  180

Query  871   cllssGRVVYFGPASAAIQFFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARG  1050
             CLLS G+ VYFGP S   +FF  NGF CPT  NPSDHFL+TINKDF   DE+ E+G + G
Sbjct  181   CLLSDGKTVYFGPTSGTNEFFALNGFACPTFINPSDHFLRTINKDF---DEEREEGSSAG  237

Query  1051  I-PTEEVINILVNSYKSYHRYREVQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFL  1227
             +    + I++L  +YK Y   + V+ +VAEI   + ++++  ++  FFTQ +VLT+RS +
Sbjct  238   LMNATKAIDVLTTAYKQYKTCQYVERRVAEICNMDRDLVENRAQVSFFTQVLVLTKRSLV  297

Query  1228  NMFRDLGYYWLRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFP  1407
             NM RDLGYYWLRL +Y+ L + +G +++D+G+   SIQAR SVL F+  F TFMAIGGFP
Sbjct  298   NMHRDLGYYWLRLAVYLMLGICIGTLFHDIGHSYGSIQARGSVLMFVGGFLTFMAIGGFP  357

Query  1408  SFVEDMKVFKKETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFA  1587
             SFVEDMK+F  E LNGHYG  AF I+NTLSS P+L L+SLIP    YF +GLQR F HF 
Sbjct  358   SFVEDMKIFGAERLNGHYGVAAFMISNTLSSAPFLALVSLIPAASGYFLIGLQRGFDHFL  417

Query  1588  YFALVILMNMLLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWR  1767
             +F LV+  +M++VE LMMI+AS+VPNYLMGII+GAG+Q LM+L GG+FRLP DLPK  W+
Sbjct  418   FFCLVLFASMMVVEGLMMIVASVVPNYLMGIISGAGIQGLMMLSGGFFRLPGDLPKPVWK  477

Query  1768  YPIYYIDFHKYAYQGLYKNEFQGLRLPEET---GQIITGEEVLRETLQVEMGHSKWIDll  1938
             YP+YYI FHKYA QG YKNEF GL  P         ITGEEV+++  Q+E+G+SKW+DL 
Sbjct  478   YPMYYISFHKYANQGYYKNEFAGLTFPSNQAGGAATITGEEVVKDYWQMEVGYSKWVDLA  537

Query  1939  vlvvmgvvcrvvfllvvKASEKAKHVVKAVMRVSPKQSHQVVA  2067
             +L  M ++ R++FL+VVK +EK K ++  ++   PK++ QVV 
Sbjct  538   ILFAMVIIYRLLFLVVVKMTEKVKPLLVELLNAPPKRTMQVVG  580



>ref|XP_011087909.1| PREDICTED: ABC transporter G family member 11-like isoform X2 
[Sesamum indicum]
Length=631

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/610 (59%), Positives = 446/610 (73%), Gaps = 39/610 (6%)
 Frame = +1

Query  223   FLTWEDLWVTVSDG-RKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELT  399
             +LTWE+LWVTVS G R G K+IL+GLTGYA PGE+LAIMGPSGCGKSTLLDALAGRL   
Sbjct  49    YLTWEELWVTVSTGKRDGAKSILRGLTGYACPGEVLAIMGPSGCGKSTLLDALAGRLSSR  108

Query  400   TRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEI  579
             TRQ G+ILING+ Q LAYGTSAYVTQEDTLT TLTVREAVYYSAQLQLP ++ + EK+EI
Sbjct  109   TRQKGEILINGQKQKLAYGTSAYVTQEDTLTWTLTVREAVYYSAQLQLPITMSKFEKREI  168

Query  580   AEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSA  759
             AE TI+EMGLQD+M+TRIG         G QKRRVSIC E+L RPKLLFLDEP+SGLDSA
Sbjct  169   AERTIREMGLQDSMDTRIGEWGRKGLSGG-QKRRVSICTELLKRPKLLFLDEPTSGLDSA  227

Query  760   ASFYVMSKIMDLASE-GRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFE  936
             AS++VM++I+ LA E G TV+ SIHQP++EVF L  +LCLLSSGR++YFGP+  A     
Sbjct  228   ASYFVMNRIVKLAREYGMTVILSIHQPTSEVFQLLHNLCLLSSGRMIYFGPSWLA-----  282

Query  937   TNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYRE  1116
                                        ++D+EQG       EEVI++L+ SY S    ++
Sbjct  283   ---------------------------NQDIEQGTGSKFTVEEVIDLLIASYNSSDTCKK  315

Query  1117  VQGQVAEISKQEG-EVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             ++  VAEI K+EG    KK+S+A+  TQ ++LT+RSF+NM+RDLGYYWLRL IY+ L  G
Sbjct  316   MKTLVAEIHKREGGPTEKKASQANLLTQCLILTKRSFVNMYRDLGYYWLRLAIYVALGFG  375

Query  1294  LGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGA  1473
             LG ++ +VG   +SI  R S+L FIAS  T MAIGGFPSFVED+KVF++E LNGHYG  A
Sbjct  376   LGSVFYNVGSSYNSIHERGSLLMFIASLLTIMAIGGFPSFVEDLKVFRRERLNGHYGAAA  435

Query  1474  FAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIAS  1653
             F +A+T+SS P+LLLIS IPG I YF  GL      F YF LV+L  M+LVESLMMI+A+
Sbjct  436   FVVAHTVSSTPFLLLISAIPGAITYFLSGLHPGNIEFMYFTLVLLACMMLVESLMMIVAT  495

Query  1654  LVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQ  1833
             ++PN+L+G+I GAG+Q LM+L GG+F+LPKDLP LFW+YP+YY+ FHKYAYQGLYKNEF+
Sbjct  496   IMPNFLLGLIVGAGIQGLMMLSGGFFQLPKDLPTLFWKYPMYYVAFHKYAYQGLYKNEFE  555

Query  1834  GLRLPEET---GQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEK  2004
             G R   +       I GE +LR+  QVEMG+SKW DL VL  M VV RV+F + VK  EK
Sbjct  556   GRRFRNDQLGGPSTIEGETILRDIWQVEMGYSKWTDLAVLFGMVVVYRVLFFVTVKIDEK  615

Query  2005  AKHVVKAVMR  2034
                V+  +++
Sbjct  616   MNSVLAKIVK  625



>emb|CAN81792.1| hypothetical protein VITISV_020570 [Vitis vinifera]
Length=597

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/593 (61%), Positives = 431/593 (73%), Gaps = 39/593 (7%)
 Frame = +1

Query  241   LWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTRQSGDI  420
             LWVTVSD   G +AIL+GL GYA+PGE+LAIMGPSGCGKSTLLDALAGRL   TRQSG+I
Sbjct  7     LWVTVSDDESGRRAILQGLAGYAQPGEVLAIMGPSGCGKSTLLDALAGRLASNTRQSGEI  66

Query  421   LINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAEMTIKE  600
             L+NG  Q LA+GTSAYVTQ+DTL  TLTVREAVYYSAQLQLP S+ RSEKKE AEMTI+E
Sbjct  67    LVNGSKQRLAFGTSAYVTQDDTLMTTLTVREAVYYSAQLQLPDSMSRSEKKERAEMTIRE  126

Query  601   MGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAASFYVMS  780
             MGLQDAMNTRIGG        G QKRRVSIC+EILTRP+LLFLDEP+SGLDSAAS++VMS
Sbjct  127   MGLQDAMNTRIGGWSVKGLSGG-QKRRVSICIEILTRPRLLFLDEPTSGLDSAASYHVMS  185

Query  781   KIMDLA-SEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNGFPCP  957
             +I+ LA  +G TVVASIHQPS+EVF +F +LCLLSSG+ VYFG AS A +FF++NGFPCP
Sbjct  186   RIVKLARHDGITVVASIHQPSSEVFEVFHNLCLLSSGKTVYFGSASMAKEFFDSNGFPCP  245

Query  958   TLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREVQGQVAE  1137
              L+NPSDH+L+TINKDFD+D    EQG      TEE IN L+ SYKS    ++VQ +V E
Sbjct  246   ALRNPSDHYLRTINKDFDSD---TEQGHGGTTNTEEAINTLIKSYKSSEICQQVQCRVYE  302

Query  1138  ISKQEGEVL-KKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLGYMYND  1314
             I + +G +L KK S+A F TQ +VLTRRS +NM+RDLGYYWLRL IYI L + +G ++ D
Sbjct  303   ICQLKGGLLEKKGSQASFITQCLVLTRRSSVNMYRDLGYYWLRLAIYIALCLCVGTIFYD  362

Query  1315  VGYGNSSIQARCSVLAFIASFFTFMAIGGFPSF---------------------------  1413
             +G+   SIQAR S+L F+A+F TFMAIGGFPSF                           
Sbjct  363   IGFSYGSIQARGSMLMFVAAFLTFMAIGGFPSFVEDMKARGSMLMFVAAFLTFMAIGGFP  422

Query  1414  --VEDMKVFKKETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFA  1587
               VEDMK+F +E LNGHYG GAF + NT SS+PYLL+ISLIPG+IAY+ VGL + F HF 
Sbjct  423   SFVEDMKIFGRERLNGHYGVGAFVVGNTFSSIPYLLMISLIPGVIAYYLVGLHKGFEHFV  482

Query  1588  YFALVILMNMLLVESLMMIIASLVPNYLMGIIAGAGLQAL-MILGGGYFRLPKDLPKLFW  1764
             YFAL++ + M+LVESLMMI+AS+VP++LMGII GAG+Q +  +  G           LF 
Sbjct  483   YFALMLFVCMMLVESLMMIVASIVPDFLMGIITGAGIQGVDDVATGASSDCQMIFLSLFG  542

Query  1765  RYPIYYIDFHKYAYQGLYKNEFQGLRLPEETG---QIITGEEVLRETLQVEMG  1914
                   +  HKYA QG YKNEFQGL  P         I+GEE+L+   QV  G
Sbjct  543   DTQCTTLPSHKYANQGFYKNEFQGLTFPNNQAGGPPTISGEEILQNVWQVADG  595



>ref|XP_002438349.1| hypothetical protein SORBIDRAFT_10g013313 [Sorghum bicolor]
 gb|EER89716.1| hypothetical protein SORBIDRAFT_10g013313 [Sorghum bicolor]
Length=728

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/633 (54%), Positives = 462/633 (73%), Gaps = 28/633 (4%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             F+TWED+WVT  DGR     IL GL+G ARPGE+LAIMGPSGCGK+TLLD LAGRL+   
Sbjct  91    FITWEDVWVTAVDGRGHAATILHGLSGSARPGEVLAIMGPSGCGKTTLLDTLAGRLDTNL  150

Query  403   RQSGDILINGRTQTLAYGTS--------------------AYVTQEDTLTATLTVREAVY  522
             R  GDILING+ Q LA+GTS                    AYVTQE+ L ATLTVREA+Y
Sbjct  151   RSKGDILINGQRQKLAFGTSPCLDAATQRKFLEKSVLLEEAYVTQENVLMATLTVREAIY  210

Query  523   YSAQLQLPSSLPRSEKKEIAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEI  702
             YS+Q+QLP ++P ++K  +A+ TI+EMGL  A++TRIGG        G Q++R+SICLEI
Sbjct  211   YSSQIQLPDTMPLAKKLALADETIQEMGLTSALDTRIGGRETKGISGG-QRKRLSICLEI  269

Query  703   LTRPKLLFLDEPSSGLDSAASFYVMSKIMDLA-SEGRTVVASIHQPSTEVfslftslcll  879
             LTRP+LLFLDEP+SGLDSAASF+VM++I DLA  EG T+VA +HQP +EVF LF  LCLL
Sbjct  270   LTRPRLLFLDEPTSGLDSAASFHVMNRIADLAVREGMTIVAVVHQPCSEVFELFHGLCLL  329

Query  880   ssGRVVYFGPASAAIQFFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPT  1059
             +SG+ VYFGPA+ A +FF +NG+PCP ++NPSDHFL TIN+DF++++E  E+   +    
Sbjct  330   ASGQTVYFGPAADAAEFFTSNGYPCPPMRNPSDHFLTTINRDFESENE--ERTVFKPSAA  387

Query  1060  EEVINILVNSYKSYHRYREVQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFR  1239
             +E I+IL+N+YKS +     + ++ +I++  G +++++ +A F T+  VLT+RSF+NM+R
Sbjct  388   DEAISILMNAYKSSNISENAKKEMHDINEMGGLMMRRN-QASFLTKVFVLTKRSFVNMYR  446

Query  1240  DLGYYWLRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVE  1419
             D+GYYWLRLGIY+++++ LG +Y + GYG  SI++R S+L F     T MAIGGFPSFVE
Sbjct  447   DVGYYWLRLGIYVSISLCLGTIYYNFGYGYDSIRSRSSMLMFTGGLLTLMAIGGFPSFVE  506

Query  1420  DMKVFKKETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFAL  1599
             +MK+F++E LNGHYG  AF I+N LS+ PYL+LI+++PG IAY+  GL+R   HF YF L
Sbjct  507   EMKIFRRERLNGHYGVSAFVISNWLSATPYLVLIAVLPGAIAYYLSGLKRGVDHFIYFTL  566

Query  1600  VILMNMLLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIY  1779
             V+    +LVE LMMI+A++VP++LMGII GAG+Q +M+L  G+F++P  LPK+ W+YP++
Sbjct  567   VLCSCTMLVEGLMMIVAAIVPDFLMGIITGAGIQGVMMLNSGFFQIPSKLPKIVWKYPMF  626

Query  1780  YIDFHKYAYQGLYKNEFQGLRLPEETG---QIITGEEVLRETLQVEMGHSKWIDllvlvv  1950
             YI FHKYA QG YKNEF GL L    G   + ITG++V+R   + EMGHSKW+D  VL  
Sbjct  627   YISFHKYALQGFYKNEFLGLVLQNNPGVGDKTITGDQVIRTIFETEMGHSKWVDFAVLCG  686

Query  1951  mgvvcrvvfllvvKASEKAKHVVKAVMRVSPKQ  2049
             M +  R++F+L++K  +K K + K  M   P Q
Sbjct  687   MIIAYRLLFILIIKVVDKLKPIFKGDMFRCPTQ  719



>ref|XP_004962534.1| PREDICTED: ABC transporter G family member 11-like [Setaria italica]
Length=717

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/577 (57%), Positives = 429/577 (74%), Gaps = 10/577 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKA--ILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLEL  396
             FLTWE++ VTV+ G +G  A  IL G++G+ARPGE+LAIMGPSGCGK+TLLD LAGRL  
Sbjct  107   FLTWEEVRVTVAGGARGAPAVDILDGVSGHARPGEVLAIMGPSGCGKTTLLDTLAGRLGP  166

Query  397   TTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKE  576
                ++G ILINGR + LAYGTSAYVTQ++ L +TL+VREAVYYSAQLQLP ++P  EK+ 
Sbjct  167   GMNKTGLILINGRQEKLAYGTSAYVTQDNVLMSTLSVREAVYYSAQLQLPDTMPPPEKRA  226

Query  577   IAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDS  756
              A+  I+EMGL DAM+TRIGG        G Q++RVSIC+E+LTRP+LLFLDEP+SGLDS
Sbjct  227   HADRVIREMGLGDAMDTRIGGRITKGISGG-QRKRVSICIEMLTRPRLLFLDEPTSGLDS  285

Query  757   AASFYVMSKIMDLA-SEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFF  933
             AAS++VMS I  +A  EG TVV+++HQPS +VF LF  LCLL++G+ V+FG  S A +FF
Sbjct  286   AASYHVMSHIARIAVREGMTVVSAVHQPSGDVFELFHGLCLLAAGKTVFFGTTSDATEFF  345

Query  934   ETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYR  1113
               +GFPCP L++PSDHFL+TINKDFD  +E+VE   A      E I+IL  +YKS     
Sbjct  346   TLSGFPCPHLRSPSDHFLRTINKDFD--EENVESSKANRKTAAEAIDILTTAYKSSSYAE  403

Query  1114  EVQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             +   Q+ E+   +G   K+  +A F T+ +VLTRRSFLNM RD+GYYW+RL +Y+ + V 
Sbjct  404   KTTYQIVEMKNMDGASFKRREQAGFCTKLLVLTRRSFLNMHRDIGYYWMRLAVYMGIGVC  463

Query  1294  LGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGA  1473
             LG ++  VGY  SSIQ+RC V+ +  +  TFMAIGGFPSFVED+K+F+KE L+GHYG   
Sbjct  464   LGTIFYQVGYSYSSIQSRCEVIMYTTALLTFMAIGGFPSFVEDVKIFRKERLSGHYGVSE  523

Query  1474  FAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIAS  1653
             F I+NTLS+ PYL +I+++PG + Y+  GL +   HF YF +V+ +  LLVES+MMIIA+
Sbjct  524   FVISNTLSATPYLSVIAVLPGAMLYYLTGLTKGVDHFTYFVIVLCICCLLVESMMMIIAA  583

Query  1654  LVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQ  1833
             +VP++LMGII GAG+Q +M+L GG+FRLP +LPK  W+YP YYI FHKYA QG YKNEF 
Sbjct  584   IVPDFLMGIIIGAGVQGVMMLNGGFFRLPSELPKPVWKYPCYYISFHKYAVQGFYKNEFM  643

Query  1834  GLRLPE----ETGQIITGEEVLRETLQVEMGHSKWID  1932
             GL  P     E+   I+G +VL+  LQVEMG+SKW++
Sbjct  644   GLSFPSDQLVESNVTISGIQVLKSKLQVEMGYSKWVN  680



>gb|KHN41484.1| ABC transporter G family member 11 [Glycine soja]
Length=598

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/568 (63%), Positives = 433/568 (76%), Gaps = 8/568 (1%)
 Frame = +1

Query  334   MGPSGCGKSTLLDALAGRLELTTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVRE  513
             MGPSGCGKSTLLD LAGRL   TRQ+G+ILING+ Q LAYGTSAYVTQ+DTL  TLTV E
Sbjct  1     MGPSGCGKSTLLDTLAGRLGSNTRQTGEILINGKKQALAYGTSAYVTQDDTLLTTLTVGE  60

Query  514   AVYYSAQLQLPSSLPRSEKKEIAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSIC  693
             AV+YSAQLQLP ++P+ EKKE A+ TI+EMGLQDA+NTRIGG        G QKRRVSIC
Sbjct  61    AVHYSAQLQLPDTMPKEEKKERADFTIREMGLQDAINTRIGGWGVKGISGG-QKRRVSIC  119

Query  694   LEILTRPKLLFLDEPSSGLDSAASFYVMSKIMDLASEG---RTVVASIHQPSTEVfslft  864
             +EILTRP LLFLDEP+SGLDSAAS+YVM +I  L  +    RTVVASIHQPS+EVF LF 
Sbjct  120   IEILTRPGLLFLDEPTSGLDSAASYYVMKRIATLDKKDDVHRTVVASIHQPSSEVFQLFD  179

Query  865   slcllssGRVVYFGPASAAIQFFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCA  1044
             +LCLLSSGR VYFGPASAA +FF +NGFPCP L NPSDH LKTINKDFD D E +  G  
Sbjct  180   NLCLLSSGRTVYFGPASAAKEFFASNGFPCPPLMNPSDHLLKTINKDFDQDTE-LNLGGT  238

Query  1045  RGIPTEEVINILVNSYKSYHRYREVQGQVAEIS-KQEGEVLKKSSRADFFTQSIVLTRRS  1221
               IPTEE I ILV+SYKS     EVQ +VA ++ K      KK   A F  Q   LT+RS
Sbjct  239   VTIPTEEAIRILVDSYKSSEMNHEVQKEVAVLTEKNTSSTNKKRRHAGFLNQCFALTKRS  298

Query  1222  FLNMFRDLGYYWLRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGG  1401
              +NM+RDLGYYWLRL IYI LA+ L  ++ D+G    SIQ R S L F++SF TFM IGG
Sbjct  299   SINMYRDLGYYWLRLAIYIALAISLATIFYDLGTSYRSIQDRGSFLMFVSSFMTFMTIGG  358

Query  1402  FPSFVEDMKVFKKETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGH  1581
             FPSFVEDMKVF++E LNGHY   AF I NT S++PYLLL+S+IPG IAY+  GLQ++F H
Sbjct  359   FPSFVEDMKVFERERLNGHYSVTAFVIGNTFSAIPYLLLVSIIPGAIAYYLPGLQKDFEH  418

Query  1582  FAYFALVILMNMLLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLF  1761
             F YF  V+   ++LVESLMMI+AS+VPN+LMGII GAG+Q +MI+GGG+FRLP DLP+ F
Sbjct  419   FVYFICVLFACLMLVESLMMIVASIVPNFLMGIITGAGIQGIMIIGGGFFRLPNDLPRPF  478

Query  1762  WRYPIYYIDFHKYAYQGLYKNEFQGLRLPEET--GQIITGEEVLRETLQVEMGHSKWIDl  1935
             W+YP++Y+ FH+YAYQGL+KNEF+GLR       G  I+GEE+LR+  QV M +SKW DL
Sbjct  479   WKYPMFYVAFHRYAYQGLFKNEFEGLRFATNNVGGGYISGEEILRDMWQVNMSYSKWFDL  538

Query  1936  lvlvvmgvvcrvvfllvvKASEKAKHVV  2019
              +L+ M ++ RV+FL+ +K +EK K ++
Sbjct  539   GILLGMIILYRVLFLINIKTTEKLKPII  566



>ref|XP_003543921.2| PREDICTED: ABC transporter G family member 11-like [Glycine max]
Length=659

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/577 (58%), Positives = 425/577 (74%), Gaps = 11/577 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             FLTWEDL VTV +GR G K ILKGLTGYA+PG+LLAIMGPSGCGKSTLLD LAGRL  +T
Sbjct  60    FLTWEDLQVTVPNGRNGRKPILKGLTGYAKPGQLLAIMGPSGCGKSTLLDTLAGRLAPST  119

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             +Q+G ILING    LAYGTSAYVT +D + +TLTV EAVYYSA LQ P S+   +KKE A
Sbjct  120   KQTGKILINGHKHALAYGTSAYVTHDDAVLSTLTVGEAVYYSAHLQFPESMSNRDKKEKA  179

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             + TI++MGLQDA +TR   G GSKG+S GQKRR++IC+EILT PKLL LDEP+SGLDSAA
Sbjct  180   DFTIRQMGLQDATDTR-IKGKGSKGLSEGQKRRLAICIEILTSPKLLLLDEPTSGLDSAA  238

Query  763   SFYVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFF  933
             S+YVMS+I  L       RT+V SIHQPS+EVF LF +LCLL SG  VYFGP SAA +FF
Sbjct  239   SYYVMSRIASLKIRDGIKRTIVVSIHQPSSEVFELFDNLCLLCSGETVYFGPTSAATEFF  298

Query  934   ETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYR  1113
               NG+PCP L NPSDHFL+ INKDF  DDE+      + +P EE ++ILV  YKS     
Sbjct  299   ALNGYPCPPLHNPSDHFLRIINKDFKLDDEECFN---KTLPKEEAVDILVGFYKSSEISN  355

Query  1114  EVQGQVAEISKQE-GEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAV  1290
             +VQ +VA I + E G + +  ++  F TQ  +L RRS L++FRD+  YWLRL +++  A+
Sbjct  356   QVQKEVAIIGESEHGFMERNRTQTAFLTQCHILVRRSSLHLFRDVSNYWLRLAVFVLAAI  415

Query  1291  GLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMA-IGGFPSFVEDMKVFKKETLNGHYGC  1467
              LG ++ DVG G SSIQAR ++++F+AS  TF+  +GGFP FVE MKVF++E LNGHYG 
Sbjct  416   SLGTIFFDVGSGESSIQARGALVSFVASVLTFITLLGGFPPFVEQMKVFQRERLNGHYGV  475

Query  1468  GAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMII  1647
              AF I++TLS +PY++L+SLIPG+I Y+  GL        YF+ V+L  +L VESLMM++
Sbjct  476   AAFVISHTLSPIPYMVLMSLIPGVITYYLSGLHTGLERCLYFSCVLLACILWVESLMMVV  535

Query  1648  ASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNE  1827
             +S+ PN   GI    G+  +MIL GG+FRLP DLPK FW+YP+YY+ FHKYA+QGL+KNE
Sbjct  536   SSIFPNPNTGITVSGGIMGIMILTGGFFRLPNDLPKPFWKYPMYYVSFHKYAFQGLFKNE  595

Query  1828  FQGLRLP--EETGQIITGEEVLRETLQVEMGHSKWID  1932
             F GL L   ++ G  I+ +E+L +  QVEMGHSKW+D
Sbjct  596   FIGLNLASDQDGGAYISDKEILTKIWQVEMGHSKWVD  632



>ref|XP_010676592.1| PREDICTED: ABC transporter G family member 11-like [Beta vulgaris 
subsp. vulgaris]
Length=627

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/583 (58%), Positives = 428/583 (73%), Gaps = 24/583 (4%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKA--------ILKGLTGYARPGELLAIMGPSGCGKSTLLDAL  378
             +LTW+DL VT  +   GN A        I+KGLTGYA PGE+LA+MGPSGCGKSTLLDAL
Sbjct  21    WLTWKDLCVTAPN--DGNSAAFGSEPLPIVKGLTGYAEPGEVLAVMGPSGCGKSTLLDAL  78

Query  379   AGRLELTTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLP  558
             AGRL    R SG IL+NGR   LA+GTSAYV Q+DTL ATLTVREA++YSA LQLP+S+ 
Sbjct  79    AGRLASNMRLSGQILLNGRKHVLAFGTSAYVAQDDTLMATLTVREAIHYSALLQLPASML  138

Query  559   RSEKKEIAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEP  738
             +SEK   AEM I++MGLQD  N  + GG   + ISGGQKRRVSIC+EILTRP+LLFLDEP
Sbjct  139   KSEKLATAEMAIQKMGLQDCSN-NLIGGRTIRSISGGQKRRVSICMEILTRPQLLFLDEP  197

Query  739   SSGLDSAASFYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPAS  915
             +SGLDSAAS++VM  I+ LA  EG TV+AS+HQPS+EVF LF  LCLLS G++VYFG   
Sbjct  198   TSGLDSAASYHVMRYIISLAKQEGITVIASLHQPSSEVFELFNKLCLLSYGKLVYFGSTP  257

Query  916   AAIQFFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYK  1095
              A  FF  N FPCP+++NPSDH+LK IN DF       E G    + TE  IN LV SYK
Sbjct  258   DAYTFFSVNAFPCPSMRNPSDHYLKIINNDF-------ELGLEGKLSTENNINFLVQSYK  310

Query  1096  SYHRYREVQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIY  1275
             S   +R+VQ +V+ I + EG  L+K S+A F TQS++LT+RSF+NM+RD GYY LRL IY
Sbjct  311   SSEAHRQVQTRVSTICEHEGVKLEKGSQASFITQSLLLTKRSFVNMYRDPGYYRLRLAIY  370

Query  1276  ITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNG  1455
             + + + LG +++ +     SIQAR S+L +I  F TFMAIGGFPSFVEDMK+F++E  NG
Sbjct  371   VVICMCLGILFHGLDDSYGSIQARISMLVYIGGFLTFMAIGGFPSFVEDMKIFERERFNG  430

Query  1456  HYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESL  1635
             HYG G + I+NTLSS+PYLLL+S++PG I Y+  GLQ+ F HF  F L++  +M +VESL
Sbjct  431   HYGVGVYVISNTLSSIPYLLLLSIVPGAITYYLSGLQKGFDHFICFVLLLFASMTMVESL  490

Query  1636  MMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGL  1815
             MMI+AS+VP++LMGII G+G+Q LM+L  GYFRLP DLPKLFW+YP+YYI F  Y  QG 
Sbjct  491   MMIVASIVPDFLMGIITGSGIQGLMMLTSGYFRLPNDLPKLFWKYPMYYISFGTYVNQGF  550

Query  1816  YKNEFQGLRLPEE----TGQIITGEEVLRETLQVEMGHSKWID  1932
             YKNEF+ L   +        +I+GE +L  TLQV+  +SKW+D
Sbjct  551   YKNEFEDLVFYDNDTHGAKHMISGEWILSNTLQVQ-DNSKWVD  592



>gb|KHN41485.1| ABC transporter G family member 11 [Glycine soja]
Length=659

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/577 (58%), Positives = 426/577 (74%), Gaps = 11/577 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             FLTWEDL VTV +GR G K ILKGLTGYA+PG+LLAIMGPSGCGKSTLLD LAGRL  +T
Sbjct  60    FLTWEDLQVTVPNGRNGRKPILKGLTGYAKPGQLLAIMGPSGCGKSTLLDTLAGRLAPST  119

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             +Q+G ILING    LAYGTSAYVT +D + +TLTV EAVYYSA LQ P S+   +KKE A
Sbjct  120   KQTGKILINGHKHALAYGTSAYVTHDDAVLSTLTVGEAVYYSAHLQFPESMSNRDKKEKA  179

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             + TI++MGLQDA +TR   G GSKG+S GQKRR++IC+EILT PKLL LDEP+SGLDSAA
Sbjct  180   DFTIRQMGLQDATDTR-IKGKGSKGLSEGQKRRLAICIEILTSPKLLLLDEPTSGLDSAA  238

Query  763   SFYVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFF  933
             S+YVMS+I  L       RT+V SIHQPS+EVF LF +LCLLSSG  VYFGP SAA +FF
Sbjct  239   SYYVMSRIASLKIRDGIKRTIVVSIHQPSSEVFELFDNLCLLSSGETVYFGPTSAATEFF  298

Query  934   ETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYR  1113
               NG+PCP L NPSDHFL+ INKDF  DDE+      + +P EE ++ILV  YKS     
Sbjct  299   ALNGYPCPPLHNPSDHFLRIINKDFKLDDEECFN---KTLPKEEAVDILVGFYKSSEISN  355

Query  1114  EVQGQVAEISKQE-GEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAV  1290
             +VQ +VA I + E G + +  ++  F TQ  +L RRS L++FRD+  YWLRL +++  A+
Sbjct  356   QVQKEVAIIGESEHGFMERNRTQTAFLTQCHILVRRSSLHLFRDVSNYWLRLSMFVLAAI  415

Query  1291  GLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMA-IGGFPSFVEDMKVFKKETLNGHYGC  1467
              LG ++ DVG G +SIQAR ++++F+AS  TF+  +GGFP FVE MKVF++E LNGHYG 
Sbjct  416   SLGTIFFDVGSGEASIQARGALVSFVASVLTFITLLGGFPPFVEQMKVFQRERLNGHYGV  475

Query  1468  GAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMII  1647
              AF I++TLS +PY++L+SLIPG+I Y+  GL        YF+ V+L  +L VESLMM++
Sbjct  476   AAFVISHTLSPIPYMVLMSLIPGVITYYLSGLHTGLERCLYFSCVLLACILWVESLMMVV  535

Query  1648  ASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNE  1827
             +S+ PN   GI    G+  +MIL GG+FRLP DLPK FW+YP+YY+ FHKYA+QGL+KNE
Sbjct  536   SSIFPNPNTGITVSGGIMGIMILTGGFFRLPNDLPKPFWKYPMYYVSFHKYAFQGLFKNE  595

Query  1828  FQGLRLP--EETGQIITGEEVLRETLQVEMGHSKWID  1932
             F GL L   ++ G  I+ +E+L +  QVEMGHSKW+D
Sbjct  596   FIGLNLASDQDGGAYISDKEILTKIWQVEMGHSKWVD  632



>gb|KHN26505.1| ABC transporter G family member 11, partial [Glycine soja]
Length=585

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/569 (61%), Positives = 422/569 (74%), Gaps = 9/569 (2%)
 Frame = +1

Query  367   LDALAGRLELTTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLP  546
             L  + GRL   TRQ+G+ILINGR Q LAYGTSAYVTQ+DTL  TLTV EAV+YSAQLQLP
Sbjct  1     LSTILGRLGSNTRQTGEILINGRKQALAYGTSAYVTQDDTLLTTLTVGEAVHYSAQLQLP  60

Query  547   SSLPRSEKKEIAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLF  726
              ++ + EKKE A+ TI+EMGLQDA+NTRIGG        G QKRRVSIC+EILTRP LLF
Sbjct  61    DTMSKEEKKERADFTIREMGLQDAINTRIGGWGVKGISGG-QKRRVSICIEILTRPGLLF  119

Query  727   LDEPSSGLDSAASFYVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllssGRVV  897
             LDEP+SGLDSAAS+YVM +I  L  +    RTV+ASIHQPS+EVF LF +LCLLSSGR V
Sbjct  120   LDEPTSGLDSAASYYVMKRIATLDKKDDVHRTVIASIHQPSSEVFQLFDNLCLLSSGRTV  179

Query  898   YFGPASAAIQFFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINI  1077
             YFGPASAA +FF +N FPCP L NPSDH LKTINKDFD D E   QG    IPTEE I I
Sbjct  180   YFGPASAAKEFFASNDFPCPPLMNPSDHLLKTINKDFDQDTELNLQG-TETIPTEEAIRI  238

Query  1078  LVNSYKSYHRYREVQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYW  1257
             LVNSYKS    +EVQ QVA ++++      K   A F  Q   LT+RS +NM+RDLGYYW
Sbjct  239   LVNSYKSSEMNQEVQKQVAVLTEKSTSSTNKRRHAGFLNQCFALTKRSCVNMYRDLGYYW  298

Query  1258  LRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFK  1437
              RL IYI LA+ L  ++ D+G    SIQ R S L F++SF TFM IGGFPSFVEDMKVF+
Sbjct  299   FRLAIYIALAISLATIFCDLGSSYRSIQERGSFLMFVSSFMTFMTIGGFPSFVEDMKVFE  358

Query  1438  KETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNM  1617
             +E LNGHY   AF I NT SS+PYLLL+S+IPG+IAYF  GLQ++F HF YF  V+   +
Sbjct  359   RERLNGHYSVTAFVIGNTFSSIPYLLLVSIIPGVIAYFLPGLQKDFEHFVYFICVLFACL  418

Query  1618  LLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHK  1797
             +LVE LMMI+AS+VPN+L GII GAG+Q +MILG G+FRLP DLPK FW+YP++YI FH+
Sbjct  419   MLVEGLMMIVASIVPNFLTGIITGAGIQGIMILGAGFFRLPNDLPKPFWKYPMFYIAFHR  478

Query  1798  YAYQGLYKNEFQGLRLPEET--GQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrv  1971
             Y YQG++KNEF+GLR       G  I+GEE+LR+  QV   +SKW+DL +++ M +V RV
Sbjct  479   YVYQGMFKNEFEGLRFATNNVGGGYISGEEILRDVWQVNTSYSKWVDLGIVLGMIIVYRV  538

Query  1972  vfllvvKASEKAKHVVKAVMR--VSPKQS  2052
             +FL+ +K +EK K ++ + M    SPK++
Sbjct  539   LFLINIKTTEKLKPIIVSFMSSWSSPKRT  567



>ref|XP_008652262.1| PREDICTED: ABC transporter G family member 11-like isoform X1 
[Zea mays]
Length=722

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/611 (57%), Positives = 444/611 (73%), Gaps = 13/611 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSD---GRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLE  393
             FLTWEDL VT S    G+     IL  ++GYARPGE+LA+MGPSGCGK+TLLDALAGRL 
Sbjct  112   FLTWEDLSVTASSSTGGKAKPAVILDKISGYARPGEVLAVMGPSGCGKTTLLDALAGRLG  171

Query  394   LTTRQS-GDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEK  570
                R++ G+ILINGR + LA+GTSAYVTQE  L ATLTV EAV+YSAQLQLP S+P ++K
Sbjct  172   SDKRRTAGNILINGRREKLAFGTSAYVTQETLLMATLTVTEAVHYSAQLQLPDSVPPADK  231

Query  571   KEIAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGL  750
             +E A+  IK+MGL      RIGG        G Q+RRVSIC+E+L  P L+FLDEP+SGL
Sbjct  232   RERADRAIKQMGLAAVAGHRIGGRVCKGISGG-QRRRVSICVELLASPALVFLDEPTSGL  290

Query  751   DSAASFYVMSKIMDLASEGR-TVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQ  927
             DSAASF+VMS+I  LA   R TVVA++HQPS+EVF LF  LCL++ GR+VYFGPAS AIQ
Sbjct  291   DSAASFHVMSRIAGLARAERVTVVATMHQPSSEVFQLFHGLCLMAYGRMVYFGPASDAIQ  350

Query  928   FFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTE-EVINILVNSYKSYH  1104
             FF++NG+PCP  +NPSDHFL  INKDF+  +E  E   A  +P+  EVI  LV+S  S  
Sbjct  351   FFDSNGYPCPMRRNPSDHFLMMINKDFEELEE--EGSTALLLPSATEVIETLVDSLMS-Q  407

Query  1105  RYREVQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITL  1284
             R   ++ +   + KQ+G    K  +A F T+ +VLT+RS +NM RD+GYYWLR GIYI +
Sbjct  408   RSLAIRNEALFMMKQQGAAFTKKRQATFLTKCVVLTKRSVINMHRDMGYYWLRFGIYIAI  467

Query  1285  AVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYG  1464
              V +G ++ +VGYG +SIQAR S+L F ++  T M+IGGFPSFVEDMKVF+KE LNGHYG
Sbjct  468   CVSIGTIFFNVGYGFASIQARASMLMFTSTLLTMMSIGGFPSFVEDMKVFRKEQLNGHYG  527

Query  1465  CGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMI  1644
               AF IANT+SS  YL +IS+IPG + Y+  GLQR   HF YFA V+    +LVE LMMI
Sbjct  528   ATAFVIANTVSSTLYLGIISIIPGAVCYYLTGLQRRLDHFLYFAAVLWACTMLVEGLMMI  587

Query  1645  IASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKN  1824
             +A+LVP++L+GII G+G+Q L++L  G+FRLP DLPK  W+YP YYI +HKYA QGLYKN
Sbjct  588   VAALVPDFLLGIITGSGIQGLLMLNAGFFRLPHDLPKPLWKYPTYYISYHKYATQGLYKN  647

Query  1825  EFQGLRLPEET---GQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKA  1995
             EF GL   +     G  ++G+ +LR +LQVEMG+SKW+DL +L+ M  + RV+FL+ +K 
Sbjct  648   EFLGLVFDDGVLGKGLTVSGDYILRTSLQVEMGYSKWVDLAILLAMVFIYRVLFLVTIKV  707

Query  1996  SEKAKHVVKAV  2028
              E  K ++K +
Sbjct  708   GEAVKPMIKCM  718



>ref|XP_011043123.1| PREDICTED: ABC transporter G family member 11-like [Populus euphratica]
Length=636

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/578 (59%), Positives = 418/578 (72%), Gaps = 62/578 (11%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             +TWE+L VTVSD + G ++IL+GLTGYARPGE                            
Sbjct  67    ITWENLGVTVSDRKHGCRSILQGLTGYARPGE----------------------------  98

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
                                AYVTQ+D +T TLTVREAV+YSAQLQLP+S+  S+KKE AE
Sbjct  99    -------------------AYVTQDDVITWTLTVREAVFYSAQLQLPNSMSLSKKKERAE  139

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TIKEMGLQD+M+TRIGG       SG QKRRVSIC+EILTRPKLLFLDEP+SGLDSAAS
Sbjct  140   TTIKEMGLQDSMDTRIGGWSNKGLSSG-QKRRVSICIEILTRPKLLFLDEPTSGLDSAAS  198

Query  766   FYVMSKIMDLASEGR-TVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETN  942
             +YVM +++DLA + R T++ASIHQPS++VF LF +LCLLSSGR +YFG +  A +FF+ N
Sbjct  199   YYVMKRMVDLAKQDRMTIIASIHQPSSQVFQLFHNLCLLSSGRTIYFGRSDRANKFFKLN  258

Query  943   GFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREVQ  1122
             GFPCP+ QNPSDH+L TIN DFD   ED++QG      TEE IN LV SYKS H  +++Q
Sbjct  259   GFPCPSHQNPSDHYLHTINTDFD---EDMDQGFHAKKTTEEAINFLVRSYKSSHTCQQIQ  315

Query  1123  GQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLGY  1302
               VAEI   + E LKK  +A+F +Q ++LTRRSF+NM+RDLGYYWLRL IYI L  GLG 
Sbjct  316   RHVAEICSLDREELKKGGQANFISQCLILTRRSFVNMYRDLGYYWLRLAIYIALCSGLGS  375

Query  1303  MYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFAI  1482
             ++ D+G G SSIQAR S+L F ASF T MAIGGFPSFVEDMKVF++E LNGHY   AF +
Sbjct  376   VFYDIGSGYSSIQARGSLLMFTASFLTIMAIGGFPSFVEDMKVFQRERLNGHYRSAAFVV  435

Query  1483  ANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLVP  1662
             +NT+SS P+LL+ISLIPG I Y+ VGLQ+ F  F YF+L +L  M+LVESLM+I+AS++P
Sbjct  436   SNTVSSTPFLLVISLIPGAITYYLVGLQQGFAQFIYFSLTLLACMMLVESLMLIVASIMP  495

Query  1663  NYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGLR  1842
             N+LMG+I GAG+Q LMIL GG+FRLP DLP +FWRYP+YYI FH+YAYQGL+KNEF+GL 
Sbjct  496   NFLMGLITGAGIQGLMILSGGFFRLPHDLPLVFWRYPLYYIAFHRYAYQGLFKNEFEGLA  555

Query  1843  LPEETGQ--------IITGEEVLRETLQVEMGHSKWID  1932
              P   GQ         I GEE+LR   QVEM +SKW+D
Sbjct  556   FP--NGQELQGGGPAYIKGEEILRIIWQVEMRYSKWMD  591



>dbj|BAJ97265.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=711

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/577 (57%), Positives = 426/577 (74%), Gaps = 10/577 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNK--AILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLEL  396
             FLTWED+ VTV+ G  G +  +IL G+TG+A PGE+LAIMGPSGCGK+TLLD LAGRL  
Sbjct  100   FLTWEDVCVTVAGGAYGAQPVSILSGITGHAGPGEVLAIMGPSGCGKTTLLDTLAGRLGP  159

Query  397   TTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKE  576
                Q+G ILINGR + LA+GTSAYVTQ++ L +T++VREAVYYSAQLQLP S+P +EK+ 
Sbjct  160   GITQTGLILINGRREKLAFGTSAYVTQDNVLMSTMSVREAVYYSAQLQLPGSMPAAEKRA  219

Query  577   IAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDS  756
              A+  I+EMGL DAM+TRIGG        G Q++RV+IC+E+LTRP+LLFLDEP+SGLDS
Sbjct  220   HADAVIQEMGLGDAMDTRIGGQMTKGISGG-QRKRVTICVEMLTRPRLLFLDEPTSGLDS  278

Query  757   AASFYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFF  933
             AAS++VMS I  +A+ EG TVVA++HQPS +VF LF  LCLL+  R V+FGPA+ A +FF
Sbjct  279   AASYHVMSHITRVAAREGMTVVAAVHQPSGDVFDLFHRLCLLAYSRTVFFGPAANATKFF  338

Query  934   ETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYR  1113
                GFPCP L+NPSDHFL+TINKDFD  +E VE   A      E I IL ++Y+S     
Sbjct  339   TECGFPCPHLRNPSDHFLRTINKDFD--EEIVESSKASRKTAAEAIKILTDAYQSPAYSE  396

Query  1114  EVQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             ++  ++AE+    G   +K  +A F  +  VLTRRSF+NM RD+GYYW+RLG+Y+ + + 
Sbjct  397   KIMDRIAEMKGIGGAPFRKREQASFSAKLFVLTRRSFVNMHRDIGYYWMRLGVYLGIGIC  456

Query  1294  LGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGA  1473
             LG ++  VG+  SSIQ+RC V+ +  +  TFMAIGGFPSFVED+KVF++E L+GHYG   
Sbjct  457   LGTIFYQVGHSYSSIQSRCEVIMYTTALLTFMAIGGFPSFVEDVKVFRRERLSGHYGVAE  516

Query  1474  FAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIAS  1653
             F I+NTLS+ PY+ +I++IPG + Y+  GL +    FAYF + + M  LLVES+MMIIA+
Sbjct  517   FVISNTLSATPYVAVIAVIPGAMLYYLTGLTKGPDRFAYFVVNLCMCTLLVESMMMIIAA  576

Query  1654  LVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQ  1833
             +VP++LMGII GAG+Q +M+L GG+FRLP +LPK  W+YP YYI FHKYA QG YKNEF 
Sbjct  577   IVPDFLMGIIVGAGVQGVMMLNGGFFRLPNELPKPVWKYPCYYISFHKYAVQGFYKNEFI  636

Query  1834  GLRLPE----ETGQIITGEEVLRETLQVEMGHSKWID  1932
             GL  P     E    I+G  VL+E LQVEMG+SKW++
Sbjct  637   GLTFPSDQLVEKNVTISGLRVLQEKLQVEMGYSKWVN  673



>dbj|BAJ86940.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92282.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=711

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/577 (57%), Positives = 426/577 (74%), Gaps = 10/577 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNK--AILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLEL  396
             FLTWED+ VTV+ G  G +  +IL G+TG+A PGE+LAIMGPSGCGK+TLLD LAGRL  
Sbjct  100   FLTWEDVCVTVAGGAYGAQPVSILSGITGHAGPGEVLAIMGPSGCGKTTLLDTLAGRLGP  159

Query  397   TTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKE  576
                Q+G ILINGR + LA+GTSAYVTQ++ L +T++VREAVYYSAQLQLP S+P +EK+ 
Sbjct  160   GITQTGLILINGRREKLAFGTSAYVTQDNVLMSTMSVREAVYYSAQLQLPGSMPAAEKRA  219

Query  577   IAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDS  756
              A+  I+EMGL DAM+TRIGG        G Q++RV+IC+E+LTRP+LLFLDEP+SGLDS
Sbjct  220   HADAVIQEMGLGDAMDTRIGGQMTKGISGG-QRKRVTICVEMLTRPRLLFLDEPTSGLDS  278

Query  757   AASFYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFF  933
             AAS++VMS I  +A+ EG TVVA++HQPS +VF LF  LCLL+  R V+FGPA+ A +FF
Sbjct  279   AASYHVMSHITRVAAREGMTVVAAVHQPSGDVFDLFHRLCLLAYSRTVFFGPAANATKFF  338

Query  934   ETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYR  1113
                GFPCP L+NPSDHFL+TINKDFD  +E VE   A      E I IL ++Y+S     
Sbjct  339   TECGFPCPHLRNPSDHFLRTINKDFD--EEIVESSKASRKTAAEAIKILTDAYQSPAYSE  396

Query  1114  EVQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             ++  ++AE+    G   +K  +A F  +  VLTRRSF+NM RD+GYYW+RLG+Y+ + + 
Sbjct  397   KIMDRIAEMKGIGGAPFRKREQASFSAKLFVLTRRSFVNMHRDIGYYWMRLGVYLGIGIC  456

Query  1294  LGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGA  1473
             LG ++  VG+  SSIQ+RC V+ +  +  TFMAIGGFPSFVED+KVF++E L+GHYG   
Sbjct  457   LGTIFYQVGHSYSSIQSRCEVIMYTTALLTFMAIGGFPSFVEDVKVFRRERLSGHYGVAE  516

Query  1474  FAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIAS  1653
             F I+NTLS+ PY+ +I++IPG + Y+  GL +    FAYF + + M  LLVES+MMIIA+
Sbjct  517   FVISNTLSATPYVAVIAVIPGAMLYYLTGLTKGPDRFAYFVVNLCMCTLLVESMMMIIAA  576

Query  1654  LVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQ  1833
             +VP++LMGII GAG+Q +M+L GG+FRLP +LPK  W+YP YYI FHKYA QG YKNEF 
Sbjct  577   IVPDFLMGIIVGAGVQGVMMLNGGFFRLPNELPKPVWKYPCYYISFHKYAVQGFYKNEFI  636

Query  1834  GLRLPE----ETGQIITGEEVLRETLQVEMGHSKWID  1932
             GL  P     E    I+G  VL+E LQVEMG+SKW++
Sbjct  637   GLTFPSDQLVEKNVTISGLRVLQEKLQVEMGYSKWVN  673



>ref|XP_008652263.1| PREDICTED: ABC transporter G family member 11-like isoform X2 
[Zea mays]
Length=721

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/611 (57%), Positives = 443/611 (73%), Gaps = 14/611 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSD---GRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLE  393
             FLTWEDL VT S    G+     IL  ++GYARPGE+LA+MGPSGCGK+TLLDALAGRL 
Sbjct  112   FLTWEDLSVTASSSTGGKAKPAVILDKISGYARPGEVLAVMGPSGCGKTTLLDALAGRLG  171

Query  394   LTTRQS-GDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEK  570
                R++ G+ILINGR + LA+GTSAYVTQE  L ATLTV EAV+YSAQLQLP S+P ++K
Sbjct  172   SDKRRTAGNILINGRREKLAFGTSAYVTQETLLMATLTVTEAVHYSAQLQLPDSVPPADK  231

Query  571   KEIAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGL  750
             +E A+  IK+MGL      RIGG        G Q+RRVSIC+E+L  P L+FLDEP+SGL
Sbjct  232   RERADRAIKQMGLAAVAGHRIGGRVCKGISGG-QRRRVSICVELLASPALVFLDEPTSGL  290

Query  751   DSAASFYVMSKIMDLASEGR-TVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQ  927
             DSAASF+VMS+I  LA   R TVVA++HQPS+EVF LF  LCL++ GR+VYFGPAS AIQ
Sbjct  291   DSAASFHVMSRIAGLARAERVTVVATMHQPSSEVFQLFHGLCLMAYGRMVYFGPASDAIQ  350

Query  928   FFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTE-EVINILVNSYKSYH  1104
             FF++NG+PCP  +NPSDHFL  INKDF+  +E  E   A  +P+  EVI  LV+S  S  
Sbjct  351   FFDSNGYPCPMRRNPSDHFLMMINKDFEELEE--EGSTALLLPSATEVIETLVDSLMS-Q  407

Query  1105  RYREVQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITL  1284
             R   ++ +   + KQ G    K  +A F T+ +VLT+RS +NM RD+GYYWLR GIYI +
Sbjct  408   RSLAIRNEALFMMKQ-GAAFTKKRQATFLTKCVVLTKRSVINMHRDMGYYWLRFGIYIAI  466

Query  1285  AVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYG  1464
              V +G ++ +VGYG +SIQAR S+L F ++  T M+IGGFPSFVEDMKVF+KE LNGHYG
Sbjct  467   CVSIGTIFFNVGYGFASIQARASMLMFTSTLLTMMSIGGFPSFVEDMKVFRKEQLNGHYG  526

Query  1465  CGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMI  1644
               AF IANT+SS  YL +IS+IPG + Y+  GLQR   HF YFA V+    +LVE LMMI
Sbjct  527   ATAFVIANTVSSTLYLGIISIIPGAVCYYLTGLQRRLDHFLYFAAVLWACTMLVEGLMMI  586

Query  1645  IASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKN  1824
             +A+LVP++L+GII G+G+Q L++L  G+FRLP DLPK  W+YP YYI +HKYA QGLYKN
Sbjct  587   VAALVPDFLLGIITGSGIQGLLMLNAGFFRLPHDLPKPLWKYPTYYISYHKYATQGLYKN  646

Query  1825  EFQGLRLPEET---GQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKA  1995
             EF GL   +     G  ++G+ +LR +LQVEMG+SKW+DL +L+ M  + RV+FL+ +K 
Sbjct  647   EFLGLVFDDGVLGKGLTVSGDYILRTSLQVEMGYSKWVDLAILLAMVFIYRVLFLVTIKV  706

Query  1996  SEKAKHVVKAV  2028
              E  K ++K +
Sbjct  707   GEAVKPMIKCM  717



>ref|XP_002451306.1| hypothetical protein SORBIDRAFT_05g027420 [Sorghum bicolor]
 gb|EES10294.1| hypothetical protein SORBIDRAFT_05g027420 [Sorghum bicolor]
Length=699

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/579 (56%), Positives = 427/579 (74%), Gaps = 12/579 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKG----NKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRL  390
             FLTWED+ VTV+ G       +  IL G++G+ARPGE++AIMGPSG GK+TLLD LAGRL
Sbjct  87    FLTWEDVRVTVAGGGGPRGAPDVRILDGISGHARPGEVVAIMGPSGGGKTTLLDTLAGRL  146

Query  391   ELTTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEK  570
                  + G ILINGR + LAYGTSAYVTQ++ L +TL+VREAVYYSAQLQLP ++P  EK
Sbjct  147   GPGMNKKGLILINGRQEKLAYGTSAYVTQDNVLMSTLSVREAVYYSAQLQLPDTMPLPEK  206

Query  571   KEIAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGL  750
             +  AE  I+E+GL DAM+TR+GG        G Q++R+SIC+E+LTRP+LLFLDEP+SGL
Sbjct  207   RAHAERVIRELGLGDAMDTRVGGRITKGISGG-QRKRLSICIEMLTRPRLLFLDEPTSGL  265

Query  751   DSAASFYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQ  927
             DSAAS++VMS I  +A+ +  TVVA++HQPS +VF LF  LCLL++GR V+FG  S A +
Sbjct  266   DSAASYHVMSHIARVAARDDMTVVAAVHQPSGDVFELFHGLCLLAAGRTVFFGTISDATE  325

Query  928   FFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHR  1107
             FF  NGFPCP L++PSDHFL+TINKDFD  +E VE    +     E I IL  +Y+S   
Sbjct  326   FFTLNGFPCPHLRSPSDHFLRTINKDFD--EETVESSKTQRKTAAEAIEILATAYRSSDY  383

Query  1108  YREVQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLA  1287
               +   Q+ E+   +G   ++  +A F T+ +VLTRRSFLNM RD+GYYW+RLGIY+ + 
Sbjct  384   IEKTTNQIVEMKNMDGASFRRREQASFATKLLVLTRRSFLNMHRDIGYYWMRLGIYMGIG  443

Query  1288  VGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGC  1467
             V LG ++  VGY  SSIQ+RCSV+ +  +  TFM+IGGFPSFVED+KVF+KE L+GHYG 
Sbjct  444   VCLGTIFYQVGYSYSSIQSRCSVIMYTVALLTFMSIGGFPSFVEDVKVFRKERLSGHYGV  503

Query  1468  GAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMII  1647
               F I+NTLS+ PYL +I+++PG + Y+  GL +   HF YF +V+ +  LLVES+MM+I
Sbjct  504   SEFVISNTLSATPYLSVIAVLPGAMLYYLTGLTKGVDHFIYFVIVVCLCCLLVESMMMVI  563

Query  1648  ASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNE  1827
             A++VP++LMGII GAG+Q +M+L GG+FRLP +LPK  W+YP YYI FHKYA QGLYKNE
Sbjct  564   AAIVPDFLMGIIVGAGVQGVMMLNGGFFRLPNELPKPVWKYPSYYISFHKYAVQGLYKNE  623

Query  1828  FQGLRLPE----ETGQIITGEEVLRETLQVEMGHSKWID  1932
             F GL  P     E+   I+G +VL++ LQVEMG+SKW++
Sbjct  624   FMGLSFPSDQLIESNVTISGIQVLKKNLQVEMGYSKWVN  662



>ref|XP_007047884.1| White-brown complex protein 11 isoform 3 [Theobroma cacao]
 gb|EOX92041.1| White-brown complex protein 11 isoform 3 [Theobroma cacao]
Length=535

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/531 (64%), Positives = 414/531 (78%), Gaps = 13/531 (2%)
 Frame = +1

Query  493   ATLTVREAVYYSAQLQLPSSLPRSEKKEIAEMTIKEMGLQDAMNTRigggwgskgisggQ  672
              TLTVREA+YYSAQLQLP S+ +SEKKE AEMTI+EMGLQD+M+TRIGG        G Q
Sbjct  2     TTLTVREAIYYSAQLQLPDSMSKSEKKERAEMTIREMGLQDSMDTRIGGWSTKGLSGG-Q  60

Query  673   KRRVSICLEILTRPKLLFLDEPSSGLDSAASFYVMSKIMDLAS-EGRTVVASIHQPSTEV  849
             KRRVSIC+EILTRPKLLFLDEP+SGLDSAAS++VMS+I+ LA  +GRTV+ASIHQPS+EV
Sbjct  61    KRRVSICIEILTRPKLLFLDEPTSGLDSAASYHVMSRIVKLARRDGRTVIASIHQPSSEV  120

Query  850   fslftslcllssGRVVYFGPASAAIQFFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDV  1029
             F LF  LCLLSSG+ VYFGP S A QFF TNGFPCP L+NPSDH+L+TINKDFD   ED+
Sbjct  121   FQLFHDLCLLSSGKTVYFGPISMAEQFFATNGFPCPVLRNPSDHYLRTINKDFD---EDI  177

Query  1030  EQGCARGIPTEEVINILVNSYKSYHRYREVQGQVAEISKQEGEVL-KKSSRADFFTQSIV  1206
             EQG    I TE+VI+ LV SYKS   +++V+  V +IS+  G  L KK S+A F TQSIV
Sbjct  178   EQGKG-SINTEKVIDTLVKSYKSSEIWKQVEQHVLKISQNRGGPLEKKGSQASFITQSIV  236

Query  1207  LTRRSFLNMFRDLGYYWLRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTF  1386
             LT+RSF+NM+RDLGYYWLRL IYI L + +G ++ D+G    SIQAR S+L F+A+F TF
Sbjct  237   LTKRSFVNMYRDLGYYWLRLAIYIALCLCVGTIFFDIGLTFGSIQARGSMLMFVAAFLTF  296

Query  1387  MAIGGFPSFVEDMKVFKKETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQ  1566
             MAIGGFPSFVEDMK+F +E LNGHYG GAF I NTLSS+PYL LISLIPG +AY+ VGLQ
Sbjct  297   MAIGGFPSFVEDMKIFGRERLNGHYGVGAFVIGNTLSSVPYLFLISLIPGALAYYLVGLQ  356

Query  1567  REFGHFAYFALVILMNMLLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKD  1746
             + F HFAYF +++   M+LVESLMM +AS+VP++LMGII GAG+Q +M+L GG+FRLP D
Sbjct  357   KSFEHFAYFVILLFTCMMLVESLMMTVASIVPDFLMGIITGAGIQGVMMLNGGFFRLPDD  416

Query  1747  LPKLFWRYPIYYIDFHKYAYQGLYKNEFQGLRLPEETG---QIITGEEVLRETLQVEMGH  1917
             LPK FWRYP+YYI FHKYA QG YKNEFQGL  P         ITG+E+LR   QVEMG+
Sbjct  417   LPKPFWRYPMYYIAFHKYANQGFYKNEFQGLTFPNNQAGGPPTITGDEILRNFWQVEMGY  476

Query  1918  SKWIDllvlvvmgvvcrvvfllvvKASEKAKHVVKAVM---RVSPKQSHQV  2061
             SKWID+ +L  M V+ R++F  ++K  EK K ++KA M    V+P QS Q+
Sbjct  477   SKWIDIAILFGMVVIYRLIFWGIIKTVEKVKPLIKAYMAGKSVAPTQSSQI  527



>emb|CBI25874.3| unnamed protein product [Vitis vinifera]
Length=667

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/487 (66%), Positives = 393/487 (81%), Gaps = 5/487 (1%)
 Frame = +1

Query  397   TTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKE  576
              TRQ+G+ILINGR Q LA+GTSAYVTQ+DTL  TLTVREAV+YSAQLQLP S+P S KKE
Sbjct  3     NTRQAGEILINGRKQRLAFGTSAYVTQDDTLMTTLTVREAVHYSAQLQLPGSMPTSAKKE  62

Query  577   IAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDS  756
              AEMTI EMGLQD + TRIGG        G QKRRVSIC+EILTRPKLLFLDEP+SGLDS
Sbjct  63    RAEMTICEMGLQDCIETRIGGWGKKGLSGG-QKRRVSICIEILTRPKLLFLDEPTSGLDS  121

Query  757   AASFYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFF  933
             AAS++VM +I+ LA  EG TV+ASIHQPS+EVF LF +LCLLSSG+ VYFGPAS A +FF
Sbjct  122   AASYHVMDRIVKLAHREGITVIASIHQPSSEVFELFHNLCLLSSGKTVYFGPASMANEFF  181

Query  934   ETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYR  1113
               NGFPCP+L+NPSDH+L+TINKDFD    D+E+G      TEE INILV +YKS    +
Sbjct  182   AKNGFPCPSLRNPSDHYLRTINKDFD---LDIEEGLGGATSTEEAINILVRAYKSSETCQ  238

Query  1114  EVQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             +VQG+V+EI +Q+G + KK S+A F TQ +VLT+RSF+NM+RDLGYYWLRL IYI L + 
Sbjct  239   QVQGRVSEICQQKGVLEKKGSQASFATQCLVLTKRSFVNMYRDLGYYWLRLAIYIALCLC  298

Query  1294  LGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGA  1473
             +G ++ D+G+   SIQAR S+L F+A+F TFMAIGGFPSFVEDMK+F +E LNGHYG GA
Sbjct  299   VGTIFYDIGFSYGSIQARGSMLMFVAAFLTFMAIGGFPSFVEDMKIFGRERLNGHYGVGA  358

Query  1474  FAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIAS  1653
             F I N+LSS+PYLL+ISLIPG IAY+ V LQ+ F HF YFA+++ + M+LVESLMM++AS
Sbjct  359   FVIGNSLSSIPYLLMISLIPGAIAYYLVHLQKGFEHFVYFAILLFVCMMLVESLMMMVAS  418

Query  1654  LVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQ  1833
             +VP++LMGII GAG+Q +M+L GG+FRLP DLP  FW+YP+YYI FHKYA QG YKNEF+
Sbjct  419   IVPDFLMGIITGAGIQGVMMLCGGFFRLPNDLPNPFWKYPMYYIAFHKYANQGFYKNEFE  478

Query  1834  GLRLPEE  1854
             GL  P  
Sbjct  479   GLTFPNN  485


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 37/54 (69%), Gaps = 4/54 (7%)
 Frame = +1

Query  226  LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGR  387
            LT    WV +S      K  L GLTGYA+PGE+L   GPSGCGKST+LDALAG+
Sbjct  608  LTTSLCWVQLSKVGLSWKP-LPGLTGYAQPGEVL---GPSGCGKSTILDALAGK  657



>ref|XP_008677842.1| PREDICTED: ABC transporter G family member 11-like [Zea mays]
 gb|AFW60110.1| hypothetical protein ZEAMMB73_326327 [Zea mays]
Length=720

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/579 (55%), Positives = 424/579 (73%), Gaps = 10/579 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKG--NKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLEL  396
             FLTWED+ VTV+ G +G  +  IL G+TG+ARPGE+LAIMGPSG GK+TLLD LAGRL  
Sbjct  106   FLTWEDVRVTVAGGPRGAPDVRILDGITGHARPGEVLAIMGPSGGGKTTLLDTLAGRLGP  165

Query  397   TTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKE  576
                ++G ILINGR + LAYGTSAYVTQ++ L +TL+VREAVYYSAQLQLP + P +EK+ 
Sbjct  166   GMNKTGLILINGRQEKLAYGTSAYVTQDNVLMSTLSVREAVYYSAQLQLPDTTPAAEKRA  225

Query  577   IAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDS  756
              AE  I+EMGL DAM+TRIGG        G Q++R+SIC+E+LTRP+LLFLDEP+SGLDS
Sbjct  226   HAERVIREMGLADAMDTRIGGRVTKGISGG-QRKRLSICIEMLTRPRLLFLDEPTSGLDS  284

Query  757   AASFYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFF  933
             AAS++VMS I  +A+ +G TVVA++HQPS +V  LF  LCLL++GR V+FG  S A +FF
Sbjct  285   AASYHVMSHIARVAARDGMTVVAAVHQPSGDVLELFHGLCLLAAGRTVFFGTISDATEFF  344

Query  934   ETNGFPCPTLQNPSDHFLKTINKDFDNDDE-DVEQGCARGIPTEEVINILVNSYKSYHRY  1110
               NGFPCP L++PSDHFL+TINKDFD +   +      R    +E I IL  +Y+S    
Sbjct  345   SLNGFPCPRLRSPSDHFLRTINKDFDEETVVESSDKAKRKTAADEAIEILATAYRSSIYL  404

Query  1111  REVQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAV  1290
              +   Q+ E+   +G   ++   A F T+ +VLTRRSFLNM RD+GYYW+RL IY+ + V
Sbjct  405   DKTTDQIVEMKSMDGASFRRREHASFGTKLLVLTRRSFLNMHRDVGYYWMRLAIYMGIGV  464

Query  1291  GLGYMYNDVGYGN-SSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGC  1467
              LG ++  +GY   SSIQ+RC V+ +  +  TFM+IGGFPSFVED+KVF+KE L+GHYG 
Sbjct  465   CLGTIFYQLGYSTYSSIQSRCEVIMYTIALLTFMSIGGFPSFVEDVKVFRKERLSGHYGV  524

Query  1468  GAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMII  1647
               F I+NT+S+ PYL ++SL+PG + Y+  GL +   HF YF +V+ +  LLVES+MM+I
Sbjct  525   SEFVISNTISATPYLSVVSLLPGAMLYYLTGLSKGADHFVYFVMVLCVCCLLVESMMMVI  584

Query  1648  ASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNE  1827
             A++VP++LMGII GAG+Q +M+L GG+FRLP +LPK  W+YP YY+ FHKYA QGLYKNE
Sbjct  585   AAVVPDFLMGIIVGAGVQGVMMLNGGFFRLPNELPKPVWKYPCYYLSFHKYAVQGLYKNE  644

Query  1828  FQGLRLPE----ETGQIITGEEVLRETLQVEMGHSKWID  1932
             F GL  P     ++   ++G +VL   LQVEMG+SKW++
Sbjct  645   FVGLSFPSDQLVDSNVTVSGLQVLEYKLQVEMGYSKWVN  683



>ref|XP_010647257.1| PREDICTED: ABC transporter G family member 11-like [Vitis vinifera]
Length=534

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/527 (63%), Positives = 413/527 (78%), Gaps = 8/527 (2%)
 Frame = +1

Query  496   TLTVREAVYYSAQLQLPSSLPRSEKKEIAEMTIKEMGLQDAMNTRigggwgskgisggQK  675
             TLTVREAV+YSAQLQLP S+P S KKE AEMTI EMGLQD + TRIGG        G QK
Sbjct  3     TLTVREAVHYSAQLQLPGSMPTSAKKERAEMTICEMGLQDCIETRIGGWGKKGLSGG-QK  61

Query  676   RRVSICLEILTRPKLLFLDEPSSGLDSAASFYVMSKIMDLAS-EGRTVVASIHQPSTEVf  852
             RRVSIC+EILTRPKLLFLDEP+SGLDSAAS++VM +I+ LA  EG TV+ASIHQPS+EVF
Sbjct  62    RRVSICIEILTRPKLLFLDEPTSGLDSAASYHVMDRIVKLAHREGITVIASIHQPSSEVF  121

Query  853   slftslcllssGRVVYFGPASAAIQFFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVE  1032
              LF +LCLLSSG+ VYFGPAS A +FF  NGFPCP+L+NPSDH+L+TINKDFD    D+E
Sbjct  122   ELFHNLCLLSSGKTVYFGPASMANEFFAKNGFPCPSLRNPSDHYLRTINKDFD---LDIE  178

Query  1033  QGCARGIPTEEVINILVNSYKSYHRYREVQGQVAEISKQEGEVLKKSSRADFFTQSIVLT  1212
             +G      TEE INILV +YKS    ++VQG+V+EI +Q+G + KK S+A F TQ +VLT
Sbjct  179   EGLGGATSTEEAINILVRAYKSSETCQQVQGRVSEICQQKGVLEKKGSQASFATQCLVLT  238

Query  1213  RRSFLNMFRDLGYYWLRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMA  1392
             +RSF+NM+RDLGYYWLRL IYI L + +G ++ D+G+   SIQAR S+L F+A+F TFMA
Sbjct  239   KRSFVNMYRDLGYYWLRLAIYIALCLCVGTIFYDIGFSYGSIQARGSMLMFVAAFLTFMA  298

Query  1393  IGGFPSFVEDMKVFKKETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQRE  1572
             IGGFPSFVEDMK+F +E LNGHYG GAF I N+LSS+PYLL+ISLIPG IAY+ V LQ+ 
Sbjct  299   IGGFPSFVEDMKIFGRERLNGHYGVGAFVIGNSLSSIPYLLMISLIPGAIAYYLVHLQKG  358

Query  1573  FGHFAYFALVILMNMLLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLP  1752
             F HF YFA+++ + M+LVESLMM++AS+VP++LMGII GAG+Q +M+L GG+FRLP DLP
Sbjct  359   FEHFVYFAILLFVCMMLVESLMMMVASIVPDFLMGIITGAGIQGVMMLCGGFFRLPNDLP  418

Query  1753  KLFWRYPIYYIDFHKYAYQGLYKNEFQGLRLPEET---GQIITGEEVLRETLQVEMGHSK  1923
               FW+YP+YYI FHKYA QG YKNEF+GL  P         ITGEE+L+   QVEMG+SK
Sbjct  419   NPFWKYPMYYIAFHKYANQGFYKNEFEGLTFPNNQVGGAPTITGEEILQNVWQVEMGYSK  478

Query  1924  WIDllvlvvmgvvcrvvfllvvKASEKAKHVVKAVMRVSPKQSHQVV  2064
             WIDL +L  M V+ R++F+ ++K  EK K +++ +  V P++S Q+V
Sbjct  479   WIDLAILFGMVVLYRLMFMGIIKTVEKVKPMIRGLFVVPPEKSKQIV  525



>ref|XP_003575559.1| PREDICTED: ABC transporter G family member 11-like [Brachypodium 
distachyon]
Length=686

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/575 (56%), Positives = 417/575 (73%), Gaps = 9/575 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             FLTWED+ VTV+ G +    IL G+TG+A PGE+LAIMGPSGCGK+TLLD LAGRL    
Sbjct  78    FLTWEDVCVTVAGGGQ-PVGILSGITGHAGPGEVLAIMGPSGCGKTTLLDTLAGRLGPGI  136

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
              Q+G ILINGR + LA+GTSAYVTQ+  L +TLTVREAVYYSA LQLP ++  +EK+  A
Sbjct  137   NQTGVILINGRPEKLAFGTSAYVTQDSVLMSTLTVREAVYYSAALQLPGAMSAAEKRAHA  196

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             ++ I+EMGL DAM+TRIGG        G Q++RV+IC+E+LTRP+LLFLDEP+SGLDSAA
Sbjct  197   DLVIREMGLGDAMDTRIGGRMRKGISGG-QRKRVTICVEMLTRPRLLFLDEPTSGLDSAA  255

Query  763   SFYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             S++VMS I  +A+ E  TVVA++HQPS +VF LF  LCLL+ G+ V+FG AS A +FF  
Sbjct  256   SYHVMSHIARIAAREAMTVVAAVHQPSGDVFDLFQRLCLLAYGKTVFFGAASDATEFFTR  315

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREV  1119
             +GFPCP L+NPSDHFL+ INKDFD  +E VE    R     E I+IL ++Y S     + 
Sbjct  316   SGFPCPHLRNPSDHFLRIINKDFD--EEIVESSKPRRKTAAEAIDILTDAYHSPDYSEKT  373

Query  1120  QGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLG  1299
               Q++ + +  G   ++  +A F  + +VLTRRSF+NM RD+GYYW+RL +Y+ + + LG
Sbjct  374   MNQISVMKQIVGAPFRRREQASFSAKLLVLTRRSFVNMHRDIGYYWMRLAVYLGIGICLG  433

Query  1300  YMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFA  1479
              ++  VG+  SSIQARC V+ +  +  TFMAIGGFPSFVED+KVF++E L+GHYG   F 
Sbjct  434   TIFYQVGHSYSSIQARCEVIMYTTALLTFMAIGGFPSFVEDVKVFRRERLSGHYGVAEFV  493

Query  1480  IANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLV  1659
             I+NTLS+ PYL +I++I G + Y+  GL R    FAYF + + M  LLVES+MMIIA +V
Sbjct  494   ISNTLSATPYLAVIAVISGAMLYYLTGLSRGTDRFAYFVVNLCMCTLLVESIMMIIAVIV  553

Query  1660  PNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGL  1839
             P++LMGII GAG+Q +M+L GG+FRLP +LPK  W+YP YYI FHKYA QG YKNEF G 
Sbjct  554   PDFLMGIIVGAGVQGVMMLNGGFFRLPNELPKPVWKYPCYYISFHKYAVQGFYKNEFMGQ  613

Query  1840  RLPE----ETGQIITGEEVLRETLQVEMGHSKWID  1932
               P     E    I+G +VL+E LQVEM +SKW++
Sbjct  614   SFPSDQLVEANVTISGLQVLQEKLQVEMWYSKWVN  648



>ref|XP_004955969.1| PREDICTED: ABC transporter G family member 11-like isoform X1 
[Setaria italica]
Length=697

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/648 (54%), Positives = 448/648 (69%), Gaps = 28/648 (4%)
 Frame = +1

Query  97    NRINIVPLDMETAGGVSSMPKDKRPgggaeaakvdvgggggvFLTWEDLWVTVSDGRKGN  276
              R+   PLD   A      P+D RP                 FLTWEDL VT S G+   
Sbjct  70    GRVGCHPLDCVGARDRDLRPEDARPRV---------------FLTWEDLTVTASSGKGSR  114

Query  277   KAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTRQSGDILINGRTQTLAYG  456
               IL  L+G ARPGE+LA+MGPSGCGK+TLLDALAGRL    +++G ILINGR + LA+G
Sbjct  115   AVILDRLSGCARPGEVLALMGPSGCGKTTLLDALAGRLGNDKKKTGSILINGRREKLAFG  174

Query  457   TSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAEMTIKEMGLQDAMNTRig  636
             TSAYVTQE  L ATLTV EAV++SA+LQLP S+P +E++  A+  I++MGL     +RIG
Sbjct  175   TSAYVTQETLLMATLTVAEAVHWSAELQLPGSVPAAERRARADRAIRQMGLAAVAGSRIG  234

Query  637   ggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAASFYVMSKIMDLA-SEGRT  813
             G        G Q+RRVSIC+E+L  P L+FLDEP+SGLDS AS +VMS+I  LA +EG T
Sbjct  235   GRVCKGISGG-QRRRVSICVELLASPALVFLDEPTSGLDSTASLHVMSRIAGLARAEGMT  293

Query  814   VVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNGFPCPTLQNPSDHFLKT  993
             VVA++HQPS+EVF LF  LCLL+ GR+VYFGPA+ AI+FF+ NG+PCP  +NPSDHFL  
Sbjct  294   VVAAVHQPSSEVFQLFHGLCLLAYGRMVYFGPAAEAIEFFDANGYPCPLRRNPSDHFLTM  353

Query  994   INKDFDNDDEDVEQGCARGIPT-EEVINILVNSYKSYHRYREVQGQVAEISKQEGEVLKK  1170
             INKDF+  DE    G    +P  +EVI  LV+S  S    R   G   E    EG  L K
Sbjct  354   INKDFEEFDE----GSTLMLPCADEVIQTLVDSLIS----RGSLGMKNEAFTMEGAPLTK  405

Query  1171  SSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLGYMYNDVGYGNSSIQARC  1350
               +A FFT+  VLT+RS  NM RDLGYYWLR GIYI + V +G ++ +VGY  +SIQAR 
Sbjct  406   KRQATFFTKCAVLTKRSCTNMHRDLGYYWLRFGIYIGICVSIGTIFCNVGYSFASIQARA  465

Query  1351  SVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFAIANTlsslpylllisli  1530
             S++ F ++  T M+IGGFPSFVED+K+F+KE L+GHY   AF I+NTLSS PYL +IS+I
Sbjct  466   SMIMFTSTLLTMMSIGGFPSFVEDLKIFRKEQLSGHYDATAFVISNTLSSTPYLGIISII  525

Query  1531  pGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLVPNYLMGIIAGAGLQALM  1710
             PG IAY+  GLQR F HF YFA V+    +LVE LMMI+A++VP++L+GII G+G+Q L+
Sbjct  526   PGAIAYYLTGLQRSFDHFVYFAAVLWACTMLVEGLMMIVAAIVPDFLLGIITGSGIQGLL  585

Query  1711  ILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGLRLPEETGQ--IITGEEV  1884
             +L  G+FRLP DLPK  W+YP YYI +HKYA QGLYKNEF GL      G+   I+GE +
Sbjct  586   MLNAGFFRLPSDLPKPIWKYPTYYISYHKYATQGLYKNEFLGLAFENLGGEGLTISGEYI  645

Query  1885  LRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAKHVVKAV  2028
             L+  LQVEMG+SKW+DL +L  M ++ RV+FL+++K  E  + ++K +
Sbjct  646   LKTYLQVEMGYSKWVDLAILFAMVLIYRVLFLVIIKVGEAVRPMIKCI  693



>ref|XP_007159118.1| hypothetical protein PHAVU_002G210100g [Phaseolus vulgaris]
 gb|ESW31112.1| hypothetical protein PHAVU_002G210100g [Phaseolus vulgaris]
Length=658

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/577 (56%), Positives = 420/577 (73%), Gaps = 11/577 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             FLTWEDL VTV +GRKG KAILKGLTGYA+PG+LLA+MGPSGCGKSTLLDALAGRL  ++
Sbjct  61    FLTWEDLQVTVPNGRKGRKAILKGLTGYAKPGQLLAVMGPSGCGKSTLLDALAGRLVSSS  120

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             +Q+G ILING    LAYGTSAYVT +D + +TLTV EAVYYSA LQ P S+   EKKE  
Sbjct  121   KQTGKILINGHKHALAYGTSAYVTHDDAVVSTLTVGEAVYYSAHLQFPDSMSNREKKERV  180

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             + TI++MGLQ++ +TR   G GSKG+S GQKRR++IC+EILT PKLL LDEP+SGLDSAA
Sbjct  181   DFTIRQMGLQESTDTR-IKGKGSKGLSEGQKRRLAICIEILTSPKLLLLDEPTSGLDSAA  239

Query  763   SFYVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFF  933
             S+YVMS+I  L       RT+VASIHQPS+EVF LF  LCLLSSG  +YFG  SAA +FF
Sbjct  240   SYYVMSRIASLKIRDGIERTIVASIHQPSSEVFELFDHLCLLSSGETIYFGTTSAATEFF  299

Query  934   ETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYR  1113
              +NGFPCP+L NPSDHFL+ INKDF   D++        +P EE ++ LV  Y S     
Sbjct  300   ASNGFPCPSLHNPSDHFLRIINKDFVLGDKERFHVI---VPKEEAVDTLVKFYNSSEISN  356

Query  1114  EVQGQVAEISKQE-GEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAV  1290
             +VQ +VA I + E G +    ++  F TQ  VL RRS +++FRD+  YWLRL ++    +
Sbjct  357   QVQKEVAAIGESEYGFMGSSKTQTAFLTQCRVLLRRSSVHLFRDVTNYWLRLAMFTVAGI  416

Query  1291  GLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMA-IGGFPSFVEDMKVFKKETLNGHYGC  1467
              +G ++ DVG  NSSIQAR ++++F+A+  T++  +GGFP FVE MKVF++E LNGHYG 
Sbjct  417   SMGTIFYDVGSSNSSIQARGALVSFVATVLTYINLLGGFPPFVEQMKVFQRERLNGHYGV  476

Query  1468  GAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMII  1647
              AF I++TLS +PY++L+S+IPG+I Y+  GL        YF+ V+L  +L VESLMM++
Sbjct  477   AAFVISHTLSPIPYMVLMSVIPGVITYYLSGLHAGLERCIYFSSVLLACILWVESLMMVV  536

Query  1648  ASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNE  1827
             +S+ PN   GI    G+  +MIL GG+FRLP DLPK FW+YP+YY+ FHKYA+QGL+KNE
Sbjct  537   SSIFPNPNTGITVSGGIMGVMILTGGFFRLPNDLPKPFWKYPMYYVSFHKYAFQGLFKNE  596

Query  1828  FQGLRLPEET--GQIITGEEVLRETLQVEMGHSKWID  1932
             F GL+L  +      I+ +E+L +T QVE  HSKW+D
Sbjct  597   FIGLKLTSDRDGATYISDKEILTKTWQVETSHSKWVD  633



>gb|KHN01282.1| ABC transporter G family member 11 [Glycine soja]
Length=645

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/578 (56%), Positives = 430/578 (74%), Gaps = 14/578 (2%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             +TWE+LWVTVS G+K  K IL+ LTGYARPG +LAIMGPSGCGKSTLLDALAGRL    +
Sbjct  44    VTWENLWVTVSSGKK-KKPILQDLTGYARPGRILAIMGPSGCGKSTLLDALAGRLSTNIK  102

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
              +G ILING+ Q LAYGTS YVTQ+D + +TLT  E +YYSAQLQ P S+  +EKKE A+
Sbjct  103   HTGKILINGQKQALAYGTSGYVTQDDAMLSTLTTGETLYYSAQLQFPDSMSIAEKKERAD  162

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
             MT++EMGLQDA+NTR  GGWGSKG+SGGQKRR+SIC+EILTRP+LLFLDEP+SGLDSAAS
Sbjct  163   MTLREMGLQDAINTR-VGGWGSKGLSGGQKRRLSICIEILTRPRLLFLDEPTSGLDSAAS  221

Query  766   FYVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFE  936
             +YVMS+I  L       RT+VASIHQPS+E+F LF  LCLLSSG  VYFGPAS A QFF 
Sbjct  222   YYVMSRIASLNLRDGIRRTIVASIHQPSSEIFELFHDLCLLSSGETVYFGPASDANQFFA  281

Query  937   TNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYRE  1116
             +NGFPCPTL NPSDH+L+ INKDF   ++D EQG  +G+ +E+ I+ LV SYKS    ++
Sbjct  282   SNGFPCPTLHNPSDHYLRIINKDF---EQDAEQGFGKGVISEKAIDNLVKSYKSSQIRKQ  338

Query  1117  VQGQVAEISKQEGEVLKKSS-RADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             V+ +V +I + + + ++K    A F TQ +VL RR+ L +FRD+  YWLRL ++I +A+ 
Sbjct  339   VKKEVNKIGESDSDAIRKQRIHAAFPTQCLVLIRRASLQLFRDISNYWLRLIVFIVIAIS  398

Query  1294  LGYMYNDVGYGNSSIQARCSVLAFIASFFTFMA-IGGFPSFVEDMKVFKKETLNGHYGCG  1470
             +G ++ D+G  N SIQ R S+  F  S  TFM  +GGF   +E++KVF++E LNGHYG  
Sbjct  399   IGSIFYDIGTSNGSIQGRGSLFIFFVSVLTFMTLVGGFSPLLEEIKVFERERLNGHYGVT  458

Query  1471  AFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIA  1650
             AF I N  S++PY+LLISLIPG IAY+  G+ +    F YF  ++   ++ VESLM+++ 
Sbjct  459   AFLIGNIFSAVPYMLLISLIPGGIAYYLCGMHKGPERFFYFTSLLFAIVMWVESLMLVVG  518

Query  1651  SLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEF  1830
             S+ PNY++G+    G++ LMIL GG++RLP DLPK  W+YP+YY+ F KYA+QG +KN+F
Sbjct  519   SICPNYVIGMFLAGGVEGLMILTGGFYRLPNDLPKPLWKYPLYYVSFLKYAFQGSFKNDF  578

Query  1831  QGLRLP-EETGQI---ITGEEVLRETLQVEMGHSKWID  1932
             +GL    ++ G +   ++G EVL +T  +EMG+SKW+D
Sbjct  579   EGLTFSVDQDGGVTRTVSGREVLSDTWHLEMGYSKWVD  616



>ref|NP_001066644.1| Os12g0411700 [Oryza sativa Japonica Group]
 gb|ABA97862.2| ABC-2 type transporter family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF29663.1| Os12g0411700 [Oryza sativa Japonica Group]
 dbj|BAG90512.1| unnamed protein product [Oryza sativa Japonica Group]
Length=713

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/577 (57%), Positives = 421/577 (73%), Gaps = 11/577 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKA--ILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLEL  396
             FLTWED+ VTV    +G+    IL G+TG+ARPGE+LAIMGPSGCGK+TLLD LAGRL  
Sbjct  103   FLTWEDVRVTVPGRTRGSPPARILDGITGHARPGEVLAIMGPSGCGKTTLLDTLAGRLGQ  162

Query  397   TTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKE  576
                Q+G ILINGR + LA+GTSAYVTQ++ L +TL+VREAVYYSA LQLP ++  SEK+ 
Sbjct  163   EMNQTGVILINGRQEKLAFGTSAYVTQDNVLMSTLSVREAVYYSAHLQLPDTMLASEKRA  222

Query  577   IAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDS  756
              AE  I+EMGL D M+TRIGG        G Q++R+SIC+E+LTRP+LLFLDEP+SGLDS
Sbjct  223   HAERVIREMGLSDTMDTRIGGRITKGISGG-QRKRMSICIEMLTRPRLLFLDEPTSGLDS  281

Query  757   AASFYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFF  933
             AAS++VMS I  +A+ EG TV+A++HQPS +VF LF  L LL+ GR+V+FG  S A +FF
Sbjct  282   AASYHVMSHITRVAAREGMTVIAAVHQPSGDVFDLFHGLLLLAYGRMVFFGTVSNATEFF  341

Query  934   ETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYR  1113
               +GFPCP L+NPSDHFL+TINKDFD  +  +E   A      E  NIL N+Y S +   
Sbjct  342   TQSGFPCPHLRNPSDHFLRTINKDFD--EGTMESSKANRKTAAEATNILTNAYHSTYS-E  398

Query  1114  EVQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             +   ++ E+    G   ++  +A F T+ +VLTRRSFLNM RD+GYYW+RLGIY+ + + 
Sbjct  399   KTANEIVEMKGMGGTPFRRKEQASFLTKLLVLTRRSFLNMHRDIGYYWMRLGIYLGIGIC  458

Query  1294  LGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGA  1473
             LG ++  VGY  SSIQ+RC V+ +  +  TFMAIGGFPSFVED+K+F++E L+GHYG   
Sbjct  459   LGTIFYQVGYSYSSIQSRCEVIMYTTALVTFMAIGGFPSFVEDIKLFRRERLSGHYGVME  518

Query  1474  FAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIAS  1653
             F I+NTLS+ PYL +I++IPG + Y+  GL R   HFAYF   + M  LLVES+MMIIA 
Sbjct  519   FVISNTLSATPYLAVIAVIPGAMMYYLTGLTRGAEHFAYFVATLCMCTLLVESMMMIIAV  578

Query  1654  LVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQ  1833
             +VP++LMGII GAG+Q +M+L GG+FRLP +LPK  W+YP YYI FHKYA QG YKNEF 
Sbjct  579   IVPDFLMGIIIGAGIQGMMMLNGGFFRLPNELPKPVWKYPCYYISFHKYAVQGFYKNEFI  638

Query  1834  GLRLPE----ETGQIITGEEVLRETLQVEMGHSKWID  1932
             GL  P     E    I+G +VL+E LQVEMG+SKW++
Sbjct  639   GLSFPSDQLIEANATISGLQVLKERLQVEMGYSKWVN  675



>ref|XP_003543927.2| PREDICTED: ABC transporter G family member 11-like [Glycine max]
Length=686

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/578 (56%), Positives = 430/578 (74%), Gaps = 14/578 (2%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             +TWE+LWVTVS G+K  K IL+ LTGYARPG +LAIMGPSGCGKSTLLDALAGRL    +
Sbjct  85    VTWENLWVTVSSGKK-KKPILQDLTGYARPGRILAIMGPSGCGKSTLLDALAGRLSTNIK  143

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
              +G ILING+ Q LAYGTS YVTQ+D + +TLT  E +YYSAQLQ P S+  +EKKE A+
Sbjct  144   HTGKILINGQKQALAYGTSGYVTQDDAMLSTLTTGETLYYSAQLQFPDSMSIAEKKERAD  203

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
             MT++EMGLQDA+NTR  GGWGSKG+SGGQKRR+SIC+EILTRP+LLFLDEP+SGLDSAAS
Sbjct  204   MTLREMGLQDAINTR-VGGWGSKGLSGGQKRRLSICIEILTRPRLLFLDEPTSGLDSAAS  262

Query  766   FYVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFE  936
             +YVMS+I  L       RT+VASIHQPS+E+F LF  LCLLSSG  VYFGPAS A QFF 
Sbjct  263   YYVMSRIASLNLRDGIRRTIVASIHQPSSEIFELFHDLCLLSSGETVYFGPASDANQFFA  322

Query  937   TNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYRE  1116
             +NGFPCPTL NPSDH+L+ INKDF   ++D EQG  +G+ +E+ I+ LV SYKS    ++
Sbjct  323   SNGFPCPTLHNPSDHYLRIINKDF---EQDAEQGFGKGVISEKAIDNLVKSYKSSQIRKQ  379

Query  1117  VQGQVAEISKQEGEVLKKSS-RADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             V+ +V +I + + + ++K    A F TQ +VL RR+ L +FRD+  YWLRL ++I +A+ 
Sbjct  380   VKKEVNKIGESDSDAIRKQRIHAAFPTQCLVLIRRASLQLFRDISNYWLRLIVFIVIAIS  439

Query  1294  LGYMYNDVGYGNSSIQARCSVLAFIASFFTFMA-IGGFPSFVEDMKVFKKETLNGHYGCG  1470
             +G ++ D+G  N SIQ R S+  F  S  TFM  +GGF   +E++KVF++E LNGHYG  
Sbjct  440   IGSIFYDIGTSNGSIQGRGSLFIFFVSVLTFMTLVGGFSPLLEEIKVFERERLNGHYGVT  499

Query  1471  AFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIA  1650
             AF I N  S++PY+LLISLIPG IAY+  G+ +    F YF  ++   ++ VESLM+++ 
Sbjct  500   AFLIGNIFSAVPYMLLISLIPGGIAYYLCGMHKGPERFFYFTSLLFAIVMWVESLMLVVG  559

Query  1651  SLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEF  1830
             S+ PNY++G+    G++ LMIL GG++RLP DLPK  W+YP+YY+ F KYA+QG +KN+F
Sbjct  560   SICPNYVIGMFLAGGVEGLMILTGGFYRLPNDLPKPLWKYPLYYVSFLKYAFQGSFKNDF  619

Query  1831  QGLRLP-EETGQI---ITGEEVLRETLQVEMGHSKWID  1932
             +GL    ++ G +   ++G EVL +T  +EMG+SKW+D
Sbjct  620   EGLTFSVDQDGGVTRTVSGREVLSDTWHLEMGYSKWVD  657



>gb|AES88369.2| white-brown-complex ABC transporter family protein, putative 
[Medicago truncatula]
Length=578

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/572 (59%), Positives = 432/572 (76%), Gaps = 16/572 (3%)
 Frame = +1

Query  385   RLELTTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRS  564
             RL  +TR++G+ILING  Q L+YGTSAYVTQ+DTL  TLTVREAVYYSAQLQLP S+ + 
Sbjct  4     RLGPSTRRTGEILINGHKQELSYGTSAYVTQDDTLLTTLTVREAVYYSAQLQLPDSMSKE  63

Query  565   EKKEIAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSS  744
             EKKE A+ TI+EMGLQDA NT I GGWG KGISGGQKRRVSIC+EILTRPKLLFLDEP+S
Sbjct  64    EKKERADFTIREMGLQDATNT-IIGGWGVKGISGGQKRRVSICIEILTRPKLLFLDEPTS  122

Query  745   GLDSAASFYVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllssGRVVYFGPAS  915
             GLDSAAS+YVM++I  L  +    RT++ SIHQP TEVF LF +LCLLSSGR+VYFGPAS
Sbjct  123   GLDSAASYYVMTRIATLDHKDGIQRTIITSIHQPGTEVFQLFHNLCLLSSGRLVYFGPAS  182

Query  916   AAIQFFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARG--IPTEEVINILVNS  1089
             AA +FF  NGFPCP LQNPSDH LKTINKDFD   + +E   A    +PTEE I ILVN+
Sbjct  183   AATEFFAMNGFPCPPLQNPSDHLLKTINKDFD---QVIETALADNGTMPTEEAICILVNA  239

Query  1090  YKSYHRYREVQGQVAEISKQEGEVL--KKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLR  1263
             YKS   Y++V  ++A +SK+    L  KK   A F  Q +VL +RS +NMFRDLGYYWLR
Sbjct  240   YKSSEMYQDVHNEIAVLSKKHTSSLDCKKEEHAKFLNQCLVLIKRSSVNMFRDLGYYWLR  299

Query  1264  LGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKV-FKK  1440
              GIY+ LA+ LG +Y D+G    SI+ R S+L+F++ F TFM+IGGFPSFVEDMKV F++
Sbjct  300   FGIYVALAISLGTVYYDLGTNYGSIKDRGSLLSFVSGFLTFMSIGGFPSFVEDMKVVFQR  359

Query  1441  ETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNML  1620
             E  NGHYG  A+ I NT SS+P++ L+++IP  I Y+  GL     HF YFA V+  +++
Sbjct  360   ERQNGHYGVIAYVIGNTFSSIPFIFLVTMIPAAITYYLSGLHNGSEHFLYFAAVLFSSLM  419

Query  1621  LVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKY  1800
             LVESLMMI+AS+VPN+LMGII GAG+QA+MIL GG+F+LP DLPK  WRYP++Y+ FH Y
Sbjct  420   LVESLMMIVASVVPNHLMGIITGAGIQAIMILIGGFFKLPHDLPKPIWRYPLHYVAFHTY  479

Query  1801  AYQGLYKNEFQGLRLPEETGQ----IITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcr  1968
             +++GL+KNE++GLR   + GQ     ITGEE+LR+  Q +M +SKW+DL +L+ M V+ R
Sbjct  480   SFEGLFKNEYEGLRFNVKKGQGTSNYITGEEILRDIWQSDMSYSKWVDLGILLGMIVLYR  539

Query  1969  vvfllvvKASEKAKHVVKAVMRVSPKQSHQVV  2064
             V+FL++ K +EK K V+ +++      S  +V
Sbjct  540   VLFLVITKITEKVKPVLGSLLTCKSISSDTIV  571



>ref|XP_004504818.1| PREDICTED: ABC transporter G family member 11-like isoform X1 
[Cicer arietinum]
Length=631

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/602 (56%), Positives = 439/602 (73%), Gaps = 12/602 (2%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             +TWE+L VTV DG K  K IL+ LTGYA+PG LLAIMGPSG GKSTLLDALAGRL    +
Sbjct  26    VTWENLKVTVPDGNK-RKPILQDLTGYAQPGRLLAIMGPSGSGKSTLLDALAGRLSSNIK  84

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
              +G+ILING  Q LAYG S YVTQ+D + +TLT  E +YYSAQLQ P S+  +EKKE A+
Sbjct  85    HTGNILINGHKQALAYGISGYVTQDDAMLSTLTAGETLYYSAQLQFPDSMSITEKKEQAD  144

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
             + ++EMGL DA+NTR+GG        G QKRR+SIC+EILTRP+LLFLDEP+SGLDSAAS
Sbjct  145   VILREMGLTDAVNTRVGGWGSKGLSGG-QKRRLSICIEILTRPRLLFLDEPTSGLDSAAS  203

Query  766   FYVMSKIMDL-ASEG--RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFE  936
             +YVMS+I  L  S+G  RTVV SIHQPS+EVF LF  LCLLSSG  VYFGP+  A QFF 
Sbjct  204   YYVMSRIASLNLSDGIKRTVVVSIHQPSSEVFELFHDLCLLSSGETVYFGPSYDANQFFA  263

Query  937   TNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYRE  1116
              NGFPCPTL NPSDH+L+ INKDF+    D E+G  +G+ TEE I+ILVNSY+S     +
Sbjct  264   ANGFPCPTLHNPSDHYLRIINKDFE---LDTEEGLGKGVTTEEAIDILVNSYRSSQIRNQ  320

Query  1117  VQGQVAEISKQE-GEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             V+ +VA+IS  + G + KK   A F TQ  VL RRS L +FRD+G YWLRL ++I +A+ 
Sbjct  321   VKKEVAKISGSDSGAIGKKRIHAAFITQCHVLIRRSSLQLFRDIGNYWLRLVVFILIAIS  380

Query  1294  LGYMYNDVGY--GNSSIQARCSVLAFIASFFTFMA-IGGFPSFVEDMKVFKKETLNGHYG  1464
             +G ++ D+G   G++SIQ R S+L F+ S  TFM  +GGF   +E++KVF++E LNGHYG
Sbjct  381   IGSIFYDIGSSKGSNSIQGRGSLLTFLISVLTFMTLVGGFSPLLEEIKVFERERLNGHYG  440

Query  1465  CGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMI  1644
               AF I N LSS+PY+L+ISLIPG IAY+   L +   HF YF  ++   ++ VESLM++
Sbjct  441   ITAFLIGNMLSSVPYILMISLIPGGIAYYLCSLHKGVEHFIYFTCLLFSIVMWVESLMLV  500

Query  1645  IASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKN  1824
             + S+ PNY++G+    G++ LMIL GG++RLP +LPK  W+YP+Y++ F KYA+QG +KN
Sbjct  501   VGSISPNYVIGMFITGGIEGLMILTGGFYRLPNELPKPLWKYPLYHVSFLKYAFQGSFKN  560

Query  1825  EFQGLRLPEETGQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEK  2004
             EF+GLR+  ET + ++G + L +   VEMGHSKW+DL ++  M V+ R++FL + K+ EK
Sbjct  561   EFEGLRVSMETNKTMSGRKALTDIWHVEMGHSKWVDLAIMFGMIVLYRLLFLAITKSKEK  620

Query  2005  AK  2010
              K
Sbjct  621   LK  622



>ref|XP_004504819.1| PREDICTED: ABC transporter G family member 11-like isoform X2 
[Cicer arietinum]
Length=635

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/606 (55%), Positives = 439/606 (72%), Gaps = 16/606 (3%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             +TWE+L VTV DG K  K IL+ LTGYA+PG LLAIMGPSG GKSTLLDALAGRL    +
Sbjct  26    VTWENLKVTVPDGNK-RKPILQDLTGYAQPGRLLAIMGPSGSGKSTLLDALAGRLSSNIK  84

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
              +G+ILING  Q LAYG S YVTQ+D + +TLT  E +YYSAQLQ P S+  +EKKE A+
Sbjct  85    HTGNILINGHKQALAYGISGYVTQDDAMLSTLTAGETLYYSAQLQFPDSMSITEKKEQAD  144

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
             + ++EMGL DA+NTR+GG        G QKRR+SIC+EILTRP+LLFLDEP+SGLDSAAS
Sbjct  145   VILREMGLTDAVNTRVGGWGSKGLSGG-QKRRLSICIEILTRPRLLFLDEPTSGLDSAAS  203

Query  766   FYVMSKIMDL-ASEG--RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFE  936
             +YVMS+I  L  S+G  RTVV SIHQPS+EVF LF  LCLLSSG  VYFGP+  A QFF 
Sbjct  204   YYVMSRIASLNLSDGIKRTVVVSIHQPSSEVFELFHDLCLLSSGETVYFGPSYDANQFFA  263

Query  937   TNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYRE  1116
              NGFPCPTL NPSDH+L+ INKDF+    D E+G  +G+ TEE I+ILVNSY+S     +
Sbjct  264   ANGFPCPTLHNPSDHYLRIINKDFE---LDTEEGLGKGVTTEEAIDILVNSYRSSQIRNQ  320

Query  1117  VQGQVAEIS-----KQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYIT  1281
             V+ +VA+IS     +  G + KK   A F TQ  VL RRS L +FRD+G YWLRL ++I 
Sbjct  321   VKKEVAKISGILKLQDSGAIGKKRIHAAFITQCHVLIRRSSLQLFRDIGNYWLRLVVFIL  380

Query  1282  LAVGLGYMYNDVGY--GNSSIQARCSVLAFIASFFTFMA-IGGFPSFVEDMKVFKKETLN  1452
             +A+ +G ++ D+G   G++SIQ R S+L F+ S  TFM  +GGF   +E++KVF++E LN
Sbjct  381   IAISIGSIFYDIGSSKGSNSIQGRGSLLTFLISVLTFMTLVGGFSPLLEEIKVFERERLN  440

Query  1453  GHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVES  1632
             GHYG  AF I N LSS+PY+L+ISLIPG IAY+   L +   HF YF  ++   ++ VES
Sbjct  441   GHYGITAFLIGNMLSSVPYILMISLIPGGIAYYLCSLHKGVEHFIYFTCLLFSIVMWVES  500

Query  1633  LMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQG  1812
             LM+++ S+ PNY++G+    G++ LMIL GG++RLP +LPK  W+YP+Y++ F KYA+QG
Sbjct  501   LMLVVGSISPNYVIGMFITGGIEGLMILTGGFYRLPNELPKPLWKYPLYHVSFLKYAFQG  560

Query  1813  LYKNEFQGLRLPEETGQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvK  1992
              +KNEF+GLR+  ET + ++G + L +   VEMGHSKW+DL ++  M V+ R++FL + K
Sbjct  561   SFKNEFEGLRVSMETNKTMSGRKALTDIWHVEMGHSKWVDLAIMFGMIVLYRLLFLAITK  620

Query  1993  ASEKAK  2010
             + EK K
Sbjct  621   SKEKLK  626



>ref|XP_003580980.1| PREDICTED: ABC transporter G family member 11-like [Brachypodium 
distachyon]
Length=698

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/611 (56%), Positives = 438/611 (72%), Gaps = 15/611 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKA--ILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLEL  396
             FLTWEDL VT   G   ++   IL GL+G ARPGELLA+MGPSG GK+TLLDALAGRL  
Sbjct  92    FLTWEDLSVTAVSGGSSSEVSLILDGLSGQARPGELLALMGPSGSGKTTLLDALAGRLGP  151

Query  397   TTRQSGDILING-RTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKK  573
               ++ GDILING R   LA+ TSAYVTQE+TL ATLTV EAV+YSAQLQLP S+  +EK+
Sbjct  152   NMKRRGDILINGVRDNKLAFRTSAYVTQENTLMATLTVAEAVHYSAQLQLPDSMSPAEKR  211

Query  574   EIAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLD  753
               A+  I+ MGL     TRI G        G Q++RVSIC+E+L+ P L+FLDEP+SGLD
Sbjct  212   SRADNAIQNMGLAGVSGTRISGRACKGISGG-QRKRVSICMELLSSPALIFLDEPTSGLD  270

Query  754   SAASFYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQF  930
             SAAS++VMS+I  +A  EG TV+A++HQPSTEVF LF  LCLL+ GR VYFGPAS AI+F
Sbjct  271   SAASYHVMSRIAGIAGREGMTVIAAVHQPSTEVFELFHGLCLLAKGRTVYFGPASKAIEF  330

Query  931   FETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIP-TEEVINILVNSYKSYHR  1107
             F+ NGFPCP   NPSDHFL+ IN DF    E+ E+G    +P   EVI  LVNS  S   
Sbjct  331   FDDNGFPCPMRMNPSDHFLRMINTDF----EESEEGSTINLPRAAEVIQTLVNSSSSLGT  386

Query  1108  YREVQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLA  1287
              R  + +  +   Q   V KK  +A F T+S++LT+RSF+NM RDLGYYWLR  IYI L 
Sbjct  387   LR-TKTEATKTIIQSASV-KKKKQASFLTKSVILTKRSFINMHRDLGYYWLRFAIYIALC  444

Query  1288  VGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGC  1467
             + +G +Y ++G+  +SIQAR S+L F ++F T MAIGGFPSFVEDMK+F+KE L+GHY  
Sbjct  445   LSIGTIYFNIGHTYASIQARASMLMFTSTFLTMMAIGGFPSFVEDMKIFEKERLSGHYRA  504

Query  1468  GAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMII  1647
               F IANT+SS+PYL  IS++P  IAY+  GLQR   HF YFA  I  +M+LVE LMMI+
Sbjct  505   TEFVIANTVSSIPYLGFISILPAAIAYYLTGLQRGIDHFVYFAATIWASMMLVEGLMMIV  564

Query  1648  ASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNE  1827
             A++VP++L+GII G+G+Q L++L  G+FRLP DLPK  W+YP Y+I +HKYA QGLYKNE
Sbjct  565   AAIVPDFLLGIITGSGVQGLLMLNAGFFRLPADLPKPVWKYPTYFISYHKYASQGLYKNE  624

Query  1828  FQGLRLPEETGQ---IITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKAS  1998
             F GL   +  G     ITG+ +L+  LQVE+G+SKW+DL +L  M V+ RV+FL+++K S
Sbjct  625   FIGLVFQDLAGARRINITGQYILKNNLQVELGYSKWVDLAILFAMIVIYRVLFLVIIKVS  684

Query  1999  EKAKHVVKAVM  2031
             E AK + + ++
Sbjct  685   EIAKPMKRCLI  695



>ref|XP_003580981.1| PREDICTED: ABC transporter G family member 11-like [Brachypodium 
distachyon]
Length=688

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/612 (55%), Positives = 438/612 (72%), Gaps = 15/612 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDG----RKGNKA-ILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGR  387
             FLTWEDL VT  +G     KG  A IL GL+G ARPGELLA+MGPSG GK+TLLDALAGR
Sbjct  80    FLTWEDLSVTAVNGGSSSDKGRDALILDGLSGQARPGELLALMGPSGSGKTTLLDALAGR  139

Query  388   LELTTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSE  567
             L     + GDILING    LA+GTSAYVTQE+ L AT+TV EAV+YSAQLQLP S+  +E
Sbjct  140   LGPNMERRGDILINGVRDKLAFGTSAYVTQENVLMATMTVAEAVHYSAQLQLPDSMSPAE  199

Query  568   KKEIAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSG  747
             K+  AE  I+ MGL     TRIGG        G Q++RVSIC+E+L+ P L+FLDEP+SG
Sbjct  200   KQARAEDAIQNMGLAGVAGTRIGGRVCKGISGG-QRKRVSICMELLSSPVLVFLDEPTSG  258

Query  748   LDSAASFYVMSKIMDLASEGR-TVVASIHQPSTEVfslftslcllssGRVVYFGPASAAI  924
             LDSAAS++VMS+I  +A   R TVVA++HQPSTEVF LF  LCLL+ GR VYFGPAS AI
Sbjct  259   LDSAASYHVMSRIARIAERNRMTVVAAVHQPSTEVFELFHGLCLLAKGRTVYFGPASKAI  318

Query  925   QFFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYH  1104
             +FF+ NGFPCP   NPSDHFL+ IN DF    E+ E+G    +P    +  ++ S  S  
Sbjct  319   EFFDDNGFPCPLRMNPSDHFLRMINTDF----EESEEGSTINLPHAAQVIQILISSSSSL  374

Query  1105  RYREVQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITL  1284
                + + +  +   Q   V KK  +A F T+S++LT+RSF+NM RDLGYYWLR  IYI L
Sbjct  375   GTLKTKMETTKTLTQSASV-KKKKQASFLTKSVILTKRSFINMHRDLGYYWLRFAIYIAL  433

Query  1285  AVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYG  1464
              + +G +Y +VG+  +SIQAR S+L F ++F T MAIGGFPSFVEDMK+F+KE L+GHYG
Sbjct  434   CLSIGTIYFNVGHSYASIQARASMLMFTSTFLTMMAIGGFPSFVEDMKIFEKERLSGHYG  493

Query  1465  CGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMI  1644
                F IANT+SS+PYL LIS++P  +AY+  GLQR   HF YFA  +  + +LVE LMMI
Sbjct  494   ATEFVIANTVSSIPYLALISILPAAVAYYLTGLQRGIDHFLYFAATLWASTMLVEGLMMI  553

Query  1645  IASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKN  1824
             +A++VP++L+GII G+G+Q L++L  G+FRLP DLPK  W+YP Y+I +HKYA QGLYKN
Sbjct  554   VAAIVPDFLLGIITGSGIQGLLMLNAGFFRLPADLPKPVWKYPTYFISYHKYASQGLYKN  613

Query  1825  EFQGLRLPEETGQ---IITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKA  1995
             EF G+   +  G     ITG+ +L+  LQVE+G+SKW+DL +LV M V+ RV+FL+++K 
Sbjct  614   EFIGMVFQDYDGAGGLNITGQYILKNNLQVELGYSKWVDLAILVAMIVIYRVLFLVIIKV  673

Query  1996  SEKAKHVVKAVM  2031
             SE AK ++K ++
Sbjct  674   SEIAKPMIKCLI  685



>ref|XP_003606172.1| White-brown-complex ABC transporter family [Medicago truncatula]
Length=609

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/601 (57%), Positives = 436/601 (73%), Gaps = 35/601 (6%)
 Frame = +1

Query  355   KSTLLDALAGRLELTTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQ  534
             K T+ +    RL  +TR++G+ILING  Q L+YGTSAYVTQ+DTL  TLTVREAVYYSAQ
Sbjct  6     KETMYNIYKSRLGPSTRRTGEILINGHKQELSYGTSAYVTQDDTLLTTLTVREAVYYSAQ  65

Query  535   LQLPSSLPRSEKKEIAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRP  714
             LQLP S+ + EKKE A+ TI+EMGLQDA NT I GGWG KGISGGQKRRVSIC+EILTRP
Sbjct  66    LQLPDSMSKEEKKERADFTIREMGLQDATNT-IIGGWGVKGISGGQKRRVSICIEILTRP  124

Query  715   KLLFLDEPSSGLDSAASFYVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllss  885
             KLLFLDEP+SGLDSAAS+YVM++I  L  +    RT++ SIHQP TEVF LF +LCLLSS
Sbjct  125   KLLFLDEPTSGLDSAASYYVMTRIATLDHKDGIQRTIITSIHQPGTEVFQLFHNLCLLSS  184

Query  886   GRVVYFGPASAAIQFFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARG--IPT  1059
             GR+VYFGPASAA +FF  NGFPCP LQNPSDH LKTINKDFD   + +E   A    +PT
Sbjct  185   GRLVYFGPASAATEFFAMNGFPCPPLQNPSDHLLKTINKDFD---QVIETALADNGTMPT  241

Query  1060  EEVINILVNSYKSYHRYREVQGQVAEISKQEGEV------LKKSSRADFFTQSIVLTRRS  1221
             EE I ILVN+YKS   Y++V  ++A +SK+   +       KK   A F  Q +VL +RS
Sbjct  242   EEAICILVNAYKSSEMYQDVHNEIAVLSKKVDFMHTSSLDCKKEEHAKFLNQCLVLIKRS  301

Query  1222  FLNMFRDLGYYWLRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGG  1401
              +NMFRDLGYYWLR GIY+ LA+ LG +Y D+G    SI+ R S+L+F++ F TFM+IGG
Sbjct  302   SVNMFRDLGYYWLRFGIYVALAISLGTVYYDLGTNYGSIKDRGSLLSFVSGFLTFMSIGG  361

Query  1402  FPSFVEDMKV----------------FKKETLNGHYGCGAFAIANTlsslpylllislip  1533
             FPSFVEDMKV                F++E  NGHYG  A+ I NT SS+P++ L+++IP
Sbjct  362   FPSFVEDMKVVSKLIYRKTNEVGFSVFQRERQNGHYGVIAYVIGNTFSSIPFIFLVTMIP  421

Query  1534  GMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLVPNYLMGIIAGAGLQALMI  1713
               I Y+  GL     HF YFA V+  +++LVESLMMI+AS+VPN+LMGII GAG+QA+MI
Sbjct  422   AAITYYLSGLHNGSEHFLYFAAVLFSSLMLVESLMMIVASVVPNHLMGIITGAGIQAIMI  481

Query  1714  LGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGLRLPEETGQ----IITGEE  1881
             L GG+F+LP DLPK  WRYP++Y+ FH Y+++GL+KNE++GLR   + GQ     ITGEE
Sbjct  482   LIGGFFKLPHDLPKPIWRYPLHYVAFHTYSFEGLFKNEYEGLRFNVKKGQGTSNYITGEE  541

Query  1882  VLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAKHVVKAVMRVSPKQSHQV  2061
             +LR+  Q +M +SKW+DL +L+ M V+ RV+FL++ K +EK K V+ +++      S  +
Sbjct  542   ILRDIWQSDMSYSKWVDLGILLGMIVLYRVLFLVITKITEKVKPVLGSLLTCKSISSDTI  601

Query  2062  V  2064
             V
Sbjct  602   V  602



>tpg|DAA60273.1| TPA: hypothetical protein ZEAMMB73_786491 [Zea mays]
Length=714

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/631 (53%), Positives = 429/631 (68%), Gaps = 61/631 (10%)
 Frame = +1

Query  223   FLTWEDLWVTVSD---GRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLE  393
             FLTWEDL VT S    G+     IL  ++GYARPGE+LA+MGPSGCGK+TLLDALAGRL 
Sbjct  112   FLTWEDLSVTASSSTGGKAKPAVILDKISGYARPGEVLAVMGPSGCGKTTLLDALAGRLG  171

Query  394   LTTRQS-GDILINGRTQTLAYGTS---------------------AYVTQEDTLTATLTV  507
                R++ G+ILINGR + LA+GTS                     AYVTQE  L ATLTV
Sbjct  172   SDKRRTAGNILINGRREKLAFGTSNNVTSSGGWCTMHTCLLIALKAYVTQETLLMATLTV  231

Query  508   REAVYYSAQLQLPSSLPRSEKKEIAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVS  687
              EAV+YSAQLQLP S+P ++K+E A+  IK+MGL      RIGG        G Q+RRVS
Sbjct  232   TEAVHYSAQLQLPDSVPPADKRERADRAIKQMGLAAVAGHRIGGRVCKGISGG-QRRRVS  290

Query  688   ICLEILTRPKLLFLDEPSSGLDSAASFYVMSKIMDLASEGR-TVVASIHQPSTEVfslft  864
             IC+E+L  P L+FLDEP+SGLDSAASF+VMS+I  LA   R TVVA++HQPS+EVF LF 
Sbjct  291   ICVELLASPALVFLDEPTSGLDSAASFHVMSRIAGLARAERVTVVATMHQPSSEVFQLFH  350

Query  865   slcllssGRVVYFGPASAAIQFFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCA  1044
              LCL++ GR+VYFGPAS AIQFF++NG+PCP  +NPSDHFL  INKDF+           
Sbjct  351   GLCLMAYGRMVYFGPASDAIQFFDSNGYPCPMRRNPSDHFLMMINKDFE-----------  399

Query  1045  RGIPTEEVINILVNSYKSYHRYREVQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSF  1224
                                 R   ++ +   + KQ+G    K  +A F T+ +VLT+RS 
Sbjct  400   --------------------RSLAIRNEALFMMKQQGAAFTKKRQATFLTKCVVLTKRSV  439

Query  1225  LNMFRDLGYYWLRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGF  1404
             +NM RD+GYYWLR GIYI + V +G ++ +VGYG +SIQAR S+L F ++  T M+IGGF
Sbjct  440   INMHRDMGYYWLRFGIYIAICVSIGTIFFNVGYGFASIQARASMLMFTSTLLTMMSIGGF  499

Query  1405  PSFVEDMKVFKKETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHF  1584
             PSFVEDMKVF+KE LNGHYG  AF IANT+SS  YL +IS+IPG + Y+  GLQR   HF
Sbjct  500   PSFVEDMKVFRKEQLNGHYGATAFVIANTVSSTLYLGIISIIPGAVCYYLTGLQRRLDHF  559

Query  1585  AYFALVILMNMLLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFW  1764
              YFA V+    +LVE LMMI+A+LVP++L+GII G+G+Q L++L  G+FRLP DLPK  W
Sbjct  560   LYFAAVLWACTMLVEGLMMIVAALVPDFLLGIITGSGIQGLLMLNAGFFRLPHDLPKPLW  619

Query  1765  RYPIYYIDFHKYAYQGLYKNEFQGLRLPEET---GQIITGEEVLRETLQVEMGHSKWIDl  1935
             +YP YYI +HKYA QGLYKNEF GL   +     G  ++G+ +LR +LQVEMG+SKW+DL
Sbjct  620   KYPTYYISYHKYATQGLYKNEFLGLVFDDGVLGKGLTVSGDYILRTSLQVEMGYSKWVDL  679

Query  1936  lvlvvmgvvcrvvfllvvKASEKAKHVVKAV  2028
              +L+ M  + RV+FL+ +K  E  K ++K +
Sbjct  680   AILLAMVFIYRVLFLVTIKVGEAVKPMIKCM  710



>ref|XP_007159124.1| hypothetical protein PHAVU_002G210700g [Phaseolus vulgaris]
 gb|ESW31118.1| hypothetical protein PHAVU_002G210700g [Phaseolus vulgaris]
Length=664

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/577 (56%), Positives = 420/577 (73%), Gaps = 13/577 (2%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             +TW++LWVTVS G+K  K IL+GLTGYA PG +LAIMGPSGCGKSTLLD+LAGRL    +
Sbjct  57    VTWDNLWVTVSSGKK-KKPILQGLTGYASPGRILAIMGPSGCGKSTLLDSLAGRLSSKMK  115

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
              +G ILING+ QTLAYGTS YVTQED + +TLT  E +YYSAQLQ P S+  +EKKE A+
Sbjct  116   HTGKILINGQKQTLAYGTSGYVTQEDAMLSTLTAGETLYYSAQLQFPDSMSTAEKKEQAD  175

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
             +T++EMGLQ A+NTR  GGWGSKG+SGGQKRR+SIC+EILTRP+LLFLDEP+SGLDSAAS
Sbjct  176   ITLREMGLQGAINTR-VGGWGSKGLSGGQKRRLSICIEILTRPRLLFLDEPTSGLDSAAS  234

Query  766   FYVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFE  936
             +YVMS+I  L       RT+VASIHQPS+EVF LF  LCLLSSG  VYFGPAS A QFF 
Sbjct  235   YYVMSRIATLNLRDGIRRTIVASIHQPSSEVFELFHDLCLLSSGETVYFGPASDANQFFA  294

Query  937   TNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYRE  1116
             +NGFPCPTL NPSDH+L+ INKDF   ++D E+G  +G+ TE+ I+ LV SY+     ++
Sbjct  295   SNGFPCPTLHNPSDHYLRMINKDF---EQDAEEGFGKGVSTEKAIDTLVKSYRLSQVRKQ  351

Query  1117  VQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGL  1296
             V+ ++ +I + +    +K   A F TQ  VL RRS L  FRD+  YWLRL ++I +A+ +
Sbjct  352   VKREMQKIVECDSCEKRKRIHAAFPTQCFVLIRRSSLQFFRDISNYWLRLIVFIVIAISI  411

Query  1297  GYMYNDVGYGNSSIQARCSVLAFIASFFTFMA-IGGFPSFVEDMKVFKKETLNGHYGCGA  1473
             G ++ ++G  N SIQ R S+L F  S  TFM  +GGF   +E+MKVF++E LNGHYG  A
Sbjct  412   GSIFYNIGTDNGSIQGRGSLLIFFVSVLTFMTLVGGFSPLLEEMKVFERERLNGHYGITA  471

Query  1474  FAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIAS  1653
             F I +T S++PY+++ISLIPG IAY   GL +    F YF  ++   ++ VESLM++I S
Sbjct  472   FLIGHTFSAVPYMVMISLIPGGIAYHLCGLHKGLDRFFYFTCLLFGIVMWVESLMLVIGS  531

Query  1654  LVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQ  1833
             + PNY++G+    G++ LMI+ GG++RLP DLPK  W+YP YY+ F KYA QG +KN+F 
Sbjct  532   ISPNYVIGMFLAGGVEGLMIVTGGFYRLPNDLPKPLWKYPFYYVSFLKYALQGSFKNDFD  591

Query  1834  GLRL---PEETGQI-ITGEEVLRETLQVEMGHSKWID  1932
             GL     P+  G   ++G EVL  T  VEM HSKW+D
Sbjct  592   GLTFSVNPDGGGTASMSGREVLAHTWHVEMNHSKWVD  628



>ref|XP_002323751.2| hypothetical protein POPTR_0017s07790g, partial [Populus trichocarpa]
 gb|EEF03884.2| hypothetical protein POPTR_0017s07790g, partial [Populus trichocarpa]
Length=522

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/557 (60%), Positives = 413/557 (74%), Gaps = 44/557 (8%)
 Frame = +1

Query  385   RLELTTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRS  564
             RL+ +T+ +G++LINGR Q LAYGTSAYVTQ+D +T TLTVREAV+YSAQLQLP+S+  S
Sbjct  1     RLDSSTKHTGEVLINGRKQPLAYGTSAYVTQDDVITWTLTVREAVFYSAQLQLPNSMSLS  60

Query  565   EKKEIAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSS  744
             +KKE AE TIKEMGLQD+M+TRIGG       SG QKRRVSIC+EILTRPKLLFLDEP+S
Sbjct  61    KKKERAETTIKEMGLQDSMDTRIGGWSNKGLSSG-QKRRVSICIEILTRPKLLFLDEPTS  119

Query  745   GLDSAASFYVMSKIMDLASEGR-TVVASIHQPSTEVfslftslcllssGRVVYFGPASAA  921
             GLDSAAS+YVM +++DLA + R T++ASIHQPS++VF LF +LCLLSSGR +YFG +  A
Sbjct  120   GLDSAASYYVMKRMVDLAKQDRMTIIASIHQPSSQVFQLFHNLCLLSSGRTIYFGRSDRA  179

Query  922   IQFFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSY  1101
              +FFE NGFPCP+ QNPSDH+L TIN DFD                 EV    VN  KS 
Sbjct  180   NKFFELNGFPCPSHQNPSDHYLHTINTDFD-----------------EVCT--VNRDKS-  219

Query  1102  HRYREVQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYIT  1281
                        EI  +E   LKK S+A+F +Q ++LTRRSF+NM+RDLGYYWLRL IYI 
Sbjct  220   ---------CLEILLEE---LKKGSQANFISQCLILTRRSFVNMYRDLGYYWLRLAIYIA  267

Query  1282  LAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHY  1461
             L  GLG ++ D+G G SSIQAR S+L F ASF T MAIGGFPSFVEDMKVF++E LNGHY
Sbjct  268   LCSGLGSVFYDIGSGYSSIQARGSLLMFTASFLTIMAIGGFPSFVEDMKVFQRERLNGHY  327

Query  1462  GCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMM  1641
                AF ++NT+SS P+LL+ISLIPG I Y+ VGLQ+    F YFAL +L  M+LVESLM+
Sbjct  328   QSAAFVVSNTVSSTPFLLVISLIPGAITYYLVGLQQGCAQFIYFALTLLACMMLVESLML  387

Query  1642  IIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYK  1821
             I+AS++PN+LMG+I GAG+Q LMIL GG+FRLP DLP +FWRYP+YYI FH+YAYQGL+K
Sbjct  388   IVASIMPNFLMGLITGAGIQGLMILSGGFFRLPHDLPLVFWRYPLYYIAFHRYAYQGLFK  447

Query  1822  NEFQGLRLPEETGQI--------ITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvf  1977
             NEF+GL  P   GQ+        I GEE+LR   QVEM +SKW+DL +L  M    R++ 
Sbjct  448   NEFEGLTFPN--GQVLQGGGPAYIKGEEILRIIWQVEMRYSKWMDLAMLFAMVAFYRLML  505

Query  1978  llvvKASEKAKHVVKAV  2028
             L+V+   EK K +++ +
Sbjct  506   LIVLGTVEKFKPIIREI  522



>ref|XP_010321482.1| PREDICTED: ABC transporter G family member 11-like [Solanum lycopersicum]
Length=530

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/523 (61%), Positives = 405/523 (77%), Gaps = 9/523 (2%)
 Frame = +1

Query  496   TLTVREAVYYSAQLQLPSSLPRSEKKEIAEMTIKEMGLQDAMNTRigggwgskgisggQK  675
             TLTV+EA+YYSAQLQLP S+  SEK+E  E TI+EMGLQDAMNTRIGG        G QK
Sbjct  3     TLTVKEAIYYSAQLQLPDSMSISEKRERGEETIREMGLQDAMNTRIGGWSVKGLSGG-QK  61

Query  676   RRVSICLEILTRPKLLFLDEPSSGLDSAASFYVMSKIMDLASE-GRTVVASIHQPSTEVf  852
             RRVSIC+EIL RPKLLFLDEP+SGLDSAAS++VM+KI+ LA + GRT+VASIHQPS+EVF
Sbjct  62    RRVSICIEILKRPKLLFLDEPTSGLDSAASYHVMNKIVQLAKQDGRTIVASIHQPSSEVF  121

Query  853   slftslcllssGRVVYFGPASAAIQFFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVE  1032
              LF +LCLLSSGR+VYFG  S A ++F  NGFPCPT++NPSDH+L+TINKDFD    D+E
Sbjct  122   QLFHNLCLLSSGRIVYFGNISNANEYFALNGFPCPTMRNPSDHYLRTINKDFD---IDIE  178

Query  1033  QGCARGIPTEEVINILVNSYKSYHRYREVQGQVAEISKQEG-EVLKKSSRADFFTQSIVL  1209
             +G        E I+ILV SYK+    ++VQ +V EI +Q G E  +K  +A F TQ +VL
Sbjct  179   KGVGGKATATEAIDILVKSYKTSQGCQQVQRKVLEICQQSGGEEAEKGRQAGFITQCMVL  238

Query  1210  TRRSFLNMFRDLGYYWLRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFM  1389
             TRRSF+NM+RDLGYYWLR  IYI L + +G +++D+G+   SIQAR S+L F+A+F TFM
Sbjct  239   TRRSFVNMYRDLGYYWLRFAIYIALCLCVGTIFHDIGHDYGSIQARGSMLMFVAAFLTFM  298

Query  1390  AIGGFPSFVEDMKVFKKETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQR  1569
             AIGGFPSFVEDMK+F +E LNGHYG  A+ + NT SS+PYL+LIS+IPG IAY+ VGLQ+
Sbjct  299   AIGGFPSFVEDMKIFTRERLNGHYGVAAYVVGNTFSSIPYLILISVIPGAIAYYLVGLQK  358

Query  1570  EFGHFAYFALVILMNMLLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDL  1749
              F HFAYF+LV+   M+LVESLMMI+AS+VP++LMGII GAG+Q +M+L GG+FRLP DL
Sbjct  359   GFDHFAYFSLVLFATMMLVESLMMIVASIVPDFLMGIITGAGIQGVMMLNGGFFRLPNDL  418

Query  1750  PKLFWRYPIYYIDFHKYAYQGLYKNEFQGLRLPEETGQ---IITGEEVLRETLQVEMGHS  1920
             PK FW+YP+YYI FHKYA QG YKNEF GL  P E  +   +I+GEE+L+   QV+MG+S
Sbjct  419   PKPFWKYPMYYIAFHKYANQGFYKNEFLGLNFPNEQIRGPAMISGEEILKNVWQVQMGYS  478

Query  1921  KWIDllvlvvmgvvcrvvfllvvKASEKAKHVVKAVMRVSPKQ  2049
             KW+D+ ++  M ++ R++FL ++K  EK K +++A M  S K 
Sbjct  479   KWVDVAIIFGMVILYRLMFLGIIKTVEKVKPMIRAFMAHSSKN  521



>dbj|BAJ96411.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=677

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/608 (54%), Positives = 430/608 (71%), Gaps = 14/608 (2%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             FLTW+DL VT  +GRK    IL  L+GYARPGE+LA+MGPSGCGK+TLLDALAGRL    
Sbjct  76    FLTWKDLAVTAINGRKDRAVILDKLSGYARPGEVLALMGPSGCGKTTLLDALAGRLGPNM  135

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             ++SGDI+ING  Q +A  TSAYVTQED L  TLTV EAV+YSAQLQLP SL  +EK+  A
Sbjct  136   KESGDIMINGCRQKIASRTSAYVTQEDVLMVTLTVAEAVHYSAQLQLPDSLTPAEKRSWA  195

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             +  IK+MGL     TRIGG        G Q++RVSIC+E+L  P L+FLDEP+SGLDSAA
Sbjct  196   DDVIKQMGLAAVAGTRIGGRVSKGISGG-QRKRVSICIELLASPALIFLDEPTSGLDSAA  254

Query  763   SFYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             S++VMS+I  +A   G TVVA+IHQPSTEVF LF  LCLL++GR VYFGPAS A++FF+ 
Sbjct  255   SYHVMSRIAGIAKRNGTTVVAAIHQPSTEVFELFHGLCLLANGRTVYFGPASKAMEFFDA  314

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIP-TEEVINILVNSYKSYHRYRE  1116
             NGFPCP   NPSDHFL+ IN DF    E+ E       P   +VI  LV S         
Sbjct  315   NGFPCPLRMNPSDHFLRMINLDF----EEFEGESTVNAPHASKVIQTLVGSASPV----A  366

Query  1117  VQGQVAEISK-QEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             + G   E  +  +GE + +  +A F T+S+VLT+RS +NM RD+GYYWLRL I + L + 
Sbjct  367   ILGPEMEARQTNQGEYVLQQRQATFLTKSVVLTKRSMINMHRDIGYYWLRLAINMGLFLT  426

Query  1294  LGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGA  1473
             +G ++ +VG+  +SIQAR S++ + ++F T MAIG FPSFVEDMK+F+KE  +GHYG   
Sbjct  427   IGTIFFNVGHNYASIQARASMIMYTSTFMTMMAIGAFPSFVEDMKIFEKERRSGHYGVTE  486

Query  1474  FAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIAS  1653
             F IANTLSS  YL LIS++P  IAY+  GLQR   H  +F   +    +LVE LMMI+A+
Sbjct  487   FVIANTLSSTIYLGLISVLPAAIAYYLTGLQRGICHLLFFVATLWACTMLVEGLMMIVAA  546

Query  1654  LVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQ  1833
             +VP++L+GII G+G+Q L++L  G+FRLP DLPK  W+YP YYI +HKY  QGLYKNEF 
Sbjct  547   IVPDFLLGIITGSGVQGLLMLNAGFFRLPNDLPKPIWKYPTYYISYHKYTTQGLYKNEFF  606

Query  1834  GLRLPEETG--QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKA  2007
             GL  P   G   +ITG+ +L+  LQVE+G+SKW+DL +L+ M ++ RV+FL+++K S+ A
Sbjct  607   GLVFPNLAGVDGVITGQYILKNNLQVELGYSKWVDLAILLGMVIIYRVIFLVLIKVSDVA  666

Query  2008  KHVVKAVM  2031
             K ++K+ M
Sbjct  667   KPMIKSFM  674



>gb|AES90636.2| white-brown-complex ABC transporter family protein [Medicago 
truncatula]
Length=632

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/615 (54%), Positives = 445/615 (72%), Gaps = 13/615 (2%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             +TWE+L   V++G K  K IL GLTGYA+PG+LLA+MGPSGCGKSTLLDALAGRL+   +
Sbjct  13    VTWENLEAIVTNG-KNRKLILHGLTGYAQPGKLLAVMGPSGCGKSTLLDALAGRLKSNIQ  71

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             QSG ILING+ Q LAYGTS YVTQ+D + +TLT  E +YYSAQLQ P+S+  +EKK  A+
Sbjct  72    QSGKILINGKKQALAYGTSGYVTQDDAMLSTLTAGETLYYSAQLQFPNSMSIAEKKRQAD  131

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
             +T+ EMGLQDA+NTR  GG+GSKG+SGGQ+RR+SIC+EILT P+LLFLDEP+SGLDSAAS
Sbjct  132   ITLAEMGLQDAINTR-VGGYGSKGLSGGQRRRLSICIEILTHPRLLFLDEPTSGLDSAAS  190

Query  766   FYVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFE  936
             +YVMS+I  L+      RT+VASIHQPS+EVF LF  LCLLSSG  VYFG AS A Q F 
Sbjct  191   YYVMSRIASLSLRDDIQRTIVASIHQPSSEVFQLFDDLCLLSSGETVYFGTASEANQVFA  250

Query  937   TNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYRE  1116
             +NGFPCPT  NPSDH+L+ IN DF   ++D E+G  +G+ TE+ I ILVNSYK     R+
Sbjct  251   SNGFPCPTHYNPSDHYLRIINNDF---EQDTEEGFGKGVITEDAIGILVNSYKESEIKRQ  307

Query  1117  VQGQVAEISKQEGEVLK-KSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             V  +VA+IS+++   ++ + + A F TQ +VL +RS   ++RD+  YWLRL +++ +A+ 
Sbjct  308   VLIEVAKISERDLSAIRNRRTHAPFQTQCMVLIKRSSQQLYRDISNYWLRLVVFVAIAIS  367

Query  1294  LGYMYNDVGYGNSSIQARCSVLAFIASFFTFMA-IGGFPSFVEDMKVFKKETLNGHYGCG  1470
             LG ++  VG    SIQ R S+L+F  S  TFM  +GGF   +E+MKVFK+E LNGHYG  
Sbjct  368   LGSIFYQVGSSTRSIQVRGSLLSFFMSVLTFMTLVGGFSPLIEEMKVFKRERLNGHYGIT  427

Query  1471  AFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIA  1650
             AF I N LSS+PY+++ISLI G I  +  GL +   H+ YFA ++   M+ VESLMM++ 
Sbjct  428   AFLIGNILSSIPYMVMISLISGSIVCYLSGLHKGLEHYLYFASILFAIMMWVESLMMVVG  487

Query  1651  SLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEF  1830
             S+ PN++MG+I   G++ L IL GG++R+P DLPK  W+YP YYI F  YA+QG +KNEF
Sbjct  488   SIFPNFVMGVIIAGGVEGLAILTGGFYRIPSDLPKPLWKYPCYYISFLTYAFQGSFKNEF  547

Query  1831  QGLRLP--EETGQI-ITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASE  2001
             +GL     +E G I ++G +VL +   V++GHSKW+DL ++  M VV RV+FL++ K  E
Sbjct  548   EGLTFVGYQEGGTITVSGRDVLTDIWHVQIGHSKWVDLFIMFGMIVVYRVLFLVINKVKE  607

Query  2002  KAKHVVKAVMRVSPK  2046
             K+   V ++ R   K
Sbjct  608   KSNPAVPSINRSQAK  622



>ref|XP_006584974.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter G family member 
41-like [Glycine max]
Length=1280

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/575 (57%), Positives = 428/575 (74%), Gaps = 12/575 (2%)
 Frame = +1

Query  229   TWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTRQ  408
             TWE+LWVTVS G K  K IL+ LTGYARPG +LAIMGPSGCGKSTLLDALAGRL    +Q
Sbjct  44    TWENLWVTVSSG-KNKKPILQDLTGYARPGRILAIMGPSGCGKSTLLDALAGRLSSNMKQ  102

Query  409   SGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAEM  588
             +G ILING+ Q LAYGTS YVTQ+D + +TLT  E +YYSAQLQ P S+  +EKKE  +M
Sbjct  103   TGKILINGQKQALAYGTSGYVTQDDAMLSTLTTGETLYYSAQLQFPDSMSIAEKKERTDM  162

Query  589   TIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAASF  768
             T++EMGLQDA+NTR  GGWGSKG+SGGQKRR+SIC+EILTRP+LLFLDEP+SGLDSAAS+
Sbjct  163   TLREMGLQDAINTR-VGGWGSKGLSGGQKRRLSICIEILTRPRLLFLDEPTSGLDSAASY  221

Query  769   YVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             YVMS+I  L       RT+VASIHQPS+E+F LF  LCLLSSG  VYFGPAS A QFF +
Sbjct  222   YVMSRIATLNQRDGIRRTIVASIHQPSSEIFELFHDLCLLSSGETVYFGPASDANQFFAS  281

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREV  1119
             NGFPCPTL NPSDH+L+ INKDF   ++D E+G   G+ +E+ I+ LV SYKS    ++V
Sbjct  282   NGFPCPTLHNPSDHYLRIINKDF---EQDAEKGLGTGVTSEKAIDTLVKSYKSSQIRKQV  338

Query  1120  QGQVAEISKQEGEVLKKSS-RADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGL  1296
             + +V +I + + + ++     A F TQ +VL RR+ L +FRD+  YWLRL ++I +A+ +
Sbjct  339   KKEVDKIGESDSDAIRNQRIHAAFPTQCLVLIRRASLQLFRDISNYWLRLIVFIVIAISI  398

Query  1297  GYMYNDVGYGNSSIQARCSVLAFIASFFTFMA-IGGFPSFVEDMKVFKKETLNGHYGCGA  1473
             G ++ D+G  N SIQ R S+L F  S  TFM  +GGF   +E+MKVF++E LNGHYG  A
Sbjct  399   GSIFYDIGTSNGSIQGRGSLLIFFVSVLTFMTLVGGFSPLLEEMKVFERERLNGHYGVTA  458

Query  1474  FAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIAS  1653
             F I N  S++PY+LLISLIPG IAY+  G+ +    F YF  ++   ++ VESLM+++ S
Sbjct  459   FLIGNIFSAVPYMLLISLIPGGIAYYLCGMHKGPERFFYFTSLLFAIVMWVESLMLVVGS  518

Query  1654  LVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQ  1833
             + PNY++G+    G++ LMIL GG++RLP DLPK  W+YP+YY+ F KYA+QG +KN+F+
Sbjct  519   ICPNYVIGMFLAGGVEGLMILTGGFYRLPNDLPKPLWKYPLYYVSFLKYAFQGSFKNDFE  578

Query  1834  GL--RLPEETGQIITGEEVLRETLQVEMGHSKWID  1932
             GL   + ++ G I++G EVL +T  +EMG+SKW+D
Sbjct  579   GLTFSVDQDGGGIMSGREVLTDTWHLEMGYSKWVD  613


 Score =   543 bits (1400),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 321/603 (53%), Positives = 411/603 (68%), Gaps = 24/603 (4%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTWE+L  TV++G K  K IL GLTGYA+PG LLAI+GPSG GKSTLLDALAGRL    +
Sbjct  666   LTWENLEATVTNG-KNRKLILHGLTGYAQPGRLLAIIGPSGSGKSTLLDALAGRLTSNIK  724

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             Q+G ILING  Q LAYGTS YVTQ+D + + LT  E +YYSA LQ P+++   EKKE A+
Sbjct  725   QTGKILINGHKQELAYGTSGYVTQDDAMLSCLTAGETLYYSAMLQFPNTMSVEEKKERAD  784

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
             MT++EMGLQDA+NTR  GGW  KG+SGGQ+RR+SIC+EILT PKLLFLDEP+SGLDSAAS
Sbjct  785   MTLREMGLQDAINTR-VGGWNCKGLSGGQRRRLSICIEILTHPKLLFLDEPTSGLDSAAS  843

Query  766   FYVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFE  936
             +YVMS I +L       RT+VAS+HQPS+EVF LF  L LLSSG  VYFGPAS A QFF 
Sbjct  844   YYVMSGIANLIQRDGIQRTIVASVHQPSSEVFQLFHDLFLLSSGETVYFGPASDANQFFA  903

Query  937   TNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYRE  1116
             +NGFPCP L NPSDH+L+ INKDF+ D ++       GI TEE   ILVNSYKS      
Sbjct  904   SNGFPCPPLYNPSDHYLRIINKDFNQDADE-------GITTEEATKILVNSYKSSEFSNH  956

Query  1117  VQGQVAEISKQEGEVLKKSS-RADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             VQ ++A+     G   KK    A F TQ ++L RR+ L ++RD   YW RL ++I +++ 
Sbjct  957   VQSEIAKSETDFGACGKKKKIHAAFITQCLILIRRASLQIYRDTNNYWARLVVFIFISLS  1016

Query  1294  LGYM-YNDVGYGNSSIQARCSVLAFIASFFTFMA-IGGFPSFVEDMKVFKKETLNGHYGC  1467
             +G + Y+  G    SI  R S+L F  S  TFM  +GG    +E+MKVFK+E LNGHYG 
Sbjct  1017  VGSIFYHSGGPDLRSIMDRGSLLCFFVSVVTFMTLVGGISPLIEEMKVFKRERLNGHYGI  1076

Query  1468  GAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMII  1647
              AF I+N  S++PY  L+S+IPG +  +  GL +   +F +   V+   +  VESLMM++
Sbjct  1077  TAFLISNIFSAVPYNFLMSIIPGAVVTYLSGLHKGVDNFVFLISVLFATVTWVESLMMVV  1136

Query  1648  ASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNE  1827
              S+ PNY+MG+I   G++ +MIL  G++RLP DLPK  W++P YYI F  YA+QGL KNE
Sbjct  1137  GSVFPNYVMGVIVCGGIEGVMILTSGFYRLPNDLPKPVWKFPFYYISFLTYAFQGLLKNE  1196

Query  1828  FQGLRLPEETGQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKA  2007
             F+ L             EVL +T  V+MGHSKW+DL ++  M V+ RV+FL + K  EK+
Sbjct  1197  FEDLPF---------SSEVLADTWHVQMGHSKWVDLAIMFAMIVLYRVLFLAISKCKEKS  1247

Query  2008  KHV  2016
             K V
Sbjct  1248  KQV  1250



>ref|XP_006657617.1| PREDICTED: ABC transporter G family member 11-like [Oryza brachyantha]
Length=721

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/577 (56%), Positives = 408/577 (71%), Gaps = 13/577 (2%)
 Frame = +1

Query  223   FLTWEDLWVTV---SDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLE  393
             FLTW+DL VT    + GRK    IL GL G+A PGE+LAIMGPSGCGK+TLLDALAGRL 
Sbjct  113   FLTWDDLCVTAPAAAGGRKSRAVILDGLAGHACPGEVLAIMGPSGCGKTTLLDALAGRLS  172

Query  394   LTTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKK  573
                +  GDILINGR + L +GTSAYVTQE+ L ATLTV EAV YSAQLQLP  +  +EK+
Sbjct  173   PNMKMRGDILINGRREKLGFGTSAYVTQENMLMATLTVTEAVRYSAQLQLPEFMAVAEKR  232

Query  574   EIAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLD  753
               A+  I++MGL      RIGG        G Q+RRVSIC+E+L  P LLFLDEP+SGLD
Sbjct  233   ARADSAIRQMGLAAVAGVRIGGRVCKGISGG-QRRRVSICVELLASPALLFLDEPTSGLD  291

Query  754   SAASFYVMSKIMDLASEGR-TVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQF  930
             SAAS++VMS+I  +A   R TVVA++HQPSTEVF LF  LCLL+ G+ VYFGPAS AI F
Sbjct  292   SAASYHVMSRIARIARRDRMTVVAAVHQPSTEVFELFHGLCLLAGGKTVYFGPASDAIGF  351

Query  931   FETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRY  1110
             FE NGFPCP   NPSDHFL+ INKDF+  ++      +R     EVI  L+ S+KS  R 
Sbjct  352   FEANGFPCPLRMNPSDHFLRMINKDFEESEDGSTVISSR---AAEVIQTLIGSFKS--RG  406

Query  1111  REVQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAV  1290
                 G  A    ++G  + +  +A F T++ VLT+RSF+NM RD GYYWLR  IYI + +
Sbjct  407   SLGTGNEACPMIEKGTTIIRQRQATFLTKTFVLTKRSFVNMHRDTGYYWLRFVIYIAICL  466

Query  1291  GLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCG  1470
              +G ++ DVG   +SIQAR S+L F ++  T MAIGGFPSFVEDMK+F+KE ++GHYG  
Sbjct  467   SIGTIFFDVGSNFASIQARASMLMFTSTLLTMMAIGGFPSFVEDMKIFRKERMSGHYGAT  526

Query  1471  AFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIA  1650
              F I+NTLSS+PYL +IS+IPG IAY+  GLQR   HF YFA V+    +LVE LMMI+A
Sbjct  527   EFVISNTLSSVPYLGIISIIPGAIAYYLTGLQRGVDHFIYFAAVLWACTMLVEGLMMIVA  586

Query  1651  SLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEF  1830
             ++VP++L+GII G+G+Q +++L  G+FRLP DLPK  W+YP Y+I +HKYA QGLYKNE 
Sbjct  587   AIVPDFLLGIITGSGVQGVLMLNAGFFRLPSDLPKPVWKYPTYFISYHKYATQGLYKNEL  646

Query  1831  QGLRLPEETGQ---IITGEEVLRETLQVEMGHSKWID  1932
              GL   +  G     ++GE +L+  LQVE+G+SKW+D
Sbjct  647   LGLSFEDAAGGGGLTVSGEYILKNYLQVELGYSKWVD  683



>ref|NP_001059389.1| Os07g0288700 [Oryza sativa Japonica Group]
 dbj|BAC79956.1| putative ABC transporter family protein [Oryza sativa Japonica 
Group]
 dbj|BAC84399.1| putative ABC transporter family protein [Oryza sativa Japonica 
Group]
 dbj|BAF21303.1| Os07g0288700 [Oryza sativa Japonica Group]
 dbj|BAG94477.1| unnamed protein product [Oryza sativa Japonica Group]
Length=729

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/579 (55%), Positives = 411/579 (71%), Gaps = 15/579 (3%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKG------NKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAG  384
             FLTW+DL VT      G         IL GL+GYARPGE+LA+MGPSGCGK+TLLDALAG
Sbjct  119   FLTWDDLSVTAPAAAAGCGGHGRRAVILDGLSGYARPGEVLALMGPSGCGKTTLLDALAG  178

Query  385   RLELTTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRS  564
             RL    +  GDILING  + L++GTSAYVTQE+ L ATLTV EAV+YSAQLQLP S+P  
Sbjct  179   RLSPNMKMRGDILINGLREKLSFGTSAYVTQENVLMATLTVTEAVHYSAQLQLPDSMPAE  238

Query  565   EKKEIAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSS  744
             +K+  A+  I++MGL      RIGG        G Q++RVSIC+E+L  P LLFLDEP+S
Sbjct  239   DKRARADRAIRQMGLGAVAGVRIGGRVCKGISGG-QRKRVSICVELLASPALLFLDEPTS  297

Query  745   GLDSAASFYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAA  921
             GLDSAAS++VMS+I  LA  +G TVVA++HQPSTE+F LF  LCLL++GR VYFG AS A
Sbjct  298   GLDSAASYHVMSRIAGLARRDGMTVVAAVHQPSTEMFELFHGLCLLATGRTVYFGAASDA  357

Query  922   IQFFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSY  1101
             I+FFE+NGFPCP  +NPSDHFL+ INKDF+  +E       R     EVI  L+ S+KS 
Sbjct  358   IEFFESNGFPCPLRRNPSDHFLRMINKDFEESEEGSTIISPRA---AEVIQKLMGSFKSC  414

Query  1102  HRYREVQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYIT  1281
                R  +   A I++    + ++  +A F T++ VLT+RS +NM RD GYYWLR  IYI 
Sbjct  415   GTLRTEKEACAMINQGASPIPQR--QATFLTKTYVLTKRSIVNMHRDAGYYWLRFVIYIA  472

Query  1282  LAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHY  1461
             + + +G ++ +VG   +SIQAR S+L F ++  T MAIGGFPSFVEDMK+F+KE ++GHY
Sbjct  473   ICLSIGTIFFNVGSNFASIQARASMLMFTSTLLTMMAIGGFPSFVEDMKIFRKERMSGHY  532

Query  1462  GCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMM  1641
             G   F I+NTLSS+PYL LIS+IPG IAY+  GLQR   HF YFA V+    +LVE LMM
Sbjct  533   GATEFVISNTLSSIPYLGLISIIPGAIAYYLTGLQRGIDHFIYFAAVLWACTMLVEGLMM  592

Query  1642  IIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYK  1821
             I+A++VP++L+GII G+G+Q +++L  G+FRLP DLPK  W+YP Y+I +HKYA QGLYK
Sbjct  593   IVAAVVPDFLLGIITGSGVQGVLMLNAGFFRLPSDLPKPVWKYPTYFISYHKYATQGLYK  652

Query  1822  NEFQGLRLPE--ETGQIITGEEVLRETLQVEMGHSKWID  1932
             NE  GL   +    G  I+GE +L+  LQVE+ +SKW+D
Sbjct  653   NELLGLVFEDIGGGGLTISGEYILKNYLQVELSYSKWVD  691



>gb|EEC81874.1| hypothetical protein OsI_25665 [Oryza sativa Indica Group]
Length=753

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/579 (55%), Positives = 411/579 (71%), Gaps = 15/579 (3%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKG------NKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAG  384
             FLTW+DL VT      G         IL GL+GYARPGE+LA+MGPSGCGK+TLLDALAG
Sbjct  119   FLTWDDLSVTAPAAAAGCGGHGRRAVILDGLSGYARPGEVLALMGPSGCGKTTLLDALAG  178

Query  385   RLELTTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRS  564
             RL    +  GDILING  + L++GTSAYVTQE+ L ATLTV EAV+YSAQLQLP S+P  
Sbjct  179   RLSPNMKMRGDILINGLREKLSFGTSAYVTQENVLMATLTVTEAVHYSAQLQLPDSMPAE  238

Query  565   EKKEIAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSS  744
             +K+  A+  I++MGL      RIGG        G Q++RVSIC+E+L  P LLFLDEP+S
Sbjct  239   DKRARADRAIRQMGLGAVAGVRIGGRVCKGISGG-QRKRVSICVELLASPALLFLDEPTS  297

Query  745   GLDSAASFYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAA  921
             GLDSAAS++VMS+I  LA  +G TVVA++HQPSTE+F LF  LCLL++GR VYFG AS A
Sbjct  298   GLDSAASYHVMSRIAGLARRDGMTVVAAVHQPSTEMFELFHGLCLLATGRTVYFGAASDA  357

Query  922   IQFFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSY  1101
             I+FFE+NGFPCP  +NPSDHFL+ INKDF+  +E       R     EVI  L+ S+KS 
Sbjct  358   IEFFESNGFPCPLRRNPSDHFLRMINKDFEESEEGSTIISPRA---AEVIQKLMGSFKSC  414

Query  1102  HRYREVQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYIT  1281
                R  +   A I++    + ++  +A F T++ VLT+RS +NM RD GYYWLR  IYI 
Sbjct  415   GTLRTEKEACAMINQGASPIPQR--QATFLTKTYVLTKRSIVNMHRDAGYYWLRFVIYIA  472

Query  1282  LAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHY  1461
             + + +G ++ +VG   +SIQAR S+L F ++  T MAIGGFPSFVEDMK+F+KE ++GHY
Sbjct  473   ICLSIGTIFFNVGSNFASIQARASMLMFTSTLLTMMAIGGFPSFVEDMKIFRKERMSGHY  532

Query  1462  GCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMM  1641
             G   F I+NTLSS+PYL LIS+IPG IAY+  GLQR   HF YFA V+    +LVE LMM
Sbjct  533   GATEFVISNTLSSIPYLGLISIIPGAIAYYLTGLQRGIDHFIYFAAVLWACTMLVEGLMM  592

Query  1642  IIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYK  1821
             I+A++VP++L+GII G+G+Q +++L  G+FRLP DLPK  W+YP Y+I +HKYA QGLYK
Sbjct  593   IVAAVVPDFLLGIITGSGVQGVLMLNAGFFRLPSDLPKPVWKYPTYFISYHKYATQGLYK  652

Query  1822  NEFQGLRLPE--ETGQIITGEEVLRETLQVEMGHSKWID  1932
             NE  GL   +    G  I+GE +L+  LQVE+ +SKW+D
Sbjct  653   NELLGLVFEDIGGGGLTISGEYILKNYLQVELSYSKWVD  691



>ref|XP_006663977.1| PREDICTED: ABC transporter G family member 11-like [Oryza brachyantha]
Length=573

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/538 (56%), Positives = 393/538 (73%), Gaps = 8/538 (1%)
 Frame = +1

Query  334   MGPSGCGKSTLLDALAGRLELTTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVRE  513
             MGPSGCGK+TLLD LAGRL     +SG +LINGR + LA+GTSAYVTQ++ L +TLTVRE
Sbjct  1     MGPSGCGKTTLLDTLAGRLGPEMNRSGVVLINGRQEKLAFGTSAYVTQDNVLMSTLTVRE  60

Query  514   AVYYSAQLQLPSSLPRSEKKEIAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSIC  693
             AV+YSA LQLP ++P  EK+  AE  I+EMGL DA +T + GG  ++GISGGQ++RVSIC
Sbjct  61    AVHYSAHLQLPDTMPAPEKRGHAERVIREMGLGDAADT-LVGGRVARGISGGQRKRVSIC  119

Query  694   LEILTRPKLLFLDEPSSGLDSAASFYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftsl  870
             +E+LTRP+LLFLDEP+SGLDSAAS++VMS I  +A+ EG  VVA++HQPS +VF LF  L
Sbjct  120   VEMLTRPRLLFLDEPTSGLDSAASYHVMSHIARVAAREGMAVVAAVHQPSGDVFELFHGL  179

Query  871   cllssGRVVYFGPASAAIQFFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARG  1050
             CLL+ GR V+FG  S A +FF  +GFPCP ++NPSDHFL+ +NKDFD  +E++E   A  
Sbjct  180   CLLAYGRTVFFGTPSNANEFFTQSGFPCPHMRNPSDHFLRIVNKDFD--EENMESSKANR  237

Query  1051  IPTEEVINILVNSYKSYHRYREVQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLN  1230
                 E   IL N+Y S     +   ++AE+   +G   ++  +A F T+ +VLT+RSF+N
Sbjct  238   KTAAEATEILTNAYLSSSYSEKTANEIAEMKGMDGAPFRRKEQASFGTKLLVLTKRSFIN  297

Query  1231  MFRDLGYYWLRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPS  1410
             M RD+GYYW+RL IY+ + V +G ++  VGY  SSIQ RC V+ +  +  TFMAIGGFPS
Sbjct  298   MHRDIGYYWMRLAIYLGIGVCIGTIFYQVGYSYSSIQTRCEVIMYTTALLTFMAIGGFPS  357

Query  1411  FVEDMKVFKKETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAY  1590
             F+ED+KVF++E L+GHYG   F I+NTLS+ PYL  I++ PG + Y+  GL R   HFAY
Sbjct  358   FIEDIKVFRRERLSGHYGVAEFVISNTLSATPYLAFIAVAPGAMLYYLTGLTRGAEHFAY  417

Query  1591  FALVILMNMLLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRY  1770
             F   + M  LLVES+MMIIA +VP++LMGII GAG+Q +M+L GG+FRLP +LPK  W+Y
Sbjct  418   FTATLCMCTLLVESMMMIIAVVVPDFLMGIIVGAGVQGVMMLNGGFFRLPNELPKPVWKY  477

Query  1771  PIYYIDFHKYAYQGLYKNEFQGLRLPE----ETGQIITGEEVLRETLQVEMGHSKWID  1932
             P YYI FHKYA QG YKNEF GL  P     E    ++G +VLRE LQVEMG+SKW++
Sbjct  478   PCYYISFHKYAVQGFYKNEFMGLSFPSDQLVEANVTLSGVQVLREKLQVEMGYSKWVN  535



>ref|XP_006661036.1| PREDICTED: ABC transporter G family member 11-like [Oryza brachyantha]
Length=559

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/552 (56%), Positives = 409/552 (74%), Gaps = 8/552 (1%)
 Frame = +1

Query  412   GDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAEMT  591
             G ILINGR+Q L +GTSAYVTQE+ L ATLTVREA+YYSAQ+QLP ++  +EK   A+ T
Sbjct  3     GQILINGRSQKLVFGTSAYVTQENMLMATLTVREAIYYSAQIQLPDTMATAEKLARADDT  62

Query  592   IKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAASFY  771
             ++EMGL  A++TRIGG        G QKR +SICLEILTRP+LLFLDEP+SGLDSAASF+
Sbjct  63    VREMGLSSALDTRIGGRSSKGISGGQQKR-LSICLEILTRPRLLFLDEPTSGLDSAASFH  121

Query  772   VMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNGF  948
             VMS+I  LA+ EG  VVA +HQP +EVF LF  LCLL++G  ++FGP S A QFF +NG+
Sbjct  122   VMSRIARLAAREGMAVVAVVHQPCSEVFELFHGLCLLAAGNTIFFGPPSMAAQFFASNGY  181

Query  949   PCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREVQGQ  1128
             PCP ++NPSDHFL+T+NKDFD + E  E+        +E I+ILVNSYKS +     + +
Sbjct  182   PCPPMRNPSDHFLRTVNKDFDKESE--ERQSYMPAVADEAIDILVNSYKSSNTSEVAKQE  239

Query  1129  VAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLGYMY  1308
             +  I++ +  ++ +  RA F T+++VLT+RSF+NM+RD+GYYWLRL IY+ ++V LG ++
Sbjct  240   MRHINEMDRAMIGRK-RAGFVTKTLVLTKRSFVNMYRDIGYYWLRLAIYVAISVCLGTIF  298

Query  1309  NDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFAIAN  1488
              +VGYG  S +AR S+L FI +  TFMAIGGFPSFVEDMK+F +E LNGHYG   F I+N
Sbjct  299   YNVGYGPDSTRARSSMLMFIGTLLTFMAIGGFPSFVEDMKIFGRERLNGHYGVTTFVISN  358

Query  1489  TlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLVPNY  1668
             TLSS PYLL ++++PG IAY+   LQR+  HF YFALV+    +LVE LMMI+A++VP++
Sbjct  359   TLSSTPYLLFLAVVPGAIAYYLTCLQRQIDHFVYFALVLCACTMLVEGLMMIVATIVPDF  418

Query  1669  LMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGLRLP  1848
             LMGII GAG+Q +M+L  G+F+LP +LPK+ W+YPIYYI FHKYA QG YKNEF GL L 
Sbjct  419   LMGIITGAGIQGVMMLTSGFFQLPNNLPKIVWKYPIYYISFHKYALQGFYKNEFSGLVLQ  478

Query  1849  E--ETGQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAKHVVK  2022
                E  +I+TGEEV+ E  QVE GHSKW+DL +L  M +  RV+F++++K  +  K ++K
Sbjct  479   SNLEGPKIVTGEEVIAELFQVETGHSKWVDLAILCGMIITYRVLFIVIIKVLDMVKPMLK  538

Query  2023  AV-MRVSPKQSH  2055
              V  R  PK  H
Sbjct  539   GVTFRWRPKCVH  550



>ref|XP_002970205.1| ATP-binding cassette transporter [Selaginella moellendorffii]
 gb|EFJ28335.1| ATP-binding cassette transporter [Selaginella moellendorffii]
Length=681

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/580 (53%), Positives = 408/580 (70%), Gaps = 14/580 (2%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW DL+V+ ++ +   +++L GL GYA PG L+A+MGPSG GKSTLLDALAGRL   T 
Sbjct  27    LTWRDLFVSATNAKGETRSLLHGLNGYAEPGYLMAVMGPSGSGKSTLLDALAGRLAKNTT  86

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             QSG++L+NGR   L+YG  A+VTQ+D L  TLTV+E + YSA+L+LP  +PR +KK I E
Sbjct  87    QSGEVLLNGRRTRLSYGIVAFVTQDDALIGTLTVKETITYSAKLRLPDLMPRKDKKAIVE  146

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI EMGLQ+  NT   G W  +G+SGG+KRR+SI LEILTRP+LLFLDEP+SGLDSA++
Sbjct  147   STIMEMGLQECQNT-PVGNWHLRGLSGGEKRRLSIGLEILTRPRLLFLDEPTSGLDSASA  205

Query  766   FYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             F+V   + +LA +GRTV+ASIHQPS+EVF LF  L LLS G+ +YFG A AA +FF + G
Sbjct  206   FFVTQTLKNLARDGRTVIASIHQPSSEVFELFDRLYLLSHGKTIYFGDAPAAKEFFASAG  265

Query  946   FPCPTLQNPSDHFLKTINKDFDNDDE---------DVEQG-CARGIPTEEVINILVNSYK  1095
             FPCP L+NPSDH+L+ IN DFD   +         D+E         T +VI IL++ Y+
Sbjct  266   FPCPPLRNPSDHYLRAINSDFDRVKDALRNSFVAKDMESADVLDKTSTAQVIKILIDHYQ  325

Query  1096  SYHRYREVQGQVAEISKQEGEVLK-KSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGI  1272
             S         ++ EI++ +G  L+ + S+A FF QS  LTRRSF+NM RD+GYYWLRL I
Sbjct  326   SSEHAMLTASKIHEINQTKGVALESEGSQASFFMQSFTLTRRSFVNMSRDMGYYWLRLVI  385

Query  1273  YITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLN  1452
             YI LA+G+G +Y D+G   SSI AR + ++F+  F  FM+IGGFPSF+EDMKVF +E LN
Sbjct  386   YIILAIGIGTLYYDIGTSYSSIMARAACMSFVGGFLIFMSIGGFPSFIEDMKVFSRERLN  445

Query  1453  GHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVES  1632
             GHYG  AF + NTLSSLP+L LI+L+ G I Y  V L   F  F+YF L +   +  VES
Sbjct  446   GHYGVVAFVVGNTLSSLPFLFLIALVSGAITYNMVKLHPGFIRFSYFVLNLFAAVAAVES  505

Query  1633  LMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQG  1812
             LMM +ASLVPN+LMGII GAG+Q + +L  G+FRLP DLPK FW++P+ YI FH Y+ QG
Sbjct  506   LMMAVASLVPNFLMGIITGAGIQGIFLLVAGFFRLPGDLPKAFWKFPLSYIGFHMYSLQG  565

Query  1813  LYKNEFQGLRLPEETGQI--ITGEEVLRETLQVEMGHSKW  1926
              ++N+F GL    +   +  I G+ +L++  ++ +G SKW
Sbjct  566   NFENDFLGLNFENKFPGLPKIPGKFILQDVYEIPVGRSKW  605



>ref|XP_002978369.1| hypothetical protein SELMODRAFT_443862 [Selaginella moellendorffii]
 gb|EFJ20355.1| hypothetical protein SELMODRAFT_443862 [Selaginella moellendorffii]
Length=709

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/580 (53%), Positives = 408/580 (70%), Gaps = 14/580 (2%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW DL+V+ ++ +   +++L GL GYA PG L+A+MGPSG GKSTLLDALAGRL   T 
Sbjct  55    LTWRDLFVSATNAKGETRSLLHGLNGYAEPGYLMAVMGPSGSGKSTLLDALAGRLAKNTT  114

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             QSG++L+NGR   L+YG  A+VTQ+D L  TLTV+E + YSA+L+LP  +PR +KK I E
Sbjct  115   QSGEVLLNGRRTRLSYGIVAFVTQDDALIGTLTVKETITYSAKLRLPDLMPRKDKKAIVE  174

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI EMGLQ+  NT   G W  +G+SGG+KRR+SI LEILTRP+LLFLDEP+SGLDSA++
Sbjct  175   STIMEMGLQECQNT-PVGNWHLRGLSGGEKRRLSIGLEILTRPRLLFLDEPTSGLDSASA  233

Query  766   FYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             F+V   + +LA +GRTV+ASIHQPS+EVF LF  L LLS G+ +YFG A AA +FF + G
Sbjct  234   FFVTQTLKNLARDGRTVIASIHQPSSEVFELFDRLYLLSHGKTIYFGDAPAAKEFFASAG  293

Query  946   FPCPTLQNPSDHFLKTINKDFDNDDE---------DVEQG-CARGIPTEEVINILVNSYK  1095
             FPCP L+NPSDH+L+ IN DFD   +         D+E         T +VI IL++ Y+
Sbjct  294   FPCPPLRNPSDHYLRAINSDFDRVKDALRNSFVAKDMESADVLDKTSTAQVIKILIDHYQ  353

Query  1096  SYHRYREVQGQVAEISKQEGEVLK-KSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGI  1272
             S         ++ EI++ +G  L+ + S+A FF QS  LTRRSF+NM RD+GYYWLRL I
Sbjct  354   SSEHAMLTASKIHEINQTKGVALESEGSQASFFMQSFTLTRRSFVNMSRDMGYYWLRLVI  413

Query  1273  YITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLN  1452
             YI LA+G+G +Y D+G   SSI AR + ++F+  F  FM+IGGFPSF+EDMKVF +E LN
Sbjct  414   YIILAIGIGTLYYDIGTSYSSIMARAACMSFVGGFLIFMSIGGFPSFIEDMKVFSRERLN  473

Query  1453  GHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVES  1632
             GHYG  AF + NTLSSLP+L LI+L+ G I Y  V L   F  F+YF L +   +  VES
Sbjct  474   GHYGVVAFVVGNTLSSLPFLFLIALVSGAITYNMVKLHPGFIRFSYFVLNLFAAVAAVES  533

Query  1633  LMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQG  1812
             LMM +ASLVPN+LMGII GAG+Q + +L  G+FRLP DLPK FW++P+ YI FH Y+ QG
Sbjct  534   LMMAVASLVPNFLMGIITGAGIQGIFLLVAGFFRLPGDLPKAFWKFPLSYIGFHMYSLQG  593

Query  1813  LYKNEFQGLRLPEETGQI--ITGEEVLRETLQVEMGHSKW  1926
              ++N+F GL    +   +  I G+ +L++  ++ +G SKW
Sbjct  594   NFENDFLGLNFENKFPGLPKIPGKFILQDVYEIPVGRSKW  633



>ref|XP_006665060.1| PREDICTED: ABC transporter G family member 11-like isoform X1 
[Oryza brachyantha]
Length=576

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/525 (57%), Positives = 395/525 (75%), Gaps = 7/525 (1%)
 Frame = +1

Query  367   LDALAGRLELTTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLP  546
             LD ++GRL+   + +G ILINGR+Q LA+GTSAYVTQE+ L  TLTVREA+YYSAQ+QLP
Sbjct  5     LDEISGRLDSNLKMTGQILINGRSQKLAFGTSAYVTQENVLMTTLTVREAIYYSAQIQLP  64

Query  547   SSLPRSEKKEIAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLF  726
              ++  +EK   A  T++EMGL  A++TRIGG        G QKR +SICLEILTRP+LLF
Sbjct  65    DTMTVAEKLARANDTVREMGLTSALDTRIGGRSSKGISGGQQKR-LSICLEILTRPRLLF  123

Query  727   LDEPSSGLDSAASFYVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYF  903
             LDEP+SGLDSAASF+VM  I  LA+ EG TVVA +HQP +EVF LF  LCLL++G+ ++F
Sbjct  124   LDEPTSGLDSAASFHVMGHITGLAAREGMTVVAVVHQPCSEVFELFHGLCLLAAGKTIFF  183

Query  904   GPASAAIQFFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILV  1083
             GPAS A +FF +NG+PCP ++NPSDHFL+T+NKDFD + E  E+        +E I+ILV
Sbjct  184   GPASTAAEFFASNGYPCPPMRNPSDHFLRTVNKDFDKESE--ERLYYMPAVADEAIDILV  241

Query  1084  NSYKSYHRYREVQGQVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLR  1263
             NSYKS +   + + ++  I++ +   + ++ R  F T+  VLTRRSF+NM+RD+GYYWLR
Sbjct  242   NSYKSSNTSEDAKQEMRHINEMDSAAIGRN-RPGFVTKMFVLTRRSFVNMYRDVGYYWLR  300

Query  1264  LGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKE  1443
             L IY++++V LG ++ +VGYG  SI+AR S+L FI +  T M+IGGFPSFVEDMK+F++E
Sbjct  301   LAIYVSISVCLGTIFYNVGYGPDSIRARSSMLMFIGTMLTLMSIGGFPSFVEDMKIFRRE  360

Query  1444  TLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLL  1623
              LNG+YG   F I+NTLSS PYLLLI+++PG IAY+  GLQ +  HF YFALV+    +L
Sbjct  361   RLNGYYGVTTFVISNTLSSTPYLLLIAVVPGAIAYYLTGLQSQVDHFVYFALVLCSCTML  420

Query  1624  VESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYA  1803
             VE LMMI+A++VP++LMGII GAG+Q +M+L  G+F+LP +LPK+ W+YPIYYI FHKYA
Sbjct  421   VEGLMMIVATIVPDFLMGIITGAGIQGIMMLTSGFFQLPNNLPKILWKYPIYYISFHKYA  480

Query  1804  YQGLYKNEFQGLRLPE--ETGQIITGEEVLRETLQVEMGHSKWID  1932
              QG YKNEF GL L    E  +I+ GE+ + E  QVEMG+SKW+D
Sbjct  481   LQGFYKNEFSGLVLQTNIEGPKIVIGEKDIAELFQVEMGYSKWVD  525



>gb|AAP80385.1| ABC transporter [Gossypium hirsutum]
Length=705

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/587 (53%), Positives = 405/587 (69%), Gaps = 24/587 (4%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTWEDL V V+      + +L+GLTGYA PG L A+MGPSG GKSTLLDAL+ RL     
Sbjct  52    LTWEDLTVMVTLSNGATQKVLEGLTGYAEPGTLTALMGPSGSGKSTLLDALSSRLAANAF  111

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
              SG IL+NGR   L++GT+AYVTQ+D L  TLTVRE + YSA+L+LP ++P S K+++ E
Sbjct  112   LSGTILLNGRKTKLSFGTAAYVTQDDNLIGTLTVRETISYSARLRLPDTMPWSAKRDLVE  171

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI EMGLQD  +T + G W  +GISGG+KRRVSI LEIL RP+LLFLDEP+SGLDSA++
Sbjct  172   GTIIEMGLQDCADT-VIGNWHLRGISGGEKRRVSIALEILMRPRLLFLDEPTSGLDSASA  230

Query  766   FYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             F+V   +  L+ +GRTV+AS+HQPS+EVF LF  L LLS G+ +YFG AS A +FF   G
Sbjct  231   FFVTQTLRGLSRDGRTVIASVHQPSSEVFELFDQLYLLSEGKTIYFGQASEAYEFFAQAG  290

Query  946   FPCPTLQNPSDHFLKTINKDFDN---------------DDEDVEQGCARGIPTEEVINIL  1080
             FPCP L+NPSDHFL+ IN DFD                 D+ +E+     I T E I  L
Sbjct  291   FPCPALRNPSDHFLRCINSDFDKVKATLKGSMKLRFEASDDPLEK-----ITTTEAIRTL  345

Query  1081  VNSYKSYHRYREVQGQVAEISKQEGEVLKKS-SRADFFTQSIVLTRRSFLNMFRDLGYYW  1257
             +N Y++ H+    + +V EISK  G VL    S+A F  QS  LT+RSF+NM RD GYYW
Sbjct  346   INFYRTSHQCYAAKEKVDEISKVRGTVLDSGGSQASFLMQSYTLTKRSFVNMSRDFGYYW  405

Query  1258  LRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFK  1437
             LRL IY+ + V +G +Y ++G   +SI AR +  +F+  F TFM+IGGFPSFVEDMKVF+
Sbjct  406   LRLLIYVVVTVCIGTIYLNIGTSYNSILARGACASFVFGFVTFMSIGGFPSFVEDMKVFQ  465

Query  1438  KETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNM  1617
             +E LNGHYG  AF I NTLS++P+L++I+ I G I YF V L   F H+ +F L +  ++
Sbjct  466   RERLNGHYGVTAFVIGNTLSAMPFLIMITFISGTICYFMVRLHPGFEHYMFFVLCLYASV  525

Query  1618  LLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHK  1797
              +VESLMM IAS+VPN+LMGII GAG+Q + +L  GYFRLP D+PK  WRYP+ YI FH 
Sbjct  526   TVVESLMMAIASIVPNFLMGIITGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYISFHF  585

Query  1798  YAYQGLYKNEFQGLRLPEETGQI--ITGEEVLRETLQVEMGHSKWID  1932
             +A QG Y+N+ +GL    +  ++  I GE +L    Q+++G SKWID
Sbjct  586   WALQGQYQNDLKGLLFDNQPPELPKIPGEYILENVFQIDVGRSKWID  632



>ref|XP_010069548.1| PREDICTED: ABC transporter G family member 11-like [Eucalyptus 
grandis]
 gb|KCW57935.1| hypothetical protein EUGRSUZ_H00674 [Eucalyptus grandis]
Length=717

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/587 (53%), Positives = 410/587 (70%), Gaps = 24/587 (4%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW+DL VTV+  +   + +L+GLTGYA PG L A+MGPSG GKSTLLDAL+ RL     
Sbjct  62    LTWQDLTVTVTLPKGETQRVLEGLTGYAEPGTLTALMGPSGSGKSTLLDALSSRLATNAF  121

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
              SG IL+NGR   L++GT+AYVTQ+D L  TLTVRE++ YSA+L+LP  +P+SEK  + E
Sbjct  122   LSGTILLNGRKTKLSFGTAAYVTQDDNLIGTLTVRESISYSARLRLPDHMPQSEKLALVE  181

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI EMGLQD  +T + G W  +GISGG+KRRVSI LEIL RP+LLFLDEP+SGLDSA++
Sbjct  182   STIIEMGLQDCADT-VIGNWHLRGISGGEKRRVSIALEILMRPRLLFLDEPTSGLDSASA  240

Query  766   FYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             F+V   +  L+ +GRTV+ASIHQPS+EVF LF  LCLLS G+ VYFG AS A +FF   G
Sbjct  241   FFVTQTLRGLSRDGRTVIASIHQPSSEVFELFDRLCLLSGGKTVYFGEASEAYEFFAQAG  300

Query  946   FPCPTLQNPSDHFLKTINKDFDN---------------DDEDVEQGCARGIPTEEVINIL  1080
             FPCP L+NPSDHFL+ +N DFD                +D+ +E+     + T E I +L
Sbjct  301   FPCPALRNPSDHFLRCVNSDFDKVKATLRGSMKMRFEANDDPLEK-----MTTAEAIRVL  355

Query  1081  VNSYKSYHRYREVQGQVAEISKQEGEVLKKS-SRADFFTQSIVLTRRSFLNMFRDLGYYW  1257
             +N +++       + +V E+SK +G VL    S+A F  Q+  LT+RSF+NM RD GYYW
Sbjct  356   INFHRTSQFSYTARQKVEEMSKVKGTVLDSGGSQASFPMQAFTLTKRSFINMSRDFGYYW  415

Query  1258  LRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFK  1437
             LRL IYI + V +G +Y +VG G +SI AR S  +F+  F TFM+IGGFPSFVEDMKVF+
Sbjct  416   LRLVIYIVVTVCIGTIYLNVGTGYNSILARGSCASFVFGFVTFMSIGGFPSFVEDMKVFQ  475

Query  1438  KETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNM  1617
             +E LNGHYG  AF I+NT+S+ P+L+LI+ I G I YF V L   F H+ +F L +  ++
Sbjct  476   RERLNGHYGVTAFVISNTISATPFLILITFIAGTICYFMVRLHPGFDHYLFFVLCLYGSV  535

Query  1618  LLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHK  1797
              +VESLMM+IAS+VPN+LMGII GAGLQ + +L  GYFRLPKD+PK  WRYP+ YI FH 
Sbjct  536   TVVESLMMVIASIVPNFLMGIIIGAGLQGIFMLVSGYFRLPKDIPKPVWRYPMSYISFHF  595

Query  1798  YAYQGLYKNEFQGLRLPEETGQI--ITGEEVLRETLQVEMGHSKWID  1932
             +A QG Y+N+  G+    ++  +  I GE +L    Q+++  SKW+D
Sbjct  596   WALQGQYQNDLSGMVFENQSPDLPRIPGEYILENVFQIDVNRSKWVD  642



>ref|XP_008245603.1| PREDICTED: ABC transporter G family member 11 [Prunus mume]
Length=707

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/582 (53%), Positives = 405/582 (70%), Gaps = 14/582 (2%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW+DL VTV+  +   + +L+GLTGYA PG   A+MGPSG GKSTLLDAL+ RL     
Sbjct  59    LTWKDLTVTVTLSKGETQKVLEGLTGYAEPGTFTALMGPSGSGKSTLLDALSSRLAANAF  118

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
              SG IL+NGR + L++GT+AYVTQ+D L  TLTVRE + YSA+L+LP  +  S+K+ + E
Sbjct  119   LSGTILLNGRKRKLSFGTAAYVTQDDNLIGTLTVRETISYSARLRLPDKMSWSKKRALIE  178

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI EMGLQD  +T + G W  +GISGG+KRRVSI LEILTRP+LLFLDEP+SGLDSA++
Sbjct  179   STIIEMGLQDCADT-VIGNWHLRGISGGEKRRVSIALEILTRPRLLFLDEPTSGLDSASA  237

Query  766   FYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             F+V   +  LA +GRTV+ASIHQPS+EVF LF  L LLSSG+ VYFG AS A +FF   G
Sbjct  238   FFVTQTLRALARDGRTVIASIHQPSSEVFELFDQLYLLSSGKTVYFGQASDAYEFFAQAG  297

Query  946   FPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARG----------IPTEEVINILVNSYK  1095
             FPCP L+NPSDHFL+ +N DFD     ++     G          I T E I +L++S++
Sbjct  298   FPCPALRNPSDHFLRCVNSDFDKVKATLKGSMKLGFEASDDPLEKITTAEAIRVLIDSFR  357

Query  1096  SYHRYREVQGQVAEISKQEGEVLKKS-SRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGI  1272
             +       + +V EISK +G VL    S+A F  Q+  L++RSF+NM RD GYYWLRL I
Sbjct  358   TSQYSYAAREKVEEISKVKGTVLDSGGSQASFLMQTFTLSKRSFINMSRDFGYYWLRLVI  417

Query  1273  YITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLN  1452
             YI + V +G +Y +VG G +SI AR S  +F+  F TFM+IGGFPSFVEDMKVF++E LN
Sbjct  418   YIVVTVCIGTIYLNVGTGYNSILARGSCASFVFGFVTFMSIGGFPSFVEDMKVFQRERLN  477

Query  1453  GHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVES  1632
             GHYG  AF I+NTLS++P+L+LI+ + G + Y+ V L   F H+ +F L +  ++ +VES
Sbjct  478   GHYGVTAFVISNTLSAMPFLILITFLAGTVCYYMVRLHPGFKHYLFFVLCLYASVTVVES  537

Query  1633  LMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQG  1812
             LMM IAS+VPN+LMGII GAG+Q + +L  GYFRLP D+PK  WRYP+ YI FH +A QG
Sbjct  538   LMMAIASIVPNFLMGIITGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYISFHFWALQG  597

Query  1813  LYKNEFQGLRLPEETGQI--ITGEEVLRETLQVEMGHSKWID  1932
              Y+N+  GL    ++  +  I GE +L    Q++   SKWID
Sbjct  598   QYQNDLSGLVFDNQSPDLPKIPGEYILENVFQIDTARSKWID  639



>ref|XP_001775949.1| ATP-binding cassette transporter, subfamily G, member 7, group 
WBC protein PpABCG7 [Physcomitrella patens]
 gb|EDQ59314.1| ATP-binding cassette transporter, subfamily G, member 7, group 
WBC protein PpABCG7 [Physcomitrella patens]
Length=695

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/589 (54%), Positives = 408/589 (69%), Gaps = 24/589 (4%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW DLWVT+   R   +AIL+G+TGYA PG  +AIMGPSG GKSTLLD LAGRL     
Sbjct  28    LTWVDLWVTIVQ-RGSKQAILQGITGYAEPGSFMAIMGPSGSGKSTLLDTLAGRLAKNAA  86

Query  406   QSGDILINGRTQT-LAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             Q+G +L+NGR +T L+YGT+AYVTQ D L  TLTV+E +YYSA L++PS++ RSEKK I 
Sbjct  87    QTGQVLLNGRRKTTLSYGTAAYVTQTDELIGTLTVKETIYYSASLRIPSTVTRSEKKAIV  146

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             + TI+EMGL D  NT   G W  +G+SGG+KRR+SI LEILTRP+LLFLDEP+SGLDSAA
Sbjct  147   DSTIREMGLYDCRNT-PVGNWHLRGLSGGEKRRLSIALEILTRPRLLFLDEPTSGLDSAA  205

Query  763   SFYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETN  942
             +F+V++ + +LA +GRT++ASIHQPS+EVF LF +L LLS G+++YFG A+ AI+ F + 
Sbjct  206   AFFVVTALRNLARDGRTIIASIHQPSSEVFELFDNLTLLSGGKLIYFGQANNAIEHFTSA  265

Query  943   GFPCPTLQNPSDHFLKTINKDFDN------------DDEDVEQGCARGIPTEEVINILVN  1086
             GFPCP L+NPSDHFL+ IN DFD             D E ++      + T +V+ IL +
Sbjct  266   GFPCPQLRNPSDHFLRAINADFDQVKSNLKGSFKIRDRESIDP--IDRMSTNQVVKILSD  323

Query  1087  SYKSYHRYREVQGQVAEISKQEGEVLKKS-SRADFFTQSIVLTRRSFLNMFRDLGYYWLR  1263
             +Y+S         ++ EI + +G +L+   S+A FF Q + LTRRSF+NM RD+GYYWLR
Sbjct  324   AYQSSDYAMGTISRIHEILQMQGTLLEAGGSQASFFKQCLTLTRRSFVNMSRDIGYYWLR  383

Query  1264  LGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKE  1443
             L IYI L++ LG ++ D+      I  R   +A++  F TFM+IGGFPSFVEDMKVF +E
Sbjct  384   LVIYIVLSLCLGSIFYDLNTKYEGILGRAGCIAYVGGFLTFMSIGGFPSFVEDMKVFNRE  443

Query  1444  TLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLL  1623
              LNGHYG  AF I NTLSSLP+L LISL+  +I YF VGL   F HFAYF + +   + +
Sbjct  444   RLNGHYGVLAFVIGNTLSSLPFLFLISLVSSLIVYFMVGLHPGFEHFAYFVISLFAQVAI  503

Query  1624  VESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYA  1803
             VESLMM +ASLVPN+LMGII GAG+Q + +L  G+FRL  DLPK  WRYP+ YI F  YA
Sbjct  504   VESLMMAVASLVPNFLMGIITGAGIQGIFMLVAGFFRLIDDLPKPVWRYPLSYIGFDMYA  563

Query  1804  YQGLYKNEFQGLRLP------EETGQIITGEEVLRETLQVEMGHSKWID  1932
              QG+Y NEF GL         ++ G  I G  V+RE   +    +KW D
Sbjct  564   LQGMYLNEFIGLTFENYVLDGKKIGPPIPGWYVIREMYGIRTSMTKWED  612



>ref|XP_007159123.1| hypothetical protein PHAVU_002G210600g [Phaseolus vulgaris]
 gb|ESW31117.1| hypothetical protein PHAVU_002G210600g [Phaseolus vulgaris]
Length=629

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/605 (54%), Positives = 425/605 (70%), Gaps = 17/605 (3%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTWE+L  +V+ G K  K IL GLTGYA+PG+LLAI+GPSGCGKSTLLDALAGRL    +
Sbjct  9     LTWENLEASVTGG-KSRKIILNGLTGYAQPGKLLAIIGPSGCGKSTLLDALAGRLGSNMK  67

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             Q+G ILING  Q LAYGTS YVTQ+D + + LT  E +YYSAQLQ P+++  +EKKE A+
Sbjct  68    QTGKILINGHKQELAYGTSGYVTQDDAMLSCLTAGETLYYSAQLQFPNTMSAAEKKERAD  127

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              T++EMGLQDA+NTR  GGW  KG+SGGQKRR+SI +EILT P+LLFLDEP+SGLDSAAS
Sbjct  128   ATLREMGLQDAINTR-VGGWSCKGLSGGQKRRLSISVEILTHPRLLFLDEPTSGLDSAAS  186

Query  766   FYVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFE  936
             +YVMS I  L  +    RT+VASIHQPS+EVF LF  LCLLSSG  VYFG AS A QFF 
Sbjct  187   YYVMSGIAGLNLKDGIQRTIVASIHQPSSEVFQLFHDLCLLSSGETVYFGSASDANQFFA  246

Query  937   TNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYRE  1116
             +NGFPCP L NPSDH+L+ INKDF+       Q    GI TEE  NILV+SYKS      
Sbjct  247   SNGFPCPPLYNPSDHYLRIINKDFN-------QYIDEGITTEEATNILVSSYKSSEYRNH  299

Query  1117  VQGQVAEIS-KQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             VQ ++A+ S K  G V +K     F TQ +VL +RS   ++RD+  YWLRL ++I ++V 
Sbjct  300   VQNEIAQRSEKDSGAVGRKKIHGAFLTQCLVLLKRSSKQIYRDISNYWLRLIVFIAVSVS  359

Query  1294  LGYMYNDVGYGNSSIQARCSVLAFIASFFTFMA-IGGFPSFVEDMKVFKKETLNGHYGCG  1470
             +G ++  +G    SIQ R S+L F  S  +FM  +GGF   +E+MKVF +E LNGHYG  
Sbjct  360   MGSIFYHIGPSMRSIQERGSLLCFFVSVLSFMTLVGGFSPLIEEMKVFNRERLNGHYGIT  419

Query  1471  AFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIA  1650
             AF + +T S++PY L+ISLIPG I  +  GL +   +F YFA V+   ++ VESLMM++ 
Sbjct  420   AFVVGSTFSAVPYTLMISLIPGAIVTYLSGLHKGVENFLYFASVLFAIVMWVESLMMVVG  479

Query  1651  SLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEF  1830
             S+ PN++MG+I   G++ LMIL  G++RLP DLPK  W+YP Y++ F  YA QGL KNEF
Sbjct  480   SIFPNFVMGVITAGGVEGLMILTSGFYRLPNDLPKPLWKYPFYHVSFLTYALQGLLKNEF  539

Query  1831  QGLRLPEETG---QIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASE  2001
             +GL    + G   + ++G ++L ET  V+MGHSK +DL ++  M V+ RV+FL++ K  E
Sbjct  540   EGLIFSSDEGGGAKSVSGRDILVETWHVQMGHSKGVDLAIMFGMIVLYRVLFLIITKCKE  599

Query  2002  KAKHV  2016
             K KHV
Sbjct  600   KLKHV  604



>ref|XP_003608439.1| ABC transporter G family member [Medicago truncatula]
Length=1319

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/615 (54%), Positives = 445/615 (72%), Gaps = 13/615 (2%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             +TWE+L   V++G K  K IL GLTGYA+PG+LLA+MGPSGCGKSTLLDALAGRL+   +
Sbjct  700   VTWENLEAIVTNG-KNRKLILHGLTGYAQPGKLLAVMGPSGCGKSTLLDALAGRLKSNIQ  758

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             QSG ILING+ Q LAYGTS YVTQ+D + +TLT  E +YYSAQLQ P+S+  +EKK  A+
Sbjct  759   QSGKILINGKKQALAYGTSGYVTQDDAMLSTLTAGETLYYSAQLQFPNSMSIAEKKRQAD  818

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
             +T+ EMGLQDA+NTR  GG+GSKG+SGGQ+RR+SIC+EILT P+LLFLDEP+SGLDSAAS
Sbjct  819   ITLAEMGLQDAINTR-VGGYGSKGLSGGQRRRLSICIEILTHPRLLFLDEPTSGLDSAAS  877

Query  766   FYVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFE  936
             +YVMS+I  L+      RT+VASIHQPS+EVF LF  LCLLSSG  VYFG AS A Q F 
Sbjct  878   YYVMSRIASLSLRDDIQRTIVASIHQPSSEVFQLFDDLCLLSSGETVYFGTASEANQVFA  937

Query  937   TNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYRE  1116
             +NGFPCPT  NPSDH+L+ IN DF   ++D E+G  +G+ TE+ I ILVNSYK     R+
Sbjct  938   SNGFPCPTHYNPSDHYLRIINNDF---EQDTEEGFGKGVITEDAIGILVNSYKESEIKRQ  994

Query  1117  VQGQVAEISKQEGEVLK-KSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             V  +VA+IS+++   ++ + + A F TQ +VL +RS   ++RD+  YWLRL +++ +A+ 
Sbjct  995   VLIEVAKISERDLSAIRNRRTHAPFQTQCMVLIKRSSQQLYRDISNYWLRLVVFVAIAIS  1054

Query  1294  LGYMYNDVGYGNSSIQARCSVLAFIASFFTFMA-IGGFPSFVEDMKVFKKETLNGHYGCG  1470
             LG ++  VG    SIQ R S+L+F  S  TFM  +GGF   +E+MKVFK+E LNGHYG  
Sbjct  1055  LGSIFYQVGSSTRSIQVRGSLLSFFMSVLTFMTLVGGFSPLIEEMKVFKRERLNGHYGIT  1114

Query  1471  AFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIA  1650
             AF I N LSS+PY+++ISLI G I  +  GL +   H+ YFA ++   M+ VESLMM++ 
Sbjct  1115  AFLIGNILSSIPYMVMISLISGSIVCYLSGLHKGLEHYLYFASILFAIMMWVESLMMVVG  1174

Query  1651  SLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEF  1830
             S+ PN++MG+I   G++ L IL GG++R+P DLPK  W+YP YYI F  YA+QG +KNEF
Sbjct  1175  SIFPNFVMGVIIAGGVEGLAILTGGFYRIPSDLPKPLWKYPCYYISFLTYAFQGSFKNEF  1234

Query  1831  QGLRLP--EETGQI-ITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASE  2001
             +GL     +E G I ++G +VL +   V++GHSKW+DL ++  M VV RV+FL++ K  E
Sbjct  1235  EGLTFVGYQEGGTITVSGRDVLTDIWHVQIGHSKWVDLFIMFGMIVVYRVLFLVINKVKE  1294

Query  2002  KAKHVVKAVMRVSPK  2046
             K+   V ++ R   K
Sbjct  1295  KSNPAVPSINRSQAK  1309


 Score =   536 bits (1382),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 330/641 (51%), Positives = 436/641 (68%), Gaps = 52/641 (8%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             +TWE L VTV +G K  K IL+GLTG A+PG LLAIMGPSG GKSTLLDALAGRL    +
Sbjct  41    VTWEKLRVTVPNGHK-RKPILQGLTGIAQPGRLLAIMGPSGSGKSTLLDALAGRLSSNMK  99

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
              +G+ILING  Q LAYG S YVTQ++ + + LT RE +YYSAQLQ P S+  +EKKE A+
Sbjct  100   HTGNILINGHKQALAYGISGYVTQDEAMLSRLTARETLYYSAQLQFPDSMSITEKKEQAD  159

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
             + ++EMGL +A+NTR  GGWGSKG+SGGQ+RR+SIC+EILTRP+LLFLDEP+SGLDSAAS
Sbjct  160   LILREMGLIEAVNTR-VGGWGSKGLSGGQRRRLSICIEILTRPRLLFLDEPTSGLDSAAS  218

Query  766   FYVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFE  936
             +YVMS I  L       RT+V SIHQPS+E+F LF  LCLLSSG  VYFGPA  A QFF 
Sbjct  219   YYVMSGIARLNLRDGIQRTIVVSIHQPSSELFELFHDLCLLSSGEAVYFGPAYDANQFFA  278

Query  937   TNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYRE  1116
              NGFPCPTL NPSDH+L+ INKDF   + DVE+G  +G+ TEE I ILV SY+S     +
Sbjct  279   ANGFPCPTLHNPSDHYLRIINKDF---EMDVEEGFGKGVTTEEAIGILVKSYRSSQIRTQ  335

Query  1117  VQGQVAEISKQE-GEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             V+ +V  ISK + G + KK     F TQ +VL RRS L +FRD+G YWLRL +++ +A+ 
Sbjct  336   VKKKVEIISKSDSGAIGKKRIHGAFTTQCLVLIRRSSLQLFRDVGNYWLRLVVFVMIAIS  395

Query  1294  LGYMY--NDVGYGNSSIQARCSVLAFIASFFTFMA-IGGFPSFVEDM-------------  1425
             +G ++       G++SIQ R S+L F+ S  TFM  +GGF   +E+M             
Sbjct  396   IGSIFYGIGSSSGSASIQGRGSLLTFLVSVLTFMTLVGGFSPLLEEMKEESRPVFYEPNQ  455

Query  1426  --------------------------KVFKKETLNGHYGCGAFAIANTlsslpylllisl  1527
                                       KVF++E LNGHYG  AF I N  SSLPY+++IS+
Sbjct  456   TARFNPLYRKPASLSAGSTTVGLSLSKVFERERLNGHYGVTAFLIGNIFSSLPYIIMISV  515

Query  1528  ipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLVPNYLMGIIAGAGLQAL  1707
             IPG IAY    + +   HF YF  +++  ++ VESLM+++ S+ PNY++G+    G++ L
Sbjct  516   IPGGIAYQLCKMHKGLEHFLYFISLLIAIVMWVESLMLVVGSISPNYVIGMFITGGIEGL  575

Query  1708  MILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGLRLPEETGQIITGEEVL  1887
             MIL  G++RLP +LPKL W+YP+Y+I F KYA+QG +KNEF+GL++   T  I++G E+L
Sbjct  576   MILTAGFYRLPNELPKLLWKYPLYHISFLKYAFQGSFKNEFEGLKVDVGT-NIVSGREIL  634

Query  1888  RETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAK  2010
              +   VE+GHSKW+DL ++  M V+ RV+FL++ K+ EK K
Sbjct  635   NDKWHVEIGHSKWVDLAIMFGMIVLYRVLFLVITKSKEKLK  675



>ref|XP_001782003.1| ATP-binding cassette transporter, subfamily G, member 8, group 
WBC protein PpABCG8 [Physcomitrella patens]
 gb|EDQ53146.1| ATP-binding cassette transporter, subfamily G, member 8, group 
WBC protein PpABCG8 [Physcomitrella patens]
Length=693

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/630 (49%), Positives = 434/630 (69%), Gaps = 17/630 (3%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             +TW DL VTVS+ +   + +L   TG A PG+L+AIMGPSG GK+TLLDALAGR      
Sbjct  42    VTWRDLNVTVSNLKGKKRTVLFNATGLAEPGKLMAIMGPSGSGKTTLLDALAGRWARNAT  101

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
              +G+IL+NGR Q ++YGT+AYVTQ+D LT TLTVRE + Y+AQLQLPSSL +++   I E
Sbjct  102   HTGEILLNGRKQQMSYGTAAYVTQDDILTGTLTVRETIQYAAQLQLPSSLSKADMNNIVE  161

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI EMGL+   +T++G         G ++RR+SI +E+LTRP+L++LDEP+SGLDSAA+
Sbjct  162   QTILEMGLRTCADTKVGNWHLKGLSGG-ERRRLSIAVEVLTRPRLMYLDEPTSGLDSAAA  220

Query  766   FYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             F+V +K+ +LA +G+T++ASIHQPS+EVF+ F +L LLS GR +YFGPAS A+++FE+ G
Sbjct  221   FFVTTKLRNLARDGKTIIASIHQPSSEVFNCFDTLFLLSEGRTIYFGPASKALEYFESVG  280

Query  946   FPCPTLQNPSDHFLKTINKDFDNDD------EDVEQGCA-RGIPTEEVINILVNSYKSYH  1104
              PCP  ++PSDHFL+ IN +FD+ +      +D+E+G A   + T EV+ IL+++Y    
Sbjct  281   LPCPPFRSPSDHFLRAINPEFDDQELDTSLIKDMERGGALENMSTVEVVKILIDAYVCSD  340

Query  1105  RYREVQGQVAEISKQEGEVLKKS-SRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYIT  1281
                +   ++  +SK  G++L ++ S+A F TQ+  LTRRSF NM RDLGYYWLR  IYI 
Sbjct  341   AAYDANVKIQNLSKNGGKLLDQNGSQAKFITQTSALTRRSFRNMRRDLGYYWLRFIIYIA  400

Query  1282  LAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHY  1461
             L V +G ++ +VG   +SI++R   + F+  F TFM+IGGFPSFVED+KVF +E LNGHY
Sbjct  401   LGVSIGSVFRNVGTSWNSIRSRAGSITFMTGFLTFMSIGGFPSFVEDLKVFSRERLNGHY  460

Query  1462  GCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMM  1641
             G GAF +AN++SS P+L  ISL   ++ Y  VGL   FGHF YF + +  +M +VES+MM
Sbjct  461   GVGAFVLANSISSAPFLFFISLPTSLVTYLLVGLHPGFGHFFYFQICLFASMWVVESVMM  520

Query  1642  IIASLV-PNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLY  1818
              IA+LV PNYL+GII GA +QA+  L  G+ RLP D PKL W+YP++Y+ FH Y  QG+ 
Sbjct  521   AIAALVSPNYLLGIIIGASVQAVYFLCSGFARLPSDYPKLMWKYPMFYVSFHTYFLQGMS  580

Query  1819  KNEFQGLRLPE--ETGQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvK  1992
             +N+F GL      +    ITGE+VL + LQV +  +KW +L +L +M    RV+F   VK
Sbjct  581   ENDFLGLTFENYLKGWPRITGEQVLTDILQVTVSRNKWWNLGILFLMVFAYRVIFFATVK  640

Query  1993  ASEKAKHVVKAVM-----RVSPKQSHQVVA  2067
              SE+ +  +  V+      + P  ++Q +A
Sbjct  641   FSERLQPWINGVVLPLFRPMEPTVTYQTIA  670



>ref|XP_002968809.1| ATP-binding cassette transporter [Selaginella moellendorffii]
 gb|EFJ29925.1| ATP-binding cassette transporter [Selaginella moellendorffii]
Length=700

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/585 (53%), Positives = 404/585 (69%), Gaps = 24/585 (4%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             L W DL+VT S+ R   + +L  L+GYA PG + AIMGPSG GKSTLLD LAGRL   T 
Sbjct  48    LAWRDLFVTASNARGEVQVLLHRLSGYAEPGNITAIMGPSGSGKSTLLDTLAGRLAKNTT  107

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
              +G+I +NGR + L+YG +AYVTQ+DTL  TLTVRE + +SA L+LP  +P S+K+ I E
Sbjct  108   LTGEIFLNGRKKQLSYGVAAYVTQDDTLIGTLTVRETIAFSANLRLPDRMPASKKRAIVE  167

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI EMGLQ++ +T   G W  +G+SGG+KRRVSI LEILTRP+LLFLDEP+SGLDSA++
Sbjct  168   STIVEMGLQESADT-AIGNWHLRGLSGGEKRRVSIALEILTRPRLLFLDEPTSGLDSASA  226

Query  766   FYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             F+V   + +LA +GRTV+ASIHQPS+EVF LF +LCLLS G+++YFG    A +FF   G
Sbjct  227   FFVTQTLKNLARDGRTVIASIHQPSSEVFELFDNLCLLSQGKLIYFGNGYGAREFFADAG  286

Query  946   FPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARG---------------IPTEEVINIL  1080
             FPCP L+NPSDH+L+ +N DFD       Q   RG               + T +VI IL
Sbjct  287   FPCPELRNPSDHYLRAVNADFDR-----VQATLRGALKLKDLEYADPLDRVSTSKVIAIL  341

Query  1081  VNSYKSYHRYREVQGQVAEISKQEGEVLKKS-SRADFFTQSIVLTRRSFLNMFRDLGYYW  1257
             V +++S      +  +V E+S+ +G VL+ + S A FF Q+  LT RSF NM RD+GYYW
Sbjct  342   VEAFQSSGYAMMMAAKVHEVSQTKGVVLQSTGSHASFFMQAATLTLRSFKNMTRDMGYYW  401

Query  1258  LRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFK  1437
             LRL IY+ L +G+G +Y  +G    SI AR + ++++  F TFM+IGGFPSFVED+KVF 
Sbjct  402   LRLAIYVILNIGIGTLYFRIGTDYGSISARAACMSYVGGFLTFMSIGGFPSFVEDIKVFS  461

Query  1438  KETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNM  1617
             +E LNGHYG  AF I NTLSSLP+LLLI+L+ G I+Y  V L     HF YF L +  ++
Sbjct  462   RERLNGHYGVAAFIIGNTLSSLPFLLLIALVSGGISYNMVKLHPGVDHFFYFVLNLFASV  521

Query  1618  LLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHK  1797
               VESLMM +ASLVPN+LMGII GAG+Q + +L  G+FRLP DLPK FW+YP+ YI FH 
Sbjct  522   AAVESLMMTVASLVPNFLMGIITGAGIQGVFLLVAGFFRLPDDLPKFFWKYPMSYIGFHM  581

Query  1798  YAYQGLYKNEFQGLRLPEETGQI--ITGEEVLRETLQVEMGHSKW  1926
             Y+ QG+Y+N+F+GL    +   +  I GE VL +  Q+ M  SKW
Sbjct  582   YSLQGMYENDFRGLEFGNKVPGLPTIPGEFVLEDVYQINMARSKW  626



>ref|XP_003574118.1| PREDICTED: ABC transporter G family member 11-like [Brachypodium 
distachyon]
Length=708

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/588 (53%), Positives = 400/588 (68%), Gaps = 25/588 (4%)
 Frame = +1

Query  226   LTWEDLWVTV-SDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             L W DL VTV + G  G +A+L+ LTGYA PG + A+MGPSG GKSTLLDALAGRL    
Sbjct  53    LAWRDLTVTVPAAGGGGTQAVLEALTGYAEPGTMTALMGPSGSGKSTLLDALAGRLAANA  112

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
               SG +L+NGR   L++G +AYVTQ+D L  TLTVRE + YSA L+LP  +P  EK+++ 
Sbjct  113   FLSGTVLLNGRKANLSFGAAAYVTQDDNLMGTLTVRETISYSASLRLPDKMPMEEKRDLV  172

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             E TI EMGLQD  +T + G W  +G+SGG+KRRVSI LEIL RP+LLFLDEP+SGLDSA+
Sbjct  173   EGTIVEMGLQDCADT-VIGNWHLRGVSGGEKRRVSIALEILMRPRLLFLDEPTSGLDSAS  231

Query  763   SFYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETN  942
             +F+V   +  LA +GRTV+ASIHQPS+EVF LF  L LLS G+ VYFG AS A +FF   
Sbjct  232   AFFVTQTLRGLARDGRTVIASIHQPSSEVFQLFDRLYLLSGGKTVYFGQASEACEFFAQA  291

Query  943   GFPCPTLQNPSDHFLKTINKDFDN---------------DDEDVEQGCARGIPTEEVINI  1077
             GFPCP L+NPSDHFL+ IN DFD                 D+ +E+     I T E I  
Sbjct  292   GFPCPALRNPSDHFLRCINADFDKVKATLKGSMKMRFERSDDPLER-----ITTCEAIRK  346

Query  1078  LVNSYKSYHRYREVQGQVAEISKQEGEVLKKS-SRADFFTQSIVLTRRSFLNMFRDLGYY  1254
             L + Y+    Y   + +V E+++ +G VL    S+A F  Q+  LT+RSF+NM RD GYY
Sbjct  347   LFSHYQHSQDYLATRQKVDEMARVKGTVLDAGGSQASFGMQACTLTKRSFVNMTRDFGYY  406

Query  1255  WLRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVF  1434
             WLRL IY+ + V +G +Y +VG   SSI AR +  +FI  F TFM+IGGFPSFVEDMKVF
Sbjct  407   WLRLVIYVVVTVCIGSIYLNVGTKYSSILARGACASFIFGFVTFMSIGGFPSFVEDMKVF  466

Query  1435  KKETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMN  1614
             ++E LNGHYG  AF + NT S+ P+LLLI++  G + YF VGL     H+ +F L +  +
Sbjct  467   QRERLNGHYGVAAFVLGNTASAAPFLLLITVCSGTLCYFMVGLHPGLSHYVFFLLCLYAS  526

Query  1615  MLLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFH  1794
             + +VESLMM IAS+VPN+LMGII GAG+Q + +L  GYFRLP D+PK FWRYP+ YI FH
Sbjct  527   VTVVESLMMAIASVVPNFLMGIITGAGIQGVFMLVSGYFRLPHDIPKPFWRYPMSYISFH  586

Query  1795  KYAYQGLYKNEFQGLRLPEETGQI--ITGEEVLRETLQVEMGHSKWID  1932
              +A QG Y+N+  GL    ++  +  I GE VL    Q+++G SKW+D
Sbjct  587   YWALQGQYQNDLVGLMFDNQSELLPKIPGEYVLENVFQIDVGRSKWLD  634



>gb|EMS64568.1| ABC transporter G family member 11 [Triticum urartu]
Length=588

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/555 (55%), Positives = 392/555 (71%), Gaps = 27/555 (5%)
 Frame = +1

Query  334   MGPSGCGKSTLLDALAGRLELTTRQSGDILINGRTQTLAYGTS-----------------  462
             MGPSGCGK+TLLD LAGRL     Q+G ILINGR + LA+GTS                 
Sbjct  1     MGPSGCGKTTLLDTLAGRLGPGITQTGAILINGRREKLAFGTSLLGQAPKQMILINRDTG  60

Query  463   AYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAEMTIKEMGLQDAMNTRiggg  642
             AYVTQ++ L +T++VRE VYYSAQLQLP S+P  EK+  A+  I+EMGL DAM+TRIGG 
Sbjct  61    AYVTQDNVLMSTMSVRETVYYSAQLQLPGSMPAVEKRAHADAVIREMGLGDAMDTRIGGR  120

Query  643   wgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAASFYVMSKIMDLAS-EGRTVV  819
                    G Q++RV+IC+E+LTRP+LLFLDEP+SGLDSAAS+ VMS I  +A+ EG TVV
Sbjct  121   MTKGISGG-QRKRVTICIEMLTRPRLLFLDEPTSGLDSAASYPVMSHIARVAAREGMTVV  179

Query  820   ASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNGFPCPTLQNPSDHFLKTIN  999
             A++HQPS +VF LF  LCLL+ GR V+FGPAS A QFF  +GFPCP L+NPSDHFL+TIN
Sbjct  180   AAVHQPSGDVFDLFHRLCLLAYGRTVFFGPASDANQFFTESGFPCPHLRNPSDHFLRTIN  239

Query  1000  KDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREVQGQVAEISKQEGEVLKKSSR  1179
             KDFD  +E VE   AR     E I IL ++Y+S     +   ++AE+    G   +K  +
Sbjct  240   KDFD--EEIVESSKARRKTAAEAIEILTDAYQSPAYSEKTMDRIAEMKGIGGAPFRKREQ  297

Query  1180  ADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVL  1359
             A F T+  VLTRRSF+NM RD+GYYW+RLG+Y+ + + LG ++  +G+  SSIQ+RC V+
Sbjct  298   AGFSTKLFVLTRRSFVNMHRDIGYYWMRLGVYLGIGICLGTIFYQLGHSYSSIQSRCEVI  357

Query  1360  AFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFAIANTlsslpylllislipGM  1539
              +  +  TFMAIGGFPSFVED  VF++E L+GHYG   F I+NTLS+ PYL +I++IPG 
Sbjct  358   MYTTALLTFMAIGGFPSFVED--VFRRERLSGHYGVAEFVISNTLSATPYLAVIAVIPGA  415

Query  1540  IAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLVPNYLMGIIAGAGLQALMILG  1719
             + Y+  GL +    FAYF + + M  +LVES+MMIIA +VP++LMGII GAG+Q +M+L 
Sbjct  416   MLYYLTGLTKGPDRFAYFVVNLCMCTMLVESMMMIIAVIVPDFLMGIIVGAGVQGVMMLN  475

Query  1720  GGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGLRLPE----ETGQIITGEEVL  1887
             GG+FRLP +LPK  W+YP YYI FHKYA QG YKNEF G   P     E    I+G  VL
Sbjct  476   GGFFRLPNELPKPVWKYPCYYISFHKYAVQGFYKNEFIGQTFPSDQLVEKNVTISGLRVL  535

Query  1888  RETLQVEMGHSKWID  1932
             +E LQVEMG+SKW++
Sbjct  536   QEKLQVEMGYSKWVN  550



>ref|XP_006665061.1| PREDICTED: ABC transporter G family member 11-like isoform X2 
[Oryza brachyantha]
 ref|XP_006665062.1| PREDICTED: ABC transporter G family member 11-like isoform X3 
[Oryza brachyantha]
Length=559

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/511 (57%), Positives = 386/511 (76%), Gaps = 7/511 (1%)
 Frame = +1

Query  409   SGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAEM  588
             +G ILINGR+Q LA+GTSAYVTQE+ L  TLTVREA+YYSAQ+QLP ++  +EK   A  
Sbjct  2     TGQILINGRSQKLAFGTSAYVTQENVLMTTLTVREAIYYSAQIQLPDTMTVAEKLARAND  61

Query  589   TIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAASF  768
             T++EMGL  A++TRIGG        G QKR +SICLEILTRP+LLFLDEP+SGLDSAASF
Sbjct  62    TVREMGLTSALDTRIGGRSSKGISGGQQKR-LSICLEILTRPRLLFLDEPTSGLDSAASF  120

Query  769   YVMSKIMDLAS-EGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             +VM  I  LA+ EG TVVA +HQP +EVF LF  LCLL++G+ ++FGPAS A +FF +NG
Sbjct  121   HVMGHITGLAAREGMTVVAVVHQPCSEVFELFHGLCLLAAGKTIFFGPASTAAEFFASNG  180

Query  946   FPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREVQG  1125
             +PCP ++NPSDHFL+T+NKDFD + E  E+        +E I+ILVNSYKS +   + + 
Sbjct  181   YPCPPMRNPSDHFLRTVNKDFDKESE--ERLYYMPAVADEAIDILVNSYKSSNTSEDAKQ  238

Query  1126  QVAEISKQEGEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLGYM  1305
             ++  I++ +   + ++ R  F T+  VLTRRSF+NM+RD+GYYWLRL IY++++V LG +
Sbjct  239   EMRHINEMDSAAIGRN-RPGFVTKMFVLTRRSFVNMYRDVGYYWLRLAIYVSISVCLGTI  297

Query  1306  YNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFAIA  1485
             + +VGYG  SI+AR S+L FI +  T M+IGGFPSFVEDMK+F++E LNG+YG   F I+
Sbjct  298   FYNVGYGPDSIRARSSMLMFIGTMLTLMSIGGFPSFVEDMKIFRRERLNGYYGVTTFVIS  357

Query  1486  NTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLVPN  1665
             NTLSS PYLLLI+++PG IAY+  GLQ +  HF YFALV+    +LVE LMMI+A++VP+
Sbjct  358   NTLSSTPYLLLIAVVPGAIAYYLTGLQSQVDHFVYFALVLCSCTMLVEGLMMIVATIVPD  417

Query  1666  YLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGLRL  1845
             +LMGII GAG+Q +M+L  G+F+LP +LPK+ W+YPIYYI FHKYA QG YKNEF GL L
Sbjct  418   FLMGIITGAGIQGIMMLTSGFFQLPNNLPKILWKYPIYYISFHKYALQGFYKNEFSGLVL  477

Query  1846  PE--ETGQIITGEEVLRETLQVEMGHSKWID  1932
                 E  +I+ GE+ + E  QVEMG+SKW+D
Sbjct  478   QTNIEGPKIVIGEKDIAELFQVEMGYSKWVD  508



>ref|XP_010933306.1| PREDICTED: ABC transporter G family member 11-like isoform X2 
[Elaeis guineensis]
Length=637

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/588 (53%), Positives = 405/588 (69%), Gaps = 28/588 (5%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW+DL VTV+ G    + +L+GLTGYA PG + A+MGPSG GKSTLLDAL+GRL     
Sbjct  57    LTWKDLTVTVTLGNGETQQVLEGLTGYAEPGTITALMGPSGSGKSTLLDALSGRLATNAF  116

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
              SG IL+NGR + +++GT+AYVTQ+DTL  TLTVRE + YSA+L+LP  + + EK+ + E
Sbjct  117   LSGTILLNGRKKNMSFGTAAYVTQDDTLIGTLTVRETISYSARLRLPDMMRQEEKRALVE  176

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI EMGLQD  +T + G W  +GISGG+KRRVSI LEIL RP+LLFLDEP+SGLDSA++
Sbjct  177   GTIVEMGLQDCADT-VIGNWHLRGISGGEKRRVSIALEILMRPRLLFLDEPTSGLDSASA  235

Query  766   FYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             F+V   +  L+ +GRTV+ASIHQPS+EVF LF  L LLS G+ VYFG AS A +FF   G
Sbjct  236   FFVTKTLRGLSRDGRTVIASIHQPSSEVFELFDRLYLLSGGKTVYFGQASEAYEFFAQAG  295

Query  946   FPCPTLQNPSDHFLKTINKDFDN---------------DDEDVEQGCARGIPTEEVINIL  1080
             FPCP+L+NPSDHFL+ IN DFD                 D+ +E+     + T E I  L
Sbjct  296   FPCPSLRNPSDHFLRCINSDFDKVKATLKGSMKARFERSDDPLEK-----MTTMEAIRRL  350

Query  1081  VNSYKSYHRYREVQGQVAEISKQEGEVLKKS-SRADFFTQSIVLTRRSFLNMFRDLGYYW  1257
              + Y     Y   + +V EIS+ +G VL    S+A FF Q+  LT+RSF+NM RD GYYW
Sbjct  351   TDFYCHSQYYYSARERVDEISRVKGAVLDSGGSQASFFMQAFTLTKRSFVNMSRDFGYYW  410

Query  1258  LRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFK  1437
             LRL IY+ + + +G +Y +VG G  SI +R +  +F+  F TFM+IGGFPSFVEDMKVF+
Sbjct  411   LRLAIYLVVTICIGTIYLNVGTGYRSILSRGACASFVFGFVTFMSIGGFPSFVEDMKVFQ  470

Query  1438  KETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNM  1617
             +E LNGHYG  AF I NT+S+LP+L+LI+   G I YF V L   F H+ +F L +   +
Sbjct  471   RERLNGHYGVSAFVIGNTISALPFLILITFTSGSICYFMVRLHPGFMHYLFFVLCLYACV  530

Query  1618  LLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHK  1797
              +VESLMM IAS+VPN+LMGII GAG+Q + +L  G+FRLP D+PK FWRYP+ YI FH 
Sbjct  531   TVVESLMMAIASVVPNFLMGIIVGAGIQGIFMLVSGFFRLPHDIPKPFWRYPMSYISFHY  590

Query  1798  YAYQGLYKNEFQGL-----RLPEETGQIITGEEVLRETLQVEMGHSKW  1926
             +A QG Y+N+ +GL      LPE   + ITGE  L +  Q+++  SKW
Sbjct  591   WALQGQYQNDLRGLVFDNQELPELPPK-ITGELALEQFFQIDVNRSKW  637



>gb|KEH31211.1| white-brown-complex ABC transporter family protein [Medicago 
truncatula]
Length=640

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/602 (55%), Positives = 436/602 (72%), Gaps = 13/602 (2%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             +TWE L VTV +G K  K IL+GLTG A+PG LLAIMGPSG GKSTLLDALAGRL    +
Sbjct  41    VTWEKLRVTVPNGHK-RKPILQGLTGIAQPGRLLAIMGPSGSGKSTLLDALAGRLSSNMK  99

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
              +G+ILING  Q LAYG S YVTQ++ + + LT RE +YYSAQLQ P S+  +EKKE A+
Sbjct  100   HTGNILINGHKQALAYGISGYVTQDEAMLSRLTARETLYYSAQLQFPDSMSITEKKEQAD  159

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
             + ++EMGL +A+NTR  GGWGSKG+SGGQ+RR+SIC+EILTRP+LLFLDEP+SGLDSAAS
Sbjct  160   LILREMGLIEAVNTR-VGGWGSKGLSGGQRRRLSICIEILTRPRLLFLDEPTSGLDSAAS  218

Query  766   FYVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFE  936
             +YVMS I  L       RT+V SIHQPS+E+F LF  LCLLSSG  VYFGPA  A QFF 
Sbjct  219   YYVMSGIARLNLRDGIQRTIVVSIHQPSSELFELFHDLCLLSSGEAVYFGPAYDANQFFA  278

Query  937   TNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYRE  1116
              NGFPCPTL NPSDH+L+ INKDF   + DVE+G  +G+ TEE I ILV SY+S     +
Sbjct  279   ANGFPCPTLHNPSDHYLRIINKDF---EMDVEEGFGKGVTTEEAIGILVKSYRSSQIRTQ  335

Query  1117  VQGQVAEISKQE-GEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             V+ +V  ISK + G + KK     F TQ +VL RRS L +FRD+G YWLRL +++ +A+ 
Sbjct  336   VKKKVEIISKSDSGAIGKKRIHGAFTTQCLVLIRRSSLQLFRDVGNYWLRLVVFVMIAIS  395

Query  1294  LGYMY--NDVGYGNSSIQARCSVLAFIASFFTFMA-IGGFPSFVEDMKVFKKETLNGHYG  1464
             +G ++       G++SIQ R S+L F+ S  TFM  +GGF   +E+MKVF++E LNGHYG
Sbjct  396   IGSIFYGIGSSSGSASIQGRGSLLTFLVSVLTFMTLVGGFSPLLEEMKVFERERLNGHYG  455

Query  1465  CGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMI  1644
               AF I N  SSLPY+++IS+IPG IAY    + +   HF YF  +++  ++ VESLM++
Sbjct  456   VTAFLIGNIFSSLPYIIMISVIPGGIAYQLCKMHKGLEHFLYFISLLIAIVMWVESLMLV  515

Query  1645  IASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKN  1824
             + S+ PNY++G+    G++ LMIL  G++RLP +LPKL W+YP+Y+I F KYA+QG +KN
Sbjct  516   VGSISPNYVIGMFITGGIEGLMILTAGFYRLPNELPKLLWKYPLYHISFLKYAFQGSFKN  575

Query  1825  EFQGLRLPEETGQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEK  2004
             EF+GL++   T  I++G E+L +   VE+GHSKW+DL ++  M V+ RV+FL++ K+ EK
Sbjct  576   EFEGLKVDVGT-NIVSGREILNDKWHVEIGHSKWVDLAIMFGMIVLYRVLFLVITKSKEK  634

Query  2005  AK  2010
              K
Sbjct  635   LK  636



>ref|XP_010933304.1| PREDICTED: ABC transporter G family member 11-like isoform X1 
[Elaeis guineensis]
Length=712

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/590 (53%), Positives = 406/590 (69%), Gaps = 28/590 (5%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW+DL VTV+ G    + +L+GLTGYA PG + A+MGPSG GKSTLLDAL+GRL     
Sbjct  57    LTWKDLTVTVTLGNGETQQVLEGLTGYAEPGTITALMGPSGSGKSTLLDALSGRLATNAF  116

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
              SG IL+NGR + +++GT+AYVTQ+DTL  TLTVRE + YSA+L+LP  + + EK+ + E
Sbjct  117   LSGTILLNGRKKNMSFGTAAYVTQDDTLIGTLTVRETISYSARLRLPDMMRQEEKRALVE  176

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI EMGLQD  +T + G W  +GISGG+KRRVSI LEIL RP+LLFLDEP+SGLDSA++
Sbjct  177   GTIVEMGLQDCADT-VIGNWHLRGISGGEKRRVSIALEILMRPRLLFLDEPTSGLDSASA  235

Query  766   FYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             F+V   +  L+ +GRTV+ASIHQPS+EVF LF  L LLS G+ VYFG AS A +FF   G
Sbjct  236   FFVTKTLRGLSRDGRTVIASIHQPSSEVFELFDRLYLLSGGKTVYFGQASEAYEFFAQAG  295

Query  946   FPCPTLQNPSDHFLKTINKDFDN---------------DDEDVEQGCARGIPTEEVINIL  1080
             FPCP+L+NPSDHFL+ IN DFD                 D+ +E+     + T E I  L
Sbjct  296   FPCPSLRNPSDHFLRCINSDFDKVKATLKGSMKARFERSDDPLEK-----MTTMEAIRRL  350

Query  1081  VNSYKSYHRYREVQGQVAEISKQEGEVLKKS-SRADFFTQSIVLTRRSFLNMFRDLGYYW  1257
              + Y     Y   + +V EIS+ +G VL    S+A FF Q+  LT+RSF+NM RD GYYW
Sbjct  351   TDFYCHSQYYYSARERVDEISRVKGAVLDSGGSQASFFMQAFTLTKRSFVNMSRDFGYYW  410

Query  1258  LRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFK  1437
             LRL IY+ + + +G +Y +VG G  SI +R +  +F+  F TFM+IGGFPSFVEDMKVF+
Sbjct  411   LRLAIYLVVTICIGTIYLNVGTGYRSILSRGACASFVFGFVTFMSIGGFPSFVEDMKVFQ  470

Query  1438  KETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNM  1617
             +E LNGHYG  AF I NT+S+LP+L+LI+   G I YF V L   F H+ +F L +   +
Sbjct  471   RERLNGHYGVSAFVIGNTISALPFLILITFTSGSICYFMVRLHPGFMHYLFFVLCLYACV  530

Query  1618  LLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHK  1797
              +VESLMM IAS+VPN+LMGII GAG+Q + +L  G+FRLP D+PK FWRYP+ YI FH 
Sbjct  531   TVVESLMMAIASVVPNFLMGIIVGAGIQGIFMLVSGFFRLPHDIPKPFWRYPMSYISFHY  590

Query  1798  YAYQGLYKNEFQGL-----RLPEETGQIITGEEVLRETLQVEMGHSKWID  1932
             +A QG Y+N+ +GL      LPE   + ITGE  L +  Q+++  SKW D
Sbjct  591   WALQGQYQNDLRGLVFDNQELPELPPK-ITGELALEQFFQIDVNRSKWWD  639



>tpg|DAA49491.1| TPA: hypothetical protein ZEAMMB73_694244 [Zea mays]
Length=710

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/591 (52%), Positives = 408/591 (69%), Gaps = 28/591 (5%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             L W DL VTV+ G    +A+L+GLTG+A PG + A+MGPSG GKSTLLDALAGRL     
Sbjct  56    LAWRDLTVTVALGTGDTQAVLQGLTGHAEPGTITALMGPSGSGKSTLLDALAGRLAANAF  115

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
               G +L+NGR   L++G +AYVTQ+D L  TLTVRE + YSA+L+LP S+PR EK+ + E
Sbjct  116   LDGTVLLNGRKANLSFGAAAYVTQDDNLIGTLTVRETISYSARLRLPDSMPREEKQALVE  175

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI EMGLQD  +T + G W  +GISGG+KRRVSI LEIL RP+LLFLDEP+SGLDSA++
Sbjct  176   GTIAEMGLQDCADT-VVGNWHLRGISGGEKRRVSIALEILMRPRLLFLDEPTSGLDSASA  234

Query  766   FYVMSKIMDLASEG-RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETN  942
             F+V   +  LA +G RTVVAS+HQPS++VF LF  L LLS GR VYFG AS A +FF   
Sbjct  235   FFVTQTLRGLARDGGRTVVASVHQPSSDVFLLFDCLYLLSGGRTVYFGKASEACEFFAQA  294

Query  943   GFPCPTLQNPSDHFLKTINKDFD----------------NDDEDVEQGCARGIPTEEVIN  1074
             GFPCP ++NPSDHFL+ IN DFD                + D+ +E+     I T E ++
Sbjct  295   GFPCPPMRNPSDHFLRCINSDFDRVKATLKGSMKTRFERSYDDPLEK-----ITTSEAMS  349

Query  1075  ILVNSYKSYHRYREVQGQVAEISKQEGEVLKKS-SRADFFTQSIVLTRRSFLNMFRDLGY  1251
              LV+ Y+    Y   Q +V E+++ +G VL    S+A F  Q+  LT+RSF+NM RD GY
Sbjct  350   RLVSHYQHSQHYVSAQQKVDEMARLKGTVLDSGGSQASFLMQASTLTKRSFVNMSRDFGY  409

Query  1252  YWLRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKV  1431
             YWLRL IY+ + + +G +Y +VG G SSI AR +  +FI  F TFM+IGGFPSFVEDMKV
Sbjct  410   YWLRLIIYVVVTICIGTIYFNVGTGYSSILARGACASFIFGFVTFMSIGGFPSFVEDMKV  469

Query  1432  FKKETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILM  1611
             F++E LNGHYG  AF I+NT+S++P+L+LI+L+ G + YF V L   F H+ +F L +  
Sbjct  470   FQRERLNGHYGVVAFVISNTVSAMPFLVLITLVSGTLCYFMVRLHPGFTHYLFFVLDLYA  529

Query  1612  NMLLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDF  1791
             ++ +VESLMM IAS++PN+LMGII GAG+Q + +L  GYFRLP D+PK FWRYP+ YI F
Sbjct  530   SVTVVESLMMAIASVIPNFLMGIIVGAGIQGIFMLVSGYFRLPHDIPKPFWRYPMSYISF  589

Query  1792  HKYAYQGLYKNEFQGLRLPEETGQI----ITGEEVLRETLQVEMGHSKWID  1932
             H +A +G Y+N+ +GL    +   +    I GE +L    Q++ G SKW+D
Sbjct  590   HYWALRGQYQNDLKGLLFDGQQDDVLPSKIPGEFILENVFQMDAGRSKWLD  640



>ref|XP_008664814.1| PREDICTED: ABC transporter G family member 11-like [Zea mays]
Length=718

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/591 (52%), Positives = 408/591 (69%), Gaps = 28/591 (5%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             L W DL VTV+ G    +A+L+GLTG+A PG + A+MGPSG GKSTLLDALAGRL     
Sbjct  64    LAWRDLTVTVALGTGDTQAVLQGLTGHAEPGTITALMGPSGSGKSTLLDALAGRLAANAF  123

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
               G +L+NGR   L++G +AYVTQ+D L  TLTVRE + YSA+L+LP S+PR EK+ + E
Sbjct  124   LDGTVLLNGRKANLSFGAAAYVTQDDNLIGTLTVRETISYSARLRLPDSMPREEKQALVE  183

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI EMGLQD  +T + G W  +GISGG+KRRVSI LEIL RP+LLFLDEP+SGLDSA++
Sbjct  184   GTIAEMGLQDCADT-VVGNWHLRGISGGEKRRVSIALEILMRPRLLFLDEPTSGLDSASA  242

Query  766   FYVMSKIMDLASEG-RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETN  942
             F+V   +  LA +G RTVVAS+HQPS++VF LF  L LLS GR VYFG AS A +FF   
Sbjct  243   FFVTQTLRGLARDGGRTVVASVHQPSSDVFLLFDCLYLLSGGRTVYFGKASEACEFFAQA  302

Query  943   GFPCPTLQNPSDHFLKTINKDFD----------------NDDEDVEQGCARGIPTEEVIN  1074
             GFPCP ++NPSDHFL+ IN DFD                + D+ +E+     I T E ++
Sbjct  303   GFPCPPMRNPSDHFLRCINSDFDRVKATLKGSMKTRFERSYDDPLEK-----ITTSEAMS  357

Query  1075  ILVNSYKSYHRYREVQGQVAEISKQEGEVLKKS-SRADFFTQSIVLTRRSFLNMFRDLGY  1251
              LV+ Y+    Y   Q +V E+++ +G VL    S+A F  Q+  LT+RSF+NM RD GY
Sbjct  358   RLVSHYQHSQHYVSAQQKVDEMARLKGTVLDSGGSQASFLMQASTLTKRSFVNMSRDFGY  417

Query  1252  YWLRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKV  1431
             YWLRL IY+ + + +G +Y +VG G SSI AR +  +FI  F TFM+IGGFPSFVEDMKV
Sbjct  418   YWLRLIIYVVVTICIGTIYFNVGTGYSSILARGACASFIFGFVTFMSIGGFPSFVEDMKV  477

Query  1432  FKKETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILM  1611
             F++E LNGHYG  AF I+NT+S++P+L+LI+L+ G + YF V L   F H+ +F L +  
Sbjct  478   FQRERLNGHYGVVAFVISNTVSAMPFLVLITLVSGTLCYFMVRLHPGFTHYLFFVLDLYA  537

Query  1612  NMLLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDF  1791
             ++ +VESLMM IAS++PN+LMGII GAG+Q + +L  GYFRLP D+PK FWRYP+ YI F
Sbjct  538   SVTVVESLMMAIASVIPNFLMGIIVGAGIQGIFMLVSGYFRLPHDIPKPFWRYPMSYISF  597

Query  1792  HKYAYQGLYKNEFQGLRLPEETGQI----ITGEEVLRETLQVEMGHSKWID  1932
             H +A +G Y+N+ +GL    +   +    I GE +L    Q++ G SKW+D
Sbjct  598   HYWALRGQYQNDLKGLLFDGQQDDVLPSKIPGEFILENVFQMDAGRSKWLD  648



>ref|XP_002985191.1| hypothetical protein SELMODRAFT_122027 [Selaginella moellendorffii]
 gb|EFJ13685.1| hypothetical protein SELMODRAFT_122027 [Selaginella moellendorffii]
Length=695

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/579 (53%), Positives = 402/579 (69%), Gaps = 14/579 (2%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW DL V V   +   + +L  LTG+A PG L  +MGPSGCGKSTLLDALAGRL     
Sbjct  62    LTWRDLSVNVLTDKGACRTVLDSLTGFAEPGSLTVVMGPSGCGKSTLLDALAGRLAKNAI  121

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             Q+GDIL+NG  + L+YG +AYVTQ+DTL +TLTVRE ++Y+++L+LP ++P SEK+ I E
Sbjct  122   QTGDILLNGHKRKLSYGIAAYVTQDDTLISTLTVRETIFYTSRLRLPDAMPNSEKQAIVE  181

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
               I EMGLQD  NT   G W  +G+SGG+KRR+SI +EILTRP+LLFLDEP+SGLDSA++
Sbjct  182   RVIIEMGLQDCANT-PVGNWHLRGLSGGEKRRLSIAVEILTRPRLLFLDEPTSGLDSASA  240

Query  766   FYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             F+V   +  LA + RTV+ S+HQPS+EVF LF +L LLS+GR VYFGPA  A Q F + G
Sbjct  241   FFVTRTLRRLARDKRTVICSVHQPSSEVFQLFDNLLLLSNGRTVYFGPAINAQQHFASVG  300

Query  946   FPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCA---------RGIPTEEVINILVNSYKS  1098
             FPCP ++NPSDHFLK IN DFD  +E +++ C              T EVI+ L+ +Y+S
Sbjct  301   FPCPPMRNPSDHFLKAINADFDRVNESLKESCLPHEESADVFETTTTAEVISALLTAYES  360

Query  1099  YHRYREVQGQVAEISKQEGEVLKKS-SRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIY  1275
               + + V  +V  ++  +G+ L+ S S+A F+ Q   LTRRSF NM RD+GYYWLR+ +Y
Sbjct  361   SEQAQSVMERVEIMTLVKGDFLESSGSQASFWMQCATLTRRSFTNMSRDMGYYWLRVLVY  420

Query  1276  ITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNG  1455
             I LA+ +G ++  VG    SI AR S + ++  F TFMAIGGFPSFVEDMKVF +E LNG
Sbjct  421   ILLAICVGTIFYRVGTSYDSIFARGSCMGYLWGFLTFMAIGGFPSFVEDMKVFHRERLNG  480

Query  1456  HYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESL  1635
             HYG  AF + NTLSS+P+LLL+SL  G I Y+ V L   F HF YF L +   + LVE L
Sbjct  481   HYGVVAFVVGNTLSSIPFLLLMSLTSGAITYYLVQLHPGFTHFLYFVLGLATCVTLVEGL  540

Query  1636  MMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGL  1815
             MM +AS+VPNYLMGII GA +QA+++L GG+FRL  DLPK  WRYPI Y+ FH Y  QG+
Sbjct  541   MMAVASVVPNYLMGIIVGAAVQAVLMLTGGFFRLLSDLPKPVWRYPISYLSFHSYVLQGM  600

Query  1816  YKNEFQGLRLPEETGQI--ITGEEVLRETLQVEMGHSKW  1926
             Y+N+F G++   +   +  I G ++L     V+M  +KW
Sbjct  601   YQNDFLGIQFDSKYPFLPKINGRDILINN-DVDMSRTKW  638



>ref|XP_006478168.1| PREDICTED: ABC transporter G family member 11-like [Citrus sinensis]
Length=706

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/589 (53%), Positives = 405/589 (69%), Gaps = 28/589 (5%)
 Frame = +1

Query  226   LTWEDL--WVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELT  399
             LTW+DL   VT+S+G   N  +L+GLTGYA PG L A+MGPSG GKSTLLDAL+ RL   
Sbjct  52    LTWKDLTVMVTLSNGETHN--VLEGLTGYAEPGTLTALMGPSGSGKSTLLDALSSRLASN  109

Query  400   TRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEI  579
                SG IL+NG    L++GT+AYVTQ+D L  TLTVRE + YSA+L+LP  +P SEK+ +
Sbjct  110   AFLSGTILLNGHKTKLSFGTAAYVTQDDNLIGTLTVRETISYSARLRLPDKMPWSEKRTL  169

Query  580   AEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSA  759
              E TI EMGLQD  +T + G W  +GISGG++RRVSI LEIL RP+LLFLDEP+SGLDSA
Sbjct  170   VERTIIEMGLQDCADT-VIGNWHLRGISGGERRRVSIALEILMRPRLLFLDEPTSGLDSA  228

Query  760   ASFYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             A+F+V   +  L+ +GRTV+ASIHQPS+EVF LF  L LLS G+ VYFG ASAA +FF  
Sbjct  229   AAFFVTQTLRCLSRDGRTVIASIHQPSSEVFELFDRLYLLSGGKTVYFGEASAAFEFFAQ  288

Query  940   NGFPCPTLQNPSDHFLKTINKDFD---------------NDDEDVEQGCARGIPTEEVIN  1074
              GFPCP L+NPSDHFL+ IN DFD                 D+ +E+     I T E I 
Sbjct  289   AGFPCPALRNPSDHFLRCINSDFDKVKATLKGSMKLKFETSDDPLEK-----ITTAEAIK  343

Query  1075  ILVNSYKSYHRYREVQGQVAEISKQEGEVLKKS-SRADFFTQSIVLTRRSFLNMFRDLGY  1251
              L++ Y++       + +V  ISK +G VL    S+A F  Q+  LT+RSF+NM RD GY
Sbjct  344   NLIDFYQTSQHSYAAKEKVEGISKVKGTVLDAGGSQASFLMQAFTLTKRSFVNMSRDFGY  403

Query  1252  YWLRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKV  1431
             YWLRL IY+ + + +G +Y +VG G +SI AR S  +F+  F TFM+IGGFPSFVEDMKV
Sbjct  404   YWLRLVIYVVVTICIGTIYLNVGTGYNSILARGSCASFVFGFVTFMSIGGFPSFVEDMKV  463

Query  1432  FKKETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILM  1611
             F++E LNGHYG  AF I NTLS++P+L++I+ I G I YF V L   F H+ +F L +  
Sbjct  464   FQRERLNGHYGVTAFVIGNTLSAMPFLIMITFISGTICYFMVRLHPGFIHYLFFVLCLYA  523

Query  1612  NMLLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDF  1791
             ++ +VESLMM IAS+VPN+LMGII GAG+Q + +L  GYFRLP D+PK  WRYP+ Y+ F
Sbjct  524   SVAVVESLMMAIASIVPNFLMGIITGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYLSF  583

Query  1792  HKYAYQGLYKNEFQGLRLPEETGQI--ITGEEVLRETLQVEMGHSKWID  1932
             H +A QG Y+N+ +GL    ++  +  I GE VL    Q+++  SKWID
Sbjct  584   HYWALQGQYQNDLKGLWFDNQSPDLPKIPGEYVLENVFQIDVRRSKWID  632



>gb|KHN26510.1| ABC transporter G family member 11 [Glycine soja]
Length=565

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/566 (54%), Positives = 410/566 (72%), Gaps = 11/566 (2%)
 Frame = +1

Query  334   MGPSGCGKSTLLDALAGRLELTTRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVRE  513
             MGPSGCGKSTLLDALAGRL    +Q+G ILING+ Q LAYGTS YVTQ+D + +TLT  E
Sbjct  1     MGPSGCGKSTLLDALAGRLSSNMKQTGKILINGQKQALAYGTSGYVTQDDAMLSTLTTGE  60

Query  514   AVYYSAQLQLPSSLPRSEKKEIAEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSIC  693
              +YYSAQLQ P S+  +EKKE  +MT++EMGLQDA+NTR+GG        G QKRR+SIC
Sbjct  61    TLYYSAQLQFPDSMSIAEKKERTDMTLREMGLQDAINTRVGGWGSKGLSGG-QKRRLSIC  119

Query  694   LEILTRPKLLFLDEPSSGLDSAASFYVMSKIMDLASEG---RTVVASIHQPSTEVfslft  864
             +EILTRP+LLFLDEP+SGLDSAAS+YVMS+I  L       RT+VASIHQPS+E+F LF 
Sbjct  120   IEILTRPRLLFLDEPTSGLDSAASYYVMSRIATLNQRDGIRRTIVASIHQPSSEIFELFH  179

Query  865   slcllssGRVVYFGPASAAIQFFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCA  1044
              LCLLSSG  VYFGPAS A QFF +NGFPCPTL NPSDH+L+ INKDF+   +D E+G  
Sbjct  180   DLCLLSSGETVYFGPASDANQFFASNGFPCPTLHNPSDHYLRIINKDFE---QDAEKGLG  236

Query  1045  RGIPTEEVINILVNSYKSYHRYREVQGQVAEISKQEGEVLKKSS-RADFFTQSIVLTRRS  1221
              G+ +E+ I+ LV SYKS    ++V+ +V +I + + + ++     A F TQ +VL RR+
Sbjct  237   TGVTSEKAIDTLVKSYKSSQIRKQVKKEVDKIGESDSDAIRNQRIHAAFPTQCLVLIRRA  296

Query  1222  FLNMFRDLGYYWLRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMA-IG  1398
              L +FRD+  YWLRL ++I +A+ +G ++ D+G  N SIQ R S+L F  S  TFM  +G
Sbjct  297   SLQLFRDISNYWLRLIVFIVIAISIGSIFYDIGTSNGSIQGRGSLLIFFVSVLTFMTLVG  356

Query  1399  GFPSFVEDMKVFKKETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFG  1578
             GF   +E+MKVF++E LNGHYG  AF I N  S++PY+LLISLIPG IAY+  G+ +   
Sbjct  357   GFSPLLEEMKVFERERLNGHYGVTAFLIGNIFSAVPYMLLISLIPGGIAYYLCGMHKGPE  416

Query  1579  HFAYFALVILMNMLLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKL  1758
              F YF  ++   ++ VESLM+++ S+ PNY++G+    G++ LMIL GG++RLP DLPK 
Sbjct  417   RFFYFTSLLFAIVMWVESLMLVVGSICPNYVIGMFLAGGVEGLMILTGGFYRLPNDLPKP  476

Query  1759  FWRYPIYYIDFHKYAYQGLYKNEFQGL--RLPEETGQIITGEEVLRETLQVEMGHSKWID  1932
              W+YP+YY+ F KYA+QG +KN+F+GL   + ++ G I++G EVL +T  +EMG+SKW+D
Sbjct  477   LWKYPLYYVSFLKYAFQGSFKNDFEGLTFSVDQDGGGIMSGREVLTDTWHLEMGYSKWVD  536

Query  1933  llvlvvmgvvcrvvfllvvKASEKAK  2010
             L ++  M V+ RV+FL++ K  EK K
Sbjct  537   LAIMFGMIVLYRVLFLVITKCKEKMK  562



>ref|XP_001782684.1| ATP-binding cassette transporter, subfamily G, member 28, group 
WBC protein PpABCG28 [Physcomitrella patens]
 gb|EDQ52515.1| ATP-binding cassette transporter, subfamily G, member 28, group 
WBC protein PpABCG28 [Physcomitrella patens]
Length=686

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/592 (53%), Positives = 406/592 (69%), Gaps = 28/592 (5%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNK-AILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             LTW D+WVT    R G+K AIL+GLTGYA PG ++AIMGPSG GKST+LD LAGRL   T
Sbjct  24    LTWVDIWVTTV--RHGSKQAILQGLTGYAEPGSIMAIMGPSGSGKSTVLDTLAGRLAKNT  81

Query  403   RQSGDILING-RTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEI  579
              Q+GDIL+NG R  TL+YGT+AYVTQ D L  TLTVRE +YYSA L+LPS++  ++KK +
Sbjct  82    TQTGDILLNGHRKSTLSYGTAAYVTQTDELIGTLTVRETMYYSADLRLPSNMSHADKKAL  141

Query  580   AEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSA  759
              + TI+EMGL D  +T   G W  +G+SGG+KRR+SI LEILTRP+LLFLDEP+SGLDSA
Sbjct  142   VDSTIQEMGLFDCRHT-PVGNWHLRGLSGGEKRRLSIALEILTRPRLLFLDEPTSGLDSA  200

Query  760   ASFYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             A+F+V++ + +LA +GRTV+ASIHQPS+EVF LF +L LLS G++++FG A AA + F T
Sbjct  201   AAFFVVTTLRNLARDGRTVIASIHQPSSEVFELFDNLTLLSGGKLIFFGEAKAANEHFTT  260

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARG--------------IPTEEVINI  1077
              GFPCP+L+NPSDHFL+ IN DFD    +    C+                + T +V+ I
Sbjct  261   AGFPCPSLRNPSDHFLRAINSDFDQVKSNFN--CSSNFRVSLQDVVDMLDKMSTNQVVRI  318

Query  1078  LVNSYKSYHRYREVQGQVAEISKQEGEVLKKS-SRADFFTQSIVLTRRSFLNMFRDLGYY  1254
             L +SY++         ++ EI + +G VL+ S S A F  Q   LTRRSF+NM RD+GYY
Sbjct  319   LSDSYQNSEYAAAAMSRINEILQMQGTVLEGSGSEASFLKQCSTLTRRSFVNMSRDIGYY  378

Query  1255  WLRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVF  1434
             WLRL IYITL++ LG ++  + +  SSI  R   + ++  F TFM+IGGFPSFVEDMKVF
Sbjct  379   WLRLVIYITLSLCLGSIFLHLDFSYSSIMGRAGCIGYVGGFLTFMSIGGFPSFVEDMKVF  438

Query  1435  KKETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMN  1614
              +E LNGHYG  AF I N+LSS P+L +I+LI  +I Y+  GL   F HF YF L + + 
Sbjct  439   HRERLNGHYGVFAFVIGNSLSSSPFLFMIALISSVIVYYMAGLHLGFDHFVYFVLSLFVQ  498

Query  1615  MLLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFH  1794
             + +VESLMM +AS+VPN+LMGII GAG+Q + +L  G+FRL  DLPK  WRYP+ YI F 
Sbjct  499   VTIVESLMMSVASIVPNFLMGIITGAGIQGIFMLVAGFFRLIDDLPKPVWRYPLSYIGFD  558

Query  1795  KYAYQGLYKNEFQGLRLP------EETGQIITGEEVLRETLQVEMGHSKWID  1932
              YA QG+YKNEF G          +  G  I G  V+RE   ++    KW D
Sbjct  559   MYALQGMYKNEFTGYTFDNFVLDGKSIGPPIPGWYVIRELYGMKTTRGKWDD  610



>gb|KDO56026.1| hypothetical protein CISIN_1g005142mg [Citrus sinensis]
 gb|KDO56027.1| hypothetical protein CISIN_1g005142mg [Citrus sinensis]
Length=706

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/589 (53%), Positives = 404/589 (69%), Gaps = 28/589 (5%)
 Frame = +1

Query  226   LTWEDL--WVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELT  399
             LTW+DL   VT+S+G   N  +L+GLTGYA PG L A+MGPSG GKSTLLDAL+ RL   
Sbjct  52    LTWKDLTVMVTLSNGETHN--VLEGLTGYAEPGTLTALMGPSGSGKSTLLDALSSRLASN  109

Query  400   TRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEI  579
                SG IL+NG    L++GT+AYVTQ+D L  TLTVRE + YSA+L+LP  +P SEK+ +
Sbjct  110   AFLSGTILLNGHKTKLSFGTAAYVTQDDNLIGTLTVRETISYSARLRLPDKMPWSEKRTL  169

Query  580   AEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSA  759
              E TI EMGLQD  +T + G W  +GISGG++RRVSI LEIL RP+LLFLDEP+SGLDSA
Sbjct  170   VERTIIEMGLQDCADT-VIGNWHLRGISGGERRRVSIALEILMRPRLLFLDEPTSGLDSA  228

Query  760   ASFYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             A+F+V   +  L+ +GRTV+ASIHQPS+EVF LF  L LLS G+ VYFG  SAA +FF  
Sbjct  229   AAFFVTQTLRCLSRDGRTVIASIHQPSSEVFELFDRLYLLSGGKTVYFGETSAAFEFFAQ  288

Query  940   NGFPCPTLQNPSDHFLKTINKDFD---------------NDDEDVEQGCARGIPTEEVIN  1074
              GFPCP L+NPSDHFL+ IN DFD                 D+ +E+     I T E I 
Sbjct  289   AGFPCPALRNPSDHFLRCINSDFDKVKATLKGSMKLKFETSDDPLEK-----ITTAEAIK  343

Query  1075  ILVNSYKSYHRYREVQGQVAEISKQEGEVLKKS-SRADFFTQSIVLTRRSFLNMFRDLGY  1251
              L++ Y++       + +V  ISK +G VL    S+A F  Q+  LT+RSF+NM RD GY
Sbjct  344   NLIDFYQTSQHSYAAKEKVEGISKVKGTVLDAGGSQASFLMQAFTLTKRSFVNMSRDFGY  403

Query  1252  YWLRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKV  1431
             YWLRL IY+ + + +G +Y +VG G +SI AR S  +F+  F TFM+IGGFPSFVEDMKV
Sbjct  404   YWLRLVIYVVVTICIGTIYLNVGTGYNSILARGSCASFVFGFVTFMSIGGFPSFVEDMKV  463

Query  1432  FKKETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILM  1611
             F++E LNGHYG  AF I NTLS++P+L++I+ I G I YF V L   F H+ +F L +  
Sbjct  464   FQRERLNGHYGVTAFVIGNTLSAMPFLIMITFISGTICYFMVRLHPGFIHYLFFVLCLYA  523

Query  1612  NMLLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDF  1791
             ++ +VESLMM IAS+VPN+LMGII GAG+Q + +L  GYFRLP D+PK  WRYP+ Y+ F
Sbjct  524   SVAVVESLMMAIASIVPNFLMGIITGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYLSF  583

Query  1792  HKYAYQGLYKNEFQGLRLPEETGQI--ITGEEVLRETLQVEMGHSKWID  1932
             H +A QG Y+N+ +GL    ++  +  I GE VL    Q+++  SKWID
Sbjct  584   HYWALQGQYQNDLKGLWFDNQSPDLPKIPGEYVLENVFQIDVRRSKWID  632



>ref|XP_006423807.1| hypothetical protein CICLE_v10027954mg [Citrus clementina]
 gb|ESR37047.1| hypothetical protein CICLE_v10027954mg [Citrus clementina]
Length=464

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/413 (71%), Positives = 341/413 (83%), Gaps = 12/413 (3%)
 Frame = +1

Query  223   FLTWEDLWVTVSDG-RKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELT  399
             FLTW+DLWVTV DG +KGN++IL+GLTGYARPGELLAIMGPSGCGKSTLLDALAGRL   
Sbjct  44    FLTWQDLWVTVPDGQKKGNRSILQGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLGSN  103

Query  400   TRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEI  579
             TRQ+G+ILINGR + LAYGTSAYVTQ+D L  TLTV EAVYYSAQLQLP ++ + +KKE 
Sbjct  104   TRQAGEILINGRKRALAYGTSAYVTQDDALITTLTVSEAVYYSAQLQLPDTMTKLQKKER  163

Query  580   AEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSA  759
             AEMTIKEMGLQDAMNTR  GGWG+KG+SGGQKRRVSIC+E+LTRPKLLFLDEP+SGLDSA
Sbjct  164   AEMTIKEMGLQDAMNTR-IGGWGAKGLSGGQKRRVSICIEMLTRPKLLFLDEPTSGLDSA  222

Query  760   ASFYVMSKIMDLASE-----GRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAI  924
             AS+YVMS+I  L         RT++ SIHQPS+EVF LF +LCLLSSG+ VYFGPASAA 
Sbjct  223   ASYYVMSRIAKLDQRDHGVGSRTIITSIHQPSSEVFQLFHNLCLLSSGQTVYFGPASAAN  282

Query  925   QFFETNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYH  1104
             +FF  NGFPCPTLQNPSDHFLKTINKDF    ED+E+G A  +PT+E I+IL  SYKS  
Sbjct  283   EFFALNGFPCPTLQNPSDHFLKTINKDF---QEDIEKGLAGVVPTQEAIDILTKSYKSSD  339

Query  1105  RYREVQGQVAEISKQE--GEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYI  1278
              Y +V+ QVAEI K +  G + KKS+ ADF TQ IVLT RSF+NM+RDLGYYW RLG+Y+
Sbjct  340   SYLQVRSQVAEICKAQDSGALEKKSTHADFLTQCIVLTSRSFVNMYRDLGYYWFRLGVYV  399

Query  1279  TLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFK  1437
              L VGL  +++++G  N+SIQAR S+L F+ASF TFM IGGFPSFVEDMKV K
Sbjct  400   LLGVGLATVFSNLGTDNNSIQARGSLLMFVASFLTFMTIGGFPSFVEDMKVRK  452



>ref|XP_009760683.1| PREDICTED: ABC transporter G family member 11-like, partial [Nicotiana 
sylvestris]
Length=537

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/425 (68%), Positives = 346/425 (81%), Gaps = 6/425 (1%)
 Frame = +1

Query  223   FLTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             +LTW+DLWVTV D + G +AIL+GLTGY +PG++LAIMGPSGCGKSTLLD LAGRL+  T
Sbjct  117   YLTWKDLWVTVPDKKTGRRAILQGLTGYVQPGQVLAIMGPSGCGKSTLLDTLAGRLDSNT  176

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
             RQ+G+ILINGR Q LA+GTSAYVTQ+DTL  TLTV+EA+YYSAQLQLP S+ RSEKKE A
Sbjct  177   RQTGEILINGRRQALAFGTSAYVTQDDTLMTTLTVKEAIYYSAQLQLPDSMSRSEKKERA  236

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             E TI+EMGLQDAMNTR  GGW  KG+SGGQKRRVSIC+EILTRPKLLFLDEP+SGLDSAA
Sbjct  237   EATIREMGLQDAMNTR-IGGWSVKGLSGGQKRRVSICIEILTRPKLLFLDEPTSGLDSAA  295

Query  763   SFYVMSKIMDLASE-GRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             S++VM++I+ LA + GRTVVASIHQPS+EVF LF +LCLLSSGR VYFG  SAA +FF  
Sbjct  296   SYHVMNRIVQLAKQDGRTVVASIHQPSSEVFELFHNLCLLSSGRTVYFGSISAANEFFAL  355

Query  940   NGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREV  1119
             NGFPCPT++NPSDH+L+TINKDF   D D+E+G        E INILV SYK+    ++V
Sbjct  356   NGFPCPTMRNPSDHYLRTINKDF---DADIEKGVGGKATATEAINILVKSYKTSQGCQQV  412

Query  1120  QGQVAEISKQE-GEVLKKSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGL  1296
             Q +V EI +Q  G+  KK ++A F TQ  VLTRRSF+NM+RDLGYYWLR  IYI L + +
Sbjct  413   QRRVLEICQQNGGQEAKKGNQASFITQCTVLTRRSFVNMYRDLGYYWLRFAIYIALCLCV  472

Query  1297  GYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAF  1476
             G +++D+G+   SIQAR S+L F+A+F TFMAIGGFPSFVEDMK+F +E LNGHYG  A+
Sbjct  473   GTIFHDIGHDYGSIQARGSMLMFVAAFLTFMAIGGFPSFVEDMKIFTRERLNGHYGVAAY  532

Query  1477  AIANT  1491
              I NT
Sbjct  533   VIGNT  537



>ref|XP_006441509.1| hypothetical protein CICLE_v10019080mg [Citrus clementina]
 gb|ESR54749.1| hypothetical protein CICLE_v10019080mg [Citrus clementina]
Length=706

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/589 (53%), Positives = 404/589 (69%), Gaps = 28/589 (5%)
 Frame = +1

Query  226   LTWEDL--WVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELT  399
             LTW+DL   VT+S+G   N  +L+GLTGYA PG L A+MGPSG GKSTLLDAL+ RL   
Sbjct  52    LTWKDLTVMVTLSNGETHN--VLEGLTGYAEPGTLTALMGPSGSGKSTLLDALSSRLASN  109

Query  400   TRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEI  579
                SG IL+NG    L++GT+AYVTQ+D L  TLTVRE + YSA+L+LP  +P SEK+ +
Sbjct  110   AFLSGTILLNGHKTKLSFGTAAYVTQDDNLIGTLTVRETISYSARLRLPDKMPWSEKRTL  169

Query  580   AEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSA  759
              E TI EMGLQD  +T + G W  +GISGG++RRVSI LEIL RP+LLFLDEP+SGLDSA
Sbjct  170   VERTIIEMGLQDCADT-VIGNWHLRGISGGERRRVSIALEILMRPRLLFLDEPTSGLDSA  228

Query  760   ASFYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             A+F+V   +  L+ +GRTV+ASIHQPS+EVF LF  L LLS G+ VYFG  SAA +FF  
Sbjct  229   AAFFVTQTLRCLSRDGRTVIASIHQPSSEVFELFDRLYLLSGGKTVYFGETSAAFEFFAQ  288

Query  940   NGFPCPTLQNPSDHFLKTINKDFD---------------NDDEDVEQGCARGIPTEEVIN  1074
              GFPCP L+NPSDHFL+ IN DFD                 D+ +E+     I T E I 
Sbjct  289   AGFPCPALRNPSDHFLRCINSDFDKVKATLKGSMKLRFETSDDPLEK-----ITTAEAIK  343

Query  1075  ILVNSYKSYHRYREVQGQVAEISKQEGEVLKKS-SRADFFTQSIVLTRRSFLNMFRDLGY  1251
              L++ Y++       + +V  ISK +G VL    S+A F  Q+  LT+RSF+NM RD GY
Sbjct  344   NLIDFYQTSQHSYAAKEKVEGISKVKGTVLDAGGSQASFLMQAFTLTKRSFVNMSRDFGY  403

Query  1252  YWLRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKV  1431
             YWLRL IY+ + + +G +Y +VG G +SI AR S  +F+  F TFM+IGGFPSFVEDMKV
Sbjct  404   YWLRLVIYVVVTICIGTIYLNVGTGYNSILARGSCASFVFGFVTFMSIGGFPSFVEDMKV  463

Query  1432  FKKETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILM  1611
             F++E LNGHYG  AF I NTLS++P+L++I+ I G + YF V L   F H+ +F L +  
Sbjct  464   FQRERLNGHYGVTAFVIGNTLSAMPFLIMITFISGTVCYFMVRLHPGFIHYLFFVLCLYA  523

Query  1612  NMLLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDF  1791
             ++ +VESLMM IAS+VPN+LMGII GAG+Q + +L  GYFRLP D+PK  WRYP+ Y+ F
Sbjct  524   SVAVVESLMMAIASIVPNFLMGIITGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYLSF  583

Query  1792  HKYAYQGLYKNEFQGLRLPEETGQI--ITGEEVLRETLQVEMGHSKWID  1932
             H +A QG Y+N+ +GL    ++  +  I GE VL    Q+++  SKWID
Sbjct  584   HFWALQGQYQNDLKGLWFDNQSPDLPKIPGEYVLENVFQIDVRRSKWID  632



>ref|XP_002969857.1| ATP-binding cassette transporter [Selaginella moellendorffii]
 gb|EFJ28981.1| ATP-binding cassette transporter [Selaginella moellendorffii]
Length=695

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/579 (53%), Positives = 401/579 (69%), Gaps = 14/579 (2%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW DL V V   +   + +L  LTG+A PG L  +MGPSGCGKSTLLDALAGRL     
Sbjct  62    LTWTDLSVNVLTDKGACRTVLDSLTGFAEPGSLTVVMGPSGCGKSTLLDALAGRLAKNAI  121

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             Q+GDIL+NG  + L+YG +AYVTQ+DTL +TLTVRE ++Y+++L+LP ++P SEK+ I E
Sbjct  122   QTGDILLNGHKRKLSYGIAAYVTQDDTLISTLTVRETIFYTSRLRLPDAMPNSEKQAIVE  181

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
               I EMGLQD  NT   G W  +G+SGG+KRR+SI +EILTRP+LLFLDEP+SGLDSA++
Sbjct  182   RVIIEMGLQDCANT-PVGNWHLRGLSGGEKRRLSIAVEILTRPRLLFLDEPTSGLDSASA  240

Query  766   FYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             F+V   +  LA + RTV+ S+HQPS+EVF LF +L LLS+GR VYFGPA  A Q F + G
Sbjct  241   FFVTRTLRRLARDKRTVICSVHQPSSEVFQLFDNLLLLSNGRTVYFGPAVNAQQHFASVG  300

Query  946   FPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCA---------RGIPTEEVINILVNSYKS  1098
             FPCP ++NPSDHFLK IN DFD  +E +++ C              T EVI+ L+ +Y+S
Sbjct  301   FPCPPMRNPSDHFLKAINADFDRVNESLKESCLPHEESADVFETTTTAEVISALLTAYES  360

Query  1099  YHRYREVQGQVAEISKQEGEVLKKS-SRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIY  1275
               + + V  +V  ++  +G+ L+ S S+A F+ Q   LTRRSF NM RD+GYYWLR+ +Y
Sbjct  361   SEQAQSVMERVEIMTLVKGDFLESSGSQASFWMQCATLTRRSFTNMSRDMGYYWLRVLVY  420

Query  1276  ITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNG  1455
             I LA+ +G ++  VG    SI AR S + ++  F TFMAIGGFPSFVEDMKVF +E LNG
Sbjct  421   ILLAICVGTIFYRVGTSYDSIFARGSCMGYLWGFLTFMAIGGFPSFVEDMKVFHRERLNG  480

Query  1456  HYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESL  1635
             HYG  AF + NTLSS+P+LLL+SL  G I Y+ V L     HF YF L +   + LVE L
Sbjct  481   HYGVVAFVVGNTLSSIPFLLLMSLTSGAITYYLVQLHPGVTHFLYFVLGLATCVTLVEGL  540

Query  1636  MMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGL  1815
             MM +AS+VPNYLMGII GA +QA+++L GG+FRL  DLPK  WRYPI Y+ FH Y  QG+
Sbjct  541   MMAVASVVPNYLMGIIVGAAVQAVLMLTGGFFRLLSDLPKPVWRYPISYLSFHSYVLQGM  600

Query  1816  YKNEFQGLRLPEETGQI--ITGEEVLRETLQVEMGHSKW  1926
             Y+N+F G++   +   +  I G ++L     V+M  +KW
Sbjct  601   YQNDFLGIQFDSKYPFLPKINGRDILINN-DVDMSRTKW  638



>ref|XP_010322516.1| PREDICTED: ABC transporter G family member 11-like [Solanum lycopersicum]
Length=676

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/587 (52%), Positives = 400/587 (68%), Gaps = 25/587 (4%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             + W+D+ V V+      + IL+GLTGYA PG   A+MGPSG GKSTLLDAL+GRL     
Sbjct  42    VAWKDVSVMVTLNNGDTRNILEGLTGYAEPGTFTALMGPSGSGKSTLLDALSGRLASNAI  101

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
              SG+IL+NGR   L++GT A+VTQ+DTL  TLTVRE ++YSAQL+LP  +P SEK+ + E
Sbjct  102   LSGNILLNGRKAKLSFGTVAFVTQDDTLIGTLTVRETIHYSAQLRLPDRMPLSEKRTLVE  161

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI +MGLQD  +T   G W  +GISGG+KRRVSI LEIL RP+LLFLDEP+SGLDSA++
Sbjct  162   STIADMGLQDCADT-FIGNWHLRGISGGEKRRVSIALEILMRPRLLFLDEPTSGLDSASA  220

Query  766   FYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             F+V   +  L+ +GRTV+ASIHQPS+EVF LF  L LLS G+ VYFG AS A QFF   G
Sbjct  221   FFVTQTLRCLSRDGRTVIASIHQPSSEVFELFDRLYLLSGGKTVYFGQASEAHQFFAEAG  280

Query  946   FPCPTLQNPSDHFLKTINKDFD---------------NDDEDVEQGCARGIPTEEVINIL  1080
             FPCP+ +NPSDHFL+  N DFD               NDD          + T E I  L
Sbjct  281   FPCPSFRNPSDHFLRCSNSDFDKVKATLRDSIKFDQYNDDP------LNKMTTVEAIRSL  334

Query  1081  VNSYKSYHRYREVQGQVAEISKQEGEVLKKS-SRADFFTQSIVLTRRSFLNMFRDLGYYW  1257
             V+ Y+          QV E+SK +G VL  + S+A FF QS +LT+RSF+NM RD GYYW
Sbjct  335   VDFYRRSQYCYLANEQVEEMSKVKGTVLDSNGSQASFFMQSYILTKRSFVNMTRDFGYYW  394

Query  1258  LRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFK  1437
             LRL IY+ ++V +G +Y +VG   +SIQAR +  AFI  F TFM+IGGFPSFVEDMKVF+
Sbjct  395   LRLVIYLVVSVCVGTIYFNVGTTYNSIQARGACAAFIFGFMTFMSIGGFPSFVEDMKVFQ  454

Query  1438  KETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNM  1617
             +E +NGHY   AF I+NTLS++P+L+LI+ + G I YF V     F H+ +F L +  ++
Sbjct  455   RERMNGHYSIIAFVISNTLSAMPFLILIATLSGTICYFMVRFHPGFSHYLFFVLALYASI  514

Query  1618  LLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHK  1797
               VESLMM+IAS+VPN+LMGI+ GAG+  + ++  G+FRLP D+PK  WRYP+ Y+ F  
Sbjct  515   TTVESLMMVIASVVPNFLMGIVIGAGILGISMVVSGFFRLPHDIPKPVWRYPVSYLTFDF  574

Query  1798  YAYQGLYKNEFQGLRLPEETGQI--ITGEEVLRETLQVEMGHSKWID  1932
             +A QG YKN  +GL    ++  +  ITGE  L+ET Q+ +  SKW+D
Sbjct  575   WAIQGQYKNHLKGLIFDNQSPDLPKITGEYALKETFQIHVNRSKWVD  621



>ref|XP_010476947.1| PREDICTED: ABC transporter G family member 11 [Camelina sativa]
Length=703

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/586 (53%), Positives = 407/586 (69%), Gaps = 23/586 (4%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW+DL V V+ G  G + +L+GLTGYA PG L A+MGPSG GKST+LDALA RL     
Sbjct  50    LTWQDLTVMVTMGDGGTQNVLEGLTGYAEPGSLTALMGPSGSGKSTMLDALASRLAANAF  109

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
              SG +L+NGR   L++GT+AYVTQ+D L  TLTVRE ++YSA+++LP  + RSEK+ + E
Sbjct  110   LSGTVLLNGRKTKLSFGTAAYVTQDDNLIGTLTVRETIWYSARVRLPDKMLRSEKRALVE  169

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI EMGLQD  +T + G W  +GISGG+KRRVSI LEIL RP+LLFLDEP+SGLDSA++
Sbjct  170   RTIIEMGLQDCADT-VIGNWHLRGISGGEKRRVSIALEILMRPRLLFLDEPTSGLDSASA  228

Query  766   FYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             F+V   +  L+ +GRTV+ASIHQPS+EVF LF  L LLS G+ VYFG AS A +FF   G
Sbjct  229   FFVTQTLRALSRDGRTVIASIHQPSSEVFELFDRLYLLSGGKTVYFGQASDAYEFFAQAG  288

Query  946   FPCPTLQNPSDHFLKTINKDFDN---------------DDEDVEQGCARGIPTEEVINIL  1080
             FPCP L+NPSDHFL+ IN DFD                 D+ +E+     I T E I +L
Sbjct  289   FPCPALRNPSDHFLRCINSDFDKVRATLKGSMKLRFEASDDPLEK-----ITTTEAIRLL  343

Query  1081  VNSYKSYHRYREVQGQVAEISKQEGEVLKKS-SRADFFTQSIVLTRRSFLNMFRDLGYYW  1257
             ++ Y +   Y   + +V EIS+ +G +L    S+A F  Q+  LT+RSF+NM RD GYYW
Sbjct  344   IDYYHTSDHYYTAKAKVEEISQFKGTILDSGGSQASFLLQTYTLTKRSFINMSRDFGYYW  403

Query  1258  LRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFK  1437
             LRL IYI + V +G +Y +VG   S+I AR S  +F+  F TFM+IGGFPSFVEDMKVF+
Sbjct  404   LRLLIYILVTVCIGTIYLNVGTSYSAILARGSCASFVFGFVTFMSIGGFPSFVEDMKVFQ  463

Query  1438  KETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNM  1617
             +E LNGHYG  AF IANTLS+ P+L++I+ I G I YF VGL   F H+ +F L +  ++
Sbjct  464   RERLNGHYGVAAFVIANTLSATPFLIMITFISGTICYFMVGLHPGFTHYLFFVLCLYGSV  523

Query  1618  LLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHK  1797
              +VESLMM IAS+VPN+LMGII GAG+Q + +L  G+FRLP D+PK FWRYP+ YI FH 
Sbjct  524   TVVESLMMAIASIVPNFLMGIIIGAGIQGIFMLVSGFFRLPNDIPKPFWRYPMSYISFHF  583

Query  1798  YAYQGLYKNEFQGLRLPEETGQI-ITGEEVLRETLQVEMGHSKWID  1932
             +A QG Y+N+ +GL    +     I+GE VL    Q+++  SKWI+
Sbjct  584   WALQGQYQNDLRGLMFDSQGSAFKISGEYVLENVFQIDVNRSKWIN  629



>ref|XP_010459397.1| PREDICTED: ABC transporter G family member 11-like [Camelina 
sativa]
Length=703

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/586 (53%), Positives = 407/586 (69%), Gaps = 23/586 (4%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW+DL V V+ G  G + +L+GLTGYA PG L A+MGPSG GKST+LDALA RL     
Sbjct  50    LTWQDLTVMVTMGDGGTQNVLEGLTGYAEPGSLTALMGPSGSGKSTMLDALASRLAANAF  109

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
              SG +L+NGR   L++GT+AYVTQ+D L  TLTVRE ++YSA+++LP  + RSEK+ + E
Sbjct  110   LSGTVLLNGRKTKLSFGTAAYVTQDDNLIGTLTVRETIWYSARVRLPDKMLRSEKRALVE  169

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI EMGLQD  +T + G W  +GISGG+KRRVSI LEIL RP+LLFLDEP+SGLDSA++
Sbjct  170   RTIIEMGLQDCADT-VIGNWHLRGISGGEKRRVSIALEILMRPRLLFLDEPTSGLDSASA  228

Query  766   FYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             F+V   +  L+ +GRTV+ASIHQPS+EVF LF  L LLS G+ VYFG AS A +FF   G
Sbjct  229   FFVTQTLRALSRDGRTVIASIHQPSSEVFELFDRLYLLSGGKTVYFGQASDAYEFFAQAG  288

Query  946   FPCPTLQNPSDHFLKTINKDFDN---------------DDEDVEQGCARGIPTEEVINIL  1080
             FPCP L+NPSDHFL+ IN DFD                 D+ +E+     I T E I +L
Sbjct  289   FPCPALRNPSDHFLRCINSDFDKVRATLKGSMKLRFEASDDPLEK-----ITTTEAIRLL  343

Query  1081  VNSYKSYHRYREVQGQVAEISKQEGEVLKKS-SRADFFTQSIVLTRRSFLNMFRDLGYYW  1257
             ++ Y +   Y   + +V EIS+ +G +L    S+A F  Q+  LT+RSF+NM RD GYYW
Sbjct  344   IDYYHTSDHYYTAKAKVEEISQFKGTILDSGGSQASFLLQTYTLTKRSFINMSRDFGYYW  403

Query  1258  LRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFK  1437
             LRL IYI + V +G +Y +VG   S+I AR S  +F+  F TFM+IGGFPSFVEDMKVF+
Sbjct  404   LRLLIYILVTVCIGTIYLNVGTSYSAILARGSCASFVFGFVTFMSIGGFPSFVEDMKVFQ  463

Query  1438  KETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNM  1617
             +E LNGHYG  AF IANTLS+ P+L++I+ I G I YF VGL   F H+ +F L +  ++
Sbjct  464   RERLNGHYGVAAFVIANTLSATPFLIMITFISGTICYFMVGLHPGFTHYLFFVLCLYGSV  523

Query  1618  LLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHK  1797
              +VESLMM IAS+VPN+LMGII GAG+Q + +L  G+FRLP D+PK FWRYP+ YI FH 
Sbjct  524   TVVESLMMAIASIVPNFLMGIIIGAGIQGIFMLVSGFFRLPNDIPKPFWRYPMSYISFHF  583

Query  1798  YAYQGLYKNEFQGLRLPEETGQI-ITGEEVLRETLQVEMGHSKWID  1932
             +A QG Y+N+ +GL    +     I+GE VL    Q+++  SKWI+
Sbjct  584   WALQGQYQNDLRGLMFDSQGSAFKISGEYVLENVFQIDVNRSKWIN  629



>ref|XP_010498161.1| PREDICTED: ABC transporter G family member 11-like [Camelina 
sativa]
Length=703

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/581 (54%), Positives = 404/581 (70%), Gaps = 13/581 (2%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW+DL V V+ G  G + +L+GLTGYA PG L A+MGPSG GKST+LDALA RL     
Sbjct  50    LTWQDLTVMVTMGDGGTQNVLEGLTGYAEPGSLTALMGPSGSGKSTMLDALASRLAANAF  109

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
              SG +L+NGR   L++GT+AYVTQ+D L  TLTVRE ++YSA+++LP  + RSEK+ + E
Sbjct  110   LSGTVLLNGRKTKLSFGTAAYVTQDDNLIGTLTVRETIWYSARVRLPDKMLRSEKRALVE  169

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI EMGLQD  +T + G W  +GISGG+KRRVSI LEIL RP+LLFLDEP+SGLDSA++
Sbjct  170   RTIIEMGLQDCADT-VIGNWHLRGISGGEKRRVSIALEILMRPRLLFLDEPTSGLDSASA  228

Query  766   FYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             F+V   +  L+ +GRTV+ASIHQPS+EVF LF  L LLS G+ VYFG AS A +FF   G
Sbjct  229   FFVTQTLRALSRDGRTVIASIHQPSSEVFELFDRLYLLSGGKTVYFGQASDAYEFFAQAG  288

Query  946   FPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCA----------RGIPTEEVINILVNSYK  1095
             FPCP L+NPSDHFL+ IN DFD     ++                I T E I +L++ Y 
Sbjct  289   FPCPALRNPSDHFLRCINSDFDKVRATLKGSMKLRFEASNDPLEKITTTEAIRVLIDYYH  348

Query  1096  SYHRYREVQGQVAEISKQEGEVLKKS-SRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGI  1272
             +   Y   + +V EIS+ +G +L    S+A F  Q+  LT+RSF+NM RD GYYWLRL I
Sbjct  349   TSDHYYTAKAKVEEISQFKGTILDSGGSQASFLLQTYTLTKRSFINMSRDFGYYWLRLLI  408

Query  1273  YITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLN  1452
             YI + V +G +Y +VG   S+I AR S  +F+  F TFM+IGGFPSFVEDMKVF++E LN
Sbjct  409   YILVTVCIGTIYLNVGTSYSAILARGSCASFVFGFVTFMSIGGFPSFVEDMKVFQRERLN  468

Query  1453  GHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVES  1632
             GHYG  AF IANTLS+ P+L++I+ I G I YF VGL   F H+ +F L +  ++ +VES
Sbjct  469   GHYGVAAFVIANTLSATPFLIMITFISGTICYFMVGLHPGFTHYLFFVLCLYGSVTVVES  528

Query  1633  LMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQG  1812
             LMM IAS+VPN+LMGII GAG+Q + +L  G+FRLP D+PK FWRYP+ YI FH +A QG
Sbjct  529   LMMAIASIVPNFLMGIIIGAGIQGIFMLVSGFFRLPNDIPKPFWRYPMSYISFHFWALQG  588

Query  1813  LYKNEFQGLRLPEETGQI-ITGEEVLRETLQVEMGHSKWID  1932
              Y+N+ +GL    +     I+GE VL    Q+++  SKWI+
Sbjct  589   QYQNDLRGLMFDSQGSAFKISGEYVLENVFQIDVNRSKWIN  629



>ref|XP_002983318.1| ATP-binding cassette transporter [Selaginella moellendorffii]
 gb|EFJ15660.1| ATP-binding cassette transporter [Selaginella moellendorffii]
Length=673

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/580 (53%), Positives = 404/580 (70%), Gaps = 15/580 (3%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW+DL VT +  R   K +L+ +TGY+ PG + AIMGPSG GKSTLLDALAGRL   T 
Sbjct  32    LTWKDLAVTAT-ARGETKRLLEPMTGYSEPGYITAIMGPSGSGKSTLLDALAGRLAKNTT  90

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             Q+G IL+NGR + L+YG  AYVTQEDTL  TLTVRE + YSA L+LP +L ++E+  I E
Sbjct  91    QTGQILLNGRKKQLSYGIVAYVTQEDTLIGTLTVRETITYSANLRLPDALNKAERLAIVE  150

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI EMGLQD  +T   G W  +G+SGG+KRR+SI LEILTRP+LLFLDEP+SGLDSA++
Sbjct  151   CTIVEMGLQDCADT-PVGNWHMRGLSGGEKRRLSIGLEILTRPRLLFLDEPTSGLDSASA  209

Query  766   FYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             F+VM  + +LA +GRTVVASIHQPS++VF LF +L LLS G+ +YFG A+ A +FF + G
Sbjct  210   FFVMQTLRNLARDGRTVVASIHQPSSQVFELFDNLVLLSHGKTIYFGEAALAQEFFASAG  269

Query  946   FPCPTLQNPSDHFLKTINKDFDNDD---------EDVEQG-CARGIPTEEVINILVNSYK  1095
             FPCP  +NPSDH+L+ IN DFD             D E G     + T ++I +L   Y+
Sbjct  270   FPCPPHRNPSDHYLRAINSDFDRVKATLKGSFKFRDFESGDPLDHVSTSQIIKVLTEHYQ  329

Query  1096  SYHRYREVQGQVAEISKQEGEVLK-KSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGI  1272
             S  +  +   +V EI++ +G VL+ + S+A F+ Q++ LTRRSF+NM RD+GYYWLR+ I
Sbjct  330   SSAQAMQTAAKVHEINQTKGAVLESEGSQASFYMQALTLTRRSFVNMSRDIGYYWLRVAI  389

Query  1273  YITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLN  1452
             YI L++G+G +Y  +G G ++I  R + ++++  F  FM+IGGFPSFVEDMKVF +E LN
Sbjct  390   YIMLSIGIGTLYYRIGTGYNAILGRAACMSYVGGFLVFMSIGGFPSFVEDMKVFSRERLN  449

Query  1453  GHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVES  1632
             GHYG  AF I NTLSSLP+L LISLI  +I Y  V L     H  YF L +   +  VES
Sbjct  450   GHYGVVAFVIGNTLSSLPFLFLISLISELIVYNMVQLHPGITHQIYFVLNLFACVAAVES  509

Query  1633  LMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQG  1812
             LMM +ASLVPN+LMGII GAG+Q + +L  G+FRLP DLPK +W+YP+ YI FH YA QG
Sbjct  510   LMMAVASLVPNFLMGIITGAGIQGIFLLVAGFFRLPNDLPKAYWKYPMSYIGFHMYALQG  569

Query  1813  LYKNEFQGLRLPEETGQI--ITGEEVLRETLQVEMGHSKW  1926
              Y+N+F GL    +   +  I G+ +L +  Q+ +  SKW
Sbjct  570   TYENDFLGLEFDNKFPGLPKIPGKFILTDVYQITVARSKW  609



>ref|XP_006416662.1| hypothetical protein EUTSA_v10006960mg [Eutrema salsugineum]
 gb|AGC11818.1| putative ABC transporter G family member 11 [Eutrema halophilum]
 gb|ESQ35015.1| hypothetical protein EUTSA_v10006960mg [Eutrema salsugineum]
Length=703

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/586 (53%), Positives = 405/586 (69%), Gaps = 23/586 (4%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW+DL V V+ G    + +L+GLTGYA PG L A+MGPSG GKST+LDALA RL     
Sbjct  50    LTWQDLTVMVTMGDGETQNVLEGLTGYAEPGSLTALMGPSGSGKSTMLDALASRLAANAF  109

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
              SG +L+NGR   L++GT+AYVTQ+D L  TLTVRE ++YSA+++LP  + RSEK+ + E
Sbjct  110   LSGTVLLNGRKTKLSFGTAAYVTQDDNLIGTLTVRETIWYSARVRLPDKMLRSEKRALVE  169

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI EMGLQD  +T + G W  +GISGG+KRRVSI LEIL RP+LLFLDEP+SGLDSA++
Sbjct  170   RTIIEMGLQDCADT-VIGNWHLRGISGGEKRRVSIALEILMRPRLLFLDEPTSGLDSASA  228

Query  766   FYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             F+V   +  L+ +GRTV+ASIHQPS+EVF LF  L LLS G+ VYFG AS A +FF   G
Sbjct  229   FFVTQTLRALSRDGRTVIASIHQPSSEVFELFDRLYLLSGGKTVYFGQASEAYEFFAQAG  288

Query  946   FPCPTLQNPSDHFLKTINKDFDN---------------DDEDVEQGCARGIPTEEVINIL  1080
             FPCP L+NPSDHFL+ IN DFD                 D+ +E+     I T E I +L
Sbjct  289   FPCPALRNPSDHFLRCINSDFDKVRATLKGSMKLRFEASDDPLEK-----ITTTEAIRLL  343

Query  1081  VNSYKSYHRYREVQGQVAEISKQEGEVLKKS-SRADFFTQSIVLTRRSFLNMFRDLGYYW  1257
             V+ Y +   Y   + +V EIS+ +G +L    S+A F  Q+  LT+RSF+NM RD GYYW
Sbjct  344   VDHYHTSDYYYTAKAKVEEISQFKGTILDSGGSQASFLLQTYTLTKRSFINMSRDFGYYW  403

Query  1258  LRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFK  1437
             LRL IYI + V +G +Y +VG   S+I AR S  +F+  F TFM+IGGFPSFVEDMKVF+
Sbjct  404   LRLLIYILVTVCIGTIYWNVGTSYSAILARGSCASFVFGFVTFMSIGGFPSFVEDMKVFQ  463

Query  1438  KETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNM  1617
             +E LNGHYG  AF IANT+++ P+L++I+ I G I YF VGL   F H+ +F L +  ++
Sbjct  464   RERLNGHYGVAAFVIANTVAATPFLIIITFISGTICYFMVGLHPGFTHYLFFVLCLYASV  523

Query  1618  LLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHK  1797
              +VESLMM IAS+VPN+LMGII GAG+Q + +L  G+FRLP D+PK+FWRYP+ YI FH 
Sbjct  524   TVVESLMMAIASIVPNFLMGIIIGAGIQGIFMLVSGFFRLPNDIPKIFWRYPMSYISFHF  583

Query  1798  YAYQGLYKNEFQGLRLPEETGQI-ITGEEVLRETLQVEMGHSKWID  1932
             +A QG Y+N+ +GL    +     I GE VL    Q+ +  SKWI+
Sbjct  584   WALQGQYQNDLRGLMFDSQGSAFKIPGEYVLENVFQINLHRSKWIN  629



>ref|XP_002987629.1| hypothetical protein SELMODRAFT_183315 [Selaginella moellendorffii]
 gb|EFJ11204.1| hypothetical protein SELMODRAFT_183315 [Selaginella moellendorffii]
Length=681

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/580 (53%), Positives = 404/580 (70%), Gaps = 15/580 (3%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW+DL VT +  R   K +L+ +TGY+ PG + AIMGPSG GKSTLLDALAGRL   T 
Sbjct  32    LTWKDLAVTAT-ARGETKRLLEPMTGYSEPGYITAIMGPSGSGKSTLLDALAGRLAKNTT  90

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             Q+G IL+NGR + L+YG  AYVTQEDTL  TLTVRE + YSA L+LP +L ++E+  I E
Sbjct  91    QTGQILLNGRKKQLSYGIVAYVTQEDTLIGTLTVRETITYSANLRLPDALNKAERLAIVE  150

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI EMGLQD  +T   G W  +G+SGG+KRR+SI LEILTRP+LLFLDEP+SGLDSA++
Sbjct  151   CTIVEMGLQDCADT-PVGNWHMRGLSGGEKRRLSIGLEILTRPRLLFLDEPTSGLDSASA  209

Query  766   FYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             F+VM  + +LA +GRTVVASIHQPS++VF LF +L LLS G+ +YFG A+ A +FF + G
Sbjct  210   FFVMQTLRNLARDGRTVVASIHQPSSQVFELFDNLVLLSHGKTIYFGEAALAQEFFASAG  269

Query  946   FPCPTLQNPSDHFLKTINKDFDNDD---------EDVEQG-CARGIPTEEVINILVNSYK  1095
             FPCP  +NPSDH+L+ IN DFD             D E G     + T ++I +L   Y+
Sbjct  270   FPCPPHRNPSDHYLRAINSDFDRVKATLKGSFKFRDFESGDPLDHVSTSQIIKVLTEHYQ  329

Query  1096  SYHRYREVQGQVAEISKQEGEVLK-KSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGI  1272
             S  +  +   +V EI++ +G VL+ + S+A F+ Q++ LTRRSF+NM RD+GYYWLR+ I
Sbjct  330   SSAQAMQTAAKVHEINQTKGAVLESEGSQASFYMQALTLTRRSFVNMSRDIGYYWLRVAI  389

Query  1273  YITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLN  1452
             YI L++G+G +Y  +G G ++I  R + ++++  F  FM+IGGFPSFVEDMKVF +E LN
Sbjct  390   YIMLSIGIGTLYYRIGTGYNAILGRAACMSYVGGFLVFMSIGGFPSFVEDMKVFSRERLN  449

Query  1453  GHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVES  1632
             GHYG  AF I NTLSSLP+L LISLI  +I Y  V L     H  YF L +   +  VES
Sbjct  450   GHYGVVAFVIGNTLSSLPFLFLISLISELIVYNMVQLHPGITHQIYFVLNLFACVAAVES  509

Query  1633  LMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQG  1812
             LMM +ASLVPN+LMGII GAG+Q + +L  G+FRLP DLPK +W+YP+ YI FH YA QG
Sbjct  510   LMMAVASLVPNFLMGIITGAGIQGIFLLVAGFFRLPNDLPKAYWKYPMSYIGFHMYALQG  569

Query  1813  LYKNEFQGLRLPEETGQI--ITGEEVLRETLQVEMGHSKW  1926
              Y+N+F GL    +   +  I G+ +L +  Q+ +  SKW
Sbjct  570   TYENDFLGLEFDNKFPGLPKIPGKFILTDVYQITVARSKW  609



>ref|XP_008388513.1| PREDICTED: ABC transporter G family member 11 [Malus domestica]
Length=687

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/588 (54%), Positives = 405/588 (69%), Gaps = 25/588 (4%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW+DL V V+      + +L+GLTGYA PG   A+MGPSG GKSTLLDAL+ RL     
Sbjct  40    LTWKDLTVMVTLNNGETQKVLEGLTGYAEPGTFTALMGPSGSGKSTLLDALSSRLAANAF  99

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
              SG IL+NGR + L++GT+AYVTQ+D L  TLTVRE + YSA+L+LP  +  SEK+ + E
Sbjct  100   LSGTILLNGRKRKLSFGTAAYVTQDDNLIGTLTVRETISYSARLRLPDKMAWSEKRALIE  159

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI EMGLQD  +T + G W  +GISGG+KRRVSI LEILTRP+LLFLDEP+SGLDSA++
Sbjct  160   STIIEMGLQDCADT-VIGNWHLRGISGGEKRRVSIALEILTRPRLLFLDEPTSGLDSASA  218

Query  766   FYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             F+V   +  LA +GRTV+ASIHQPS+EVF LF  L LLSSG+ VYFG A+ A +FF  +G
Sbjct  219   FFVTQTLRALARDGRTVIASIHQPSSEVFELFDQLYLLSSGKTVYFGQAADAYEFFAQSG  278

Query  946   FPCPTLQNPSDHFLKTINKDFDN---------------DDEDVEQGCARGIPTEEVINIL  1080
             FPCP L+NPSDHFL+ IN DFD                 D+ +E+     + T E I +L
Sbjct  279   FPCPALRNPSDHFLRCINSDFDKVKATLKGSMKLRFEASDDPLEK-----MTTAEAIRVL  333

Query  1081  VNSYKSYHRYREVQGQVAEISKQEGEVLKKS-SRADFFTQSIVLTRRSFLNMFRDLGYYW  1257
             +NSY+S       + +V EISK +G VL    S+A FF Q+  LT+RSF+NM RD GYYW
Sbjct  334   INSYRSSQYSYAAREKVEEISKVKGTVLDSGGSQASFFMQAFQLTKRSFINMSRDFGYYW  393

Query  1258  LRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFK  1437
             LRL IYI + V +G +Y +VG G SSI AR S  +F+  F TFM+IGGFPSF+EDMKVF+
Sbjct  394   LRLVIYIVVTVCIGTIYLNVGTGYSSILARGSCASFVFGFVTFMSIGGFPSFIEDMKVFQ  453

Query  1438  KETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNM  1617
             +E LNGHYG  AF I+NT S++P+L+LI+ + G + YF V L   F H+ +F L +  ++
Sbjct  454   RERLNGHYGVTAFVISNTFSAMPFLILITFLAGTVCYFMVRLHPGFEHYLFFVLCLYASV  513

Query  1618  LLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHK  1797
              +VESLMM IAS+VPN+LMGII GAG+Q + +L  GYFRLP D+PKL WRYP+ YI FH 
Sbjct  514   TVVESLMMAIASVVPNFLMGIIIGAGIQGIFMLVSGYFRLPNDIPKLVWRYPMSYISFHF  573

Query  1798  YAYQGLYKNEFQGLRLPEETGQ---IITGEEVLRETLQVEMGHSKWID  1932
             +A QG Y+N+  GL    +T      I GE +L    Q+    SKWID
Sbjct  574   WALQGQYQNDLSGLLFDNDTPDHLPKIPGEYILENVFQINTARSKWID  621



>ref|XP_006306902.1| hypothetical protein CARUB_v10008462mg [Capsella rubella]
 gb|EOA39800.1| hypothetical protein CARUB_v10008462mg [Capsella rubella]
Length=703

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/586 (53%), Positives = 405/586 (69%), Gaps = 23/586 (4%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW+DL V V+ G    + +L+GLTGYA PG L A+MGPSG GKST+LDALA RL     
Sbjct  50    LTWQDLTVMVTMGDGETQNVLEGLTGYAEPGSLTALMGPSGSGKSTMLDALASRLAANAF  109

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
              SG +L+NGR   L++GT+AYVTQ+D L  TLTVRE ++YSA+++LP  + RSEK+ + E
Sbjct  110   LSGSVLLNGRKTKLSFGTAAYVTQDDNLIGTLTVRETIWYSARVRLPDKMLRSEKRSLVE  169

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI EMGLQD  +T + G W  +GISGG+KRRVSI LEIL RP+LLFLDEP+SGLDSA++
Sbjct  170   RTIIEMGLQDCADT-VIGNWHLRGISGGEKRRVSIALEILMRPRLLFLDEPTSGLDSASA  228

Query  766   FYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             F+V   +  L+ +GRTV+ASIHQPS+EVF LF  L LLS G+ VYFG AS A +FF   G
Sbjct  229   FFVTQTLRALSRDGRTVIASIHQPSSEVFELFDRLYLLSGGKTVYFGQASDAYEFFAQAG  288

Query  946   FPCPTLQNPSDHFLKTINKDFDN---------------DDEDVEQGCARGIPTEEVINIL  1080
             FPCP L+NPSDHFL+ IN DFD                 D+ +E+     I T E I +L
Sbjct  289   FPCPALRNPSDHFLRCINSDFDKVRATLKGSMKLRFEASDDPLEK-----ITTTEAIRLL  343

Query  1081  VNSYKSYHRYREVQGQVAEISKQEGEVLKKS-SRADFFTQSIVLTRRSFLNMFRDLGYYW  1257
             V+ Y +   Y   + +V EIS+ +G +L    S+A F  Q+  LT+RSF+NM RD GYYW
Sbjct  344   VDHYHTSDYYFTAKAKVEEISQFKGTILDSGGSQASFLLQTYTLTKRSFINMSRDFGYYW  403

Query  1258  LRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFK  1437
             LRL IYI + + +G +Y +VG   S+I AR S  +F+  F TFM+IGGFPSFVEDMKVF+
Sbjct  404   LRLLIYILVTICIGTIYLNVGTSYSAILARGSCASFVFGFVTFMSIGGFPSFVEDMKVFQ  463

Query  1438  KETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNM  1617
             +E LNGHYG  AF IANTLS+ P+L++I+ I G I YF VGL   F H+ +F L +  ++
Sbjct  464   RERLNGHYGVAAFVIANTLSATPFLIMITFISGTICYFMVGLHPGFTHYLFFVLCLYASV  523

Query  1618  LLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHK  1797
              +VESLMM IAS+VPN+LMGII GAG+Q + +L  G+FRLP D+PK FWRYP+ YI FH 
Sbjct  524   TVVESLMMAIASIVPNFLMGIIIGAGIQGIFMLVSGFFRLPNDIPKPFWRYPMSYISFHF  583

Query  1798  YAYQGLYKNEFQGLRLPEETGQI-ITGEEVLRETLQVEMGHSKWID  1932
             +A QG Y+N+ +GL    +     I GE VL    Q+++  SKWID
Sbjct  584   WALQGQYQNDLRGLMFDSQGSAFKIPGEYVLENVFQIDLHRSKWID  629



>ref|XP_006347487.1| PREDICTED: ABC transporter G family member 11-like [Solanum tuberosum]
Length=666

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/581 (52%), Positives = 398/581 (69%), Gaps = 13/581 (2%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             + W+++ V V+      + IL+GLTGYA PG   A+MGPSG GKSTLLDAL+GRL     
Sbjct  41    VAWKNVNVMVTLNNGDTRNILEGLTGYAEPGTFTALMGPSGSGKSTLLDALSGRLASNAI  100

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
              SG IL+NGR   L++GT+AYVTQ+DTL  TLTVRE +YYSAQL+LP  +P SEK+ + E
Sbjct  101   LSGKILLNGRKAKLSFGTAAYVTQDDTLIGTLTVRETIYYSAQLRLPDRMPVSEKRTLVE  160

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI +MGLQD  +T   G W  +GISGG+KRRVSI LEIL RP+LLFLDEP+SGLDSA++
Sbjct  161   STIVDMGLQDCADT-FIGNWHLRGISGGEKRRVSIALEILMRPRLLFLDEPTSGLDSASA  219

Query  766   FYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             F+V   +  L+ +GRTV+ASIHQPS+EVF LF  L LLS G+ VYFG AS A QFF   G
Sbjct  220   FFVTQTLRCLSRDGRTVIASIHQPSSEVFELFDRLYLLSGGKTVYFGQASEANQFFAEAG  279

Query  946   FPCPTLQNPSDHFLKTINKDFDN---------DDEDVEQGCARGIPTEEVINILVNSYKS  1098
             FPCP+ +NPSDHFL+  N DFD            +         + T E I  LV+ Y+ 
Sbjct  280   FPCPSFRNPSDHFLRCSNSDFDKVMTTLADSIKSDQYNDDPLNKMTTVEAIRSLVDFYRR  339

Query  1099  YHRYREVQGQVAEISKQEGEVLKKS-SRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIY  1275
                      QV E+SK +G VL  + S+A FF QS +LT+RSF+NM RD GYYWLRL IY
Sbjct  340   SQYCYLANEQVEEMSKVKGAVLDSNGSQASFFMQSYILTKRSFVNMTRDFGYYWLRLVIY  399

Query  1276  ITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNG  1455
             + ++V +G +Y +VG   +SIQAR +  AFI  F TFM+IGGFPSFVEDMKVF++E +NG
Sbjct  400   LVVSVCVGTIYFNVGTTYNSIQARGACAAFIFGFMTFMSIGGFPSFVEDMKVFQRERMNG  459

Query  1456  HYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESL  1635
             HYG  AF I+NTLS++P+L+LI+ + G + Y  V     F H+ +F L +  ++  VESL
Sbjct  460   HYGVIAFVISNTLSAMPFLILIATLSGTVCYLMVRFHPGFSHYLFFVLALYASITTVESL  519

Query  1636  MMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGL  1815
             MM+IAS+VPN+LMGI+ GAG+  + ++  G+FRLP D+PK  WRYP+ Y+ F  +A QG 
Sbjct  520   MMVIASVVPNFLMGIVIGAGILGISMVVSGFFRLPHDIPKPVWRYPVSYLTFDFWAIQGQ  579

Query  1816  YKNEFQGLRLPEETGQI--ITGEEVLRETLQVEMGHSKWID  1932
             YKN  +GL    ++  +  ITGE  L++T Q+ +  SKW+D
Sbjct  580   YKNHLKGLVFDNQSPDLPKITGEYALKQTFQIHVERSKWVD  620



>gb|KDP46471.1| hypothetical protein JCGZ_08443 [Jatropha curcas]
Length=694

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/582 (53%), Positives = 405/582 (70%), Gaps = 14/582 (2%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW+DL V VS      + +L+GLTGYA PG + A+MGPSG GKSTLLDAL+ RL     
Sbjct  42    LTWKDLTVMVSLSNGETQNVLEGLTGYAEPGTITALMGPSGSGKSTLLDALSSRLAANAF  101

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
              SG IL+NGR   L++G +AYVTQ+D L  TLTVRE ++YSA+L+LP  +PRSEK+ + E
Sbjct  102   LSGTILLNGRKTKLSFGAAAYVTQDDNLIGTLTVRETIWYSARLRLPDKMPRSEKRALVE  161

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI EMGLQD  +T + G W  +GISGG+KRRVSI LEIL RP+LLFLDEP+SGLDSA++
Sbjct  162   STIIEMGLQDCADT-VIGNWHLRGISGGEKRRVSIALEILMRPRLLFLDEPTSGLDSASA  220

Query  766   FYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             F+V   +  L+ +GRTV+ASIHQPS+EVF LF  L LLS G+ VYFG AS A +FF   G
Sbjct  221   FFVTQTLRGLSRDGRTVIASIHQPSSEVFELFDRLYLLSGGKTVYFGQASEAYEFFAQAG  280

Query  946   FPCPTLQNPSDHFLKTINKDFDNDDEDVE----------QGCARGIPTEEVINILVNSYK  1095
             FPCP L+NPSDHFL+ IN DFD     ++          +     I T E I  LV+ Y+
Sbjct  281   FPCPALRNPSDHFLRCINSDFDKVKATLKGSMKLRFESSEDPLEKITTAEAIRTLVDYYR  340

Query  1096  SYHRYREVQGQVAEISKQEGEVLKKS-SRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGI  1272
             S   Y   + +V EISK +G VL    S+A F  Q+ +LT+RSF+NM RD GYYWLRL I
Sbjct  341   SSQYYYAAREKVEEISKVKGTVLDSGGSQASFLLQAFILTKRSFINMSRDFGYYWLRLVI  400

Query  1273  YITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLN  1452
             YI + + +G +Y +VG G +SI AR S  +F+  F TFM+IGGFPSFVEDMKVF++E LN
Sbjct  401   YIVVTICIGTIYLNVGTGYNSILARGSCASFVFGFVTFMSIGGFPSFVEDMKVFQRERLN  460

Query  1453  GHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVES  1632
             GHYG  +F I+NT+S++P+L++I+ I G I YF V L   F H+ +F L +  ++ +VES
Sbjct  461   GHYGVTSFVISNTISAMPFLIMITFISGTICYFMVRLHPGFEHYLFFVLCLYASVTVVES  520

Query  1633  LMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQG  1812
             LMM IAS+VPN+LMGII GAG+Q + +L  GYFRLP D+PK  WRYP+ YI FH +A QG
Sbjct  521   LMMAIASIVPNFLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYISFHFWALQG  580

Query  1813  LYKNEFQGLRLPEETGQI--ITGEEVLRETLQVEMGHSKWID  1932
              Y+N+ +GL    +T  +  I GE +L    Q+++  SKW+D
Sbjct  581   QYQNDLRGLMFDNQTPDLPKIPGEYILENIFQIDVHRSKWVD  622



>gb|AAY28856.1| white-brown complex protein 11 [Arabidopsis halleri subsp. gemmifera]
Length=687

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/586 (53%), Positives = 405/586 (69%), Gaps = 23/586 (4%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW+DL V V+ G    + +L+GLTGYA PG L A+MGPSG GKST+LDALA RL     
Sbjct  42    LTWQDLTVMVTMGDGETQNVLEGLTGYAEPGSLTALMGPSGSGKSTMLDALASRLAANAF  101

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
              SG +L+NGR   L++GT+AYVTQ+D L  TLTVRE ++YSA+++LP  + RSEK+ + E
Sbjct  102   LSGTVLLNGRKTKLSFGTAAYVTQDDNLIGTLTVRETIWYSARVRLPDKMLRSEKRALVE  161

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI EMGLQD  +T + G W  +GISGG+KRRVSI LEIL RP+LLFLDEP+SGLDSA++
Sbjct  162   RTIIEMGLQDCADT-VIGNWHLRGISGGEKRRVSIALEILMRPRLLFLDEPTSGLDSASA  220

Query  766   FYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             F+V   +  L+ +GRTV+ASIHQPS+EVF LF  L LLS G+ VYFG AS A +FF   G
Sbjct  221   FFVTQTLRALSRDGRTVIASIHQPSSEVFELFDRLYLLSGGKTVYFGQASDAYEFFAQAG  280

Query  946   FPCPTLQNPSDHFLKTINKDFDN---------------DDEDVEQGCARGIPTEEVINIL  1080
             FPCP L+NPSDHFL+ IN DFD                 D+ +E+     I T E I +L
Sbjct  281   FPCPALRNPSDHFLRCINSDFDKVRATLKGSMKLRFEASDDPLEK-----ITTAEAIRVL  335

Query  1081  VNSYKSYHRYREVQGQVAEISKQEGEVLKKS-SRADFFTQSIVLTRRSFLNMFRDLGYYW  1257
             V+ Y +   Y   + +V EIS+ +G +L    S+A F  Q+  LT+RSF+NM RD GYYW
Sbjct  336   VDYYHTSDYYYTAKAKVEEISQFKGTILDSGGSQASFLLQTYTLTKRSFINMSRDFGYYW  395

Query  1258  LRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFK  1437
             LRL IYI + V +G +Y +VG   S+I AR S  +F+  F TFM+IGGFPSFVEDMKVF+
Sbjct  396   LRLLIYILVTVCIGTIYLNVGTSYSAILARGSCASFVFGFVTFMSIGGFPSFVEDMKVFQ  455

Query  1438  KETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNM  1617
             +E LNGHYG  AF IANTLS+ P+L++I+ I G I YF VGL   F H+ +F L +  ++
Sbjct  456   RERLNGHYGVAAFVIANTLSATPFLIMITFISGTICYFMVGLHPGFTHYLFFVLCLYASV  515

Query  1618  LLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHK  1797
              +VESLMM IAS+VPN+LMGII GAG+Q + +L  G+FRLP D+PK FWRYP+ YI FH 
Sbjct  516   TVVESLMMAIASIVPNFLMGIIIGAGIQGIFMLVSGFFRLPNDIPKPFWRYPMSYISFHF  575

Query  1798  YAYQGLYKNEFQGLRLPEETGQI-ITGEEVLRETLQVEMGHSKWID  1932
             +A QG Y+N+ +GL    +     I GE VL    Q+++  SKWI+
Sbjct  576   WALQGQYQNDLRGLMFDSQGSAFKIPGEYVLENVFQIDLHRSKWIN  621



>ref|XP_002890251.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66510.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=703

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/586 (53%), Positives = 405/586 (69%), Gaps = 23/586 (4%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW+DL V V+ G    + +L+GLTGYA PG L A+MGPSG GKST+LDALA RL     
Sbjct  50    LTWQDLTVMVTMGDGETQNVLEGLTGYAEPGSLTALMGPSGSGKSTMLDALASRLAANAF  109

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
              SG +L+NGR   L++GT+AYVTQ+D L  TLTVRE ++YSA+++LP  + RSEK+ + E
Sbjct  110   LSGTVLLNGRKTKLSFGTAAYVTQDDNLIGTLTVRETIWYSARVRLPDKMLRSEKRALVE  169

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI EMGLQD  +T + G W  +GISGG+KRRVSI LEIL RP+LLFLDEP+SGLDSA++
Sbjct  170   RTIIEMGLQDCADT-VIGNWHLRGISGGEKRRVSIALEILMRPRLLFLDEPTSGLDSASA  228

Query  766   FYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             F+V   +  L+ +GRTV+ASIHQPS+EVF LF  L LLS G+ VYFG AS A +FF   G
Sbjct  229   FFVTQTLRALSRDGRTVIASIHQPSSEVFELFDRLYLLSGGKTVYFGQASDAYEFFAQAG  288

Query  946   FPCPTLQNPSDHFLKTINKDFDN---------------DDEDVEQGCARGIPTEEVINIL  1080
             FPCP L+NPSDHFL+ IN DFD                 D+ +E+     I T E I +L
Sbjct  289   FPCPALRNPSDHFLRCINSDFDKVRASLKGSMKLRFEASDDPLEK-----ITTAEAIRVL  343

Query  1081  VNSYKSYHRYREVQGQVAEISKQEGEVLKKS-SRADFFTQSIVLTRRSFLNMFRDLGYYW  1257
             V+ Y +   Y   + +V EIS+ +G +L    S+A F  Q+  LT+RSF+NM RD GYYW
Sbjct  344   VDYYHTSDYYYTAKAKVEEISQFKGTILDSGGSQASFLLQTYTLTKRSFINMSRDFGYYW  403

Query  1258  LRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFK  1437
             LRL IYI + V +G +Y +VG   S+I AR S  +F+  F TFM+IGGFPSFVEDMKVF+
Sbjct  404   LRLLIYILVTVCIGTIYLNVGTSYSAILARGSCASFVFGFVTFMSIGGFPSFVEDMKVFQ  463

Query  1438  KETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNM  1617
             +E LNGHYG  AF IANTLS+ P+L++I+ I G I YF VGL   F H+ +F L +  ++
Sbjct  464   RERLNGHYGVAAFVIANTLSATPFLIMITFISGTICYFMVGLHPGFTHYLFFVLCLYASV  523

Query  1618  LLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHK  1797
              +VESLMM IAS+VPN+LMGII GAG+Q + +L  G+FRLP D+PK FWRYP+ YI FH 
Sbjct  524   TVVESLMMAIASIVPNFLMGIIIGAGIQGIFMLVSGFFRLPNDIPKPFWRYPMSYISFHF  583

Query  1798  YAYQGLYKNEFQGLRLPEETGQI-ITGEEVLRETLQVEMGHSKWID  1932
             +A QG Y+N+ +GL    +     I GE VL    Q+++  SKWI+
Sbjct  584   WALQGQYQNDLRGLMFDSQGSAFKIPGEYVLENVFQIDLHRSKWIN  629



>ref|XP_010274916.1| PREDICTED: ABC transporter G family member 11 [Nelumbo nucifera]
 ref|XP_010274917.1| PREDICTED: ABC transporter G family member 11 [Nelumbo nucifera]
Length=704

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/587 (54%), Positives = 404/587 (69%), Gaps = 24/587 (4%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW+DL VTVS      + +L+GLTGYA PG L A+MGPSG GKSTLLDAL+ RL     
Sbjct  54    LTWKDLTVTVSLPNGEAQKVLEGLTGYAVPGTLTALMGPSGSGKSTLLDALSSRLAANAF  113

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
              SG IL+NGR   L++GT+AYVTQ+D L  TLTVRE + YSA+L+LP  +P SEK+E+ E
Sbjct  114   LSGSILLNGRKTKLSFGTAAYVTQDDNLIGTLTVRETILYSARLRLPDKMPWSEKQELVE  173

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI EMGLQD  +T + G W  +GISGG+KRRVSI LEIL RP+LLFLDEP+SGLDSA++
Sbjct  174   STIVEMGLQDCADT-VVGNWHLRGISGGEKRRVSIALEILMRPRLLFLDEPTSGLDSASA  232

Query  766   FYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             F+V   +  L+  GRTV+ SIHQPS+EVF LF  L LLS G+ VYFG AS A +FF   G
Sbjct  233   FFVTQTLRSLSRGGRTVICSIHQPSSEVFELFDRLYLLSGGKTVYFGQASDAYEFFAQAG  292

Query  946   FPCPTLQNPSDHFLKTINKDFDN---------------DDEDVEQGCARGIPTEEVINIL  1080
             FPCP L+NPSDHFL+ IN DFD                 D+ +E+     I T E I  L
Sbjct  293   FPCPALRNPSDHFLRCINSDFDKVKATMKGSMKLRFARTDDPLEK-----ITTAEAIRTL  347

Query  1081  VNSYKSYHRYREVQGQVAEISKQEGEVLKKS-SRADFFTQSIVLTRRSFLNMFRDLGYYW  1257
             +N Y +       + +V EISK +G VL    S+A F  Q+ +LT+RSF+NM RD GYYW
Sbjct  348   INYYNTCQYNYSARERVEEISKVKGTVLDSGGSQASFLMQAFMLTKRSFVNMSRDFGYYW  407

Query  1258  LRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFK  1437
             LRL IYI + V +G +Y DVG G +SI AR S  +F+  F TFM+IGGFPSFVEDMKVF+
Sbjct  408   LRLVIYIVVTVCIGTIYLDVGTGYNSILARGSCASFVFGFVTFMSIGGFPSFVEDMKVFQ  467

Query  1438  KETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNM  1617
             +E LNGHYG  AF I NTLS+LP+L+LI+ I G I YF V L   F H+ +F L +  ++
Sbjct  468   RERLNGHYGVAAFVIGNTLSALPFLILITFISGTICYFMVHLHPGFMHYLFFVLCLYASV  527

Query  1618  LLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHK  1797
              +VESLMM IAS++PN+LMGII GAG+Q + +L  GYFRLP D+PK FWRYP+ YI FH 
Sbjct  528   TVVESLMMAIASVIPNFLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHF  587

Query  1798  YAYQGLYKNEFQGLRLPEETGQI--ITGEEVLRETLQVEMGHSKWID  1932
             +A QG Y+N+ +GL    ++  +  I GE +L    Q+++  SKWID
Sbjct  588   WALQGQYQNDLKGLLFDNQSPDLPKIPGEYILENVFQIDVKRSKWID  634



>ref|XP_002525670.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF36788.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=705

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/582 (54%), Positives = 403/582 (69%), Gaps = 14/582 (2%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW+DL V V+      + +L+GLTGYA PG L A+MGPSG GKSTLLDAL+ RL     
Sbjct  51    LTWKDLTVMVTLSNGETQNVLEGLTGYAEPGSLTALMGPSGSGKSTLLDALSSRLAANAF  110

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
              SG IL+NGR   L++GT+AYVTQ+D L  TLTVRE + YSA+L+LP  +P SEK+ + E
Sbjct  111   LSGTILLNGRKTKLSFGTAAYVTQDDNLIGTLTVRETISYSARLRLPDKMPWSEKRALVE  170

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI EMGLQD  +T + G W  +GISGG+KRRVSI LEIL RP+LLFLDEP+SGLDSA++
Sbjct  171   STIIEMGLQDCADT-VIGNWHLRGISGGEKRRVSIALEILMRPRLLFLDEPTSGLDSASA  229

Query  766   FYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             F+V   +  L+ +GRTV+ASIHQPS+EVF LF  L LLS G+ VYFG AS A +FF   G
Sbjct  230   FFVTQTLRGLSRDGRTVIASIHQPSSEVFELFDRLYLLSGGKTVYFGQASEAYEFFAQAG  289

Query  946   FPCPTLQNPSDHFLKTINKDFDNDDEDVE----------QGCARGIPTEEVINILVNSYK  1095
             FPCP L+NPSDHFL+ IN DFD     ++          +     I T E I  LVN Y+
Sbjct  290   FPCPALRNPSDHFLRCINSDFDKVKATLKGSMKLRFESSEDPLEKITTAEAIRTLVNYYR  349

Query  1096  SYHRYREVQGQVAEISKQEGEVLKKS-SRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGI  1272
             +   Y   + +V EISK +G VL    S+A F  Q+  LT+RSF+NM RD GYYWLRL I
Sbjct  350   TSQYYYAAREKVEEISKVKGTVLDSGGSQASFLMQAFTLTKRSFVNMSRDFGYYWLRLVI  409

Query  1273  YITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLN  1452
             YI + V +G +Y +VG G +SI AR S  +F+  F TFM+IGGFPSFVEDMKVF++E LN
Sbjct  410   YIVVTVCIGTIYLNVGTGYNSILARGSCASFVFGFVTFMSIGGFPSFVEDMKVFQRERLN  469

Query  1453  GHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVES  1632
             GHYG  AF I+NT+S++P+L++I+ I G I YF V L   F H+ +F L +  ++ +VES
Sbjct  470   GHYGVTAFVISNTISAMPFLIMITFISGTICYFMVRLHPGFEHYLFFVLCLYASVTVVES  529

Query  1633  LMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQG  1812
             LMM IAS+VPN+LMGII GAG+Q + +L  GYFRLP D+PK  WRYP+ YI FH +A QG
Sbjct  530   LMMAIASIVPNFLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYISFHFWALQG  589

Query  1813  LYKNEFQGLRLPEETGQI--ITGEEVLRETLQVEMGHSKWID  1932
              Y+N+ +GL    +T  +  I GE +L    Q+++  SKW+D
Sbjct  590   QYQNDLRGLLFDNQTPDLPKIPGEYILEYIFQIDVHRSKWVD  631



>ref|NP_173226.2| ABC transporter G family member 11 [Arabidopsis thaliana]
 sp|Q8RXN0.1|AB11G_ARATH RecName: Full=ABC transporter G family member 11; Short=ABC transporter 
ABCG.11; Short=AtABCG11; AltName: Full=Protein CUTICULAR 
DEFECT AND ORGAN FUSION 1; AltName: Full=Protein DESPERADO; 
AltName: Full=Protein PERMEABLE LEAVES 1; AltName: Full=White-brown 
complex homolog protein 11; Short=AtWBC11 [Arabidopsis 
thaliana]
 gb|AAL87274.1| putative ABC transporter protein [Arabidopsis thaliana]
 gb|AAN12898.1| putative ABC transporter protein [Arabidopsis thaliana]
 gb|AEE29642.1| ABC transporter G family member 11 [Arabidopsis thaliana]
Length=703

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/586 (53%), Positives = 405/586 (69%), Gaps = 23/586 (4%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW+DL V V+ G    + +L+GLTGYA PG L A+MGPSG GKST+LDALA RL     
Sbjct  50    LTWQDLTVMVTMGDGETQNVLEGLTGYAEPGSLTALMGPSGSGKSTMLDALASRLAANAF  109

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
              SG +L+NGR   L++GT+AYVTQ+D L  TLTVRE ++YSA+++LP  + RSEK+ + E
Sbjct  110   LSGTVLLNGRKTKLSFGTAAYVTQDDNLIGTLTVRETIWYSARVRLPDKMLRSEKRALVE  169

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI EMGLQD  +T + G W  +GISGG+KRRVSI LEIL RP+LLFLDEP+SGLDSA++
Sbjct  170   RTIIEMGLQDCADT-VIGNWHLRGISGGEKRRVSIALEILMRPRLLFLDEPTSGLDSASA  228

Query  766   FYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             F+V   +  L+ +GRTV+ASIHQPS+EVF LF  L LLS G+ VYFG AS A +FF   G
Sbjct  229   FFVTQTLRALSRDGRTVIASIHQPSSEVFELFDRLYLLSGGKTVYFGQASDAYEFFAQAG  288

Query  946   FPCPTLQNPSDHFLKTINKDFDN---------------DDEDVEQGCARGIPTEEVINIL  1080
             FPCP L+NPSDHFL+ IN DFD                 D+ +E+     I T E I +L
Sbjct  289   FPCPALRNPSDHFLRCINSDFDKVRATLKGSMKLRFEASDDPLEK-----ITTAEAIRLL  343

Query  1081  VNSYKSYHRYREVQGQVAEISKQEGEVLKKS-SRADFFTQSIVLTRRSFLNMFRDLGYYW  1257
             V+ Y +   Y   + +V EIS+ +G +L    S+A F  Q+  LT+RSF+NM RD GYYW
Sbjct  344   VDYYHTSDYYYTAKAKVEEISQFKGTILDSGGSQASFLLQTYTLTKRSFINMSRDFGYYW  403

Query  1258  LRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFK  1437
             LRL IYI + V +G +Y +VG   S+I AR S  +F+  F TFM+IGGFPSFVEDMKVF+
Sbjct  404   LRLLIYILVTVCIGTIYLNVGTSYSAILARGSCASFVFGFVTFMSIGGFPSFVEDMKVFQ  463

Query  1438  KETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNM  1617
             +E LNGHYG  AF IANTLS+ P+L++I+ I G I YF VGL   F H+ +F L +  ++
Sbjct  464   RERLNGHYGVAAFVIANTLSATPFLIMITFISGTICYFMVGLHPGFTHYLFFVLCLYASV  523

Query  1618  LLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHK  1797
              +VESLMM IAS+VPN+LMGII GAG+Q + +L  G+FRLP D+PK FWRYP+ YI FH 
Sbjct  524   TVVESLMMAIASIVPNFLMGIIIGAGIQGIFMLVSGFFRLPNDIPKPFWRYPMSYISFHF  583

Query  1798  YAYQGLYKNEFQGLRLPEETGQI-ITGEEVLRETLQVEMGHSKWID  1932
             +A QG Y+N+ +GL    +     I GE VL    Q+++  SKWI+
Sbjct  584   WALQGQYQNDLRGLTFDSQGSAFKIPGEYVLENVFQIDLHRSKWIN  629



>gb|KDO56025.1| hypothetical protein CISIN_1g005142mg [Citrus sinensis]
Length=712

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/595 (52%), Positives = 404/595 (68%), Gaps = 34/595 (6%)
 Frame = +1

Query  226   LTWEDL--WVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELT  399
             LTW+DL   VT+S+G   N  +L+GLTGYA PG L A+MGPSG GKSTLLDAL+ RL   
Sbjct  52    LTWKDLTVMVTLSNGETHN--VLEGLTGYAEPGTLTALMGPSGSGKSTLLDALSSRLASN  109

Query  400   TRQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEI  579
                SG IL+NG    L++GT+AYVTQ+D L  TLTVRE + YSA+L+LP  +P SEK+ +
Sbjct  110   AFLSGTILLNGHKTKLSFGTAAYVTQDDNLIGTLTVRETISYSARLRLPDKMPWSEKRTL  169

Query  580   AEMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSA  759
              E TI EMGLQD  +T + G W  +GISGG++RRVSI LEIL RP+LLFLDEP+SGLDSA
Sbjct  170   VERTIIEMGLQDCADT-VIGNWHLRGISGGERRRVSIALEILMRPRLLFLDEPTSGLDSA  228

Query  760   ASFYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFET  939
             A+F+V   +  L+ +GRTV+ASIHQPS+EVF LF  L LLS G+ VYFG  SAA +FF  
Sbjct  229   AAFFVTQTLRCLSRDGRTVIASIHQPSSEVFELFDRLYLLSGGKTVYFGETSAAFEFFAQ  288

Query  940   NGFPCPTLQNPSDHFLKTINKDFD---------------NDDEDVEQGCARGIPTEEVIN  1074
              GFPCP L+NPSDHFL+ IN DFD                 D+ +E+     I T E I 
Sbjct  289   AGFPCPALRNPSDHFLRCINSDFDKVKATLKGSMKLKFETSDDPLEK-----ITTAEAIK  343

Query  1075  ILVNSYKSYHRYREVQGQVAEISKQEGEVLKK-SSRADFFTQSIVLTRRSFLNMFRDLGY  1251
              L++ Y++       + +V  ISK +G VL    S+A F  Q+  LT+RSF+NM RD GY
Sbjct  344   NLIDFYQTSQHSYAAKEKVEGISKVKGTVLDAGGSQASFLMQAFTLTKRSFVNMSRDFGY  403

Query  1252  YWLRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMK-  1428
             YWLRL IY+ + + +G +Y +VG G +SI AR S  +F+  F TFM+IGGFPSFVEDMK 
Sbjct  404   YWLRLVIYVVVTICIGTIYLNVGTGYNSILARGSCASFVFGFVTFMSIGGFPSFVEDMKF  463

Query  1429  -----VFKKETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYF  1593
                  VF++E LNGHYG  AF I NTLS++P+L++I+ I G I YF V L   F H+ +F
Sbjct  464   CNIFQVFQRERLNGHYGVTAFVIGNTLSAMPFLIMITFISGTICYFMVRLHPGFIHYLFF  523

Query  1594  ALVILMNMLLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYP  1773
              L +  ++ +VESLMM IAS+VPN+LMGII GAG+Q + +L  GYFRLP D+PK  WRYP
Sbjct  524   VLCLYASVAVVESLMMAIASIVPNFLMGIITGAGIQGIFMLVSGYFRLPNDIPKPVWRYP  583

Query  1774  IYYIDFHKYAYQGLYKNEFQGLRLPEETGQI--ITGEEVLRETLQVEMGHSKWID  1932
             + Y+ FH +A QG Y+N+ +GL    ++  +  I GE VL    Q+++  SKWID
Sbjct  584   MSYLSFHYWALQGQYQNDLKGLWFDNQSPDLPKIPGEYVLENVFQIDVRRSKWID  638



>gb|KHN26509.1| ABC transporter G family member 11 [Glycine soja]
Length=623

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/603 (53%), Positives = 411/603 (68%), Gaps = 24/603 (4%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTWE+L  TV++G K  K IL GLTGYA+PG LLAI+GPSG GKSTLLDALAGRL    +
Sbjct  9     LTWENLEATVTNG-KNRKLILHGLTGYAQPGRLLAIIGPSGSGKSTLLDALAGRLTSNIK  67

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
             Q+G ILING  Q LAYGTS YVTQ+D + + LT  E +YYSA LQ P+++   EKKE A+
Sbjct  68    QTGKILINGHKQELAYGTSGYVTQDDAMLSCLTAGETLYYSAMLQFPNTMSVEEKKERAD  127

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
             MT++EMGLQDA+NTR  GGW  KG+SGGQ+RR+SIC+EILT PKLLFLDEP+SGLDSAAS
Sbjct  128   MTLREMGLQDAINTR-VGGWNCKGLSGGQRRRLSICIEILTHPKLLFLDEPTSGLDSAAS  186

Query  766   FYVMSKIMDLASEG---RTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFE  936
             +YVMS I +L       RT+VAS+HQPS+EVF LF  L LLSSG  VYFGPAS A QFF 
Sbjct  187   YYVMSGIANLIQRDGIQRTIVASVHQPSSEVFQLFHDLFLLSSGETVYFGPASDANQFFA  246

Query  937   TNGFPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYRE  1116
             +NGFPCP L NPSDH+L+ INKDF+ D ++       GI TEE   ILVNSYKS      
Sbjct  247   SNGFPCPPLYNPSDHYLRIINKDFNQDADE-------GITTEEATKILVNSYKSSEFSNH  299

Query  1117  VQGQVAEISKQEGEVLKKSS-RADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVG  1293
             VQ ++A+     G   KK    A F TQ ++L RR+ L ++RD   YW RL ++I +++ 
Sbjct  300   VQSEIAKSETDFGACGKKKKIHAAFITQCLILIRRASLQIYRDTNNYWARLVVFIFISLS  359

Query  1294  LGYM-YNDVGYGNSSIQARCSVLAFIASFFTFMA-IGGFPSFVEDMKVFKKETLNGHYGC  1467
             +G + Y+  G    SI  R S+L F  S  TFM  +GG    +E+MKVFK+E LNGHYG 
Sbjct  360   VGSIFYHSGGPDLRSIMDRGSLLCFFVSVVTFMTLVGGISPLIEEMKVFKRERLNGHYGI  419

Query  1468  GAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMII  1647
              AF I+N  S++PY  L+S+IPG +  +  GL +   +F +   V+   +  VESLMM++
Sbjct  420   TAFLISNIFSAVPYNFLMSIIPGAVVTYLSGLHKGVDNFVFLVSVLFATVTWVESLMMVV  479

Query  1648  ASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNE  1827
              S+ PNY+MG+I   G++ +MIL  G++RLP DLPK  W++P YYI F  YA+QGL KNE
Sbjct  480   GSVFPNYVMGVIVCGGIEGVMILTSGFYRLPNDLPKPVWKFPFYYISFLTYAFQGLLKNE  539

Query  1828  FQGLRLPEETGQIITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKA  2007
             F+ L             EVL +T  V+MGHSKW+DL ++  M V+ RV+FL + K  EK+
Sbjct  540   FEDLPF---------SSEVLADTWHVQMGHSKWVDLAIMFAMIVLYRVLFLAISKCKEKS  590

Query  2008  KHV  2016
             K V
Sbjct  591   KQV  593



>ref|XP_007208437.1| hypothetical protein PRUPE_ppa002298mg [Prunus persica]
 gb|EMJ09636.1| hypothetical protein PRUPE_ppa002298mg [Prunus persica]
Length=690

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/587 (53%), Positives = 406/587 (69%), Gaps = 24/587 (4%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW+DL VTV+      + +L+GLTGYA PG   A+MGPSG GKSTLLDAL+ RL     
Sbjct  42    LTWKDLTVTVTLSNGETQKVLEGLTGYAEPGTFTALMGPSGSGKSTLLDALSSRLAANAF  101

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
              SG IL+NGR + L++GT+AYVTQ+D L  TLTVRE + YSA+L+LP  +  S+K+E+ E
Sbjct  102   LSGTILLNGRKRKLSFGTAAYVTQDDNLIGTLTVRETISYSARLRLPDKMSWSKKRELVE  161

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI EMGLQD  +T + G W  +GISGG+KRRVSI LEIL RP+LLFLDEP+SGLDSA++
Sbjct  162   STIIEMGLQDCADT-VIGNWHLRGISGGEKRRVSIALEILMRPRLLFLDEPTSGLDSASA  220

Query  766   FYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             F+V   +  LA +GRTV+ASIHQPS+EVF LF  L LLSSG+ VYFG AS A +FF   G
Sbjct  221   FFVTQTLRALARDGRTVIASIHQPSSEVFELFDQLYLLSSGKTVYFGQASDAYEFFAQAG  280

Query  946   FPCPTLQNPSDHFLKTINKDFDN---------------DDEDVEQGCARGIPTEEVINIL  1080
             FPCP L+NPSDHFL+ +N DFD                 D+ +E+     I T E I +L
Sbjct  281   FPCPALRNPSDHFLRCVNSDFDKVKATLKGSMKLRFEASDDPLEK-----ITTAEAIRVL  335

Query  1081  VNSYKSYHRYREVQGQVAEISKQEGEVLKKS-SRADFFTQSIVLTRRSFLNMFRDLGYYW  1257
             ++SY++       + +V EISK +G VL    S+A F  QS  L++RSF+NM RD GYYW
Sbjct  336   IDSYRTSQYSYAAREKVEEISKVKGTVLDSGGSQASFLMQSFTLSKRSFINMSRDFGYYW  395

Query  1258  LRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFK  1437
             LRL IYI + V +G +Y +VG G SSI AR S  +F+  F TFM+IGGFPSFVEDMKVF+
Sbjct  396   LRLVIYIVVTVCIGTIYLNVGTGYSSILARGSCASFVFGFVTFMSIGGFPSFVEDMKVFQ  455

Query  1438  KETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNM  1617
             +E LNGHYG  AF I+NTLS++P+L+LI+ + G + Y+ V L   F H+ +F L +  ++
Sbjct  456   RERLNGHYGVTAFVISNTLSAMPFLILITFLAGTVCYYMVRLHPGFKHYLFFVLCLYASV  515

Query  1618  LLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHK  1797
              +VESLMM IAS+VPN+LMGII GAG+Q + +L  GYFRLP D+PK  WRYP+ YI FH 
Sbjct  516   TVVESLMMAIASIVPNFLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYISFHY  575

Query  1798  YAYQGLYKNEFQGLRLPEETGQI--ITGEEVLRETLQVEMGHSKWID  1932
             +A QG Y+N+  GL    ++  +  I GE +L    Q++   SKWID
Sbjct  576   WALQGQYQNDLSGLVFDNQSPDLPKIPGEYILENVFQIDTTRSKWID  622



>ref|XP_002459718.1| hypothetical protein SORBIDRAFT_02g009310 [Sorghum bicolor]
 gb|EER96239.1| hypothetical protein SORBIDRAFT_02g009310 [Sorghum bicolor]
Length=615

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/648 (51%), Positives = 424/648 (65%), Gaps = 81/648 (13%)
 Frame = +1

Query  91    DSNRINIVPLDMETAGGVSSMPKDKRPgggaeaakvdvgggggvFLTWEDLWVTVSDGRK  270
             D +R+   PLD   A G SS+P++                   VFLTWEDL VT S G+ 
Sbjct  43    DDHRLGSHPLDCVGARG-SSLPEEA---------------SHEVFLTWEDLSVTASSGKA  86

Query  271   GNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTRQSGDILINGRTQTLA  450
                 I+  ++GYARPGE+LA+MGPSGCGK+TLLDALAGRL    +++G+ILINGR + LA
Sbjct  87    KAAVIIDKISGYARPGEVLALMGPSGCGKTTLLDALAGRLGSDKKKTGNILINGRREKLA  146

Query  451   YGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAEMTIKEMGLQDAMNTR  630
             +GTSAYVTQE  L ATLTV EAV+YSAQLQLP S+P +EK+E A+  I++MGL      R
Sbjct  147   FGTSAYVTQETLLMATLTVTEAVHYSAQLQLPDSVPAAEKRERADRAIRQMGLAAVAGHR  206

Query  631   igggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAASFYVMSKIMDLASEGR  810
               GG   KGISGGQ+RRVSIC+E+L  P L FLDEP+SGLDSAASF+VMS+I  LA + R
Sbjct  207   -IGGRVCKGISGGQRRRVSICVELLASPALAFLDEPTSGLDSAASFHVMSRIAGLARDER  265

Query  811   -TVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNGFPCPTLQNPSDHFL  987
              TVVA++HQPS+EVF LF  LCL++ GR+VYFGPAS AIQFF+ NG+ CP  +NPSDHFL
Sbjct  266   VTVVAAMHQPSSEVFQLFHGLCLMAYGRMVYFGPASDAIQFFDANGYACPMRRNPSDHFL  325

Query  988   KTINKDFDNDDEDVEQGCARGIPTEEVINILVNSYKSYHRYREVQGQVAEISKQEGEVLK  1167
               INKDF+          +  I  E  +                         ++G    
Sbjct  326   MMINKDFEK---------SLAITNEAFM------------------------MKQGAPFT  352

Query  1168  KSSRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGIYITLAVGLGYMYNDVGYGNSSIQAR  1347
             K  +A F T+ +VLT+RS +NM RD+GYYWLR GIYI + V +G ++ +VGY  +SIQ  
Sbjct  353   KKRQASFLTKCVVLTKRSVINMHRDMGYYWLRFGIYIAICVSIGTIFFNVGYSFASIQ--  410

Query  1348  CSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLNGHYGCGAFAIANTlsslpylllisl  1527
                                        VF+KE LNGHYG  AF I+NTLSS PYL +IS+
Sbjct  411   ---------------------------VFRKEQLNGHYGATAFVISNTLSSAPYLGIISI  443

Query  1528  ipGMIAYFPVGLQREFGHFAYFALVILMNMLLVESLMMIIASLVPNYLMGIIAGAGLQAL  1707
             IPG I Y+  GLQR F HF YFA V+    +LVE LMMI+A++VP++L+GII G+G+Q L
Sbjct  444   IPGAICYYLTGLQRGFDHFLYFAAVLWACTMLVEGLMMIVAAIVPDFLLGIITGSGMQGL  503

Query  1708  MILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQGLYKNEFQGLRLPE-ETGQIITGEEV  1884
             ++L  G+FRLP DLPK  W+YP YYI +HKYA QGLYKNEF GL   +   G  ITG+ +
Sbjct  504   LMLNAGFFRLPNDLPKPLWKYPTYYISYHKYATQGLYKNEFLGLVFDDLGRGFTITGDYI  563

Query  1885  LRETLQVEMGHSKWIDllvlvvmgvvcrvvfllvvKASEKAKHVVKAV  2028
             LR  LQVEMG+SKW+DL +L+VM ++ RV+FL+ +K  E  K ++K +
Sbjct  564   LRTNLQVEMGYSKWVDLAILLVMVLIYRVLFLVTIKVGEAMKPMIKCM  611



>ref|XP_009401807.1| PREDICTED: ABC transporter G family member 11-like [Musa acuminata 
subsp. malaccensis]
Length=711

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/587 (53%), Positives = 404/587 (69%), Gaps = 24/587 (4%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW+DL VTV+ G+     +L+GLTGYA PG L A+MGPSG GKSTLLDALAGRL     
Sbjct  56    LTWKDLTVTVTLGKGETHKVLEGLTGYAEPGTLTALMGPSGSGKSTLLDALAGRLATNAF  115

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
              SG ILINGR   L++G +AYVTQ+D L  TLTVRE ++YSA+L+LP  +PR EK+ + E
Sbjct  116   LSGAILINGRKTKLSFGAAAYVTQDDNLIGTLTVRETIWYSARLRLPDKMPREEKRALVE  175

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI EMGLQD  +T + G W  +G+SGG+KRRVSI LEIL RP+LLFLDEP+SGLDSA++
Sbjct  176   STIMEMGLQDCADT-VIGNWHLRGVSGGEKRRVSIALEILMRPRLLFLDEPTSGLDSASA  234

Query  766   FYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             F+V   +  L+ +GRTV+ASIHQPS+EVF LF SL LLS GR VYFG AS A QFF   G
Sbjct  235   FFVTQTLRGLSRDGRTVIASIHQPSSEVFELFDSLYLLSGGRTVYFGQASEACQFFAQAG  294

Query  946   FPCPTLQNPSDHFLKTINKDFDN---------------DDEDVEQGCARGIPTEEVINIL  1080
             FPCP+L+NPSDHFL+ +N DFD                 D+ +E+       T E +  L
Sbjct  295   FPCPSLRNPSDHFLRCVNSDFDKVKATLKGSVKLRFERSDDPLER-----TTTAEAMRRL  349

Query  1081  VNSYKSYHRYREVQGQVAEISKQEGEVLKKS-SRADFFTQSIVLTRRSFLNMFRDLGYYW  1257
             +  Y         + +V EIS+ +G VL    S+A F  Q++ LTRRSF+NM RD GYYW
Sbjct  350   IEFYSRSQYSYAARQKVDEISRIKGTVLDSGGSQASFLMQALTLTRRSFVNMSRDFGYYW  409

Query  1258  LRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFK  1437
             LRL IYI + + +G +Y +VG G S+I AR +  +F+  F TFM+IGGFPSFVEDMKVF+
Sbjct  410   LRLLIYIVVTICIGTIYLNVGTGYSAILARGACASFVFGFVTFMSIGGFPSFVEDMKVFQ  469

Query  1438  KETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNM  1617
             +E LNGHYG  AF I+NTLS++P+L++IS   G I YF V L   F H+ +F L +  ++
Sbjct  470   RERLNGHYGVLAFVISNTLSAMPFLIMISFASGTICYFMVKLHPGFMHYLFFVLCLYASV  529

Query  1618  LLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHK  1797
              +VESLMM IAS+VPN+LMGII GAG+Q + +L  GYFRLP D+PK FWRYP+ YI F  
Sbjct  530   TVVESLMMAIASVVPNFLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMTYISFDY  589

Query  1798  YAYQGLYKNEFQGLRLPEETGQI--ITGEEVLRETLQVEMGHSKWID  1932
             ++ QG Y+N+ +GL    +T  +  I GE VL    Q+++  SKW D
Sbjct  590   WSLQGQYQNDLKGLLFDNQTPDLPKIPGEYVLENVFQIDVSRSKWWD  636



>ref|XP_010687272.1| PREDICTED: ABC transporter G family member 11 [Beta vulgaris 
subsp. vulgaris]
Length=723

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/587 (51%), Positives = 397/587 (68%), Gaps = 24/587 (4%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW DL V V+      + +L+ LTGYA PG   A+MGPSG GKSTLLDAL+ RL     
Sbjct  67    LTWNDLTVMVTLSNGDTQKVLESLTGYAEPGSFTALMGPSGSGKSTLLDALSSRLAANAF  126

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
              SG IL+NGR   L++G +AYVTQ+D L  TLTVRE + YSA+L+LP  +  SEK+ + E
Sbjct  127   LSGTILLNGRKTKLSFGAAAYVTQDDNLIGTLTVRETISYSARLRLPDKMAWSEKQALIE  186

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI EMGLQD  +T + G W  +GISGG+KRRVSI +EIL RP+LLFLDEP+SGLDSA++
Sbjct  187   STIIEMGLQDCADT-VIGNWHLRGISGGEKRRVSIAIEILMRPRLLFLDEPTSGLDSASA  245

Query  766   FYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             F+V+  +  L+ +GRTV+ASIHQPS+EVF LF  L LLS G+ VYFG AS A  FF   G
Sbjct  246   FFVIETLRGLSRDGRTVIASIHQPSSEVFELFDRLYLLSGGKTVYFGQASEAYDFFAQAG  305

Query  946   FPCPTLQNPSDHFLKTINKDFDN---------------DDEDVEQGCARGIPTEEVINIL  1080
             FPCP L+NPSDHFL+ IN DFD                 D+ +E+     I T E    L
Sbjct  306   FPCPALRNPSDHFLRCINSDFDKVKATLKGSMKLRFEASDDPLEK-----ITTAEATRTL  360

Query  1081  VNSYKSYHRYREVQGQVAEISKQEGEVLKKS-SRADFFTQSIVLTRRSFLNMFRDLGYYW  1257
             ++ Y +  +    + +V EISK +G VL    S+A F  Q+  LT+RSF+NM RD GYYW
Sbjct  361   ISHYSTSQQSYSARHRVDEISKVKGTVLDSGGSQASFLMQTFTLTKRSFVNMSRDFGYYW  420

Query  1258  LRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFK  1437
             LRL IY+ + + +G ++ +VG   ++I AR S  +F+  F TFM+IGGFPSFVEDMKVF+
Sbjct  421   LRLVIYVVVTMCIGSIFLNVGTSFNAILARGSCASFVFGFVTFMSIGGFPSFVEDMKVFQ  480

Query  1438  KETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNM  1617
             +E LNGHYG  AF I+NT+S++P+L+LI+ I G + YF V L   F H+ +F L +  ++
Sbjct  481   RERLNGHYGVAAFVISNTISAMPFLMLITFISGTVCYFMVHLHPGFEHYIFFVLCLYASV  540

Query  1618  LLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHK  1797
              +VESLMM IAS+VPN+LMGII GAG+Q + +L  G+FRLPKD+PK  WRYP+ YI FH 
Sbjct  541   TVVESLMMAIASIVPNFLMGIITGAGIQGIFMLVSGFFRLPKDIPKPVWRYPMSYISFHF  600

Query  1798  YAYQGLYKNEFQGLRLPEETGQI--ITGEEVLRETLQVEMGHSKWID  1932
             +A QG Y+N+ +GL     T  +  I GE VL    Q+++  SKW+D
Sbjct  601   WALQGQYQNDLKGLVFDNRTPDLPKIPGEYVLENVFQIDVNRSKWVD  647



>ref|XP_008370410.1| PREDICTED: ABC transporter G family member 11-like [Malus domestica]
Length=709

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/632 (52%), Positives = 429/632 (68%), Gaps = 27/632 (4%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW+DL V V+      + +L+GLTGYA PG   A+MGPSG GKSTLLDAL+ RL     
Sbjct  63    LTWKDLTVMVTLNNGETQKVLEGLTGYAEPGTFTALMGPSGSGKSTLLDALSSRLAANAF  122

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
              SG IL+NGR + L++GT+AYVTQ+D L  TLTVRE + YSA+L+LP  +  SEK+ + E
Sbjct  123   LSGTILLNGRKRKLSFGTAAYVTQDDNLIGTLTVRETISYSARLRLPDKMAWSEKRALVE  182

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI EMGLQD  +T + G W  +GISGG+KRRVSI LEILTRP+LLFLDEP+SGLDSA++
Sbjct  183   STIIEMGLQDCADT-VIGNWHLRGISGGEKRRVSIALEILTRPRLLFLDEPTSGLDSASA  241

Query  766   FYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             F+V   +  LA +GRTV+ASIHQPS+EVF LF  L LLSSG+ VYFG A+ A  FF   G
Sbjct  242   FFVTQTLRALARDGRTVIASIHQPSSEVFELFDQLYLLSSGKTVYFGQAADAYGFFAQAG  301

Query  946   FPCPTLQNPSDHFLKTINKDFDN---------------DDEDVEQGCARGIPTEEVINIL  1080
             FPCP L+NPSDHFL+ IN DFD                 D+ +E+     I T E I +L
Sbjct  302   FPCPALRNPSDHFLRCINSDFDKVKATLKGSMELRFEASDDPLEK-----ITTAEAIRVL  356

Query  1081  VNSYKSYHRYREVQGQVAEISKQEGEVLKKS-SRADFFTQSIVLTRRSFLNMFRDLGYYW  1257
             ++SY+S       + +V EISK +G VL    S+A FF Q+  L++RSF+NM RD GYYW
Sbjct  357   IDSYRSSQYSYAAREKVEEISKVKGTVLDSGGSQASFFMQAFQLSKRSFINMSRDFGYYW  416

Query  1258  LRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFK  1437
             LRL IYI + V +G +Y +VG G SSI AR S  +F+  F TFM+IGGFPSFVEDMKVF+
Sbjct  417   LRLVIYIVVTVCIGTIYLNVGTGYSSILARGSCASFVFGFVTFMSIGGFPSFVEDMKVFQ  476

Query  1438  KETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNM  1617
             +E LNGHYG  AF I+NTLS++P+L+LI+ + G + YF V L   F H+ +F L +  ++
Sbjct  477   RERLNGHYGVTAFVISNTLSAMPFLILITFLAGTVCYFMVRLHPGFEHYLFFVLCLYASV  536

Query  1618  LLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHK  1797
              +VESLMM IAS+VPN+LMGII GAG+Q + +L  GYFRLP D+PK  WRYP+ YI FH 
Sbjct  537   TVVESLMMAIASIVPNFLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPVWRYPMSYISFHF  596

Query  1798  YAYQGLYKNEFQGLRLPEETGQI--ITGEEVLRETLQVEMGHSKWIDllvlvvmgvvcrv  1971
             +A QG Y+N+  GL    +T  +  I GE +L    Q+    SKWIDL V++ M VV R+
Sbjct  597   WALQGQYQNDLSGLLFDNQTPDLPKIPGEYILENVFQINTARSKWIDLSVILSMIVVYRI  656

Query  1972  vfllvvKASEKAKHVVKAVM---RVSPKQSHQ  2058
             +F +++K SE     ++  M   R+  K  +Q
Sbjct  657   IFFIMIKFSEDVTPWIRGYMARRRIQQKNGNQ  688



>gb|KFK42295.1| hypothetical protein AALP_AA2G237200 [Arabis alpina]
Length=704

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/581 (53%), Positives = 401/581 (69%), Gaps = 13/581 (2%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW+DL V V+ G    + +L+GLTGYA PG L A+MGPSG GKST+LDALA RL     
Sbjct  51    LTWQDLTVMVTMGDGETQNVLEGLTGYAEPGSLTALMGPSGSGKSTMLDALASRLAANAF  110

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
              SG +L+NGR   L++GT+AYVTQ+D L  TLTVRE ++YSA+++LP  + RSEK+ + E
Sbjct  111   LSGTVLLNGRKTKLSFGTAAYVTQDDNLIGTLTVRETIWYSARVRLPDKMLRSEKRALVE  170

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI EMGLQD  +T + G W  +GISGG+KRRVSI LEIL RP+LLFLDEP+SGLDSA++
Sbjct  171   RTIIEMGLQDCADT-VIGNWHLRGISGGEKRRVSIALEILMRPRLLFLDEPTSGLDSASA  229

Query  766   FYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             F+V   +  L+ +GRTV+ASIHQPS+EVF LF  L LLS G+ VYFG AS A +FF   G
Sbjct  230   FFVTQTLRALSRDGRTVIASIHQPSSEVFELFDRLYLLSGGKTVYFGQASEAYEFFAQAG  289

Query  946   FPCPTLQNPSDHFLKTINKDFDNDDEDVEQGCA----------RGIPTEEVINILVNSYK  1095
             FPCP L+NPSDHFL+ +N DFD     ++                I T E I +LV+ Y 
Sbjct  290   FPCPALRNPSDHFLRCVNSDFDKVRATLKGSMKLRFEESNDPLEKITTTEAIRVLVDYYH  349

Query  1096  SYHRYREVQGQVAEISKQEGEVLKKS-SRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGI  1272
             +   Y   + +V EIS+ +G +L    S+A F  Q+  LT+RSF+NM RD GYYWLRL I
Sbjct  350   TSDYYYTAKAKVEEISQFKGTILDSGGSQASFLLQTYTLTKRSFINMSRDFGYYWLRLLI  409

Query  1273  YITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLN  1452
             YI + V +G +Y +VG   S+I AR S  +F+  F TFM+IGGFPSFVEDMKVF++E LN
Sbjct  410   YILVTVCIGTIYWNVGTSYSAILARGSCASFVFGFVTFMSIGGFPSFVEDMKVFQRERLN  469

Query  1453  GHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVES  1632
             GHYG  AF IANTL++ P+L++I+ I G I YF VGL   F H+ +F L +  ++ +VES
Sbjct  470   GHYGVAAFVIANTLAATPFLIIITFISGTICYFMVGLHPGFTHYLFFVLCLYASVTVVES  529

Query  1633  LMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQG  1812
             LMM IAS+VPN+LMGII GAG+Q + +L  G+FRLP D+PK FWRYP+ YI FH +A QG
Sbjct  530   LMMAIASIVPNFLMGIIIGAGIQGIFMLVSGFFRLPNDIPKPFWRYPMSYISFHFWALQG  589

Query  1813  LYKNEFQGLRLPEETGQI-ITGEEVLRETLQVEMGHSKWID  1932
              Y+N+ +GL    +     I GE VL    Q+ +  SKWI+
Sbjct  590   QYQNDLRGLYFDSQGSAFKIPGEYVLENVFQINLHRSKWIN  630



>ref|XP_010537533.1| PREDICTED: ABC transporter G family member 11 [Tarenaya hassleriana]
Length=705

 Score =   546 bits (1407),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 306/582 (53%), Positives = 401/582 (69%), Gaps = 14/582 (2%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW+DL V V+ G    + +L+GLTGYA PG L A+MGPSG GKSTLLDALA RL     
Sbjct  51    LTWQDLTVMVTLGNGETQNVLEGLTGYAEPGTLTALMGPSGSGKSTLLDALASRLAANAF  110

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
              SG +L+NGR   L++GT+AYVTQ+D L  TLTVRE ++YSA+L+LP  + RSEK+ + E
Sbjct  111   LSGTVLLNGRKTKLSFGTAAYVTQDDNLIGTLTVRETIWYSARLRLPDKMSRSEKRALVE  170

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI EMGLQD  +T   G W  +G+SGG+KRRVSI LEIL RP+LLFLDEP+SGLDSA++
Sbjct  171   STITEMGLQDCADT-AIGNWHLRGVSGGEKRRVSIALEILMRPRLLFLDEPTSGLDSASA  229

Query  766   FYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             F+V   +  L+ +GRTV+ASIHQPS+EVF LF  L LLS G+ VYFG AS A +FF   G
Sbjct  230   FFVTQTLRGLSRDGRTVIASIHQPSSEVFELFDRLYLLSGGKTVYFGHASEAYEFFAQAG  289

Query  946   FPCPTLQNPSDHFLKTINKDFDNDDE----------DVEQGCARGIPTEEVINILVNSYK  1095
             FPCP L+NPSDHFL+ IN DFD              +  +     I T E I +L++ Y 
Sbjct  290   FPCPALRNPSDHFLRCINSDFDKVKATLKGSMKLRFEASEDPLDKITTTEAIRLLIDYYH  349

Query  1096  SYHRYREVQGQVAEISKQEGEVLKKS-SRADFFTQSIVLTRRSFLNMFRDLGYYWLRLGI  1272
             +   Y   + +V EIS+ +G +L    S+A F+ Q+  LT+RSF+NM RD GYYWLRL I
Sbjct  350   TSEYYYSTKAKVEEISQVKGTILDSGGSQASFWMQAYTLTKRSFINMSRDFGYYWLRLVI  409

Query  1273  YITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFKKETLN  1452
             YI + + +G +Y ++G    +I AR S  +F+  F TFM+IGGFPSFVEDMKVF++E LN
Sbjct  410   YILVTLCIGTIYLNIGTSYGAILARGSCASFVFGFVTFMSIGGFPSFVEDMKVFQRERLN  469

Query  1453  GHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNMLLVES  1632
             GHYG  +F +ANTLS +P+L++I+ I G I YF VGL   F H+ +F L +  ++ +VES
Sbjct  470   GHYGVFSFVLANTLSGMPFLIMITFISGTICYFMVGLHSGFTHYLFFVLCLYASVTVVES  529

Query  1633  LMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHKYAYQG  1812
             LMM IAS+VPN+LMGII GAG+Q + +L  GYFRLP D+PK FWRYP+ YI FH +A QG
Sbjct  530   LMMAIASVVPNFLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFHFWALQG  589

Query  1813  LYKNEFQGLRLPEETGQI--ITGEEVLRETLQVEMGHSKWID  1932
              Y+N+ +GL    ++     I GE +L    Q+ +  SKW+D
Sbjct  590   QYQNDLKGLLFDSQSPSSFKIPGEYILENVFQINVHRSKWVD  631



>ref|XP_006848619.1| hypothetical protein AMTR_s00171p00031180 [Amborella trichopoda]
 gb|ERN10200.1| hypothetical protein AMTR_s00171p00031180 [Amborella trichopoda]
Length=712

 Score =   545 bits (1404),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 311/588 (53%), Positives = 412/588 (70%), Gaps = 25/588 (4%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKG-NKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTT  402
             LTW+DL VTV+  + G +  +L GLTGYA PG L+A+MGPSG GKSTLLDAL+GRL    
Sbjct  56    LTWKDLTVTVALPKGGGSHKVLDGLTGYAEPGSLMALMGPSGSGKSTLLDALSGRLASNA  115

Query  403   RQSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIA  582
               SG +L+NGR + L++GT+AYVTQ+D L  TLTVRE + YSA+L+LP+ +P S+K+ + 
Sbjct  116   FLSGTVLLNGRKRNLSFGTAAYVTQDDNLIGTLTVRETIMYSARLRLPNRMPWSDKQALV  175

Query  583   EMTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAA  762
             E TI EMGLQD  NT + G W  +GISGG+KRRVSI LEIL RP+LLFLDEP+SGLDSA+
Sbjct  176   ESTIIEMGLQDCANT-VIGNWHLRGISGGEKRRVSIALEILMRPRLLFLDEPTSGLDSAS  234

Query  763   SFYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETN  942
             +F+V   +  LA +GRTV+ SIHQPS+EVF LF  LCLLS G+ +YFG    A +FF   
Sbjct  235   AFFVTQTLRSLARDGRTVLTSIHQPSSEVFELFDRLCLLSGGKTLYFGQVPEACEFFAQA  294

Query  943   GFPCPTLQNPSDHFLKTINKDFDN---------------DDEDVEQGCARGIPTEEVINI  1077
             GFPCP+L+NPSDHFL+ IN DFD                 D+ +E+     I T E I +
Sbjct  295   GFPCPSLRNPSDHFLRCINSDFDKVKATLKGSMKLRLERSDDPLEK-----ITTIEAIRV  349

Query  1078  LVNSYKSYHRYREVQGQVAEISKQEGEVLKKS-SRADFFTQSIVLTRRSFLNMFRDLGYY  1254
             L++ Y S  +Y     +V +ISK +G VL+   S+A F  Q+ VLT+RSF+NM RD GYY
Sbjct  350   LLDHYNSSQQYYGTNQRVEQISKVKGTVLESGGSQASFLRQTAVLTKRSFVNMSRDFGYY  409

Query  1255  WLRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVF  1434
             WLRL IYI + + +G +Y +VG   +SI AR +  +F+  F TFM+IGGFPSFVEDMKVF
Sbjct  410   WLRLVIYIVVTICIGTIYLNVGTSYTSILARGACASFVFGFVTFMSIGGFPSFVEDMKVF  469

Query  1435  KKETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMN  1614
             ++E LNGHYG  AF I+NTLS++P+L++I+ I G I YF V L   F H+ +F + +  +
Sbjct  470   QRERLNGHYGVVAFVISNTLSAMPFLIMITFISGTICYFMVRLHPGFIHYVFFVMCLYAS  529

Query  1615  MLLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFH  1794
             + +VESLMM IAS++PN+LMGII GAG+Q + +L  GYFRLP D+PK FWRYP+ YI FH
Sbjct  530   VTVVESLMMAIASVIPNFLMGIIIGAGIQGIFMLVSGYFRLPNDIPKPFWRYPMSYISFH  589

Query  1795  KYAYQGLYKNEFQGLRLPEETGQI--ITGEEVLRETLQVEMGHSKWID  1932
              +A QG Y+N+ +GL    ++  +  I+GE +L    Q+ +  SKWID
Sbjct  590   YWALQGQYQNDLRGLYFDNQSPDLPKISGEYILEYVFQINVNRSKWID  637



>ref|NP_001147125.1| ATP-binding cassette sub-family G member 2 [Zea mays]
 gb|ACG25567.1| ATP-binding cassette sub-family G member 2 [Zea mays]
Length=708

 Score =   544 bits (1402),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 307/590 (52%), Positives = 407/590 (69%), Gaps = 27/590 (5%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             L W DL VTV+ G    +A+L+GLTG+A PG + A+MGPSG GKSTLLDALAGRL     
Sbjct  55    LAWRDLTVTVALGSGDTQAVLQGLTGHAEPGTITALMGPSGSGKSTLLDALAGRLAANAF  114

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
              SG +L+NGR   L++G +AYVTQ+D L  TLTVRE + YSA+L+LP  +PR EK+ + E
Sbjct  115   LSGTVLLNGRKANLSFGAAAYVTQDDNLIGTLTVRETISYSARLRLPDKMPREEKQALVE  174

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI EMGLQD  +T + G W  +GISGG+KRRVSI LEIL RP+LLFLDEP+SGLDSA++
Sbjct  175   GTIVEMGLQDCADT-VVGNWHLRGISGGEKRRVSIALEILMRPRLLFLDEPTSGLDSASA  233

Query  766   FYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             F+V   +  LA +GRTV+AS+HQPS+EVF LF  L LLS GR VYFG AS A +FF   G
Sbjct  234   FFVTQTLRGLARDGRTVIASVHQPSSEVFLLFDCLYLLSGGRTVYFGKASEACEFFAQAG  293

Query  946   FPCPTLQNPSDHFLKTINKDFD-----------------NDDEDVEQGCARGIPTEEVIN  1074
             FPCP ++NPSDHFL+ IN DFD                 NDD+ +E+     + T E + 
Sbjct  294   FPCPPMRNPSDHFLRCINSDFDKVKATLKGSMKAKFERSNDDDPLEK-----MTTSEAMR  348

Query  1075  ILVNSYKSYHRYREVQGQVAEISKQEGEVLKKS--SRADFFTQSIVLTRRSFLNMFRDLG  1248
              L + Y+    +   Q +V E+++ +G VL     S+A F  Q+  LT+RSF+NM RD G
Sbjct  349   RLTSYYQHSQCHINAQQKVDEMARLKGTVLDPGGGSQASFLMQAFTLTKRSFVNMSRDFG  408

Query  1249  YYWLRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMK  1428
             YYWLRL IYI + + +G +Y +VG G SSI AR +  +FI  F TFM+IGGFPSFVEDMK
Sbjct  409   YYWLRLIIYIVVTLCIGTIYLNVGTGYSSILARGACASFIFGFVTFMSIGGFPSFVEDMK  468

Query  1429  VFKKETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVIL  1608
             VF++E LNGHYG  AF ++NT+S++P+L+LI+ + G + YF V L   F H+ +F L + 
Sbjct  469   VFQRERLNGHYGVLAFVVSNTVSAMPFLVLITFVSGTLCYFMVRLHPGFTHYLFFVLALY  528

Query  1609  MNMLLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYID  1788
              ++ +VESLMM IAS++PN+LMGII GAG+Q + +L  GYFRLP D+PK FWRYP+ YI 
Sbjct  529   ASVTVVESLMMAIASVIPNFLMGIIIGAGIQGIFMLVSGYFRLPHDIPKPFWRYPMSYIS  588

Query  1789  FHKYAYQGLYKNEFQGLRLPEETGQI--ITGEEVLRETLQVEMGHSKWID  1932
             FH +A QG Y+N+ +GL    +  ++  I GE +L    Q+++  SKW+D
Sbjct  589   FHYWALQGQYQNDLRGLLFDNQDDELPRIPGEFILETVFQIDVARSKWLD  638



>gb|AFW68510.1| ATP-binding cassette sub-family G member 2 [Zea mays]
Length=710

 Score =   544 bits (1402),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 307/590 (52%), Positives = 407/590 (69%), Gaps = 27/590 (5%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             L W DL VTV+ G    +A+L+GLTG+A PG + A+MGPSG GKSTLLDALAGRL     
Sbjct  57    LAWRDLTVTVALGTGDTQAVLQGLTGHAEPGTITALMGPSGSGKSTLLDALAGRLAANAF  116

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
              SG +L+NGR   L++G +AYVTQ+D L  TLTVRE + YSA+L+LP  +PR EK+ + E
Sbjct  117   LSGTVLLNGRKANLSFGAAAYVTQDDNLIGTLTVRETISYSARLRLPDKMPREEKQALVE  176

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI EMGLQD  +T + G W  +GISGG+KRRVSI LEIL RP+LLFLDEP+SGLDSA++
Sbjct  177   GTIVEMGLQDCADT-VVGNWHLRGISGGEKRRVSIALEILMRPRLLFLDEPTSGLDSASA  235

Query  766   FYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             F+V   +  LA +GRTV+AS+HQPS+EVF LF  L LLS GR VYFG AS A +FF   G
Sbjct  236   FFVTQTLRGLARDGRTVIASVHQPSSEVFLLFDCLYLLSGGRTVYFGKASEACEFFAQAG  295

Query  946   FPCPTLQNPSDHFLKTINKDFD-----------------NDDEDVEQGCARGIPTEEVIN  1074
             FPCP ++NPSDHFL+ IN DFD                 NDD+ +E+     + T E + 
Sbjct  296   FPCPPMRNPSDHFLRCINSDFDKVKATLKGSMKARFERSNDDDPLEK-----MTTSEAMR  350

Query  1075  ILVNSYKSYHRYREVQGQVAEISKQEGEVLKKS--SRADFFTQSIVLTRRSFLNMFRDLG  1248
              L + Y+    +   Q +V E+++ +G VL     S+A F  Q+  LT+RSF+NM RD G
Sbjct  351   RLTSYYQHSQCHINAQQKVDEMARLKGTVLDPGGGSQASFLMQAFTLTKRSFVNMSRDFG  410

Query  1249  YYWLRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMK  1428
             YYWLRL IYI + + +G +Y +VG G SSI AR +  +FI  F TFM+IGGFPSFVEDMK
Sbjct  411   YYWLRLIIYIVVTLCIGTIYLNVGTGYSSILARGACASFIFGFVTFMSIGGFPSFVEDMK  470

Query  1429  VFKKETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVIL  1608
             VF++E LNGHYG  AF ++NT+S++P+L+LI+ + G + YF V L   F H+ +F L + 
Sbjct  471   VFQRERLNGHYGVLAFVVSNTVSAMPFLVLITFVSGTLCYFMVRLHPGFTHYLFFVLALY  530

Query  1609  MNMLLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYID  1788
              ++ +VESLMM IAS++PN+LMGII GAG+Q + +L  GYFRLP D+PK FWRYP+ YI 
Sbjct  531   ASVTVVESLMMAIASVIPNFLMGIIIGAGIQGIFMLVSGYFRLPHDIPKPFWRYPMSYIS  590

Query  1789  FHKYAYQGLYKNEFQGLRLPEETGQI--ITGEEVLRETLQVEMGHSKWID  1932
             FH +A QG Y+N+ +GL    +  ++  I GE +L    Q+++  SKW+D
Sbjct  591   FHYWALQGQYQNDLRGLLFDNQDDELPRIPGEFILETVFQIDVARSKWLD  640



>ref|XP_009149237.1| PREDICTED: ABC transporter G family member 11 [Brassica rapa]
Length=703

 Score =   543 bits (1399),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 310/586 (53%), Positives = 403/586 (69%), Gaps = 23/586 (4%)
 Frame = +1

Query  226   LTWEDLWVTVSDGRKGNKAILKGLTGYARPGELLAIMGPSGCGKSTLLDALAGRLELTTR  405
             LTW+DL V  + G    + +L+GLTGYA PG L A+MGPSG GKST+LDALA RL     
Sbjct  50    LTWQDLTVMFTMGDGETQNVLEGLTGYAEPGTLTALMGPSGSGKSTMLDALASRLAANAF  109

Query  406   QSGDILINGRTQTLAYGTSAYVTQEDTLTATLTVREAVYYSAQLQLPSSLPRSEKKEIAE  585
              SG +L+NGR   L++GT+AYVTQ+D L  TLTVRE ++YSA+++LP  + RSEK  + E
Sbjct  110   LSGTVLLNGRKTKLSFGTAAYVTQDDNLIGTLTVRETIWYSARVRLPDKMLRSEKLALVE  169

Query  586   MTIKEMGLQDAMNTRigggwgskgisggQKRRVSICLEILTRPKLLFLDEPSSGLDSAAS  765
              TI EMGLQD  +T + G W  +GISGG+KRRVSI LEIL RP+LLFLDEP+SGLDSA++
Sbjct  170   RTIIEMGLQDCADT-VIGNWHLRGISGGEKRRVSIALEILMRPRLLFLDEPTSGLDSASA  228

Query  766   FYVMSKIMDLASEGRTVVASIHQPSTEVfslftslcllssGRVVYFGPASAAIQFFETNG  945
             F+V   +  L+ +GRTV+ASIHQPS+EVF LF  L LLSSG+ VYFG AS A +FF   G
Sbjct  229   FFVTQTLRALSRDGRTVIASIHQPSSEVFELFDRLYLLSSGKTVYFGQASEAYEFFAQAG  288

Query  946   FPCPTLQNPSDHFLKTINKDFDN---------------DDEDVEQGCARGIPTEEVINIL  1080
             FPCP L+NPSDHFL+ +N DFD                 D+ +E+     I T E I +L
Sbjct  289   FPCPALRNPSDHFLRCVNSDFDKVRATLKGSMKLRFEASDDPLEK-----ITTTEAIRLL  343

Query  1081  VNSYKSYHRYREVQGQVAEISKQEGEVLKKS-SRADFFTQSIVLTRRSFLNMFRDLGYYW  1257
             V+ Y +   Y   + +V EIS+ +G +L    S+A F  Q+  LT+RSF+NM RD GYYW
Sbjct  344   VDYYHTSDYYYNAKAKVEEISQYKGTILDSGGSQASFLLQTYTLTKRSFINMSRDFGYYW  403

Query  1258  LRLGIYITLAVGLGYMYNDVGYGNSSIQARCSVLAFIASFFTFMAIGGFPSFVEDMKVFK  1437
             LRL IYI + V +G +Y +VG   S+I AR S  +F+  F TFM+IGGFPSFVEDMKVF+
Sbjct  404   LRLLIYILVTVCIGTIYWNVGTSYSAILARGSCASFVFGFVTFMSIGGFPSFVEDMKVFQ  463

Query  1438  KETLNGHYGCGAFAIANTlsslpylllislipGMIAYFPVGLQREFGHFAYFALVILMNM  1617
             +E LNGHYG  AF IANTL++ P+L++I+ I G I YF VGL   F H+ +F L +  ++
Sbjct  464   RERLNGHYGVAAFVIANTLAATPFLIIITFISGTICYFMVGLHPGFTHYLFFVLCLYASV  523

Query  1618  LLVESLMMIIASLVPNYLMGIIAGAGLQALMILGGGYFRLPKDLPKLFWRYPIYYIDFHK  1797
              +VESLMM IAS+VPN+LMGII GAG+Q + +L  G+FRLP D+PK FWRYP+ YI FH 
Sbjct  524   TVVESLMMAIASIVPNFLMGIIIGAGIQGIFMLVSGFFRLPNDIPKPFWRYPMSYISFHF  583

Query  1798  YAYQGLYKNEFQGLRLPEETGQI-ITGEEVLRETLQVEMGHSKWID  1932
             +A QG Y+N+ +G+    +     I GE VL    Q+ +  SKWI+
Sbjct  584   WALQGQYQNDLRGVMFDSQGSAFKIPGEYVLENVFQINLHRSKWIN  629



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7017750365668