BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24083_g1_i3 len=1231 path=[841:0-529 1371:530-551 5133:552-563
5145:564-584 3375:585-1230]

Length=1231
                                                                      Score     E

ref|XP_009762863.1|  PREDICTED: brassinosteroid-regulated protein...    347   5e-114   
ref|XP_009598225.1|  PREDICTED: brassinosteroid-regulated protein...    346   2e-113   
ref|XP_009597029.1|  PREDICTED: probable xyloglucan endotransgluc...    345   3e-113   
ref|XP_009598236.1|  PREDICTED: brassinosteroid-regulated protein...    345   4e-113   
ref|XP_009762866.1|  PREDICTED: brassinosteroid-regulated protein...    343   2e-112   
ref|XP_009785048.1|  PREDICTED: probable xyloglucan endotransgluc...    342   4e-112   
ref|XP_006350014.1|  PREDICTED: probable xyloglucan endotransgluc...    337   6e-110   
ref|NP_001234478.1|  xyloglucan endotransglucosylase-hydrolase XT...    336   9e-110   
ref|XP_004243230.1|  PREDICTED: probable xyloglucan endotransgluc...    335   2e-109   
ref|XP_009602932.1|  PREDICTED: probable xyloglucan endotransgluc...    335   2e-109   
ref|XP_006350013.1|  PREDICTED: probable xyloglucan endotransgluc...    335   3e-109   
ref|XP_011082926.1|  PREDICTED: xyloglucan endotransglucosylase/h...    335   5e-109   
ref|XP_006348946.1|  PREDICTED: probable xyloglucan endotransgluc...    334   9e-109   
ref|XP_009758414.1|  PREDICTED: probable xyloglucan endotransgluc...    333   1e-108   
ref|XP_011082921.1|  PREDICTED: xyloglucan endotransglucosylase/h...    323   7e-105   
ref|XP_011082922.1|  PREDICTED: xyloglucan endotransglucosylase/h...    323   8e-105   
gb|ABD96609.1|  xyloglucan endotransglucosylase XET3                    323   2e-104   Capsicum annuum
ref|XP_008229404.1|  PREDICTED: brassinosteroid-regulated protein...    323   2e-104   
ref|XP_011082923.1|  PREDICTED: xyloglucan endotransglucosylase/h...    322   2e-104   
gb|ABD96607.1|  xyloglucan endotransglucosylase XET1                    322   2e-104   Capsicum annuum
gb|ABD96608.1|  xyloglucan endotransglucosylase XET2                    322   3e-104   Capsicum annuum
ref|XP_010536006.1|  PREDICTED: xyloglucan endotransglucosylase/h...    322   5e-104   
ref|XP_004303859.1|  PREDICTED: probable xyloglucan endotransgluc...    322   5e-104   
ref|XP_011082925.1|  PREDICTED: xyloglucan endotransglucosylase/h...    322   5e-104   
gb|EYU31577.1|  hypothetical protein MIMGU_mgv1a011275mg                321   8e-104   
ref|XP_008229403.1|  PREDICTED: brassinosteroid-regulated protein...    321   8e-104   
gb|EYU31576.1|  hypothetical protein MIMGU_mgv1a011220mg                321   1e-103   
ref|XP_007215791.1|  hypothetical protein PRUPE_ppa009863mg             319   2e-103   
ref|XP_010102170.1|  putative xyloglucan endotransglucosylase/hyd...    320   3e-103   
ref|XP_004303862.1|  PREDICTED: probable xyloglucan endotransgluc...    319   5e-103   
ref|XP_006366771.1|  PREDICTED: probable xyloglucan endotransgluc...    319   6e-103   
gb|EPS58668.1|  hypothetical protein M569_16144                         318   1e-102   
ref|NP_001281066.1|  brassinosteroid-regulated protein BRU1-like ...    318   1e-102   
ref|XP_009356634.1|  PREDICTED: brassinosteroid-regulated protein...    318   2e-102   
ref|NP_001234213.1|  xyloglucan endo-transglycosylase precursor         317   2e-102   
gb|ACD03217.1|  xyloglucan endotransglucosylase/hydrolase 7             317   3e-102   Actinidia deliciosa [Chinese gooseberry]
ref|XP_002306736.2|  xyloglucan endo-1 family protein                   317   4e-102   Populus trichocarpa [western balsam poplar]
ref|XP_009356637.1|  PREDICTED: brassinosteroid-regulated protein...    317   6e-102   
ref|XP_008341405.1|  PREDICTED: brassinosteroid-regulated protein...    317   6e-102   
gb|AAR37363.1|  xyloglucan endo-transglycosylase                        315   9e-102   Nicotiana attenuata
ref|XP_008229401.1|  PREDICTED: brassinosteroid-regulated protein...    315   1e-101   
ref|XP_009356635.1|  PREDICTED: probable xyloglucan endotransgluc...    314   2e-101   
ref|XP_011082924.1|  PREDICTED: xyloglucan endotransglucosylase/h...    315   3e-101   
gb|EYU29581.1|  hypothetical protein MIMGU_mgv1a022262mg                314   3e-101   
ref|NP_001274880.1|  probable xyloglucan endotransglucosylase/hyd...    313   6e-101   
ref|XP_011044805.1|  PREDICTED: brassinosteroid-regulated protein...    315   7e-101   
gb|EYU29580.1|  hypothetical protein MIMGU_mgv1a018934mg                313   7e-101   
ref|XP_004303861.1|  PREDICTED: probable xyloglucan endotransgluc...    313   9e-101   
ref|NP_001234207.1|  xyloglycan endo-transglycosylase precursor         313   1e-100   
ref|XP_011044804.1|  PREDICTED: brassinosteroid-regulated protein...    313   1e-100   
ref|XP_007215773.1|  hypothetical protein PRUPE_ppa009608mg             312   2e-100   
ref|XP_008229405.1|  PREDICTED: brassinosteroid-regulated protein...    312   2e-100   
ref|XP_009597028.1|  PREDICTED: brassinosteroid-regulated protein...    312   4e-100   
ref|XP_007217342.1|  hypothetical protein PRUPE_ppa020825mg             310   4e-100   
ref|XP_009356633.1|  PREDICTED: brassinosteroid-regulated protein...    311   8e-100   
ref|XP_008229400.1|  PREDICTED: brassinosteroid-regulated protein...    310   1e-99    
emb|CDP15955.1|  unnamed protein product                                310   2e-99    
ref|XP_008348360.1|  PREDICTED: brassinosteroid-regulated protein...    310   2e-99    
ref|XP_009356638.1|  PREDICTED: brassinosteroid-regulated protein...    310   2e-99    
ref|XP_008229402.1|  PREDICTED: brassinosteroid-regulated protein...    309   3e-99    
ref|XP_006387415.1|  xyloglucan endo-1 family protein                   308   3e-99    
ref|XP_009377621.1|  PREDICTED: brassinosteroid-regulated protein...    309   4e-99    
ref|XP_009127941.1|  PREDICTED: xyloglucan endotransglucosylase/h...    309   4e-99    
ref|XP_011082930.1|  PREDICTED: probable xyloglucan endotransgluc...    308   5e-99    
ref|NP_001280908.1|  brassinosteroid-regulated protein BRU1-like ...    308   7e-99    
emb|CDX68640.1|  BnaC01g08130D                                          308   9e-99    
ref|XP_011016785.1|  PREDICTED: probable xyloglucan endotransgluc...    308   9e-99    
ref|XP_010525737.1|  PREDICTED: xyloglucan endotransglucosylase/h...    308   9e-99    
ref|XP_009377610.1|  PREDICTED: brassinosteroid-regulated protein...    307   2e-98    
ref|XP_011026280.1|  PREDICTED: probable xyloglucan endotransgluc...    307   2e-98    
ref|XP_011016106.1|  PREDICTED: brassinosteroid-regulated protein...    306   3e-98    
gb|AFR46576.1|  xyloglucan endotransglucosylase/hydrolase 7             305   4e-98    
ref|XP_010525736.1|  PREDICTED: xyloglucan endotransglucosylase/h...    306   4e-98    
ref|XP_008449516.1|  PREDICTED: brassinosteroid-regulated protein...    306   6e-98    
gb|EYU37336.1|  hypothetical protein MIMGU_mgv1a021219mg                305   7e-98    
ref|XP_009108993.1|  PREDICTED: xyloglucan endotransglucosylase/h...    305   7e-98    
gb|AFR46580.2|  xyloglucan endotransglucosylase/hydrolase 12            305   1e-97    
ref|XP_006412723.1|  hypothetical protein EUTSA_v10025933mg             305   1e-97    
ref|XP_007217276.1|  hypothetical protein PRUPE_ppa017487mg             304   1e-97    
ref|XP_002321087.1|  brassinosteroid-regulated family protein           305   2e-97    Populus trichocarpa [western balsam poplar]
ref|XP_002520387.1|  Brassinosteroid-regulated protein BRU1 precu...    305   2e-97    Ricinus communis
ref|XP_002302146.2|  xyloglucan endo-1 family protein                   305   2e-97    Populus trichocarpa [western balsam poplar]
ref|XP_007211780.1|  hypothetical protein PRUPE_ppa009685mg             304   2e-97    
ref|XP_002317310.1|  xyloglucan endo-1 family protein                   305   3e-97    Populus trichocarpa [western balsam poplar]
ref|XP_007215793.1|  hypothetical protein PRUPE_ppa009871mg             303   4e-97    
ref|XP_009417169.1|  PREDICTED: probable xyloglucan endotransgluc...    303   4e-97    
ref|XP_006280918.1|  hypothetical protein CARUB_v10026914mg             303   4e-97    
ref|XP_008225386.1|  PREDICTED: brassinosteroid-regulated protein...    303   6e-97    
ref|XP_008362366.1|  PREDICTED: LOW QUALITY PROTEIN: xyloglucan e...    303   6e-97    
ref|XP_006412727.1|  hypothetical protein EUTSA_v10025941mg             303   7e-97    
ref|XP_002270973.2|  PREDICTED: brassinosteroid-regulated protein...    303   7e-97    Vitis vinifera
gb|AEX07595.1|  xyloglucosyl transferase 2                              302   7e-97    
ref|XP_011006106.1|  PREDICTED: brassinosteroid-regulated protein...    303   8e-97    
gb|AFR46575.1|  xyloglucan endotransglucosylase/hydrolase 6             303   9e-97    
ref|XP_011082928.1|  PREDICTED: probable xyloglucan endotransgluc...    302   1e-96    
gb|EYU41110.1|  hypothetical protein MIMGU_mgv1a011456mg                302   1e-96    
ref|XP_010677921.1|  PREDICTED: probable xyloglucan endotransgluc...    302   1e-96    
ref|XP_010677922.1|  PREDICTED: probable xyloglucan endotransgluc...    302   1e-96    
ref|XP_009356706.1|  PREDICTED: xyloglucan endotransglucosylase/h...    303   1e-96    
ref|NP_001284443.1|  probable xyloglucan endotransglucosylase/hyd...    302   1e-96    
ref|XP_010442224.1|  PREDICTED: xyloglucan endotransglucosylase/h...    302   2e-96    
gb|KFK27295.1|  hypothetical protein AALP_AA8G363900                    302   2e-96    
ref|XP_010482054.1|  PREDICTED: xyloglucan endotransglucosylase/h...    302   2e-96    
ref|XP_011045332.1|  PREDICTED: brassinosteroid-regulated protein...    302   2e-96    
ref|XP_010439278.1|  PREDICTED: xyloglucan endotransglucosylase/h...    302   2e-96    
ref|XP_010681689.1|  PREDICTED: brassinosteroid-regulated protein...    302   2e-96    
ref|NP_193149.2|  probable xyloglucan endotransglucosylase/hydrol...    302   2e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008796499.1|  PREDICTED: xyloglucan endotransglucosylase/h...    301   3e-96    
gb|ABM91071.1|  xyloglucan endotransglycosylase/hydrolase precurs...    301   4e-96    Populus tremula x Populus tremuloides
ref|XP_004303860.1|  PREDICTED: probable xyloglucan endotransgluc...    301   4e-96    
ref|XP_010450105.1|  PREDICTED: probable xyloglucan endotransgluc...    301   5e-96    
ref|XP_010435185.1|  PREDICTED: probable xyloglucan endotransgluc...    301   5e-96    
ref|XP_010440528.1|  PREDICTED: probable xyloglucan endotransgluc...    301   5e-96    
ref|XP_004140250.1|  PREDICTED: probable xyloglucan endotransgluc...    301   6e-96    
gb|AGI42452.1|  xyloglucan endotransglycosylase/hydrolase               301   7e-96    
ref|XP_004164863.1|  PREDICTED: brassinosteroid-regulated protein...    300   8e-96    
ref|XP_002520388.1|  Brassinosteroid-regulated protein BRU1 precu...    300   8e-96    Ricinus communis
ref|XP_009378317.1|  PREDICTED: xyloglucan endotransglucosylase/h...    301   8e-96    
gb|KGN47997.1|  hypothetical protein Csa_6G423390                       300   9e-96    
ref|XP_004293654.1|  PREDICTED: probable xyloglucan endotransgluc...    301   1e-95    
ref|XP_010443442.1|  PREDICTED: xyloglucan endotransglucosylase/h...    300   1e-95    
ref|NP_200564.1|  xyloglucan endotransglucosylase/hydrolase prote...    300   1e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004140252.1|  PREDICTED: brassinosteroid-regulated protein...    300   1e-95    
ref|XP_010452475.1|  PREDICTED: xyloglucan endotransglucosylase/h...    300   1e-95    
ref|XP_006401194.1|  hypothetical protein EUTSA_v10014326mg             300   1e-95    
ref|XP_010676725.1|  PREDICTED: probable xyloglucan endotransgluc...    300   2e-95    
ref|NP_001284418.1|  brassinosteroid-regulated protein BRU1-like ...    300   2e-95    
ref|XP_002863854.1|  ATXTH20                                            299   2e-95    
gb|AGI42451.1|  xyloglucan endotransglycosylase/hydrolase               300   2e-95    
ref|XP_008449531.1|  PREDICTED: brassinosteroid-regulated protein...    300   2e-95    
gb|AGI42460.1|  xyloglucan endotransglycosylase/hydrolase               300   2e-95    
gb|KHG09063.1|  Xyloglucan endotransglucosylase/hydrolase 22 -lik...    300   2e-95    
gb|AFP93557.1|  xyloglucan endotransglycosylase/hydrolase 1             299   2e-95    
ref|XP_002868312.1|  hypothetical protein ARALYDRAFT_493497             300   2e-95    
ref|XP_004164865.1|  PREDICTED: brassinosteroid-regulated protein...    300   2e-95    
gb|AGI42449.1|  xyloglucan endotransglycosylase/hydrolase               299   2e-95    
ref|XP_006284242.1|  hypothetical protein CARUB_v10005405mg             299   2e-95    
ref|XP_002267890.2|  PREDICTED: brassinosteroid-regulated protein...    299   2e-95    Vitis vinifera
ref|XP_004164862.1|  PREDICTED: brassinosteroid-regulated protein...    299   3e-95    
gb|AGI42456.1|  xyloglucan endotransglycosylase/hydrolase               299   3e-95    
emb|CAB10192.1|  xyloglucan endotransglycosylase-related protein ...    299   3e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009108100.1|  PREDICTED: probable xyloglucan endotransgluc...    299   3e-95    
ref|XP_008449536.1|  PREDICTED: brassinosteroid-regulated protein...    299   3e-95    
ref|XP_002866213.1|  hypothetical protein ARALYDRAFT_918931             299   3e-95    
ref|XP_009137907.1|  PREDICTED: xyloglucan endotransglucosylase/h...    298   3e-95    
ref|XP_010668001.1|  PREDICTED: probable xyloglucan endotransgluc...    299   4e-95    
ref|XP_006279674.1|  hypothetical protein CARUB_v10026912mg             298   6e-95    
ref|XP_009120272.1|  PREDICTED: xyloglucan endotransglucosylase/h...    298   7e-95    
gb|KFK24577.1|  hypothetical protein AALP_AAs45078U000600               298   7e-95    
gb|AGI42458.1|  xyloglucan endotransglycosylase/hydrolase               298   7e-95    
gb|AEQ37175.1|  xyloglucan endotransglucosylase/hydrolase               298   8e-95    
emb|CDY27126.1|  BnaA08g07640D                                          298   9e-95    
ref|XP_006425209.1|  hypothetical protein CICLE_v10010858mg             297   1e-94    
gb|KDO46534.1|  hypothetical protein CISIN_1g023431mg                   297   1e-94    
gb|AGI42450.1|  xyloglucan endotransglycosylase/hydrolase               297   1e-94    
ref|XP_008380219.1|  PREDICTED: xyloglucan endotransglucosylase/h...    298   1e-94    
gb|KCW89706.1|  hypothetical protein EUGRSUZ_A01968                     299   1e-94    
gb|KHN22714.1|  Putative xyloglucan endotransglucosylase/hydrolas...    297   1e-94    
ref|XP_010053241.1|  PREDICTED: brassinosteroid-regulated protein...    297   1e-94    
emb|CCH26408.1|  xyloglucan endotransglycosylase                        297   1e-94    
ref|NP_199618.1|  xyloglucan endotransglucosylase/hydrolase prote...    297   1e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010053265.1|  PREDICTED: probable xyloglucan endotransgluc...    297   1e-94    
gb|AGI42454.1|  xyloglucan endotransglycosylase/hydrolase               297   1e-94    
ref|XP_009120273.1|  PREDICTED: xyloglucan endotransglucosylase/h...    297   1e-94    
ref|XP_008449534.1|  PREDICTED: brassinosteroid-regulated protein...    297   2e-94    
ref|XP_011026281.1|  PREDICTED: brassinosteroid-regulated protein...    297   2e-94    
ref|XP_002268708.1|  PREDICTED: brassinosteroid-regulated protein...    297   2e-94    Vitis vinifera
gb|KCW89704.1|  hypothetical protein EUGRSUZ_A01966                     296   2e-94    
ref|NP_001242530.1|  uncharacterized protein LOC100785313 precursor     297   2e-94    
ref|XP_007025220.1|  Xyloglucan endotransglucosylase/hydrolase 16       297   2e-94    
ref|XP_010690581.1|  PREDICTED: probable xyloglucan endotransgluc...    296   2e-94    
ref|NP_001267702.1|  probable xyloglucan endotransglucosylase/hyd...    296   2e-94    
gb|KFK29589.1|  hypothetical protein AALP_AA7G154000                    296   3e-94    
gb|AGI42459.1|  xyloglucan endotransglycosylase/hydrolase               296   3e-94    
gb|KGN47998.1|  hypothetical protein Csa_6G423400                       296   3e-94    
gb|AGI42461.1|  xyloglucan endotransglycosylase/hydrolase               296   3e-94    
gb|EYU29578.1|  hypothetical protein MIMGU_mgv1a011198mg                296   4e-94    
emb|CDX72228.1|  BnaC07g42500D                                          296   4e-94    
ref|XP_009373581.1|  PREDICTED: brassinosteroid-regulated protein...    296   4e-94    
ref|XP_010446167.1|  PREDICTED: probable xyloglucan endotransgluc...    296   4e-94    
ref|XP_007163801.1|  hypothetical protein PHAVU_001G265300g             296   4e-94    
gb|KFK27294.1|  hypothetical protein AALP_AA8G363800                    296   5e-94    
ref|XP_009413334.1|  PREDICTED: xyloglucan endotransglucosylase/h...    295   6e-94    
gb|KDP35747.1|  hypothetical protein JCGZ_10519                         295   6e-94    
gb|KDO46535.1|  hypothetical protein CISIN_1g023581mg                   295   6e-94    
ref|XP_009381589.1|  PREDICTED: xyloglucan endotransglucosylase/h...    295   7e-94    
gb|AEX07596.1|  xyloglucosyl transferase 1                              295   7e-94    
ref|XP_011082931.1|  PREDICTED: probable xyloglucan endotransgluc...    295   8e-94    
ref|XP_011024784.1|  PREDICTED: brassinosteroid-regulated protein...    295   8e-94    
ref|XP_007221284.1|  hypothetical protein PRUPE_ppa009792mg             295   8e-94    
gb|ACD03218.1|  xyloglucan endotransglucosylase/hydrolase 8             295   9e-94    Actinidia deliciosa [Chinese gooseberry]
ref|XP_006414798.1|  hypothetical protein EUTSA_v10025705mg             296   1e-93    
ref|XP_002301752.1|  brassinosteroid-regulated family protein           295   1e-93    Populus trichocarpa [western balsam poplar]
gb|ABM91075.1|  xyloglucan endotransglycosylase/hydrolase precurs...    295   1e-93    Populus tremula x Populus tremuloides
ref|XP_006474161.1|  PREDICTED: probable xyloglucan endotransgluc...    295   2e-93    
gb|KDP33066.1|  hypothetical protein JCGZ_13603                         294   2e-93    
gb|KFK35964.1|  xyloglucan:xyloglucosyl transferase                     295   2e-93    
ref|XP_007034180.1|  Xyloglucan endotransglucosylase/hydrolase 16       295   2e-93    
gb|EYU38970.1|  hypothetical protein MIMGU_mgv1a011611mg                294   2e-93    
ref|XP_008222773.1|  PREDICTED: brassinosteroid-regulated protein...    294   3e-93    
gb|EYU29579.1|  hypothetical protein MIMGU_mgv1a018742mg                293   3e-93    
gb|ABK30789.1|  xyloglucan endotransglycosylase 3                       293   3e-93    Litchi chinensis [litchi]
ref|XP_010927056.1|  PREDICTED: probable xyloglucan endotransgluc...    293   3e-93    
ref|XP_011043991.1|  PREDICTED: xyloglucan endotransglucosylase/h...    294   3e-93    
gb|KDP36434.1|  hypothetical protein JCGZ_08703                         294   3e-93    
ref|XP_010927058.1|  PREDICTED: probable xyloglucan endotransgluc...    294   3e-93    
ref|XP_010433588.1|  PREDICTED: probable xyloglucan endotransgluc...    293   4e-93    
ref|XP_009793860.1|  PREDICTED: probable xyloglucan endotransgluc...    293   4e-93    
emb|CDP02962.1|  unnamed protein product                                293   5e-93    
emb|CAA63663.1|  xyloglucan endotransglycosylase (XET)                  293   5e-93    Hordeum vulgare [barley]
ref|XP_010246961.1|  PREDICTED: brassinosteroid-regulated protein...    293   6e-93    
gb|AFK33604.1|  unknown                                                 293   6e-93    
ref|XP_010911439.1|  PREDICTED: probable xyloglucan endotransgluc...    293   7e-93    
dbj|BAJ10423.1|  xyloglucan endotransglucosylase/hydrolase              293   7e-93    
gb|KHN17579.1|  Putative xyloglucan endotransglucosylase/hydrolas...    293   7e-93    
ref|XP_006474633.1|  PREDICTED: probable xyloglucan endotransgluc...    293   8e-93    
ref|XP_010545425.1|  PREDICTED: probable xyloglucan endotransgluc...    293   9e-93    
gb|AAT94297.1|  endotransglucosylase/hydrolase XTH5                     293   9e-93    Triticum aestivum [Canadian hard winter wheat]
dbj|BAD93484.1|  pollen major allergen No.121 isoform 1                 292   9e-93    Cryptomeria japonica
ref|XP_002867357.1|  ATXTH18/XTH18                                      292   9e-93    
ref|XP_006453413.1|  hypothetical protein CICLE_v10008951mg             293   1e-92    
gb|EMT27816.1|  Putative xyloglucan endotransglucosylase/hydrolas...    292   1e-92    
gb|AII99393.1|  xyloglucan endotransglucosylase/hydrolase2              292   1e-92    
emb|CDY66832.1|  BnaAnng23050D                                          292   1e-92    
ref|XP_010676747.1|  PREDICTED: probable xyloglucan endotransgluc...    292   1e-92    
gb|AII99392.1|  xyloglucan endotransglucosylase/hydrolase2              292   1e-92    
ref|XP_002438935.1|  hypothetical protein SORBIDRAFT_10g028570          292   1e-92    Sorghum bicolor [broomcorn]
ref|XP_009360814.1|  PREDICTED: brassinosteroid-regulated protein...    293   1e-92    
ref|XP_003601714.1|  Xyloglucan endotransglycosylase/hydrolase XT...    292   1e-92    
ref|XP_003601713.1|  Xyloglucan endotransglycosylase/hydrolase XT...    292   1e-92    
ref|XP_010243150.1|  PREDICTED: brassinosteroid-regulated protein...    292   1e-92    
ref|XP_010673331.1|  PREDICTED: brassinosteroid-regulated protein...    293   1e-92    
ref|XP_004293370.1|  PREDICTED: probable xyloglucan endotransgluc...    292   1e-92    
ref|XP_009343827.1|  PREDICTED: brassinosteroid-regulated protein...    291   2e-92    
ref|XP_009121735.1|  PREDICTED: probable xyloglucan endotransgluc...    292   2e-92    
ref|XP_003563483.1|  PREDICTED: xyloglucan endotransglucosylase/h...    292   2e-92    
ref|XP_008380453.1|  PREDICTED: brassinosteroid-regulated protein...    291   2e-92    
gb|KHN44468.1|  Brassinosteroid-regulated protein BRU1                  291   2e-92    
gb|KDO46531.1|  hypothetical protein CISIN_1g045763mg                   291   2e-92    
ref|XP_009759293.1|  PREDICTED: xyloglucan endotransglucosylase/h...    291   2e-92    
ref|XP_010927057.1|  PREDICTED: probable xyloglucan endotransgluc...    291   2e-92    
ref|XP_004298224.1|  PREDICTED: brassinosteroid-regulated protein...    295   2e-92    
ref|NP_176710.1|  probable xyloglucan endotransglucosylase/hydrol...    291   2e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003549488.1|  PREDICTED: probable xyloglucan endotransgluc...    291   2e-92    
ref|XP_010670334.1|  PREDICTED: probable xyloglucan endotransgluc...    291   2e-92    
gb|AAB18364.1|  xyloglucan endotransglycosylase-related protein         291   2e-92    Arabidopsis thaliana [mouse-ear cress]
emb|CDY14905.1|  BnaA02g22470D                                          291   3e-92    
emb|CDY61576.1|  BnaCnng38050D                                          291   3e-92    
ref|XP_006453403.1|  hypothetical protein CICLE_v10010760mg             291   3e-92    
ref|XP_008801539.1|  PREDICTED: probable xyloglucan endotransgluc...    291   3e-92    
ref|NP_568859.2|  probable xyloglucan endotransglucosylase/hydrol...    291   3e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010681690.1|  PREDICTED: brassinosteroid-regulated protein...    291   3e-92    
ref|XP_006656424.1|  PREDICTED: xyloglucan endotransglucosylase/h...    291   3e-92    
ref|XP_002888396.1|  ATXTH17                                            291   4e-92    
ref|XP_003552612.1|  PREDICTED: brassinosteroid-regulated protein...    291   4e-92    
emb|CDY03539.1|  BnaC03g67980D                                          292   4e-92    
ref|XP_002866212.1|  hypothetical protein ARALYDRAFT_495853             291   4e-92    
emb|CDY39193.1|  BnaA03g50050D                                          290   4e-92    
ref|XP_006474159.1|  PREDICTED: xyloglucan endotransglucosylase/h...    291   5e-92    
ref|XP_008453618.1|  PREDICTED: probable xyloglucan endotransgluc...    293   5e-92    
ref|XP_009765042.1|  PREDICTED: brassinosteroid-regulated protein...    290   5e-92    
ref|NP_001267579.1|  probable xyloglucan endotransglucosylase/hyd...    291   5e-92    
ref|XP_002867358.1|  meristem-5                                         290   5e-92    
ref|NP_001276167.1|  uncharacterized protein LOC100784191 precursor     290   5e-92    
ref|XP_009628113.1|  PREDICTED: brassinosteroid-regulated protein...    290   6e-92    
ref|NP_194311.1|  probable xyloglucan endotransglucosylase/hydrol...    290   6e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011007582.1|  PREDICTED: probable xyloglucan endotransgluc...    290   7e-92    
ref|XP_002519768.1|  Brassinosteroid-regulated protein BRU1 precu...    290   7e-92    Ricinus communis
gb|AAF80591.1|AF223420_1  xyloglucan endotransglycosylase XET2          290   7e-92    Asparagus officinalis
ref|XP_010023598.1|  PREDICTED: brassinosteroid-regulated protein...    290   8e-92    
gb|AEL33281.1|  brassinosteroid-regulated protein                       290   8e-92    
ref|XP_010673363.1|  PREDICTED: brassinosteroid-regulated protein...    290   8e-92    
ref|XP_003610142.1|  Xyloglucan endotransglucosylase/hydrolase          290   8e-92    
ref|XP_010512813.1|  PREDICTED: probable xyloglucan endotransgluc...    290   9e-92    
ref|XP_010259797.1|  PREDICTED: xyloglucan endotransglucosylase/h...    290   9e-92    
ref|XP_011007580.1|  PREDICTED: probable xyloglucan endotransgluc...    290   1e-91    
ref|NP_001058455.2|  Os06g0696400                                       289   1e-91    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010447742.1|  PREDICTED: probable xyloglucan endotransgluc...    290   1e-91    
ref|XP_003524918.1|  PREDICTED: brassinosteroid-regulated protein...    290   1e-91    
dbj|BAE06063.1|  xyloglucan endotransglucosylase/hydrolase              290   1e-91    
ref|XP_010042670.1|  PREDICTED: brassinosteroid-regulated protein...    290   1e-91    
gb|KHF98175.1|  putative xyloglucan endotransglucosylase/hydrolas...    290   1e-91    
ref|XP_002869654.1|  hypothetical protein ARALYDRAFT_354208             290   1e-91    
ref|XP_010525738.1|  PREDICTED: xyloglucan endotransglucosylase/h...    289   1e-91    
ref|XP_006413268.1|  hypothetical protein EUTSA_v10025720mg             291   1e-91    
ref|XP_010047002.1|  PREDICTED: probable xyloglucan endotransgluc...    290   2e-91    
gb|EYU25733.1|  hypothetical protein MIMGU_mgv1a011641mg                289   2e-91    
dbj|BAO57276.1|  xyloglucan endotransglucosylase/hydrolase              289   2e-91    
ref|NP_194756.1|  xyloglucan endotransglucosylase/hydrolase prote...    289   2e-91    
ref|XP_006387118.1|  hypothetical protein POPTR_1795s00200g             286   2e-91    
ref|XP_010536923.1|  PREDICTED: probable xyloglucan endotransgluc...    289   2e-91    
ref|XP_002324480.1|  xyloglucan endo-1 family protein                   289   2e-91    
ref|XP_006474158.1|  PREDICTED: xyloglucan endotransglucosylase/h...    289   2e-91    
ref|XP_007014179.1|  Xyloglucan endotransglycosylase 6 isoform 1        289   2e-91    
ref|XP_006474156.1|  PREDICTED: probable xyloglucan endotransgluc...    289   2e-91    
ref|XP_010438196.1|  PREDICTED: probable xyloglucan endotransgluc...    289   2e-91    
ref|XP_002883457.1|  hypothetical protein ARALYDRAFT_479888             289   2e-91    
ref|XP_002267838.1|  PREDICTED: brassinosteroid-regulated protein...    289   2e-91    
gb|AAL32550.1|  xyloglucan endo-1, 4-beta-D-glucanase (XTR-6)           289   2e-91    
ref|XP_006284247.1|  hypothetical protein CARUB_v10005412mg             289   2e-91    
ref|XP_009798276.1|  PREDICTED: xyloglucan endotransglucosylase/h...    289   3e-91    
emb|CDY25904.1|  BnaC09g32760D                                          289   3e-91    
ref|NP_001105367.1|  xyloglucan endotransglycosylase homolog1 pre...    288   3e-91    
ref|XP_010447741.1|  PREDICTED: probable xyloglucan endotransgluc...    288   3e-91    
ref|XP_006381821.1|  xyloglucan endo-1 family protein                   289   3e-91    
ref|XP_011045330.1|  PREDICTED: brassinosteroid-regulated protein...    288   3e-91    
gb|ADV41673.1|  endo-xyloglucan transferase                             288   3e-91    
ref|XP_008801540.1|  PREDICTED: probable xyloglucan endotransgluc...    288   3e-91    
ref|XP_004966139.1|  PREDICTED: probable xyloglucan endotransgluc...    289   3e-91    
ref|XP_010483277.1|  PREDICTED: LOW QUALITY PROTEIN: probable xyl...    288   4e-91    
ref|XP_002317309.1|  xyloglucan endo-1 family protein                   288   4e-91    
ref|XP_010466730.1|  PREDICTED: probable xyloglucan endotransgluc...    288   4e-91    
ref|XP_002302145.2|  hypothetical protein POPTR_0002s06120g             291   4e-91    
ref|XP_010448365.1|  PREDICTED: probable xyloglucan endotransgluc...    288   4e-91    
ref|XP_008801408.1|  PREDICTED: probable xyloglucan endotransgluc...    288   4e-91    
ref|XP_010259800.1|  PREDICTED: probable xyloglucan endotransgluc...    290   5e-91    
ref|XP_008223658.1|  PREDICTED: probable xyloglucan endotransgluc...    288   5e-91    
dbj|BAJ10395.1|  xyloglucan endotransglucosylase/hydrolase              288   5e-91    
emb|CAN80251.1|  hypothetical protein VITISV_036641                     288   6e-91    
ref|XP_002526228.1|  Xyloglucan endotransglucosylase/hydrolase pr...    288   6e-91    
ref|XP_010438197.1|  PREDICTED: xyloglucan endotransglucosylase/h...    287   6e-91    
ref|XP_009798277.1|  PREDICTED: probable xyloglucan endotransgluc...    288   6e-91    
gb|KFK27296.1|  hypothetical protein AALP_AA8G364000                    288   6e-91    
ref|XP_010433006.1|  PREDICTED: xyloglucan endotransglucosylase/h...    287   6e-91    
ref|XP_010433003.1|  PREDICTED: probable xyloglucan endotransgluc...    288   7e-91    
ref|XP_006474155.1|  PREDICTED: probable xyloglucan endotransgluc...    288   7e-91    
ref|NP_001238152.1|  xyloglucan endotransglucosylase/hydrolase 2 ...    288   7e-91    
ref|XP_002274601.1|  PREDICTED: probable xyloglucan endotransgluc...    288   7e-91    
ref|XP_010438195.1|  PREDICTED: probable xyloglucan endotransgluc...    287   8e-91    
ref|XP_011018193.1|  PREDICTED: probable xyloglucan endotransgluc...    288   8e-91    
ref|XP_006453420.1|  hypothetical protein CICLE_v10008778mg             290   9e-91    
ref|XP_002274404.1|  PREDICTED: brassinosteroid-regulated protein...    288   9e-91    
ref|NP_566738.1|  xyloglucan endotransglucosylase/hydrolase prote...    288   9e-91    
ref|XP_010932220.1|  PREDICTED: xyloglucan endotransglucosylase/h...    287   9e-91    
ref|XP_008229406.1|  PREDICTED: probable xyloglucan endotransgluc...    288   9e-91    
gb|AAQ82628.1|  xyloglucan endotransglucosylase                         287   1e-90    
gb|AAM63080.1|  xyloglucan endo-1,4-beta-D-glucanase precursor          287   1e-90    
gb|EYU20916.1|  hypothetical protein MIMGU_mgv1a011962mg                286   1e-90    
gb|ABE11608.1|  xyloglucan endo-transglycosylase precursor              287   1e-90    
ref|XP_002526229.1|  conserved hypothetical protein                     287   1e-90    
ref|XP_004966138.1|  PREDICTED: probable xyloglucan endotransgluc...    287   1e-90    
ref|XP_010667998.1|  PREDICTED: probable xyloglucan endotransgluc...    287   1e-90    
ref|XP_010259803.1|  PREDICTED: probable xyloglucan endotransgluc...    287   1e-90    
gb|ABP04059.1|  xyloglucan endo-transglucosylase/hydrolase 1            287   1e-90    
ref|XP_006358761.1|  PREDICTED: brassinosteroid-regulated protein...    287   1e-90    
ref|XP_006285734.1|  hypothetical protein CARUB_v10007207mg             287   1e-90    
gb|AFW69274.1|  Xyloglucan endo-transglycosylase Xyloglucan endot...    290   1e-90    
gb|KFK29591.1|  hypothetical protein AALP_AA7G154200                    287   1e-90    
gb|KDP36430.1|  hypothetical protein JCGZ_08699                         287   2e-90    
ref|XP_006453421.1|  hypothetical protein CICLE_v10009118mg             287   2e-90    
gb|KDP21183.1|  hypothetical protein JCGZ_21654                         286   2e-90    
ref|XP_010536922.1|  PREDICTED: probable xyloglucan endotransgluc...    287   2e-90    
ref|XP_011043998.1|  PREDICTED: probable xyloglucan endotransgluc...    287   2e-90    
ref|XP_004507837.1|  PREDICTED: probable xyloglucan endotransgluc...    287   2e-90    
ref|XP_006453414.1|  hypothetical protein CICLE_v10009119mg             286   2e-90    
ref|XP_011069899.1|  PREDICTED: probable xyloglucan endotransgluc...    287   2e-90    
ref|XP_009102589.1|  PREDICTED: probable xyloglucan endotransgluc...    287   2e-90    
gb|ACU23820.1|  unknown                                                 286   2e-90    
ref|XP_010259798.1|  PREDICTED: probable xyloglucan endotransgluc...    287   2e-90    
ref|XP_011044000.1|  PREDICTED: probable xyloglucan endotransgluc...    287   2e-90    
ref|XP_011043999.1|  PREDICTED: probable xyloglucan endotransgluc...    286   2e-90    
ref|XP_010670335.1|  PREDICTED: probable xyloglucan endotransgluc...    287   2e-90    
ref|XP_006474154.1|  PREDICTED: probable xyloglucan endotransgluc...    286   2e-90    
ref|XP_003542166.1|  PREDICTED: xyloglucan endotransglucosylase/h...    286   2e-90    
gb|KDP32580.1|  hypothetical protein JCGZ_13130                         286   2e-90    
ref|XP_011045331.1|  PREDICTED: brassinosteroid-regulated protein...    286   2e-90    
ref|XP_002324481.2|  xyloglucan endo-1 family protein                   286   2e-90    
ref|XP_007014183.1|  Xyloglucan endotransglycosylase 6                  287   2e-90    
ref|XP_010532726.1|  PREDICTED: probable xyloglucan endotransgluc...    286   2e-90    
gb|AAM61021.1|  xyloglucan endotransglycosylase, putative               286   2e-90    
dbj|BAE06064.1|  xyloglucan endotransglucosylase/hydrolase              286   2e-90    
ref|XP_007014172.1|  Xyloglucan endotransglucosylase/hydrolase fa...    286   3e-90    
ref|XP_004247897.1|  PREDICTED: brassinosteroid-regulated protein...    286   3e-90    
ref|XP_002266082.1|  PREDICTED: brassinosteroid-regulated protein...    286   3e-90    
gb|AIJ10712.1|  xyloglucan endotransglucosylase/hydrolase 3             286   3e-90    
ref|XP_002318936.2|  putative xyloglucan endotransglycosylase fam...    287   3e-90    
gb|AIC66436.1|  putative xyloglucan endotransglucosylase/hydrolas...    286   3e-90    
ref|XP_003630685.1|  Xyloglucan endotransglycosylase                    285   3e-90    
gb|KFK29593.1|  hypothetical protein AALP_AA7G154400                    286   3e-90    
ref|XP_010929301.1|  PREDICTED: xyloglucan endotransglucosylase/h...    286   3e-90    
emb|CDX72231.1|  BnaC07g42530D                                          286   4e-90    
ref|XP_009137909.1|  PREDICTED: probable xyloglucan endotransgluc...    286   4e-90    
ref|XP_010488450.1|  PREDICTED: probable xyloglucan endotransgluc...    286   4e-90    
ref|XP_010046997.1|  PREDICTED: probable xyloglucan endotransgluc...    286   4e-90    
gb|ACD03232.1|  xyloglucan endotransglucosylase/hydrolase 8             286   4e-90    
ref|XP_008799439.1|  PREDICTED: probable xyloglucan endotransgluc...    286   5e-90    
ref|NP_194757.1|  probable xyloglucan endotransglucosylase/hydrol...    285   5e-90    
ref|XP_006298237.1|  hypothetical protein CARUB_v10014298mg             286   5e-90    
ref|XP_010656825.1|  PREDICTED: probable xyloglucan endotransgluc...    285   5e-90    
ref|XP_011038986.1|  PREDICTED: probable xyloglucan endotransgluc...    286   5e-90    
ref|XP_006453415.1|  hypothetical protein CICLE_v10010412mg             285   6e-90    
ref|XP_007014165.1|  Xyloglucan endotransglucosylase/hydrolase fa...    285   6e-90    
ref|XP_004252976.1|  PREDICTED: brassinosteroid-regulated protein...    285   6e-90    
emb|CAN83588.1|  hypothetical protein VITISV_004806                     285   6e-90    
ref|XP_004305828.1|  PREDICTED: xyloglucan endotransglucosylase/h...    290   7e-90    
emb|CAN74784.1|  hypothetical protein VITISV_032594                     285   7e-90    
ref|XP_004242687.1|  PREDICTED: probable xyloglucan endotransgluc...    285   7e-90    
ref|XP_010433005.1|  PREDICTED: probable xyloglucan endotransgluc...    285   7e-90    
gb|KHN22712.1|  Putative xyloglucan endotransglucosylase/hydrolas...    285   7e-90    
gb|KHG10045.1|  Xyloglucan endotransglucosylase/hydrolase 22 -lik...    285   8e-90    
gb|ABV46534.1|  xyloglucan endotransglucosylase hydrolase 2             285   8e-90    
ref|XP_002262761.1|  PREDICTED: brassinosteroid-regulated protein...    285   8e-90    
dbj|BAD53910.1|  putative xyloglucan endotransglycosylase               285   8e-90    
ref|XP_010545428.1|  PREDICTED: xyloglucan endotransglucosylase/h...    285   8e-90    
ref|XP_007048840.1|  Xyloglucan endotransglucosylase/hydrolase 15       285   9e-90    
ref|XP_007035759.1|  Xyloglucan endotransglucosylase/hydrolase fa...    285   9e-90    
ref|XP_004242686.1|  PREDICTED: xyloglucan endotransglucosylase/h...    285   1e-89    
gb|KFK29592.1|  hypothetical protein AALP_AA7G154300                    285   1e-89    
ref|XP_010656826.1|  PREDICTED: probable xyloglucan endotransgluc...    285   1e-89    
ref|XP_010046998.1|  PREDICTED: probable xyloglucan endotransgluc...    285   1e-89    
ref|XP_008799438.1|  PREDICTED: probable xyloglucan endotransgluc...    285   1e-89    
gb|EMS56986.1|  Xyloglucan endotransglucosylase/hydrolase protein 22    285   1e-89    
emb|CDY67778.1|  BnaA10g29060D                                          285   1e-89    
ref|XP_003625289.1|  Xyloglucan endotransglucosylase/hydrolase          284   1e-89    
ref|XP_006349901.1|  PREDICTED: brassinosteroid-regulated protein...    284   1e-89    
ref|XP_010929299.1|  PREDICTED: xyloglucan endotransglucosylase/h...    285   1e-89    
ref|XP_007223211.1|  hypothetical protein PRUPE_ppa009346mg             285   1e-89    
ref|XP_011079307.1|  PREDICTED: probable xyloglucan endotransgluc...    285   1e-89    
ref|NP_194758.1|  xyloglucan endotransglucosylase/hydrolase 19          284   1e-89    
ref|XP_010259807.1|  PREDICTED: probable xyloglucan endotransgluc...    285   1e-89    
ref|XP_006412724.1|  hypothetical protein EUTSA_v10025803mg             285   1e-89    
emb|CDP02959.1|  unnamed protein product                                283   1e-89    
ref|XP_009127924.1|  PREDICTED: probable xyloglucan endotransgluc...    284   2e-89    
ref|XP_010046996.1|  PREDICTED: probable xyloglucan endotransgluc...    284   2e-89    
gb|AFK47205.1|  unknown                                                 284   2e-89    
ref|XP_009120269.1|  PREDICTED: probable xyloglucan endotransgluc...    284   2e-89    
ref|XP_006284057.1|  hypothetical protein CARUB_v10005183mg             286   2e-89    
ref|XP_010673330.1|  PREDICTED: probable xyloglucan endotransgluc...    284   2e-89    
gb|ABD98046.1|  xyloglucan endotransglycosylase                         284   2e-89    
emb|CAN80250.1|  hypothetical protein VITISV_036640                     284   2e-89    
dbj|BAO57275.1|  xyloglucan endotransglucosylase/hydrolase              284   2e-89    
emb|CDX68642.1|  BnaC01g08110D                                          284   2e-89    
emb|CDX72230.1|  BnaC07g42520D                                          284   2e-89    
ref|XP_010046992.1|  PREDICTED: probable xyloglucan endotransgluc...    284   3e-89    
ref|XP_010046993.1|  PREDICTED: probable xyloglucan endotransgluc...    284   3e-89    
ref|XP_007014171.1|  Xyloglucan endotransglucosylase/hydrolase fa...    284   3e-89    
ref|XP_002867356.1|  ATXTH19                                            283   3e-89    
ref|XP_006474631.1|  PREDICTED: xyloglucan endotransglucosylase/h...    283   3e-89    
ref|XP_010103015.1|  putative xyloglucan endotransglucosylase/hyd...    283   3e-89    
ref|XP_003610008.1|  Xyloglucan endotransglucosylase/hydrolase          283   3e-89    
ref|XP_009127934.1|  PREDICTED: probable xyloglucan endotransgluc...    283   3e-89    
ref|XP_006281550.1|  hypothetical protein CARUB_v10027651mg             283   3e-89    
emb|CDX68641.1|  BnaC01g08120D                                          283   4e-89    
gb|EYU20918.1|  hypothetical protein MIMGU_mgv1a011123mg                283   4e-89    
ref|XP_002325067.2|  hypothetical protein POPTR_0018s10290g             283   4e-89    
gb|KDO38356.1|  hypothetical protein CISIN_1g047166mg                   282   4e-89    
ref|NP_001151103.1|  xyloglucan endotransglucosylase/hydrolase pr...    283   4e-89    
ref|XP_009614968.1|  PREDICTED: xyloglucan endotransglucosylase/h...    283   4e-89    
gb|KDP36435.1|  hypothetical protein JCGZ_08704                         283   5e-89    
ref|XP_004966141.1|  PREDICTED: xyloglucan endotransglucosylase/h...    283   5e-89    
gb|KHG05436.1|  putative xyloglucan endotransglucosylase/hydrolas...    283   6e-89    
ref|NP_001289204.1|  probable xyloglucan endotransglucosylase/hyd...    283   6e-89    
gb|EMT22597.1|  Xyloglucan endotransglucosylase/hydrolase protein 22    283   6e-89    
ref|XP_002518632.1|  Brassinosteroid-regulated protein BRU1 precu...    282   7e-89    
gb|ABY79073.1|  xyloglucan xyloglucosyl transferase                     282   8e-89    
ref|XP_002270299.1|  PREDICTED: probable xyloglucan endotransgluc...    282   8e-89    
ref|XP_010047000.1|  PREDICTED: probable xyloglucan endotransgluc...    283   8e-89    
gb|ACU14124.1|  unknown                                                 283   9e-89    
ref|XP_002273742.2|  PREDICTED: probable xyloglucan endotransgluc...    283   1e-88    
ref|XP_004235156.1|  PREDICTED: probable xyloglucan endotransgluc...    282   1e-88    
gb|KCW78734.1|  hypothetical protein EUGRSUZ_C00178                     284   1e-88    
ref|NP_001281042.1|  probable xyloglucan endotransglucosylase/hyd...    282   1e-88    
ref|XP_010259802.1|  PREDICTED: probable xyloglucan endotransgluc...    283   1e-88    
ref|XP_007154781.1|  hypothetical protein PHAVU_003G147400g             282   1e-88    
gb|KDP36436.1|  hypothetical protein JCGZ_08705                         282   1e-88    
ref|XP_006358259.1|  PREDICTED: probable xyloglucan endotransgluc...    282   1e-88    
ref|XP_002325068.2|  hypothetical protein POPTR_0018s10300g             282   1e-88    
gb|KEH20644.1|  xyloglucan endotransglucosylase/hydrolase family ...    282   1e-88    
ref|XP_006284215.1|  hypothetical protein CARUB_v10005373mg             282   1e-88    
ref|XP_006858039.1|  hypothetical protein AMTR_s00062p00020460          282   1e-88    
ref|XP_003560505.2|  PREDICTED: xyloglucan endotransglucosylase/h...    282   1e-88    
ref|XP_010103016.1|  putative xyloglucan endotransglucosylase/hyd...    282   1e-88    
ref|XP_002307040.2|  xyloglucan endo-1 family protein                   281   1e-88    
ref|XP_006421042.1|  hypothetical protein CICLE_v10005561mg             282   1e-88    
gb|KHN22640.1|  Putative xyloglucan endotransglucosylase/hydrolas...    281   2e-88    
gb|KHG21666.1|  putative xyloglucan endotransglucosylase/hydrolas...    281   2e-88    
ref|XP_004243015.1|  PREDICTED: probable xyloglucan endotransgluc...    283   2e-88    
ref|XP_002274154.2|  PREDICTED: probable xyloglucan endotransgluc...    282   2e-88    
ref|XP_010927060.1|  PREDICTED: brassinosteroid-regulated protein...    282   2e-88    
gb|ABL10090.1|  xyloglucan endotransglycosylase                         281   2e-88    
gb|KHG09882.1|  Xyloglucan endotransglucosylase/hydrolase 22 -lik...    281   2e-88    
gb|AES92349.2|  xyloglucan endotransglucosylase/hydrolase family ...    281   2e-88    
dbj|BAH36874.1|  xyloglucan endotransglucosylase/hydrolase              281   2e-88    
ref|XP_009137908.1|  PREDICTED: probable xyloglucan endotransgluc...    281   2e-88    
gb|ACD03219.1|  xyloglucan endotransglucosylase/hydrolase 9             281   2e-88    
gb|AAK91391.1|  AT4g30290/F17I23_370                                    281   2e-88    
gb|ACJ84668.1|  unknown                                                 281   3e-88    
dbj|BAO02549.1|  endo-(1,4)-beta-D-glucanase ortholog                   282   3e-88    
ref|XP_006358261.1|  PREDICTED: probable xyloglucan endotransgluc...    281   3e-88    
emb|CDY39194.1|  BnaA03g50060D                                          281   3e-88    
gb|AFK40376.1|  unknown                                                 281   3e-88    
ref|XP_009126833.1|  PREDICTED: probable xyloglucan endotransgluc...    281   3e-88    
ref|XP_009626663.1|  PREDICTED: probable xyloglucan endotransgluc...    280   3e-88    
gb|KHG04746.1|  putative xyloglucan endotransglucosylase/hydrolas...    281   3e-88    
ref|XP_010103020.1|  Xyloglucan endotransglucosylase/hydrolase pr...    281   3e-88    
ref|XP_002519767.1|  Brassinosteroid-regulated protein BRU1 precu...    280   3e-88    
ref|XP_007224386.1|  hypothetical protein PRUPE_ppa021675mg             281   4e-88    
ref|XP_010046991.1|  PREDICTED: probable xyloglucan endotransgluc...    281   4e-88    
ref|XP_009390494.1|  PREDICTED: probable xyloglucan endotransgluc...    280   4e-88    
ref|NP_001234472.1|  xyloglucan endotransglucosylase-hydrolase XT...    281   4e-88    



>ref|XP_009762863.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Nicotiana 
sylvestris]
Length=290

 Score =   347 bits (891),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 168/299 (56%), Positives = 211/299 (71%), Gaps = 21/299 (7%)
 Frame = +2

Query  131  AGKMKKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTM  310
            A K       +C+IM I ++A S             NF  D  + +G   G++Q+ G  +
Sbjct  2    ASKFSSVMLLLCIIMSIQLLAAS-----------AGNFYRDAVITWGEGRGKIQEGGRGL  50

Query  311  ALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLG  490
            AL LD+ +GSGF +KNEYLFGRFDMQ+KLV G SAGTVTTF+L+S  G+ HDE+DFEFLG
Sbjct  51   ALTLDKLSGSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFFLSSQ-GEGHDEIDFEFLG  109

Query  491  NATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYE  670
            N + QPYTVHTNV+  GKG++EQQFHLWFDPTAA+H YTI+WN  RIV+LVDN PIRVY 
Sbjct  110  NVSGQPYTVHTNVYTQGKGNKEQQFHLWFDPTAAFHTYTIVWNPHRIVFLVDNSPIRVYN  169

Query  671  NHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCV---G  841
            NHE++G+PFPKS+ M+V+CSLW A +WATQGG VK DW+ APFTAYY+N  IDGC    G
Sbjct  170  NHESIGIPFPKSQAMRVYCSLWNADEWATQGGRVKTDWTLAPFTAYYRNINIDGCAVLSG  229

Query  842  TSSCADS------KPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECKPA  1000
            TSSC  S      KPW  + LD    N+L+ V++++ VYNYC D+KRF     AECK +
Sbjct  230  TSSCKSSNSANNAKPWQTHELDGKGRNRLRWVQSRHMVYNYCADSKRFPQGFSAECKSS  288



>ref|XP_009598225.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Nicotiana 
tomentosiformis]
Length=290

 Score =   346 bits (887),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 167/297 (56%), Positives = 209/297 (70%), Gaps = 21/297 (7%)
 Frame = +2

Query  131  AGKMKKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTM  310
            A K       +C++M I ++A S             NF  D  + +G   G++Q+ G  +
Sbjct  2    ASKFSSAMLLLCILMSIQLLAAS-----------AGNFYGDTVITWGEGRGKIQEGGRGL  50

Query  311  ALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLG  490
            AL LD+ +GSGF +KNEYLFGRFDMQ+KLV G SAGTVTTF+L+S  G+ HDE+DFEFLG
Sbjct  51   ALTLDKLSGSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFFLSSQ-GEGHDEIDFEFLG  109

Query  491  NATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYE  670
            N + QPYTVHTNV+  GKG++EQQFHLWFDPTAA+H YTI+WN  RIV+LVDN PIRVY 
Sbjct  110  NVSGQPYTVHTNVYTQGKGNKEQQFHLWFDPTAAFHTYTIVWNPHRIVFLVDNSPIRVYN  169

Query  671  NHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCV---G  841
            NHEN+G+PFPKS+ M+V+CSLW A +WATQGG VK DW+ APFTAYY+N  IDGC    G
Sbjct  170  NHENIGIPFPKSQAMRVYCSLWNADEWATQGGRVKTDWTLAPFTAYYRNINIDGCAVLSG  229

Query  842  TSSCADS------KPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
            TSSC  S      KPW  + LD    N+L+ V++++ VYNYC D+KRF      ECK
Sbjct  230  TSSCKSSNSANNAKPWQTHELDGKGRNRLRWVQSRHMVYNYCADSKRFPQGFSEECK  286



>ref|XP_009597029.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16 [Nicotiana tomentosiformis]
Length=284

 Score =   345 bits (885),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 164/286 (57%), Positives = 211/286 (74%), Gaps = 17/286 (6%)
 Frame = +2

Query  170  IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
            + +I ++  SLV  +        NFNN  ++ +G   G++ + G  ++L+LD+ +GSGF 
Sbjct  5    LFLISILMGSLVAASA-------NFNNLAEITWGEGRGKITEGGKGLSLSLDKLSGSGFQ  57

Query  350  TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
            +KNEYLFGRFDMQ+KLV G SAGTVTTF+L+S  G+ HDE+DFEFLGN T +PYTVHTNV
Sbjct  58   SKNEYLFGRFDMQLKLVPGNSAGTVTTFFLSSQ-GEGHDEIDFEFLGNTTGEPYTVHTNV  116

Query  530  FADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSK  709
            ++ GKG++EQQFHLWFDPTAA+H YTI+WNS RIV+LVDN+PIRVY NHEN G+PFPKS+
Sbjct  117  YSQGKGNKEQQFHLWFDPTAAFHTYTIVWNSNRIVFLVDNIPIRVYNNHENNGIPFPKSQ  176

Query  710  PMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCV---GTSSC------ADS  862
            PMKV+CSLW A +WATQGG VK DW+ APFTAYY+NF IDGC    G SSC       ++
Sbjct  177  PMKVYCSLWNADEWATQGGRVKTDWTHAPFTAYYRNFKIDGCAVTSGASSCKSTDSAGNA  236

Query  863  KPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECKPA  1000
            K W    LDA   N+++ V++++ VYNYC D KRF      ECK +
Sbjct  237  KAWQNQELDAKGRNRVRWVQSRHMVYNYCADKKRFPQGYSHECKSS  282



>ref|XP_009598236.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Nicotiana 
tomentosiformis]
Length=290

 Score =   345 bits (884),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 165/299 (55%), Positives = 210/299 (70%), Gaps = 21/299 (7%)
 Frame = +2

Query  131  AGKMKKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTM  310
            A K       +C++M I ++A S             NF  D  + +G   G++Q+ G  +
Sbjct  2    ASKFSSAMLLLCILMSIQLLAAS-----------AGNFYRDTVITWGEGRGKIQEGGRGL  50

Query  311  ALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLG  490
            AL LD+ +GSGF +KNEYLFGRFDMQ+KLV G SAGTVTTF+L+S  G+ HDE+DFEFLG
Sbjct  51   ALTLDKLSGSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFFLSSQ-GEGHDEIDFEFLG  109

Query  491  NATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYE  670
            N + QPYTVHTNV+  GKG++EQQFHLWFDPTAA+H Y+I+WN  RIV+LVDN PIRVY 
Sbjct  110  NVSGQPYTVHTNVYTQGKGNKEQQFHLWFDPTAAFHTYSIVWNPHRIVFLVDNSPIRVYN  169

Query  671  NHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGC---VG  841
            NHE++G+PFPKS+ M+V+CSLW A +WATQGG +K DW  APFTAYY+N  IDGC    G
Sbjct  170  NHESIGIPFPKSQAMRVYCSLWNADEWATQGGRIKTDWKLAPFTAYYRNINIDGCAVLAG  229

Query  842  TSSCADS------KPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECKPA  1000
            TSSC  S      KPW  + LD    N+L+ V++++ VYNYC D+KRF     AECK +
Sbjct  230  TSSCKSSNSANNAKPWQTHELDGKGRNRLRWVQSRHMVYNYCADSKRFPQGFSAECKSS  288



>ref|XP_009762866.1| PREDICTED: brassinosteroid-regulated protein BRU1-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009762867.1| PREDICTED: brassinosteroid-regulated protein BRU1-like isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009762869.1| PREDICTED: brassinosteroid-regulated protein BRU1-like isoform 
X3 [Nicotiana sylvestris]
Length=290

 Score =   343 bits (880),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 165/299 (55%), Positives = 211/299 (71%), Gaps = 21/299 (7%)
 Frame = +2

Query  131  AGKMKKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTM  310
            A K+      + ++M I ++A S             NF  D  + +G   G++Q+ G  +
Sbjct  2    ASKVSTAMLLLSVLMSIQLLAAS-----------AGNFYRDAVITWGEGRGKIQEGGRGL  50

Query  311  ALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLG  490
            AL LD+ +GSGF +KNEYLFGRFDMQ+KLV G SAGTVTTF+L+S  G+ HDE+DFEFLG
Sbjct  51   ALTLDKLSGSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFFLSSQ-GEGHDEIDFEFLG  109

Query  491  NATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYE  670
            N + QPYT+HTNV+  GKG++EQQFHLWFDPTAA+H YTI+WN  RIV+LVDN PIRVY 
Sbjct  110  NVSGQPYTIHTNVYTQGKGNKEQQFHLWFDPTAAFHTYTIVWNPHRIVFLVDNSPIRVYN  169

Query  671  NHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCV---G  841
            NHE++G+PFPKS+ M+V+CSLW A +WATQGG VK DW+ APFTAYY+N  IDGC    G
Sbjct  170  NHESIGIPFPKSQAMRVYCSLWNADEWATQGGRVKTDWTLAPFTAYYRNINIDGCAVLSG  229

Query  842  TSSCADS------KPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECKPA  1000
            TSSC  S      KPW  + LD    N+L+ V++++ VYNYC D+KRF     AECK +
Sbjct  230  TSSCKSSNSANNAKPWQTHELDGKGRNRLRWVQSRHMVYNYCADSKRFPQGFSAECKSS  288



>ref|XP_009785048.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16 [Nicotiana sylvestris]
Length=284

 Score =   342 bits (877),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 161/286 (56%), Positives = 211/286 (74%), Gaps = 17/286 (6%)
 Frame = +2

Query  170  IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
             ++I ++  SLV           NFNN  ++ +G   G++ + G  ++L+LD+ +GSGF 
Sbjct  5    FLLISILMGSLV-------VASANFNNLAEITWGEGRGKITEGGKGLSLSLDKLSGSGFQ  57

Query  350  TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
            +KNEYLFGRFDMQ+KLV G SAGTVTTF+L+S  G+ HDE+DFEFLGN T +PYTVHTNV
Sbjct  58   SKNEYLFGRFDMQLKLVPGNSAGTVTTFFLSSQ-GKGHDEIDFEFLGNTTGEPYTVHTNV  116

Query  530  FADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSK  709
            ++ GKG++EQQFHLWFDPTAA+H YTI+WN+ RI++LVDN+PIRVY NHE+ G+PFPKS+
Sbjct  117  YSQGKGNKEQQFHLWFDPTAAFHTYTIVWNANRILFLVDNIPIRVYNNHESNGIPFPKSQ  176

Query  710  PMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCV---GTSSC------ADS  862
            PMKV+CSLW A +WATQGG VK DW+ APFTAYY+NF IDGC    G SSC       ++
Sbjct  177  PMKVYCSLWNADEWATQGGRVKTDWTHAPFTAYYRNFKIDGCAVTSGASSCKSTDSAGNA  236

Query  863  KPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECKPA  1000
            K W  + LDA   N+++ V++++ VYNYC D KRF      ECK +
Sbjct  237  KAWQNHELDAKGRNRVRWVQSRHMVYNYCADKKRFPQGYSHECKSS  282



>ref|XP_006350014.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16-like [Solanum tuberosum]
Length=290

 Score =   337 bits (863),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 158/263 (60%), Positives = 201/263 (76%), Gaps = 10/263 (4%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  DV + +G   G++Q+ G  +AL+LD+ +GSGF +KNE+LFGRFDMQ+KLV   SAG
Sbjct  27   NFYKDVDITWGEGRGKIQEGGRGLALSLDKLSGSGFQSKNEFLFGRFDMQIKLVPENSAG  86

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTF+L+S  G+ HDE+DFEFLGN + QPYT+HTNV+  GKG++EQQFHLWFDPTAA+H
Sbjct  87   TVTTFFLSSQ-GEGHDEIDFEFLGNVSGQPYTIHTNVYTQGKGNKEQQFHLWFDPTAAFH  145

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             YTI+WN  RIV+LVDN PIRV+ NHE++G+PFPKS+ MKV+CSLW A +WATQGG VK 
Sbjct  146  TYTIVWNPHRIVFLVDNSPIRVFNNHESIGIPFPKSQAMKVYCSLWNADEWATQGGRVKT  205

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCA------DSKPWGKYALDADANNKLQGVRTKN  931
            DW+ APFTAYY+N  IDGC    GTSSC       ++KPW  + LD    N+L+ V++K+
Sbjct  206  DWALAPFTAYYRNINIDGCAVSSGTSSCKSIGSTNNAKPWETHELDGKGRNRLRWVQSKH  265

Query  932  RVYNYCTDNKRFGGNPPAECKPA  1000
             VYNYC D+KRF     AECK +
Sbjct  266  MVYNYCADSKRFPQGFSAECKSS  288



>ref|NP_001234478.1| xyloglucan endotransglucosylase-hydrolase XTH9 precursor [Solanum 
lycopersicum]
 gb|AAS46244.1| xyloglucan endotransglucosylase-hydrolase XTH9 [Solanum lycopersicum]
Length=290

 Score =   336 bits (862),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 158/263 (60%), Positives = 200/263 (76%), Gaps = 10/263 (4%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  DV + +G   G++Q+ G  +AL+LD+ +GSGF +KNEYLFGRFDMQ+KLV   SAG
Sbjct  27   NFYRDVDITWGEGRGKIQEGGRGLALSLDKLSGSGFQSKNEYLFGRFDMQLKLVPKNSAG  86

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTF+L+S  G+ HDE+DFEFLGN + QPYT+HTNV+  GKG++EQQFHLWFDPTAA+H
Sbjct  87   TVTTFFLSSQ-GEGHDEIDFEFLGNVSGQPYTIHTNVYTQGKGNKEQQFHLWFDPTAAFH  145

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             YTI+WN  RIV+LVDN PIRV+ NHE++G+PFPKS+ MKV+CSLW A +WATQGG VK 
Sbjct  146  TYTIVWNPHRIVFLVDNSPIRVFNNHESMGIPFPKSQAMKVYCSLWNADEWATQGGRVKT  205

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCA------DSKPWGKYALDADANNKLQGVRTKN  931
            DW+ APFTAYY+N  IDGC    G S+C       ++KPW  + LD    N+L+ V+TK+
Sbjct  206  DWALAPFTAYYRNINIDGCAVSSGASTCKSIGSTNNAKPWQTHELDGKGRNRLRWVQTKH  265

Query  932  RVYNYCTDNKRFGGNPPAECKPA  1000
             VYNYC D+KRF     AECK +
Sbjct  266  MVYNYCADSKRFPQGFSAECKSS  288



>ref|XP_004243230.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16 [Solanum lycopersicum]
Length=290

 Score =   335 bits (860),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/265 (59%), Positives = 203/265 (77%), Gaps = 12/265 (5%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NFN+  ++ +G+  G++ D G  ++L+LD  +GSGF +KNEYL+GRFDMQ+KLV   SAG
Sbjct  25   NFNDLTEITWGDGRGKILDGGKGLSLSLDNYSGSGFQSKNEYLYGRFDMQLKLVPKNSAG  84

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTF+L+S  G+ HDE+DFEFLGN T +PYTVHTNV++ GKG++EQQFHLWFDPTAA+H
Sbjct  85   TVTTFFLSSQ-GEGHDEIDFEFLGNVTGEPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  143

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             YTI+WN+ RIV+LVD +PIRVY NHE++G+ +PKS+PMKV+CSLW A +WATQGG VK 
Sbjct  144  TYTIVWNANRIVFLVDQIPIRVYNNHESIGIAYPKSQPMKVYCSLWNADEWATQGGRVKT  203

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCA--------DSKPWGKYALDADANNKLQGVRT  925
            DWS+APFTAYY+N  IDGCV   G SSCA         +K W  + LDA   N+++ V++
Sbjct  204  DWSQAPFTAYYRNINIDGCVVKSGASSCASRSTESTNSAKSWETHELDAKGRNRVRWVQS  263

Query  926  KNRVYNYCTDNKRFGGNPPAECKPA  1000
            K+ VYNYC D+KRF      ECK +
Sbjct  264  KHMVYNYCADSKRFPQGYSQECKRS  288



>ref|XP_009602932.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15 [Nicotiana tomentosiformis]
Length=291

 Score =   335 bits (860),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 164/284 (58%), Positives = 210/284 (74%), Gaps = 15/284 (5%)
 Frame = +2

Query  170  IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
            ++I+ +V  SL  VA A      NF N   + +G   G++ + G  ++L+LD+ +GSGF 
Sbjct  9    MLILPIVMASLWAVASAG-----NFYNLADITWGEGRGKITEGGRGLSLSLDKFSGSGFQ  63

Query  350  TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
            +KNEYLFGRFDMQ+KLV G SAGTVTTF+L+S  G  HDE+DFEFLGN + QPYTVHTNV
Sbjct  64   SKNEYLFGRFDMQLKLVPGNSAGTVTTFFLSSQ-GAGHDEIDFEFLGNVSGQPYTVHTNV  122

Query  530  FADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSK  709
            ++ GKG++EQQFHLWFDPTAA+H Y+IIWN+Q+I++LVDN PIRVY NHE+ G+PFPKS+
Sbjct  123  YSQGKGNKEQQFHLWFDPTAAFHTYSIIWNAQKIIFLVDNSPIRVYNNHESAGIPFPKSQ  182

Query  710  PMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCV---GTSSCA------DS  862
            PMKV+CSLW A +WATQGG VK DW+ APFTAYY+NF IDGC    G SSC       ++
Sbjct  183  PMKVYCSLWNADEWATQGGRVKTDWTHAPFTAYYRNFNIDGCAITSGASSCKSTDSANNA  242

Query  863  KPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
            +PW    LDA   N+L+ V+ ++ VYNYC D+KRF      ECK
Sbjct  243  RPWQNQELDAKGRNRLRWVQNRHMVYNYCADSKRFPQGFSHECK  286



>ref|XP_006350013.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16-like [Solanum tuberosum]
Length=290

 Score =   335 bits (858),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 157/261 (60%), Positives = 199/261 (76%), Gaps = 10/261 (4%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  DV + +G   G++Q+ G  +AL+LD+ +GSGF +KNE+LFGRFDMQ+KLV   SAG
Sbjct  27   NFYRDVDITWGEGRGKIQEGGRGLALSLDKLSGSGFQSKNEFLFGRFDMQLKLVPENSAG  86

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTF+L+S  G+ HDE+DFEFLGN + QPYT+HTNV+  GKG++EQQFHLWFDPTAA+H
Sbjct  87   TVTTFFLSSQ-GEGHDEIDFEFLGNVSGQPYTIHTNVYTQGKGNKEQQFHLWFDPTAAFH  145

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             YTI+WN  RIV+LVDN PIRV+ NHE++G+PFPKS+ MKV+CSLW A +WATQGG VK 
Sbjct  146  TYTIVWNPHRIVFLVDNSPIRVFNNHESIGIPFPKSQAMKVYCSLWNADEWATQGGRVKT  205

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCA------DSKPWGKYALDADANNKLQGVRTKN  931
            DW+ APFTAYY+N  IDGC    GTSSC       ++KPW  + LD    N+L+ V++K+
Sbjct  206  DWALAPFTAYYRNINIDGCAVSSGTSSCKSIGSTNNAKPWQTHELDGKGRNRLRWVQSKH  265

Query  932  RVYNYCTDNKRFGGNPPAECK  994
             VYNYC D+KRF      ECK
Sbjct  266  MVYNYCADSKRFPQGFSEECK  286



>ref|XP_011082926.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like isoform X1 [Sesamum indicum]
Length=292

 Score =   335 bits (858),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 151/283 (53%), Positives = 207/283 (73%), Gaps = 15/283 (5%)
 Frame = +2

Query  167  MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
            M++++ ++  ++            +F  D ++ +G+   ++ + G  + L+LDQQ+GSGF
Sbjct  14   MMLLLAILVANIA-------TAAADFYRDAEITWGDGRAKILEGGRMLTLSLDQQSGSGF  66

Query  347  NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
             +KNEYLFGRFD+Q+KLV G SAGTVTTF+L+S  G  HDE+DFEFLGN + +PYTVHTN
Sbjct  67   QSKNEYLFGRFDLQLKLVPGNSAGTVTTFFLSSQ-GAGHDEIDFEFLGNTSGEPYTVHTN  125

Query  527  VFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKS  706
            V+A GKGD+EQ+FHLWFDPTAA+H Y+I+WN QRI++LVDN+PIRV+ N+E +G+P+PKS
Sbjct  126  VYAQGKGDKEQRFHLWFDPTAAFHTYSIVWNPQRIIFLVDNIPIRVFSNNEAIGIPYPKS  185

Query  707  KPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTSSCA-------DSK  865
            + M+V+CSLW A DWATQGG VK DW+KAPF A Y+NF I+GCV  SSC        +++
Sbjct  186  QAMRVYCSLWNADDWATQGGRVKTDWTKAPFVASYRNFNINGCVPGSSCGSKSAESFNTE  245

Query  866  PWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
             W    LD    N+L+  + K+ +YNYCTDNKRF    PAEC+
Sbjct  246  AWQTKELDGKGRNRLRWAQQKHMIYNYCTDNKRFPQGTPAECR  288



>ref|XP_006348946.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16-like [Solanum tuberosum]
Length=290

 Score =   334 bits (856),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 162/287 (56%), Positives = 212/287 (74%), Gaps = 17/287 (6%)
 Frame = +2

Query  167  MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
            +++I  V+  SLV V  A      NFN+  ++ +G+  G++ D G  ++L+LD+ +GSGF
Sbjct  6    LLLISIVLMGSLVAVLAAG-----NFNDLTEITWGDGRGKILDGGKGLSLSLDKLSGSGF  60

Query  347  NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
             +KNEYL+GRFDMQ+K V   SAGTVTTF+L+S  G+ HDE+DFEFLGN T +PYTVHTN
Sbjct  61   QSKNEYLYGRFDMQIKFVPRNSAGTVTTFFLSSQ-GEGHDEIDFEFLGNVTGEPYTVHTN  119

Query  527  VFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKS  706
            V++ GKG++EQQFHLWFDPT A+H YTI+WN+ RIV+LVD +PIRVY NHE++G+ +PKS
Sbjct  120  VYSQGKGNKEQQFHLWFDPTTAFHTYTIVWNANRIVFLVDEIPIRVYNNHESIGIAYPKS  179

Query  707  KPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCV---GTSSCA-------  856
            +PMKV+CSLW A +WATQGG VK DW++APFTA YKN  IDGCV   G SSCA       
Sbjct  180  QPMKVYCSLWNADEWATQGGRVKTDWTQAPFTASYKNINIDGCVVKSGASSCASRSTDSA  239

Query  857  -DSKPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
             ++KPW  + LDA   N+L+ V+ K+ VYNYC D+KRF      ECK
Sbjct  240  NNAKPWETHELDAKGRNRLRWVQNKHMVYNYCADSKRFPQGYSQECK  286



>ref|XP_009758414.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15 [Nicotiana sylvestris]
Length=291

 Score =   333 bits (855),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 162/284 (57%), Positives = 209/284 (74%), Gaps = 15/284 (5%)
 Frame = +2

Query  170  IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
            ++I+ +V  SL   A A      NF N   + +G   G++ + G  ++L+LD+ +GSGF 
Sbjct  9    MLILPIVMASLWAAASAG-----NFYNLADITWGEGRGKITEGGRGLSLSLDKLSGSGFQ  63

Query  350  TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
            +KNEYLFGRFDMQ+KLV G SAGTVTTF+L+S  G  HDE+DFEFLGN + QPYTVHTNV
Sbjct  64   SKNEYLFGRFDMQLKLVPGNSAGTVTTFFLSSQ-GAGHDEIDFEFLGNVSGQPYTVHTNV  122

Query  530  FADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSK  709
            ++ GKG++EQQFHLWFDPTAA+H Y+IIWN+Q+I++LVDN PIRVY NHE+ G+PFPK +
Sbjct  123  YSQGKGNKEQQFHLWFDPTAAFHTYSIIWNAQKIIFLVDNSPIRVYNNHESNGIPFPKIQ  182

Query  710  PMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCV---GTSSCA------DS  862
            PMKV+CSLW A +WATQGG VK DW+  PFTAYY+NF IDGC    GTSSC       ++
Sbjct  183  PMKVYCSLWNADEWATQGGRVKTDWTHVPFTAYYRNFNIDGCAVTSGTSSCKSTDSANNA  242

Query  863  KPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
            +PW    LDA   N+L+ V++++ VYNYC D+KRF      ECK
Sbjct  243  RPWQNQELDAKGRNRLRWVQSRHMVYNYCADSKRFPQGFSHECK  286



>ref|XP_011082921.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase 2-like [Sesamum 
indicum]
Length=287

 Score =   323 bits (829),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 149/253 (59%), Positives = 194/253 (77%), Gaps = 2/253 (1%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  D ++ +G+   ++ + G  ++L+LDQ +GSGF +KNEYLFGRFD+Q+KLV G SAG
Sbjct  32   NFYRDAEITWGDGRAKILEGGRGLSLSLDQYSGSGFQSKNEYLFGRFDLQLKLVPGNSAG  91

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTF+L+S  G+ HDE+DFEFLGN + +PYTVHTNV+A GKGD+EQQFHLWFDPTAA+H
Sbjct  92   TVTTFFLSSQ-GEGHDEIDFEFLGNVSGEPYTVHTNVYAGGKGDKEQQFHLWFDPTAAFH  150

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+W+ QRI++LVDN PIRV+ NH+++G+PFP S+PM+V CSLW A DWATQGG VK 
Sbjct  151  TYSIVWHPQRIIFLVDNSPIRVFNNHKSIGIPFPTSQPMRVHCSLWNADDWATQGGRVKT  210

Query  779  DWSKAPFTAYYKNFVIDGC-VGTSSCADSKPWGKYALDADANNKLQGVRTKNRVYNYCTD  955
            DW+KAPF  YY+NF IDGC VGTS  +         LDA   N+++ V+ K+ +YNYC D
Sbjct  211  DWTKAPFVTYYRNFKIDGCPVGTSGGSCGFQSQTQELDAKGRNRMRWVQQKHMIYNYCAD  270

Query  956  NKRFGGNPPAECK  994
             +RF     AECK
Sbjct  271  VRRFPQGSSAECK  283



>ref|XP_011082922.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase 2-like [Sesamum 
indicum]
Length=287

 Score =   323 bits (829),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 149/253 (59%), Positives = 195/253 (77%), Gaps = 2/253 (1%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  D ++ +G+   ++ + G  ++L+LDQ +GSGF +KNEYL+GRFD+Q+KLV G SAG
Sbjct  32   NFYRDAEITWGDGRAKILEGGRGLSLSLDQYSGSGFQSKNEYLYGRFDLQLKLVPGNSAG  91

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTF+L+S  G+ HDE+DFEFLGN + +PYTVHTNV+A GKGD+EQQFHLWFDPTAA+H
Sbjct  92   TVTTFFLSSQ-GEGHDEIDFEFLGNVSGEPYTVHTNVYAGGKGDKEQQFHLWFDPTAAFH  150

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+W+ QRI++LVDN PIRV+ NH+++G+PFP S+PM+V CSLW A DWATQGG VK 
Sbjct  151  TYSIVWHPQRIIFLVDNSPIRVFNNHKSIGIPFPTSQPMRVHCSLWNADDWATQGGRVKT  210

Query  779  DWSKAPFTAYYKNFVIDGC-VGTSSCADSKPWGKYALDADANNKLQGVRTKNRVYNYCTD  955
            DW+KAPF AYY+NF IDGC VGTS  +         LDA   N+++ V+ K+ +YNYC D
Sbjct  211  DWTKAPFVAYYRNFKIDGCPVGTSGGSCGFQSQTQELDAKGRNRMRWVQQKHMIYNYCAD  270

Query  956  NKRFGGNPPAECK  994
             +RF     AECK
Sbjct  271  VRRFPQGSSAECK  283



>gb|ABD96609.1| xyloglucan endotransglucosylase XET3 [Capsicum annuum]
Length=287

 Score =   323 bits (827),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 155/267 (58%), Positives = 195/267 (73%), Gaps = 14/267 (5%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  D  + FG+H  Q+QD G  +AL+LD+ +GSGF +KNEYLFGRFDMQ+KLV G SAG
Sbjct  20   NFYQDATVTFGDHRAQIQDGGRVLALSLDKISGSGFQSKNEYLFGRFDMQLKLVPGNSAG  79

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTFYL+S  G  HDE+DFEFLGN++ QPYTVHTNV++ GKG++EQQF LWFDPT+++H
Sbjct  80   TVTTFYLSSQ-GAGHDEIDFEFLGNSSGQPYTVHTNVYSQGKGNKEQQFRLWFDPTSSFH  138

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WNSQRI++LVD++PIRV+ NHE +GV FPK++ M+V+ SLW A DWATQGG VK 
Sbjct  139  TYSIVWNSQRIIFLVDDIPIRVFNNHEALGVAFPKNQAMRVYASLWNADDWATQGGWVKT  198

Query  779  DWSKAPFTAYYKNFVIDGCV-----GTSSCADSK--------PWGKYALDADANNKLQGV  919
            DWS APFTA Y+NF  + CV      TSSC  SK         W    L+A   N+L+ V
Sbjct  199  DWSMAPFTASYRNFNTNACVWSAATSTSSCGGSKTDSVNNVQTWQTQELNASERNRLRWV  258

Query  920  RTKNRVYNYCTDNKRFGGNPPAECKPA  1000
            + K  +YNYCTD KRF      ECK +
Sbjct  259  QQKYMIYNYCTDAKRFSQGFSPECKRS  285



>ref|XP_008229404.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Prunus 
mume]
Length=285

 Score =   323 bits (827),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 148/279 (53%), Positives = 200/279 (72%), Gaps = 6/279 (2%)
 Frame = +2

Query  158  QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
            +V M++++ +   SL+ +  +      NF  D+ + FG+   ++ + G  + LNLD+ +G
Sbjct  9    KVSMVLVVSLFVTSLMAMTASAG----NFFQDIDVTFGDERAKILNGGQLLTLNLDKASG  64

Query  338  SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
            SGF +KNEYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PYT+
Sbjct  65   SGFKSKNEYLFGRIDMQIKLVSGNSAGTVTAYYLSSE-GPTHDEIDFEFLGNLSGDPYTL  123

Query  518  HTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPF  697
            HTNVF+ GKG+REQQFHLWFDPT A+H Y+I+WNSQRI++LVDN+PIRV+ N E +GVPF
Sbjct  124  HTNVFSQGKGNREQQFHLWFDPTKAFHTYSIVWNSQRIIFLVDNIPIRVFTNLETIGVPF  183

Query  698  PKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTSSCADSKPWGK  877
            PK++PM+++ SLW A DWAT+GG VK DW+KAPFTA Y+NF       T+S  +   W  
Sbjct  184  PKNQPMRIYSSLWNADDWATRGGLVKTDWTKAPFTASYRNFQA-STTSTNSLTEQSAWQT  242

Query  878  YALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
              LD++  N+L+ V+ K  VYNYC+D KRF    P EC+
Sbjct  243  QGLDSEGRNRLRWVQQKFMVYNYCSDLKRFPQGLPVECR  281



>ref|XP_011082923.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase 2-like [Sesamum 
indicum]
Length=288

 Score =   322 bits (826),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 148/253 (58%), Positives = 195/253 (77%), Gaps = 2/253 (1%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  D ++ +G+   ++ + G  ++L+LDQ +GSGF +KNEYL+GRFD+Q+KLV G SAG
Sbjct  33   NFYRDAEITWGDGRAKILEGGRGLSLSLDQYSGSGFQSKNEYLYGRFDLQLKLVPGNSAG  92

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTF+L+S  G+ HDE+DFEFLGN + +PYTVHTNV+A GKGD+EQQFHLWFDPTAA+H
Sbjct  93   TVTTFFLSSQ-GEGHDEIDFEFLGNVSGEPYTVHTNVYAGGKGDKEQQFHLWFDPTAAFH  151

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+W+ QRI++LVDN PIR++ NH+++G+PFP S+PM+V CSLW A DWATQGG VK 
Sbjct  152  TYSIVWHPQRIIFLVDNSPIRIFNNHKSIGIPFPTSQPMRVHCSLWNADDWATQGGRVKT  211

Query  779  DWSKAPFTAYYKNFVIDGC-VGTSSCADSKPWGKYALDADANNKLQGVRTKNRVYNYCTD  955
            DW+KAPF AYY+NF IDGC VGTS  +         LDA   N+++ V+ K+ +YNYC D
Sbjct  212  DWTKAPFVAYYRNFKIDGCPVGTSGGSCGFQSQTQELDAKGRNRMRWVQQKHMIYNYCAD  271

Query  956  NKRFGGNPPAECK  994
             +RF     AECK
Sbjct  272  VRRFPQGSSAECK  284



>gb|ABD96607.1| xyloglucan endotransglucosylase XET1 [Capsicum annuum]
Length=287

 Score =   322 bits (826),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/265 (58%), Positives = 192/265 (72%), Gaps = 14/265 (5%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  D  + FG+   Q+QD G  +AL+LD+ +GSGF +KNEYLFGRFDMQ+KLV G SAG
Sbjct  20   NFYQDTTVTFGDQRAQIQDGGRILALSLDKISGSGFQSKNEYLFGRFDMQLKLVPGNSAG  79

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTFYL+S  G  HDE+DFEFLGN++ QPYTVHTNV++ GKG++EQQF LWFDPT+++H
Sbjct  80   TVTTFYLSSQ-GAGHDEIDFEFLGNSSGQPYTVHTNVYSQGKGNKEQQFRLWFDPTSSFH  138

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WNSQRI++LVDN+PIRV+ NHE +GV FPK++ M+V+ SLW A DWATQGG VK 
Sbjct  139  TYSIVWNSQRIIFLVDNIPIRVFNNHEAIGVAFPKNQAMRVYASLWNADDWATQGGRVKT  198

Query  779  DWSKAPFTAYYKNFVIDGCV-----GTSSCADSK--------PWGKYALDADANNKLQGV  919
            DWS APFTA Y+NF  + CV      TSSC  SK         W    L+A   N+L+ V
Sbjct  199  DWSMAPFTAAYRNFNTNACVWSAATSTSSCGGSKTDSVNNAQTWQTQELNASERNRLRWV  258

Query  920  RTKNRVYNYCTDNKRFGGNPPAECK  994
            + K  +YNYC D KRF      ECK
Sbjct  259  QQKYMIYNYCADAKRFSQGFSPECK  283



>gb|ABD96608.1| xyloglucan endotransglucosylase XET2 [Capsicum annuum]
Length=288

 Score =   322 bits (825),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 155/267 (58%), Positives = 193/267 (72%), Gaps = 14/267 (5%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  D  + FG+   Q+QD G   AL+LD+ +GSGF +KNEYLFGRFDMQ+KLV G SAG
Sbjct  21   NFYQDATVTFGDQRAQIQDGGRVFALSLDKISGSGFQSKNEYLFGRFDMQLKLVPGNSAG  80

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTFYL+S  G  HDE+DFEFLGN++ QPYTVHTNV++ GKG++EQQF LWFDPT+++H
Sbjct  81   TVTTFYLSSQ-GAGHDEIDFEFLGNSSGQPYTVHTNVYSQGKGNKEQQFRLWFDPTSSFH  139

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WNSQRI++LVDN+PIRVY N E +GVPFPK++ M+V+ SLW A DWATQGG VK 
Sbjct  140  TYSIVWNSQRIIFLVDNIPIRVYNNDEAIGVPFPKNQAMRVYASLWNADDWATQGGRVKT  199

Query  779  DWSKAPFTAYYKNFVIDGCV-----GTSSCADSK--------PWGKYALDADANNKLQGV  919
            DWS APFTA Y+NF  + CV      TSSC  SK         W    L+A+  N+L+ V
Sbjct  200  DWSMAPFTASYRNFNTNACVWSAASSTSSCGGSKTDSVNNAQTWQTQELNANERNRLRWV  259

Query  920  RTKNRVYNYCTDNKRFGGNPPAECKPA  1000
            + K  +YNYC D KRF      ECK +
Sbjct  260  QQKYMIYNYCADAKRFSQGFSPECKRS  286



>ref|XP_010536006.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
20-like [Tarenaya hassleriana]
Length=283

 Score =   322 bits (824),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 153/284 (54%), Positives = 205/284 (72%), Gaps = 10/284 (4%)
 Frame = +2

Query  158  QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
            Q  + +I+ ++A   +           NF  DVQ+ +GN  G+V +NGN +AL+LDQ +G
Sbjct  7    QRFLFLILSLLATHAL------EASVGNFERDVQITWGNGRGKVLENGNLLALSLDQFSG  60

Query  338  SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
            SGF +KNE+L+GR + Q+KLV G SAGTVTTFYL SP G   DE+DFEFLGN +  PYT+
Sbjct  61   SGFQSKNEFLYGRVEAQIKLVPGNSAGTVTTFYLKSP-GATWDEIDFEFLGNLSGHPYTL  119

Query  518  HTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPF  697
            HTNV+  GKGD+EQQFHLWFDPTA +H Y+I WN QRI++ VD +PIR ++N E++GVPF
Sbjct  120  HTNVYTQGKGDKEQQFHLWFDPTADFHTYSITWNPQRIIFTVDGIPIREFKNLESIGVPF  179

Query  698  PKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCV---GTSSCADSKP  868
            PK++PM+++ SLWEA +WAT+GG VK+DWS+APFTA Y+N+  +GCV   G SSC  +KP
Sbjct  180  PKNQPMRLYASLWEADEWATRGGLVKIDWSRAPFTASYRNYNANGCVWSSGRSSCPANKP  239

Query  869  WGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECKPA  1000
            W    LD +  N+++ V+++  VYNYCTD KR     P ECK A
Sbjct  240  WFSQELDFNGKNRMKWVQSRYMVYNYCTDRKRSPQGAPPECKMA  283



>ref|XP_004303859.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16-like [Fragaria vesca subsp. vesca]
Length=298

 Score =   322 bits (825),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 155/295 (53%), Positives = 205/295 (69%), Gaps = 21/295 (7%)
 Frame = +2

Query  158  QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
            +V M++++ +   SL+ +  +      NF  D  + FG+   ++ + G ++ LNLDQ +G
Sbjct  5    KVPMVLLLSLFITSLLAMIASAG----NFLQDFDVTFGDQRVKILEGGKSLTLNLDQYSG  60

Query  338  SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
            SGF +KNEYLFGR DMQ+KLV G SAGTVTT+YL+S  G  HDE+DFEFLGN++  PYT+
Sbjct  61   SGFKSKNEYLFGRIDMQIKLVPGNSAGTVTTYYLSSE-GPTHDEIDFEFLGNSSGNPYTL  119

Query  518  HTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPF  697
            HTNVF+ GKGDREQQFHLWFDPT A+H Y+ +WNSQRI++LVDN+PIRV+ N E+ G+PF
Sbjct  120  HTNVFSQGKGDREQQFHLWFDPTKAFHTYSFVWNSQRIIFLVDNIPIRVFNNLESFGIPF  179

Query  698  PKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVG------------  841
            PK++PM+++ SLW A DWATQGG VK DW++APFTA Y+NF  + CV             
Sbjct  180  PKNQPMRIYSSLWNADDWATQGGRVKTDWTQAPFTASYRNFKANACVAGSSSSSSCGVAT  239

Query  842  ---TSSCADSK-PWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
               T+S  D +  W    LDA   N+L+ V+ K  VYNYC+D KRF    PAECK
Sbjct  240  TASTNSLTDQQSAWQTQTLDAAGRNRLRWVQHKFMVYNYCSDRKRFPQGVPAECK  294



>ref|XP_011082925.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase 2-like [Sesamum 
indicum]
Length=288

 Score =   322 bits (824),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 148/253 (58%), Positives = 194/253 (77%), Gaps = 2/253 (1%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  D ++ +G+   ++ + G  ++L+LDQ +GSGF +KNEYLFGRFD+Q+KLV G SAG
Sbjct  33   NFYRDAEITWGDGRAKILEGGRGLSLSLDQYSGSGFQSKNEYLFGRFDLQLKLVPGNSAG  92

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTF+L+S  G+ HDE+DFEFLGN + +PYTVHTNV+A GKGD+EQQFHLWFDPTAA+H
Sbjct  93   TVTTFFLSSQ-GEGHDEIDFEFLGNVSGEPYTVHTNVYAGGKGDKEQQFHLWFDPTAAFH  151

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+W+ QRI++LVDN PIRV+ NH+++G+PFP S+PM+V CSLW A DWATQGG VK 
Sbjct  152  TYSIVWHPQRIIFLVDNSPIRVFNNHKSIGIPFPTSQPMRVHCSLWNADDWATQGGRVKT  211

Query  779  DWSKAPFTAYYKNFVIDGC-VGTSSCADSKPWGKYALDADANNKLQGVRTKNRVYNYCTD  955
            DW+KAPF AYY+NF IDGC +GTS  +         LD    N+++ V+ K+ +YNYC D
Sbjct  212  DWTKAPFVAYYRNFKIDGCPIGTSGGSCGFQSQTQELDGKGRNRMRWVQQKHMIYNYCAD  271

Query  956  NKRFGGNPPAECK  994
             +RF     AECK
Sbjct  272  VRRFPQGTSAECK  284



>gb|EYU31577.1| hypothetical protein MIMGU_mgv1a011275mg [Erythranthe guttata]
Length=287

 Score =   321 bits (823),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 151/265 (57%), Positives = 196/265 (74%), Gaps = 14/265 (5%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            +F  D ++ +G+   ++ + G  ++L+LD  +GSGF +KNEYLFGRFD+Q+KLV G SAG
Sbjct  20   DFYRDAEITWGDGRAKILEGGRALSLSLDNYSGSGFQSKNEYLFGRFDIQLKLVPGNSAG  79

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTF+L+S  G  HDE+DFEFLGNAT +PYTVHTNV+A GKGD+EQQF LWFDP++AYH
Sbjct  80   TVTTFFLSSQ-GAGHDEIDFEFLGNATGEPYTVHTNVYAKGKGDKEQQFRLWFDPSSAYH  138

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENV-GVPFPKSKPMKVFCSLWEASDWATQGGDVK  775
             Y+I+WN QRI++LVDN+PIRV+ N E + G PFP S+PM+V+CSLW A DWATQGG VK
Sbjct  139  TYSILWNPQRIIFLVDNIPIRVFNNEEAITGTPFPTSQPMRVYCSLWNADDWATQGGRVK  198

Query  776  VDWSKAPFTAYYKNFVIDGCVGTSSC------------ADSKPWGKYALDADANNKLQGV  919
             DW+KAPF A Y+NF I+GCV  S C            A++  W    LDA+  N+L+ V
Sbjct  199  TDWTKAPFVASYRNFNINGCVAGSQCGSGSDSNMKAEGANNNNWRTQGLDANGRNRLRWV  258

Query  920  RTKNRVYNYCTDNKRFGGNPPAECK  994
            + K  +YNYC+D+KRF    PAECK
Sbjct  259  QQKYIIYNYCSDSKRFPQGIPAECK  283



>ref|XP_008229403.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Prunus 
mume]
Length=285

 Score =   321 bits (822),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 150/279 (54%), Positives = 200/279 (72%), Gaps = 6/279 (2%)
 Frame = +2

Query  158  QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
            +V M++++ +   SL+ +A +      NF  D  + FG+   ++ + G  + LNLD+ +G
Sbjct  9    KVSMVLVVSLFVTSLMAMAASAG----NFFQDFDVTFGDERVKILNGGQLLTLNLDKASG  64

Query  338  SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
            SGF +KNEYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PYT+
Sbjct  65   SGFKSKNEYLFGRIDMQIKLVSGNSAGTVTAYYLSSE-GPTHDEIDFEFLGNLSGDPYTL  123

Query  518  HTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPF  697
            HTNVF+ GKG+REQQFHLWFDPT A+H Y+I+WNSQRI++LVDN+PIRV+ N E +GVPF
Sbjct  124  HTNVFSQGKGNREQQFHLWFDPTRAFHTYSIVWNSQRIIFLVDNIPIRVFHNLETIGVPF  183

Query  698  PKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTSSCADSKPWGK  877
            PKS+PM+++ SLW A DWAT+GG VK DW++APFTA Y+NF       T+S  +   W  
Sbjct  184  PKSQPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFQA-STTSTNSLTEQSAWQN  242

Query  878  YALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
              LDA   N+L+ V+ K  +YNYC+D KRF    PAEC+
Sbjct  243  QGLDAAGRNRLRWVQQKFMIYNYCSDLKRFPQGLPAECR  281



>gb|EYU31576.1| hypothetical protein MIMGU_mgv1a011220mg [Erythranthe guttata]
Length=288

 Score =   321 bits (822),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/265 (58%), Positives = 197/265 (74%), Gaps = 14/265 (5%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            +F  D ++ +G+   ++ + G  ++L+LD  +GSGF +KNEYLFGRFD+Q+KLV G SAG
Sbjct  21   DFYRDAEITWGDGRAKILEGGRALSLSLDNYSGSGFQSKNEYLFGRFDIQLKLVPGNSAG  80

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTF+L+S  G  HDE+DFEFLGNAT +PYTVHTNV+A GKGD+EQQF LWFDP++AYH
Sbjct  81   TVTTFFLSSQ-GAGHDEIDFEFLGNATGEPYTVHTNVYAKGKGDKEQQFRLWFDPSSAYH  139

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENV-GVPFPKSKPMKVFCSLWEASDWATQGGDVK  775
             Y+I+WN QRI++LVDN+PIRV+ N E + G PFP S+PM+V+CSLW A DWATQGG VK
Sbjct  140  TYSILWNPQRIIFLVDNIPIRVFNNEEAITGTPFPTSQPMRVYCSLWNADDWATQGGRVK  199

Query  776  VDWSKAPFTAYYKNFVIDGCVGTSSC---ADSK---------PWGKYALDADANNKLQGV  919
             DW+KAPF A Y+NF I+GCV  S C   +DSK          W    LDA+  N+L+ V
Sbjct  200  TDWTKAPFVATYRNFNINGCVAGSQCGSGSDSKLKTEGANNNNWRTQGLDANGRNRLRWV  259

Query  920  RTKNRVYNYCTDNKRFGGNPPAECK  994
            + K  +YNYC+D+KRF    PAECK
Sbjct  260  QQKYIIYNYCSDSKRFPKGIPAECK  284



>ref|XP_007215791.1| hypothetical protein PRUPE_ppa009863mg [Prunus persica]
 gb|EMJ16990.1| hypothetical protein PRUPE_ppa009863mg [Prunus persica]
Length=274

 Score =   319 bits (818),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/276 (54%), Positives = 197/276 (71%), Gaps = 6/276 (2%)
 Frame = +2

Query  167  MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
            M++++ +   SL+ +A +      NF  D  + FG+   ++ + G  + LNLD+ +GSGF
Sbjct  1    MVLVVSLFVTSLMAMAASAG----NFFQDFDVTFGDERAKILNGGQLLTLNLDKASGSGF  56

Query  347  NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
             +KNEYL GR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PYT+HTN
Sbjct  57   KSKNEYLLGRIDMQIKLVSGNSAGTVTAYYLSSE-GPTHDEIDFEFLGNLSGDPYTLHTN  115

Query  527  VFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKS  706
            VF+ GKG+REQQFHLWFDPT A+H Y+I+WNSQRI++LVDN+PIRV+ N E +GVPFPKS
Sbjct  116  VFSQGKGNREQQFHLWFDPTKAFHTYSIVWNSQRIIFLVDNIPIRVFHNLETIGVPFPKS  175

Query  707  KPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTSSCADSKPWGKYAL  886
            +PM+++ SLW A DWAT+GG VK DW++APFTA Y+NF       T+S  +   W    L
Sbjct  176  QPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFQAS-TTSTNSLTEQSAWQTQGL  234

Query  887  DADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
            DA   N+L+ V+ K  VYNYC+D KRF    PAEC+
Sbjct  235  DAAGRNRLRWVQQKFMVYNYCSDLKRFPQGLPAECR  270



>ref|XP_010102170.1| putative xyloglucan endotransglucosylase/hydrolase protein 16 
[Morus notabilis]
 gb|EXB92420.1| putative xyloglucan endotransglucosylase/hydrolase protein 16 
[Morus notabilis]
Length=289

 Score =   320 bits (819),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 157/290 (54%), Positives = 200/290 (69%), Gaps = 24/290 (8%)
 Frame = +2

Query  161  VCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGS  340
            + + M+  ++A +  G          NF  D  + +G+H  Q+ + G  + LNLD+ +GS
Sbjct  7    ITLFMVSWLMAAATAG----------NFYQDFDITWGDHRAQILNGGQLLTLNLDKASGS  56

Query  341  GFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVH  520
            GF +KNEYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PYT+H
Sbjct  57   GFQSKNEYLFGRIDMQIKLVPGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLH  115

Query  521  TNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFP  700
            TNV + GKG+REQQFHLWFDPT A+H Y+I+WN QRI++LVDN+PIRV+ N E+ GVPFP
Sbjct  116  TNVLSQGKGNREQQFHLWFDPTKAFHTYSIVWNKQRIIFLVDNIPIRVFNNLESTGVPFP  175

Query  701  KSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCV---GTSSCADSKP-  868
            KS+PM+++ SLW A DWAT+GG VK DW+KAPFTA Y+NF  + CV   G SSC DSK  
Sbjct  176  KSQPMRIYSSLWNADDWATRGGLVKTDWTKAPFTASYRNFKANACVWSAGKSSC-DSKST  234

Query  869  --------WGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
                    W    LDA   N+L+ V+ K  VYNYCTD+KRF    P ECK
Sbjct  235  SAAFEDATWQDQGLDAAGRNRLRWVQQKYMVYNYCTDSKRFPQGLPPECK  284



>ref|XP_004303862.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15-like [Fragaria vesca subsp. vesca]
Length=292

 Score =   319 bits (817),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 149/283 (53%), Positives = 202/283 (71%), Gaps = 10/283 (4%)
 Frame = +2

Query  167  MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
            M++++ VV+C+L+   +A      +F  ++ + FG+   ++ D G  + LNLD+  GSGF
Sbjct  9    MLLMLSVVSCNLL--IMAASSSAGDFYRNIDVTFGDQRAKILDGGKLLTLNLDKTLGSGF  66

Query  347  NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
             +K EYLFGR D+QMKLV G SAGTVTT+YL+S  G  HDE+DFEFLGN+T  PYT+HTN
Sbjct  67   RSKKEYLFGRIDIQMKLVPGNSAGTVTTYYLSSE-GVTHDEIDFEFLGNSTGNPYTLHTN  125

Query  527  VFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKS  706
            VF+ GKG+REQQFHLWFDPT ++H Y+I+WN+ RI++ VDN+PIRV++N E++GVPFPK 
Sbjct  126  VFSQGKGEREQQFHLWFDPTKSFHTYSILWNTHRIIFFVDNIPIRVFDNLESIGVPFPKK  185

Query  707  KPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVG-------TSSCADSK  865
            +PM+++ SLW A DWATQGG VK DW++APFTA Y+N   + C+         S+ A+ K
Sbjct  186  QPMRIYSSLWNADDWATQGGLVKTDWAQAPFTASYRNLKANACLAGSSSSTCVSTTAEDK  245

Query  866  PWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
             W   ALDA    +L+ V+ K  VYNYC+D KRF    P ECK
Sbjct  246  AWQNQALDAAGRKRLRWVQNKFMVYNYCSDRKRFPQGFPPECK  288



>ref|XP_006366771.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15-like [Solanum tuberosum]
 ref|XP_006366772.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15-like [Solanum tuberosum]
Length=287

 Score =   319 bits (817),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 153/267 (57%), Positives = 193/267 (72%), Gaps = 14/267 (5%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  D  + FG+   Q+QD G  +AL+LD+ +GSGF +KNEYLFGRFDMQ+KLV G SAG
Sbjct  20   NFYQDATVTFGDQRAQIQDGGRLLALSLDKISGSGFQSKNEYLFGRFDMQLKLVPGNSAG  79

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTFYL+S  G  HDE+DFEFLGN++ QPYTVHTNV++ GKG++EQQF LWFDPT+++H
Sbjct  80   TVTTFYLSSQ-GAGHDEIDFEFLGNSSGQPYTVHTNVYSQGKGNKEQQFRLWFDPTSSFH  138

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WNSQRI++LVDN+PIRV+ NHE +GV FPK++ M+V+ SLW A DWATQGG VK 
Sbjct  139  TYSIVWNSQRIIFLVDNIPIRVFNNHEALGVAFPKNQAMRVYASLWNADDWATQGGRVKT  198

Query  779  DWSKAPFTAYYKNFVIDGCV-----GTSSCADSK--------PWGKYALDADANNKLQGV  919
            DWS APFTA Y+NF  + CV      TSSC  SK         W    L+A+  N+L+ V
Sbjct  199  DWSMAPFTASYRNFNTNACVWSAATSTSSCGGSKTESVNNDQTWQTQQLNANGRNRLRWV  258

Query  920  RTKNRVYNYCTDNKRFGGNPPAECKPA  1000
            + K  +YNYC D  RF      ECK +
Sbjct  259  QQKYMIYNYCADANRFSQGFSPECKRS  285



>gb|EPS58668.1| hypothetical protein M569_16144, partial [Genlisea aurea]
Length=273

 Score =   318 bits (814),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 153/276 (55%), Positives = 198/276 (72%), Gaps = 10/276 (4%)
 Frame = +2

Query  176  IIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTK  355
            +  +V C LV  A A      NF +DV + +G+   Q+ D+GN + L+LD+ +GSGF ++
Sbjct  1    VYALVVCVLVATAAA------NFYSDVDVTWGDGRAQILDSGNELTLSLDKSSGSGFQSR  54

Query  356  NEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFA  535
            N+YLFGRFDMQ+KLV G SAGTVTTF+L+S  G  HDE+DFEFLGN++  PYTVHTNVFA
Sbjct  55   NQYLFGRFDMQLKLVPGNSAGTVTTFFLSSQ-GADHDEIDFEFLGNSSGDPYTVHTNVFA  113

Query  536  DGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPM  715
             GKG+REQQF LWFDPTA +H Y+I+WN QRI+++VD +PIRV+ N++ +G+PFP ++ M
Sbjct  114  QGKGNREQQFRLWFDPTADFHTYSIVWNPQRIIFMVDQIPIRVFSNNQAIGIPFPNTQAM  173

Query  716  KVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTSSCAD---SKPWGKYAL  886
            +V+CSLW A DWATQGG VK DWS APFTA Y+NF I+ C      +D   S  W   AL
Sbjct  174  RVYCSLWNADDWATQGGRVKTDWSLAPFTASYRNFAINACSPGQCGSDTFSSGAWKTQAL  233

Query  887  DADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
            DA   N+L+ V+    +YNYCTD KRF    P ECK
Sbjct  234  DAQGRNRLRWVQQNYMIYNYCTDYKRFPQGIPVECK  269



>ref|NP_001281066.1| brassinosteroid-regulated protein BRU1-like precursor [Malus 
domestica]
 gb|ACD03231.1| xyloglucan endotransglucosylase/hydrolase 7 [Malus domestica]
Length=295

 Score =   318 bits (815),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 151/287 (53%), Positives = 199/287 (69%), Gaps = 16/287 (6%)
 Frame = +2

Query  167  MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
            M+ ++ +   SL+     +     NF  D  + FG+   ++ + G  + LNLD+ +GSGF
Sbjct  10   MVFLLSLFTTSLM----VMTASAGNFFQDFDITFGDGRAKILNGGQLLTLNLDKASGSGF  65

Query  347  NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
             +KNEYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN+T +PYT+HTN
Sbjct  66   KSKNEYLFGRIDMQIKLVSGNSAGTVTAYYLSSE-GPTHDEIDFEFLGNSTGEPYTLHTN  124

Query  527  VFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKS  706
            VF+ GKG+REQQFHLWFDPT  +H Y+I+WNSQRI++LVDN+PIRV+ N E+ GVPFPK+
Sbjct  125  VFSQGKGNREQQFHLWFDPTKTFHTYSIVWNSQRIIFLVDNIPIRVFNNLESAGVPFPKN  184

Query  707  KPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGT--SSCA--------  856
            +PM+++ SLW A DWAT+GG VK DW++APFTA Y+NF  + C  +  SSCA        
Sbjct  185  QPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFKANACTASSPSSCASTTSTNSL  244

Query  857  -DSKPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
             +   W    LDA   N+L+ V+ K  VYNYC+D KRF    P ECK
Sbjct  245  TEQSAWKTQGLDAAGRNRLRWVQQKFMVYNYCSDLKRFPQGLPTECK  291



>ref|XP_009356634.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Pyrus 
x bretschneideri]
Length=295

 Score =   318 bits (815),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 151/287 (53%), Positives = 200/287 (70%), Gaps = 16/287 (6%)
 Frame = +2

Query  167  MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
            M+ ++ +   SL+ +  +      NF  D  + FG+   ++ + G  + LNLD+ +GSGF
Sbjct  10   MVFLLSLFTTSLMAMTASAG----NFFQDFDITFGDGRAKILNGGQLLTLNLDKASGSGF  65

Query  347  NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
             +KNEYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN+T +PYT+HTN
Sbjct  66   KSKNEYLFGRIDMQIKLVSGNSAGTVTAYYLSSE-GPTHDEIDFEFLGNSTGEPYTLHTN  124

Query  527  VFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKS  706
            VF+ GKG+REQQF LWFDPT  +H Y+I+WNSQRI++LVDN+PIRV+ N E+ GVPFPK+
Sbjct  125  VFSQGKGNREQQFQLWFDPTKTFHTYSIVWNSQRIIFLVDNIPIRVFNNLESAGVPFPKN  184

Query  707  KPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGT--SSCA--------  856
            +PM+++ SLW A DWAT+GG VK DW++APFTA Y+NF  + C  +  SSCA        
Sbjct  185  QPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFKANACTASSPSSCASTTSTNSL  244

Query  857  -DSKPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
             +   W    LDA   N+L+ V+ K  VYNYC+D KRF    PAECK
Sbjct  245  TEQSAWKTQGLDAAGRNRLRWVQQKFMVYNYCSDLKRFPQGLPAECK  291



>ref|NP_001234213.1| xyloglucan endo-transglycosylase precursor [Solanum lycopersicum]
 emb|CAA58003.1| xyloglucan endo-transglycosylase [Solanum lycopersicum]
Length=289

 Score =   317 bits (813),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 153/265 (58%), Positives = 191/265 (72%), Gaps = 14/265 (5%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  D  + FG+   Q+QD G  +AL+LD+ +GSGF +KNEYLFGRFDMQ+KLV G SAG
Sbjct  22   NFYQDATVTFGDQRAQIQDGGRLLALSLDKISGSGFQSKNEYLFGRFDMQLKLVPGNSAG  81

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTFYL+S  G  HDE+DFEFLGN++ QPYTVHTNV++ GKG++EQQF LWFDPT+ +H
Sbjct  82   TVTTFYLSSQ-GAGHDEIDFEFLGNSSGQPYTVHTNVYSQGKGNKEQQFRLWFDPTSPFH  140

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WNSQRI++LVDN+PIRV+ NHE +GV FPK++ M+V+ SLW A DWATQGG VK 
Sbjct  141  TYSIVWNSQRIIFLVDNIPIRVFNNHEKLGVAFPKNQAMRVYASLWNADDWATQGGRVKT  200

Query  779  DWSKAPFTAYYKNFVIDGCV-----GTSSCADSK--------PWGKYALDADANNKLQGV  919
            DWS APFTA Y+NF  + CV      TSSC  SK         W    L+ +  N+L+ V
Sbjct  201  DWSMAPFTASYRNFNTNACVWSAASSTSSCGGSKTDSVNNDQAWQTQELNGNDRNRLRWV  260

Query  920  RTKNRVYNYCTDNKRFGGNPPAECK  994
            + K  +YNYC D KRF      ECK
Sbjct  261  QQKYMIYNYCADAKRFSQGLSPECK  285



>gb|ACD03217.1| xyloglucan endotransglucosylase/hydrolase 7 [Actinidia deliciosa]
Length=294

 Score =   317 bits (813),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 152/287 (53%), Positives = 199/287 (69%), Gaps = 20/287 (7%)
 Frame = +2

Query  167  MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
            M+M++ +++C +     +          DV++ +GN  G++ + G  + L+LD  +GSGF
Sbjct  12   MLMLVMLMSCLVSSSYGSF--------EDVEITWGNGRGKILNGGQLLTLSLDNYSGSGF  63

Query  347  NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
             +KNEYLFGR DMQ+KLV G SAGTVTT+YL+S  G  HDE+DFEFLGN + QPYTVHTN
Sbjct  64   QSKNEYLFGRIDMQLKLVPGNSAGTVTTYYLSSQ-GATHDEIDFEFLGNVSGQPYTVHTN  122

Query  527  VFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKS  706
            VFA GKG+REQQFHLWFDPT ++H YTI+WN QRI++LVDN+PIRV+ N+E +GVPFP S
Sbjct  123  VFAQGKGNREQQFHLWFDPTTSFHTYTILWNPQRIIFLVDNIPIRVFNNNEAIGVPFPTS  182

Query  707  KPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCV-----------GTSSC  853
            +PM+V+ S W A DWATQGG VK DW+ APFTA YKNF  + CV            T S 
Sbjct  183  QPMRVYSSFWNADDWATQGGRVKTDWTHAPFTASYKNFNANACVHSSGSSSCGSQSTKSI  242

Query  854  ADSKPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
            ++ + W    LDA+   +L+ V+ K  +YNYCTD +RF    P ECK
Sbjct  243  SNDQAWQTQDLDANGRKRLRWVQQKFMIYNYCTDTQRFPQGLPLECK  289



>ref|XP_002306736.2| xyloglucan endo-1 family protein [Populus trichocarpa]
 gb|EEE93732.2| xyloglucan endo-1 family protein [Populus trichocarpa]
Length=294

 Score =   317 bits (812),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 152/285 (53%), Positives = 202/285 (71%), Gaps = 16/285 (6%)
 Frame = +2

Query  167  MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
            M +   ++AC L+G ++       NF  D  + +G+   ++ + G  + L+LD+ +GSGF
Sbjct  12   MPLFASLLAC-LLGASMGG-----NFFQDFDITWGDQRAKILNGGQLLTLSLDKDSGSGF  65

Query  347  NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
             +KNEYLFGR DMQ+KLV G SAGTVTT+YL+S  G  HDE+DFEFLGN T +PYT+HTN
Sbjct  66   RSKNEYLFGRIDMQIKLVSGNSAGTVTTYYLSSQ-GPTHDEIDFEFLGNVTGEPYTLHTN  124

Query  527  VFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKS  706
            VF+ GKG++EQQF+LWFDPT A+H Y+I+WN QRI++LVDN+PIRV+ N E++GVPFP  
Sbjct  125  VFSQGKGNKEQQFYLWFDPTKAFHTYSIVWNQQRIIFLVDNIPIRVFHNSESIGVPFPTK  184

Query  707  KPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGT--SSCADSKP----  868
            +PM+++ SLW A DWAT+GG VK DW++APFTA Y+NF    CV +  SSC  + P    
Sbjct  185  QPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFKASACVSSPGSSCTSTSPNSLQ  244

Query  869  ---WGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
               W   ALDA   N+L+ V+ K  +YNYCTD KRF    PAECK
Sbjct  245  DSTWQVQALDASGRNRLRWVQQKYMIYNYCTDLKRFPQGIPAECK  289



>ref|XP_009356637.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Pyrus 
x bretschneideri]
Length=295

 Score =   317 bits (811),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 151/287 (53%), Positives = 199/287 (69%), Gaps = 16/287 (6%)
 Frame = +2

Query  167  MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
            M+ ++ +   SL+     +     NF  D  + FG+   ++ + G  + LNLD+ +GSGF
Sbjct  10   MMFLLSLFTTSLM----VMTASAGNFFQDFDITFGDGRAKILNGGQLLTLNLDKASGSGF  65

Query  347  NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
             +KNEYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN+T +PYT+HTN
Sbjct  66   KSKNEYLFGRIDMQIKLVSGNSAGTVTAYYLSSE-GPTHDEIDFEFLGNSTGEPYTLHTN  124

Query  527  VFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKS  706
            VF+ GKG+REQQF LWFDPT  +H Y+I+WNSQRI++LVDN+PIRV+ N E+ GVPFPK+
Sbjct  125  VFSQGKGNREQQFQLWFDPTKTFHTYSIVWNSQRIIFLVDNIPIRVFNNLESAGVPFPKN  184

Query  707  KPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGT--SSCA--------  856
            +PM+++ SLW A DWAT+GG VK DW++APFTA Y+NF  + C  +  SSCA        
Sbjct  185  QPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFKANACTASSPSSCASTTSTNSL  244

Query  857  -DSKPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
             +   W    LDA   N+L+ V+ K  VYNYC+D KRF    PAECK
Sbjct  245  TEQSAWKTQGLDAAGRNRLRWVQQKFMVYNYCSDLKRFPQGLPAECK  291



>ref|XP_008341405.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Malus 
domestica]
Length=294

 Score =   317 bits (811),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 153/290 (53%), Positives = 201/290 (69%), Gaps = 16/290 (6%)
 Frame = +2

Query  158  QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
            +V MI+ + +   SL+ +A        NF  D  + FG+   ++ D G  + LNLDQ +G
Sbjct  6    KVLMILFLSLFINSLMAMAAQAG----NFYQDFDVTFGDGRAKILDGGKLLTLNLDQVSG  61

Query  338  SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
            SGF +KNEYLFGR DMQ+KLV G SAGTVTT+YL+S  G  HDE+DFEFLGN+T +PYT+
Sbjct  62   SGFKSKNEYLFGRIDMQIKLVPGNSAGTVTTYYLSSE-GLTHDEIDFEFLGNSTGEPYTL  120

Query  518  HTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPF  697
            HTNVF+ GKG REQQFHLWFDPT  +H Y+I+WN Q I++LVD++PIRV+ N E+ GVPF
Sbjct  121  HTNVFSQGKGGREQQFHLWFDPTKTFHTYSIVWNRQNIIFLVDSIPIRVFNNLESAGVPF  180

Query  698  PKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVG--TSSCADSKP-  868
            PK++PM+V+ SLW A +WAT+GG VK +W+ APFTA Y+NF  D C+   +SSCA + P 
Sbjct  181  PKTQPMRVYSSLWNADEWATRGGLVKTNWTLAPFTATYRNFKADACIAGSSSSCASTIPT  240

Query  869  --------WGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
                    W    +DA    +L+ V+ K  +YNYC+D KRF    PAECK
Sbjct  241  NPLTEKSAWETQGIDAAGRKRLRWVQQKFMIYNYCSDFKRFPEGLPAECK  290



>gb|AAR37363.1| xyloglucan endo-transglycosylase, partial [Nicotiana attenuata]
Length=257

 Score =   315 bits (806),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 151/252 (60%), Positives = 184/252 (73%), Gaps = 15/252 (6%)
 Frame = +2

Query  281  GQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQA  460
             Q+QD G  + L+LD+ +GSGF +KNE+LFGRFDMQ+KLV G SAGTVTTFYL+S  G  
Sbjct  3    AQIQDGGRLLTLSLDKISGSGFQSKNEFLFGRFDMQLKLVPGNSAGTVTTFYLSSQ-GAG  61

Query  461  HDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWL  640
            HDE+DFEFLGN++ QPYTVHTNV++ GKG++EQQFHLWFDPT ++H Y+IIWNSQRI++L
Sbjct  62   HDEIDFEFLGNSSGQPYTVHTNVYSQGKGNKEQQFHLWFDPTTSFHTYSIIWNSQRIIFL  121

Query  641  VDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNF  820
            VDN+PIRVY NHE +GV FPK++ M+V+ SLW A DWATQGG VK DWS APFTA Y+NF
Sbjct  122  VDNIPIRVYNNHEALGVAFPKNQAMRVYASLWNADDWATQGGRVKTDWSMAPFTASYRNF  181

Query  821  VIDGCV-----GTSSCADSKP---------WGKYALDADANNKLQGVRTKNRVYNYCTDN  958
              + CV      TSSC  SK          W    LDA+  N+L+ V+ K   YNYC D 
Sbjct  182  NTNACVWSAASSTSSCGGSKSTDSVNNDQTWQTQELDANGRNRLRWVQQKYMTYNYCADV  241

Query  959  KRFGGNPPAECK  994
             RF    P ECK
Sbjct  242  ARFSQGIPPECK  253



>ref|XP_008229401.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Prunus 
mume]
Length=282

 Score =   315 bits (808),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 146/279 (52%), Positives = 196/279 (70%), Gaps = 6/279 (2%)
 Frame = +2

Query  158  QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
            +V M++++ +   SL+ +  +      NF  D  + FG    ++   G  + L+LD+ +G
Sbjct  6    EVSMVLVVSLFVTSLMAITASAG----NFYQDFDITFGGERAKILTGGQLLTLSLDKFSG  61

Query  338  SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
            SGF +KNEYL GR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PYT+
Sbjct  62   SGFKSKNEYLLGRIDMQIKLVSGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTL  120

Query  518  HTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPF  697
            HTNVF+ GKG+REQQFHLWFDPT A+H Y+I+WNSQRI++LVDN+PIRV+ N E +GVPF
Sbjct  121  HTNVFSQGKGNREQQFHLWFDPTKAFHTYSIVWNSQRIIFLVDNIPIRVFHNLETIGVPF  180

Query  698  PKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTSSCADSKPWGK  877
            PK++PM+++ SLW A DWAT+GG VK DW++APFTA Y+NF       T+S  +   W  
Sbjct  181  PKNQPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFQAS-TTSTNSLTEQSAWQT  239

Query  878  YALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
              LDA   N+L+ V+ K  +YNYC+D KRF    PAEC+
Sbjct  240  QGLDAAGRNRLRWVQQKFMIYNYCSDLKRFPQGLPAECR  278



>ref|XP_009356635.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16 [Pyrus x bretschneideri]
Length=274

 Score =   314 bits (805),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/263 (56%), Positives = 190/263 (72%), Gaps = 12/263 (5%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  D  + FG+   ++ + G  + LNLD+ +GSGF +KNEYLFGR DMQ+KLV G SAG
Sbjct  9    NFFQDFDITFGDGRAKILNGGQLLTLNLDKASGSGFKSKNEYLFGRIDMQIKLVSGNSAG  68

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G  HDE+DFEFLGN+T +PYT+HTNVF+ GKG+REQQF LWFDPT  +H
Sbjct  69   TVTAYYLSSE-GPTHDEIDFEFLGNSTGEPYTLHTNVFSQGKGNREQQFQLWFDPTKTFH  127

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WNSQRI++LVDN+PIRV+ N E+ GVPFPK++PM+++ SLW A DWAT+GG VK 
Sbjct  128  TYSIVWNSQRIIFLVDNIPIRVFNNLESAGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  187

Query  779  DWSKAPFTAYYKNFVIDGCVGT--SSCA---------DSKPWGKYALDADANNKLQGVRT  925
            DW++APFTA Y+NF  + C  +  SSCA         +   W    LDA   N+L+ V+ 
Sbjct  188  DWTQAPFTASYRNFKANACTASSPSSCASTTSTNSLTEQSAWKTQGLDAAGRNRLRWVQQ  247

Query  926  KNRVYNYCTDNKRFGGNPPAECK  994
            K  VYNYC+D KRF    PAECK
Sbjct  248  KFMVYNYCSDLKRFPQGLPAECK  270



>ref|XP_011082924.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase 2-like [Sesamum 
indicum]
Length=288

 Score =   315 bits (806),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 147/253 (58%), Positives = 192/253 (76%), Gaps = 2/253 (1%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  D ++ +G+   ++ + G  ++L+LDQ +GSGF +KNEYLFGRFD+Q+KLV G SAG
Sbjct  33   NFYRDAEITWGDGRAKILEGGRGLSLSLDQYSGSGFQSKNEYLFGRFDLQLKLVPGNSAG  92

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTF+L+S  G+ HDE+DFEFLGN + +PYTVHTNV+A GKGD+EQQFHL  +PTAA+H
Sbjct  93   TVTTFFLSSQ-GEGHDEIDFEFLGNVSGEPYTVHTNVYAGGKGDKEQQFHLRSNPTAAFH  151

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+W+ QRI++LVDN PIRV+ NH ++G+PFP S+PM+V CSLW A DWATQGG VK 
Sbjct  152  TYSIVWHPQRIIFLVDNSPIRVFNNHNSIGIPFPTSQPMRVHCSLWNADDWATQGGRVKT  211

Query  779  DWSKAPFTAYYKNFVIDGC-VGTSSCADSKPWGKYALDADANNKLQGVRTKNRVYNYCTD  955
            DW+KAPF AYY+NF IDGC VGTS  +         LDA   N+++ V+ K+ +YNYC D
Sbjct  212  DWTKAPFVAYYRNFKIDGCPVGTSGGSCGFQSQTQELDAKGRNRMRWVQQKHMIYNYCAD  271

Query  956  NKRFGGNPPAECK  994
             +RF     AECK
Sbjct  272  VRRFPQGSSAECK  284



>gb|EYU29581.1| hypothetical protein MIMGU_mgv1a022262mg [Erythranthe guttata]
Length=272

 Score =   314 bits (804),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 151/271 (56%), Positives = 195/271 (72%), Gaps = 7/271 (3%)
 Frame = +2

Query  182  GVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNE  361
            G+    L+   +A  P   NF  D ++ +G+   ++ D G  ++L+LDQ +GSGF +KNE
Sbjct  5    GISLFVLLACLVAAAPSTANFIRDAEITWGDGRAKIVDGGRGLSLSLDQFSGSGFQSKNE  64

Query  362  YLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADG  541
            YLFGRFDMQ+KLV   SAGTVTTF+L+S  G+ HDE+DFEFLGN+T +PYTVHTNV+A G
Sbjct  65   YLFGRFDMQLKLVPDNSAGTVTTFFLSSQ-GEGHDEIDFEFLGNSTGEPYTVHTNVYAQG  123

Query  542  KGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKV  721
            KGD+EQQF LWFDPTAA+H Y+I+WN QRI++LVDN PIRV+ NH+  GV FP S+PM+V
Sbjct  124  KGDKEQQFKLWFDPTAAFHTYSIVWNPQRIIFLVDNSPIRVFNNHKASGVQFPTSQPMRV  183

Query  722  FCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTSSCADSKPWGKYALDADAN  901
            +CSLW A DWATQGG VK DW+KAPF A Y+NF I+ C   + CA       + LD++  
Sbjct  184  YCSLWNADDWATQGGRVKTDWAKAPFVANYRNFKIESCAAGTPCA------SHELDSNGR  237

Query  902  NKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
            N+L+ V+ K+ VYNYC D  RF      ECK
Sbjct  238  NRLRWVQQKHMVYNYCADATRFPLGTSIECK  268



>ref|NP_001274880.1| probable xyloglucan endotransglucosylase/hydrolase protein 15-like 
precursor [Solanum tuberosum]
 emb|CAJ77496.1| putative xyloglucan endotransglycosylase precursor [Solanum tuberosum]
Length=287

 Score =   313 bits (803),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 150/267 (56%), Positives = 192/267 (72%), Gaps = 14/267 (5%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  D  + FG+   Q+QD G  +AL+LD+ +GSGF +KNEYLFGRFDMQ+KLV G SAG
Sbjct  20   NFYQDATVTFGDQRAQIQDGGRLLALSLDKISGSGFQSKNEYLFGRFDMQLKLVPGNSAG  79

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTF L+S  G  HDE+DFEFLGN++ +PYTVHTNV++ GKG++EQQF LWFDPT+++H
Sbjct  80   TVTTFLLSSQ-GAGHDEIDFEFLGNSSGKPYTVHTNVYSQGKGNKEQQFRLWFDPTSSFH  138

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WNSQRI++LVDN+PIRV+ NHE +GV FPK++ M+V+ SLW A DWATQGG VK 
Sbjct  139  TYSIVWNSQRIIFLVDNIPIRVFNNHEALGVAFPKNQAMRVYASLWNADDWATQGGRVKT  198

Query  779  DWSKAPFTAYYKNFVIDGCV-----GTSSCADSK--------PWGKYALDADANNKLQGV  919
            DWS APFTA Y+NF  + CV      TSSC  SK         W    L+A+  N+++ V
Sbjct  199  DWSMAPFTASYRNFNTNACVWSAATSTSSCGGSKTESVNNDQTWQSQQLNANGRNRVRWV  258

Query  920  RTKNRVYNYCTDNKRFGGNPPAECKPA  1000
            + K  +YNYC D  RF      ECK +
Sbjct  259  QQKYMIYNYCADANRFSQGFSPECKRS  285



>ref|XP_011044805.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Populus 
euphratica]
Length=342

 Score =   315 bits (808),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 146/261 (56%), Positives = 191/261 (73%), Gaps = 10/261 (4%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  D  + +G+   ++ + G  + L+LD+ +GSGF +KNEYLFGR DMQ+KLV G SAG
Sbjct  78   NFFQDFDITWGDQRAKILNGGQLLTLSLDKDSGSGFRSKNEYLFGRIDMQIKLVSGNSAG  137

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTT+YL+S  G  HDE+DFEFLGN T +PYT+HTNVF+ GKG++EQQF+LWFDPT A+H
Sbjct  138  TVTTYYLSSQ-GPTHDEIDFEFLGNVTGEPYTLHTNVFSQGKGNKEQQFYLWFDPTKAFH  196

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN QRI++LVDN+P+RV+ N E++GVPFP  +PM+++ SLW A DWAT+GG VK 
Sbjct  197  TYSIVWNQQRIIFLVDNIPLRVFHNSESIGVPFPTKQPMRIYSSLWNADDWATRGGLVKT  256

Query  779  DWSKAPFTAYYKNFVIDGCVGT--SSCADSKP-------WGKYALDADANNKLQGVRTKN  931
            DW++APFTA Y+NF    CV +  SSC  + P       W   ALDA   N+L+ V+ K 
Sbjct  257  DWTQAPFTASYRNFKATACVRSPGSSCTSTSPNSVEDSTWQVQALDASGRNRLRWVQQKY  316

Query  932  RVYNYCTDNKRFGGNPPAECK  994
             +YNYCTD KRF    PAECK
Sbjct  317  MIYNYCTDLKRFPQGIPAECK  337



>gb|EYU29580.1| hypothetical protein MIMGU_mgv1a018934mg [Erythranthe guttata]
Length=272

 Score =   313 bits (802),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 150/271 (55%), Positives = 195/271 (72%), Gaps = 7/271 (3%)
 Frame = +2

Query  182  GVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNE  361
            G+    L+   +A  P   NF  D ++ +G+   ++ D G  ++L+LDQ +GSGF +KNE
Sbjct  5    GISLFVLLACLVAAAPSTANFIRDAEITWGDGRAKIVDGGRGLSLSLDQFSGSGFQSKNE  64

Query  362  YLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADG  541
            YLFGRFDMQ+KLV   SAGTVTTF+L+S  G+ HDE+DFEFLGN+T +PYTVHTNV+A G
Sbjct  65   YLFGRFDMQLKLVPDNSAGTVTTFFLSSQ-GEGHDEIDFEFLGNSTGEPYTVHTNVYAQG  123

Query  542  KGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKV  721
            KGD+EQQF LWFDPTAA+H Y+I+WN QRI++LVDN PIRV+ NH+  GV FP S+PM+V
Sbjct  124  KGDKEQQFKLWFDPTAAFHTYSIVWNPQRIIFLVDNSPIRVFNNHKASGVQFPTSQPMRV  183

Query  722  FCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTSSCADSKPWGKYALDADAN  901
            +CSLW A DWATQGG VK DW+KAPF A Y+NF I+ C   + CA       + LD++  
Sbjct  184  YCSLWNADDWATQGGRVKTDWAKAPFVANYRNFKIESCAAGTPCA------SHELDSNGR  237

Query  902  NKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
            N+L+ V+ K+ +YNYC D  RF      ECK
Sbjct  238  NRLRWVQQKHMLYNYCADATRFPLGTSIECK  268



>ref|XP_004303861.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16-like [Fragaria vesca subsp. vesca]
Length=297

 Score =   313 bits (803),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 147/266 (55%), Positives = 188/266 (71%), Gaps = 16/266 (6%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  D  + FG    ++ + G  + L+LDQ +GSGF +KNEYLFGR DMQ++LV G SAG
Sbjct  28   NFYQDFDITFGEQRAKILNGGQLLTLDLDQYSGSGFKSKNEYLFGRIDMQIRLVAGNSAG  87

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G  HDE+DFEFLGN+T +PYT+HTNVF+ GKG+REQQFHLWFDPT A+H
Sbjct  88   TVTAYYLSSQ-GPTHDEIDFEFLGNSTGEPYTLHTNVFSQGKGNREQQFHLWFDPTKAFH  146

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+++WNSQRI++LVDN+PIRV+ N E+VGVPFPK++PM+++ SLW A DWATQGG VK 
Sbjct  147  TYSLVWNSQRIIFLVDNIPIRVFNNLESVGVPFPKNQPMRIYSSLWNADDWATQGGRVKT  206

Query  779  DWSKAPFTAYYKNFVIDGCVG---TSSCA------------DSKPWGKYALDADANNKLQ  913
            DW+ APFTA Y+NF  + CV    +SSC               + W    LDA   N+++
Sbjct  207  DWTHAPFTASYRNFKANACVAGSSSSSCGVTTSASTNSLTDQQRSWHNQGLDAAGRNRIR  266

Query  914  GVRTKNRVYNYCTDNKRFGGNPPAEC  991
             V+ K  VYNYC D KRF    P EC
Sbjct  267  WVQQKFMVYNYCADLKRFPQGLPVEC  292



>ref|NP_001234207.1| xyloglycan endo-transglycosylase precursor [Solanum lycopersicum]
 emb|CAA58002.1| xyloglycan endo-transglycosylase [Solanum lycopersicum]
Length=287

 Score =   313 bits (801),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/265 (56%), Positives = 190/265 (72%), Gaps = 14/265 (5%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  D  + FG+   Q+QD G  + L+LD+ +GSGF +KNEYLFGRFDMQ+KLV G SAG
Sbjct  20   NFYQDAAVTFGDQRAQIQDGGRLLTLSLDKISGSGFQSKNEYLFGRFDMQLKLVPGNSAG  79

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTFYL+S  G  HDE+DFEFLGN++  PYTVHTNV++ GKG++EQQF LWFDPT+++H
Sbjct  80   TVTTFYLSSQ-GAGHDEIDFEFLGNSSGLPYTVHTNVYSQGKGNKEQQFRLWFDPTSSFH  138

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WNSQRI++LVDN+PIRV+ NHE +GV +PK++ M+V+ SLW A DWATQGG VK 
Sbjct  139  TYSIVWNSQRIIFLVDNIPIRVFNNHEALGVAYPKNQAMRVYASLWNADDWATQGGRVKT  198

Query  779  DWSKAPFTAYYKNFVIDGCV-----GTSSCADSK--------PWGKYALDADANNKLQGV  919
            DWS APFTA Y+NF  + CV      TSSC  SK         W    L+A+  N+++ V
Sbjct  199  DWSMAPFTASYRNFNTNACVWSAATSTSSCGGSKTESVNNDETWQTQQLNANGRNRIRWV  258

Query  920  RTKNRVYNYCTDNKRFGGNPPAECK  994
            + K  +YNYC D  RF      ECK
Sbjct  259  QQKYMIYNYCADANRFSQGFSPECK  283



>ref|XP_011044804.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Populus 
euphratica]
Length=295

 Score =   313 bits (801),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 146/261 (56%), Positives = 191/261 (73%), Gaps = 10/261 (4%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  D  + +G+   ++ + G  + L+LD+ +GSGF +KNEYLFGR DMQ+KLV G SAG
Sbjct  31   NFFQDFDITWGDQRAKILNGGQLLTLSLDKDSGSGFRSKNEYLFGRIDMQIKLVSGNSAG  90

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTT+YL+S  G  HDE+DFEFLGN T +PYT+HTNVF+ GKG++EQQF+LWFDPT A+H
Sbjct  91   TVTTYYLSSQ-GPTHDEIDFEFLGNVTGEPYTLHTNVFSQGKGNKEQQFYLWFDPTKAFH  149

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN QRI++LVDN+PIRV+ N E++GVPFP  +PM+++ SLW A DWAT+GG VK 
Sbjct  150  TYSIVWNQQRIIFLVDNIPIRVFHNSESIGVPFPTKQPMRIYSSLWNADDWATRGGLVKT  209

Query  779  DWSKAPFTAYYKNFVIDGCVGT--SSCADSKP-------WGKYALDADANNKLQGVRTKN  931
            DW++APFTA Y+NF    CV +  SSC  + P       W   ALDA   N+L+ V+ K 
Sbjct  210  DWTQAPFTASYRNFKAPACVRSPGSSCTATSPNSVEDSTWQVQALDASGRNRLRWVQQKY  269

Query  932  RVYNYCTDNKRFGGNPPAECK  994
             +YNYC+D KRF    PAECK
Sbjct  270  MIYNYCSDLKRFPQGIPAECK  290



>ref|XP_007215773.1| hypothetical protein PRUPE_ppa009608mg [Prunus persica]
 gb|EMJ16972.1| hypothetical protein PRUPE_ppa009608mg [Prunus persica]
Length=285

 Score =   312 bits (800),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/281 (53%), Positives = 198/281 (70%), Gaps = 7/281 (2%)
 Frame = +2

Query  158  QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
            +V M++++ +   SL+ +  +      NF  D  + FG    ++ + G  + LNLD+ +G
Sbjct  6    EVSMVLVVSLFVTSLMALTASAG----NFYQDFDITFGGERAKILNGGQLLTLNLDKFSG  61

Query  338  SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
            SGF +KNEYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PYT+
Sbjct  62   SGFKSKNEYLFGRIDMQIKLVSGNSAGTVTAYYLSSE-GPTHDEIDFEFLGNLSGDPYTL  120

Query  518  HTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPF  697
            HTNVF+ GKG+REQQFHLWFDPT A+H Y+I+WNSQRI++LVDN+PIRV+ N E +GVPF
Sbjct  121  HTNVFSQGKGNREQQFHLWFDPTKAFHTYSIVWNSQRIIFLVDNIPIRVFHNLETIGVPF  180

Query  698  PKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVI--DGCVGTSSCADSKPW  871
            PK++PM+++ SLW A DWAT+GG VK DW++APFTA Y+NF +       T+S  +   W
Sbjct  181  PKNQPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFKVSTTTSTSTNSLTEQSEW  240

Query  872  GKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
                LDA   N+L+ V+ K  VYNYC+D KRF    P EC+
Sbjct  241  QTQGLDAAGRNRLRWVQQKFMVYNYCSDLKRFPQGLPVECR  281



>ref|XP_008229405.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Prunus 
mume]
Length=288

 Score =   312 bits (800),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 149/281 (53%), Positives = 198/281 (70%), Gaps = 7/281 (2%)
 Frame = +2

Query  158  QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
            +V M+ I+ +V  SL+ +  +      NF  D  + FG+   ++ + G  + LNLD+ +G
Sbjct  9    KVSMVFILSLVITSLMAMTASAG----NFFQDFDVTFGDERAKILNGGQLLTLNLDKASG  64

Query  338  SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
            SGF +KNEYL GR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PYT+
Sbjct  65   SGFKSKNEYLLGRIDMQIKLVSGNSAGTVTAYYLSSE-GPTHDEIDFEFLGNLSGDPYTL  123

Query  518  HTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPF  697
            HTNVF+ GKG+REQQFHLWFDPT A+H Y+I+WNSQRI++LVDN+PIRV+ N E +GVPF
Sbjct  124  HTNVFSQGKGNREQQFHLWFDPTKAFHTYSIVWNSQRIIFLVDNIPIRVFTNLETIGVPF  183

Query  698  PKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVI--DGCVGTSSCADSKPW  871
            PK++PM+++ SLW A DWAT+GG VK DW++APFTA Y+NF +       T+S  +   W
Sbjct  184  PKNQPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFKVSTTTSTSTNSLTEQSAW  243

Query  872  GKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
                LDA   N+L+ V+ K  VYNYC+D KRF    P EC+
Sbjct  244  PTQGLDAAGRNRLRWVQQKFMVYNYCSDLKRFPQGLPVECR  284



>ref|XP_009597028.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Nicotiana 
tomentosiformis]
Length=300

 Score =   312 bits (799),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 146/266 (55%), Positives = 191/266 (72%), Gaps = 15/266 (6%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  D  + +G+    +Q+ G  + L+LD+ +GSGF +K+E+LFGRFDMQ+KL+ G SAG
Sbjct  32   NFYQDATVTWGDQRAHIQEGGRLLTLSLDKISGSGFQSKSEFLFGRFDMQLKLIPGNSAG  91

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTFYL+S  G  HDE+DFEFLGN++ QPYTVHTNV++ GKG++EQQFHLWFDPT ++H
Sbjct  92   TVTTFYLSSQ-GAGHDEIDFEFLGNSSGQPYTVHTNVYSQGKGNKEQQFHLWFDPTTSFH  150

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+IIWN+QRI++LVDN+PIRVY NHE +GV FPK++ M+V+ SLW A DWATQGG VK 
Sbjct  151  TYSIIWNAQRIIFLVDNIPIRVYNNHEALGVAFPKNQAMRVYASLWNADDWATQGGRVKT  210

Query  779  DWSKAPFTAYYKNFVIDGCVGTS--------------SCADSKPWGKYALDADANNKLQG  916
            DWS APFTA Y+NF  + CV ++              S  + + W    LDA+  N+L+ 
Sbjct  211  DWSMAPFTASYRNFNTNACVWSAASSTSSCGGSTSTDSANNDQTWQTQELDANGRNRLRW  270

Query  917  VRTKNRVYNYCTDNKRFGGNPPAECK  994
            V+ K   YNYCTD +RF    P ECK
Sbjct  271  VQQKYMTYNYCTDAQRFNQVIPPECK  296



>ref|XP_007217342.1| hypothetical protein PRUPE_ppa020825mg [Prunus persica]
 gb|EMJ18541.1| hypothetical protein PRUPE_ppa020825mg [Prunus persica]
Length=260

 Score =   310 bits (795),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 143/252 (57%), Positives = 184/252 (73%), Gaps = 2/252 (1%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  D  + FG+   ++ + G  + LNLD+ +GSGF +KNEYL GR DMQ+KLV G SAG
Sbjct  7    NFFQDFDVTFGDQRAKILNGGQLLTLNLDKASGSGFKSKNEYLLGRIDMQIKLVSGNSAG  66

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNVF+ GKG+REQQFHLWFDPT A+H
Sbjct  67   TVTAYYLSSE-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGNREQQFHLWFDPTEAFH  125

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WNSQRI++LVDN+PIRV+ N E +GVPFPK++PM+++ SLW A DWAT+GG VK 
Sbjct  126  TYSIVWNSQRIIFLVDNIPIRVFTNLETIGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  185

Query  779  DWSKAPFTAYYKNFVIDGCVGTSSCADSKPWGKYALDADANNKLQGVRTKNRVYNYCTDN  958
            DW++APFTA Y+NF       T+S  +   W    LDA   N+L+ V+ K  VYNYC+D 
Sbjct  186  DWTQAPFTASYRNFQA-STTSTNSLTEQSAWQTQGLDAAGRNRLRWVQQKFMVYNYCSDL  244

Query  959  KRFGGNPPAECK  994
            KRF    P EC+
Sbjct  245  KRFPQGLPVECR  256



>ref|XP_009356633.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Pyrus 
x bretschneideri]
Length=294

 Score =   311 bits (796),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 151/290 (52%), Positives = 200/290 (69%), Gaps = 16/290 (6%)
 Frame = +2

Query  158  QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
            +V MI+ + +   SL+ +A        NF  D  + FG+   ++ D G  + LNLDQ +G
Sbjct  6    KVSMILFLSLFINSLMAMAAQAG----NFYQDFDITFGDGRAKILDRGKLLTLNLDQVSG  61

Query  338  SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
            SGF +KNEYLFGR DMQ+KLV G SAGTVTT+YL+S  G  HDE+DFEFLGN+T +PYT+
Sbjct  62   SGFKSKNEYLFGRIDMQIKLVPGNSAGTVTTYYLSSE-GLTHDEIDFEFLGNSTGEPYTL  120

Query  518  HTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPF  697
            HTNVF+ GKG REQQFHLWFDPT  +H Y+I+W+ Q I++LVD++PIRV+ N E+ GVPF
Sbjct  121  HTNVFSQGKGGREQQFHLWFDPTKTFHTYSIVWSRQNIIFLVDSIPIRVFNNLESAGVPF  180

Query  698  PKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVG--TSSCADSKP-  868
            PK++PM+V+ SLW A D AT+GG VK +W+ APFTA Y+NF  + C+   +SSCA + P 
Sbjct  181  PKTQPMRVYSSLWNAEDGATRGGLVKTNWTLAPFTATYRNFKANACIAGSSSSCASTIPT  240

Query  869  --------WGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
                    W    +DA    +L+ V+ K  +YNYC+D KRF    PAECK
Sbjct  241  NPLTEKSAWETQGIDAAGRKRLRWVQQKFMIYNYCSDFKRFPEGLPAECK  290



>ref|XP_008229400.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Prunus 
mume]
Length=285

 Score =   310 bits (795),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/281 (52%), Positives = 197/281 (70%), Gaps = 7/281 (2%)
 Frame = +2

Query  158  QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
            +V M++++ +   SL+ +  +      NF  D  + FG    ++ + G  + LNLD+ +G
Sbjct  6    EVSMVLVVSLFVTSLMAMTASAG----NFYQDFDITFGGERAKILNGGQLLTLNLDKFSG  61

Query  338  SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
            SGF +KNEYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PYT+
Sbjct  62   SGFKSKNEYLFGRIDMQIKLVSGNSAGTVTAYYLSSE-GPTHDEIDFEFLGNLSGDPYTL  120

Query  518  HTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPF  697
            HTNVF+ GKG+REQQF LWFDPT A+H Y+I+WNSQRI++LVDN+PIRV+ N E +GVPF
Sbjct  121  HTNVFSQGKGNREQQFQLWFDPTKAFHTYSIVWNSQRIIFLVDNIPIRVFHNLETIGVPF  180

Query  698  PKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVI--DGCVGTSSCADSKPW  871
            PKS+PM+++ SLW A DWAT+GG VK DW++APFTA Y+NF +       T+S  +   W
Sbjct  181  PKSQPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFKVSTTASTSTNSLTEQSAW  240

Query  872  GKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
                LDA   N+++ V+ K  VYNYC+D KRF    P EC+
Sbjct  241  QTQGLDAAGRNRIRWVQQKFMVYNYCSDLKRFPQGLPVECR  281



>emb|CDP15955.1| unnamed protein product [Coffea canephora]
Length=291

 Score =   310 bits (794),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/263 (57%), Positives = 193/263 (73%), Gaps = 12/263 (5%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  D    FG+   ++ + G  ++L+LD+ +GSGF +KNEYLFGRFDMQ+KLV G SAG
Sbjct  26   NFYQDAVTTFGDQRVKIAEGGRLLSLSLDKSSGSGFQSKNEYLFGRFDMQLKLVPGNSAG  85

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTFYL+S +GQ HDE+DFEFLGNA+ QPYT+HTNV++ GKGD+EQQF LWFDPT  +H
Sbjct  86   TVTTFYLSS-VGQGHDEIDFEFLGNASGQPYTLHTNVYSQGKGDKEQQFKLWFDPTTFFH  144

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             YTI+WNSQRI++LVDN+PIRVY NHE +GVPFPK++PM+V+CS W A DWATQGG VK 
Sbjct  145  TYTIVWNSQRIIFLVDNIPIRVYNNHEAIGVPFPKNQPMRVYCSFWNADDWATQGGQVKT  204

Query  779  DWSKAPFTAYYKNFVIDG--CVGTSSCA---------DSKPWGKYALDADANNKLQGVRT  925
            DW+ APFT YY+NF + G  CV  S C          +++ W    LD    N+++ V+ 
Sbjct  205  DWANAPFTVYYRNFNVKGDVCVPGSPCGSGSKSTDSLNTQEWETQGLDGKGRNRIRWVQQ  264

Query  926  KNRVYNYCTDNKRFGGNPPAECK  994
            K+ +YNYC D KR+    P ECK
Sbjct  265  KHMIYNYCADRKRYPQGLPVECK  287



>ref|XP_008348360.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Malus 
domestica]
Length=293

 Score =   310 bits (795),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/263 (57%), Positives = 189/263 (72%), Gaps = 13/263 (5%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  D  + FG+   ++ + G  + LNLDQ +GSGF +KNEYLFGR DMQ+KLV G SAG
Sbjct  29   NFYQDFDVTFGDGRAKILNGGQLLTLNLDQTSGSGFKSKNEYLFGRIDMQIKLVSGNSAG  88

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNVF+ GKG+REQQFHLWFDPT A+H
Sbjct  89   TVTAYYLSSE-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGNREQQFHLWFDPTKAFH  147

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN+QRI++LVD +PIRV+ N E+VGVPFPKS+PM+++ SLW A DWAT+GG VK 
Sbjct  148  TYSIVWNAQRIIFLVDKIPIRVFNNLESVGVPFPKSQPMRIYSSLWNADDWATRGGLVKT  207

Query  779  DWSKAPFTAYYKNFVIDGC-----------VGTSSCADSKPWGKYALDADANNKLQGVRT  925
            DW++APFTA Y+NF  D C             TSS  DS  W    LDA   N+L+ V+ 
Sbjct  208  DWTQAPFTASYRNFKADACTAGSSSSCASTASTSSVGDS-AWQTQGLDAAGRNRLRWVQQ  266

Query  926  KNRVYNYCTDNKRFGGNPPAECK  994
            K  VYNYC+D KRF    PAEC+
Sbjct  267  KFMVYNYCSDLKRFPQGLPAECR  289



>ref|XP_009356638.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Pyrus 
x bretschneideri]
Length=293

 Score =   310 bits (794),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 150/291 (52%), Positives = 200/291 (69%), Gaps = 19/291 (7%)
 Frame = +2

Query  158  QVCMIMIIGV-VACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQT  334
            ++ M++++ + + C +            NF  D  + FG+   ++ + G  + LNLDQ +
Sbjct  6    KLSMVVLLSLFITCVMA-----TAASAGNFYQDFDVTFGDGRAKILNGGQLLTLNLDQTS  60

Query  335  GSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYT  514
            GSGF +KNEYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PYT
Sbjct  61   GSGFKSKNEYLFGRIDMQIKLVSGNSAGTVTAYYLSSE-GPTHDEIDFEFLGNLSGDPYT  119

Query  515  VHTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVP  694
            +HTNVF+ GKG+REQQFHLWFDPT A+H Y+I+WN+QRI++LVD +PIRV+ N E+VG+P
Sbjct  120  LHTNVFSQGKGNREQQFHLWFDPTKAFHTYSIVWNAQRIIFLVDKIPIRVFNNLESVGIP  179

Query  695  FPKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGC-----------VG  841
            FPK++PM+++ SLW A DWAT+GG VK DW++APFTA Y+NF  D C             
Sbjct  180  FPKNQPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFKADACTAGSSSSCASTAS  239

Query  842  TSSCADSKPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
            T+S  DS  W    LDA   N+L+ V+ K  VYNYC+D KRF    PAEC+
Sbjct  240  TNSVGDS-AWQTQGLDAAGRNRLRWVQQKFMVYNYCSDLKRFPQGLPAECR  289



>ref|XP_008229402.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Prunus 
mume]
Length=279

 Score =   309 bits (792),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 141/252 (56%), Positives = 185/252 (73%), Gaps = 2/252 (1%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  D  + FG+   ++ + G  + LNLD+ +GSGF +KNEYL GR DMQ+KLV G SAG
Sbjct  26   NFYQDFDVTFGDERAKILNGGQLLTLNLDKFSGSGFKSKNEYLLGRIDMQIKLVSGNSAG  85

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNVF+ GKG+REQQF+LWFDPT A+H
Sbjct  86   TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGNREQQFNLWFDPTKAFH  144

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WNSQRI++LVDN+PIRV+ N E +GVPFPK++PM+++ SLW A DWAT+GG VK 
Sbjct  145  TYSIVWNSQRIIFLVDNIPIRVFTNLETIGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  204

Query  779  DWSKAPFTAYYKNFVIDGCVGTSSCADSKPWGKYALDADANNKLQGVRTKNRVYNYCTDN  958
            DW++APFTA Y+NF +     T+S  +   W    LDA   N+L+ V+ K  +YNYC+D 
Sbjct  205  DWTQAPFTASYRNFQV-STTSTNSLTEQSAWQTQGLDAAGRNRLRWVQQKFMIYNYCSDL  263

Query  959  KRFGGNPPAECK  994
            KRF    P EC+
Sbjct  264  KRFPQGLPVECR  275



>ref|XP_006387415.1| xyloglucan endo-1 family protein, partial [Populus trichocarpa]
 gb|ERP46329.1| xyloglucan endo-1 family protein, partial [Populus trichocarpa]
Length=271

 Score =   308 bits (790),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 144/261 (55%), Positives = 190/261 (73%), Gaps = 10/261 (4%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  D  + +G+   ++ + G  + L+LD+ +GSGF +KNEYLFGR DMQ+KLV G SAG
Sbjct  7    NFFQDFDITWGDQRAKILNGGQLLTLSLDKDSGSGFRSKNEYLFGRIDMQIKLVSGNSAG  66

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTT+YL+S  G  HDE+DFEFLGN T +PYT+HTNVF+ GKG++EQQF+LWFDPT A+H
Sbjct  67   TVTTYYLSSQ-GPTHDEIDFEFLGNLTGEPYTLHTNVFSQGKGNKEQQFYLWFDPTKAFH  125

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN Q+I++LVDN+PIRV+ N E++GVPFP  +PM+++ SLW A DWAT+GG VK 
Sbjct  126  TYSIVWNQQQIIFLVDNIPIRVFHNSESIGVPFPTKQPMRIYSSLWNADDWATRGGLVKT  185

Query  779  DWSKAPFTAYYKNFVIDGCVGT--SSCADSKP-------WGKYALDADANNKLQGVRTKN  931
            DW++APFTA Y+NF    CV +  SSC  + P       W   ALDA   N+L+ V+ K 
Sbjct  186  DWTQAPFTASYRNFKASACVSSPVSSCTSTSPNSLQDSTWQVQALDASGRNRLRWVQQKY  245

Query  932  RVYNYCTDNKRFGGNPPAECK  994
             +YNYCTD KRF    PAE +
Sbjct  246  MIYNYCTDLKRFPQGIPAEMQ  266



>ref|XP_009377621.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Pyrus 
x bretschneideri]
Length=293

 Score =   309 bits (792),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 150/263 (57%), Positives = 188/263 (71%), Gaps = 13/263 (5%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  D    FG+   ++ + G  + LNLDQ +GSGF +KNEYLFGR DMQ+KLV G SAG
Sbjct  29   NFYQDFDFTFGDGRAKILNGGQLLTLNLDQASGSGFKSKNEYLFGRIDMQIKLVAGNSAG  88

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNVF+ GKG+REQQFHLWFDPT A+H
Sbjct  89   TVTAYYLSSE-GPTHDEIDFEFLGNVSGDPYTLHTNVFSQGKGNREQQFHLWFDPTKAFH  147

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN+QRI++LVDN+PIRV+ N E+VGVPFPK++PM+++ SLW A DWAT+GG VK 
Sbjct  148  TYSIVWNTQRIIFLVDNIPIRVFNNLESVGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  207

Query  779  DWSKAPFTAYYKNFVIDGC-----------VGTSSCADSKPWGKYALDADANNKLQGVRT  925
            DW+KAPFTA Y+NF  + C             T+S  DS  W    LDA   N+L+ V+ 
Sbjct  208  DWTKAPFTASYRNFKANACTAGSSSSCASTASTNSVGDS-AWQTQGLDAAGRNRLRWVQQ  266

Query  926  KNRVYNYCTDNKRFGGNPPAECK  994
            K  VYNYC D KRF    PAEC+
Sbjct  267  KFMVYNYCNDLKRFPQGLPAECR  289



>ref|XP_009127941.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24 [Brassica rapa]
 emb|CDY28174.1| BnaA01g06750D [Brassica napus]
Length=282

 Score =   309 bits (791),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 147/257 (57%), Positives = 186/257 (72%), Gaps = 7/257 (3%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            +FN+DV + +GN  G++ +NG  + L LD+ +GSGF +K EYLFG+ DMQ+KLV G SAG
Sbjct  23   DFNSDVNVAWGNGRGKILNNGQLLTLTLDKSSGSGFQSKTEYLFGKIDMQIKLVPGNSAG  82

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTFYL S  G   DE+DFEFLGN T  PYT+HTNV+  GKGD+EQQFHLWFDPTA +H
Sbjct  83   TVTTFYLKSE-GSTWDEIDFEFLGNMTGDPYTLHTNVYTQGKGDKEQQFHLWFDPTANFH  141

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN QRI+  VD+ PIR ++N E++GV FPKSKPM+++ SLW A DWAT+GG VK 
Sbjct  142  TYSILWNPQRIILTVDDTPIREFKNSESLGVLFPKSKPMRMYASLWNADDWATRGGLVKT  201

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCADSKP---WGKYALDADANNKLQGVRTKNRVY  940
            DWSKAPFTA Y+N  IDGC    G SSC  +KP   W    +D+ +  +L+ V+    +Y
Sbjct  202  DWSKAPFTASYRNIKIDGCAHSNGRSSCTSTKPTSTWYTQEMDSTSQARLRWVQKNYMIY  261

Query  941  NYCTDNKRFGGNPPAEC  991
            NYCTD KRF    P EC
Sbjct  262  NYCTDTKRFPQGIPREC  278



>ref|XP_011082930.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15 [Sesamum indicum]
Length=281

 Score =   308 bits (790),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 151/262 (58%), Positives = 191/262 (73%), Gaps = 13/262 (5%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  DV + +G+  G++ + G  + L LDQ +GSGF +KNEYLFGRFDMQ++L+ G SAG
Sbjct  19   NFYKDVNVNWGDGRGKIVEGGRGLTLLLDQYSGSGFQSKNEYLFGRFDMQLRLIPGNSAG  78

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTF+L S  G AHDE+DFEFLGN++ +PYTVHTNV+A GKGD+EQQF LWFDP+AA+H
Sbjct  79   TVTTFFLASQ-GSAHDEIDFEFLGNSSGEPYTVHTNVYAQGKGDKEQQFRLWFDPSAAFH  137

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN +RI++LVDN+PIRV+ NH   GVPFP S+PM+V CSLW A DWATQGG VK 
Sbjct  138  TYSIVWNPRRIIFLVDNIPIRVFHNHG--GVPFPTSQPMRVHCSLWNADDWATQGGRVKT  195

Query  779  DWSKAPFTAYYKNFVIDGCV-------GTSSCADS---KPWGKYALDADANNKLQGVRTK  928
            DW+KAPF AYY+NF I+ CV         S+ ADS   + W    LD+   N+L+ V  K
Sbjct  196  DWTKAPFVAYYRNFKINACVSGSIGGSCGSTSADSFGDEEWQTQELDSKGRNRLRWVHQK  255

Query  929  NRVYNYCTDNKRFGGNPPAECK  994
            + +YNYC D  RF    P ECK
Sbjct  256  HMIYNYCGDMPRFPQGIPPECK  277



>ref|NP_001280908.1| brassinosteroid-regulated protein BRU1-like precursor [Malus 
domestica]
 gb|ACD03230.1| xyloglucan endotransglucosylase/hydrolase 6 [Malus domestica]
Length=294

 Score =   308 bits (790),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 153/289 (53%), Positives = 198/289 (69%), Gaps = 17/289 (6%)
 Frame = +2

Query  161  VCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGS  340
            V M++ + +   SL+     +     NF  D  + FG+   ++ + G  + LNLDQ +GS
Sbjct  8    VNMVLFLFLFTTSLM----LMAASAGNFYQDFDVTFGDGRAKILNGGQLLTLNLDQASGS  63

Query  341  GFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVH  520
            GF +KNEYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PYT+H
Sbjct  64   GFKSKNEYLFGRIDMQIKLVAGNSAGTVTAYYLSSE-GPTHDEIDFEFLGNVSGDPYTLH  122

Query  521  TNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFP  700
            TNVF+ GKG+REQQF LWFDPT A+H Y+I+WNSQRI++LVDN+PIRV+ N E+VGVPFP
Sbjct  123  TNVFSQGKGNREQQFQLWFDPTNAFHTYSIVWNSQRIIFLVDNIPIRVFNNLESVGVPFP  182

Query  701  KSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGC-----------VGTS  847
            K++PM+++ SLW A DWAT+GG VK DW+KAPFTA Y+NF  + C             T+
Sbjct  183  KNQPMRIYSSLWNADDWATRGGLVKTDWTKAPFTASYRNFKANACTADSSSSCASTASTN  242

Query  848  SCADSKPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
            S  DS  W    LDA   N+L+ V+ K  +YNYC D KRF    PAEC+
Sbjct  243  SVGDSA-WQTQGLDAAGRNRLRWVQQKFMIYNYCNDLKRFPQGLPAECR  290



>emb|CDX68640.1| BnaC01g08130D [Brassica napus]
Length=282

 Score =   308 bits (788),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 146/257 (57%), Positives = 186/257 (72%), Gaps = 7/257 (3%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            +FN+DV + +GN  G++ +NG  + L LD+ +GSGF +K EYLFG+ DMQ+KLV G SAG
Sbjct  23   DFNSDVNVAWGNGRGKILNNGQLLTLTLDKSSGSGFQSKTEYLFGKIDMQIKLVPGNSAG  82

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTFYL S  G   DE+DFEFLGN T  PYT+HTNV+  GKGD+EQQFHLWFDPTA +H
Sbjct  83   TVTTFYLKSE-GSTWDEIDFEFLGNMTGDPYTLHTNVYTQGKGDKEQQFHLWFDPTANFH  141

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN QRI+  VD+ PIR ++N E++GV FPKSKPM+++ SLW A DWAT+GG VK 
Sbjct  142  TYSILWNPQRIILTVDDTPIREFKNSESLGVLFPKSKPMRMYASLWNADDWATRGGLVKT  201

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCADSKP---WGKYALDADANNKLQGVRTKNRVY  940
            DWSKAPFTA Y+N  +DGC    G SSC  +KP   W    +D+ +  +L+ V+    +Y
Sbjct  202  DWSKAPFTASYRNIKVDGCAHSNGRSSCTSTKPTSNWYTQEMDSTSQARLRWVQKNYMIY  261

Query  941  NYCTDNKRFGGNPPAEC  991
            NYCTD KRF    P EC
Sbjct  262  NYCTDTKRFPQGIPREC  278



>ref|XP_011016785.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15 [Populus euphratica]
Length=294

 Score =   308 bits (790),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 151/292 (52%), Positives = 201/292 (69%), Gaps = 16/292 (5%)
 Frame = +2

Query  146  KQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLD  325
            + ++   M++   + AC L+GV+        NF  D  + +G+   ++ + G  + L+LD
Sbjct  5    RSRKLSSMLLFTLLFAC-LMGVSKGG-----NFFQDFDITWGDQRAKILNGGQLLTLSLD  58

Query  326  QQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQ  505
            + +GSGF +KNEYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGNAT +
Sbjct  59   KASGSGFQSKNEYLFGRIDMQIKLVAGNSAGTVTAYYLSSQ-GSTHDEIDFEFLGNATGE  117

Query  506  PYTVHTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENV  685
            PY VHTNVF+ GKGDREQQF+LWFDPT A+H Y+I+WN QRI++LVDN+PIRV+ N E++
Sbjct  118  PYIVHTNVFSQGKGDREQQFYLWFDPTKAFHTYSIVWNQQRIIFLVDNIPIRVFHNLESI  177

Query  686  GVPFPKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGT--SSCAD  859
            GVPFP  + M++  SLW A DWAT+GG VK DW++APFTA Y+NF  + C+ +  S C  
Sbjct  178  GVPFPNKQAMRIHSSLWNADDWATRGGLVKTDWTQAPFTASYRNFKANACIWSPASPCTS  237

Query  860  SKP-------WGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
            + P       W   ALDA   N+L+ V+ K  +YNYCTD KRF    P ECK
Sbjct  238  TSPNSVQDNAWQVQALDAPGRNRLRWVQQKYMIYNYCTDLKRFPQGLPPECK  289



>ref|XP_010525737.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
20-like [Tarenaya hassleriana]
Length=283

 Score =   308 bits (788),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 144/257 (56%), Positives = 189/257 (74%), Gaps = 4/257 (2%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  DVQ+ +G+  G++ DNGN +AL+LDQ +GSGF +KNE+L+G+ + Q+KLV G SAG
Sbjct  28   NFQRDVQITWGDGRGKILDNGNLLALSLDQFSGSGFQSKNEFLYGKVEAQIKLVPGNSAG  87

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTFYL SP G   DE+DFEFLGN +  PYT+HTNV+  G+GD+EQQFHLWFDPTA +H
Sbjct  88   TVTTFYLKSP-GSTWDEIDFEFLGNLSGHPYTLHTNVYTQGRGDKEQQFHLWFDPTADFH  146

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I WN QRI++ VD +PIR ++N E++GVPFPK +PM+++ SLWEA +WAT+GG VK 
Sbjct  147  TYSITWNPQRIIFTVDGIPIREFKNFESIGVPFPKDQPMRLYASLWEADEWATRGGLVKT  206

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCADSKPWGKYALDADANNKLQGVRTKNRVYNYC  949
            DWS APF A Y+N+  +GCV   G SSC   K W    LD    N+++ V+ +  VY+YC
Sbjct  207  DWSHAPFMASYRNYNENGCVWSNGRSSCPADKAWFSQELDFKGKNRVKWVQRRYMVYDYC  266

Query  950  TDNKRFGGNPPAECKPA  1000
            TD KR+    P ECK A
Sbjct  267  TDRKRYPQGAPPECKMA  283



>ref|XP_009377610.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Pyrus 
x bretschneideri]
Length=294

 Score =   307 bits (787),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/289 (53%), Positives = 196/289 (68%), Gaps = 17/289 (6%)
 Frame = +2

Query  161  VCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGS  340
            V M++ + +   SL+     +     NF  D  + FG+   ++ + G  + LNLDQ +GS
Sbjct  8    VNMVLFLSLFTTSLM----VMAASAGNFYQDFDVTFGDGRAKILNGGQLLTLNLDQASGS  63

Query  341  GFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVH  520
            GF +KNEYL GR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PYT+H
Sbjct  64   GFKSKNEYLLGRIDMQIKLVTGNSAGTVTAYYLSSE-GPTHDEIDFEFLGNVSGDPYTLH  122

Query  521  TNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFP  700
            TNVF+ GKG+REQQF LWFDPT A+H Y+I+WNSQRI++LVDN+PIRV+ N E+VGVPFP
Sbjct  123  TNVFSQGKGNREQQFQLWFDPTNAFHTYSIVWNSQRIIFLVDNIPIRVFNNLESVGVPFP  182

Query  701  KSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGC-----------VGTS  847
            K++PM+++ SLW A DWAT+GG VK DW+KAPFTA Y+NF  + C             T+
Sbjct  183  KNQPMRIYSSLWNADDWATRGGLVKTDWTKAPFTASYRNFKANACTADSSSSCASTASTN  242

Query  848  SCADSKPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
            S  DS  W    LDA   N+L+ V  K  +YNYC D KRF    PAEC+
Sbjct  243  SVGDSA-WQTQGLDAAGRNRLRWVHQKFMIYNYCNDLKRFPQGLPAECR  290



>ref|XP_011026280.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15 isoform X1 [Populus euphratica]
Length=294

 Score =   307 bits (787),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/261 (56%), Positives = 187/261 (72%), Gaps = 10/261 (4%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  D  + +G+   ++ + G  + L+LD+ +GSGF +KNEYLFGR DMQ+KLV G SAG
Sbjct  30   NFFQDFDITWGDQRAKILNGGQLLTLSLDKASGSGFQSKNEYLFGRIDMQIKLVAGNSAG  89

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G  HDE+DFEFLGNAT +PY +HTNVF+ GKGDREQQF+LWFDPT A+H
Sbjct  90   TVTAYYLSSQ-GSTHDEIDFEFLGNATGEPYILHTNVFSQGKGDREQQFYLWFDPTKAFH  148

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN QRI++LVDN+PIRV+ N E+VGVPFP  + M++  SLW A DWAT+GG VK 
Sbjct  149  TYSIVWNKQRIIFLVDNIPIRVFHNLESVGVPFPNKQAMRIHSSLWNADDWATRGGLVKT  208

Query  779  DWSKAPFTAYYKNFVIDGCVGT--SSCADSKP-------WGKYALDADANNKLQGVRTKN  931
            DW++APFTA Y+NF  + C+ +  S C  + P       W   ALDA   N+L+ V+ K 
Sbjct  209  DWTQAPFTASYRNFKANACIWSPASPCTSTSPNSVQDNAWQVQALDAPGRNRLRWVQQKY  268

Query  932  RVYNYCTDNKRFGGNPPAECK  994
             +YNYCTD KRF    P ECK
Sbjct  269  MIYNYCTDLKRFPQGLPPECK  289



>ref|XP_011016106.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Populus 
euphratica]
Length=284

 Score =   306 bits (785),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 150/288 (52%), Positives = 196/288 (68%), Gaps = 19/288 (7%)
 Frame = +2

Query  164  CMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSG  343
            C    + V+ACS+            NF  D  + +G+   ++ + G  ++L+LD+ +GSG
Sbjct  5    CYEFSLFVIACSMA------VVASGNFYQDFDLTWGDRRAKIFNGGQLLSLSLDKVSGSG  58

Query  344  FNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHT  523
            F +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +HT
Sbjct  59   FQSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILHT  117

Query  524  NVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPK  703
            NVF  GKG+REQQF+LWFDPT  +H Y+IIWN Q I++LVD++PIRV++N E++GVPFPK
Sbjct  118  NVFTQGKGNREQQFYLWFDPTRNFHTYSIIWNPQHIIFLVDSIPIRVFKNAESIGVPFPK  177

Query  704  SKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCV---GTSSCADSKP--  868
            S+PM+++ SLW A DWAT+GG VK DW+KAPFTAYY+NF    C    GTSSC  SKP  
Sbjct  178  SQPMRIYSSLWNADDWATRGGLVKTDWTKAPFTAYYRNFKASACTWSYGTSSCG-SKPSS  236

Query  869  ------WGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
                  W    LDA +  +L+ V+    +YNYCTD +RF   PP ECK
Sbjct  237  AFSDGAWKTNDLDAPSRRRLRWVQKYFMIYNYCTDLRRFPQGPPPECK  284



>gb|AFR46576.1| xyloglucan endotransglucosylase/hydrolase 7, partial [Rosa x 
borboniana]
Length=257

 Score =   305 bits (782),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 144/254 (57%), Positives = 182/254 (72%), Gaps = 14/254 (6%)
 Frame = +2

Query  272  NHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPI  451
            +   ++ + G  + LNLD+ +GSGF +KNEYLFGR DMQ+KLV G SAGTVTT+YL+S  
Sbjct  1    DQRAKILEGGQFLTLNLDKYSGSGFKSKNEYLFGRIDMQIKLVPGNSAGTVTTYYLSSE-  59

Query  452  GQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRI  631
            G  HDE+DFEFLGN++  PYT+HTNVF+ GKGDREQQFHLWFDPT A+H Y+ +WNSQRI
Sbjct  60   GPTHDEIDFEFLGNSSGDPYTLHTNVFSQGKGDREQQFHLWFDPTTAFHTYSFVWNSQRI  119

Query  632  VWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYY  811
            ++ VDN+PIRV+ N E+ GVPFPK++PM+++ SLW A DWATQGG VK DW++APFTA Y
Sbjct  120  IFFVDNIPIRVFNNMESFGVPFPKNQPMRIYSSLWNADDWATQGGRVKTDWTQAPFTASY  179

Query  812  KNFVIDGCVG---TSSCA----------DSKPWGKYALDADANNKLQGVRTKNRVYNYCT  952
            +NF  + CV    +SSC               W    LDA   N+L+ V+ K  VYNYC+
Sbjct  180  RNFKANACVAGSSSSSCGVATVASTDKTQQSAWQTQTLDAAGRNRLRWVQQKFMVYNYCS  239

Query  953  DNKRFGGNPPAECK  994
            D KRF    P ECK
Sbjct  240  DLKRFPQGLPVECK  253



>ref|XP_010525736.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
20-like [Tarenaya hassleriana]
Length=294

 Score =   306 bits (785),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 151/288 (52%), Positives = 200/288 (69%), Gaps = 18/288 (6%)
 Frame = +2

Query  158  QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
            +   +M+  +V+C  V  A        NF  DVQ+ +G+  G++ DNGN +AL+LDQ +G
Sbjct  12   RFLFLMLSLLVSCFAVAFAG-------NFQRDVQITWGDGRGKILDNGNLLALSLDQFSG  64

Query  338  SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
            SGF +KNE+L+G+ + Q+KLV G SAGTVTTFYL SP G   DE+DFEFLGN +  PYT+
Sbjct  65   SGFQSKNEFLYGKVEAQIKLVPGNSAGTVTTFYLKSP-GSTWDEIDFEFLGNLSGHPYTL  123

Query  518  HTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPF  697
            HTNV+  GKGD+EQQFHLWFDPTA +H Y+I WN QRI++ VD +PIR ++N E++GVPF
Sbjct  124  HTNVYTQGKGDKEQQFHLWFDPTADFHTYSITWNPQRIIFTVDGIPIREFKNFESIGVPF  183

Query  698  PKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCV---GTSSCADSKP  868
            PK++PM+++ SLWEA +WAT+GG VK DWS APFTA Y+N+  +GCV   G SSC  + P
Sbjct  184  PKNQPMRLYASLWEADEWATRGGLVKTDWSHAPFTASYRNYNENGCVWSNGRSSCPANSP  243

Query  869  -------WGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAEC  991
                   W    LD    N+++ V+ +  VYNYCTD KRF    P EC
Sbjct  244  GSRPGGAWFSQELDFRGKNRVKWVQRRYMVYNYCTDKKRFPQGAPREC  291



>ref|XP_008449516.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
melo]
Length=289

 Score =   306 bits (784),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 157/295 (53%), Positives = 203/295 (69%), Gaps = 24/295 (8%)
 Frame = +2

Query  146  KQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLD  325
            +Q  Q+C+ M   ++A +  G          NF  DV + +G    ++ D G  + L+LD
Sbjct  2    RQLLQLCVFMA-SLMAATTAG----------NFLRDVDVTWGGPRAKMLDGGRHLTLSLD  50

Query  326  QQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQ  505
            + +GSGF +K E+LFGRFD++M LV G SAGTVTTFYL+S  G +HDE+DFEFLGN T  
Sbjct  51   KDSGSGFQSKKEFLFGRFDVRMMLVPGNSAGTVTTFYLSSE-GTSHDEIDFEFLGNLTGH  109

Query  506  PYTVHTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENV  685
            PYT+HTNV++ GKGDREQQFHLWFDPT A+H Y+I W+ Q I +LVDN+PIRV+ N E +
Sbjct  110  PYTLHTNVYSQGKGDREQQFHLWFDPTKAFHTYSIDWSPQSIKFLVDNIPIRVFHNWEGI  169

Query  686  GVPFPKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTSSCADSK  865
            GV FPKS+PMKV+ SLW A DWAT+GG VK DW+KAPFTA Y++F  +GCV ++S + S 
Sbjct  170  GVSFPKSQPMKVYSSLWNADDWATRGGLVKTDWTKAPFTASYRDFNANGCVASTSSSLSS  229

Query  866  PWGKYA------------LDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
               KYA            LDA + N+L+ V++K  VYNYCTD KRF    PAECK
Sbjct  230  CSSKYANTLHGAKNNQGGLDAKSRNRLRWVQSKFMVYNYCTDRKRFPQGIPAECK  284



>gb|EYU37336.1| hypothetical protein MIMGU_mgv1a021219mg, partial [Erythranthe 
guttata]
Length=275

 Score =   305 bits (782),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 144/256 (56%), Positives = 190/256 (74%), Gaps = 6/256 (2%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NFN DV + +G    Q+ + G  ++L+LD  +GSGF +K ++L+GRFD+Q+KL+ G SAG
Sbjct  16   NFNTDVTITWGQPRAQILNKGQLLSLSLDNTSGSGFESKYDFLYGRFDVQLKLIPGNSAG  75

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTFY++S  G AHDE+DFEFLGNA+ QPYTVHTNV+A G G++EQQF LW+DPT A+H
Sbjct  76   TVTTFYMSSQ-GAAHDEIDFEFLGNASGQPYTVHTNVYAQGVGNKEQQFRLWYDPTLAFH  134

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             YTI+WN  RI+++VDN+PIRV+ N+   GV +P S+PMKV+ SLW A DWATQGG VK 
Sbjct  135  TYTILWNPLRIIYMVDNIPIRVFNNYIANGVQYPTSQPMKVYASLWNADDWATQGGQVKT  194

Query  779  DWSKAPFTAYYKNFVIDGCV--GTSSCADSKP---WGKYALDADANNKLQGVRTKNRVYN  943
            DW+KAPFTA YKN+  +GC+  GT++   +KP   W    LDA+A  K+Q ++ K  +YN
Sbjct  195  DWTKAPFTATYKNYNANGCIVNGTTNSCTNKPRQSWQTMGLDANAKKKIQTLQQKYMIYN  254

Query  944  YCTDNKRFGGNPPAEC  991
            YCTD KRF    P EC
Sbjct  255  YCTDLKRFPQGLPREC  270



>ref|XP_009108993.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like [Brassica rapa]
Length=282

 Score =   305 bits (782),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 144/257 (56%), Positives = 186/257 (72%), Gaps = 7/257 (3%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            +FN+DV + +GN  G++ +NG  + L LD+ +GSGF +K EYLFG+ DMQ+KLV G SAG
Sbjct  23   DFNSDVNVAWGNGRGKILNNGQLLTLTLDKSSGSGFQSKAEYLFGKIDMQIKLVPGNSAG  82

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTFYL S  G   DE+DFEFLGN +  PYT+HTNV+  GKGD+EQQFHLWFDP A +H
Sbjct  83   TVTTFYLKSE-GSTWDEIDFEFLGNMSGDPYTLHTNVYTQGKGDKEQQFHLWFDPAANFH  141

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN QRI+W VDN PIR ++N E +GV FPKSKPM+++ SLW A DWAT+GG VK 
Sbjct  142  TYSILWNPQRIIWTVDNTPIREFKNSEPLGVLFPKSKPMRMYASLWNADDWATRGGLVKT  201

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCADSKP---WGKYALDADANNKLQGVRTKNRVY  940
            DWSKAPF A Y++   DGCV   G SSC+ ++P   W    +D+ +  +L+ V+    +Y
Sbjct  202  DWSKAPFVASYRHIKCDGCVHANGRSSCSSTRPTSNWYTQQMDSTSQARLRWVQKNYMIY  261

Query  941  NYCTDNKRFGGNPPAEC  991
            NYCTD+KRF    P EC
Sbjct  262  NYCTDSKRFPQGIPREC  278



>gb|AFR46580.2| xyloglucan endotransglucosylase/hydrolase 12 [Rosa x borboniana]
Length=281

 Score =   305 bits (781),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 144/278 (52%), Positives = 196/278 (71%), Gaps = 7/278 (3%)
 Frame = +2

Query  164  CMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSG  343
            C+++++G+   SL+     V     NF  D  + +G H  ++   G  ++L+LD+ +GSG
Sbjct  9    CLVLLVGLALSSLI-----VGSYAGNFYQDFDLTWGGHRPKIFKGGQLLSLSLDKVSGSG  63

Query  344  FNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHT  523
            F +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +HT
Sbjct  64   FQSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNVSGDPYVLHT  122

Query  524  NVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPK  703
            N+F  GKG+REQQF+LWFDP+  +H Y+IIW  Q I++LVDN PIRV++N E++GVPFPK
Sbjct  123  NIFTQGKGNREQQFYLWFDPSKNFHTYSIIWKPQHIIFLVDNTPIRVFKNAESLGVPFPK  182

Query  704  SKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTSSCADSKP-WGKY  880
            ++ M+++ SLW A DWAT+GG VK DWSKAPFTAYY+NF +     + S +DS+P W   
Sbjct  183  NQAMRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRNFNVIDAKSSKSFSDSQPSWQTN  242

Query  881  ALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
            ALDA +  +L+ V+    +YNYCTD KRF    PAEC+
Sbjct  243  ALDAPSRRRLRWVQKYFMIYNYCTDLKRFPRGFPAECR  280



>ref|XP_006412723.1| hypothetical protein EUTSA_v10025933mg [Eutrema salsugineum]
 gb|ESQ54176.1| hypothetical protein EUTSA_v10025933mg [Eutrema salsugineum]
Length=282

 Score =   305 bits (781),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/288 (51%), Positives = 200/288 (69%), Gaps = 11/288 (4%)
 Frame = +2

Query  140  MKKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNG-NTMAL  316
            MK         +++ + A   VGV         +F+ DVQ+++G+  G++ DNG   ++L
Sbjct  1    MKSSCGARFAFLVLSLFAAQSVGVYAG------SFHRDVQIHWGDGRGKIHDNGGRLLSL  54

Query  317  NLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNA  496
            +LD+ +GSGF +K E+L+G+ ++QMKLV G SAGTVTTFYL SP G   DE+DFEFLGN 
Sbjct  55   SLDKTSGSGFQSKQEFLYGKAEVQMKLVPGNSAGTVTTFYLKSP-GVTWDEIDFEFLGNI  113

Query  497  TFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENH  676
            +  PYT+HTNV+  G GD+EQQFHLWFDPTA +H Y I WN QRI++ VD +PIR ++N 
Sbjct  114  SGHPYTLHTNVYTRGSGDKEQQFHLWFDPTADFHTYCITWNPQRIIFTVDGIPIREFKNS  173

Query  677  ENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCV---GTS  847
            E++GVPFPKS+PM+++ SLWEA  WAT+GG  K DWSKAPFTA+Y+N+ ++GCV   G S
Sbjct  174  ESIGVPFPKSQPMRLYASLWEAEHWATRGGLEKTDWSKAPFTAFYRNYNVEGCVWANGKS  233

Query  848  SCADSKPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAEC  991
            SC  + PW    LD    N+++  ++K  VYNYCTD KRF    PA C
Sbjct  234  SCPANAPWFTQKLDRRGANRVKWAQSKYMVYNYCTDKKRFPKGVPAVC  281



>ref|XP_007217276.1| hypothetical protein PRUPE_ppa017487mg [Prunus persica]
 gb|EMJ18475.1| hypothetical protein PRUPE_ppa017487mg [Prunus persica]
Length=263

 Score =   304 bits (779),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 143/254 (56%), Positives = 186/254 (73%), Gaps = 3/254 (1%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF +D  + FG    ++ + G  + LNLD+ +GSGF +KNEYL GR DMQ+KLV G SAG
Sbjct  7    NFYHDFDITFGGERAKILNGGQLLTLNLDKFSGSGFKSKNEYLLGRIDMQIKLVSGNSAG  66

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNVF+ GKG+REQQFHLWFDPT A+H
Sbjct  67   TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGNREQQFHLWFDPTKAFH  125

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WNSQRI++LVDN+PIRV+ N E +GVPFPK++PM+++ SLW A DWAT+GG VK 
Sbjct  126  TYSIVWNSQRIIFLVDNIPIRVFHNLETIGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  185

Query  779  DWSKAPFTAYYKNFVI--DGCVGTSSCADSKPWGKYALDADANNKLQGVRTKNRVYNYCT  952
            DW++APFTA Y+NF +       T+S  +   W    LDA   N+L+ V+ K  +YNYC+
Sbjct  186  DWTQAPFTASYRNFKVSTTSTTSTNSLTEQSAWQTQGLDAAGRNRLRWVQQKFMIYNYCS  245

Query  953  DNKRFGGNPPAECK  994
            D KRF    PAEC+
Sbjct  246  DLKRFPQGLPAECR  259



>ref|XP_002321087.1| brassinosteroid-regulated family protein [Populus trichocarpa]
 gb|EEE99402.1| brassinosteroid-regulated family protein [Populus trichocarpa]
Length=284

 Score =   305 bits (780),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/288 (52%), Positives = 196/288 (68%), Gaps = 19/288 (7%)
 Frame = +2

Query  164  CMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSG  343
            C    + V+ CS+            NF  D  + +G+   ++ + G  ++L+LD+ +GSG
Sbjct  5    CNGFSLFVIVCSMA------VVASGNFYQDFDLTWGDRRAKIFNGGQLLSLSLDKVSGSG  58

Query  344  FNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHT  523
            F +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +HT
Sbjct  59   FQSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILHT  117

Query  524  NVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPK  703
            NVF  GKG+REQQF+LWFDPT  +H Y+IIWN Q I++LVD++PIRV++N E++GVPFPK
Sbjct  118  NVFTQGKGNREQQFYLWFDPTRNFHTYSIIWNPQHIIFLVDSIPIRVFKNAESIGVPFPK  177

Query  704  SKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCV---GTSSCADSKP--  868
            S+PM+++ SLW A DWAT+GG VK DW+KAPFTAYY+NF  + C    GTSSC  SKP  
Sbjct  178  SQPMRIYSSLWNADDWATRGGLVKTDWTKAPFTAYYRNFKANACTWSYGTSSCG-SKPSS  236

Query  869  ------WGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
                  W    LDA +  +L+ V+    +YNYCTD +RF   PP ECK
Sbjct  237  AFSDGAWKTNELDAPSRRRLRWVQKYFMIYNYCTDLRRFPQGPPPECK  284



>ref|XP_002520387.1| Brassinosteroid-regulated protein BRU1 precursor, putative [Ricinus 
communis]
 gb|EEF42003.1| Brassinosteroid-regulated protein BRU1 precursor, putative [Ricinus 
communis]
Length=287

 Score =   305 bits (780),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/286 (52%), Positives = 194/286 (68%), Gaps = 19/286 (7%)
 Frame = +2

Query  167  MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
             ++ + V+ C L            NF     + +G+  G++ + G  + L+LD+ +GSGF
Sbjct  6    FLLSVFVICCLLA-------VSEANFYKHFDITWGDQRGKILNGGQLLTLSLDKASGSGF  58

Query  347  NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
             +KNEYLFGR DMQ+KLV G SAGTVTTFYL+S  G  HDE+DFEFLGN +  PY +HTN
Sbjct  59   QSKNEYLFGRIDMQIKLVPGNSAGTVTTFYLSSQ-GPNHDEIDFEFLGNLSGDPYILHTN  117

Query  527  VFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKS  706
            VF+ GKG+REQQFHLWFDPT A+H Y+I+WN+QRI++LVDN+PIRV+ N E++GVPFP  
Sbjct  118  VFSQGKGNREQQFHLWFDPTLAFHTYSIVWNAQRIMFLVDNIPIRVFNNLESIGVPFPNK  177

Query  707  KPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCV----------GTSSCA  856
            KPM+++ SLW A DWAT+GG VK DW+KAPFTA Y+NF  + CV           T+S  
Sbjct  178  KPMRIYSSLWNADDWATRGGLVKTDWTKAPFTASYRNFNANACVWSSGSPCELISTNSLQ  237

Query  857  DSKPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
            DS  W    L+A   N+++ V  K  +YNYCTD KRF    P ECK
Sbjct  238  DSA-WQLQELNASGRNRIRWVHQKYMIYNYCTDFKRFPEGLPPECK  282



>ref|XP_002302146.2| xyloglucan endo-1 family protein [Populus trichocarpa]
 gb|EEE81419.2| xyloglucan endo-1 family protein [Populus trichocarpa]
Length=294

 Score =   305 bits (781),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/292 (50%), Positives = 201/292 (69%), Gaps = 16/292 (5%)
 Frame = +2

Query  146  KQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLD  325
            + ++   M++   + AC L+G +        NF  D  + +G+   ++ + G  + L+LD
Sbjct  5    RSRKLSSMLLFTLLFAC-LMGASKGG-----NFFQDFDITWGDQRAKILNGGQLLTLSLD  58

Query  326  QQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQ  505
            + +GSGF +KNEYLFG+ DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGNAT +
Sbjct  59   KASGSGFQSKNEYLFGQIDMQIKLVAGNSAGTVTAYYLSSQ-GSTHDEIDFEFLGNATGE  117

Query  506  PYTVHTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENV  685
            PY +HTNVF+ GKG+REQQF+LWFDPT A+H Y+I+WN QRI++LVDN+PIRV+ N E++
Sbjct  118  PYILHTNVFSQGKGNREQQFYLWFDPTKAFHTYSIVWNQQRIIFLVDNIPIRVFHNLESI  177

Query  686  GVPFPKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTSS--CAD  859
            GVPFP  + M++  SLW A DWAT+GG VK DW++APFTA Y+NF  + C+ +S+  C  
Sbjct  178  GVPFPNKQAMRIHSSLWNADDWATRGGLVKTDWTQAPFTASYRNFKANACIWSSASPCTS  237

Query  860  SKP-------WGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
            + P       W   ALDA   N+L+ V+ K  +YNYCTD KRF    P ECK
Sbjct  238  TSPNSVQDNAWQVQALDAPGRNRLRWVQQKYMIYNYCTDLKRFPQGLPPECK  289



>ref|XP_007211780.1| hypothetical protein PRUPE_ppa009685mg [Prunus persica]
 gb|EMJ12979.1| hypothetical protein PRUPE_ppa009685mg [Prunus persica]
Length=282

 Score =   304 bits (779),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/280 (52%), Positives = 196/280 (70%), Gaps = 11/280 (4%)
 Frame = +2

Query  170  IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
            +++I +  CS +  + A      NF  D  + +G+H  ++   G+ + L+LDQ +GSGF 
Sbjct  5    LILISLFLCSFMAASSAG-----NFYQDFDLIWGDHRAKILSGGSLLTLSLDQASGSGFQ  59

Query  350  TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
            +K +YLFGR DMQ+KLV G SAGTVT +YL+S  G   DE+DFEFLGN +  PY VHTNV
Sbjct  60   SKRQYLFGRIDMQLKLVAGNSAGTVTAYYLSSE-GPNRDEIDFEFLGNLSGDPYIVHTNV  118

Query  530  FADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSK  709
            +  GK DREQQF+LWFDPT  +H Y+ +WN QRI++LVDN+PIRV++N E+ GVPFPK +
Sbjct  119  YTQGKADREQQFYLWFDPTKDFHTYSFLWNPQRIIFLVDNIPIRVFDNGESYGVPFPKRQ  178

Query  710  PMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCV---GTSSCADSK--PWG  874
            PMK++ SLW A  WAT+GG VK DWSKAPFTA+Y+NF  + CV   G+SSCA++K   W 
Sbjct  179  PMKLYSSLWNADQWATKGGLVKTDWSKAPFTAFYRNFKANACVWSKGSSSCANNKNNAWQ  238

Query  875  KYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
               LDA++  +L+ V+    +YNYC+D KRF    P EC+
Sbjct  239  TQGLDANSRRRLRWVQKYFMIYNYCSDLKRFPQGRPRECR  278



>ref|XP_002317310.1| xyloglucan endo-1 family protein [Populus trichocarpa]
 gb|EEE97922.1| xyloglucan endo-1 family protein [Populus trichocarpa]
Length=292

 Score =   305 bits (780),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 141/262 (54%), Positives = 187/262 (71%), Gaps = 11/262 (4%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NFN +V + +G    ++   G+ ++L LD+ +GSGF +K+EYLFGR DMQ+KLV G SAG
Sbjct  27   NFNQEVDLTWGGDRAKILSGGSVLSLTLDKVSGSGFQSKSEYLFGRIDMQIKLVGGNSAG  86

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            +VT +YL+S  G  HDE+DFEFLGN + +PYTVHTNV+  GKGDREQQFHLWFDPT  +H
Sbjct  87   SVTAYYLSSE-GPYHDEIDFEFLGNLSGEPYTVHTNVYTQGKGDREQQFHLWFDPTKDFH  145

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+++WN QRI++LVD+ PIRVYEN E++GVPFPK++PMK++ SLW A  WAT+GG VK 
Sbjct  146  LYSVVWNHQRIIFLVDDTPIRVYENQESIGVPFPKNQPMKLYSSLWNADQWATRGGLVKA  205

Query  779  DWSKAPFTAYYKNFVIDGC----------VGTSSCADSKPWGKYALDADANNKLQGVRTK  928
            DWSKAPFTAYY+NF  + C          + T+S + +  W    LD+ +   L+ V+  
Sbjct  206  DWSKAPFTAYYRNFKANACLWSSGSSSCSLKTTSSSTNNAWQTQGLDSTSRRSLRWVQKY  265

Query  929  NRVYNYCTDNKRFGGNPPAECK  994
              +YNYCTD KRF    P EC+
Sbjct  266  YMIYNYCTDYKRFPMGRPRECR  287



>ref|XP_007215793.1| hypothetical protein PRUPE_ppa009871mg [Prunus persica]
 gb|EMJ16992.1| hypothetical protein PRUPE_ppa009871mg [Prunus persica]
Length=274

 Score =   303 bits (777),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 142/254 (56%), Positives = 185/254 (73%), Gaps = 3/254 (1%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  D  + FG+   ++ + G  + LNLD+ +GSGF +KNEYL GR DMQ+KLV G SAG
Sbjct  18   NFYQDFDVTFGDERAKILNGGQLLTLNLDKFSGSGFKSKNEYLLGRIDMQIKLVSGNSAG  77

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNVF+ GKG+REQQFHLWFDPT A+H
Sbjct  78   TVTAYYLSSE-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGNREQQFHLWFDPTKAFH  136

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WNSQRI++LVDN+PIRV+ N E +GVPFPK++PM+++ SLW A DWAT+GG VK 
Sbjct  137  TYSIVWNSQRIIFLVDNIPIRVFTNLETIGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  196

Query  779  DWSKAPFTAYYKNFVI--DGCVGTSSCADSKPWGKYALDADANNKLQGVRTKNRVYNYCT  952
            DW++APFTA Y+NF +       T+S  +   W    LDA   N+L+ V+ K  +YNYC+
Sbjct  197  DWTQAPFTASYRNFKVSTTTSTSTNSLTEQSAWQTQGLDAAGRNRLRWVQQKFMIYNYCS  256

Query  953  DNKRFGGNPPAECK  994
            D KRF    P EC+
Sbjct  257  DLKRFPQGLPVECR  270



>ref|XP_009417169.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Musa acuminata subsp. malaccensis]
Length=281

 Score =   303 bits (777),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 146/255 (57%), Positives = 184/255 (72%), Gaps = 5/255 (2%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF +DV + +G+  G++ DNG  + L LD+ +GSGF +K  YLFGRFDM+MKLV G SAG
Sbjct  23   NFLSDVDITWGDGRGKMLDNGELLQLTLDRASGSGFQSKQAYLFGRFDMKMKLVPGNSAG  82

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTT+YL+S  G AHDE+DFEFLGN + +PY +HTNVFA GKGDREQQF+LWFDPT A+H
Sbjct  83   TVTTYYLSSQ-GPAHDEIDFEFLGNTSGEPYVLHTNVFAQGKGDREQQFYLWFDPTLAFH  141

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+++WN +RIV+ VD  P+RV+ N E  GV +PKS+ M+V+ SLW+A DWAT+GG VK 
Sbjct  142  TYSVLWNPRRIVFYVDGTPVRVFRNSEGAGVAYPKSQAMRVYASLWDADDWATRGGLVKT  201

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCADSKP-WGKYALDADANNKLQGVRTKNRVYNY  946
            DWS+APF A Y+ FV D CV   G  SC+ SK  W    LD+    KL+ VR    VY+Y
Sbjct  202  DWSQAPFVASYRGFVADACVAASGRPSCSASKAGWWDQGLDSGGARKLKWVRDNYMVYDY  261

Query  947  CTDNKRFGGNPPAEC  991
            C D KRF G  P EC
Sbjct  262  CRDAKRFPGGFPPEC  276



>ref|XP_006280918.1| hypothetical protein CARUB_v10026914mg [Capsella rubella]
 gb|EOA13816.1| hypothetical protein CARUB_v10026914mg [Capsella rubella]
Length=284

 Score =   303 bits (777),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 148/286 (52%), Positives = 195/286 (68%), Gaps = 10/286 (3%)
 Frame = +2

Query  167  MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
            M +IIG +   L    + +     NF  DV++ +G+  GQ+++NG  + L+LD+ +GSGF
Sbjct  1    MAIIIGYL-LPLFLSLIIISSVSANFQRDVEITWGDGRGQIKNNGELLTLSLDKSSGSGF  59

Query  347  NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
             ++NEYLFG+ DMQMKLV G SAGTVTT YL SP G   DE+DFEFLGN++ +PYT+HTN
Sbjct  60   QSRNEYLFGKIDMQMKLVPGNSAGTVTTLYLKSP-GTTWDEIDFEFLGNSSGEPYTLHTN  118

Query  527  VFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKS  706
            V+  GKGD+EQQF LWFDPTA +H Y+I+WN QRI++ VD  PIR ++N E+VG  FPK+
Sbjct  119  VYTQGKGDKEQQFKLWFDPTADFHTYSILWNPQRIIFTVDGTPIREFKNMESVGTLFPKN  178

Query  707  KPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCV---GTSSCADSK----  865
            KPM+++ SLW A DWAT+GG VK DWSKAPFTA Y+ F  + CV   G SSC   +    
Sbjct  179  KPMRMYSSLWNADDWATRGGLVKTDWSKAPFTASYRGFKQEACVWSNGKSSCGSKQRTTT  238

Query  866  -PWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECKPA  1000
              W    LD+ A  +++ V+    +YNYCTD KRF    P EC  A
Sbjct  239  GSWLSQQLDSTAQQRMRWVQRNYMIYNYCTDTKRFPQGLPKECLAA  284



>ref|XP_008225386.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Prunus 
mume]
Length=282

 Score =   303 bits (776),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 144/280 (51%), Positives = 195/280 (70%), Gaps = 11/280 (4%)
 Frame = +2

Query  170  IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
            +++I +  CS +  + A      NF  D  + +G+H  ++   G+ + L+LDQ +GSGF 
Sbjct  5    LILISLFLCSFMAASSAG-----NFYQDFDLIWGDHRAKILSGGSLLTLSLDQASGSGFQ  59

Query  350  TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
            +K +YLFGR DMQ+KLV G SAGTVT +YL+S  G   DE+DFEFLGN +  PY +HTNV
Sbjct  60   SKRQYLFGRIDMQLKLVAGNSAGTVTAYYLSSE-GPNRDEIDFEFLGNLSGDPYVMHTNV  118

Query  530  FADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSK  709
            +  GK DREQQF+LWFDPT  +H Y+ +WN QRI++LVDN+PIRV++N E+ GVPFPK +
Sbjct  119  YTQGKADREQQFYLWFDPTKDFHTYSFLWNPQRIIFLVDNIPIRVFDNGESYGVPFPKRQ  178

Query  710  PMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCV---GTSSCADSK--PWG  874
            PMK++ SLW A  WAT+GG VK DWSKAPFTA+Y+NF  + CV   G+SSCA +K   W 
Sbjct  179  PMKLYSSLWNADQWATKGGLVKTDWSKAPFTAFYRNFKANACVWSKGSSSCASNKNNAWQ  238

Query  875  KYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
               LDA++  +L+ V+    +YNYC+D KRF    P EC+
Sbjct  239  TQGLDANSRRRLRWVQKYFMIYNYCSDLKRFPQGRPRECR  278



>ref|XP_008362366.1| PREDICTED: LOW QUALITY PROTEIN: xyloglucan endotransglucosylase/hydrolase 
protein 22-like [Malus domestica]
Length=292

 Score =   303 bits (777),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 143/289 (49%), Positives = 199/289 (69%), Gaps = 15/289 (5%)
 Frame = +2

Query  158  QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
            +V M+  + ++  SLV V  +      NF  D ++ FG+ L +V +NG  + L+LD+ +G
Sbjct  5    KVSMMFFLSLITISLVAVVASAD----NFYQDFEVMFGDQLAKVLENGQLVTLSLDKSSG  60

Query  338  SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
            +GF +KNEYLFGRFDMQ+KL  G SAGTVTTF L+S  G  HDE+DFEFLGN+T +PYT+
Sbjct  61   AGFKSKNEYLFGRFDMQIKLQPGNSAGTVTTFCLSSS-GSNHDEIDFEFLGNSTGEPYTI  119

Query  518  HTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPF  697
            HTNV+A G+G +EQQF +WFDPT  +H Y+++WN++RI++LVDN PIRV+ N E++G+PF
Sbjct  120  HTNVYAQGQGLKEQQFRVWFDPTQDFHTYSVVWNTKRIIFLVDNSPIRVFNNLESIGLPF  179

Query  698  PKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVG----------TS  847
            PK++PM+++ + W A  WATQGG V+ DWS APFTA Y+N  I+ C+G          T+
Sbjct  180  PKNQPMRIYATFWNADHWATQGGHVRTDWSLAPFTASYRNLNINACLGSQGPSCASTSTN  239

Query  848  SCADSKPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
              AD   W    L+A   N+L+ V+ K  VY+YCTD  +F    P ECK
Sbjct  240  RSADGASWANQGLNAAEXNRLRWVQHKFMVYDYCTDRIKFTKGLPRECK  288



>ref|XP_006412727.1| hypothetical protein EUTSA_v10025941mg [Eutrema salsugineum]
 dbj|BAJ33741.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ54180.1| hypothetical protein EUTSA_v10025941mg [Eutrema salsugineum]
Length=281

 Score =   303 bits (776),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 145/257 (56%), Positives = 189/257 (74%), Gaps = 8/257 (3%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            +FN+DV + +GN  G++ +NG  + L+LD+ +GSGF +K EYLFG+ DMQ+KLV G SAG
Sbjct  23   DFNSDVNVAWGNGRGKILNNGQLLTLSLDKSSGSGFQSKTEYLFGKIDMQIKLVPGNSAG  82

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTFYL S  G   DE+DFEFLGN +  PYT+HTNV+  GKGD+EQQFHLWFDP+A +H
Sbjct  83   TVTTFYLKSE-GSTWDEIDFEFLGNMSGDPYTLHTNVYTQGKGDKEQQFHLWFDPSANFH  141

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN QRI++ VDN PIR ++N E++GV FPK+KPM+++ SLW A DWAT+GG VK 
Sbjct  142  TYSILWNPQRIIFTVDNTPIREFKNSESIGVLFPKNKPMRMYASLWNADDWATRGGLVKT  201

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCADSKP---WGKYALDADANNKLQGVRTKNRVY  940
            DWSKAPFTA Y+N  +D CV   G SSC+ SKP   W    +D+ +  +L+ V+    +Y
Sbjct  202  DWSKAPFTASYRNIKVDACVNSKGRSSCS-SKPNASWYTQEMDSTSQARLRWVQKNYMIY  260

Query  941  NYCTDNKRFGGNPPAEC  991
            NYCTD KRF    P EC
Sbjct  261  NYCTDTKRFPQGIPREC  277



>ref|XP_002270973.2| PREDICTED: brassinosteroid-regulated protein BRU1-like [Vitis 
vinifera]
Length=290

 Score =   303 bits (777),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 143/262 (55%), Positives = 187/262 (71%), Gaps = 11/262 (4%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            +F  D  + +G+H  ++ D    + L+LD+ +GSGF +K EYLFG+ DMQ+KLV G SAG
Sbjct  29   SFYQDFDLTWGDHRAKILDGEKLLTLSLDKASGSGFQSKKEYLFGKIDMQLKLVSGNSAG  88

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G  HDE+DFEFLGN +  PY +HTNVF  GKG+REQQF+LWFDPT  +H
Sbjct  89   TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILHTNVFTQGKGNREQQFYLWFDPTENFH  147

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+IIWN Q I++LVDN+PIR ++N E++GVPFPKS+PM+++ SLW A DWAT+GG VK+
Sbjct  148  TYSIIWNLQNIIFLVDNIPIREFKNQESIGVPFPKSQPMRIYSSLWNADDWATRGGLVKI  207

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCAD--SKP-----WGKYALDADANNKLQGVRTK  928
            DWSKAPFTA Y+NF    C+   G+SSCA   + P     W    LDA +  KLQ V+  
Sbjct  208  DWSKAPFTASYRNFNAAACLWSHGSSSCASKFTSPVSNIAWQNQGLDAKSRRKLQWVQKN  267

Query  929  NRVYNYCTDNKRFGGNPPAECK  994
              +YNYC+D KRF G  P EC+
Sbjct  268  YMIYNYCSDMKRFPGGLPLECR  289



>gb|AEX07595.1| xyloglucosyl transferase 2, partial [Brassica juncea]
Length=265

 Score =   302 bits (774),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 143/257 (56%), Positives = 184/257 (72%), Gaps = 7/257 (3%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            +FN+DV + +GN  G++ +NG  + L LD+ +G+GF +K EYLFG+ DMQ+KLV G SAG
Sbjct  6    DFNSDVNVAWGNGRGKILNNGQLLTLTLDKSSGAGFQSKTEYLFGKIDMQIKLVPGNSAG  65

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTFYL S  G   DE+DFEFLGN +  PYT+HTNV+  GKGD+EQQFHLWFDPT  +H
Sbjct  66   TVTTFYLKSE-GTTWDEIDFEFLGNMSGDPYTLHTNVYTQGKGDKEQQFHLWFDPTVNFH  124

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN QRI+  VD  PIR ++N E++GV FPKSKPM+++ SLW A DWAT+GG VK 
Sbjct  125  TYSILWNPQRIILTVDGTPIREFKNSESLGVLFPKSKPMRMYASLWNADDWATRGGLVKT  184

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCADSKP---WGKYALDADANNKLQGVRTKNRVY  940
            DWSKAPFTA Y+N  I+GC    G SSC  +KP   W    +D+ +  +L+ V+    +Y
Sbjct  185  DWSKAPFTASYRNIKIEGCAHSNGRSSCTSTKPSSNWYTQEMDSTSQARLRWVQKNYMIY  244

Query  941  NYCTDNKRFGGNPPAEC  991
            NYCTD KRF    P EC
Sbjct  245  NYCTDTKRFPQGIPREC  261



>ref|XP_011006106.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Populus 
euphratica]
Length=282

 Score =   303 bits (775),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 148/286 (52%), Positives = 196/286 (69%), Gaps = 17/286 (6%)
 Frame = +2

Query  164  CMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSG  343
            C    + V+ACS+            +F  D  + +G+   ++ + G  ++L+LD+ +GSG
Sbjct  5    CYEFSLFVIACSMA------VVASGSFYQDFDLTWGDRRAKIFNGGQLLSLSLDKVSGSG  58

Query  344  FNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHT  523
            F +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +HT
Sbjct  59   FQSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILHT  117

Query  524  NVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPK  703
            NVF  GKG+REQQF+LWFDPT  +H Y+IIWN Q I++LVD++PIRV++N E++GVPFPK
Sbjct  118  NVFTQGKGNREQQFYLWFDPTRNFHTYSIIWNPQHIIFLVDSIPIRVFKNAESIGVPFPK  177

Query  704  SKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDG-CVGTSSCADSKP----  868
            S+PM+++ SLW A DWAT+GG VK DW+KAPFTAYY+NF  +    GTSSC  SKP    
Sbjct  178  SQPMRIYSSLWNADDWATRGGLVKTDWTKAPFTAYYRNFKANAWSYGTSSCG-SKPSSAF  236

Query  869  ----WGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
                W    LDA +  +L+ V+    +YNYCTD +RF   PP ECK
Sbjct  237  SYGAWKTNELDAPSRRRLRWVQKYFMIYNYCTDLRRFPQGPPPECK  282



>gb|AFR46575.1| xyloglucan endotransglucosylase/hydrolase 6 [Rosa x borboniana]
Length=289

 Score =   303 bits (776),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 145/267 (54%), Positives = 187/267 (70%), Gaps = 16/267 (6%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  D  + FG    ++ + G  + L+LDQ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  20   NFYQDFDITFGEQRAKIFNGGQHLTLDLDQYSGSGFKSKKEYLFGRIDMQIKLVAGNSAG  79

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G  HDE+DFEFLGN++ +PYT+HTNVF+ GKG+REQQFHLWFDPT A+H
Sbjct  80   TVTAYYLSSQ-GPTHDEIDFEFLGNSSGEPYTLHTNVFSQGKGNREQQFHLWFDPTNAFH  138

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+++WNSQRI++LVDN+PIRV+ N E+VGVPFPK++PM+++ SLW A DWATQGG VK 
Sbjct  139  TYSLVWNSQRIIFLVDNIPIRVFNNLESVGVPFPKNQPMRIYSSLWNADDWATQGGRVKT  198

Query  779  DWSKAPFTAYYKNFVIDG--------------CVGTSSCADSK-PWGKYALDADANNKLQ  913
            DW+ APFTA Y+NF  +                  T+S  D +  W    LDA   N+++
Sbjct  199  DWTHAPFTASYRNFKANACVAGSSSSSCGVSTSASTNSLTDQQGTWHNQGLDAAGRNRIR  258

Query  914  GVRTKNRVYNYCTDNKRFGGNPPAECK  994
             V+ K  VYNYCTD KRF    P EC+
Sbjct  259  WVQQKFMVYNYCTDLKRFPQGLPVECR  285



>ref|XP_011082928.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15 isoform X2 [Sesamum indicum]
Length=274

 Score =   302 bits (774),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 136/257 (53%), Positives = 188/257 (73%), Gaps = 15/257 (6%)
 Frame = +2

Query  164  CMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSG  343
             M++++ ++  ++            +F  D ++ +G+   ++ + G  + L+LDQQ+GSG
Sbjct  13   LMMLLLAILVANIA-------TAAADFYRDAEITWGDGRAKILEGGRMLTLSLDQQSGSG  65

Query  344  FNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHT  523
            F +KNEYLFGRFD+Q+KLV G SAGTVTTF+L+S  G  HDE+DFEFLGN + +PYTVHT
Sbjct  66   FQSKNEYLFGRFDLQLKLVPGNSAGTVTTFFLSSQ-GAGHDEIDFEFLGNTSGEPYTVHT  124

Query  524  NVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPK  703
            NV+A GKGD+EQ+FHLWFDPTAA+H Y+I+WN QRI++LVDN+PIRV+ N+E +G+P+PK
Sbjct  125  NVYAQGKGDKEQRFHLWFDPTAAFHTYSIVWNPQRIIFLVDNIPIRVFSNNEAIGIPYPK  184

Query  704  SKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTSSCA-------DS  862
            S+ M+V+CSLW A DWATQGG VK DW+KAPF A Y+NF I+GCV  SSC        ++
Sbjct  185  SQAMRVYCSLWNADDWATQGGRVKTDWTKAPFVASYRNFNINGCVPGSSCGSKSAESFNT  244

Query  863  KPWGKYALDADANNKLQ  913
            + W    LD    N+L+
Sbjct  245  EAWQTKELDGKGRNRLR  261



>gb|EYU41110.1| hypothetical protein MIMGU_mgv1a011456mg [Erythranthe guttata]
Length=281

 Score =   302 bits (774),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/256 (56%), Positives = 189/256 (74%), Gaps = 6/256 (2%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NFN DV + +G    Q+ +NG  ++L+LD  +GSGF +K ++L+GRFD+Q+KL+ G SAG
Sbjct  22   NFNTDVTITWGQPRAQILNNGQLLSLSLDNTSGSGFESKYDFLYGRFDVQLKLIPGNSAG  81

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTFY++S  G AHDE+DFEFLGNA+ QPYTVHTNV+A G G++EQQF LW+DPT A+H
Sbjct  82   TVTTFYMSSQ-GTAHDEIDFEFLGNASGQPYTVHTNVYAQGVGNKEQQFRLWYDPTLAFH  140

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             YTI+WN  RI+++VDN+PIRV+ N+   GV +P S+PMKV+ SLW A DWATQGG VK 
Sbjct  141  TYTILWNPLRIIYMVDNIPIRVFNNYIANGVQYPTSQPMKVYGSLWNADDWATQGGQVKT  200

Query  779  DWSKAPFTAYYKNFVIDGCV--GTSSCADSKP---WGKYALDADANNKLQGVRTKNRVYN  943
            DW+KAPFTA YKN+  +GC+  GT++   +KP   W    LDA+A   +Q ++ K  +YN
Sbjct  201  DWTKAPFTATYKNYNANGCIVNGTTNSCSNKPRQSWQTMGLDANAKKNIQTLQQKYMIYN  260

Query  944  YCTDNKRFGGNPPAEC  991
            YCTD  RF    P EC
Sbjct  261  YCTDVNRFPQGLPKEC  276



>ref|XP_010677921.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Beta vulgaris subsp. vulgaris]
Length=285

 Score =   302 bits (774),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/260 (56%), Positives = 190/260 (73%), Gaps = 10/260 (4%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NFNND  + +G+   ++ +NG+ + L+LD+ +GSGF +KNEYLFG  DMQ+KLV G SAG
Sbjct  23   NFNNDFAITWGDGRAKILNNGDDLTLSLDKASGSGFQSKNEYLFGSIDMQLKLVPGNSAG  82

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S +G  HDE+DFEFLGNA+ QPYT+HTNVFA GKG+REQQFHLWFDPT  +H
Sbjct  83   TVTAYYLSS-LGTTHDEIDFEFLGNASGQPYTLHTNVFAQGKGNREQQFHLWFDPTKDFH  141

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN QRIV+ VD +PIR + N E+ GV FPK++PM+++ SLW A DWATQGG VK+
Sbjct  142  TYSILWNPQRIVFSVDGIPIREFNNMESQGVSFPKNQPMRIYSSLWNADDWATQGGRVKI  201

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSC-----ADS-KPWGKYALDADANNKLQGVRTKN  931
            DW+ APFTA Y+NF  + CV   G+SSC     ADS   W    LD+ +  +++ V+T  
Sbjct  202  DWTHAPFTASYRNFNANACVWASGSSSCGLSPSADSGSDWLNQELDSASLERMRWVQTNY  261

Query  932  RVYNYCTDNKRFGGNPPAEC  991
             VYNYC D +RF    P EC
Sbjct  262  MVYNYCADLQRFPQGLPTEC  281



>ref|XP_010677922.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Beta vulgaris subsp. vulgaris]
Length=285

 Score =   302 bits (774),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/260 (56%), Positives = 190/260 (73%), Gaps = 10/260 (4%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NFNND  + +G+   ++ +NG+ + L+LD+ +GSGF +KNEYLFG  DMQ+KLV G SAG
Sbjct  23   NFNNDFAITWGDGRAKILNNGDDLTLSLDKASGSGFQSKNEYLFGNIDMQLKLVPGNSAG  82

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S +G  HDE+DFEFLGNA+ QPYT+HTNVFA GKG+REQQFHLWFDPT  +H
Sbjct  83   TVTAYYLSS-LGSTHDEIDFEFLGNASGQPYTLHTNVFAQGKGNREQQFHLWFDPTKDFH  141

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN QRIV+ VD +PIR + N E+ GV FPK++PM+++ SLW A DWATQGG VK+
Sbjct  142  TYSILWNPQRIVFSVDGIPIREFNNMESQGVSFPKNQPMRIYSSLWNADDWATQGGRVKI  201

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSC-----ADS-KPWGKYALDADANNKLQGVRTKN  931
            DW+ APFTA Y+NF  + CV   G+SSC     ADS   W    LD+ +  +++ V+T  
Sbjct  202  DWTHAPFTASYRNFNANACVWASGSSSCGLSPSADSGSDWLNQELDSASLERMRWVQTNY  261

Query  932  RVYNYCTDNKRFGGNPPAEC  991
             VYNYC D +RF    P EC
Sbjct  262  MVYNYCADLQRFPQGLPTEC  281



>ref|XP_009356706.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like [Pyrus x bretschneideri]
Length=292

 Score =   303 bits (775),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/289 (50%), Positives = 199/289 (69%), Gaps = 15/289 (5%)
 Frame = +2

Query  158  QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
            +V M+  +  +  SLV +  +      NF  D ++ FG+   +V +NG  + L LD+ +G
Sbjct  5    KVSMLFFLCSITISLVAIVASAG----NFYQDYEVMFGDQHAKVLENGQIITLALDKSSG  60

Query  338  SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
            +GF +KN YLFGRFDMQ+KL  G SAGTVTTFYL+S  G  HDE+DFEFLGN+T +PYT+
Sbjct  61   AGFKSKNAYLFGRFDMQIKLQPGNSAGTVTTFYLSSS-GANHDEIDFEFLGNSTGEPYTI  119

Query  518  HTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPF  697
            HTNV+A G+G +EQQFHLWFDPT  +H Y+I+WN++RI++LVD+ PIRV+ N E++G+PF
Sbjct  120  HTNVYAQGQGLKEQQFHLWFDPTQDFHTYSIVWNTKRIIFLVDDSPIRVFNNLESIGLPF  179

Query  698  PKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTS--SCADS---  862
            PK++ M ++ + W A DWATQGG VK DWS APFTA Y+NF I+ C+G+   SCA +   
Sbjct  180  PKNQSMGIYATFWNADDWATQGGRVKTDWSLAPFTASYRNFKINACLGSQGPSCASTSTE  239

Query  863  -----KPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
                   W    L+A   N+L+ V++K  VY+YCTD  +F    P ECK
Sbjct  240  RSPVGSSWKNQGLNAAERNRLRWVQSKFMVYDYCTDRIKFNKGLPRECK  288



>ref|NP_001284443.1| probable xyloglucan endotransglucosylase/hydrolase protein 23 
precursor [Cucumis melo]
 gb|ABI94063.1| xyloglucan endotransglucosylase/hydrolase 3 [Cucumis melo]
Length=285

 Score =   302 bits (774),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/285 (52%), Positives = 196/285 (69%), Gaps = 16/285 (6%)
 Frame = +2

Query  167  MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
            M + +   A SL+ ++ A      NFN D Q+ +G+   ++ +NG  + L+LD+ +GSGF
Sbjct  6    MFLTLLFSAASLIAISSA------NFNQDFQITWGDGRAKILNNGELLTLSLDKASGSGF  59

Query  347  NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
             ++NEYLFG+ DMQ+KLV G SAGTVT +YL+S  G   DE+DFEFLGN T  PYT+HTN
Sbjct  60   QSQNEYLFGKIDMQLKLVAGNSAGTVTAYYLSSK-GSTWDEIDFEFLGNLTGDPYTLHTN  118

Query  527  VFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKS  706
            VF+ GKG+REQQFHLWFDPTA +H Y+I+WN  RIV+ VD  PIR ++N E+ GVPFPK 
Sbjct  119  VFSQGKGNREQQFHLWFDPTADFHTYSILWNPNRIVFSVDGTPIREFKNWESNGVPFPKD  178

Query  707  KPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCV---GTSSCADSKP---  868
            +PM+++ SLW A DWAT+GG VK DW+KAPFTA YKNF  + CV   G SSC+ S P   
Sbjct  179  QPMRIYSSLWNADDWATRGGLVKTDWTKAPFTASYKNFKAEACVLSGGQSSCSPSAPAGS  238

Query  869  ---WGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
               W    +D+ +  +L+ V+    +YNYCTD +RF    P ECK
Sbjct  239  RNSWLSEEMDSVSQERLKWVQKNYMIYNYCTDTRRFPQGLPTECK  283



>ref|XP_010442224.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
20 [Camelina sativa]
Length=282

 Score =   302 bits (773),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/255 (55%), Positives = 188/255 (74%), Gaps = 5/255 (2%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDN-GNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSA  415
            +F+ DVQ+++G+  G++ DN GN ++L+LD+ +GSGF +  E+L+G+ ++QMKLV G SA
Sbjct  28   SFHKDVQIHWGDGRGKILDNTGNLLSLSLDKFSGSGFQSHQEFLYGKVEVQMKLVPGNSA  87

Query  416  GTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAY  595
            GTVTTFYL SP G   DE+DFEFLGN +  PYT+HTNV+  G GD+EQQFHLWFDPT  +
Sbjct  88   GTVTTFYLKSP-GTTWDEIDFEFLGNISGHPYTLHTNVYTKGTGDKEQQFHLWFDPTVHF  146

Query  596  HDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVK  775
            H Y I+WN QR+++ +D +PIR ++N E+VGVPFPK +PM+++ SLWEA  WAT+GG  K
Sbjct  147  HTYCIVWNPQRVIFTIDGIPIREFKNSESVGVPFPKHQPMRLYASLWEAEHWATRGGLEK  206

Query  776  VDWSKAPFTAYYKNFVIDGCV---GTSSCADSKPWGKYALDADANNKLQGVRTKNRVYNY  946
             DWSKAPFTA+Y+N+ +D CV   G SSC+ + PW    LD    N+++  + K  VYNY
Sbjct  207  TDWSKAPFTAFYRNYNVDACVWANGKSSCSANSPWFTQVLDFKGKNRVKWAQRKYMVYNY  266

Query  947  CTDNKRFGGNPPAEC  991
            CTD KRF    P EC
Sbjct  267  CTDKKRFPQGAPPEC  281



>gb|KFK27295.1| hypothetical protein AALP_AA8G363900 [Arabis alpina]
Length=284

 Score =   302 bits (773),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/263 (55%), Positives = 188/263 (71%), Gaps = 10/263 (4%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  DV++ +G+  GQ+++NG  + L+LD+ +GSGF +KNEYLFG+  MQMKLV G SAG
Sbjct  23   NFQRDVEITWGDGRGQIKNNGELLTLSLDKSSGSGFQSKNEYLFGKIGMQMKLVPGNSAG  82

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTT YL SP G   DE+DFEFLGN++ +PYT+HTNV+  GKGD+EQQF LWFDPTA +H
Sbjct  83   TVTTLYLKSP-GTTWDEIDFEFLGNSSGEPYTLHTNVYTQGKGDKEQQFKLWFDPTADFH  141

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             YTI+WN QRI++ VD  PIR ++N E++G  FPK+KPM+++ SLW A DWAT+GG VK 
Sbjct  142  TYTILWNPQRIIFTVDGTPIREFKNMESIGTLFPKNKPMRMYSSLWNADDWATRGGLVKT  201

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCAD------SKPWGKYALDADANNKLQGVRTKN  931
            DWSKAPFTA Y+ F  +GCV   G SSC +      +  W    LD+ A  +++ V+   
Sbjct  202  DWSKAPFTASYRGFNQEGCVWSNGKSSCPNGSKKGTTGSWLSQELDSTAQQRMRWVQRNY  261

Query  932  RVYNYCTDNKRFGGNPPAECKPA  1000
             +YNYCTD+KRF    P EC  A
Sbjct  262  MIYNYCTDSKRFPQGLPKECLAA  284



>ref|XP_010482054.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
20-like [Camelina sativa]
Length=282

 Score =   302 bits (773),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/255 (55%), Positives = 188/255 (74%), Gaps = 5/255 (2%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDN-GNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSA  415
            +F+ DVQ+++G+  G++ DN GN ++L+LD+ +GSGF +  E+L+G+ ++QMKLV G SA
Sbjct  28   SFHKDVQIHWGDGRGKILDNTGNLLSLSLDKFSGSGFQSHQEFLYGKVEVQMKLVPGNSA  87

Query  416  GTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAY  595
            GTVTTFYL SP G   DE+DFEFLGN +  PYT+HTNV+  G GD+EQQFHLWFDPT  +
Sbjct  88   GTVTTFYLKSP-GTTWDEIDFEFLGNISGHPYTLHTNVYTKGTGDKEQQFHLWFDPTVHF  146

Query  596  HDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVK  775
            H Y I+WN QR+++ +D +PIR ++N E+VGVPFPK +PM+++ SLWEA  WAT+GG  K
Sbjct  147  HTYCIVWNPQRVIFTIDGIPIREFKNSESVGVPFPKHQPMRLYASLWEAEHWATRGGLEK  206

Query  776  VDWSKAPFTAYYKNFVIDGCV---GTSSCADSKPWGKYALDADANNKLQGVRTKNRVYNY  946
             DWSKAPFTA+Y+N+ +D CV   G SSC+ + PW    LD    N+++  + K  VYNY
Sbjct  207  TDWSKAPFTAFYRNYNVDACVWANGKSSCSANSPWFTQVLDFKGKNRVKWAQRKYMVYNY  266

Query  947  CTDNKRFGGNPPAEC  991
            CTD KRF    P EC
Sbjct  267  CTDKKRFPQGAPPEC  281



>ref|XP_011045332.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Populus 
euphratica]
Length=292

 Score =   302 bits (774),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/262 (54%), Positives = 184/262 (70%), Gaps = 11/262 (4%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NFN +V + +G+   ++   GN ++L LD+ +GSGF +KN YLFGR DMQ+KLV G SAG
Sbjct  27   NFNQEVDLTWGDDRAKILSGGNVLSLTLDKVSGSGFQSKNGYLFGRIDMQIKLVGGNSAG  86

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            +VT +YL+S     HDE+DFEFLGN + +PYTVHTNV+  GKGDREQQFHLWFDPT  +H
Sbjct  87   SVTAYYLSSE-RPYHDEIDFEFLGNLSGEPYTVHTNVYTQGKGDREQQFHLWFDPTKDFH  145

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+++WN QRI++LVD+ PIRVYEN E++GVPFPK++PMK++ SLW A  WAT+GG VK 
Sbjct  146  LYSVVWNHQRIIFLVDDTPIRVYENQESIGVPFPKNQPMKLYSSLWNADQWATRGGLVKA  205

Query  779  DWSKAPFTAYYKNFVIDGCV----------GTSSCADSKPWGKYALDADANNKLQGVRTK  928
            DWSKAPFTAYY+NF  + C+           T+    +K W    LD+     L+ V+  
Sbjct  206  DWSKAPFTAYYRNFKANACIWSSGSSSCSLKTTGSIKNKAWQTQGLDSTGRRSLRWVQKY  265

Query  929  NRVYNYCTDNKRFGGNPPAECK  994
              +YNYCTD KRF    P EC+
Sbjct  266  YMIYNYCTDYKRFPMGRPRECR  287



>ref|XP_010439278.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
20-like [Camelina sativa]
Length=282

 Score =   302 bits (773),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/255 (55%), Positives = 188/255 (74%), Gaps = 5/255 (2%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDN-GNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSA  415
            +F+ DVQ+++G+  G++ DN GN ++L+LD+ +GSGF +  E+L+G+ ++QMKLV G SA
Sbjct  28   SFHKDVQIHWGDGRGKILDNTGNLLSLSLDKFSGSGFQSHQEFLYGKVEVQMKLVPGNSA  87

Query  416  GTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAY  595
            GTVTTFYL SP G   DE+DFEFLGN +  PYT+HTNV+  G GD+EQQFHLWFDPT  +
Sbjct  88   GTVTTFYLKSP-GTTWDEIDFEFLGNISGHPYTLHTNVYTKGTGDKEQQFHLWFDPTVHF  146

Query  596  HDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVK  775
            H Y I+WN QR+++ +D +PIR ++N E+VGVPFPK +PM+++ SLWEA  WAT+GG  K
Sbjct  147  HTYCIVWNPQRVIFTIDGIPIREFKNSESVGVPFPKHQPMRLYASLWEAEHWATRGGLEK  206

Query  776  VDWSKAPFTAYYKNFVIDGCV---GTSSCADSKPWGKYALDADANNKLQGVRTKNRVYNY  946
             DWSKAPFTA+Y+N+ +D CV   G SSC+ + PW    LD    N+++  + K  VYNY
Sbjct  207  TDWSKAPFTAFYRNYNVDACVWANGKSSCSANSPWFTQVLDFKGKNRVKWAQRKYMVYNY  266

Query  947  CTDNKRFGGNPPAEC  991
            CTD KRF    P EC
Sbjct  267  CTDKKRFPQGAPPEC  281



>ref|XP_010681689.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Beta 
vulgaris subsp. vulgaris]
Length=284

 Score =   302 bits (773),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/281 (54%), Positives = 193/281 (69%), Gaps = 19/281 (7%)
 Frame = +2

Query  158  QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFG-NHLGQVQDNGNTMALNLDQQT  334
            Q+ M++I+ +V+ S+ G          +F++  Q  FG   +      G+ ++L+LDQ +
Sbjct  17   QIIMVLIL-MVSTSVHGA---------HFDDAFQQTFGGERVKTYGSGGDHLSLSLDQYS  66

Query  335  GSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTS-PIGQAHDEVDFEFLGNATFQPY  511
            GSGF +K +YLFGRFDMQMKLV G SAGTVTT YL S P    HDE+DFEFLGNA+ QPY
Sbjct  67   GSGFTSKKDYLFGRFDMQMKLVAGNSAGTVTTLYLQSDPSTGRHDEIDFEFLGNASGQPY  126

Query  512  TVHTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGV  691
            T+HTNVF +GKG REQQF LWFDPT  YH Y+I+WN + I++LVD  PIRV+ NHE  GV
Sbjct  127  TLHTNVFGEGKGSREQQFRLWFDPTNEYHTYSIVWNPRLIMFLVDETPIRVFLNHEKHGV  186

Query  692  PFPKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTSSCADSKPW  871
            PF K +PMK++ SLWEA DWATQGG VK DWSKAPFTAYY+N+ +D   G         W
Sbjct  187  PFLKKQPMKLYSSLWEADDWATQGGLVKTDWSKAPFTAYYRNYNVDTARGGK-------W  239

Query  872  GKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
              + LDA++  K++ ++ KN +YNYC D KRF    P ECK
Sbjct  240  WTHDLDANSRRKMRRIQKKNMIYNYCQDAKRFPEGYPTECK  280



>ref|NP_193149.2| probable xyloglucan endotransglucosylase/hydrolase protein 15 
[Arabidopsis thaliana]
 sp|Q38911.1|XTH15_ARATH RecName: Full=Probable xyloglucan endotransglucosylase/hydrolase 
protein 15; Short=At-XTH15; Short=XTH-15; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAB18368.1| xyloglucan endotransglycosylase-related protein [Arabidopsis 
thaliana]
 gb|AAK76539.1| putative xyloglucan endotransglycosylase-related protein XTR-7 
[Arabidopsis thaliana]
 gb|AAM64835.1| xyloglucan endotransglycosylase-related protein XTR-7 [Arabidopsis 
thaliana]
 gb|AAW28549.1| At4g14130 [Arabidopsis thaliana]
 gb|AEE83378.1| probable xyloglucan endotransglucosylase/hydrolase protein 15 
[Arabidopsis thaliana]
Length=289

 Score =   302 bits (773),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/262 (55%), Positives = 185/262 (71%), Gaps = 9/262 (3%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF ++  + +G+H G++ + GN ++L+LDQ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  27   NFFDEFDLTWGDHRGKIFNGGNMLSLSLDQVSGSGFKSKKEYLFGRIDMQLKLVAGNSAG  86

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G  HDE+DFEFLGN T +PY +HTNVFA GKGDREQQF+LWFDPT  +H
Sbjct  87   TVTAYYLSSQ-GATHDEIDFEFLGNETGKPYVLHTNVFAQGKGDREQQFYLWFDPTKNFH  145

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+W  Q I++LVDN+PIRV+ N E +GVPFPKS+PM+++ SLW A DWAT+GG VK 
Sbjct  146  TYSIVWRPQHIIFLVDNLPIRVFNNAEKLGVPFPKSQPMRIYSSLWNADDWATRGGLVKT  205

Query  779  DWSKAPFTAYYKNFVIDGCVGTSSC--------ADSKPWGKYALDADANNKLQGVRTKNR  934
            DWSKAPFTAYY+ F    C  +S C         D K      L+A    +L+ V+    
Sbjct  206  DWSKAPFTAYYRGFNAAACTASSGCDPKFKSSFGDGKLQVATELNAYGRRRLRWVQKYFM  265

Query  935  VYNYCTDNKRFGGNPPAECKPA  1000
            +YNYC+D KRF    P ECK +
Sbjct  266  IYNYCSDLKRFPRGFPPECKKS  287



>ref|XP_008796499.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Phoenix dactylifera]
Length=280

 Score =   301 bits (772),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 147/285 (52%), Positives = 190/285 (67%), Gaps = 17/285 (6%)
 Frame = +2

Query  158  QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
               +I+   VVA S             NF  DV + +G+  G++ +NGN + L+LD+ +G
Sbjct  8    HASLILTTLVVAAS------------ANFLADVDLTWGSGRGKILENGNLLQLSLDKASG  55

Query  338  SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
            SGF +K EYLF R DM+MKLV G SAGTVTT YL+S  G  HDE+DFEFLGN + QPYT+
Sbjct  56   SGFQSKQEYLFARMDMRMKLVPGNSAGTVTTLYLSSQ-GSTHDEIDFEFLGNLSGQPYTL  114

Query  518  HTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPF  697
            HTN++  GKGDREQQFHLWFDP   +H Y+I+WN Q+I++ VD  PIRV+ N E  GVP+
Sbjct  115  HTNIYTQGKGDREQQFHLWFDPRMDFHTYSILWNPQQILFYVDGTPIRVFRNMEAKGVPY  174

Query  698  PKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCV---GTSSCADSK-  865
            PK++PM+++ SLW A DWAT GG VK DWS+APF A Y+ F  D CV   G S+C+ SK 
Sbjct  175  PKNQPMRLYSSLWNADDWATMGGRVKTDWSQAPFVASYRGFSADACVWAGGKSTCSASKG  234

Query  866  PWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECKPA  1000
             W   +LD+    KL+ VR K  +Y+YC D KRF    P EC P+
Sbjct  235  TWWAQSLDSPGAQKLKWVRQKYMIYDYCKDPKRFPQGFPPECSPS  279



>gb|ABM91071.1| xyloglucan endotransglycosylase/hydrolase precursor XTH-14 [Populus 
tremula x Populus tremuloides]
Length=284

 Score =   301 bits (771),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 148/288 (51%), Positives = 195/288 (68%), Gaps = 19/288 (7%)
 Frame = +2

Query  164  CMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSG  343
            C    + V+ CS+            NF+ D  + +G+   ++ + G  ++L+LD+ +GSG
Sbjct  5    CNGFSLFVMVCSMA------VVASGNFHQDFDLTWGDRRAKIFNGGQLLSLSLDKVSGSG  58

Query  344  FNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHT  523
            F +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +HT
Sbjct  59   FQSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILHT  117

Query  524  NVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPK  703
            NVF  GKG+REQQF+LWFDPT  +H Y+IIWN Q I++LVD+VPIRV++N E++GVPFPK
Sbjct  118  NVFTQGKGNREQQFYLWFDPTRNFHTYSIIWNPQHIIFLVDSVPIRVFKNAESIGVPFPK  177

Query  704  SKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCV---GTSSCADSKP--  868
            S+PM+++ SLW A DWAT+GG VK DW+KAPF AYY+NF  + C    G SSC  SKP  
Sbjct  178  SQPMRIYSSLWNADDWATRGGLVKTDWTKAPFNAYYRNFKANACTWSYGASSCG-SKPSS  236

Query  869  ------WGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
                  W    LDA +  +L+ V+    +YNYCTD +RF   PP ECK
Sbjct  237  AFSDGAWKTNELDAPSRRRLRWVQKYFMIYNYCTDLRRFPQGPPPECK  284



>ref|XP_004303860.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16-like [Fragaria vesca subsp. vesca]
Length=296

 Score =   301 bits (772),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 150/292 (51%), Positives = 198/292 (68%), Gaps = 19/292 (7%)
 Frame = +2

Query  161  VCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGS  340
            +  ++++ +   SL+ +  +      NF  D  + FG+   ++ + G  + LNLD+ +GS
Sbjct  6    ISRMLLLSLFITSLLAMTASAG----NFFQDFDITFGDQRAKILEGGQFLTLNLDKYSGS  61

Query  341  GFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVH  520
            GF +K EYLFGR DMQ+KLV G SAGTVTT+YL+S  G  HDE+DFEFLGN++  PYT+H
Sbjct  62   GFKSKKEYLFGRIDMQIKLVPGNSAGTVTTYYLSSE-GPTHDEIDFEFLGNSSGNPYTLH  120

Query  521  TNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFP  700
            TNVF+ GKGDREQQFHLWFDPT A+H Y+ +WNSQRI++LVDN+PIRV+ N E+ GVPFP
Sbjct  121  TNVFSQGKGDREQQFHLWFDPTKAFHTYSFVWNSQRIIFLVDNIPIRVFNNLESFGVPFP  180

Query  701  KSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYY-KNFVIDGCVG---TSSCA----  856
            K++PM+V+ SLW A DWATQGG VK DW++APF  +  K +  + CV    +SSC     
Sbjct  181  KNQPMRVYSSLWNADDWATQGGRVKTDWTQAPFYCFIPKPYKANACVAGSSSSSCGVATT  240

Query  857  ---DSK---PWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
               DS     W    LDA   N+L+ V+ K  VYNYC+D KRF    P ECK
Sbjct  241  ASTDSTQQGAWQTQTLDAAGRNRLRWVQQKFMVYNYCSDLKRFPQGLPVECK  292



>ref|XP_010450105.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15 [Camelina sativa]
Length=289

 Score =   301 bits (771),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 147/283 (52%), Positives = 196/283 (69%), Gaps = 14/283 (5%)
 Frame = +2

Query  170  IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
            I++  V+  S+VG A +      NF N+  + +G+H G++ + G+ ++L+LD+ +GSGF 
Sbjct  9    IVVATVLLMSMVGSAYSG-----NFFNEFDLTWGDHRGKIFNGGSMLSLSLDRVSGSGFK  63

Query  350  TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
            +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G+ HDE+DFEFLGN T +PY +HTNV
Sbjct  64   SKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GETHDEIDFEFLGNETGKPYVLHTNV  122

Query  530  FADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSK  709
            FA GKG+REQQF+LWFDPT  +H Y+I+W  Q I++LVDN+PIRV+ N E +GVPFPKS+
Sbjct  123  FAQGKGNREQQFYLWFDPTKNFHTYSIVWRPQHIIFLVDNLPIRVFNNAEKLGVPFPKSQ  182

Query  710  PMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTSSC--------ADSK  865
            PM+++ SLW A DWAT+GG VK DWSKAPFTAYY+ F    C  +S C         D K
Sbjct  183  PMRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRGFNAAACTVSSGCDPKFKSSFGDGK  242

Query  866  PWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
                  L+A    +L+ V+    +YNYC+D KRF    P ECK
Sbjct  243  LQIASELNAYGRRRLRWVQKYFMIYNYCSDLKRFPRGFPPECK  285



>ref|XP_010435185.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15 [Camelina sativa]
Length=289

 Score =   301 bits (771),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 148/283 (52%), Positives = 195/283 (69%), Gaps = 14/283 (5%)
 Frame = +2

Query  170  IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
            I++  V+  S+VG A +      NF N+  + +G+H G++ + GN ++L+LD+ +GSGF 
Sbjct  9    IVVATVLLMSMVGSAYSG-----NFFNEFDLTWGDHRGKIFNGGNMLSLSLDRVSGSGFK  63

Query  350  TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
            +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN T +PY +HTNV
Sbjct  64   SKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GATHDEIDFEFLGNETGKPYVLHTNV  122

Query  530  FADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSK  709
            FA GKG+REQQF+LWFDPT  +H Y+I+W  Q I++LVDN+PIRV+ N E +GVPFPKS+
Sbjct  123  FAQGKGNREQQFYLWFDPTKNFHTYSIVWRPQHIIFLVDNLPIRVFNNAEKLGVPFPKSQ  182

Query  710  PMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTSSC--------ADSK  865
            PM+++ SLW A DWAT+GG VK DWSKAPFTAYY+ F    C  +S C         D K
Sbjct  183  PMRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRGFNAAACTVSSGCDPKFKRSFGDGK  242

Query  866  PWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
                  L+A    +L+ V+    +YNYC+D KRF    P ECK
Sbjct  243  LQVANELNAYGRRRLRWVQKYFMIYNYCSDLKRFPRGFPPECK  285



>ref|XP_010440528.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15 [Camelina sativa]
Length=290

 Score =   301 bits (771),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 147/291 (51%), Positives = 194/291 (67%), Gaps = 13/291 (4%)
 Frame = +2

Query  152  QQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQ  331
            Q     I++  V+  S+VG A +      NF N+  + +G+H G++ + GN ++L+LD+ 
Sbjct  3    QNSSLTIVVATVLLMSMVGSAYSG-----NFFNEFDLTWGDHRGKIFNGGNMLSLSLDRV  57

Query  332  TGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPY  511
            +GSGF +K EYLFGR DMQ+KLV G SAGTVT +Y  S  G  HDE+DFEFLGN T +PY
Sbjct  58   SGSGFKSKKEYLFGRIDMQLKLVAGNSAGTVTAYYKLSSQGATHDEIDFEFLGNETGKPY  117

Query  512  TVHTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGV  691
             +HTNVFA GKG+REQQF+LWFDPT  +H Y+I+W  Q I++LVDN+PIRV+ N E +G 
Sbjct  118  VLHTNVFAQGKGNREQQFYLWFDPTKNFHTYSIVWRPQHIIFLVDNLPIRVFNNAEKLGA  177

Query  692  PFPKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTSSC------  853
            PFPKS+PM+++ SLW A DWAT+GG VK DWSKAPFTAYY+ F    C  +S C      
Sbjct  178  PFPKSQPMRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRGFNAAACTVSSGCDPKFKR  237

Query  854  --ADSKPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECKPA  1000
               D K      L+A    +L+ V+    +YNYC+D KRF    P ECK +
Sbjct  238  SFGDGKLQVANELNAYGRRRLRWVQKYFMIYNYCSDLKRFPRGFPPECKKS  288



>ref|XP_004140250.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15-like, partial [Cucumis sativus]
Length=286

 Score =   301 bits (770),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 147/264 (56%), Positives = 192/264 (73%), Gaps = 14/264 (5%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  DV + +G    ++ D G  ++L+LD+ +GSGF +K ++LFGRFD+QM LV G SAG
Sbjct  20   NFLRDVDITWGGPRAKILDGGRHLSLSLDKDSGSGFQSKKQFLFGRFDVQMMLVPGNSAG  79

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTFYL+S  G +HDE+DFEFLGN +  PYT+HTNV++ GKGDREQQFHLWFDPT A+H
Sbjct  80   TVTTFYLSSE-GTSHDEIDFEFLGNLSGDPYTLHTNVYSQGKGDREQQFHLWFDPTKAFH  138

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I W+ Q I++LVDN+PIRV+ N E +GV +PKS+PMKV+ SLW A DWAT+GG VK 
Sbjct  139  TYSIDWSPQSIMFLVDNIPIRVFHNWEKIGVSYPKSQPMKVYSSLWNADDWATRGGRVKT  198

Query  779  DWSKAPFTAYYKNFVIDGCVGTSSCADSKPWGKYA------------LDADANNKLQGVR  922
            DW+KAPFTA Y+NF  +GCV ++  + S    KYA            LDA + N+L+ V+
Sbjct  199  DWTKAPFTASYRNFNANGCVASTGSSSSCS-SKYANTQQGGTKNNQGLDAKSRNRLRWVQ  257

Query  923  TKNRVYNYCTDNKRFGGNPPAECK  994
            +K  VYNYCTD +RF    PAEC+
Sbjct  258  SKFMVYNYCTDRQRFPQGIPAECR  281



>gb|AGI42452.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   301 bits (770),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 143/258 (55%), Positives = 185/258 (72%), Gaps = 8/258 (3%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF+ND  + +G+  G++ +NG  + L LD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  26   NFHNDFDVTWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNSAG  85

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNVF+ GKG REQQFHLWFDPTA +H
Sbjct  86   TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGGREQQFHLWFDPTADFH  144

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN QRI++ VDN PIR ++N E+VGV +PKS+ M+++ SLW A DWAT+GG +K 
Sbjct  145  TYSILWNPQRIIFSVDNTPIREFKNAESVGVAYPKSQAMRIYSSLWNADDWATRGGLIKT  204

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCADSKP----WGKYALDADANNKLQGVRTKNRV  937
            DWSKAPFTA Y+NF    C+   G SSC  + P    W    LDA +  +LQ V+    +
Sbjct  205  DWSKAPFTASYRNFNAKACIWSSGRSSCNSNAPSNNAWLNEELDATSQQRLQWVQKNYMI  264

Query  938  YNYCTDNKRFGGNPPAEC  991
            YNYCTD KRF    P EC
Sbjct  265  YNYCTDAKRFPQGYPPEC  282



>ref|XP_004164863.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
sativus]
 emb|CCH26410.1| xyloglucan endotransglycosylase [Cucumis sativus]
Length=286

 Score =   300 bits (769),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 151/287 (53%), Positives = 200/287 (70%), Gaps = 20/287 (7%)
 Frame = +2

Query  170  IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
            ++++     SLV    A      NF  DV + +G    ++ D G  ++L+LD+ +GSGF 
Sbjct  3    LLLLCAFLASLVAATAA------NFLRDVDITWGGPRAKILDGGRHLSLSLDKDSGSGFQ  56

Query  350  TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
            +K ++LFGRFD+QM LV G SAGTVTTFYL+S  G +HDE+DFEFLGN +  PYT+HTNV
Sbjct  57   SKKQFLFGRFDVQMMLVPGNSAGTVTTFYLSSE-GTSHDEIDFEFLGNLSGDPYTLHTNV  115

Query  530  FADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSK  709
            ++ GKGDREQQFHLWFDPT A+H Y+I W+ Q I++LVDN+PIRV+ N E +GV +PKS+
Sbjct  116  YSQGKGDREQQFHLWFDPTKAFHTYSIDWSPQSIMFLVDNIPIRVFHNWEKIGVSYPKSQ  175

Query  710  PMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTSSCADSKPWGKYA--  883
            PMKV+ SLW A DWAT+GG VK DW+KAPFTA Y+NF  +GCV ++  + S    KYA  
Sbjct  176  PMKVYSSLWNADDWATRGGRVKTDWTKAPFTASYRNFNANGCVASTGSSSSCS-SKYANT  234

Query  884  ----------LDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
                      LDA + N+L+ V++K  VYNYCTD +RF    PAEC+
Sbjct  235  QQGGAKNNQGLDAKSRNRLRWVQSKFMVYNYCTDRQRFPQGIPAECR  281



>ref|XP_002520388.1| Brassinosteroid-regulated protein BRU1 precursor, putative [Ricinus 
communis]
 gb|EEF42004.1| Brassinosteroid-regulated protein BRU1 precursor, putative [Ricinus 
communis]
Length=287

 Score =   300 bits (769),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 146/262 (56%), Positives = 185/262 (71%), Gaps = 12/262 (5%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF     + +G+H G++ + G  + L+LD+ +GSGF +KNEYLFGR DMQ+KLV G SAG
Sbjct  23   NFYKHFDITWGDHRGKILNGGQLLTLSLDKASGSGFQSKNEYLFGRIDMQIKLVPGNSAG  82

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTFYL+S  G  HDE+DFEFLGN +  PY +HTNVF+ GKG+REQQF+LWFDPT A+H
Sbjct  83   TVTTFYLSSQ-GPNHDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTLAFH  141

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN+QRI++LVDN+PIRV+ N E  GVPFP  KPM+++ SLW A DWAT+GG VK 
Sbjct  142  TYSIVWNAQRIMFLVDNIPIRVFNNLEPKGVPFPNKKPMRIYSSLWNADDWATRGGLVKT  201

Query  779  DWSKAPFTAYYKNFVIDGCV----------GTSSCADSKPWGKYALDADANNKLQGVRTK  928
            DW+KAPFTA Y+NF  + CV           T+S  DS  W    LD    N+++ V  K
Sbjct  202  DWTKAPFTASYRNFNANACVWSSGSPCELISTNSLQDSA-WQVQELDVAGRNRIRWVHQK  260

Query  929  NRVYNYCTDNKRFGGNPPAECK  994
              +YNYCTD KRF    P ECK
Sbjct  261  YMIYNYCTDFKRFPEGLPPECK  282



>ref|XP_009378317.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Pyrus x bretschneideri]
Length=292

 Score =   301 bits (770),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 143/289 (49%), Positives = 198/289 (69%), Gaps = 15/289 (5%)
 Frame = +2

Query  158  QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
            +V M   + ++  S+     AV     NF  D ++ FG+   +V +NG  + L+LD+ +G
Sbjct  5    KVSMTFFLSLITISV----GAVVASADNFYQDFEVMFGDQHAKVLENGQVVTLSLDKSSG  60

Query  338  SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
            +GF +KNEYLFGRFDMQ+KL  G SAGTVTTFYL+S  G  HDE+DFEFLGN+T +PYT+
Sbjct  61   AGFKSKNEYLFGRFDMQIKLQPGNSAGTVTTFYLSSS-GSNHDEIDFEFLGNSTGEPYTI  119

Query  518  HTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPF  697
            HTNV+A G+G +EQQF +WFDPT  +H Y+++WN++RI++LVDN PIRV+ N E++G+PF
Sbjct  120  HTNVYAQGQGLKEQQFRVWFDPTQDFHTYSVVWNTKRIIFLVDNSPIRVFNNLESIGLPF  179

Query  698  PKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVG----------TS  847
            PK++ M+++ + W A DWATQGG VK DW+ APFTA Y+NF I+ C+G          T+
Sbjct  180  PKNQLMRIYATFWNADDWATQGGRVKTDWNLAPFTASYRNFNINACLGSQGPSCASTSTN  239

Query  848  SCADSKPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
              AD   W    L+A   N+L+ V+ K  VY+YCTD  +F    P ECK
Sbjct  240  RSADGASWANQGLNAAERNRLRWVQRKFMVYDYCTDRIKFTKGLPRECK  288



>gb|KGN47997.1| hypothetical protein Csa_6G423390 [Cucumis sativus]
Length=286

 Score =   300 bits (769),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 151/287 (53%), Positives = 200/287 (70%), Gaps = 20/287 (7%)
 Frame = +2

Query  170  IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
            ++++     SLV    A      NF  DV + +G    ++ D G  ++L+LD+ +GSGF 
Sbjct  3    LLLLCAFLASLVAATAA------NFLRDVDITWGGPRAKILDGGRHLSLSLDKDSGSGFQ  56

Query  350  TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
            +K ++LFGRFD+QM LV G SAGTVTTFYL+S  G +HDE+DFEFLGN +  PYT+HTNV
Sbjct  57   SKKQFLFGRFDVQMMLVPGNSAGTVTTFYLSSE-GTSHDEIDFEFLGNLSGDPYTLHTNV  115

Query  530  FADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSK  709
            ++ GKGDREQQFHLWFDPT A+H Y+I W+ Q I++LVDN+PIRV+ N E +GV +PKS+
Sbjct  116  YSQGKGDREQQFHLWFDPTKAFHTYSIDWSPQSIMFLVDNIPIRVFHNWEKIGVSYPKSQ  175

Query  710  PMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTSSCADSKPWGKYA--  883
            PMKV+ SLW A DWAT+GG VK DW+KAPFTA Y+NF  +GCV ++  + S    KYA  
Sbjct  176  PMKVYSSLWNADDWATRGGRVKTDWTKAPFTASYRNFNANGCVASTGSSSSCS-SKYANT  234

Query  884  ----------LDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
                      LDA + N+L+ V++K  VYNYCTD +RF    PAEC+
Sbjct  235  QQGGTKNNQGLDAKSRNRLRWVQSKFMVYNYCTDRQRFPQGIPAECR  281



>ref|XP_004293654.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16-like [Fragaria vesca subsp. vesca]
Length=306

 Score =   301 bits (770),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 153/304 (50%), Positives = 195/304 (64%), Gaps = 29/304 (10%)
 Frame = +2

Query  134  GKMKKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMA  313
            GKM K      +++    V+C  +  A A      NF  D  + +G+H  ++ D GN + 
Sbjct  11   GKMLK------IVLFFLSVSCPFMAAASAG-----NFYRDFDLTWGDHRAKILDGGNLLT  59

Query  314  LNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGN  493
            L+LD+ +GSGF +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN
Sbjct  60   LSLDRISGSGFQSKREYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPNHDEIDFEFLGN  118

Query  494  ATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYEN  673
             +  PY VHTNV+  GKGDREQQFHLWFDPT  +H Y+I+WN QRI++LVDN PIRV+ N
Sbjct  119  LSGDPYIVHTNVYTQGKGDREQQFHLWFDPTKNFHTYSILWNPQRIIFLVDNTPIRVFNN  178

Query  674  HENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCV---GT  844
             E +GV FPK +PMK++ SLW A  WAT+GG +K DWSKAPFTAYYK F  + CV   G+
Sbjct  179  EEAIGVGFPKKQPMKLYSSLWNADQWATRGGLIKTDWSKAPFTAYYKGFNANACVWSRGS  238

Query  845  SSCADSKP--------------WGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPP  982
             SCA  +               W    LDA    +L+ V+  + +YNYCTD KRF    P
Sbjct  239  LSCASGRSTPRPYGLGMNYNNGWQTQGLDAPGRRRLRWVQRYHMIYNYCTDLKRFPQGRP  298

Query  983  AECK  994
             EC+
Sbjct  299  RECR  302



>ref|XP_010443442.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22 [Camelina sativa]
 ref|XP_010483278.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22 [Camelina sativa]
Length=287

 Score =   300 bits (768),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/266 (54%), Positives = 186/266 (70%), Gaps = 13/266 (5%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  DV++ +G+  GQ+++NG  + L LD+ +GSGF +KNEYLFG+ DMQMKLV G SAG
Sbjct  23   NFQRDVEITWGDGRGQIKNNGELLTLTLDKSSGSGFQSKNEYLFGKIDMQMKLVPGNSAG  82

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTT YL SP G   DE+DFEFLGN++  PYT+HTNV+  GKGD+EQQF LWFDPTA +H
Sbjct  83   TVTTLYLKSP-GTTWDEIDFEFLGNSSGDPYTLHTNVYTQGKGDKEQQFKLWFDPTADFH  141

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN QRI++ VD  PIR ++N E++G  FPK+KPM+++ SLW A DWAT+GG VK 
Sbjct  142  TYSILWNPQRIIFTVDGTPIREFKNMESLGTLFPKNKPMRMYSSLWNADDWATRGGLVKT  201

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCAD---------SKPWGKYALDADANNKLQGVR  922
            DWSKAPFTA Y+ F  + CV   G SSC +         S  W    LD+ A  +++ V+
Sbjct  202  DWSKAPFTATYRGFKQEACVWSNGKSSCPNGSKQGTTGTSGSWLSQQLDSTAQQRMRWVQ  261

Query  923  TKNRVYNYCTDNKRFGGNPPAECKPA  1000
                +YNYCTD+KRF    P EC  A
Sbjct  262  RNYMIYNYCTDSKRFPQGLPKECLAA  287



>ref|NP_200564.1| xyloglucan endotransglucosylase/hydrolase protein 22 [Arabidopsis 
thaliana]
 sp|Q38857.1|XTH22_ARATH RecName: Full=Xyloglucan endotransglucosylase/hydrolase protein 
22; Short=At-XTH22; Short=XTH-22; AltName: Full=Touch protein 
4; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK56251.1|AF367262_1 AT5g57560/MUA2_13 [Arabidopsis thaliana]
 gb|AAL38614.1|AF446881_1 AT5g57560/MUA2_13 [Arabidopsis thaliana]
 gb|AAA92363.1| TCH4 protein [Arabidopsis thaliana]
 gb|AAC05572.1| xyloglucan endotransglycosylase related protein [Arabidopsis 
thaliana]
 dbj|BAB08791.1| TCH4 protein [Arabidopsis thaliana]
 gb|AAK96616.1| AT5g57560/MUA2_13 [Arabidopsis thaliana]
 gb|AAL05902.1| AT5g57560/MUA2_13 [Arabidopsis thaliana]
 gb|AED96915.1| xyloglucan endotransglucosylase/hydrolase protein 22 [Arabidopsis 
thaliana]
Length=284

 Score =   300 bits (768),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/264 (54%), Positives = 186/264 (70%), Gaps = 11/264 (4%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  DV++ +G+  GQ+++NG  + L+LD+ +GSGF +KNEYLFG+  MQMKLV G SAG
Sbjct  22   NFQRDVEITWGDGRGQIKNNGELLTLSLDKSSGSGFQSKNEYLFGKVSMQMKLVPGNSAG  81

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTT YL SP G   DE+DFEFLGN++ +PYT+HTNV+  GKGD+EQQF LWFDPTA +H
Sbjct  82   TVTTLYLKSP-GTTWDEIDFEFLGNSSGEPYTLHTNVYTQGKGDKEQQFKLWFDPTANFH  140

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             YTI+WN QRI++ VD  PIR ++N E++G  FPK+KPM+++ SLW A DWAT+GG VK 
Sbjct  141  TYTILWNPQRIIFTVDGTPIREFKNMESLGTLFPKNKPMRMYSSLWNADDWATRGGLVKT  200

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCADSK-------PWGKYALDADANNKLQGVRTK  928
            DWSKAPFTA Y+ F  + CV   G SSC ++         W    LD+ A  +++ V+  
Sbjct  201  DWSKAPFTASYRGFQQEACVWSNGKSSCPNASKQGTTTGSWLSQELDSTAQQRMRWVQRN  260

Query  929  NRVYNYCTDNKRFGGNPPAECKPA  1000
              +YNYCTD KRF    P EC  A
Sbjct  261  YMIYNYCTDAKRFPQGLPKECLAA  284



>ref|XP_004140252.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
sativus]
Length=291

 Score =   300 bits (768),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/293 (49%), Positives = 206/293 (70%), Gaps = 15/293 (5%)
 Frame = +2

Query  140  MKKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALN  319
            M    + + +++++ V+  S++           NF  DV + +G    ++ D+G  ++L+
Sbjct  1    MHSPHKGLAIMLLLCVLMASIL------TTSAGNFLQDVDITWGGPRAKILDSGRHLSLS  54

Query  320  LDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNAT  499
            LD+ +GSGF +K E+LFGRFD+QM+LV G SAGTVTTFYL+S  G +HDE+DFEFLGN++
Sbjct  55   LDKDSGSGFQSKQEFLFGRFDVQMQLVPGNSAGTVTTFYLSSQ-GGSHDEIDFEFLGNSS  113

Query  500  FQPYTVHTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHE  679
              PYT+HTNV++ GKG+REQQFHLWFDPT  +H Y+I W+ + I +LVDN+PIRV+ N E
Sbjct  114  GDPYTLHTNVYSQGKGNREQQFHLWFDPTKGFHTYSIDWSPESIKFLVDNIPIRVFHNWE  173

Query  680  NVGVPFPKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTSSCAD  859
            N+GV +PKS+PM+V+ SLW A DWAT+GG VK DW++APFTA Y+NF  +GCV +S  + 
Sbjct  174  NIGVSYPKSQPMRVYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFNANGCVASSGSSS  233

Query  860  S--------KPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
                     +   +  LDA + N+L+ V++K  VYNYCTD+KRF    PAEC+
Sbjct  234  CGSKFSSTLQGGAQSGLDAKSRNRLRWVQSKFMVYNYCTDHKRFPQGIPAECR  286



>ref|XP_010452475.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Camelina sativa]
Length=287

 Score =   300 bits (768),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/266 (54%), Positives = 187/266 (70%), Gaps = 13/266 (5%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  DV++ +G+  GQ+++NG  + L+LD+ +GSGF +KNEYLFG+ DMQMKLV G SAG
Sbjct  23   NFQRDVEITWGDGRGQIKNNGELLTLSLDKSSGSGFQSKNEYLFGKIDMQMKLVPGNSAG  82

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTT YL SP G   DE+DFEFLGN++  PYT+HTNV+  GKGD+EQQF LWFDPTA +H
Sbjct  83   TVTTLYLKSP-GTTWDEIDFEFLGNSSGDPYTLHTNVYTQGKGDKEQQFKLWFDPTADFH  141

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN QRI++ VD  PIR ++N E++G  FPK+KPM+++ SLW A DWAT+GG VK 
Sbjct  142  TYSILWNPQRIIFTVDGTPIREFKNMESLGTLFPKNKPMRMYSSLWNADDWATRGGLVKT  201

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCAD---------SKPWGKYALDADANNKLQGVR  922
            DWSKAPFTA Y+ F  + CV   G SSC +         S  W    LD+ A  +++ V+
Sbjct  202  DWSKAPFTATYRGFKQEACVWSNGKSSCPNGSKQGTTGTSGSWLSQQLDSTAQQRMRWVQ  261

Query  923  TKNRVYNYCTDNKRFGGNPPAECKPA  1000
                +YNYCTD+KRF    P EC  A
Sbjct  262  RNYMIYNYCTDSKRFPQGLPKECLAA  287



>ref|XP_006401194.1| hypothetical protein EUTSA_v10014326mg [Eutrema salsugineum]
 dbj|BAJ34580.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ42647.1| hypothetical protein EUTSA_v10014326mg [Eutrema salsugineum]
Length=282

 Score =   300 bits (767),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/263 (55%), Positives = 185/263 (70%), Gaps = 10/263 (4%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  DV++ +G+  GQ+++NG  + L+LD+ +GSGF +KNEYLFG+ DMQMKLV G SAG
Sbjct  21   NFQRDVEITWGDGRGQIKNNGELLTLSLDKSSGSGFQSKNEYLFGKIDMQMKLVPGNSAG  80

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTT YL SP G   DE+DFEFLGN +  PYT+HTNV+  GKGD+EQQF LWFDPTA +H
Sbjct  81   TVTTLYLKSP-GTTWDEIDFEFLGNLSGDPYTLHTNVYTQGKGDKEQQFKLWFDPTADFH  139

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             YTI+WN QRI++ VD  PIR ++N E+VG  FPK++PM+++ SLW A DWAT+GG VK 
Sbjct  140  TYTILWNPQRIIFTVDGTPIREFKNMESVGTLFPKNRPMRMYSSLWNADDWATRGGLVKT  199

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCAD------SKPWGKYALDADANNKLQGVRTKN  931
            DWSKAPFTA Y+ F  + CV   G SSC        +  W    LD+ A  +++ V+   
Sbjct  200  DWSKAPFTASYRGFNQEACVWSNGKSSCPSGSKQGTTGSWLSQELDSTAQERMRWVQRNY  259

Query  932  RVYNYCTDNKRFGGNPPAECKPA  1000
             +YNYCTD+KRF    P EC  A
Sbjct  260  MIYNYCTDSKRFPRGLPKECLAA  282



>ref|XP_010676725.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Beta vulgaris subsp. vulgaris]
Length=280

 Score =   300 bits (767),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/254 (55%), Positives = 181/254 (71%), Gaps = 4/254 (2%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            N N +  + +G+   ++ +NG  + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  24   NLNQNFDITWGDGRAKILNNGQLLTLSLDKASGSGFQSKNEYLFGKIDMQIKLVAGNSAG  83

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G  HDE+DFEFLGN + QPYT+HTNVF+ GKG REQQF LWFDPT+ +H
Sbjct  84   TVTAYYLSSQ-GPTHDEIDFEFLGNVSGQPYTLHTNVFSQGKGGREQQFRLWFDPTSDFH  142

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN QRIV+ VD  P+R + N E++GV FPK++PM+++ SLW A DWATQGG VK 
Sbjct  143  TYSILWNPQRIVFSVDGTPLREFRNMESMGVAFPKNQPMRIYSSLWNADDWATQGGRVKT  202

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCADSKPWGKYALDADANNKLQGVRTKNRVYNYC  949
            DWSKAPFTA Y+NF  D CV   G SSC  +  W    LDA +  ++Q ++    +YNYC
Sbjct  203  DWSKAPFTASYRNFNADACVSSNGRSSCNSASSWMNQELDATSQRRMQQMQKNYMIYNYC  262

Query  950  TDNKRFGGNPPAEC  991
            TD  RF    P EC
Sbjct  263  TDTPRFPQGFPKEC  276



>ref|NP_001284418.1| brassinosteroid-regulated protein BRU1-like precursor [Cucumis 
melo]
 gb|ABI94061.1| xyloglucan endotransglucosylase/hydrolase 1 [Cucumis melo]
Length=290

 Score =   300 bits (767),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 146/293 (50%), Positives = 206/293 (70%), Gaps = 15/293 (5%)
 Frame = +2

Query  140  MKKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALN  319
            M    + + +++++ V+  S++           NF  DV + +G    ++ D G  ++L+
Sbjct  1    MHFPHKGLTIMLLLCVLMASIM------TASAGNFLQDVDVTWGGPRAKILDGGRHLSLS  54

Query  320  LDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNAT  499
            LD+ +GSGF +K E+LFGRFD+QMKLV G SAGTVTTFYL+S  G +HDE+DFEFLGN++
Sbjct  55   LDKDSGSGFQSKQEFLFGRFDVQMKLVPGNSAGTVTTFYLSSQ-GGSHDEIDFEFLGNSS  113

Query  500  FQPYTVHTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHE  679
              PYT+HTNV++ GKG+REQQFHLWFDPT  +H Y+I W+ + I +LVDN+PIRV+ N E
Sbjct  114  GDPYTLHTNVYSQGKGNREQQFHLWFDPTKGFHTYSIDWSPESIKFLVDNIPIRVFHNWE  173

Query  680  NVGVPFPKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTSSCAD  859
            N+GV +PKS+PM+V+ SLW A DWAT+GG VK DW++APFTA Y+NF  +GCV +S  + 
Sbjct  174  NIGVSYPKSQPMRVYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFNANGCVASSGSSS  233

Query  860  S--------KPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
                     +   +  LDA++ N+L+ V++K  +YNYCTD+KRF    PAECK
Sbjct  234  CGSKFSSTLQGGAQSGLDANSRNRLRWVQSKFMIYNYCTDHKRFPQGIPAECK  286



>ref|XP_002863854.1| ATXTH20 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40113.1| ATXTH20 [Arabidopsis lyrata subsp. lyrata]
Length=282

 Score =   299 bits (766),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/255 (55%), Positives = 186/255 (73%), Gaps = 5/255 (2%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDN-GNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSA  415
            +F+ DVQ+++G+  G++ DN GN ++L+LD+ +GSGF +  E+L+G+ ++QMKLV G SA
Sbjct  28   SFHKDVQIHWGDGRGKILDNVGNLLSLSLDKFSGSGFQSHQEFLYGKVEVQMKLVPGNSA  87

Query  416  GTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAY  595
            GTVTTFYL SP G   DE+DFEFLGN +  PYT+HTNV+  G GD+EQQFHLWFDPT  +
Sbjct  88   GTVTTFYLKSP-GTTWDEIDFEFLGNISGHPYTLHTNVYTKGTGDKEQQFHLWFDPTVHF  146

Query  596  HDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVK  775
            H Y IIWN QR+++ +D +PIR ++N E+VGVPFPK +PM+++ SLWEA  WAT+GG  K
Sbjct  147  HTYCIIWNPQRVIFTIDGIPIREFKNSESVGVPFPKHQPMRLYASLWEAEHWATRGGLEK  206

Query  776  VDWSKAPFTAYYKNFVIDGCV---GTSSCADSKPWGKYALDADANNKLQGVRTKNRVYNY  946
             DWSKAPFTA+Y+N+ +D CV   G SSC+    W    LD    N+++  + K  VYNY
Sbjct  207  TDWSKAPFTAFYRNYNVDACVWAHGKSSCSAHSSWFTQVLDFKGKNRVKWAQRKYMVYNY  266

Query  947  CTDNKRFGGNPPAEC  991
            CTD KRF    P EC
Sbjct  267  CTDKKRFPQGAPPEC  281



>gb|AGI42451.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
 gb|AGI42453.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
 gb|AGI42462.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   300 bits (767),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/258 (55%), Positives = 185/258 (72%), Gaps = 8/258 (3%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF+ND  + +G+  G++ +NG  + L LD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  26   NFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNSAG  85

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNVF+ GKG REQQFHLWFDPTA +H
Sbjct  86   TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGGREQQFHLWFDPTADFH  144

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN QRI++ VDN PIR ++N E+VGV +PK++ M+++ SLW A DWAT+GG +K 
Sbjct  145  TYSILWNPQRIIFSVDNTPIREFKNAESVGVAYPKNQAMRIYSSLWNADDWATRGGLIKT  204

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCADSKP----WGKYALDADANNKLQGVRTKNRV  937
            DWSKAPFTA Y+NF    C+   G SSC  + P    W    LDA +  +LQ V+    +
Sbjct  205  DWSKAPFTASYRNFNAKACIWSSGRSSCNSNAPSNNAWLNEELDATSQQRLQWVQKNYMI  264

Query  938  YNYCTDNKRFGGNPPAEC  991
            YNYCTD KRF    P EC
Sbjct  265  YNYCTDAKRFPQGYPPEC  282



>ref|XP_008449531.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
melo]
 ref|XP_008449532.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
melo]
Length=291

 Score =   300 bits (767),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 147/293 (50%), Positives = 204/293 (70%), Gaps = 15/293 (5%)
 Frame = +2

Query  140  MKKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALN  319
            M    + + +++ + V+  S++           NF  DV + +G    ++ D G  ++L+
Sbjct  1    MHSPHKGLTIMLPLCVLMASIM------TATAGNFLQDVDVTWGGPRAKILDRGRHLSLS  54

Query  320  LDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNAT  499
            LD+ +GSGF +K E+LFGRFD+QMKLV G SAGTVTTFYL+S  G +HDE+DFEFLGN++
Sbjct  55   LDKDSGSGFQSKQEFLFGRFDVQMKLVPGNSAGTVTTFYLSSQ-GGSHDEIDFEFLGNSS  113

Query  500  FQPYTVHTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHE  679
              PYT+HTNV++ GKG+REQQFHLWFDPT  +H Y+I W+ + I +LVDN+PIRV+ N E
Sbjct  114  GHPYTLHTNVYSQGKGNREQQFHLWFDPTKGFHTYSIDWSPESIKFLVDNIPIRVFHNWE  173

Query  680  NVGVPFPKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTSSCAD  859
            NVGV +PKS+PM+V+ SLW A DWAT+GG VK DW++APFTA Y+NF  +GCV +S  + 
Sbjct  174  NVGVSYPKSQPMRVYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFNANGCVASSGSSS  233

Query  860  S--------KPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
                     +   +  LDA + N+L+ V++K  +YNYCTD+KRF    PAECK
Sbjct  234  CGSKFSSSLQGGAQSGLDAKSRNRLRWVQSKFMIYNYCTDHKRFPQGIPAECK  286



>gb|AGI42460.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   300 bits (767),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/258 (55%), Positives = 185/258 (72%), Gaps = 8/258 (3%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF+ND  + +G+  G++ +NG  + L LD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  26   NFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNSAG  85

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNVF+ GKG REQQFHLWFDPTA +H
Sbjct  86   TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGGREQQFHLWFDPTADFH  144

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN QRI++ VDN PIR ++N E+VGV +PK++ M+++ SLW A DWAT+GG +K 
Sbjct  145  TYSILWNPQRIIFSVDNAPIREFKNAESVGVAYPKNQAMRIYSSLWNADDWATRGGLIKT  204

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCADSKP----WGKYALDADANNKLQGVRTKNRV  937
            DWSKAPFTA Y+NF    C+   G SSC  + P    W    LDA +  +LQ V+    +
Sbjct  205  DWSKAPFTASYRNFNAKACIWSSGRSSCNSNAPSNNAWLNEELDATSQQRLQWVQKNYMI  264

Query  938  YNYCTDNKRFGGNPPAEC  991
            YNYCTD KRF    P EC
Sbjct  265  YNYCTDAKRFPQGYPPEC  282



>gb|KHG09063.1| Xyloglucan endotransglucosylase/hydrolase 22 -like protein [Gossypium 
arboreum]
Length=292

 Score =   300 bits (767),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/287 (50%), Positives = 198/287 (69%), Gaps = 19/287 (7%)
 Frame = +2

Query  170  IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
            +++  +VAC ++  + +      NF+ND  + +G+  G++  NG  + L+LD+Q+GSGF 
Sbjct  11   LLMPLMVACLIMAASGS------NFHNDFDITWGDGRGKIASNGEVLTLSLDKQSGSGFQ  64

Query  350  TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
            +KNEYLFG+ DMQ+KLV G SAGTVT +YL+S  G   DE+DFEFLGN +  PY +HTNV
Sbjct  65   SKNEYLFGKIDMQLKLVPGNSAGTVTAYYLSSK-GSTWDEIDFEFLGNLSGDPYILHTNV  123

Query  530  FADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSK  709
            F+ GKG+REQQF+LWFDPT  +H Y+I+WN QRI++ VD+ PIR ++N E++GVPFPK++
Sbjct  124  FSQGKGNREQQFYLWFDPTTDFHTYSILWNPQRIIFSVDDTPIREFKNMESIGVPFPKNQ  183

Query  710  PMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCV---GTSSCADSKP----  868
            PM+++ SLW A DWAT+GG +K DW++APFTA Y+NF  D CV   G SSC  + P    
Sbjct  184  PMRIYSSLWNADDWATRGGLLKTDWTQAPFTASYRNFNADACVWSNGASSCKSNAPSSST  243

Query  869  -----WGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
                 W    +D+    +LQ V+    +YNYCTD KRF    P ECK
Sbjct  244  STNNAWFSQEMDSAKMQRLQWVQQNYMIYNYCTDAKRFPQGLPPECK  290



>gb|AFP93557.1| xyloglucan endotransglycosylase/hydrolase 1 [Neolamarckia cadamba]
 gb|AGI42455.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
 gb|AGI42463.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   299 bits (766),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/258 (55%), Positives = 185/258 (72%), Gaps = 8/258 (3%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF+ND  + +G+  G++ +NG  + L LD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  26   NFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNSAG  85

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNVF+ GKG REQQFHLWFDPTA +H
Sbjct  86   TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGGREQQFHLWFDPTADFH  144

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN QRI++ VDN PIR ++N E+VGV +PK++ M+++ SLW A DWAT+GG +K 
Sbjct  145  TYSILWNPQRIIFSVDNTPIREFKNAESVGVAYPKNQAMRIYSSLWNADDWATRGGLIKT  204

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCADSKP----WGKYALDADANNKLQGVRTKNRV  937
            DWSKAPFTA Y+NF    C+   G SSC  + P    W    LDA +  +LQ V+    +
Sbjct  205  DWSKAPFTASYRNFNAKACIWSSGRSSCNSNAPSNNAWLNEELDATSQQRLQWVQKNYMI  264

Query  938  YNYCTDNKRFGGNPPAEC  991
            YNYCTD KRF    P EC
Sbjct  265  YNYCTDAKRFPQGYPPEC  282



>ref|XP_002868312.1| hypothetical protein ARALYDRAFT_493497 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44571.1| hypothetical protein ARALYDRAFT_493497 [Arabidopsis lyrata subsp. 
lyrata]
Length=289

 Score =   300 bits (767),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 146/282 (52%), Positives = 193/282 (68%), Gaps = 14/282 (5%)
 Frame = +2

Query  173  MIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNT  352
            ++  ++  +LVG A A      NF ++  + +G+H G++ + G  ++L+LD+ +GSGF +
Sbjct  10   VVAAILLVTLVGSAYAS-----NFFDEFDLTWGDHRGKIFNGGTMLSLSLDRVSGSGFKS  64

Query  353  KNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVF  532
            K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN T +PY +HTNVF
Sbjct  65   KKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GATHDEIDFEFLGNETGKPYVLHTNVF  123

Query  533  ADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKP  712
            A GKGDREQQF+LWFDPT  +H Y+I+W  Q I++LVDN+PIRV+ N E +GVPFPKS+P
Sbjct  124  AQGKGDREQQFYLWFDPTKNFHTYSIVWRPQHIIFLVDNLPIRVFNNAERLGVPFPKSQP  183

Query  713  MKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTSSC--------ADSKP  868
            M+++ SLW A DWAT+GG VK DWSKAPFTAYY+ F    C  +S C         D K 
Sbjct  184  MRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRGFNAAACTVSSGCYPKFKSSLGDGKL  243

Query  869  WGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
                 L+A    +L+ V+    +YNYC+D KRF    P ECK
Sbjct  244  QVASELNAYGRRRLRWVQKYFMIYNYCSDLKRFPRGFPPECK  285



>ref|XP_004164865.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
sativus]
 emb|CCH26409.1| xyloglucan endotransglycosylase [Cucumis sativus]
Length=291

 Score =   300 bits (767),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/293 (49%), Positives = 206/293 (70%), Gaps = 15/293 (5%)
 Frame = +2

Query  140  MKKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALN  319
            M    + + +++++ V+  S++           NF  DV + +G    ++ D+G  ++L+
Sbjct  1    MHSPHKGLAIMLLLCVLMASIL------TTSAGNFLQDVDITWGGPRAKILDSGRHLSLS  54

Query  320  LDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNAT  499
            LD+ +GSGF +K E+LFGRFD+QM+LV G SAGTVTTFYL+S  G +HDE+DFEFLGN++
Sbjct  55   LDKDSGSGFQSKQEFLFGRFDVQMQLVPGNSAGTVTTFYLSSQ-GGSHDEIDFEFLGNSS  113

Query  500  FQPYTVHTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHE  679
              PYT+HTNV++ GKG+REQQFHLWFDPT  +H Y+I W+ + I +LVDN+PIRV+ N E
Sbjct  114  GDPYTLHTNVYSQGKGNREQQFHLWFDPTKGFHTYSIDWSPESIKFLVDNIPIRVFHNWE  173

Query  680  NVGVPFPKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTSSCAD  859
            N+GV +PKS+PM+V+ SLW A DWAT+GG VK DW++APFTA Y+NF  +GCV +S  + 
Sbjct  174  NIGVSYPKSQPMRVYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFNANGCVASSGSSS  233

Query  860  S--------KPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
                     +   +  LDA + N+L+ V++K  +YNYCTD+KRF    PAEC+
Sbjct  234  CGSKFSSTLQGGAQSGLDAKSRNRLRWVQSKFMIYNYCTDHKRFPQGIPAECR  286



>gb|AGI42449.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   299 bits (766),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/258 (55%), Positives = 185/258 (72%), Gaps = 8/258 (3%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF+ND  + +G+  G++ +NG  + L LD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  26   NFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNSAG  85

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNVF+ GKG REQQFHLWFDPTA +H
Sbjct  86   TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGGREQQFHLWFDPTADFH  144

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN QRI++ VDN PIR ++N E+VGV +PK++ M+++ SLW A DWAT+GG +K 
Sbjct  145  TYSILWNPQRIIFSVDNTPIREFKNAESVGVAYPKNQAMRIYSSLWNADDWATRGGLIKT  204

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCADSKP----WGKYALDADANNKLQGVRTKNRV  937
            DWSKAPFTA Y+NF    C+   G SSC  + P    W    LDA +  +LQ V+    +
Sbjct  205  DWSKAPFTASYRNFNAKACIWSSGRSSCNSNAPSNNAWLNEELDATSQQRLQWVQKNYMI  264

Query  938  YNYCTDNKRFGGNPPAEC  991
            YNYCTD KRF    P EC
Sbjct  265  YNYCTDAKRFPQGYPPEC  282



>ref|XP_006284242.1| hypothetical protein CARUB_v10005405mg [Capsella rubella]
 gb|EOA17140.1| hypothetical protein CARUB_v10005405mg [Capsella rubella]
Length=289

 Score =   299 bits (766),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 146/295 (49%), Positives = 196/295 (66%), Gaps = 19/295 (6%)
 Frame = +2

Query  134  GKMKKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMA  313
            G+       V  ++++ +V  +  G          NF ++  + +G+H G++ + GN ++
Sbjct  2    GRNSSLTTLVATVLLVTMVGSAYSG----------NFFDEFDLTWGDHRGKIFNGGNMLS  51

Query  314  LNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGN  493
            L+LD+ +GSGF +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G AHDE+DFEFLGN
Sbjct  52   LSLDRVSGSGFKSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GAAHDEIDFEFLGN  110

Query  494  ATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYEN  673
             T +PY +HTNVFA GKG+REQQF+LWFDPT  +H Y+I+W  Q I++LVDN+PIRV+ N
Sbjct  111  ETGKPYVLHTNVFALGKGNREQQFYLWFDPTKNFHTYSIVWRPQHIIFLVDNLPIRVFNN  170

Query  674  HENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTSSC  853
             E +GVPFPKS+PM+++ SLW A DWAT+GG VK DWSKAPFTAYY+ F    C  +S C
Sbjct  171  AEKLGVPFPKSQPMRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRGFKAAACTVSSGC  230

Query  854  --------ADSKPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
                     D K      L+A    +L+ V+    +YNYC+D KRF    P ECK
Sbjct  231  DPKFKSSFGDGKLQVANELNAYGRRRLRWVQKYFMIYNYCSDLKRFPRGFPPECK  285



>ref|XP_002267890.2| PREDICTED: brassinosteroid-regulated protein BRU1-like [Vitis 
vinifera]
Length=281

 Score =   299 bits (766),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/252 (56%), Positives = 186/252 (74%), Gaps = 2/252 (1%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  D  + +G++  ++ + G  ++L+LDQ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  26   NFYQDFDLTWGDNRAKIFNGGQLLSLSLDQASGSGFQSKKEYLFGRIDMQLKLVAGNSAG  85

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G  HDE+DFEFLGN +  PY +HTNVF  GKG+REQQF+LWFDPT  +H
Sbjct  86   TVTAYYLSSQ-GSTHDEIDFEFLGNLSGDPYILHTNVFTQGKGNREQQFYLWFDPTRNFH  144

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+IIW ++ I++LVDNVPIR+++N E++GVPFPK++PM+++ SLW A DWAT+GG VK 
Sbjct  145  TYSIIWTARHIIFLVDNVPIRLFKNAESMGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  204

Query  779  DWSKAPFTAYYKNFVIDGCVGTSSCADSKPWGKYALDADANNKLQGVRTKNRVYNYCTDN  958
            DWSKAPFTAYY+NF  +    TSS  DS  +    LD+ +  +L+ V+    +YNYCTD 
Sbjct  205  DWSKAPFTAYYRNFRANSSTPTSSFPDST-FQTQELDSYSRRRLRWVQKNFMIYNYCTDL  263

Query  959  KRFGGNPPAECK  994
            KRF    PAECK
Sbjct  264  KRFPQGVPAECK  275



>ref|XP_004164862.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
sativus]
Length=280

 Score =   299 bits (765),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 144/260 (55%), Positives = 192/260 (74%), Gaps = 9/260 (3%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  DV + +G    ++ D G  ++L+LD+ +GSGF +K E+LFGRFD+QMKLV G SAG
Sbjct  18   NFLQDVDITWGGPRAKILDGGRHLSLSLDKDSGSGFQSKQEFLFGRFDVQMKLVPGNSAG  77

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTFYL+S  G +HDE+DFEFLGN++  PYT+HTNV++ GKG+REQQFHLWFDPT  +H
Sbjct  78   TVTTFYLSSQ-GGSHDEIDFEFLGNSSGDPYTLHTNVYSQGKGNREQQFHLWFDPTKGFH  136

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I W+ + I +LVDN+PIRV+ N EN+GV +PKS+PM+V+ SLW A DWAT+GG VK 
Sbjct  137  TYSIDWSPESIKFLVDNIPIRVFRNWENIGVSYPKSQPMRVYSSLWNADDWATRGGLVKT  196

Query  779  DWSKAPFTAYYKNFVIDGCVGTSSCADS--------KPWGKYALDADANNKLQGVRTKNR  934
            DW++APFTA Y+NF  +GCV +S  +          +   +  LDA + N+L+ V++K  
Sbjct  197  DWTQAPFTASYRNFNANGCVASSGSSSCGSKFSSTLQGGAQSGLDAKSRNRLRWVQSKFM  256

Query  935  VYNYCTDNKRFGGNPPAECK  994
            VYNYCTD+KRF    PAECK
Sbjct  257  VYNYCTDHKRFPQGIPAECK  276



>gb|AGI42456.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   299 bits (766),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 142/258 (55%), Positives = 185/258 (72%), Gaps = 8/258 (3%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF+ND  + +G+  G++ +NG  + L LD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  26   NFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNSAG  85

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNVF+ GKG REQQFHLWFDPTA +H
Sbjct  86   TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGGREQQFHLWFDPTADFH  144

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN QRI++ VDN PIR ++N E+VGV +PK++ M+++ SLW A DWAT+GG +K 
Sbjct  145  TYSILWNPQRIIFSVDNTPIREFKNAESVGVAYPKNQAMRIYSSLWNADDWATRGGLIKT  204

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCADSKP----WGKYALDADANNKLQGVRTKNRV  937
            DWSKAPFTA Y+NF    C+   G SSC  + P    W    LDA +  +LQ V+    +
Sbjct  205  DWSKAPFTASYRNFNAKACIWSSGRSSCNSNAPSNNAWLNEELDATSQQRLQWVQKNYMI  264

Query  938  YNYCTDNKRFGGNPPAEC  991
            YNYCTD KRF    P EC
Sbjct  265  YNYCTDAKRFPQGYPPEC  282



>emb|CAB10192.1| xyloglucan endotransglycosylase-related protein XTR-7 [Arabidopsis 
thaliana]
 emb|CAB78455.1| xyloglucan endotransglycosylase-related protein XTR-7 [Arabidopsis 
thaliana]
Length=289

 Score =   299 bits (766),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 142/262 (54%), Positives = 184/262 (70%), Gaps = 9/262 (3%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF ++  + +G+H G++ + GN ++L+LDQ +GSGF +K EYL GR DMQ+KLV G SAG
Sbjct  27   NFFDEFDLTWGDHRGKIFNGGNMLSLSLDQVSGSGFKSKKEYLVGRIDMQLKLVAGNSAG  86

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G  HDE+DFEFLGN T +PY +HTNVFA GKGDREQQF+LWFDPT  +H
Sbjct  87   TVTAYYLSSQ-GATHDEIDFEFLGNETGKPYVLHTNVFAQGKGDREQQFYLWFDPTKNFH  145

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+W  Q I++LVDN+PIRV+ N E +GVPFPKS+PM+++ SLW A DWAT+GG VK 
Sbjct  146  TYSIVWRPQHIIFLVDNLPIRVFNNAEKLGVPFPKSQPMRIYSSLWNADDWATRGGLVKT  205

Query  779  DWSKAPFTAYYKNFVIDGCVGTSSC--------ADSKPWGKYALDADANNKLQGVRTKNR  934
            DWSKAPFTAYY+ F    C  +S C         D K      L+A    +L+ V+    
Sbjct  206  DWSKAPFTAYYRGFNAAACTASSGCDPKFKSSFGDGKLQVATELNAYGRRRLRWVQKYFM  265

Query  935  VYNYCTDNKRFGGNPPAECKPA  1000
            +YNYC+D KRF    P ECK +
Sbjct  266  IYNYCSDLKRFPRGFPPECKKS  287



>ref|XP_009108100.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15 [Brassica rapa]
Length=289

 Score =   299 bits (766),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 141/260 (54%), Positives = 187/260 (72%), Gaps = 9/260 (3%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF N+  + +G+H G++ + GN ++L+LD+ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  27   NFFNEFDLTWGDHRGKIFNGGNMLSLSLDRVSGSGFKSKKEYLFGRIDMQLKLVAGNSAG  86

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTT+YL+S  G  HDE+DFEFLGN T +PY +HTNVFA GKG+REQQF+LWFDPT  +H
Sbjct  87   TVTTYYLSSQ-GATHDEIDFEFLGNETGKPYVLHTNVFAQGKGNREQQFYLWFDPTKNFH  145

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+W  Q I++LVDN+PIRV+ N E +GVPFPK++PM+++ SLW A DWAT+GG VK 
Sbjct  146  TYSIVWRPQHIIFLVDNLPIRVFNNAEKLGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  205

Query  779  DWSKAPFTAYYKNFVIDGCVGTSSC--------ADSKPWGKYALDADANNKLQGVRTKNR  934
            DWSKAPFTAYY+ F    C  +S C        +DS+      L+A    +L+ V+    
Sbjct  206  DWSKAPFTAYYRGFNAAACTVSSGCDPKFKTSLSDSELQTANELNAYGRRRLRWVQKYFM  265

Query  935  VYNYCTDNKRFGGNPPAECK  994
            +YNYC+D KRF    P EC+
Sbjct  266  IYNYCSDLKRFPRGFPPECR  285



>ref|XP_008449536.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
melo]
Length=290

 Score =   299 bits (766),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 145/282 (51%), Positives = 201/282 (71%), Gaps = 11/282 (4%)
 Frame = +2

Query  173  MIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNT  352
            + I ++ C L+   +       NF  DV + +G    ++ D G  ++L+LD+ +GSGF +
Sbjct  8    LTIMLLQCVLMASIMTTSAG--NFFQDVDITWGGPRAKILDGGRHLSLSLDKDSGSGFQS  65

Query  353  KNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVF  532
            K E+LFGRFD+QMKLV G SAGTVTTFYL+S  G +HDE+DFEFLGN++  PYT+HTNV+
Sbjct  66   KQEFLFGRFDVQMKLVPGNSAGTVTTFYLSSQ-GGSHDEIDFEFLGNSSGDPYTLHTNVY  124

Query  533  ADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKP  712
            + GKG+REQQFHLWFDPT  +H Y+I W+ + I +LVDN+PIRV+ N EN+GV +PKS+P
Sbjct  125  SQGKGNREQQFHLWFDPTKGFHTYSIDWSPESIKFLVDNIPIRVFRNWENIGVSYPKSQP  184

Query  713  MKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTSSCADS--------KP  868
            M+V+ SLW A DWAT+GG VK DW++APFTA Y+NF  +GCV +S  +          + 
Sbjct  185  MRVYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFNANGCVASSGSSSCGSKFSSTLQG  244

Query  869  WGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
              +  LDA++ N+++ V++K  +YNYCTD+KRF    PAECK
Sbjct  245  GAQSGLDANSRNRMRWVQSKFMIYNYCTDHKRFPQGIPAECK  286



>ref|XP_002866213.1| hypothetical protein ARALYDRAFT_918931 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42472.1| hypothetical protein ARALYDRAFT_918931 [Arabidopsis lyrata subsp. 
lyrata]
Length=282

 Score =   299 bits (765),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 143/263 (54%), Positives = 185/263 (70%), Gaps = 10/263 (4%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  DV++ +G+  GQ+++NG  + L+LD+ +GSGF +KNEYLFG+  MQMKLV G SAG
Sbjct  21   NFQRDVEITWGDGRGQIKNNGELLTLSLDKSSGSGFQSKNEYLFGKIAMQMKLVPGNSAG  80

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTT YL SP G   DE+DFEFLGN++  PYT+HTNV+  GKGD+EQQF LWFDPTA +H
Sbjct  81   TVTTLYLKSP-GTTWDEIDFEFLGNSSGDPYTLHTNVYTQGKGDKEQQFKLWFDPTADFH  139

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             YTI+WN QRI++ VD  PIR ++N E++G  FPK+KPM+++ SLW A DWAT+GG VK 
Sbjct  140  TYTILWNPQRIIFTVDGTPIREFKNMESLGTLFPKNKPMRMYSSLWNADDWATRGGLVKT  199

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCADSK------PWGKYALDADANNKLQGVRTKN  931
            DWSKAPFTA Y+ F  + CV   G SSC ++        W    LD+ A  +++ V+   
Sbjct  200  DWSKAPFTASYRGFKQEACVWSNGKSSCPNASKQGTTGSWLSQELDSTAQQRMRWVQRNY  259

Query  932  RVYNYCTDNKRFGGNPPAECKPA  1000
             +YNYCTD KRF    P EC  A
Sbjct  260  MIYNYCTDAKRFPQGLPKECLAA  282



>ref|XP_009137907.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like [Brassica rapa]
Length=279

 Score =   298 bits (764),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 145/258 (56%), Positives = 187/258 (72%), Gaps = 4/258 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             +FN+DV + +GN  G++ +NG  + L+LD+ +GSGF +K EYLFG+ DMQ+KLV G SAG
Sbjct  23    DFNSDVNVAWGNGRGKILNNGQLLTLSLDRSSGSGFQSKTEYLFGKIDMQIKLVPGNSAG  82

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
             TVTTFYL S  G   DE+DFEFLGN +  PYT+HTNV+  GKGD+EQQF+LWFDPTA +H
Sbjct  83    TVTTFYLKSE-GSTWDEIDFEFLGNMSGDPYTLHTNVYTQGKGDKEQQFYLWFDPTANFH  141

Query  599   DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
              Y+I+WN QRI+  VD  PIR ++N E++GV FPKSKPM+++ SLW A DWAT+GG VK 
Sbjct  142   TYSILWNPQRIILTVDGTPIREFKNSESIGVLFPKSKPMRMYASLWNADDWATRGGLVKT  201

Query  779   DWSKAPFTAYYKNFVIDGCV---GTSSCADSKPWGKYALDADANNKLQGVRTKNRVYNYC  949
             DWSKAPF A Y+N  I+GCV   G SSC+ S  W    +DA +  +L+ V+    +YNYC
Sbjct  202   DWSKAPFMASYRNIKIEGCVHINGRSSCSPSSSWYTQQMDATSQARLRWVQKNYMIYNYC  261

Query  950   TDNKRFGGNPPAECKPAG  1003
             TD KRF    P EC P+ 
Sbjct  262   TDRKRFPQGIPRECAPSA  279



>ref|XP_010668001.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Beta vulgaris subsp. vulgaris]
Length=290

 Score =   299 bits (765),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 144/257 (56%), Positives = 183/257 (71%), Gaps = 7/257 (3%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  +  + +G+   ++ +NG  + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  25   NFYQNFDITWGDGRAKIMNNGLLLTLSLDKASGSGFKSKNEYLFGKIDMQIKLVPGNSAG  84

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTT+YL+S  G  HDE+DFEFLGNAT QPYT+HTNVFA GKGDREQQF LWFDPTA +H
Sbjct  85   TVTTYYLSSQ-GPNHDEIDFEFLGNATGQPYTLHTNVFAQGKGDREQQFRLWFDPTADFH  143

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN QRI++ VD  PIR ++N E +GV FPKS+ M+++ SLW+A DWATQGG +K 
Sbjct  144  TYSILWNPQRIIFAVDGTPIREFKNMEAIGVSFPKSQAMRMYSSLWDAEDWATQGGRIKT  203

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSC---ADSKPWGKYALDADANNKLQGVRTKNRVY  940
            DWSKAPF A Y+NF  + CV   G SSC     S  W    LD  +  +LQ V+    +Y
Sbjct  204  DWSKAPFVASYRNFNANACVWSNGRSSCRGSGASSAWMNQQLDGTSQQRLQWVQRNYMIY  263

Query  941  NYCTDNKRFGGNPPAEC  991
            NYCTD +RF    P EC
Sbjct  264  NYCTDIQRFPQGLPKEC  280



>ref|XP_006279674.1| hypothetical protein CARUB_v10026912mg [Capsella rubella]
 gb|EOA12572.1| hypothetical protein CARUB_v10026912mg [Capsella rubella]
Length=285

 Score =   298 bits (763),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 145/289 (50%), Positives = 196/289 (68%), Gaps = 9/289 (3%)
 Frame = +2

Query  140  MKKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALN  319
            M +    + ++  + VV+ S +      P     F+ D  + +GN  G+V +NG  + L+
Sbjct  1    MDRSTLILSLLFTLTVVSTSTL----FSPVLAGTFDTDFDITWGNGRGKVLNNGELLTLS  56

Query  320  LDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNAT  499
            LD  +GSGF TK EYLFG+ DMQ+KLV G SAGTVT +YL S  G+  DE+DFEFLGN T
Sbjct  57   LDSASGSGFQTKKEYLFGKIDMQLKLVPGNSAGTVTAYYLKSK-GETWDEIDFEFLGNLT  115

Query  500  FQPYTVHTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHE  679
              PYT+HTNV+  GKGDREQQFHLWFDPTA +H Y+++WN   IV++VD+VP+R ++N +
Sbjct  116  GDPYTMHTNVYTQGKGDREQQFHLWFDPTADFHTYSVLWNPHHIVFMVDDVPVRQFKNLQ  175

Query  680  NVGVPFPKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCV---GTSS  850
            ++G+ +PK +PM+++ SLW A  WAT+GG VK DWSKAPFTA Y+NF  D CV   G S+
Sbjct  176  HMGIQYPKLQPMRLYSSLWNADQWATRGGLVKTDWSKAPFTASYRNFRADACVSAGGKSA  235

Query  851  CADSKP-WGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
            C  S P W    LD  A +K++ V++K  +YNYCTD KRF    P EC+
Sbjct  236  CPASSPRWFSQRLDLTAEDKMRVVQSKYMIYNYCTDTKRFPQGFPKECR  284



>ref|XP_009120272.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22 [Brassica rapa]
Length=283

 Score =   298 bits (763),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 143/260 (55%), Positives = 184/260 (71%), Gaps = 10/260 (4%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  DV++ +G+  GQ+++NG  + L+LD+ +GSGF +KNEYLFG+ DMQMKLV G SAG
Sbjct  22   NFQRDVEITWGDGRGQIKNNGELLTLSLDKSSGSGFQSKNEYLFGKIDMQMKLVPGNSAG  81

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTT YL SP G   DE+DFEFLGN +  PYT+HTNV+  GKGD+EQQF LWFDPTA +H
Sbjct  82   TVTTLYLKSP-GTTWDEIDFEFLGNLSGDPYTLHTNVYTQGKGDKEQQFKLWFDPTADFH  140

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             YTI+WN QRI++ VD  PIR ++N E+VG  FPK++PM+++ SLW A DWAT+GG VK 
Sbjct  141  TYTILWNPQRIIFTVDGTPIREFKNMESVGTLFPKNQPMRMYSSLWNADDWATRGGLVKT  200

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCAD------SKPWGKYALDADANNKLQGVRTKN  931
            DWSKAPFTA Y+ F  + CV   G SSC +      +  W    LD+ A  +++ V+   
Sbjct  201  DWSKAPFTASYRGFNQEACVWSNGKSSCPNGSGQGTTGSWLSQELDSTAQERMRWVQKNY  260

Query  932  RVYNYCTDNKRFGGNPPAEC  991
             +YNYCTD KRF    P EC
Sbjct  261  MIYNYCTDTKRFPQGLPKEC  280



>gb|KFK24577.1| hypothetical protein AALP_AAs45078U000600 [Arabis alpina]
Length=289

 Score =   298 bits (763),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 143/280 (51%), Positives = 193/280 (69%), Gaps = 9/280 (3%)
 Frame = +2

Query  179  IGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKN  358
            +  V  +++ V ++      NF +D  + +G+H G++ + GN ++L+LD+ +GSGF +K 
Sbjct  7    LATVVAAILLVTMSGSAYSGNFLDDFDLTWGDHRGKIFNGGNMLSLSLDKVSGSGFKSKK  66

Query  359  EYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFAD  538
            EYLFGR DMQ+KLV G SAGTVTT+YL+S  G  HDE+DFEFLGN T +PY +HTNVFA 
Sbjct  67   EYLFGRIDMQLKLVAGNSAGTVTTYYLSSE-GATHDEIDFEFLGNETGKPYVLHTNVFAQ  125

Query  539  GKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMK  718
            GKG++EQQF+LWFDPT  +H Y+I+W  Q I++LVDN+PIRV+ N E +GVPFPK++PM+
Sbjct  126  GKGNKEQQFYLWFDPTKNFHTYSIVWRPQHIIFLVDNLPIRVFNNAEKLGVPFPKNQPMR  185

Query  719  VFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTSSC--------ADSKPWG  874
            ++ SLW A DWAT+GG VK DWSKAPFTAYY+ F    C  +S C         D K   
Sbjct  186  IYSSLWNADDWATRGGLVKTDWSKAPFTAYYRGFKAAACTVSSGCDPKFKSSFTDGKLQV  245

Query  875  KYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
               L+A    +L+ V+    +YNYC+D KRF    P ECK
Sbjct  246  ANELNAYGRRRLRWVQKYFMIYNYCSDLKRFPREFPPECK  285



>gb|AGI42458.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   298 bits (763),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 141/258 (55%), Positives = 184/258 (71%), Gaps = 8/258 (3%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF+ND  + +G+  G++ +NG  + L LD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  26   NFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNSAG  85

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNVF+ GKG REQQFHLWFDPTA +H
Sbjct  86   TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGGREQQFHLWFDPTADFH  144

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN QRI++ VDN PIR ++N E+VGV +PK++ M+++ SLW A DWAT+GG +K 
Sbjct  145  TYSILWNPQRIIFSVDNTPIREFKNAESVGVAYPKNQAMRIYSSLWNADDWATRGGLIKT  204

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCADSKP----WGKYALDADANNKLQGVRTKNRV  937
            DWSKAPFTA Y+NF    C+   G SSC  + P    W    LDA +  +LQ  +    +
Sbjct  205  DWSKAPFTASYRNFNAKACIWSSGRSSCNSNAPSNNAWLNEELDATSQQRLQWAQKNYMI  264

Query  938  YNYCTDNKRFGGNPPAEC  991
            YNYCTD KRF    P EC
Sbjct  265  YNYCTDAKRFPQGYPPEC  282



>gb|AEQ37175.1| xyloglucan endotransglucosylase/hydrolase [Diospyros kaki]
Length=287

 Score =   298 bits (763),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 139/278 (50%), Positives = 194/278 (70%), Gaps = 12/278 (4%)
 Frame = +2

Query  170  IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
            + ++ ++A S++           NF  D  + +G+H  ++ + G  ++L+LD+ +GSGF 
Sbjct  13   LFLVALLASSMMAAKGG------NFYQDFDVTWGDHRAKIFNGGQLLSLSLDKTSGSGFR  66

Query  350  TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
            +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY VHTNV
Sbjct  67   SKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYIVHTNV  125

Query  530  FADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSK  709
            F  GKG+REQQF+LWFDPT  +H Y+++WN ++I++L+DN PIRV++N E++GVPFPK++
Sbjct  126  FTQGKGNREQQFYLWFDPTRNFHTYSVVWNPRQIIFLIDNTPIRVFKNAESIGVPFPKNQ  185

Query  710  PMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTSSCADS---KPWGKY  880
            PM+++ SLW A DWAT+GG VK DW+KAPFTAYY+NF    C G  +C +S     W   
Sbjct  186  PMRIYSSLWNADDWATRGGLVKTDWTKAPFTAYYRNFNAKTCSG--ACTESFGDGAWQSQ  243

Query  881  ALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
             LDA +  +L+ V+    +YNYCTD KRF    P EC+
Sbjct  244  ELDAHSRRRLRWVQKNFMIYNYCTDLKRFPEGLPKECQ  281



>emb|CDY27126.1| BnaA08g07640D [Brassica napus]
Length=289

 Score =   298 bits (762),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 141/260 (54%), Positives = 186/260 (72%), Gaps = 9/260 (3%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF N+  + +G+H G++ + GN ++L+LD+ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  27   NFFNEFDLTWGDHRGKIFNGGNMLSLSLDRVSGSGFKSKKEYLFGRIDMQLKLVAGNSAG  86

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTT+YL+S  G  HDE+DFEFLGN T +PY +HTNVFA GKG+REQQF+LWFDPT  +H
Sbjct  87   TVTTYYLSSQ-GATHDEIDFEFLGNETGKPYVLHTNVFAQGKGNREQQFYLWFDPTKNFH  145

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+W  Q I++LVDN+PIRV+ N E +GVPFPK++PM ++ SLW A DWAT+GG VK 
Sbjct  146  TYSIVWRPQHIIFLVDNLPIRVFNNAEKLGVPFPKNQPMMIYSSLWNADDWATRGGLVKT  205

Query  779  DWSKAPFTAYYKNFVIDGCVGTSSC--------ADSKPWGKYALDADANNKLQGVRTKNR  934
            DWSKAPFTAYY+ F    C  +S C        +DS+      L+A    +L+ V+    
Sbjct  206  DWSKAPFTAYYRGFNAAACTVSSGCDPKFKTSLSDSELQTANELNAYGRRRLRWVQKYFM  265

Query  935  VYNYCTDNKRFGGNPPAECK  994
            +YNYC+D KRF    P EC+
Sbjct  266  IYNYCSDLKRFPRGFPPECR  285



>ref|XP_006425209.1| hypothetical protein CICLE_v10010858mg [Citrus clementina]
 ref|XP_006474162.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Citrus sinensis]
 gb|ESR38449.1| hypothetical protein CICLE_v10010858mg [Citrus clementina]
Length=280

 Score =   297 bits (761),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/285 (50%), Positives = 196/285 (69%), Gaps = 18/285 (6%)
 Frame = +2

Query  167  MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
            + +++G +  +  G          +F  D  + +G+   ++ +NG  + L+LD+ +GSGF
Sbjct  7    LFLVLGTLMVASAG----------SFYQDFDITWGDGRAKIHNNGQFLTLSLDKASGSGF  56

Query  347  NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
             +KNEYLFG+ DMQ+KLV G SAGTVT +YL SP G   DE+DFEFLGN +  PYT+HTN
Sbjct  57   QSKNEYLFGKIDMQLKLVPGNSAGTVTAYYLKSP-GSTWDEIDFEFLGNLSGDPYTLHTN  115

Query  527  VFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKS  706
            VF +GKG+REQQFHLWFDPTAA+H Y+I+WN QRIV+ VD  PIR ++N E++GVPFPK+
Sbjct  116  VFTNGKGNREQQFHLWFDPTAAFHTYSILWNPQRIVFSVDGTPIREFKNSESIGVPFPKN  175

Query  707  KPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTS-------SCADSK  865
            +PM+++ SLW A DWAT+GG VK DW+ APFTA Y+NF  D C+ ++       S + S+
Sbjct  176  QPMRIYSSLWNADDWATRGGLVKTDWTHAPFTASYRNFKADACLWSNGKSSCASSKSRSR  235

Query  866  PWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECKPA  1000
             W    LD+ + NKL+ V+    +YNYCTD KRF    P EC+ A
Sbjct  236  AWFSQELDSSSQNKLKWVQKNYMIYNYCTDTKRFPQGLPVECRTA  280



>gb|KDO46534.1| hypothetical protein CISIN_1g023431mg [Citrus sinensis]
Length=282

 Score =   297 bits (761),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/285 (50%), Positives = 194/285 (68%), Gaps = 20/285 (7%)
 Frame = +2

Query  167  MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
            + +++G +  +  G          +F  D  + +G+   ++ +NG  + L+LD+ +GSGF
Sbjct  7    LFLVLGTLMVASAG----------SFYKDFDITWGDGRAKILNNGQLLTLSLDKASGSGF  56

Query  347  NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
             +KNEYL+G+ DMQ+KLV G SAGTVT +YL SP G   DE+DFEFLGN +  PYT+HTN
Sbjct  57   QSKNEYLYGKIDMQLKLVPGNSAGTVTAYYLKSP-GSTWDEIDFEFLGNLSGDPYTLHTN  115

Query  527  VFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKS  706
            VF +GKGDREQQFHLWFDP+AA+H Y+I+WN QRIV+ VD  PIR  +N E++GVPFPK+
Sbjct  116  VFTNGKGDREQQFHLWFDPSAAFHTYSILWNPQRIVFFVDGTPIRELKNSESIGVPFPKN  175

Query  707  KPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVI-DGCV---GTSSCADSK---  865
            +PM+++ SLW A DWAT+GG VK DW+ APFTA Y+NF   + CV   G SSCA +    
Sbjct  176  QPMRIYSSLWNADDWATRGGLVKTDWTHAPFTASYRNFKANNACVWSNGKSSCASTSFRS  235

Query  866  --PWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
               W    LD+ + N+L+ V+    +YNYCTD KRF    P EC+
Sbjct  236  RNSWLSQELDSTSQNRLKWVQKNYMIYNYCTDTKRFPRGIPKECR  280



>gb|AGI42450.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   297 bits (761),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/258 (55%), Positives = 184/258 (71%), Gaps = 8/258 (3%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF+ND  + +G+  G++ +NG  + L LD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  26   NFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNSAG  85

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G  HDE+DFEFLGN +  PYT+H NVF+ GKG REQQFHLWFDPTA +H
Sbjct  86   TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHINVFSQGKGGREQQFHLWFDPTADFH  144

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN QRI++ VDN PIR ++N E+VGV +PK++ M+++ SLW A DWAT+GG +K 
Sbjct  145  TYSILWNPQRIIFSVDNTPIREFKNAESVGVAYPKNQAMRIYSSLWNADDWATRGGLIKT  204

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCADSKP----WGKYALDADANNKLQGVRTKNRV  937
            DWSKAPFTA Y+NF    C+   G SSC  + P    W    LDA +  +LQ V+    +
Sbjct  205  DWSKAPFTASYRNFNAKACIWSSGRSSCNSNAPSNNAWLNEELDATSQQRLQWVQKNYMI  264

Query  938  YNYCTDNKRFGGNPPAEC  991
            YNYCTD KRF    P EC
Sbjct  265  YNYCTDAKRFPQGYPPEC  282



>ref|XP_008380219.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like [Malus domestica]
Length=292

 Score =   298 bits (762),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 144/289 (50%), Positives = 197/289 (68%), Gaps = 15/289 (5%)
 Frame = +2

Query  158  QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
            +V M+  +  +  SLV V  +      NF  D ++ FG+   +V +NG  + L LD+ +G
Sbjct  5    KVSMLFFLCSITISLVAVVASAG----NFYQDYEVMFGDQHAKVLENGQIITLALDKSSG  60

Query  338  SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
            +GF +KN YLFG+FDMQ+KL  G SAGTVTTFYL+S  G  HDE+DFEFLGN+T +PYT+
Sbjct  61   AGFKSKNAYLFGKFDMQIKLQPGNSAGTVTTFYLSSS-GANHDEIDFEFLGNSTGEPYTI  119

Query  518  HTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPF  697
            HTNV+A G+G +EQQFHLWFDPT  +H Y+I+WN++RI++LVD+ PIRV+ N E++G+PF
Sbjct  120  HTNVYAQGQGLKEQQFHLWFDPTQDFHTYSIVWNTKRIIFLVDDSPIRVFNNLESIGLPF  179

Query  698  PKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTS--SCADS---  862
            PK++ M ++ + W A DWATQGG VK DWS APFTA Y+NF I+ C G+   SC  +   
Sbjct  180  PKNQSMGIYATFWNADDWATQGGRVKTDWSLAPFTASYRNFNINACPGSQGPSCTSTSTE  239

Query  863  -----KPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
                   W    L+A   N+L+ V++K  VY+YCTD  +F    P ECK
Sbjct  240  RSAVGSSWKNQGLNAAERNRLRWVQSKFMVYDYCTDRIKFNKXLPRECK  288



>gb|KCW89706.1| hypothetical protein EUGRSUZ_A01968 [Eucalyptus grandis]
Length=340

 Score =   299 bits (766),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 137/262 (52%), Positives = 188/262 (72%), Gaps = 11/262 (4%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  D  + +G+H  Q+ + G  + L+LDQ +GSGF +KNEYLFGR DM++KLV+G SAG
Sbjct  75   NFYKDFDITWGDHRSQILNGGQELTLSLDQASGSGFKSKNEYLFGRIDMEIKLVEGNSAG  134

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TV  +YL+S  G  HDE+DFEFLGN +  PYT+HTNVF+ GKG+REQQFHLWFDPT A+H
Sbjct  135  TVNAYYLSSQ-GPTHDEIDFEFLGNLSGNPYTLHTNVFSQGKGNREQQFHLWFDPTKAFH  193

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN++RI++LVDN PIRV+ N E++GVPFP ++PM+++ SLW A DWAT GG VK 
Sbjct  194  TYSIVWNTRRIIFLVDNSPIRVFNNLESIGVPFPSNQPMRIYSSLWNADDWATMGGRVKT  253

Query  779  DWSKAPFTAYYKNFVIDG----------CVGTSSCADSKPWGKYALDADANNKLQGVRTK  928
            DW+KAPFTA ++NF  +              +++   +  W + +L+A   N+L+ V+ K
Sbjct  254  DWTKAPFTASFRNFNANACVVSSGSSSCGSKSTNNLQTSAWQEQSLNAAGRNRLRWVQQK  313

Query  929  NRVYNYCTDNKRFGGNPPAECK  994
              +YNYC+D+KRF    P ECK
Sbjct  314  YMIYNYCSDSKRFPQGLPPECK  335



>gb|KHN22714.1| Putative xyloglucan endotransglucosylase/hydrolase protein 23 
[Glycine soja]
Length=287

 Score =   297 bits (761),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/258 (54%), Positives = 183/258 (71%), Gaps = 8/258 (3%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NFN D Q+ +G+   ++ +N N + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  28   NFNQDFQITWGDGRAKILNNANLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSAG  87

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G   DE+DFEFLGN +  PY +HTNVF+ GKG+REQQF+LWFDPTA +H
Sbjct  88   TVTAYYLSSK-GSTWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFH  146

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN QRIV+ VD  PIR ++N E++GVPFPK +PM+++ SLW A DWAT+GG +K 
Sbjct  147  TYSILWNPQRIVFSVDGTPIREFKNLESIGVPFPKRQPMRIYSSLWNADDWATRGGRIKT  206

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCADSKP----WGKYALDADANNKLQGVRTKNRV  937
            DWSKAPFTA Y+NF  + CV   G S+C  + P    W    LD+ A  +L  V+    +
Sbjct  207  DWSKAPFTASYRNFNANACVWNRGKSTCKSNSPSSNAWLSQELDSTAQQRLSWVQKNYMI  266

Query  938  YNYCTDNKRFGGNPPAEC  991
            YNYC+D  RF    P EC
Sbjct  267  YNYCSDKNRFAQGLPLEC  284



>ref|XP_010053241.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Eucalyptus 
grandis]
Length=287

 Score =   297 bits (761),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 150/284 (53%), Positives = 192/284 (68%), Gaps = 15/284 (5%)
 Frame = +2

Query  185  VVACSLVGvalavpppplNF-NNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNE  361
            +VA SLV  +L +      F   D  + +G    ++   G  + L+LD+ +GSGF +KNE
Sbjct  4    LVAVSLVMSSLVMVGAQAGFFYRDFDLTWGGERAKISQGGQLLTLSLDKYSGSGFQSKNE  63

Query  362  YLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADG  541
            YLFGR D+Q+KLV G SAGTVTT+YL+S  G AHDE+DFEFLGN +  PYTVHTNVF  G
Sbjct  64   YLFGRIDLQLKLVPGNSAGTVTTYYLSSQ-GPAHDEIDFEFLGNLSGNPYTVHTNVFTQG  122

Query  542  KGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKV  721
            KG+REQQF+LWFDPT A+H Y+I+WN QRI++LVDNVPIR + N E++GVPFP  + M++
Sbjct  123  KGNREQQFYLWFDPTKAFHTYSILWNPQRILFLVDNVPIREFVNKESMGVPFPNKQAMRI  182

Query  722  FCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGC---VGTSSCADSKP--------  868
            + SLW A DWAT GG VK DW++APFTA Y+NF  + C    G SSCA +          
Sbjct  183  YSSLWNADDWATMGGRVKTDWTQAPFTASYRNFNANACAWSAGKSSCASTTTTSSTTSSS  242

Query  869  --WGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
              W   ALDA+   +L+ V+ K  +YNYCTD KRF    P ECK
Sbjct  243  DVWRTQALDANGRQRLKWVQKKFMIYNYCTDLKRFPQGLPPECK  286



>emb|CCH26408.1| xyloglucan endotransglycosylase [Cucumis sativus]
Length=280

 Score =   297 bits (761),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/259 (55%), Positives = 191/259 (74%), Gaps = 9/259 (3%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  DV + +G    ++ D G  ++L+LD+ +GSGF +K E+LFGRFD+QMKLV G SAG
Sbjct  18   NFLQDVDITWGGPRAKILDGGRHLSLSLDKDSGSGFQSKQEFLFGRFDVQMKLVPGNSAG  77

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTFYL+S  G +HDE+DFEFLGN++  PYT+HTNV++ GKG+REQQFHLWFDPT  +H
Sbjct  78   TVTTFYLSSQ-GGSHDEIDFEFLGNSSGDPYTLHTNVYSQGKGNREQQFHLWFDPTKGFH  136

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I W+ + I +LVDN+PIRV+ N EN+GV +PKS+PM+V+ SLW A DWAT+GG VK 
Sbjct  137  TYSIDWSPESIKFLVDNIPIRVFRNWENIGVSYPKSQPMRVYSSLWNADDWATRGGLVKT  196

Query  779  DWSKAPFTAYYKNFVIDGCVGTSSCADS--------KPWGKYALDADANNKLQGVRTKNR  934
            DW++APFTA Y+NF  +GCV +S  +          +   +  LDA + N+L+ V++K  
Sbjct  197  DWTQAPFTASYRNFNANGCVASSGSSSCGSKFSSTLQGGAQSGLDAKSRNRLRWVQSKFM  256

Query  935  VYNYCTDNKRFGGNPPAEC  991
            VYNYCTD+KRF    PAEC
Sbjct  257  VYNYCTDHKRFPQGIPAEC  275



>ref|NP_199618.1| xyloglucan endotransglucosylase/hydrolase protein 20 [Arabidopsis 
thaliana]
 sp|Q9FI31.1|XTH20_ARATH RecName: Full=Xyloglucan endotransglucosylase/hydrolase protein 
20; Short=At-XTH20; Short=XTH-20; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB11071.1| xyloglucan endo-1,4-beta-D-glucanase [Arabidopsis thaliana]
 gb|AAS77486.1| At5g48070 [Arabidopsis thaliana]
 dbj|BAD94531.1| xyloglucan endo-1,4-beta-D-glucanase [Arabidopsis thaliana]
 gb|AED95616.1| xyloglucan endotransglucosylase/hydrolase protein 20 [Arabidopsis 
thaliana]
Length=282

 Score =   297 bits (761),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/255 (54%), Positives = 186/255 (73%), Gaps = 5/255 (2%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDN-GNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSA  415
            +F+ DVQ+++G+  G++ DN GN ++L+LD+ +GSGF +  E+L+G+ ++QMKLV G SA
Sbjct  28   SFHKDVQIHWGDGRGKILDNVGNLLSLSLDKFSGSGFQSHQEFLYGKVEVQMKLVPGNSA  87

Query  416  GTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAY  595
            GTVTTFYL SP G   DE+DFEFLGN +  PYT+HTNV+  G GD+EQQFHLWFDPT  +
Sbjct  88   GTVTTFYLKSP-GTTWDEIDFEFLGNISGHPYTLHTNVYTKGTGDKEQQFHLWFDPTVDF  146

Query  596  HDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVK  775
            H Y IIWN QR+++ +D +PIR ++N E +GVPFPK +PM+++ SLWEA  WAT+GG  K
Sbjct  147  HTYCIIWNPQRVIFTIDGIPIREFKNSEALGVPFPKHQPMRLYASLWEAEHWATRGGLEK  206

Query  776  VDWSKAPFTAYYKNFVIDGCV---GTSSCADSKPWGKYALDADANNKLQGVRTKNRVYNY  946
             DWSKAPFTA+Y+N+ +D CV   G SSC+ +  W    LD    N+++  + K  VYNY
Sbjct  207  TDWSKAPFTAFYRNYNVDACVWSNGKSSCSANSSWFTQVLDFKGKNRVKWAQRKYMVYNY  266

Query  947  CTDNKRFGGNPPAEC  991
            CTD KRF    P EC
Sbjct  267  CTDKKRFPQGAPPEC  281



>ref|XP_010053265.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16 [Eucalyptus grandis]
Length=291

 Score =   297 bits (761),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/262 (53%), Positives = 190/262 (73%), Gaps = 11/262 (4%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  D  + +G+H  Q+ + G  + L+LDQ +GSGF +KNEYLFGR DM++KLV+G SAG
Sbjct  26   NFYKDFDITWGDHRSQILNGGQELTLSLDQASGSGFKSKNEYLFGRIDMEIKLVEGNSAG  85

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TV  +YL+S  G  HDE+DFEFLGN +  PYT+HTNVF+ GKG+REQQFHLWFDPT A+H
Sbjct  86   TVNAYYLSSQ-GPTHDEIDFEFLGNLSGNPYTLHTNVFSQGKGNREQQFHLWFDPTKAFH  144

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN++RI++LVDN PIRV+ N E++GVPFP ++PM+++ SLW A DWAT GG VK 
Sbjct  145  TYSIVWNTRRIIFLVDNSPIRVFNNLESIGVPFPSNQPMRIYSSLWNADDWATMGGRVKT  204

Query  779  DWSKAPFTAYYKNFVIDGCVG----------TSSCADSKPWGKYALDADANNKLQGVRTK  928
            DW+KAPFTA ++NF  + CV           +++   +  W + +L+A   N+L+ V+ K
Sbjct  205  DWTKAPFTASFRNFNANACVVSSGSSSCGSKSTNNLQTSAWQEQSLNAAGRNRLRWVQQK  264

Query  929  NRVYNYCTDNKRFGGNPPAECK  994
              +YNYC+D+KRF    P ECK
Sbjct  265  YMIYNYCSDSKRFPQGLPPECK  286



>gb|AGI42454.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=281

 Score =   297 bits (760),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/258 (55%), Positives = 184/258 (71%), Gaps = 8/258 (3%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF+ND  + +G+  G++ +NG  + L LD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  22   NFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNSAG  81

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNVF+ GKG REQQFHLWFDPTA +H
Sbjct  82   TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGGREQQFHLWFDPTADFH  140

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN QR ++ VDN PIR ++N E+VGV +PK++ M+++ SLW A DWAT+GG +K 
Sbjct  141  TYSILWNPQRTIFSVDNTPIREFKNAESVGVAYPKNQAMRIYSSLWNADDWATRGGLIKT  200

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCADSKP----WGKYALDADANNKLQGVRTKNRV  937
            DWSKAPFTA Y+NF    C+   G SSC  + P    W    LDA +  +LQ V+    +
Sbjct  201  DWSKAPFTASYRNFNAKACIWSSGRSSCNSNAPSNNAWLNEELDATSQQRLQWVQKNYMI  260

Query  938  YNYCTDNKRFGGNPPAEC  991
            YNYCTD KRF    P EC
Sbjct  261  YNYCTDAKRFPQGYPPEC  278



>ref|XP_009120273.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Brassica rapa]
Length=283

 Score =   297 bits (760),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/260 (55%), Positives = 183/260 (70%), Gaps = 10/260 (4%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  DV++ +G+  GQ+ +NG  + L+LD+ +GSGF +KNEYLFG+ DMQMKLV G SAG
Sbjct  22   NFQRDVEITWGDGRGQITNNGELLTLSLDKSSGSGFQSKNEYLFGKIDMQMKLVPGNSAG  81

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTT YL SP G   DE+DFEFLGN +  PYT+HTNV+  GKGD+EQQF LWFDPTA +H
Sbjct  82   TVTTLYLKSP-GTTWDEIDFEFLGNLSGDPYTLHTNVYTQGKGDKEQQFKLWFDPTADFH  140

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             YTI+WN QRI++ VD  PIR ++N E+VG  FPK++PM+++ SLW A DWAT+GG VK 
Sbjct  141  TYTILWNPQRIIFTVDGTPIREFKNMESVGTLFPKNQPMRMYSSLWNADDWATRGGLVKT  200

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCAD------SKPWGKYALDADANNKLQGVRTKN  931
            DWSKAPFTA Y+ F  + CV   G SSC +      +  W    LD+ A  +++ V+   
Sbjct  201  DWSKAPFTASYRGFNQEACVWSNGKSSCPNGSGQGPTGSWLSQELDSTAQERMRWVQKNY  260

Query  932  RVYNYCTDNKRFGGNPPAEC  991
             +YNYCTD KRF    P EC
Sbjct  261  MIYNYCTDTKRFPQGLPKEC  280



>ref|XP_008449534.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
melo]
Length=290

 Score =   297 bits (761),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/260 (55%), Positives = 193/260 (74%), Gaps = 9/260 (3%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  DV + +G    ++ D G  ++L+LD+ +GSGF +K E+LFGRFD+QMKLV G SAG
Sbjct  28   NFLQDVDITWGGPRAKILDGGRHLSLSLDKDSGSGFQSKQEFLFGRFDVQMKLVPGNSAG  87

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTFYL+S  G +HDE+DFEFLGN++  PYT+HTNV++ GKG+REQQFHLWFDPT  +H
Sbjct  88   TVTTFYLSSQ-GGSHDEIDFEFLGNSSGDPYTLHTNVYSQGKGNREQQFHLWFDPTKGFH  146

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I W+ + I +LVDN+PIRV+ N EN+GV +PKS+PM+V+ SLW A DWAT+GG VK 
Sbjct  147  TYSIDWSPESIKFLVDNIPIRVFHNWENIGVSYPKSQPMRVYSSLWNADDWATRGGLVKT  206

Query  779  DWSKAPFTAYYKNFVIDGCVGTSSCADS--------KPWGKYALDADANNKLQGVRTKNR  934
            DW++APFTA Y+NF  +GCV +S  +          +   +  LDA++ N+++ V++K  
Sbjct  207  DWTQAPFTASYRNFNANGCVASSGSSSCGSKFSSTLQGGAQSGLDANSRNRMRWVQSKFM  266

Query  935  VYNYCTDNKRFGGNPPAECK  994
            +YNYCTD+KRF    PAECK
Sbjct  267  IYNYCTDHKRFPQGIPAECK  286



>ref|XP_011026281.1| PREDICTED: brassinosteroid-regulated protein BRU1-like isoform 
X2 [Populus euphratica]
Length=289

 Score =   297 bits (760),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/261 (53%), Positives = 186/261 (71%), Gaps = 10/261 (4%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  D  + +G+   ++ + G  + L+LD  +GSGF +KNEYLFGR DMQ+KL+ G SAG
Sbjct  30   NFFQDFDITWGDQRAKILNGGQLLTLSLDTASGSGFQSKNEYLFGRIDMQIKLIPGNSAG  89

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTT+YL+S  G  HDE+DFEFLGNAT +PY +HTNVF+ GKGDREQ+F+LWFDP+ A+H
Sbjct  90   TVTTYYLSSQ-GPTHDEIDFEFLGNATGEPYVLHTNVFSQGKGDREQRFYLWFDPSKAFH  148

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN Q I++LVDN+PIRV++N E++GV FP  + M+++ SLW A DWAT+GG VK 
Sbjct  149  TYSIVWNKQLIIFLVDNIPIRVFQNLESIGVAFPNKQAMRIYSSLWNADDWATRGGLVKT  208

Query  779  DWSKAPFTAYYKNFVIDGCVGT--SSCADSKP-------WGKYALDADANNKLQGVRTKN  931
            DW++APF + Y+NF  + C+ +  S C  + P       W   ALDA   N+L+ V+ K 
Sbjct  209  DWTQAPFISSYRNFKANACIWSPGSPCTSTSPISVQDNAWQVQALDAPGRNRLRWVQQKY  268

Query  932  RVYNYCTDNKRFGGNPPAECK  994
             +YNYCTD KRF    P ECK
Sbjct  269  MIYNYCTDLKRFPQGLPPECK  289



>ref|XP_002268708.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Vitis 
vinifera]
Length=294

 Score =   297 bits (761),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/262 (52%), Positives = 182/262 (69%), Gaps = 11/262 (4%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  D  + +G+   ++ D G  + L+LD+ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  29   NFYQDFDLTWGDRRAKIVDGGKLLMLSLDRASGSGFQSKKEYLFGRIDMQLKLVSGNSAG  88

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  GQ HDE+DFEFLGN +  PY +HTNVF  GKG+REQQF+LWFDPT  +H
Sbjct  89   TVTAYYLSSQ-GQTHDEIDFEFLGNLSGDPYILHTNVFTQGKGNREQQFYLWFDPTKNFH  147

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+IIWN QRI++LVDN PIR ++N E++G+PFPKS+PM+++ SLW A +WAT+GG VK+
Sbjct  148  TYSIIWNPQRIIFLVDNFPIRQFQNQESIGIPFPKSQPMRIYSSLWNADNWATRGGVVKI  207

Query  779  DWSKAPFTAYYKNFVIDGCVGTSSCADSKP----------WGKYALDADANNKLQGVRTK  928
            DWSKAPFTA+Y+NF    C+ +   +              W    LDA +  +L+ V+  
Sbjct  208  DWSKAPFTAFYRNFNAAACIWSYGSSSCASKSVSPMSNIGWQTQGLDAKSRRRLRWVQRY  267

Query  929  NRVYNYCTDNKRFGGNPPAECK  994
              +YNYCTD KRF    P EC+
Sbjct  268  YMIYNYCTDMKRFPEGLPPECR  289



>gb|KCW89704.1| hypothetical protein EUGRSUZ_A01966 [Eucalyptus grandis]
Length=277

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/264 (55%), Positives = 183/264 (69%), Gaps = 14/264 (5%)
 Frame = +2

Query  242  FNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGT  421
            F  D  + +G    ++   G  + L+LD+ +GSGF +KNEYLFGR D+Q+KLV G SAGT
Sbjct  14   FYRDFDLTWGGERAKISQGGQLLTLSLDKYSGSGFQSKNEYLFGRIDLQLKLVPGNSAGT  73

Query  422  VTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYHD  601
            VTT+YL+S  G AHDE+DFEFLGN +  PYTVHTNVF  GKG+REQQF+LWFDPT A+H 
Sbjct  74   VTTYYLSSQ-GPAHDEIDFEFLGNLSGNPYTVHTNVFTQGKGNREQQFYLWFDPTKAFHT  132

Query  602  YTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKVD  781
            Y+I+WN QRI++LVDNVPIR + N E++GVPFP  + M+++ SLW A DWAT GG VK D
Sbjct  133  YSILWNPQRILFLVDNVPIREFVNKESMGVPFPNKQAMRIYSSLWNADDWATMGGRVKTD  192

Query  782  WSKAPFTAYYKNFVIDGC---VGTSSCADSKP----------WGKYALDADANNKLQGVR  922
            W++APFTA Y+NF  + C    G SSCA +            W   ALDA+   +L+ V+
Sbjct  193  WTQAPFTASYRNFNANACAWSAGKSSCASTTTTSSTTSSSDVWRTQALDANGRQRLKWVQ  252

Query  923  TKNRVYNYCTDNKRFGGNPPAECK  994
             K  +YNYCTD KRF    P ECK
Sbjct  253  KKFMIYNYCTDLKRFPQGLPPECK  276



>ref|NP_001242530.1| uncharacterized protein LOC100785313 precursor [Glycine max]
 gb|ACU21249.1| unknown [Glycine max]
Length=287

 Score =   297 bits (760),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/258 (54%), Positives = 183/258 (71%), Gaps = 8/258 (3%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NFN D Q+ +G+   ++ +N N + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  28   NFNQDFQITWGDGRAKILNNANLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSAG  87

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G   DE+DFEFLGN +  PY +HTNVF+ GKG+REQQF+LWFDPTA +H
Sbjct  88   TVTAYYLSSK-GSTWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFH  146

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN QRIV+ VD  PIR ++N E++GVPFPK +PM+++ SLW A DWAT+GG +K 
Sbjct  147  TYSILWNPQRIVFSVDGTPIREFKNLESIGVPFPKRQPMRIYSSLWNADDWATRGGRIKT  206

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCADSKP----WGKYALDADANNKLQGVRTKNRV  937
            DWSKAPFTA Y+NF  + CV   G S+C  + P    W    LD+ A  +L  V+    +
Sbjct  207  DWSKAPFTASYRNFNANACVWNRGKSTCKSNSPSSNAWLSQELDSTAQQRLSWVQKNYMI  266

Query  938  YNYCTDNKRFGGNPPAEC  991
            YNYC+D  RF    P EC
Sbjct  267  YNYCSDKNRFAQGLPLEC  284



>ref|XP_007025220.1| Xyloglucan endotransglucosylase/hydrolase 16 [Theobroma cacao]
 gb|EOY27842.1| Xyloglucan endotransglucosylase/hydrolase 16 [Theobroma cacao]
Length=291

 Score =   297 bits (760),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/285 (50%), Positives = 192/285 (67%), Gaps = 17/285 (6%)
 Frame = +2

Query  170  IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
            ++++ +V  S +  +        +F+ + ++ +GN   Q+ D G  + L LD+ +GSGF 
Sbjct  9    MLLLSLVMGSFIAASAG------DFHQEFELTWGNERAQILDGGKLLTLTLDKTSGSGFR  62

Query  350  TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
            +KN+Y+FGR DMQ+KLV G SAGTVT FYL+S  G  HDE+DFEFLGN +  PY +HTNV
Sbjct  63   SKNQYIFGRIDMQIKLVAGNSAGTVTAFYLSSE-GPNHDEIDFEFLGNLSGDPYILHTNV  121

Query  530  FADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSK  709
            ++ GKGDREQQF+LWFDPT  +H Y+I+WN QRI+++VD++PIRV+ N E+ GVPFPK++
Sbjct  122  YSQGKGDREQQFYLWFDPTKNFHTYSIVWNLQRIIFMVDDIPIRVFNNEESYGVPFPKNQ  181

Query  710  PMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCV---GTSSCADSKP----  868
            PMK++ SLW+A  WAT+GG VK DWSKAPF AY++NF  + C    G S CA        
Sbjct  182  PMKLYSSLWDADQWATRGGLVKTDWSKAPFKAYFRNFNANACTWSNGESGCASETSGSVR  241

Query  869  ---WGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
               W   ALDA     L+ V+    VYNYCTD KRF    P EC+
Sbjct  242  NNVWRTQALDASGRRILRWVQKYFMVYNYCTDLKRFPQGRPRECR  286



>ref|XP_010690581.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Beta vulgaris subsp. vulgaris]
Length=279

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/254 (54%), Positives = 180/254 (71%), Gaps = 4/254 (2%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  DV + +G+H  ++ DNGN + L+LD+  GSGF +KNEYLFG   MQ+KLVKG SAG
Sbjct  24   NFYKDVDITWGDHRAKIIDNGNLLTLSLDKMLGSGFRSKNEYLFGMIQMQIKLVKGNSAG  83

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S +G  HDE+DFEFLGN + QPY VHTN++  G+G REQQF+LWFDPT  +H
Sbjct  84   TVTAYYLSS-LGATHDELDFEFLGNVSGQPYIVHTNIYTQGRGKREQQFYLWFDPTIDFH  142

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN + I++ VD  PIRV+ N ++ G+PFP ++PM+++ SLW+A DWATQGG VK 
Sbjct  143  TYSILWNPRTIIFYVDGTPIRVFPNRKSKGIPFPNNQPMRLYASLWDAEDWATQGGRVKT  202

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCADSKPWGKYALDADANNKLQGVRTKNRVYNYC  949
            DW  APFTA ++NF  + C+   G SSC  S PW    LD+ +  KL  V+    VYNYC
Sbjct  203  DWKFAPFTASFRNFKPNACIWLNGVSSCNKSLPWFSQELDSSSKAKLNWVQKNFMVYNYC  262

Query  950  TDNKRFGGNPPAEC  991
            +D KRF    P EC
Sbjct  263  SDTKRFTQGLPREC  276



>ref|NP_001267702.1| probable xyloglucan endotransglucosylase/hydrolase protein 23-like 
precursor [Cucumis sativus]
 emb|CAD87535.1| putative xyloglucan endotransglycosylase [Cucumis sativus]
 emb|CAD87533.1| putative xyloglucan endotransglycosylase [Cucumis sativus]
 gb|KGN65438.1| hypothetical protein Csa_1G422470 [Cucumis sativus]
Length=283

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/259 (54%), Positives = 184/259 (71%), Gaps = 9/259 (3%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NFN D Q+ +G+   ++ +NG  + L+LD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  23   NFNQDFQITWGDGRAKILNNGELLTLSLDKASGSGFQSQNEYLFGKIDMQLKLVAGNSAG  82

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G   DE+DFEFLGN +  PYT+HTNVF+ GKG+REQQFHLWFDPTA +H
Sbjct  83   TVTAYYLSSK-GSTWDEIDFEFLGNLSGDPYTLHTNVFSQGKGNREQQFHLWFDPTADFH  141

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN  RI++ VD  PIR ++N E+ GVPFPK +PM+++ SLW A DWAT+GG VK 
Sbjct  142  TYSILWNPNRIIFSVDGTPIREFKNWESNGVPFPKDQPMRIYSSLWNADDWATRGGLVKT  201

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCA-----DSKPWGKYALDADANNKLQGVRTKNR  934
            DW+KAPFTA YKNF  + CV   G SSC+      S  W    +D+ +  +L+ V+    
Sbjct  202  DWTKAPFTASYKNFKAEACVWSGGKSSCSPSPAGSSNSWLSQEMDSASQERLKWVQKNYM  261

Query  935  VYNYCTDNKRFGGNPPAEC  991
            +YNYCTD KRF    P EC
Sbjct  262  IYNYCTDTKRFPQGLPTEC  280



>gb|KFK29589.1| hypothetical protein AALP_AA7G154000 [Arabis alpina]
Length=270

 Score =   296 bits (757),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/251 (55%), Positives = 181/251 (72%), Gaps = 7/251 (3%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            +FN DV + +GN  G++ +NG  + L+LD+ +GSGF +K EYLFG+ DMQ+KLV G SAG
Sbjct  23   DFNTDVDVAWGNGRGKILNNGQLLTLSLDKSSGSGFQSKTEYLFGKIDMQIKLVPGNSAG  82

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTFYL SP G   DE+DFEFLGN++  PYT+HTNV+  GKGD+EQQFHLWFDPT  +H
Sbjct  83   TVTTFYLKSP-GTTWDEIDFEFLGNSSGDPYTLHTNVYTQGKGDKEQQFHLWFDPTVNFH  141

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN QRI++ VDN PIR ++N E++GV FPKSKPM+++ SLW A DWAT+GG VK 
Sbjct  142  TYSILWNPQRIIFTVDNTPIREFKNSESIGVLFPKSKPMRMYASLWNADDWATRGGLVKT  201

Query  779  DWSKAPFTAYYKNFVIDGCVGTSSCADSKPWGKYALDADANNKLQGVRTKNRVYNYCTDN  958
            DWSKAPF A Y+N  ID     S+      W    +D+ +  +L+ V+    +YNYCTD+
Sbjct  202  DWSKAPFMASYRNIKIDTSRPNSN------WYTQEMDSTSQARLKWVQKNYMIYNYCTDS  255

Query  959  KRFGGNPPAEC  991
            KRF    P EC
Sbjct  256  KRFPQGTPKEC  266



>gb|AGI42459.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   296 bits (758),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/258 (55%), Positives = 184/258 (71%), Gaps = 8/258 (3%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            N +ND  + +G+  G++ +NG  + L LD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  26   NSHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNSAG  85

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNVF+ GKG REQQFHLWFDPTA +H
Sbjct  86   TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGGREQQFHLWFDPTADFH  144

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN QRI++ VDN PIR ++N E+VGV +PK++ M+++ SLW A DWAT+GG +K 
Sbjct  145  TYSILWNPQRIIFSVDNTPIREFKNAESVGVAYPKNQAMRIYSSLWNADDWATRGGLIKT  204

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCADSKP----WGKYALDADANNKLQGVRTKNRV  937
            DWSKAPFTA Y+NF    C+   G SSC  + P    W    LDA +  +LQ V+    +
Sbjct  205  DWSKAPFTASYRNFNARACIWSSGRSSCNSNAPSNNAWLNEELDATSQQRLQWVQKNYMI  264

Query  938  YNYCTDNKRFGGNPPAEC  991
            YNYCTD KRF    P EC
Sbjct  265  YNYCTDAKRFPQGYPPEC  282



>gb|KGN47998.1| hypothetical protein Csa_6G423400 [Cucumis sativus]
Length=274

 Score =   296 bits (757),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/260 (54%), Positives = 191/260 (73%), Gaps = 9/260 (3%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  DV + +G    ++ D G  ++L+LD+ +GSGF +K E+LFGRFD+QMKLV G SAG
Sbjct  11   NFLQDVDITWGGPRAKILDGGRHLSLSLDKDSGSGFQSKQEFLFGRFDVQMKLVPGNSAG  70

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTFYL+S  G +HDE+DFEFLGN++  PYT+HTNV++ GKG+REQQFHLWFDPT  +H
Sbjct  71   TVTTFYLSSQ-GGSHDEIDFEFLGNSSGDPYTLHTNVYSQGKGNREQQFHLWFDPTKGFH  129

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I W+ + I +LVDN+PIRV+ N EN+GV +PKS+PM+ + SLW A DWAT+GG VK 
Sbjct  130  TYSIDWSPESIKFLVDNIPIRVFHNWENIGVSYPKSQPMRAYSSLWNADDWATRGGLVKT  189

Query  779  DWSKAPFTAYYKNFVIDGCVGTSSCADS--------KPWGKYALDADANNKLQGVRTKNR  934
            DW++APFTA Y+NF  +GCV +S  +          +   +  LDA + N+L+ V++K  
Sbjct  190  DWTQAPFTASYRNFNANGCVASSGSSSCGSKFSSTLQGGAQSGLDAKSRNRLRWVQSKFM  249

Query  935  VYNYCTDNKRFGGNPPAECK  994
            +YNYCTD+KRF    PAEC+
Sbjct  250  IYNYCTDHKRFPQGIPAECR  269



>gb|AGI42461.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   296 bits (758),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/258 (55%), Positives = 184/258 (71%), Gaps = 8/258 (3%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF+ND  + +G+  G++ +NG  + L LD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  26   NFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNSAG  85

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G  HDE+DFEFL N +  PYT+HTNVF+ GKG REQQFHLWFDPTA +H
Sbjct  86   TVTAYYLSSQ-GPTHDEIDFEFLENLSGDPYTLHTNVFSQGKGGREQQFHLWFDPTADFH  144

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN QRI++ VDN PIR ++N E+VGV +PK++ M+++ SLW A DWAT+GG +K 
Sbjct  145  TYSILWNPQRIIFSVDNTPIREFKNAESVGVAYPKNQAMRIYSSLWNADDWATRGGLIKT  204

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCADSKP----WGKYALDADANNKLQGVRTKNRV  937
            DWSKAPFTA Y+NF    C+   G SSC  + P    W    LDA +  +LQ V+    +
Sbjct  205  DWSKAPFTASYRNFNAKACIWSSGRSSCNSNAPSNNAWLNEELDATSQQRLQWVQENYMI  264

Query  938  YNYCTDNKRFGGNPPAEC  991
            YNYCTD KRF    P EC
Sbjct  265  YNYCTDAKRFPQGYPPEC  282



>gb|EYU29578.1| hypothetical protein MIMGU_mgv1a011198mg [Erythranthe guttata]
Length=289

 Score =   296 bits (758),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 143/256 (56%), Positives = 187/256 (73%), Gaps = 6/256 (2%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  DV + +G   GQ+ + G T++L+LD  +GSGF +  ++L+GRFD+Q+KL+ G SAG
Sbjct  30   NFYQDVTITWGGPRGQILNGGQTLSLSLDNISGSGFESNYQFLYGRFDVQLKLIPGDSAG  89

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTF+L+S  G AHDE+DFEFLGN++ QPYTVHTNVFA G G+REQQF LWFDPT  +H
Sbjct  90   TVTTFFLSSQ-GTAHDEIDFEFLGNSSGQPYTVHTNVFAQGLGNREQQFKLWFDPTIDFH  148

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             YTIIWNSQRI+++VDN+PIRV+ N+   GV +P S+PMKV+ SLW A DWATQGG VK 
Sbjct  149  TYTIIWNSQRIIYMVDNIPIRVFTNYIANGVSYPTSQPMKVYASLWNADDWATQGGRVKT  208

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCAD--SKPWGKYALDADANNKLQGVRTKNRVYN  943
            +W+ APFTA Y+ +  D C+    T+SC D  S+PW    LDA+  N ++ V+    +Y+
Sbjct  209  NWALAPFTATYRYYNADACMINGMTNSCNDGISRPWQTQGLDANGTNAIRWVQQNYMIYD  268

Query  944  YCTDNKRFGGNPPAEC  991
            YCTD KRF    P EC
Sbjct  269  YCTDFKRFPMGLPTEC  284



>emb|CDX72228.1| BnaC07g42500D [Brassica napus]
Length=279

 Score =   296 bits (757),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 144/254 (57%), Positives = 185/254 (73%), Gaps = 4/254 (2%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            +FN+DV + +GN  G++ +NG  + L+LD+ +GSGF +K EYLFG+ DMQ+KLV G SAG
Sbjct  23   DFNSDVNVAWGNGRGKILNNGQLLTLSLDRSSGSGFQSKTEYLFGKIDMQIKLVPGNSAG  82

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTFYL S  G   DE+DFEFLGN +  PYT+HTNV+  GKGD+EQQF+LWFDPTA +H
Sbjct  83   TVTTFYLKSE-GSTWDEIDFEFLGNMSGDPYTLHTNVYTQGKGDKEQQFYLWFDPTANFH  141

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN QRI+  VD+ PIR ++N E++GV FPKSKPM+++ SLW A DWAT+GG VK 
Sbjct  142  TYSILWNPQRIILTVDDTPIREFKNSESIGVLFPKSKPMRMYASLWNADDWATRGGLVKT  201

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCADSKPWGKYALDADANNKLQGVRTKNRVYNYC  949
            DWSKAPF A Y+N  IDGC    G SSC+ S  W    +DA +  +L+ V+    +YNYC
Sbjct  202  DWSKAPFMAAYRNIKIDGCAHINGRSSCSPSSSWYTQQMDATSQARLRWVQKNYMIYNYC  261

Query  950  TDNKRFGGNPPAEC  991
            TD KRF    P EC
Sbjct  262  TDRKRFPQGIPREC  275



>ref|XP_009373581.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Pyrus 
x bretschneideri]
Length=275

 Score =   296 bits (757),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 139/277 (50%), Positives = 191/277 (69%), Gaps = 9/277 (3%)
 Frame = +2

Query  164  CMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSG  343
             +++++G+V  SL+     +     NF  D  + +G H  ++   G  ++L+LD+ +GSG
Sbjct  5    SLVLLVGLVCSSLM-----IATYAGNFYQDFDLTWGGHRPKIFKGGQLLSLSLDKVSGSG  59

Query  344  FNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHT  523
            F +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +HT
Sbjct  60   FQSKKEYLFGRIDMQLKLVPGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNVSGDPYILHT  118

Query  524  NVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPK  703
            N+F  GKG+REQQF+LWFDP+  +H Y++IW  Q I++LVD  PIRV++N E VGVPFPK
Sbjct  119  NIFTQGKGNREQQFYLWFDPSKNFHTYSVIWKPQHIIFLVDKTPIRVFKNAEAVGVPFPK  178

Query  704  SKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTSSCADSKPWGKYA  883
            S+PM+++ SLW A DWAT+GG VK DWSKAPFTAYY+NF +     ++S ++   W    
Sbjct  179  SQPMRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRNFNVIDSRSSNSFSE---WQTNE  235

Query  884  LDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
            LDA +  +L+ V+    +YNYCTD KRF    P EC+
Sbjct  236  LDAPSRRRLRWVQKYFMIYNYCTDLKRFPQGAPPECR  272



>ref|XP_010446167.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 25, partial [Camelina sativa]
Length=276

 Score =   296 bits (757),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 141/256 (55%), Positives = 184/256 (72%), Gaps = 5/256 (2%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             F+ +  + +G+  G+V +NG  + L+LD+ +GSGF TK EYLFG+ DMQ+KLV G SAG
Sbjct  21   TFDTEFDITWGDGRGKVLNNGGLLTLSLDRASGSGFQTKKEYLFGKIDMQLKLVPGNSAG  80

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL S  G   DE+DFEFLGN T  PYT+HTNV+  GKGDREQQFHLWFDPTA +H
Sbjct  81   TVTAYYLKSK-GDTWDEIDFEFLGNLTGDPYTMHTNVYTQGKGDREQQFHLWFDPTADFH  139

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+++WN   IV++VD++P+R ++N +++GVP+PK +PM+++ SLW A  WAT+GG VK 
Sbjct  140  TYSVLWNPHHIVFMVDDIPVRKFKNLQHIGVPYPKLQPMRLYSSLWNADQWATRGGLVKT  199

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSC-ADSKPWGKYALDADANNKLQGVRTKNRVYNY  946
            DWSKAPFTA Y+NF  D CV   G SSC A S  W    LD  A +K++ V+ K  VYNY
Sbjct  200  DWSKAPFTASYRNFRADACVSSGGKSSCPAGSTRWFSQRLDLTAEDKMKVVQRKYMVYNY  259

Query  947  CTDNKRFGGNPPAECK  994
            CTD KRF    P EC+
Sbjct  260  CTDTKRFPQGAPKECR  275



>ref|XP_007163801.1| hypothetical protein PHAVU_001G265300g [Phaseolus vulgaris]
 gb|ESW35795.1| hypothetical protein PHAVU_001G265300g [Phaseolus vulgaris]
Length=278

 Score =   296 bits (757),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 143/278 (51%), Positives = 189/278 (68%), Gaps = 7/278 (3%)
 Frame = +2

Query  161  VCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGS  340
            V   +++ VV  S+V    A      NF  D  + +G+H  ++   G  ++L+LD+ +GS
Sbjct  7    VFYALLLAVVVSSMVAQCAA------NFYQDFDLTWGDHRAKIFGGGQLLSLSLDKVSGS  60

Query  341  GFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVH  520
            GF +K +YLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +H
Sbjct  61   GFQSKKDYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNVSGDPYILH  119

Query  521  TNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFP  700
            TNVF  G+G+REQQF+LWFDPT  +H Y+IIW  Q I++LVDN+PIRV++N E+ GVPFP
Sbjct  120  TNVFTQGQGNREQQFYLWFDPTRNFHTYSIIWKPQHIIFLVDNIPIRVFKNAESAGVPFP  179

Query  701  KSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTSSCADSKPWGKY  880
            K++PM+++ SLW A DWAT+GG VK DWSKAPFTAYY+NF   G   +S+      W   
Sbjct  180  KNQPMRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRNFKATGFSVSSNSLSDSAWQST  239

Query  881  ALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
             LDA    +L+ V+    +YNYC D KRF    PAECK
Sbjct  240  ELDAYGRRRLRWVQKYFMIYNYCNDLKRFPQGLPAECK  277



>gb|KFK27294.1| hypothetical protein AALP_AA8G363800 [Arabis alpina]
Length=284

 Score =   296 bits (757),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 141/263 (54%), Positives = 185/263 (70%), Gaps = 10/263 (4%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            N   DV++ +G+  GQ+++NG  + L+LD+ +GSGF +KNEYLFG+  MQMKLV G SAG
Sbjct  23   NLQRDVEITWGDGRGQIKNNGELLTLSLDKSSGSGFQSKNEYLFGKIGMQMKLVPGNSAG  82

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTT YL SP G   DE+DFEFLGN++ +PYT+HTNV+  GKG +EQQF LWFDPTA +H
Sbjct  83   TVTTLYLKSP-GTTWDEIDFEFLGNSSGEPYTLHTNVYTQGKGHKEQQFKLWFDPTADFH  141

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             YTI+WN QRI++ VD  PIR ++N E++G  FPK+KPM+++ SLW A DWAT+GG VK 
Sbjct  142  TYTILWNPQRIIFTVDGTPIREFKNMESIGTLFPKNKPMRMYSSLWNADDWATRGGLVKT  201

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCAD------SKPWGKYALDADANNKLQGVRTKN  931
            DWSKAPFTA Y+ F  + CV   G SSC +      +  W    LD+ A  +++ V+   
Sbjct  202  DWSKAPFTASYRGFNQEACVWSNGKSSCPNGSKKGATGSWLSQELDSTAQQRMRWVQRNF  261

Query  932  RVYNYCTDNKRFGGNPPAECKPA  1000
             +YNYCTD+KRF    P EC  A
Sbjct  262  MIYNYCTDSKRFPQGLPKECSAA  284



>ref|XP_009413334.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Musa acuminata subsp. malaccensis]
Length=280

 Score =   295 bits (756),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 138/255 (54%), Positives = 187/255 (73%), Gaps = 5/255 (2%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF +DV++ +G+  G++ ++GN + L LD+ +GSGF +K EYLFGRFDM+MKLV G SAG
Sbjct  22   NFLSDVEITWGDGRGKILESGNLLQLTLDRASGSGFQSKQEYLFGRFDMKMKLVPGNSAG  81

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTT+YL+S +G  HDE+DFEFLGN + +PY +HTNV++ GKGD+EQQF+LWFDP  A+H
Sbjct  82   TVTTYYLSS-LGPTHDEIDFEFLGNVSGEPYVLHTNVYSQGKGDKEQQFYLWFDPRLAFH  140

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN Q+IV+ VD  PIRV+ N E++GVP+PKS+ M+++ SLW+  DWAT+GG VK 
Sbjct  141  TYSILWNPQQIVFYVDGTPIRVFRNSESLGVPYPKSQAMRLYASLWDGDDWATRGGLVKT  200

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCADSKP-WGKYALDADANNKLQGVRTKNRVYNY  946
            DWS+APF A Y+ +  D CV   G  SC+ S+  W    LD+ A  KL+ VR    +Y+Y
Sbjct  201  DWSQAPFVASYQGYAADACVSSAGRPSCSPSRGNWWDQGLDSGALQKLKWVRDNYMIYDY  260

Query  947  CTDNKRFGGNPPAEC  991
            C D KRF    P EC
Sbjct  261  CRDTKRFPQGFPPEC  275



>gb|KDP35747.1| hypothetical protein JCGZ_10519 [Jatropha curcas]
Length=271

 Score =   295 bits (755),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 140/262 (53%), Positives = 187/262 (71%), Gaps = 12/262 (5%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF ND  + +G+   ++ + G  + L+LD+ +GSGF +KNEYLFGR DMQ+KLV G SAG
Sbjct  7    NFYNDFDITWGDGRAKILNGGQLLTLSLDKASGSGFRSKNEYLFGRIDMQIKLVPGNSAG  66

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTFYL+S  G  HDE+D EFLGN++  PY +HTNVF+ GKG+REQQF+LWFDPT  +H
Sbjct  67   TVTTFYLSSQ-GPNHDEIDLEFLGNSSGDPYILHTNVFSQGKGNREQQFYLWFDPTFTFH  125

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN+Q+I++LVDN+PIRV+ N E++GVPFP  +PM+++ SLW A DWAT+GG VK 
Sbjct  126  TYSIVWNAQKIIFLVDNIPIRVFNNLESIGVPFPSKQPMRIYSSLWNADDWATRGGLVKT  185

Query  779  DWSKAPFTAYYKNFVIDGCV----------GTSSCADSKPWGKYALDADANNKLQGVRTK  928
            DW+ APF A Y+NF  + CV           T+S  DSK W    LDA   N+ + V+ K
Sbjct  186  DWTNAPFIASYRNFKANACVWSSGSPCAVTSTNSLQDSK-WQVQELDASGRNRPRWVQKK  244

Query  929  NRVYNYCTDNKRFGGNPPAECK  994
              +YNYC+D +RF    P+ECK
Sbjct  245  YMIYNYCSDYQRFPQGLPSECK  266



>gb|KDO46535.1| hypothetical protein CISIN_1g023581mg [Citrus sinensis]
Length=280

 Score =   295 bits (756),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 140/261 (54%), Positives = 188/261 (72%), Gaps = 8/261 (3%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            +F  +  + +G+   ++ +NG  + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  21   SFYQEFDITWGDGRAKIHNNGQFLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSAG  80

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL SP G   DE+DFEFLGN +  PYT+HTNVF +GKG+REQQFHLWFDPTAA+H
Sbjct  81   TVTAYYLKSP-GSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGNREQQFHLWFDPTAAFH  139

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN QRIV+ VD  PIR ++N E++GVPFPK++PM+++ SLW A DWAT+GG VK 
Sbjct  140  TYSILWNPQRIVFSVDGTPIREFKNSESIGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  199

Query  779  DWSKAPFTAYYKNFVIDGCVGTS-------SCADSKPWGKYALDADANNKLQGVRTKNRV  937
            DW+ APFTA Y+NF  D C+ ++       S + S+ W    LD+ + NKL+ V+    +
Sbjct  200  DWTHAPFTASYRNFKADACLWSNGKSSCASSKSRSRAWFSQELDSSSQNKLKWVQKNYMI  259

Query  938  YNYCTDNKRFGGNPPAECKPA  1000
            YNYCTD KRF    P EC+ A
Sbjct  260  YNYCTDTKRFPQGLPVECRTA  280



>ref|XP_009381589.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Musa acuminata subsp. malaccensis]
Length=282

 Score =   295 bits (756),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 142/276 (51%), Positives = 190/276 (69%), Gaps = 5/276 (2%)
 Frame = +2

Query  185  VVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEY  364
              AC  + + L+      NF  DV + +G+   ++ D+G  + L+LD+ +GSGF ++N+Y
Sbjct  8    TAACFFLALCLSSIALAGNFYQDVDITWGDARAKILDDGQLLMLSLDKYSGSGFQSRNQY  67

Query  365  LFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGK  544
            L+G+FDMQ+KLV G SAGTV TFYL+S  G  HDE+DFEFLGN +  PY VHTN++  GK
Sbjct  68   LYGKFDMQLKLVPGDSAGTVATFYLSSQ-GNTHDEIDFEFLGNLSGDPYVVHTNLYTQGK  126

Query  545  GDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVF  724
            GDREQQF+LWFDPT  +H Y+++WN + IV+ VD  PIR + N E+ GVP+PKS+ M+ +
Sbjct  127  GDREQQFYLWFDPTMDFHTYSVLWNPRHIVFSVDGTPIREFRNRESAGVPYPKSQAMRAY  186

Query  725  CSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCV---GTSSCA-DSKPWGKYALDA  892
             SLW+A DWAT+GG VK DWSKAPFTA Y+N+  +GCV   G SSCA  S  W    LD+
Sbjct  187  ASLWDADDWATRGGLVKTDWSKAPFTASYRNYTANGCVWNSGASSCAMGSNSWMWQELDS  246

Query  893  DANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECKPA  1000
            +A N+L  V+    +YNYCTD KRF    P EC  +
Sbjct  247  NAMNRLNWVQKNYMIYNYCTDPKRFPQGLPRECNAS  282



>gb|AEX07596.1| xyloglucosyl transferase 1, partial [Brassica juncea]
Length=283

 Score =   295 bits (756),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 143/262 (55%), Positives = 183/262 (70%), Gaps = 10/262 (4%)
 Frame = +2

Query  242  FNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGT  421
            F  DV++ +G+  GQ+ +NG  + L+LD+ +GSGF +KNEYLFG+ DMQMKLV G SAGT
Sbjct  23   FQRDVEITWGDGRGQITNNGELLTLSLDKSSGSGFQSKNEYLFGKIDMQMKLVPGNSAGT  82

Query  422  VTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYHD  601
            VTT YL SP G   DE+DFEFLGN +  PYT+HTNV+  GKGD+EQQF LWFDPTA +H 
Sbjct  83   VTTLYLKSP-GTTWDEIDFEFLGNLSGDPYTLHTNVYTQGKGDKEQQFKLWFDPTADFHT  141

Query  602  YTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKVD  781
            YTI+WN QRI++ VD  PIR ++N E+VG  FPK++PM+++ SLW A DWAT+GG VK D
Sbjct  142  YTILWNPQRIIFTVDGTPIREFKNMESVGTLFPKNQPMRMYSSLWNADDWATRGGLVKTD  201

Query  782  WSKAPFTAYYKNFVIDGCV---GTSSCAD------SKPWGKYALDADANNKLQGVRTKNR  934
            WSKAPFTA Y+ F  + CV   G SSC +      +  W    LD+ A  +++ V+    
Sbjct  202  WSKAPFTASYRGFNQEACVWSNGKSSCPNGSGQGTTGSWLSQELDSTAQERMRWVQKNYM  261

Query  935  VYNYCTDNKRFGGNPPAECKPA  1000
            +YNYCTD KRF    P EC  A
Sbjct  262  IYNYCTDTKRFPQGLPKECFAA  283



>ref|XP_011082931.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Sesamum indicum]
Length=289

 Score =   295 bits (756),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 140/259 (54%), Positives = 186/259 (72%), Gaps = 8/259 (3%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  DV + +G    Q+ + G  ++L+LD  +GSGF + NEYL+GRFD+Q+KLV G SAG
Sbjct  28   NFYKDVTITWGGPRAQILNGGQVLSLSLDNVSGSGFQSNNEYLYGRFDVQLKLVPGNSAG  87

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTF+L S  G AHDE+DFEFLGN++ QPYTVHTN++  G G+REQQF LWFDPT A+H
Sbjct  88   TVTTFFLASQ-GSAHDEIDFEFLGNSSGQPYTVHTNIYTRGVGNREQQFRLWFDPTVAFH  146

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WNSQ I+++VDN+PIRV++N+   GV FP S+PM++  SL  A    TQGG VK 
Sbjct  147  TYSILWNSQNIIYMVDNIPIRVFKNYAAYGVAFPTSQPMRLLASLCNAEPMTTQGGRVKT  206

Query  779  DWSKAPFTAYYKNFVIDGCV----GTSSC---ADSKPWGKYALDADANNKLQGVRTKNRV  937
            DW+KAPFTA Y+N+   GCV    GT+SC   A+S+ W    LDA+  N+++ V+ K  +
Sbjct  207  DWTKAPFTATYRNYNATGCVVSATGTNSCNGAANSQAWLTQGLDANGRNRIRWVQQKQMI  266

Query  938  YNYCTDNKRFGGNPPAECK  994
            YNYCTD KR+    P EC+
Sbjct  267  YNYCTDVKRYPQGLPKECR  285



>ref|XP_011024784.1| PREDICTED: brassinosteroid-regulated protein BRU1-like isoform 
X1 [Populus euphratica]
 ref|XP_011024785.1| PREDICTED: brassinosteroid-regulated protein BRU1-like isoform 
X2 [Populus euphratica]
Length=288

 Score =   295 bits (756),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 193/287 (67%), Gaps = 17/287 (6%)
 Frame = +2

Query  164  CMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSG  343
            C    + ++ACS+V           +F  D  + +G+H  ++ + G  ++L+LD+ +GSG
Sbjct  5    CNGFSLFLIACSMV------VVASGSFYQDFDLTWGDHRAKIFNGGQLLSLSLDKVSGSG  58

Query  344  FNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHT  523
            F +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +HT
Sbjct  59   FQSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILHT  117

Query  524  NVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPK  703
            NVF  GKG+REQQF+LWFDPT  +H Y+IIW+ Q I++LVDN PIRV++N E++GVPFPK
Sbjct  118  NVFTQGKGNREQQFYLWFDPTRNFHTYSIIWSHQHIIFLVDNFPIRVFKNAESIGVPFPK  177

Query  704  SKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGT----------SSC  853
            S+PM+++ SLW A DWAT+GG VK DW+KAPFTAYY+NF  D C  +          SS 
Sbjct  178  SQPMRIYSSLWNADDWATRGGVVKTDWTKAPFTAYYRNFKADACTWSYGKSSCGSRSSSS  237

Query  854  ADSKPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
               + W   ALDA +  +L+ V+    +YNYC D KRF    P EC+
Sbjct  238  FSDRAWQTNALDAPSRRRLRWVQKYFMIYNYCADLKRFPQGLPPECR  284



>ref|XP_007221284.1| hypothetical protein PRUPE_ppa009792mg [Prunus persica]
 gb|EMJ22483.1| hypothetical protein PRUPE_ppa009792mg [Prunus persica]
Length=277

 Score =   295 bits (755),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 139/252 (55%), Positives = 183/252 (73%), Gaps = 4/252 (2%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  D  + +G +  ++   G  ++L+LD+ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  29   NFYQDFDLTWGGNRPKIFKGGQLLSLSLDKVSGSGFQSKKEYLFGRIDMQLKLVPGNSAG  88

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G  HDE+DFEFLGN +  PY +HTNVF  GKG+REQQF+LWF+P+  +H
Sbjct  89   TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGNREQQFYLWFNPSRNFH  147

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y++IW  Q I++LVDN+PIRV+ N E+VGVPFPKS+PM+++ SLW A DWAT+GG VK 
Sbjct  148  TYSVIWKPQHIIFLVDNIPIRVFNNAESVGVPFPKSQPMRIYSSLWNADDWATRGGLVKT  207

Query  779  DWSKAPFTAYYKNFVIDGCVGTSSCADSKPWGKYALDADANNKLQGVRTKNRVYNYCTDN  958
            DWSKAPFTAYY+NF +     ++S A+   W   ALDA +  +L+ V+    +YNYCTD 
Sbjct  208  DWSKAPFTAYYRNFNVMESKTSNSFAE---WHTNALDAPSRRRLRWVQKYFMIYNYCTDL  264

Query  959  KRFGGNPPAECK  994
            KRF   PP ECK
Sbjct  265  KRFPQGPPVECK  276



>gb|ACD03218.1| xyloglucan endotransglucosylase/hydrolase 8 [Actinidia deliciosa]
Length=285

 Score =   295 bits (756),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 139/258 (54%), Positives = 186/258 (72%), Gaps = 7/258 (3%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF+ D  + +G+   ++ + G  ++L+LD+ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  24   NFHQDFDLTWGDQKAKIFNGGQILSLSLDKTSGSGFKSKQEYLFGRIDMQLKLVAGNSAG  83

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G  HDE+DFEFLGN +  PY VHTNVF  GKG+REQQF+LWFDPT  +H
Sbjct  84   TVTAYYLSSE-GPTHDEIDFEFLGNLSGDPYIVHTNVFTQGKGNREQQFYLWFDPTRNFH  142

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+IIWN+Q+I++LVDN PIRV++N E +GVPFPK++PM+++ SLW A DWAT+GG VK 
Sbjct  143  TYSIIWNTQQIIFLVDNTPIRVFKNAETIGVPFPKTQPMRIYSSLWNADDWATRGGLVKT  202

Query  779  DWSKAPFTAYYKNFVIDGC------VGTSSCADSKPWGKYALDADANNKLQGVRTKNRVY  940
            DW+KAPFTAYY+NF +  C        ++S   +  W    LDA +  +L+ V+    +Y
Sbjct  203  DWTKAPFTAYYRNFNVQTCSPRSCTSSSASSISNGAWQGQELDAYSRRRLRWVQKHFMIY  262

Query  941  NYCTDNKRFGGNPPAECK  994
            NYCTD KRF    PAEC+
Sbjct  263  NYCTDLKRFPQGIPAECR  280



>ref|XP_006414798.1| hypothetical protein EUTSA_v10025705mg [Eutrema salsugineum]
 gb|ESQ56251.1| hypothetical protein EUTSA_v10025705mg [Eutrema salsugineum]
Length=326

 Score =   296 bits (759),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 143/290 (49%), Positives = 196/290 (68%), Gaps = 14/290 (5%)
 Frame = +2

Query  149  QQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQ  328
            ++  +   ++  V+  ++ G A +      NF ++  + +G+H G++ + GN ++L+LD+
Sbjct  39   RRSSLTTTVVAAVLLVTMFGSAYSG-----NFFDEFDLTWGDHRGKIFNGGNMLSLSLDR  93

Query  329  QTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQP  508
             +GSGF +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN T +P
Sbjct  94   VSGSGFKSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GATHDEIDFEFLGNETGKP  152

Query  509  YTVHTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVG  688
            Y +HTNVFA GKG+REQQF+LWFDPT  +H Y+I+W  Q I++LVDN+PIRV+ N E +G
Sbjct  153  YVLHTNVFAQGKGNREQQFYLWFDPTKNFHTYSIVWRPQHIIFLVDNLPIRVFNNAEKLG  212

Query  689  VPFPKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTSSC-----  853
            VPFPKS+PM+++ SLW A DWAT+GG VK DWSKAPFTAYY+ F    C  +S C     
Sbjct  213  VPFPKSQPMRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRGFKAAACTVSSGCDPKFK  272

Query  854  ---ADSKPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
                D K      L+A    +L+ V+    +Y+YC+D KRF    P ECK
Sbjct  273  SSFTDGKFQVANELNAYGRRRLRWVQRYFMIYDYCSDLKRFPRGFPPECK  322



>ref|XP_002301752.1| brassinosteroid-regulated family protein [Populus trichocarpa]
 gb|ABK93796.1| unknown [Populus trichocarpa]
 gb|EEE81025.1| brassinosteroid-regulated family protein [Populus trichocarpa]
Length=288

 Score =   295 bits (755),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 146/287 (51%), Positives = 194/287 (68%), Gaps = 17/287 (6%)
 Frame = +2

Query  164  CMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSG  343
            C    + ++ CS+V           +F  D  + +G+H  ++ + G  ++L+LD+ +GSG
Sbjct  5    CNGFSLFLIVCSMV------VVASGSFYQDFDLTWGDHRAKIFNGGQLLSLSLDKVSGSG  58

Query  344  FNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHT  523
            F +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +HT
Sbjct  59   FQSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GATHDEIDFEFLGNLSGDPYILHT  117

Query  524  NVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPK  703
            NVF  GKG+REQQF+LWFDPT  +H Y+IIW+ Q I++LVDN PIRV++N E++GVPFPK
Sbjct  118  NVFTQGKGNREQQFYLWFDPTRNFHTYSIIWSQQHIIFLVDNFPIRVFKNAESIGVPFPK  177

Query  704  SKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCV---GTSSCADS----  862
            S+PM+++ SLW A DWAT+GG VK DW+KAPFTAYY+NF  D C    GTSSC       
Sbjct  178  SQPMRIYSSLWNADDWATRGGLVKTDWTKAPFTAYYRNFKADACTWSYGTSSCGSRSSSS  237

Query  863  ---KPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
               + W   ALDA +  +L+ V+    +YNYC D KRF    P EC+
Sbjct  238  FSDRAWHTNALDAPSRRRLRWVQKYFMIYNYCADLKRFPQGLPPECR  284



>gb|ABM91075.1| xyloglucan endotransglycosylase/hydrolase precursor XTH-21 [Populus 
tremula x Populus tremuloides]
Length=288

 Score =   295 bits (755),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 145/287 (51%), Positives = 193/287 (67%), Gaps = 17/287 (6%)
 Frame = +2

Query  164  CMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSG  343
            C    + ++ACS+V           +F  D  + +G+H  ++ + G  ++L+LD+ +GSG
Sbjct  5    CNGFSLFLIACSMV------VVASGSFYQDFDLTWGDHRAKIFNGGQLLSLSLDKVSGSG  58

Query  344  FNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHT  523
            F +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN T  PY +HT
Sbjct  59   FKSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLTGDPYILHT  117

Query  524  NVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPK  703
            NVF  GKG+REQQF+LWFDPT  +H Y+IIW+ Q I++LVDN PIRV++N E++GVPFPK
Sbjct  118  NVFTQGKGNREQQFYLWFDPTRNFHTYSIIWSQQHIIFLVDNFPIRVFKNAESIGVPFPK  177

Query  704  SKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCV----------GTSSC  853
            S+PM+++ SLW A DWAT+GG VK DW+KAPFTAYY+NF  D C            +SS 
Sbjct  178  SQPMRIYSSLWNADDWATRGGLVKTDWTKAPFTAYYRNFKADACTWSYGTSSCGSSSSSS  237

Query  854  ADSKPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
               + W   ALDA +  +L+ V+    +YNYC D KRF    P EC+
Sbjct  238  FSDRSWQTNALDAPSRRRLRWVQKYFMIYNYCADLKRFPQGLPPECR  284



>ref|XP_006474161.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like [Citrus sinensis]
 gb|KDO46536.1| hypothetical protein CISIN_1g023337mg [Citrus sinensis]
Length=283

 Score =   295 bits (754),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/278 (51%), Positives = 192/278 (69%), Gaps = 12/278 (4%)
 Frame = +2

Query  173  MIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNT  352
            ++I +   SL+           NF  D  + +G+  G++ +NG  ++L+LD+ +GSGF +
Sbjct  9    LLISIAISSLM------VASASNFYQDFDITWGDGRGKILNNGQLLSLSLDKASGSGFQS  62

Query  353  KNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVF  532
            K+EYLFG+ DMQ+KLV G SAGTVT +YL SP G   DE+DFEFLGN +  PYT+HTNVF
Sbjct  63   KSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSP-GSTWDEIDFEFLGNLSGDPYTLHTNVF  121

Query  533  ADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKP  712
             +GKGDREQQFHLWFDPTA +H Y+++WN QRIV+ VD  PIR ++N E+ GV FPK++P
Sbjct  122  TNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQP  181

Query  713  MKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCV---GTSSC--ADSKPWGK  877
            M+++ SLW A DWAT+GG +K DW++APFTA Y+NF  + CV   G SSC   ++ PW  
Sbjct  182  MRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANACVWSNGKSSCNSKNNNPWFS  241

Query  878  YALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAEC  991
              LDA    +L+ V+    +YNYC D+KRF    P EC
Sbjct  242  QELDATGQERLKWVQKNYMIYNYCKDSKRFPQGLPKEC  279



>gb|KDP33066.1| hypothetical protein JCGZ_13603 [Jatropha curcas]
Length=271

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/262 (53%), Positives = 188/262 (72%), Gaps = 12/262 (5%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  +  + +G+   ++ + G  + L+LD+ +GSGF +KNEYLFGR D+Q+KLV G SAG
Sbjct  7    NFYQNFDITWGDGRAKILNGGQLLTLSLDKASGSGFQSKNEYLFGRIDVQIKLVPGNSAG  66

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTFYL+S  G  HDE+DFEFLGN++  PY +HTNV++ GKG+REQQF+LWFDPT  +H
Sbjct  67   TVTTFYLSSQ-GPNHDEIDFEFLGNSSGDPYILHTNVYSQGKGNREQQFYLWFDPTLTFH  125

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN+Q+I+++VDN+PIRV+ N E++GVPFP  +PM+++ SLW A DWAT+GG VK 
Sbjct  126  TYSIVWNAQKIIFMVDNIPIRVFNNLESIGVPFPNKQPMRIYSSLWNADDWATRGGLVKT  185

Query  779  DWSKAPFTAYYKNFVIDGCV----------GTSSCADSKPWGKYALDADANNKLQGVRTK  928
            DW+ APF A Y+NF  + CV           T+S  DSK W    LDA   N+L+ V+ K
Sbjct  186  DWTNAPFIASYRNFKANACVWSSGSPCALTSTNSLQDSK-WQVQELDASGRNRLRWVQKK  244

Query  929  NRVYNYCTDNKRFGGNPPAECK  994
              +YNYC+D KRF    P+ECK
Sbjct  245  YMIYNYCSDYKRFPQGLPSECK  266



>gb|KFK35964.1| xyloglucan:xyloglucosyl transferase [Arabis alpina]
Length=292

 Score =   295 bits (754),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/287 (49%), Positives = 193/287 (67%), Gaps = 17/287 (6%)
 Frame = +2

Query  167  MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
            + M++ V+  ++VG A +      NFN +  + +G H GQ+   G  ++L+LD+ +GSGF
Sbjct  8    LTMLVTVLVLTMVGTAYSG-----NFNEEFDLTWGEHRGQIFGGGKMLSLSLDRVSGSGF  62

Query  347  NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
             +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN T +PY +HTN
Sbjct  63   KSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSE-GPTHDEIDFEFLGNETGKPYVLHTN  121

Query  527  VFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKS  706
            VFA GKG+REQQF+LWFDPT  +H Y+++W  Q I+++VDNVPIRV+ N E +GVPFPK 
Sbjct  122  VFAQGKGNREQQFYLWFDPTKNFHTYSLVWRPQHIIFMVDNVPIRVFNNAEQLGVPFPKK  181

Query  707  KPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTSSCADSKPWGKYA-  883
            +PM+++ SLW A DWAT+GG VK DWSKAPFTAYY+ F    C  +S  +   P  K + 
Sbjct  182  QPMRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRGFNAAACTVSSGSSYCDPKFKSSF  241

Query  884  ----------LDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
                      L+A    +L+ V+    +Y+YC+D KRF    P EC+
Sbjct  242  TNGESQAATELNAYGRRRLRWVQKYFMIYDYCSDVKRFSQGFPPECR  288



>ref|XP_007034180.1| Xyloglucan endotransglucosylase/hydrolase 16 [Theobroma cacao]
 gb|EOY05106.1| Xyloglucan endotransglucosylase/hydrolase 16 [Theobroma cacao]
Length=291

 Score =   295 bits (754),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 145/286 (51%), Positives = 191/286 (67%), Gaps = 14/286 (5%)
 Frame = +2

Query  161  VCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGS  340
            V M++++G+V  SLV     V     +F  D  + +G+H  ++ + G  ++L+LD+ +GS
Sbjct  8    VSMLVLVGLVVNSLV-----VVAYAGDFYQDFDLTWGDHRAKIFNGGKLLSLSLDRVSGS  62

Query  341  GFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVH  520
            GF +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +H
Sbjct  63   GFQSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILH  121

Query  521  TNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFP  700
            TNV+  GKG+REQQF LWFDPT  +H Y+IIW  Q I++LVDN PIRV++N E+VGVPFP
Sbjct  122  TNVYTQGKGNREQQFFLWFDPTRNFHTYSIIWKPQHIIFLVDNTPIRVFKNAESVGVPFP  181

Query  701  KSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTSSCADSKP----  868
            KS+PM+++ SLW A DWAT+GG VK DW+KAPFTAYY+NF    C  +   +        
Sbjct  182  KSQPMRIYSSLWNADDWATRGGLVKTDWTKAPFTAYYRNFNAKACTWSGGASSCASTSSV  241

Query  869  ----WGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
                W    LDA    +L+ V+    +YNYCTD KRF    P ECK
Sbjct  242  SDGVWETNELDAPGRRRLRWVQKYFMIYNYCTDLKRFPQGVPPECK  287



>gb|EYU38970.1| hypothetical protein MIMGU_mgv1a011611mg [Erythranthe guttata]
Length=276

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/251 (56%), Positives = 183/251 (73%), Gaps = 4/251 (2%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NFN D  + +G +  ++   G  ++L+LD+ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  28   NFNQDFDLTWGENRAKIFGGGQLLSLSLDKVSGSGFQSKKEYLFGRIDMQLKLVAGNSAG  87

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G  HDE+DFEFLGN +  PY +HTNVF  GKG+REQQF+LWFDPT  +H
Sbjct  88   TVTAYYLSSQ-GPTHDEIDFEFLGNVSGDPYILHTNVFTQGKGNREQQFYLWFDPTRNFH  146

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y++IWNSQ IV+LVDN PIRV++N E+VGVP+PKS+PM+++ SLW A DWAT+GG VK 
Sbjct  147  TYSVIWNSQNIVFLVDNTPIRVFKNSESVGVPYPKSQPMRIYSSLWNADDWATRGGLVKT  206

Query  779  DWSKAPFTAYYKNFVIDGCVGTSSCADSKPWGKYALDADANNKLQGVRTKNRVYNYCTDN  958
            DWSKAPFTAYY+NF++    G S  ++   W    LDA +  +L+ V+    +YNYCTD 
Sbjct  207  DWSKAPFTAYYRNFLVQ--TGGSKFSNG-AWQNQELDAYSRRRLRWVQKNFMIYNYCTDF  263

Query  959  KRFGGNPPAEC  991
            KRF    P EC
Sbjct  264  KRFPQGFPLEC  274



>ref|XP_008222773.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Prunus 
mume]
Length=277

 Score =   294 bits (752),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 138/252 (55%), Positives = 183/252 (73%), Gaps = 4/252 (2%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  D  + +G +  ++   G  ++L+LD+ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  29   NFYQDFDLTWGGNRPKIFKGGQLLSLSLDKVSGSGFQSKKEYLFGRIDMQLKLVPGNSAG  88

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G  HDE+DFEFLGN +  PY +HTNVF  GKG+REQQF+LWF+P+  +H
Sbjct  89   TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYVLHTNVFTQGKGNREQQFYLWFNPSRNFH  147

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y++IW  Q I++LVDN+PIRV+ N E+VGVPFPKS+PM+++ SLW A DWAT+GG VK 
Sbjct  148  TYSVIWKPQHIIFLVDNIPIRVFNNAESVGVPFPKSQPMRIYSSLWNADDWATRGGLVKT  207

Query  779  DWSKAPFTAYYKNFVIDGCVGTSSCADSKPWGKYALDADANNKLQGVRTKNRVYNYCTDN  958
            DWSKAPFTAYY+NF +     ++S A+   W   ALDA +  +L+ V+    +YNYCTD 
Sbjct  208  DWSKAPFTAYYRNFNVIESKTSNSFAE---WHTNALDAPSRRRLRWVQKYFMIYNYCTDL  264

Query  959  KRFGGNPPAECK  994
            KRF   PP EC+
Sbjct  265  KRFPQGPPVECR  276



>gb|EYU29579.1| hypothetical protein MIMGU_mgv1a018742mg [Erythranthe guttata]
Length=273

 Score =   293 bits (751),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/263 (54%), Positives = 184/263 (70%), Gaps = 12/263 (5%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF    ++ +G+  G++ + G  + L+LD  +GSGF +KN++LFGRFD+Q+KL+   SAG
Sbjct  8    NFTKYAEINWGDGRGKIIEAGRGLTLSLDNSSGSGFQSKNDFLFGRFDIQLKLIPNNSAG  67

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTF+L S  G AHDE+DFEFLGN++ +PYTVHTNV+A GKGDREQQF LWFDP A +H
Sbjct  68   TVTTFFLASQ-GSAHDEIDFEFLGNSSGEPYTVHTNVYAQGKGDREQQFKLWFDPVATFH  126

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WNSQRI++LVDN+PIRV+ N+   GVPFP ++PM+V+ SLW A DWATQGG VK 
Sbjct  127  TYSIVWNSQRIIFLVDNIPIRVFNNNGAFGVPFPTNQPMRVYGSLWNADDWATQGGQVKT  186

Query  779  DWSKAPFTAYYKNFVIDGCV------GTSSCADSKP-----WGKYALDADANNKLQGVRT  925
            +W++ PF A Y+NF I+ C       GT       P     W    LDA+  N+L+ V  
Sbjct  187  NWTQGPFVANYRNFKINACASSSSSNGTCVSGSGDPFSNQSWQTQELDANGRNRLRWVHQ  246

Query  926  KNRVYNYCTDNKRFGGNPPAECK  994
            K  +YNYCTD  RF    PAECK
Sbjct  247  KYMIYNYCTDFVRFPQGIPAECK  269



>gb|ABK30789.1| xyloglucan endotransglycosylase 3 [Litchi chinensis]
Length=272

 Score =   293 bits (751),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/260 (54%), Positives = 185/260 (71%), Gaps = 9/260 (3%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  D  + +G+H  ++ + G  ++L+LD+ +GSGF +K EY+FGR DMQ+KLV G SAG
Sbjct  9    NFYQDFDLTWGDHRAKIFNRGQLLSLSLDKVSGSGFRSKKEYMFGRIDMQLKLVAGNSAG  68

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G  HDE+DFEFLGN +  PY +HTNVF  GKGDREQQF+LWFDPT  +H
Sbjct  69   TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILHTNVFTQGKGDREQQFYLWFDPTRNFH  127

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+IIW  Q I++LVDN+PIRV++N E+VGVPFPK++PM+++ SLW A DWAT+GG VK 
Sbjct  128  TYSIIWKPQHIIFLVDNIPIRVFKNAESVGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  187

Query  779  DWSKAPFTAYYKNFVIDGCV-----GTSSCADSKPWGKY---ALDADANNKLQGVRTKNR  934
            DW+KAPFTAYY+NF    C       +SSCAD           LDA++  +L+ V+    
Sbjct  188  DWTKAPFTAYYRNFNAVPCTSCWPKSSSSCADGARQQANMNDELDANSRRRLRWVQKYFM  247

Query  935  VYNYCTDNKRFGGNPPAECK  994
            +YNYC D KRF    P+EC+
Sbjct  248  IYNYCADLKRFPQGIPSECR  267



>ref|XP_010927056.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Elaeis guineensis]
Length=277

 Score =   293 bits (751),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 142/280 (51%), Positives = 191/280 (68%), Gaps = 10/280 (4%)
 Frame = +2

Query  173  MIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNT  352
            ++  ++AC L+  A A      NF  +  + +G+  G++ DNG  + L LD+ +GSGF +
Sbjct  4    LVFPLLACFLMATASAG-----NFYQEFDITWGDGRGKILDNGQLLTLALDKASGSGFQS  58

Query  353  KNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVF  532
            KNEYLFG+ DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN + +PYT+HTNVF
Sbjct  59   KNEYLFGKIDMQLKLVPGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGEPYTLHTNVF  117

Query  533  ADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKP  712
              GKG+RE QFHLWF+PT  +H Y+I+WN + ++++VD  PIR ++N E+ GV FPKS+P
Sbjct  118  TQGKGNREMQFHLWFNPTEDFHTYSILWNPEHVIFMVDGTPIRDFKNMESKGVAFPKSQP  177

Query  713  MKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCV---GTSSCADSKP-WGKY  880
            M+++ SLW A DWATQGG VK DW+KAPFTA Y+NF  D C+   GTSSC   K  W   
Sbjct  178  MRIYSSLWNADDWATQGGRVKTDWTKAPFTASYRNFNADACIWSSGTSSCNSQKSDWWNQ  237

Query  881  ALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECKPA  1000
             LD+    +++  +    +YNYCTD KRF    P EC  A
Sbjct  238  ELDSTGQERMRWAQENYMIYNYCTDLKRFPQGLPPECSIA  277



>ref|XP_011043991.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Populus euphratica]
Length=292

 Score =   294 bits (752),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 136/253 (54%), Positives = 184/253 (73%), Gaps = 4/253 (2%)
 Frame = +2

Query  242  FNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGT  421
            FN +  + +GN  G++ +NG+ + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAGT
Sbjct  37   FNQEFDISWGNGRGKILNNGDLLTLSLDKTSGSGFQSKNEYLFGKIDMQLKLVPGNSAGT  96

Query  422  VTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYHD  601
            VTT+YL SP G + DE+DFEFLGN +  PYT+HTNV++ GKGDREQQF LWFDPTA +H 
Sbjct  97   VTTYYLKSP-GNSWDEMDFEFLGNLSGDPYTLHTNVYSQGKGDREQQFRLWFDPTADFHT  155

Query  602  YTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKVD  781
            Y+I+WN + I++ VD  PIR ++N E++GVPFPK + M+++ SLW A DWAT+GG +K D
Sbjct  156  YSILWNPKLIIFSVDGKPIREFKNLESIGVPFPKKQQMRIYSSLWNADDWATRGGLIKTD  215

Query  782  WSKAPFTAYYKNFVIDGCV---GTSSCADSKPWGKYALDADANNKLQGVRTKNRVYNYCT  952
            W++APFTA Y+NF  D C+   G ++C   K W    LDA +  +L+ V+    +YNYCT
Sbjct  216  WTRAPFTASYRNFKADACIWSSGRAACPSRKSWLWQKLDATSFQRLKWVQKNFMIYNYCT  275

Query  953  DNKRFGGNPPAEC  991
            D KRF    P EC
Sbjct  276  DTKRFPLGFPPEC  288



>gb|KDP36434.1| hypothetical protein JCGZ_08703 [Jatropha curcas]
Length=286

 Score =   294 bits (752),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 138/260 (53%), Positives = 186/260 (72%), Gaps = 9/260 (3%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  D  + +G+   ++ +NG  + LNLD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  26   NFYQDFDITWGDGRAKILNNGQLLTLNLDKASGSGFQSRNEYLFGKIDMQLKLVPGNSAG  85

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G   DE+DFEFLGN +  PY +HTN+F+ GKG+REQQF++WFDPTA +H
Sbjct  86   TVTAYYLSSK-GSTWDEIDFEFLGNLSGDPYILHTNLFSQGKGNREQQFYVWFDPTADFH  144

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WNSQRI++ VD  PIR ++N E+ GVPFPKS+PM+++ SLW A DWAT+GG VK 
Sbjct  145  TYSILWNSQRIIFSVDGTPIREFKNLESAGVPFPKSQPMRIYSSLWNADDWATRGGLVKT  204

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSC-----ADSKPWGKYALDADANNKLQGVRTKNR  934
            DWS+APFTA Y+NF  + CV   G SSC     +++  W    LD+ +  +L+ V+    
Sbjct  205  DWSQAPFTASYRNFNANACVWSNGASSCGTNAASNTTSWLSEELDSTSQERLKWVQKNYM  264

Query  935  VYNYCTDNKRFGGNPPAECK  994
            +YNYCTD KRF    P ECK
Sbjct  265  IYNYCTDIKRFPQGLPTECK  284



>ref|XP_010927058.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Elaeis guineensis]
Length=296

 Score =   294 bits (753),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 142/291 (49%), Positives = 196/291 (67%), Gaps = 17/291 (6%)
 Frame = +2

Query  161  VCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGS  340
              M ++  ++ACSL+ +A A      NF+ D Q+ +G+   ++ DNG  + L+LD+ +GS
Sbjct  12   AIMALLFPLLACSLMAIASAG-----NFHRDFQITWGDGRAKILDNGQHLTLSLDKASGS  66

Query  341  GFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVH  520
            GF +KNEYLFG+  MQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PYT+H
Sbjct  67   GFQSKNEYLFGKIHMQLKLVPGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLH  125

Query  521  TNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFP  700
            TNVF  GKG+RE QFHLWFDPT  +H Y+I+WN + I+++VD +PIR ++N E+ G+ FP
Sbjct  126  TNVFTQGKGNREMQFHLWFDPTKDFHTYSILWNPRHIIFMVDGIPIRDFKNLESRGIAFP  185

Query  701  KSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTSSCAD-------  859
            K++PM+++ SLW A DWATQGG VK DW+KAPFTA Y+NF  D CV +S+ ++       
Sbjct  186  KNQPMRIYSSLWNADDWATQGGRVKTDWTKAPFTASYRNFKADACVWSSAASNCPSKKSS  245

Query  860  ----SKPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECKPA  1000
                S  W    LD  +  +++ V+    +YNYCTD KRF    P EC  A
Sbjct  246  TDSASDDWWNQELDFTSQERMRWVQNNYMIYNYCTDLKRFPQGLPPECSLA  296



>ref|XP_010433588.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Camelina sativa]
Length=287

 Score =   293 bits (751),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 141/286 (49%), Positives = 191/286 (67%), Gaps = 20/286 (7%)
 Frame = +2

Query  161  VCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGS  340
            + ++++  ++ CS+            NF  DV++ +G+  GQ+ +NG+ + L LD+ +GS
Sbjct  10   MLVLLVAALIICSV----------SANFQRDVEVTWGDGRGQITNNGDLLTLALDKASGS  59

Query  341  GFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVH  520
            GF +KNEYLFG+ DMQ+KLV G SAGTVT +YL SP G   DE+DFEFLGN +  PYT+H
Sbjct  60   GFQSKNEYLFGKIDMQIKLVAGNSAGTVTAYYLKSP-GSTWDEIDFEFLGNLSGDPYTLH  118

Query  521  TNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFP  700
            TNVF  GKGDREQQF LWFDPT+ +H Y+I+WNSQRI++ VD  PIR ++N E+ G  FP
Sbjct  119  TNVFTQGKGDREQQFKLWFDPTSDFHTYSILWNSQRIIFSVDGTPIREFKNMESQGTLFP  178

Query  701  KSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCV---GTSSCAD----  859
            K++PM+++ SLW A DWAT+GG VK DWSKAPFTA Y+ F ++ CV     SSC +    
Sbjct  179  KNQPMRMYSSLWNAEDWATRGGLVKTDWSKAPFTASYRGFNVEACVLVNDQSSCPNGSEQ  238

Query  860  --SKPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAEC  991
              S  W    LD+    +++ V+    +YNYCTD  RF    P EC
Sbjct  239  GSSGSWLSQELDSTGQEQMRRVQNNYMIYNYCTDTNRFPQGLPREC  284



>ref|XP_009793860.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Nicotiana sylvestris]
Length=272

 Score =   293 bits (750),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/284 (48%), Positives = 194/284 (68%), Gaps = 14/284 (5%)
 Frame = +2

Query  140  MKKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALN  319
            M     ++ + +I+   A ++ G           F+++ ++ +G    ++ +NG  + L+
Sbjct  1    MSSFTSKLVLALIVSAFAVAIAG----------TFDDNFEITWGEGRAKMLNNGELLTLS  50

Query  320  LDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNAT  499
            LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +
Sbjct  51   LDKISGSGFQSKNEYLFGKIDMQLKLVPGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLS  109

Query  500  FQPYTVHTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHE  679
              PYT+HTNVF+ GKG+REQQFHLWFDPTA +H Y+I+WN QRI++ VD  PIR Y+N E
Sbjct  110  GDPYTLHTNVFSQGKGNREQQFHLWFDPTADFHTYSILWNPQRIIFYVDGTPIREYKNSE  169

Query  680  NVGVPFPKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTSSCAD  859
            ++GV +PK++PM+++ SLW A DWAT+GG +K DWSKAPF+A Y+NF       ++S A+
Sbjct  170  SIGVSYPKNQPMRIYSSLWNADDWATRGGLIKTDWSKAPFSASYRNF---KSATSTSAAN  226

Query  860  SKPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAEC  991
            S  W    LD  +  +L+ V+    VYNYC D+KRF    PA+C
Sbjct  227  SNSWLNEELDNTSQERLKWVQKNYMVYNYCNDSKRFPQGFPADC  270



>emb|CDP02962.1| unnamed protein product [Coffea canephora]
Length=294

 Score =   293 bits (751),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 140/256 (55%), Positives = 183/256 (71%), Gaps = 6/256 (2%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF+ D  + +G+   +  +NG  + L+LD+ +GSG  +KNEYLFGR DMQ+KLV G SAG
Sbjct  33   NFDQDFAVTWGDGRAKTLNNGKLLTLSLDKASGSGVQSKNEYLFGRIDMQLKLVPGNSAG  92

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTT+YL+SP G   DE+DFEFLGN +  PY VHTNV+A GKGD+EQQF+ WFDPTA +H
Sbjct  93   TVTTYYLSSP-GSTRDEIDFEFLGNLSGDPYIVHTNVYAQGKGDKEQQFYAWFDPTADFH  151

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN + I++ VD  PIRVY+N E  G+P+PK++PMKV+ SLW+A DWAT+GG VK 
Sbjct  152  TYSILWNPRSILFYVDGTPIRVYKNLEARGIPYPKNQPMKVYASLWDAEDWATRGGLVKT  211

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCA--DSKPWGKYALDADANNKLQGVRTKNRVYN  943
            DWS++PFTA  ++F  D CV   G SSC    +KPW    LDA +  +L+ V+    +YN
Sbjct  212  DWSQSPFTASLRDFKADACVWSSGRSSCGSNSTKPWFSQELDATSQARLKWVQQNYMIYN  271

Query  944  YCTDNKRFGGNPPAEC  991
            YCTD KRF    P EC
Sbjct  272  YCTDAKRFPQGFPPEC  287



>emb|CAA63663.1| xyloglucan endotransglycosylase (XET) [Hordeum vulgare subsp. 
vulgare]
 dbj|BAJ98866.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=286

 Score =   293 bits (751),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 148/284 (52%), Positives = 187/284 (66%), Gaps = 17/284 (6%)
 Frame = +2

Query  179  IGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKN  358
            +G+VA + +           NF  D +M +G+  G+V D G  + L LD+ +GSGF +K+
Sbjct  6    LGIVAMACL----VAVARAGNFFQDSEMSWGDGRGKVVDGGRGLDLTLDKTSGSGFQSKS  61

Query  359  EYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFAD  538
            EYLFG+ DMQ+KLV G SAGTVTTFYL+S  G AHDE+DFEFLGN T +PYT+HTNVFA 
Sbjct  62   EYLFGKIDMQIKLVPGNSAGTVTTFYLSSQ-GTAHDEIDFEFLGNVTGEPYTLHTNVFAQ  120

Query  539  GKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMK  718
            G+G REQQF LWFDPT A+H Y+IIWN Q +++ VD   IR ++NHE  GV FPKS+PM+
Sbjct  121  GQGQREQQFRLWFDPTKAFHTYSIIWNPQHVIFAVDGTAIRDFKNHEARGVSFPKSQPMR  180

Query  719  VFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCV----------GT--SSCADS  862
            ++ SLW A DWATQGG VK DWSKAPF A ++NF  D CV          GT  +S A  
Sbjct  181  LYASLWNADDWATQGGRVKTDWSKAPFVASFRNFNADACVMSGGAQRCPAGTMEASAAGG  240

Query  863  KPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
              W    L      +++ V+ K  +YNYCTD KR     PAECK
Sbjct  241  GSWWNQELSGMGYRRMRWVQRKFMIYNYCTDPKRVAQGVPAECK  284



>ref|XP_010246961.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Nelumbo 
nucifera]
Length=291

 Score =   293 bits (751),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 142/285 (50%), Positives = 192/285 (67%), Gaps = 17/285 (6%)
 Frame = +2

Query  170  IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
            +++I +V  SL+           +F  D  + +G+H  ++ + G  ++L+LD+ +GSGF 
Sbjct  9    VLLIALVMSSLMAACAG------SFYQDFDLTWGDHRAKIFNGGQLLSLSLDRTSGSGFQ  62

Query  350  TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
            +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +HTNV
Sbjct  63   SKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILHTNV  121

Query  530  FADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSK  709
            F  GKG+REQQF+LWFDPT  +H Y+I+WN QRI++LVDNVPIR + N E++GVPFPK++
Sbjct  122  FTQGKGNREQQFYLWFDPTRNFHTYSIVWNPQRIIFLVDNVPIREFSNAESIGVPFPKNQ  181

Query  710  PMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTSSCA----------D  859
            PM+++ SLW A DWAT+GG VK DWSKAPFTAYY+NF  + CV +S  +           
Sbjct  182  PMRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRNFNANACVWSSGSSSCSSRSTNSFK  241

Query  860  SKPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
               W    LD  +  +L+ V+    +YNYCTD KRF    P EC+
Sbjct  242  DSDWQTQELDGWSRRRLRWVQKYYMIYNYCTDLKRFPQGLPPECR  286



>gb|AFK33604.1| unknown [Lotus japonicus]
Length=282

 Score =   293 bits (749),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 141/277 (51%), Positives = 191/277 (69%), Gaps = 8/277 (3%)
 Frame = +2

Query  167  MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
            + M++G+V  ++V           NF+ D    +G++  ++   G  ++L+LD+ +GSGF
Sbjct  12   VFMLMGIVISTMVATCAG------NFHQDFDPTWGDNRAKIFQGGQLLSLSLDKVSGSGF  65

Query  347  NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
             +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +HTN
Sbjct  66   KSKREYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILHTN  124

Query  527  VFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKS  706
            VF  G+G+REQQF+LWFDPT  +H Y+IIW  Q I++LVDN+PIRV++N E+VGVPFPK+
Sbjct  125  VFTQGRGNREQQFYLWFDPTRNFHTYSIIWKRQHIIFLVDNMPIRVFKNAESVGVPFPKN  184

Query  707  KPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNF-VIDGCVGTSSCADSKPWGKYA  883
            +PM+++ SLW A DWAT+GG VK DWSKAPFTAYY+NF       G+S+      +   A
Sbjct  185  QPMRIYSSLWSADDWATRGGLVKTDWSKAPFTAYYRNFKATSISTGSSNPNSGAEYQTNA  244

Query  884  LDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
            LDA    +L+ V+    +YNYC D KRF    PAEC+
Sbjct  245  LDAYGRRRLRWVQKYFMIYNYCNDLKRFPQGIPAECR  281



>ref|XP_010911439.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Elaeis guineensis]
Length=281

 Score =   293 bits (749),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 135/263 (51%), Positives = 186/263 (71%), Gaps = 10/263 (4%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF+ D Q+ +G+   ++ +NG  + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  20   NFDQDFQITWGDERAKILENGQLLTLSLDKPSGSGFQSKNEYLFGKIDMQLKLVPGNSAG  79

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNVF+ GKG+RE QFHLWFDPT  +H
Sbjct  80   TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGNREMQFHLWFDPTKDFH  138

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN + I+++VD +PIR ++N E+ GV FP+++PM+++ SLW A DWATQGG +K 
Sbjct  139  TYSILWNPKHIIFMVDGIPIRDFKNMESRGVAFPRNQPMRIYSSLWNADDWATQGGRIKT  198

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCADSKP------WGKYALDADANNKLQGVRTKN  931
            DW+ APFTA Y+NF  D C+   GTS+C  +        W    LD+ +  +++ V+T  
Sbjct  199  DWTNAPFTASYRNFNADACIWSSGTSNCPSTSTASASSDWWNQELDSTSQERMRWVQTNY  258

Query  932  RVYNYCTDNKRFGGNPPAECKPA  1000
             +YNYC D KRF   PP EC  A
Sbjct  259  MIYNYCADLKRFPQGPPPECSAA  281



>dbj|BAJ10423.1| xyloglucan endotransglucosylase/hydrolase [Dianthus caryophyllus]
Length=281

 Score =   293 bits (749),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 145/279 (52%), Positives = 194/279 (70%), Gaps = 14/279 (5%)
 Frame = +2

Query  176  IIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTK  355
            I  ++A +LVG  LA      NF ++  + FG+   ++ +NG+ + L+LD+ +GSGF +K
Sbjct  6    IFLLIATTLVGSTLA------NFYSEFDITFGDGRARLLNNGDDLTLSLDKYSGSGFRSK  59

Query  356  NEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFA  535
            NEYLFG+ DMQ+KLV G SAG+VTT+YL+S +G  HDE+DFEFLGN T +PYT+HTNVFA
Sbjct  60   NEYLFGKIDMQIKLVPGNSAGSVTTYYLSS-LGPTHDEIDFEFLGNVTGEPYTLHTNVFA  118

Query  536  DGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPM  715
             GKG+REQQFHLWFDPT  +H Y+I+WN QRIV+ VD VP+R ++N E+ GV FPK++PM
Sbjct  119  QGKGNREQQFHLWFDPTTEFHTYSILWNPQRIVFSVDGVPLREFKNMESKGVSFPKNQPM  178

Query  716  KVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCV---GTSSCADSKP----WG  874
            +V+ SLW A DWATQGG VK DWSKAPF A +K +  + CV   G+S+C         W 
Sbjct  179  RVYSSLWNADDWATQGGRVKADWSKAPFVASFKKYNANACVWGSGSSTCKSGSRSRSNWL  238

Query  875  KYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAEC  991
               LD+    +++ V+    VYNYC D +RF    P EC
Sbjct  239  TEELDSAGLERMKWVQKNYMVYNYCADVQRFPQGLPTEC  277



>gb|KHN17579.1| Putative xyloglucan endotransglucosylase/hydrolase protein 23 
[Glycine soja]
Length=287

 Score =   293 bits (749),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 141/264 (53%), Positives = 185/264 (70%), Gaps = 13/264 (5%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            N N D Q+ +G+   ++ +N N + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  23   NLNQDFQLTWGDGRAKILNNENLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSAG  82

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G   DE+DFEFLGN +  PY +HTNVF+ GKG+REQQF+LWFDPTA +H
Sbjct  83   TVTAYYLSSK-GSTWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFH  141

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN QRIV+ VD  PIR ++N E++GVPFPKS+PM+++ SLW A DWAT+GG +K 
Sbjct  142  TYSILWNPQRIVFSVDGTPIREFKNLESIGVPFPKSQPMRIYSSLWNADDWATRGGLIKT  201

Query  779  DWSKAPFTAYYKNFVIDGCV------------GTSSCADSKPWGKYALDADANNKLQGVR  922
            DWSKAPFTA Y+NF  + CV              SS + +  W    LD+ A  +L+ V+
Sbjct  202  DWSKAPFTASYRNFNANACVWNSGKSSCKSNSSPSSASPTNAWLSQELDSTAQQRLRWVQ  261

Query  923  TKNRVYNYCTDNKRFGGNPPAECK  994
                +YNYCTDNKRF    P ECK
Sbjct  262  KNYLIYNYCTDNKRFPQGLPLECK  285



>ref|XP_006474633.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like [Citrus sinensis]
Length=289

 Score =   293 bits (750),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 135/264 (51%), Positives = 182/264 (69%), Gaps = 15/264 (6%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF +D ++ +G H  ++ DNG  + LNLD+  GSGF +K EYLFG+ DM++KLV G+SAG
Sbjct  23   NFYDDFEITWG-HGAKIHDNGKVLTLNLDKSGGSGFQSKKEYLFGKIDMRIKLVPGYSAG  81

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G   DE+DFEFLGN T +PYT+HTNVF+ G GDRE+QFHLWFDPT  +H
Sbjct  82   TVTAYYLSSK-GANWDEIDFEFLGNVTGEPYTLHTNVFSQGNGDRERQFHLWFDPTTDFH  140

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN +R+++  D+VPIR ++N E +G+PFPK +PM+++ SLW A  WATQGG +K+
Sbjct  141  TYSILWNPKRVIFYADDVPIREFKNLEYLGIPFPKKQPMRIYSSLWNADSWATQGGRIKI  200

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCADSKP----------WGKYALDADANNKLQGV  919
            DW  APFTA Y NF  D C+   G SSC  + P          W ++ LD     K++ V
Sbjct  201  DWKYAPFTASYSNFTADACIWAFGASSCDTNSPYSNSNSKTKVWLRHELDIAKKRKMRWV  260

Query  920  RTKNRVYNYCTDNKRFGGNPPAEC  991
               + VY+YC D+KRF   PP EC
Sbjct  261  EKNHMVYDYCKDHKRFPHGPPLEC  284



>ref|XP_010545425.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Tarenaya hassleriana]
Length=290

 Score =   293 bits (749),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 144/286 (50%), Positives = 194/286 (68%), Gaps = 20/286 (7%)
 Frame = +2

Query  170  IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
            +++ GV+  S+V           NF  +V++ +G+  GQ+++NG+ + L+LD+ +GSGF 
Sbjct  16   LLLAGVLLPSVVA----------NFYQNVEITWGDGRGQIKNNGDLLTLSLDKPSGSGFQ  65

Query  350  TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
            +KNEYL+G+ DMQ+KLV G SAGTVT +YL SP G   DE+DFEFLGN +  PYT+HTNV
Sbjct  66   SKNEYLYGKIDMQLKLVAGNSAGTVTAYYLKSP-GTTWDEIDFEFLGNLSGDPYTLHTNV  124

Query  530  FADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSK  709
            F  GKG+REQQF LWFDPTA +H Y+I+WN QRI++ VD  PIR ++N E+ GV FPK++
Sbjct  125  FTQGKGNREQQFKLWFDPTADFHSYSILWNPQRIIFSVDGTPIREFKNMESQGVLFPKNQ  184

Query  710  PMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCV---GTSSCAD------S  862
            PM+++ SLW A DWAT+GG VK DWS+APFTA Y+NF  D CV   G SSC +      S
Sbjct  185  PMRMYSSLWNADDWATRGGLVKTDWSQAPFTASYRNFKEDACVWSNGKSSCPNGSSQGTS  244

Query  863  KPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECKPA  1000
              W    LD  +  +++ V+    +YNYCTD  RF    P EC  A
Sbjct  245  GSWLSQELDTTSQERMRWVQKSYMIYNYCTDTNRFPQGLPKECIAA  290



>gb|AAT94297.1| endotransglucosylase/hydrolase XTH5 [Triticum aestivum]
Length=287

 Score =   293 bits (749),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 145/265 (55%), Positives = 179/265 (68%), Gaps = 14/265 (5%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  D +M +G+  G+V D G  + L LD+ +GSGF +K EYLFG+ DMQ+KLV G SAG
Sbjct  22   NFFQDSEMTWGDGRGKVVDGGRGLDLTLDKTSGSGFQSKTEYLFGKIDMQIKLVPGNSAG  81

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTFYL+S  G AHDE+DFEFLGN T +PYT+HTNVFA G+G REQQF LWFDPT A+H
Sbjct  82   TVTTFYLSSQ-GTAHDEIDFEFLGNVTGEPYTLHTNVFAKGQGQREQQFRLWFDPTKAFH  140

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+IIWN Q +++ VD   IR ++NHE  GV FPKS+PM+++ SLW A DWATQGG VK 
Sbjct  141  TYSIIWNPQHVIFAVDGTAIRDFKNHEARGVSFPKSQPMRLYASLWNADDWATQGGRVKT  200

Query  779  DWSKAPFTAYYKNFVIDGCV----------GT---SSCADSKPWGKYALDADANNKLQGV  919
            DWSKAPF A ++NF  D CV          GT   S+   S  W    L      +++ V
Sbjct  201  DWSKAPFVASFRNFNADACVMSGGAQRCPAGTMEASAAGGSGSWWNQELSGMGYRRMRWV  260

Query  920  RTKNRVYNYCTDNKRFGGNPPAECK  994
            + K  +YNYCTD KR     PAECK
Sbjct  261  QRKFMIYNYCTDPKRVAQGVPAECK  285



>dbj|BAD93484.1| pollen major allergen No.121 isoform 1 [Cryptomeria japonica]
Length=278

 Score =   292 bits (748),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 134/251 (53%), Positives = 180/251 (72%), Gaps = 1/251 (0%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF ND  + +GN   ++ DNG  + L LDQ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  23   NFFNDFDITWGNDRAKILDNGQRLQLTLDQSSGSGFQSKNEYLFGKIDMQIKLVPGNSAG  82

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G  HDE+DFEFLGN +  PY +HTNVF+ GKG REQQF+LWFDPTA +H
Sbjct  83   TVTAYYLSSQ-GDKHDEIDFEFLGNLSGDPYIMHTNVFSQGKGSREQQFYLWFDPTADFH  141

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+++WN  +I++ VD  P+RV++N E++G  +PK++ M+++ SLW A DWAT+GG VK+
Sbjct  142  TYSLLWNPHQIMFSVDGTPVRVFKNSEDLGFAYPKNQAMRIYSSLWNADDWATRGGAVKI  201

Query  779  DWSKAPFTAYYKNFVIDGCVGTSSCADSKPWGKYALDADANNKLQGVRTKNRVYNYCTDN  958
            DWSK+PF A Y NF  + C  +S C+ +  +G  AL+     KL+ VR    +YNYCTD+
Sbjct  202  DWSKSPFVASYGNFKAETCSASSDCSVNSWYGAQALELSEQEKLEWVRKNYMIYNYCTDS  261

Query  959  KRFGGNPPAEC  991
            KRF    PAEC
Sbjct  262  KRFPQGFPAEC  272



>ref|XP_002867357.1| ATXTH18/XTH18 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43616.1| ATXTH18/XTH18 [Arabidopsis lyrata subsp. lyrata]
Length=282

 Score =   292 bits (748),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 139/255 (55%), Positives = 190/255 (75%), Gaps = 5/255 (2%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQD-NGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSA  415
            +F+ DVQ+++G+  G+++D +G  ++L+LD+ +GSGF +  E+L+G+ ++QMKLV G SA
Sbjct  28   SFHKDVQIHWGDGRGKIRDRDGKLLSLSLDKSSGSGFQSNQEFLYGKAEVQMKLVSGNSA  87

Query  416  GTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAY  595
            GTVTTFYL SP G   DE+DFEFLGN +  PYT+HTNV+  G GD+EQQFHLWFDPT  +
Sbjct  88   GTVTTFYLKSP-GTTWDEIDFEFLGNLSGHPYTLHTNVYTKGSGDKEQQFHLWFDPTVNF  146

Query  596  HDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVK  775
            H Y I WN QRI++ VD +PIR ++N E++GVPFP  +PM+++ SLWEA  WAT+GG  K
Sbjct  147  HTYCITWNPQRIIFTVDGIPIREFKNSESIGVPFPTKQPMRLYASLWEAEHWATRGGLEK  206

Query  776  VDWSKAPFTAYYKNFVIDGCV---GTSSCADSKPWGKYALDADANNKLQGVRTKNRVYNY  946
             DWSKAPFTA+Y+N+ +DGCV   G SSC  + PW    LD++   +++GV++K  VYNY
Sbjct  207  TDWSKAPFTAFYRNYNVDGCVWANGKSSCPTNSPWFTQQLDSNGQTRMKGVQSKYMVYNY  266

Query  947  CTDNKRFGGNPPAEC  991
            CTD  RF    PAEC
Sbjct  267  CTDKNRFPRGVPAEC  281



>ref|XP_006453413.1| hypothetical protein CICLE_v10008951mg [Citrus clementina]
 gb|ESR66653.1| hypothetical protein CICLE_v10008951mg [Citrus clementina]
Length=317

 Score =   293 bits (751),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/297 (48%), Positives = 197/297 (66%), Gaps = 19/297 (6%)
 Frame = +2

Query  137  KMKKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMAL  316
            ++ K      M+ +  V+   +   A        NF  D  + +G+   ++ +NG+ + L
Sbjct  27   RLLKHMSMASMLHLFLVLGSLMAASAG-------NFYKDFDITWGDGRAKMLNNGDLLTL  79

Query  317  NLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNA  496
            +LD+ +GSGF +KNEYL+G+ DMQ+KLV G SAGTVT +YL SP G   DE+DFEFLGN+
Sbjct  80   SLDKASGSGFQSKNEYLYGKIDMQLKLVPGNSAGTVTAYYLKSP-GSTWDEIDFEFLGNS  138

Query  497  TFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENH  676
            +  PYT+HTNVF +GKGDREQQFHLWFDPTA +H Y+I+WN QRI++ VD  PIR ++N 
Sbjct  139  SGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNS  198

Query  677  ENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTS---  847
            E++GVPFPK++PM+++ SLW A DWAT+GG VK DW+ APFTA Y+NF  + CV ++   
Sbjct  199  ESIGVPFPKNQPMRIYSSLWNADDWATRGGLVKTDWTHAPFTASYRNFNAEACVWSNGKS  258

Query  848  --------SCADSKPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
                    S + +  W    LD+   N+L+ V+    +YNYCTD KRF    PAEC+
Sbjct  259  SCASNSASSTSSNGAWFSQELDSTNQNRLKWVQKNYMIYNYCTDTKRFPQGLPAECR  315



>gb|EMT27816.1| Putative xyloglucan endotransglucosylase/hydrolase protein 23 
[Aegilops tauschii]
Length=287

 Score =   292 bits (748),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 143/265 (54%), Positives = 178/265 (67%), Gaps = 14/265 (5%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  D +M +G+  G+V D G  + L LD+ +GSGF +K EYLFG+ DMQ+KLV G SAG
Sbjct  22   NFFQDSEMTWGDGRGKVVDGGRGLDLTLDKTSGSGFQSKTEYLFGKIDMQIKLVPGNSAG  81

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTFYL+S  G AHDE+DFEFLGN T +PYT+HTNVFA G+G REQQF LWFDPT A+H
Sbjct  82   TVTTFYLSSQ-GTAHDEIDFEFLGNVTGEPYTLHTNVFAKGQGQREQQFRLWFDPTKAFH  140

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+IIWN Q +++ VD   IR ++NHE  GV FPKS+PM+++ SLW A DWATQGG VK 
Sbjct  141  TYSIIWNPQHVIFAVDGTAIRDFKNHEARGVSFPKSQPMRLYASLWNADDWATQGGRVKT  200

Query  779  DWSKAPFTAYYKNFVIDGCVGT-------------SSCADSKPWGKYALDADANNKLQGV  919
            DWSKAPF A ++NF  D CV +             S+   S  W    L      +++ V
Sbjct  201  DWSKAPFVASFRNFNADACVMSGGAQRCPAGRMEASAAGGSGSWWNQELSGMGYRRMRWV  260

Query  920  RTKNRVYNYCTDNKRFGGNPPAECK  994
            + K  +YNYCTD KR     PAECK
Sbjct  261  QRKFMIYNYCTDPKRVAQGVPAECK  285



>gb|AII99393.1| xyloglucan endotransglucosylase/hydrolase2 [Dianthus caryophyllus]
Length=281

 Score =   292 bits (748),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 145/279 (52%), Positives = 192/279 (69%), Gaps = 14/279 (5%)
 Frame = +2

Query  176  IIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTK  355
            I  ++A +LVG  LA      NF ++  + FG+   ++ +NG+ + L+LD+ +GSGF +K
Sbjct  6    IFLLIATTLVGSTLA------NFYSEFDITFGDGRARLLNNGDDLTLSLDKYSGSGFRSK  59

Query  356  NEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFA  535
            NEYLFG+ DMQ+KLV G SAG+VTT+YL+S +G  HDE+DFEFLGN T +PYT+HTNVFA
Sbjct  60   NEYLFGKIDMQIKLVPGNSAGSVTTYYLSS-LGPTHDEIDFEFLGNVTGEPYTLHTNVFA  118

Query  536  DGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPM  715
             GKG+REQQFHLWFDPT  +H Y+I+WN QRIV+ VD VP+R ++N E+ GV FPKS+PM
Sbjct  119  QGKGNREQQFHLWFDPTTEFHTYSILWNPQRIVFSVDGVPLREFKNMESKGVSFPKSQPM  178

Query  716  KVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTSSCADSKP-------WG  874
            +V+ SLW A DWATQGG VK DWSKAPF A +K +  + CV  S  +  K        W 
Sbjct  179  RVYSSLWNADDWATQGGRVKADWSKAPFVASFKKYNANACVWGSGSSTYKSGSRSRSNWL  238

Query  875  KYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAEC  991
               LD+    +++ V+    VYNYC D +RF    P EC
Sbjct  239  TEELDSAGLERMKWVQKNYMVYNYCADVQRFPQGLPTEC  277



>emb|CDY66832.1| BnaAnng23050D [Brassica napus]
Length=271

 Score =   292 bits (747),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/251 (55%), Positives = 178/251 (71%), Gaps = 6/251 (2%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            +FN+DV + +GN  G++ +NG  + L LD+ +GSGF +K EYLFG+ DMQ+KLV G SAG
Sbjct  23   DFNSDVNVAWGNGRGKILNNGQLLTLTLDKSSGSGFQSKAEYLFGKIDMQIKLVPGNSAG  82

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTFYL S  G   DE+DFEFLGN +  PYT+HTNV+  GKGD+EQQFHLWFDP A +H
Sbjct  83   TVTTFYLKSE-GSTWDEIDFEFLGNMSGDPYTLHTNVYTQGKGDKEQQFHLWFDPAANFH  141

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN QRI+W VDN PIR ++N E +GV FPKSKPM+++ SLW A DWAT+GG VK 
Sbjct  142  TYSILWNPQRIIWTVDNTPIREFKNSEPLGVLFPKSKPMRMYASLWNADDWATRGGLVKT  201

Query  779  DWSKAPFTAYYKNFVIDGCVGTSSCADSKPWGKYALDADANNKLQGVRTKNRVYNYCTDN  958
            DWSKAPF A Y++   DG    +S      W    +D+ +  +L+ V+    +YNYCTD+
Sbjct  202  DWSKAPFVASYRHIKCDGSTRPTSN-----WYTQQMDSTSQARLRWVQKNYMIYNYCTDS  256

Query  959  KRFGGNPPAEC  991
            KRF    P EC
Sbjct  257  KRFPQGIPREC  267



>ref|XP_010676747.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 25 [Beta vulgaris subsp. vulgaris]
 ref|XP_010676755.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 25 [Beta vulgaris subsp. vulgaris]
Length=276

 Score =   292 bits (747),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/280 (50%), Positives = 192/280 (69%), Gaps = 11/280 (4%)
 Frame = +2

Query  167  MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
            M++I+ ++   L+GV         NF  D+++ +GN  G++ ++G  + L LD  +GSGF
Sbjct  1    MMIILMLLLQFLMGVYGE------NFIQDLKITWGNDRGKILNDGQLLTLTLDNYSGSGF  54

Query  347  NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
             +  EY FG+ DMQ+KLV G SAGTVT +YL+S  G  HDE+D+EFLGN T QPYTVHTN
Sbjct  55   ESSKEYHFGKIDMQIKLVPGNSAGTVTAYYLSSK-GDTHDEIDYEFLGNLTGQPYTVHTN  113

Query  527  VFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKS  706
            V+A+GKG+REQQFHLWFDPT  +H Y+I+WN Q I++ +D +PIR ++N E++G+PFPK+
Sbjct  114  VYAEGKGEREQQFHLWFDPTVEFHTYSILWNPQTIIFSIDEIPIREFKNRESIGIPFPKT  173

Query  707  KPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCV---GTSSCA-DSKPWG  874
              M+++ S+W A  WATQGG +K DWS+APF A Y+NF  D CV   G +SC+  +  W 
Sbjct  174  HAMRLYSSIWNADQWATQGGRIKTDWSQAPFRASYRNFKADACVRDAGRTSCSPRTLTWM  233

Query  875  KYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
               LD    N+L+ VR    +YNYCTD KRF    P EC+
Sbjct  234  TKKLDDLNVNRLKWVRENFMIYNYCTDTKRFPQGLPKECR  273



>gb|AII99392.1| xyloglucan endotransglucosylase/hydrolase2 [Dianthus caryophyllus]
Length=281

 Score =   292 bits (748),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 145/279 (52%), Positives = 194/279 (70%), Gaps = 14/279 (5%)
 Frame = +2

Query  176  IIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTK  355
            I  ++A +LVG  LA      NF ++  + FG+   ++ +NG+ + L+LD+ +GSGF +K
Sbjct  6    IYLLIATTLVGSTLA------NFYSEFDITFGDGRARLLNNGDDLTLSLDKYSGSGFRSK  59

Query  356  NEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFA  535
            NEYLFG+ DMQ+KLV G SAG+VTT+YL+S +G  HDE+DFEFLGN T +PYT+HTNVFA
Sbjct  60   NEYLFGKIDMQIKLVPGNSAGSVTTYYLSS-LGPTHDEIDFEFLGNVTGEPYTLHTNVFA  118

Query  536  DGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPM  715
             GKG+REQQFHLWFDPT  +H Y+I+WN QRIV+ VD VP+R ++N E+ GV FPK++PM
Sbjct  119  QGKGNREQQFHLWFDPTTEFHTYSILWNPQRIVFSVDGVPLREFKNMESKGVSFPKNQPM  178

Query  716  KVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCV---GTSSCADSKP----WG  874
            +V+ SLW A DWATQGG VK DWSKAPF A +K +  + CV   G+S+C         W 
Sbjct  179  RVYSSLWNADDWATQGGRVKADWSKAPFVASFKKYNANACVWGSGSSTCKSGSRSRSNWL  238

Query  875  KYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAEC  991
               LD+    +++ V+    VYNYC D +RF    P EC
Sbjct  239  TEELDSAGLERMKWVQKNYMVYNYCADVQRFPQGLPTEC  277



>ref|XP_002438935.1| hypothetical protein SORBIDRAFT_10g028570 [Sorghum bicolor]
 gb|EER90302.1| hypothetical protein SORBIDRAFT_10g028570 [Sorghum bicolor]
Length=288

 Score =   292 bits (748),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/255 (53%), Positives = 180/255 (71%), Gaps = 4/255 (2%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  DV + +G+  G++ +NG  + L++D+ +GSGF +K++YL+GRFDMQ+KLV G SAG
Sbjct  31   NFYQDVDITWGDGRGKILNNGQLLTLSMDRSSGSGFQSKSQYLYGRFDMQLKLVPGNSAG  90

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTFYL+S  G AHDE+DFEFLGNA+ +PYTVHTNV++ GKG REQQF +WFDPTA +H
Sbjct  91   TVTTFYLSS-QGSAHDEIDFEFLGNASGEPYTVHTNVYSQGKGGREQQFRMWFDPTADFH  149

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+++WN   IV+ VD VPIR +    +  VPFP S+PM+V+ S+W+A +WATQGG VK 
Sbjct  150  AYSVLWNPSHIVFYVDGVPIREFRRRNDGAVPFPTSQPMRVYASVWDAEEWATQGGRVKT  209

Query  779  DWSKAPFTAYYKNFVIDGCVG--TSSCADSK-PWGKYALDADANNKLQGVRTKNRVYNYC  949
            DWSKAPF A Y+ +   GC     ++CA S   W    LD+ A  +L+  +    +YNYC
Sbjct  210  DWSKAPFVASYQGYAAAGCTAPDAAACARSNGAWMSQELDSAAQGQLRRAQASYMIYNYC  269

Query  950  TDNKRFGGNPPAECK  994
            TD  RF   PP EC 
Sbjct  270  TDKYRFPQGPPPECS  284



>ref|XP_009360814.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Pyrus 
x bretschneideri]
Length=296

 Score =   293 bits (749),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/262 (53%), Positives = 178/262 (68%), Gaps = 12/262 (5%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  D  + +G+H  ++   GN + L+LDQ +GSGF +  +YLFGR +MQ+KLV G SAG
Sbjct  31   NFQQDFDLTWGDHRAKIIGGGNVLQLSLDQASGSGFQSNKQYLFGRIEMQLKLVAGNSAG  90

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G  HDE+DFEFLGN T +PY VHTNV++ GKG REQQF+LWFDPT  +H
Sbjct  91   TVTAYYLSSE-GPNHDEIDFEFLGNVTGEPYIVHTNVYSQGKGGREQQFYLWFDPTKNFH  149

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             YT +WN QRI+ LVDN+PIRV+ N E+ GVPFPKSKPMK++ SLW A  WAT+GG VK 
Sbjct  150  TYTFLWNPQRIILLVDNIPIRVFNNGESYGVPFPKSKPMKLYSSLWNADQWATRGGLVKT  209

Query  779  DWSKAPFTAYYKNFVIDGCV-----------GTSSCADSKPWGKYALDADANNKLQGVRT  925
            DWSKAPFTAYYKNF  + CV                + +  W   + DA +  +L+ V+ 
Sbjct  210  DWSKAPFTAYYKNFNANACVWSGSSSCSSTGNIEKGSKNNAWQTQSFDAISRRRLRWVQK  269

Query  926  KNRVYNYCTDNKRFGGNPPAEC  991
               +YNYC+D KRF    P EC
Sbjct  270  YFMIYNYCSDLKRFPRGRPREC  291



>ref|XP_003601714.1| Xyloglucan endotransglycosylase/hydrolase XTH-21 [Medicago truncatula]
 gb|AES71965.1| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
Length=282

 Score =   292 bits (747),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 144/276 (52%), Positives = 191/276 (69%), Gaps = 9/276 (3%)
 Frame = +2

Query  173  MIIGV-VACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
            M+IGV +  SLV    A      NFN D  + +G+H  ++ + G  ++L+LD+ +GSGF 
Sbjct  10   MLIGVMIISSLVATCSA------NFNQDFDLTWGDHRAKIFNGGQLLSLSLDKTSGSGFQ  63

Query  350  TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
            +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +HTNV
Sbjct  64   SKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNVSGDPYILHTNV  122

Query  530  FADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSK  709
            F+ GKG+REQQF+LWFDPT  +H Y+IIW  Q I++LVDN PIR+++N E++G+PFPK++
Sbjct  123  FSQGKGNREQQFYLWFDPTKNFHTYSIIWKPQHIIFLVDNTPIRIFKNAESIGIPFPKNQ  182

Query  710  PMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNF-VIDGCVGTSSCADSKPWGKYAL  886
            PM+++ SLW A DWAT+GG VK DWSKAPFTAYY+NF   +    +S+           L
Sbjct  183  PMRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRNFKATELSSVSSTSFSDSALQSNEL  242

Query  887  DADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
            DA    +L+ V+    +YNYC D KRF    PAECK
Sbjct  243  DAYGRRRLRWVQKYFMIYNYCNDLKRFPEGIPAECK  278



>ref|XP_003601713.1| Xyloglucan endotransglycosylase/hydrolase XTH-21 [Medicago truncatula]
 gb|AES71964.1| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
Length=282

 Score =   292 bits (747),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 144/276 (52%), Positives = 191/276 (69%), Gaps = 9/276 (3%)
 Frame = +2

Query  173  MIIGV-VACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
            M+IGV +  SLV    A      NFN D  + +G+H  ++ + G  ++L+LD+ +GSGF 
Sbjct  10   MLIGVMIISSLVATCSA------NFNQDFDLTWGDHRAKIFNGGQLLSLSLDKTSGSGFQ  63

Query  350  TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
            +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +HTNV
Sbjct  64   SKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNVSGDPYILHTNV  122

Query  530  FADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSK  709
            F+ GKG+REQQF+LWFDPT  +H Y+IIW  Q I++LVDN PIR+++N E++G+PFPK++
Sbjct  123  FSQGKGNREQQFYLWFDPTKNFHTYSIIWKPQHIIFLVDNTPIRIFKNAESIGIPFPKNQ  182

Query  710  PMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNF-VIDGCVGTSSCADSKPWGKYAL  886
            PM+++ SLW A DWAT+GG VK DWSKAPFTAYY+NF   +    +S+           L
Sbjct  183  PMRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRNFKATELSSVSSTSFSDSALQSNEL  242

Query  887  DADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
            DA    +L+ V+    +YNYC D KRF    PAECK
Sbjct  243  DAYGRRRLRWVQKYFMIYNYCNDLKRFPEGIPAECK  278



>ref|XP_010243150.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Nelumbo 
nucifera]
Length=288

 Score =   292 bits (748),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/290 (48%), Positives = 193/290 (67%), Gaps = 17/290 (6%)
 Frame = +2

Query  155  QQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQT  334
             ++  +++  ++  SL+    A      NF  D  + +G+H  ++ + G  ++L+LD+ +
Sbjct  5    HRLSDLLMSALIMSSLMAAYAA------NFYQDFDLTWGDHRAKIFNGGQLLSLSLDKTS  58

Query  335  GSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYT  514
            GSGF +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY 
Sbjct  59   GSGFQSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYI  117

Query  515  VHTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVP  694
            +HTNVF  GKG+REQQF+LWFDPT  +H Y+I+WN QRI++LVDN+PIR + N E  GVP
Sbjct  118  LHTNVFTQGKGNREQQFYLWFDPTRNFHTYSIVWNPQRIIFLVDNIPIREFNNAEARGVP  177

Query  695  FPKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTSSCA------  856
            FPK++PM+++ SLW A DWAT+GG VK DW+KAPFTAYY+NF  + CV ++  +      
Sbjct  178  FPKNQPMRIYSSLWNADDWATRGGLVKTDWTKAPFTAYYRNFNANACVWSAGSSSCSSKS  237

Query  857  ----DSKPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
                    W    LDA +  +L+ V+    +YNYCTD KRF    P EC+
Sbjct  238  TNSFTDSAWQTQELDATSRRRLRWVQKYYMIYNYCTDVKRFPQGLPPECR  287



>ref|XP_010673331.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Beta 
vulgaris subsp. vulgaris]
Length=310

 Score =   293 bits (750),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 145/298 (49%), Positives = 194/298 (65%), Gaps = 29/298 (10%)
 Frame = +2

Query  167  MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGN-TMALNLDQQTGSG  343
            +++++ ++ C+             NFN + +  FG +  +V   GN  ++L LD+ +GSG
Sbjct  16   IVIVVALMVCTTA-------YGAGNFNEEFEPTFGGNRVRVFGRGNQLLSLTLDKYSGSG  68

Query  344  FNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQA-HDEVDFEFLGNATFQPYTVH  520
            F +K EYL+GR DMQMKLV G SAGTVTTFYL++      HDE+DFEFLGN +  PYT+H
Sbjct  69   FRSKKEYLYGRVDMQMKLVPGNSAGTVTTFYLSADQSTGIHDEIDFEFLGNVSGHPYTIH  128

Query  521  TNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFP  700
            TNVF+ GKG+REQQFHLWFDPT  +H Y+I+WN++ I++LVD +PIR++ NHE  GV FP
Sbjct  129  TNVFSQGKGNREQQFHLWFDPTRNFHTYSIVWNTKLIMFLVDEIPIRIFRNHEKHGVAFP  188

Query  701  KSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTS---SCADS---  862
            K++PM+++ SLW A DWATQGG VK DWSKAPFTAYY+NF I+ CV  S   SCA +   
Sbjct  189  KNQPMRLYSSLWNADDWATQGGLVKTDWSKAPFTAYYRNFYINACVAGSSLPSCATAPEA  248

Query  863  --------------KPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
                            W  + LDA+   +L+      +VY+YC D KRF    P ECK
Sbjct  249  RTNSEGSTGASTARAAWRSHDLDANGRKRLRWAHKYFKVYDYCNDLKRFPQGYPPECK  306



>ref|XP_004293370.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 25-like [Fragaria vesca subsp. vesca]
Length=291

 Score =   292 bits (748),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 143/284 (50%), Positives = 190/284 (67%), Gaps = 11/284 (4%)
 Frame = +2

Query  158  QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
            + C++  I      L+G  +AV     NFN D ++ +G+   ++ +N   + L LD+ +G
Sbjct  4    RYCLVFSIAF----LIGSLMAVISSASNFNQDFEITWGDGRAKILNNNELLVLFLDRISG  59

Query  338  SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
            SGF +K EYLFG+ DMQ+KLV G SAGTVT +YL+S  G A DE+DFEFLGN +  PYT+
Sbjct  60   SGFQSKYEYLFGKIDMQLKLVPGNSAGTVTAYYLSSK-GSAWDEIDFEFLGNLSGDPYTI  118

Query  518  HTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPF  697
            HTNV++ GKGDREQQFHLWFDPT  +H Y+I+WN + IV+ VD  PIR ++N E++GVPF
Sbjct  119  HTNVYSQGKGDREQQFHLWFDPTTDFHTYSILWNPRSIVFYVDGTPIREFKNLESIGVPF  178

Query  698  PKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCV---GTSSCADSK-  865
            PK +PM++  SLW A DWAT+GG VK DW+KAPF A Y+NF  + C+   GTSSC     
Sbjct  179  PKDQPMRLHSSLWSADDWATRGGLVKTDWTKAPFIASYRNFNANACIWSSGTSSCTSPST  238

Query  866  --PWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAEC  991
               W    +D  +  KL+ V+ K  +YNYCTD KRF    P EC
Sbjct  239  KGEWLSQEMDLASKQKLKMVQEKFMIYNYCTDTKRFPQGFPKEC  282



>ref|XP_009343827.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Pyrus 
x bretschneideri]
Length=275

 Score =   291 bits (746),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 144/279 (52%), Positives = 188/279 (67%), Gaps = 11/279 (4%)
 Frame = +2

Query  161  VCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGS  340
              + +++G+   SL+    A      NF  D  + +G +  ++   G  ++L+LD  +GS
Sbjct  4    ASLALLVGLAFSSLIAATYAG-----NFYQDFDLTWGGNRPKIFKGGQLLSLSLDIVSGS  58

Query  341  GFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVH  520
            GF +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +H
Sbjct  59   GFQSKKEYLFGRIDMQLKLVPGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNVSGDPYVLH  117

Query  521  TNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFP  700
            TNVF  GKG+REQQF+LWFDP+  +H Y+IIW  Q I++LVDN PIRV++N   VGVPFP
Sbjct  118  TNVFTQGKGNREQQFYLWFDPSKNFHTYSIIWKPQHIIFLVDNTPIRVFKNAGKVGVPFP  177

Query  701  KSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNF-VIDGCVGTSSCADSKPWGK  877
            KS+PM+++ SLW A DWAT+GG VK DWSKAPFTAYY+NF VID    + S      W  
Sbjct  178  KSQPMRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRNFNVID----SKSSNSFSEWQT  233

Query  878  YALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
              LDA +  +L+ V+    +YNYCTD KRF    PAEC+
Sbjct  234  NELDAPSRRRLRWVQKYFMIYNYCTDLKRFPRGAPAECR  272



>ref|XP_009121735.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Brassica rapa]
Length=287

 Score =   292 bits (747),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/264 (53%), Positives = 184/264 (70%), Gaps = 11/264 (4%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF+ DV++ +G+  GQ+ +NG+ + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  25   NFHQDVEITWGDGRGQITNNGDLLTLSLDKSSGSGFQSKNEYLFGKIDMQIKLVAGNSAG  84

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL SP G   DE+DFEFLGN +  PYT+HTNVF  GKGDREQQF LWFDPT  +H
Sbjct  85   TVTAYYLKSP-GSTWDEIDFEFLGNLSGDPYTLHTNVFTQGKGDREQQFKLWFDPTIDFH  143

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN QRI++ VD  PIR ++N E+ G  FPK++PM+++ SLW A DWAT+GG VK 
Sbjct  144  TYSILWNPQRIIFSVDGTPIREFKNMESQGTLFPKNQPMRMYSSLWNAEDWATRGGLVKT  203

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSC-------ADSKPWGKYALDADANNKLQGVRTK  928
            DWSKAPFTA Y+ F  + CV   G SSC       + S  W    LD+    +++ V++ 
Sbjct  204  DWSKAPFTASYRGFSEEACVVSNGKSSCSNGSAQGSGSGSWLSQELDSTGQERMRWVQSN  263

Query  929  NRVYNYCTDNKRFGGNPPAECKPA  1000
              +YNYCTD KRF    P EC  A
Sbjct  264  YMIYNYCTDAKRFPQGLPRECLSA  287



>ref|XP_003563483.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Brachypodium distachyon]
Length=290

 Score =   292 bits (747),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 152/290 (52%), Positives = 194/290 (67%), Gaps = 22/290 (8%)
 Frame = +2

Query  173  MIIGVVACS-LVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
            + +G+VA + LVG+A        NFN D +M +G+  G+V D G  + L LD+ TGSGF 
Sbjct  4    VALGIVAMACLVGMAQGG-----NFNQDAEMTWGHGNGKVVDGGRGLDLTLDRTTGSGFQ  58

Query  350  TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
            +K+EYLFG+ DMQ+KLV G SAGTVTTFYL+S  G AHDE+DFEFLGN T +PYT+HTNV
Sbjct  59   SKSEYLFGKIDMQIKLVPGNSAGTVTTFYLSSQ-GSAHDEIDFEFLGNVTGEPYTLHTNV  117

Query  530  FADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSK  709
            FA G+G REQQF LWFDPT ++H Y+IIWN Q +++ VD  PIR ++N+E  GV FPKS+
Sbjct  118  FAKGQGQREQQFRLWFDPTTSFHTYSIIWNPQHVIFAVDGTPIRDFKNNEARGVSFPKSQ  177

Query  710  PMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCV---GTSSC---------  853
            PM+++ SLW A DWATQGG VK DWSKAPF A +++F  D CV   G   C         
Sbjct  178  PMRLYASLWNADDWATQGGRVKADWSKAPFVASFRDFNADACVWSAGAQRCPAGTMEASS  237

Query  854  ---ADSKPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
               A    W    L   +  +++ V+ K  +YNYCTD KRF    PAECK
Sbjct  238  ATGASGSSWWNQQLSDMSYRRMRWVQRKFMIYNYCTDAKRFPQGVPAECK  287



>ref|XP_008380453.1| PREDICTED: brassinosteroid-regulated protein BRU1 [Malus domestica]
Length=275

 Score =   291 bits (746),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 143/278 (51%), Positives = 191/278 (69%), Gaps = 11/278 (4%)
 Frame = +2

Query  164  CMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSG  343
             +++++G+V  SL+     V     NF  D  + +G +  ++   G  ++L+LD+ +GSG
Sbjct  5    SLVLLVGLVCSSLM-----VATYAGNFYQDFDLTWGGNRPKIFKGGQLLSLSLDKVSGSG  59

Query  344  FNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHT  523
            F +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +HT
Sbjct  60   FQSKKEYLFGRIDMQLKLVPGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILHT  118

Query  524  NVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPK  703
            N+F  GKGDREQQF+LWFDP+  +H Y++IW  Q I++LVD  PIRV++N E VGVPFPK
Sbjct  119  NIFTQGKGDREQQFYLWFDPSKNFHTYSVIWKPQHIIFLVDKTPIRVFKNAEAVGVPFPK  178

Query  704  SKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNF-VIDGCVGTSSCADSKPWGKY  880
            S+PM+++ SLW A DWAT+GG VK DWSKAPFTAYY+NF VID    + S +    W   
Sbjct  179  SQPMRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRNFNVID----SRSSSSFSEWQTN  234

Query  881  ALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
             LDA +  +L+ V+    +YNYCTD KRF    P EC+
Sbjct  235  ELDAPSRRRLRWVQKYFMIYNYCTDLKRFPQGAPPECR  272



>gb|KHN44468.1| Brassinosteroid-regulated protein BRU1 [Glycine soja]
Length=276

 Score =   291 bits (746),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 145/285 (51%), Positives = 193/285 (68%), Gaps = 10/285 (4%)
 Frame = +2

Query  140  MKKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALN  319
            M   + +   +M++ VV  S+V    A      NFN D  + +G+   ++ + G  ++L+
Sbjct  1    MASSRNEFYALMLV-VVVGSIVASCGA------NFNQDFDLTWGDQRAKIFNGGQLLSLS  53

Query  320  LDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNAT  499
            LD+ +GSGF +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +
Sbjct  54   LDKVSGSGFQSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNVS  112

Query  500  FQPYTVHTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHE  679
              PY +HTNVF  G+G+REQQF+LWFDPT  +H Y+IIW  Q I++LVDN+PIRV++N E
Sbjct  113  GDPYILHTNVFTQGQGNREQQFYLWFDPTRNFHTYSIIWKPQHIIFLVDNIPIRVFKNGE  172

Query  680  NVGVPFPKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTSSCAD  859
             +GVPFPK +PM+++ SLW A DWAT+GG VK DWSKAPFTAYY+NF       T+S +D
Sbjct  173  TIGVPFPKKQPMRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRNFKATE-FSTNSFSD  231

Query  860  SKPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
            +  W    LDA    KL+ V+    +YNYC D KRF    P EC+
Sbjct  232  A-AWQSNELDAYGRRKLRWVQKYFMIYNYCNDLKRFPQGIPVECR  275



>gb|KDO46531.1| hypothetical protein CISIN_1g045763mg, partial [Citrus sinensis]
Length=267

 Score =   291 bits (745),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/264 (51%), Positives = 182/264 (69%), Gaps = 15/264 (6%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF +D ++ +G H  ++ DNG  + LNLD+  GSGF +K EYLFG+ DM++KLV G+SAG
Sbjct  1    NFYDDFEITWG-HGAKIHDNGKVLTLNLDKSGGSGFQSKKEYLFGKIDMRIKLVPGYSAG  59

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G   DE+DFEFLGN T +PYT+HTNVF+ G GDRE+QFHLWFDPT  +H
Sbjct  60   TVTAYYLSSK-GANWDEIDFEFLGNVTGEPYTLHTNVFSQGNGDRERQFHLWFDPTTDFH  118

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN +R+++  D+VPIR ++N E +G+PFPK +PM+++ SLW A  WATQGG +K+
Sbjct  119  TYSILWNPKRVIFYADDVPIREFKNLEYLGIPFPKKQPMRIYSSLWNADSWATQGGRIKI  178

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCADSKP----------WGKYALDADANNKLQGV  919
            DW  APFTA Y NF  D C+   G SSC  + P          W ++ LD     K++ V
Sbjct  179  DWKYAPFTASYSNFTADACIWAFGASSCDTNSPYSNSNSKTKVWLRHELDIAKKRKMRWV  238

Query  920  RTKNRVYNYCTDNKRFGGNPPAEC  991
               + VY+YC D+KRF   PP EC
Sbjct  239  EKNHMVYDYCKDHKRFPHGPPLEC  262



>ref|XP_009759293.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like [Nicotiana sylvestris]
 ref|XP_009767490.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like [Nicotiana sylvestris]
Length=272

 Score =   291 bits (745),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/284 (48%), Positives = 194/284 (68%), Gaps = 14/284 (5%)
 Frame = +2

Query  140  MKKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALN  319
            M     ++ + +I+   A ++ G           F+++ ++ +G    ++ +NG  + L+
Sbjct  1    MSSFTSKLVLALIVSAFAVAIAG----------TFDDNFEITWGEGRAKMLNNGELLTLS  50

Query  320  LDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNAT  499
            LD+ +GSGF +K+EYLFG+ DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +
Sbjct  51   LDKISGSGFQSKDEYLFGKIDMQLKLVPGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLS  109

Query  500  FQPYTVHTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHE  679
              PYT+HTNVF+ GKG+REQQFHLWFDPTA +H Y+I+WN QRI++ VD  PIR Y+N E
Sbjct  110  GDPYTLHTNVFSQGKGNREQQFHLWFDPTADFHTYSILWNPQRIIFYVDGTPIREYKNSE  169

Query  680  NVGVPFPKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTSSCAD  859
            ++GV +PK++PM+++ SLW A DWAT+GG +K DWSKAPF+A Y+NF       ++S A+
Sbjct  170  SIGVSYPKNQPMRIYSSLWNADDWATRGGLIKTDWSKAPFSASYRNF---KSATSTSAAN  226

Query  860  SKPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAEC  991
            S  W    LD  +  +L+ V+    VYNYC D+KRF    PA+C
Sbjct  227  SNSWLNEELDNTSQERLKWVQKNYMVYNYCNDSKRFPQGFPADC  270



>ref|XP_010927057.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Elaeis guineensis]
Length=279

 Score =   291 bits (746),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/285 (49%), Positives = 194/285 (68%), Gaps = 13/285 (5%)
 Frame = +2

Query  167  MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
            M ++  ++A SL+           N   D Q+ +G+   ++ +NG  + L+LD+ +GSGF
Sbjct  1    MALVFLLLAFSLM-----TGASAGNLYQDFQITWGDGRAKILENGQLLTLSLDKASGSGF  55

Query  347  NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
             +KNEYLFG+ DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PYT+HTN
Sbjct  56   QSKNEYLFGKIDMQLKLVPGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTN  114

Query  527  VFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKS  706
            VFA GKG+RE QFHLWFDPT  +H ++I+WN + I+++VD  PIR ++N E+ GV FPK+
Sbjct  115  VFAQGKGNREMQFHLWFDPTKDFHTHSILWNPKHIIFMVDGTPIRDFKNMESKGVAFPKN  174

Query  707  KPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCV---GTSSC----ADSK  865
            +PM+++ SLW A DWATQGG +K DW+KAPFTA Y+NF  D CV   GTS+C    ++S 
Sbjct  175  QPMRIYSSLWNADDWATQGGRIKTDWTKAPFTASYRNFNADACVWSSGTSNCPPKKSNSA  234

Query  866  PWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECKPA  1000
             W    LD+ +  +++ V+    +YNYCTD KRF    P EC  A
Sbjct  235  DWWNQDLDSTSQARMRWVQRNYMIYNYCTDQKRFPQGLPPECSMA  279



>ref|XP_004298224.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Fragaria 
vesca subsp. vesca]
Length=378

 Score =   295 bits (755),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 194/287 (68%), Gaps = 7/287 (2%)
 Frame = +2

Query  137  KMKKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMAL  316
            KM        ++++IG+   S +     V     NF  D  + +G +  ++   G  ++L
Sbjct  97   KMGISGNGAWLVLLIGLALSSFI-----VGSYAGNFYQDFDLTWGGNRPKIFKGGQLLSL  151

Query  317  NLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNA  496
            +LD+ +GSGF +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN 
Sbjct  152  SLDKVSGSGFQSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNV  210

Query  497  TFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYHDYTIIWNSQRIVWLVDNVPIRVYENH  676
            +  PY +HTNVF  GKG+REQQF+LWFDP+  +H Y+IIW  Q I++LVDN PIRV++N 
Sbjct  211  SGDPYVLHTNVFTQGKGNREQQFYLWFDPSKNFHTYSIIWKPQHIIFLVDNTPIRVFKNA  270

Query  677  ENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKVDWSKAPFTAYYKNFVIDGCVGTSSCA  856
            E++GVPFPK++PM+++ SLW A DWAT+GG VK DWSKAPFTAYY+NF +     + S +
Sbjct  271  ESLGVPFPKNQPMRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRNFNVIDAKSSKSFS  330

Query  857  DS-KPWGKYALDADANNKLQGVRTKNRVYNYCTDNKRFGGNPPAECK  994
            DS   W   ALDA    +L+ V+    +YNYC+D KRF    PAEC+
Sbjct  331  DSLASWQTNALDAPGRRRLRWVQKYFMIYNYCSDFKRFPQGFPAECR  377



>ref|NP_176710.1| probable xyloglucan endotransglucosylase/hydrolase protein 17 
[Arabidopsis thaliana]
 sp|O80803.1|XTH17_ARATH RecName: Full=Probable xyloglucan endotransglucosylase/hydrolase 
protein 17; Short=At-XTH17; Short=XTH-17; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK43940.1|AF370621_1 xylglucan endo-transglycolsylase-like protein [Arabidopsis thaliana]
 gb|AAC27142.1| Strong similarity to xylglucan endo-transglycolsylase (TCH4) 
gene gb|U27609, first exon contains strong similarity to meri 
5 gene gb|Z17989 from A. thaliana. EST gb|N37583 comes from 
this gene [Arabidopsis thaliana]
 gb|ABN04746.1| At1g65310 [Arabidopsis thaliana]
 gb|AEE34357.1| probable xyloglucan endotransglucosylase/hydrolase protein 17 
[Arabidopsis thaliana]
Length=282

 Score =   291 bits (746),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/255 (54%), Positives = 190/255 (75%), Gaps = 5/255 (2%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQD-NGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSA  415
            +F+ DVQ+++G+  G++ D +G  ++L+LD+ +GSGF +  E+L+G+ ++QMKLV G SA
Sbjct  28   SFHKDVQIHWGDGRGKIHDRDGKLLSLSLDKSSGSGFQSNQEFLYGKAEVQMKLVPGNSA  87

Query  416  GTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAY  595
            GTVTTFYL SP G   DE+DFEFLGN +  PYT+HTNV+  G GD+EQQFHLWFDPT  +
Sbjct  88   GTVTTFYLKSP-GTTWDEIDFEFLGNISGHPYTLHTNVYTKGTGDKEQQFHLWFDPTVNF  146

Query  596  HDYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVK  775
            H Y I WN QRI++ VD +PIR ++N E +GVPFP  +PM+++ SLWEA  WAT+GG  K
Sbjct  147  HTYCITWNPQRIIFTVDGIPIREFKNPEAIGVPFPTRQPMRLYASLWEAEHWATRGGLEK  206

Query  776  VDWSKAPFTAYYKNFVIDGCV---GTSSCADSKPWGKYALDADANNKLQGVRTKNRVYNY  946
             DWSKAPFTA+Y+N+ +DGCV   G SSC+ + PW    LD++   +++GV++K  +YNY
Sbjct  207  TDWSKAPFTAFYRNYNVDGCVWANGKSSCSANSPWFTQKLDSNGQTRMKGVQSKYMIYNY  266

Query  947  CTDNKRFGGNPPAEC  991
            CTD +RF    PAEC
Sbjct  267  CTDKRRFPRGVPAEC  281



>ref|XP_003549488.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Glycine max]
Length=287

 Score =   291 bits (746),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/264 (53%), Positives = 185/264 (70%), Gaps = 13/264 (5%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            N N D Q+ +G+   ++ +N N + L+LD+ +GSGF +KNEYL+G+ DMQ+KLV G SAG
Sbjct  23   NLNQDFQLTWGDGRAKILNNENLLTLSLDKASGSGFQSKNEYLYGKIDMQLKLVPGNSAG  82

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G   DE+DFEFLGN +  PY +HTNVF+ GKG+REQQF+LWFDPTA +H
Sbjct  83   TVTAYYLSSK-GSTWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFH  141

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN QRIV+ VD  PIR ++N E++GVPFPKS+PM+++ SLW A DWAT+GG +K 
Sbjct  142  TYSILWNPQRIVFSVDGTPIREFKNLESIGVPFPKSQPMRIYSSLWNADDWATRGGLIKT  201

Query  779  DWSKAPFTAYYKNFVIDGCV------------GTSSCADSKPWGKYALDADANNKLQGVR  922
            DWSKAPFTA Y+NF  + CV              SS + +  W    LD+ A  +L+ V+
Sbjct  202  DWSKAPFTASYRNFNANACVWNSGKSSCKSNSSPSSASPTNAWLSQELDSTAQQRLRWVQ  261

Query  923  TKNRVYNYCTDNKRFGGNPPAECK  994
                +YNYCTDNKRF    P ECK
Sbjct  262  KNYLIYNYCTDNKRFPQGLPLECK  285



>ref|XP_010670334.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Beta vulgaris subsp. vulgaris]
Length=284

 Score =   291 bits (746),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/261 (52%), Positives = 184/261 (70%), Gaps = 10/261 (4%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF  D  + +G+  G++ +NG  + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  23   NFYKDFDITWGDGRGKIINNGQLLTLSLDKTSGSGFQSKNEYLFGKIDMQLKLVGGNSAG  82

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G +HDE+DFEFLGN + QPYT+HTNVF+ GKG REQQF LWFDPT  +H
Sbjct  83   TVTAYYLSSQ-GASHDEIDFEFLGNVSGQPYTLHTNVFSQGKGGREQQFRLWFDPTTDFH  141

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN QRI++ VD  PIR ++N E++G+PFPK++PM+++ SLW A DWATQGG VK 
Sbjct  142  TYSILWNPQRIIFSVDGTPIREFKNSESMGMPFPKNQPMRIYSSLWNADDWATQGGRVKT  201

Query  779  DWSKAPFTAYYKNFVIDGCVGTSSCADS---------KPWGKYALDADANNKLQGVRTKN  931
            DWSKAPFTA Y+NF  + CV +   +            PW    +D+ +  +++ V+   
Sbjct  202  DWSKAPFTASYRNFNANACVWSKGKSSCKSSSVASKINPWFTQEMDSTSQARMKWVQKNY  261

Query  932  RVYNYCTDNKRFGGNPPAECK  994
             +YNYCTD +RF    P EC+
Sbjct  262  MIYNYCTDRQRFPQGLPKECR  282



>gb|AAB18364.1| xyloglucan endotransglycosylase-related protein, partial [Arabidopsis 
thaliana]
Length=277

 Score =   291 bits (745),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/256 (54%), Positives = 182/256 (71%), Gaps = 5/256 (2%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             F+ +  + +G+  G+V +NG  + L+LD+ +GSGF TK EYLFG+ DMQ+KLV G SAG
Sbjct  22   TFDTEFDITWGDGRGKVLNNGELLTLSLDRASGSGFQTKKEYLFGKIDMQLKLVPGNSAG  81

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL S  G   DE+DFEFLGN T  PYT+HTNV+  GKGDREQQFHLWFDPTA +H
Sbjct  82   TVTAYYLKSK-GDTWDEIDFEFLGNLTGDPYTMHTNVYTQGKGDREQQFHLWFDPTADFH  140

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+++WN   IV++VD++P+R ++N +++G+ +PK +PM+++ SLW A  WAT+GG VK 
Sbjct  141  TYSVLWNPHHIVFMVDDIPVREFKNLQHMGIQYPKLQPMRLYSSLWNADQWATRGGLVKT  200

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCADSKP-WGKYALDADANNKLQGVRTKNRVYNY  946
            DWSKAPFTA Y+NF  D CV   G SSC    P W    LD  A +K++ V+ K  +YNY
Sbjct  201  DWSKAPFTASYRNFRADACVSSGGRSSCPAGSPRWFSQRLDLTAEDKMRVVQRKYMIYNY  260

Query  947  CTDNKRFGGNPPAECK  994
            CTD KRF    P EC+
Sbjct  261  CTDTKRFPQGFPKECR  276



>emb|CDY14905.1| BnaA02g22470D [Brassica napus]
Length=271

 Score =   291 bits (744),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/251 (55%), Positives = 178/251 (71%), Gaps = 6/251 (2%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            +FN+DV + +GN  G++ +NG  + L LD+ +GSGF +K EYLFG+ DMQ+KLV G SAG
Sbjct  23   DFNSDVNVAWGNGRGKILNNGQLLTLTLDKSSGSGFQSKAEYLFGKIDMQIKLVPGNSAG  82

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVTTFYL S  G   DE+DFEFLGN +  PYT+HTNV+  GKGD+EQQFHLWFDP A +H
Sbjct  83   TVTTFYLKSE-GSTWDEIDFEFLGNMSGDPYTLHTNVYTQGKGDKEQQFHLWFDPAANFH  141

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN QRI+W VDN PIR ++N E +GV FPKSKPM+++ SLW A DWAT+GG VK 
Sbjct  142  TYSILWNPQRIIWTVDNTPIREFKNSEPLGVLFPKSKPMRMYASLWNADDWATRGGLVKT  201

Query  779  DWSKAPFTAYYKNFVIDGCVGTSSCADSKPWGKYALDADANNKLQGVRTKNRVYNYCTDN  958
            DWSKAPF A Y++   DG    +S      W    +D+ +  +L+ V+    +YNYCTD+
Sbjct  202  DWSKAPFVASYRHIKCDGSTRPTSN-----WYTQQMDSTSQARLRWVQKNYMIYNYCTDS  256

Query  959  KRFGGNPPAEC  991
            KRF    P EC
Sbjct  257  KRFPQGIPREC  267



>emb|CDY61576.1| BnaCnng38050D [Brassica napus]
Length=280

 Score =   291 bits (745),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 134/252 (53%), Positives = 179/252 (71%), Gaps = 1/252 (0%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            +FN +  + +G H G++   G  ++L+LD+ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  26   SFNEEFDLTWGEHRGKIFSGGKMLSLSLDRVSGSGFKSKKEYLFGRIDMQLKLVAGNSAG  85

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G  HDE+DFEFLGN T +PY +HTNVFA GKG+REQQF+LWFDPT  +H
Sbjct  86   TVTAYYLSSE-GPTHDEIDFEFLGNETGKPYVLHTNVFAQGKGNREQQFYLWFDPTKNFH  144

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+++W  Q I+++VDNVPIRV+ N E +GVPFPK +PM+++ SLW A DWAT+GG VK 
Sbjct  145  TYSLVWRPQHIIFMVDNVPIRVFNNAEQLGVPFPKKQPMRIYSSLWNADDWATRGGLVKT  204

Query  779  DWSKAPFTAYYKNFVIDGCVGTSSCADSKPWGKYALDADANNKLQGVRTKNRVYNYCTDN  958
            DWSKAPF AYY+ F    C   S+ AD +      L+A    +L+ V+    +Y+YC+D 
Sbjct  205  DWSKAPFIAYYRGFNAAACTFRSTFADGESQVPNELNAYGRRRLRWVQKYFMIYDYCSDL  264

Query  959  KRFGGNPPAECK  994
            KRF    P EC+
Sbjct  265  KRFPQGFPPECR  276



>ref|XP_006453403.1| hypothetical protein CICLE_v10010760mg, partial [Citrus clementina]
 gb|ESR66643.1| hypothetical protein CICLE_v10010760mg, partial [Citrus clementina]
Length=278

 Score =   291 bits (745),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 135/264 (51%), Positives = 182/264 (69%), Gaps = 15/264 (6%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF +D ++ +G H  ++ DNG  + LNLD+  GSGF +K EYLFG+ DM++KLV G+SAG
Sbjct  12   NFYDDFEITWG-HGAKIHDNGKVLTLNLDKSGGSGFQSKKEYLFGKIDMRIKLVPGYSAG  70

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G   DE+DFEFLGN T +PYT+HTNVF+ G GDRE+QFHLWFDPT  +H
Sbjct  71   TVTAYYLSSK-GANWDEIDFEFLGNVTGEPYTLHTNVFSQGNGDRERQFHLWFDPTTDFH  129

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN +R+++  D+VPIR ++N E +G+PFPK +PM+++ SLW A  WATQGG +K+
Sbjct  130  TYSILWNPKRVIFYADDVPIREFKNLEYLGIPFPKKQPMRIYSSLWNADSWATQGGRIKI  189

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCADSKP----------WGKYALDADANNKLQGV  919
            DW  APFTA Y NF  D C+   G SSC  + P          W ++ LD     K++ V
Sbjct  190  DWKYAPFTASYSNFTADACIWAFGASSCDTNSPYSNSNSKTKVWLRHELDIAKKRKMRWV  249

Query  920  RTKNRVYNYCTDNKRFGGNPPAEC  991
               + VY+YC D+KRF   PP EC
Sbjct  250  EKNHMVYDYCKDHKRFPHGPPLEC  273



>ref|XP_008801539.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Phoenix dactylifera]
Length=284

 Score =   291 bits (745),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 135/258 (52%), Positives = 181/258 (70%), Gaps = 5/258 (2%)
 Frame = +2

Query  239  NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
            NF     + +G+  G++ DNG  + L LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  28   NFYQGFDITWGDGRGKILDNGQLLTLALDEASGSGFQSKNEYLFGKIDMQLKLVPGNSAG  87

Query  419  TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVFADGKGDREQQFHLWFDPTAAYH  598
            TVT +YL+S  G  HDE+DFEFLGN + +PYT+HTNVFA GKG+RE QFHLWFDPT  +H
Sbjct  88   TVTAYYLSSQ-GPTHDEIDFEFLGNLSGEPYTLHTNVFAQGKGNREMQFHLWFDPTEDFH  146

Query  599  DYTIIWNSQRIVWLVDNVPIRVYENHENVGVPFPKSKPMKVFCSLWEASDWATQGGDVKV  778
             Y+I+WN   ++++VD +PIR ++N E+ G+ FPK++PM+++ SLW A DWATQGG +K 
Sbjct  147  TYSILWNPGHVIYMVDGIPIRDFKNLESRGIAFPKNQPMRIYSSLWNADDWATQGGRIKT  206

Query  779  DWSKAPFTAYYKNFVIDGCV---GTSSCADSKP-WGKYALDADANNKLQGVRTKNRVYNY  946
            DW+KAPFTA Y+NF  D C+   G SSC   K  W    LD+ +  +++  +    +YNY
Sbjct  207  DWTKAPFTASYRNFNADACIWSSGASSCNSQKSDWWNQELDSTSQERMRWAQENYMIYNY  266

Query  947  CTDNKRFGGNPPAECKPA  1000
            CTD KRF    P EC  A
Sbjct  267  CTDLKRFPQGLPLECSVA  284



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3154706302980