BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24083_g1_i2 len=1304 path=[841:0-529 3322:530-551 5133:552-563
5145:564-584 1425:585-585 1426:586-699 1540:700-711 1552:712-787
1628:788-807 1648:808-854 1694:855-930 688:931-1019 310:1020-1303]

Length=1304
                                                                      Score     E

ref|XP_009762863.1|  PREDICTED: brassinosteroid-regulated protein...    425   3e-144   
ref|XP_009598225.1|  PREDICTED: brassinosteroid-regulated protein...    423   2e-143   
ref|XP_009598236.1|  PREDICTED: brassinosteroid-regulated protein...    422   6e-143   
ref|XP_009762866.1|  PREDICTED: brassinosteroid-regulated protein...    421   1e-142   
ref|XP_006350013.1|  PREDICTED: probable xyloglucan endotransgluc...    419   1e-141   
ref|XP_006350014.1|  PREDICTED: probable xyloglucan endotransgluc...    417   3e-141   
ref|NP_001234478.1|  xyloglucan endotransglucosylase-hydrolase XT...    417   5e-141   
ref|XP_009597029.1|  PREDICTED: probable xyloglucan endotransgluc...    412   4e-139   
ref|XP_004243230.1|  PREDICTED: probable xyloglucan endotransgluc...    412   5e-139   
ref|XP_009785048.1|  PREDICTED: probable xyloglucan endotransgluc...    411   1e-138   
ref|XP_009602932.1|  PREDICTED: probable xyloglucan endotransgluc...    411   1e-138   
ref|XP_009758414.1|  PREDICTED: probable xyloglucan endotransgluc...    409   6e-138   
ref|XP_006348946.1|  PREDICTED: probable xyloglucan endotransgluc...    402   4e-135   
gb|ABD96607.1|  xyloglucan endotransglucosylase XET1                    397   3e-133   Capsicum annuum
ref|XP_006366771.1|  PREDICTED: probable xyloglucan endotransgluc...    395   1e-132   
ref|XP_010102170.1|  putative xyloglucan endotransglucosylase/hyd...    395   2e-132   
gb|ABD96609.1|  xyloglucan endotransglucosylase XET3                    395   3e-132   Capsicum annuum
ref|NP_001234213.1|  xyloglucan endo-transglycosylase precursor         394   6e-132   
gb|ABD96608.1|  xyloglucan endotransglucosylase XET2                    394   7e-132   Capsicum annuum
ref|XP_011082926.1|  PREDICTED: xyloglucan endotransglucosylase/h...    393   1e-131   
ref|NP_001274880.1|  probable xyloglucan endotransglucosylase/hyd...    392   4e-131   
ref|XP_011082922.1|  PREDICTED: xyloglucan endotransglucosylase/h...    392   4e-131   
ref|XP_011082921.1|  PREDICTED: xyloglucan endotransglucosylase/h...    392   4e-131   
ref|XP_011082925.1|  PREDICTED: xyloglucan endotransglucosylase/h...    391   5e-131   
ref|NP_001234207.1|  xyloglycan endo-transglycosylase precursor         390   1e-130   
ref|XP_011082923.1|  PREDICTED: xyloglucan endotransglucosylase/h...    390   1e-130   
gb|ACD03217.1|  xyloglucan endotransglucosylase/hydrolase 7             387   2e-129   Actinidia deliciosa [Chinese gooseberry]
ref|NP_001281066.1|  brassinosteroid-regulated protein BRU1-like ...    385   3e-128   
ref|XP_009356634.1|  PREDICTED: brassinosteroid-regulated protein...    384   3e-128   
gb|EYU31577.1|  hypothetical protein MIMGU_mgv1a011275mg                384   3e-128   
ref|XP_004303861.1|  PREDICTED: probable xyloglucan endotransgluc...    384   4e-128   
ref|XP_009356637.1|  PREDICTED: brassinosteroid-regulated protein...    383   1e-127   
ref|XP_011082924.1|  PREDICTED: xyloglucan endotransglucosylase/h...    382   2e-127   
ref|XP_009356635.1|  PREDICTED: probable xyloglucan endotransgluc...    381   3e-127   
gb|EYU31576.1|  hypothetical protein MIMGU_mgv1a011220mg                381   4e-127   
emb|CDP15955.1|  unnamed protein product                                380   1e-126   
gb|AAR37363.1|  xyloglucan endo-transglycosylase                        379   1e-126   Nicotiana attenuata
ref|XP_004303859.1|  PREDICTED: probable xyloglucan endotransgluc...    380   1e-126   
ref|XP_002306736.2|  xyloglucan endo-1 family protein                   379   3e-126   Populus trichocarpa [western balsam poplar]
ref|XP_011044804.1|  PREDICTED: brassinosteroid-regulated protein...    379   6e-126   
ref|XP_011044805.1|  PREDICTED: brassinosteroid-regulated protein...    380   1e-125   
ref|XP_004303862.1|  PREDICTED: probable xyloglucan endotransgluc...    378   1e-125   
ref|XP_008229404.1|  PREDICTED: brassinosteroid-regulated protein...    376   4e-125   
gb|AFR46576.1|  xyloglucan endotransglucosylase/hydrolase 7             374   1e-124   
ref|XP_008348360.1|  PREDICTED: brassinosteroid-regulated protein...    375   1e-124   
ref|XP_011082930.1|  PREDICTED: probable xyloglucan endotransgluc...    375   1e-124   
ref|XP_009356638.1|  PREDICTED: brassinosteroid-regulated protein...    374   3e-124   
ref|XP_009377621.1|  PREDICTED: brassinosteroid-regulated protein...    374   4e-124   
ref|XP_007215791.1|  hypothetical protein PRUPE_ppa009863mg             373   6e-124   
ref|XP_006387415.1|  xyloglucan endo-1 family protein                   371   2e-123   
ref|NP_001280908.1|  brassinosteroid-regulated protein BRU1-like ...    372   3e-123   
ref|XP_007215773.1|  hypothetical protein PRUPE_ppa009608mg             370   8e-123   
ref|XP_009597028.1|  PREDICTED: brassinosteroid-regulated protein...    371   9e-123   
ref|XP_008229403.1|  PREDICTED: brassinosteroid-regulated protein...    370   1e-122   
ref|XP_008341405.1|  PREDICTED: brassinosteroid-regulated protein...    370   2e-122   
ref|XP_004293654.1|  PREDICTED: probable xyloglucan endotransgluc...    370   2e-122   
gb|KFK35964.1|  xyloglucan:xyloglucosyl transferase                     369   2e-122   
ref|XP_008229401.1|  PREDICTED: brassinosteroid-regulated protein...    369   2e-122   
gb|EPS58668.1|  hypothetical protein M569_16144                         369   3e-122   
ref|XP_009377610.1|  PREDICTED: brassinosteroid-regulated protein...    369   3e-122   
ref|XP_002520387.1|  Brassinosteroid-regulated protein BRU1 precu...    369   4e-122   Ricinus communis
ref|XP_004303860.1|  PREDICTED: probable xyloglucan endotransgluc...    369   6e-122   
ref|XP_008229400.1|  PREDICTED: brassinosteroid-regulated protein...    368   1e-121   
ref|XP_009356633.1|  PREDICTED: brassinosteroid-regulated protein...    368   1e-121   
gb|KDP33066.1|  hypothetical protein JCGZ_13603                         367   1e-121   
ref|XP_008225386.1|  PREDICTED: brassinosteroid-regulated protein...    367   1e-121   
ref|XP_007211780.1|  hypothetical protein PRUPE_ppa009685mg             367   1e-121   
gb|KHG09063.1|  Xyloglucan endotransglucosylase/hydrolase 22 -lik...    366   4e-121   
gb|EYU29581.1|  hypothetical protein MIMGU_mgv1a022262mg                365   4e-121   
ref|XP_008229405.1|  PREDICTED: brassinosteroid-regulated protein...    366   4e-121   
gb|KCW89706.1|  hypothetical protein EUGRSUZ_A01968                     367   8e-121   
ref|XP_011016785.1|  PREDICTED: probable xyloglucan endotransgluc...    365   8e-121   
ref|XP_010053265.1|  PREDICTED: probable xyloglucan endotransgluc...    365   9e-121   
ref|XP_002520388.1|  Brassinosteroid-regulated protein BRU1 precu...    365   1e-120   Ricinus communis
gb|EYU29580.1|  hypothetical protein MIMGU_mgv1a018934mg                364   1e-120   
ref|XP_002302146.2|  xyloglucan endo-1 family protein                   365   1e-120   Populus trichocarpa [western balsam poplar]
gb|KDP35747.1|  hypothetical protein JCGZ_10519                         364   1e-120   
ref|XP_007217342.1|  hypothetical protein PRUPE_ppa020825mg             364   1e-120   
ref|XP_010450105.1|  PREDICTED: probable xyloglucan endotransgluc...    363   4e-120   
ref|XP_011026280.1|  PREDICTED: probable xyloglucan endotransgluc...    363   5e-120   
ref|XP_002883457.1|  hypothetical protein ARALYDRAFT_479888             363   7e-120   
ref|XP_010246961.1|  PREDICTED: brassinosteroid-regulated protein...    363   9e-120   
ref|XP_006298237.1|  hypothetical protein CARUB_v10014298mg             363   9e-120   
ref|XP_007025220.1|  Xyloglucan endotransglucosylase/hydrolase 16       363   9e-120   
gb|KHF98175.1|  putative xyloglucan endotransglucosylase/hydrolas...    363   1e-119   
ref|XP_009108100.1|  PREDICTED: probable xyloglucan endotransgluc...    363   1e-119   
ref|XP_010435185.1|  PREDICTED: probable xyloglucan endotransgluc...    363   1e-119   
ref|XP_002268708.1|  PREDICTED: brassinosteroid-regulated protein...    362   2e-119   Vitis vinifera
ref|NP_566738.1|  xyloglucan endotransglucosylase/hydrolase prote...    361   3e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010525736.1|  PREDICTED: xyloglucan endotransglucosylase/h...    361   5e-119   
ref|XP_010440528.1|  PREDICTED: probable xyloglucan endotransgluc...    361   5e-119   
ref|XP_010512813.1|  PREDICTED: probable xyloglucan endotransgluc...    361   5e-119   
gb|KFK24577.1|  hypothetical protein AALP_AAs45078U000600               360   7e-119   
ref|XP_010536006.1|  PREDICTED: xyloglucan endotransglucosylase/h...    360   7e-119   
ref|XP_007034180.1|  Xyloglucan endotransglucosylase/hydrolase 16       360   7e-119   
ref|XP_008229402.1|  PREDICTED: brassinosteroid-regulated protein...    360   8e-119   
gb|AFR46575.1|  xyloglucan endotransglucosylase/hydrolase 6             360   8e-119   
ref|XP_007217276.1|  hypothetical protein PRUPE_ppa017487mg             359   9e-119   
ref|XP_010466730.1|  PREDICTED: probable xyloglucan endotransgluc...    360   1e-118   
ref|XP_010677921.1|  PREDICTED: probable xyloglucan endotransgluc...    360   1e-118   
emb|CDY27126.1|  BnaA08g07640D                                          360   1e-118   
ref|XP_009102589.1|  PREDICTED: probable xyloglucan endotransgluc...    360   1e-118   
ref|XP_007215793.1|  hypothetical protein PRUPE_ppa009871mg             359   2e-118   
ref|XP_010677922.1|  PREDICTED: probable xyloglucan endotransgluc...    359   2e-118   
ref|XP_006280918.1|  hypothetical protein CARUB_v10026914mg             358   3e-118   
ref|XP_008449516.1|  PREDICTED: brassinosteroid-regulated protein...    358   4e-118   
ref|NP_200564.1|  xyloglucan endotransglucosylase/hydrolase prote...    358   5e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006284242.1|  hypothetical protein CARUB_v10005405mg             358   6e-118   
ref|XP_009120272.1|  PREDICTED: xyloglucan endotransglucosylase/h...    358   6e-118   
ref|XP_002868312.1|  hypothetical protein ARALYDRAFT_493497             358   6e-118   
gb|AAM61021.1|  xyloglucan endotransglycosylase, putative               358   6e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010452475.1|  PREDICTED: xyloglucan endotransglucosylase/h...    357   9e-118   
ref|XP_010443442.1|  PREDICTED: xyloglucan endotransglucosylase/h...    357   1e-117   
gb|AGI42452.1|  xyloglucan endotransglycosylase/hydrolase               357   1e-117   
ref|XP_006401194.1|  hypothetical protein EUTSA_v10014326mg             357   1e-117   
ref|NP_193149.2|  probable xyloglucan endotransglucosylase/hydrol...    357   1e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004140250.1|  PREDICTED: probable xyloglucan endotransgluc...    357   1e-117   
ref|XP_010488450.1|  PREDICTED: probable xyloglucan endotransgluc...    357   1e-117   
ref|XP_010532726.1|  PREDICTED: probable xyloglucan endotransgluc...    357   2e-117   
ref|XP_002866213.1|  hypothetical protein ARALYDRAFT_918931             357   2e-117   
ref|XP_004164863.1|  PREDICTED: brassinosteroid-regulated protein...    357   2e-117   
gb|KDP36434.1|  hypothetical protein JCGZ_08703                         357   2e-117   
gb|KGN47997.1|  hypothetical protein Csa_6G423390                       357   2e-117   
ref|XP_009120273.1|  PREDICTED: xyloglucan endotransglucosylase/h...    356   2e-117   
gb|KFK27295.1|  hypothetical protein AALP_AA8G363900                    356   3e-117   
ref|XP_006414798.1|  hypothetical protein EUTSA_v10025705mg             358   3e-117   
gb|AFP93557.1|  xyloglucan endotransglycosylase/hydrolase 1             356   4e-117   
ref|XP_002526229.1|  conserved hypothetical protein                     356   4e-117   Ricinus communis
gb|AGI42451.1|  xyloglucan endotransglycosylase/hydrolase               356   4e-117   
gb|AGI42449.1|  xyloglucan endotransglycosylase/hydrolase               355   5e-117   
ref|XP_010525737.1|  PREDICTED: xyloglucan endotransglucosylase/h...    355   5e-117   
ref|XP_004140252.1|  PREDICTED: brassinosteroid-regulated protein...    355   6e-117   
gb|AGI42460.1|  xyloglucan endotransglycosylase/hydrolase               355   6e-117   
ref|XP_010259800.1|  PREDICTED: probable xyloglucan endotransgluc...    357   7e-117   
ref|XP_011016106.1|  PREDICTED: brassinosteroid-regulated protein...    355   7e-117   
ref|XP_009360814.1|  PREDICTED: brassinosteroid-regulated protein...    355   7e-117   
gb|AGI42456.1|  xyloglucan endotransglycosylase/hydrolase               355   7e-117   
ref|XP_004164865.1|  PREDICTED: brassinosteroid-regulated protein...    355   8e-117   
gb|AEX07596.1|  xyloglucosyl transferase 1                              355   8e-117   
ref|XP_002324480.1|  xyloglucan endo-1 family protein                   355   1e-116   Populus trichocarpa [western balsam poplar]
ref|XP_010023598.1|  PREDICTED: brassinosteroid-regulated protein...    355   1e-116   
ref|XP_004164862.1|  PREDICTED: brassinosteroid-regulated protein...    355   1e-116   
ref|NP_001284443.1|  probable xyloglucan endotransglucosylase/hyd...    355   1e-116   
ref|XP_006412727.1|  hypothetical protein EUTSA_v10025941mg             354   1e-116   
emb|CAB10192.1|  xyloglucan endotransglycosylase-related protein ...    355   1e-116   Arabidopsis thaliana [mouse-ear cress]
gb|KFK27294.1|  hypothetical protein AALP_AA8G363800                    354   2e-116   
ref|XP_010053241.1|  PREDICTED: brassinosteroid-regulated protein...    354   2e-116   
ref|XP_006474161.1|  PREDICTED: probable xyloglucan endotransgluc...    354   2e-116   
ref|XP_011018193.1|  PREDICTED: probable xyloglucan endotransgluc...    354   2e-116   
ref|XP_007014165.1|  Xyloglucan endotransglucosylase/hydrolase fa...    354   2e-116   
ref|XP_007048840.1|  Xyloglucan endotransglucosylase/hydrolase 15       354   2e-116   
gb|AGI42450.1|  xyloglucan endotransglycosylase/hydrolase               354   2e-116   
gb|AGI42458.1|  xyloglucan endotransglycosylase/hydrolase               354   2e-116   
gb|KCW89704.1|  hypothetical protein EUGRSUZ_A01966                     353   3e-116   
ref|XP_010927058.1|  PREDICTED: probable xyloglucan endotransgluc...    354   3e-116   
gb|AGI42454.1|  xyloglucan endotransglycosylase/hydrolase               353   3e-116   
ref|XP_002526228.1|  Xyloglucan endotransglucosylase/hydrolase pr...    353   3e-116   Ricinus communis
ref|XP_011043999.1|  PREDICTED: probable xyloglucan endotransgluc...    353   4e-116   
ref|XP_008449531.1|  PREDICTED: brassinosteroid-regulated protein...    353   4e-116   
ref|XP_002321087.1|  brassinosteroid-regulated family protein           353   4e-116   Populus trichocarpa [western balsam poplar]
gb|AGI42461.1|  xyloglucan endotransglycosylase/hydrolase               353   5e-116   
ref|XP_011043998.1|  PREDICTED: probable xyloglucan endotransgluc...    353   5e-116   
gb|EYU37336.1|  hypothetical protein MIMGU_mgv1a021219mg                352   6e-116   
ref|XP_007035759.1|  Xyloglucan endotransglucosylase/hydrolase fa...    353   7e-116   
emb|CDX68640.1|  BnaC01g08130D                                          352   7e-116   
gb|AGI42459.1|  xyloglucan endotransglycosylase/hydrolase               353   7e-116   
gb|KGN47998.1|  hypothetical protein Csa_6G423400                       352   9e-116   
ref|NP_001284418.1|  brassinosteroid-regulated protein BRU1-like ...    352   9e-116   
ref|XP_010243150.1|  PREDICTED: brassinosteroid-regulated protein...    352   9e-116   
emb|CCH26408.1|  xyloglucan endotransglycosylase                        352   1e-115   
ref|XP_011044000.1|  PREDICTED: probable xyloglucan endotransgluc...    352   1e-115   
ref|XP_003610142.1|  Xyloglucan endotransglucosylase/hydrolase          352   1e-115   
ref|XP_009121735.1|  PREDICTED: probable xyloglucan endotransgluc...    352   1e-115   
ref|XP_002317310.1|  xyloglucan endo-1 family protein                   352   2e-115   Populus trichocarpa [western balsam poplar]
ref|XP_008449536.1|  PREDICTED: brassinosteroid-regulated protein...    352   2e-115   
gb|AAF80591.1|AF223420_1  xyloglucan endotransglycosylase XET2          351   2e-115   Asparagus officinalis
ref|XP_011024784.1|  PREDICTED: brassinosteroid-regulated protein...    352   2e-115   
ref|XP_010536923.1|  PREDICTED: probable xyloglucan endotransgluc...    351   2e-115   
gb|EYU41110.1|  hypothetical protein MIMGU_mgv1a011456mg                351   3e-115   
gb|ABM91071.1|  xyloglucan endotransglycosylase/hydrolase precurs...    351   3e-115   Populus tremula x Populus tremuloides
ref|XP_008449534.1|  PREDICTED: brassinosteroid-regulated protein...    351   3e-115   
ref|XP_010259798.1|  PREDICTED: probable xyloglucan endotransgluc...    351   4e-115   
ref|XP_002324481.2|  xyloglucan endo-1 family protein                   351   4e-115   Populus trichocarpa [western balsam poplar]
ref|XP_002301752.1|  brassinosteroid-regulated family protein           351   4e-115   Populus trichocarpa [western balsam poplar]
ref|XP_009127941.1|  PREDICTED: xyloglucan endotransglucosylase/h...    350   5e-115   
ref|XP_010927056.1|  PREDICTED: probable xyloglucan endotransgluc...    350   5e-115   
ref|XP_010259803.1|  PREDICTED: probable xyloglucan endotransgluc...    351   6e-115   
ref|NP_001267702.1|  probable xyloglucan endotransglucosylase/hyd...    350   6e-115   
ref|XP_006453421.1|  hypothetical protein CICLE_v10009118mg             350   7e-115   
ref|XP_006453414.1|  hypothetical protein CICLE_v10009119mg             350   7e-115   
gb|ABM91075.1|  xyloglucan endotransglycosylase/hydrolase precurs...    350   9e-115   Populus tremula x Populus tremuloides
ref|XP_002270973.2|  PREDICTED: brassinosteroid-regulated protein...    350   1e-114   Vitis vinifera
gb|EYU29579.1|  hypothetical protein MIMGU_mgv1a018742mg                349   1e-114   
gb|KDO46534.1|  hypothetical protein CISIN_1g023431mg                   349   1e-114   
ref|XP_008801408.1|  PREDICTED: probable xyloglucan endotransgluc...    349   1e-114   
ref|XP_006453413.1|  hypothetical protein CICLE_v10008951mg             350   1e-114   
gb|AFK47205.1|  unknown                                                 349   1e-114   
ref|XP_011045332.1|  PREDICTED: brassinosteroid-regulated protein...    349   2e-114   
ref|XP_006474159.1|  PREDICTED: xyloglucan endotransglucosylase/h...    349   2e-114   
ref|XP_002273742.2|  PREDICTED: probable xyloglucan endotransgluc...    349   2e-114   Vitis vinifera
ref|NP_194311.1|  probable xyloglucan endotransglucosylase/hydrol...    349   2e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011026281.1|  PREDICTED: brassinosteroid-regulated protein...    349   2e-114   
gb|AEQ37175.1|  xyloglucan endotransglucosylase/hydrolase               348   3e-114   
ref|XP_009356706.1|  PREDICTED: xyloglucan endotransglucosylase/h...    348   3e-114   
ref|XP_010525738.1|  PREDICTED: xyloglucan endotransglucosylase/h...    348   3e-114   
gb|AEX07595.1|  xyloglucosyl transferase 2                              347   4e-114   
ref|XP_006413268.1|  hypothetical protein EUTSA_v10025720mg             350   4e-114   
gb|KHN22714.1|  Putative xyloglucan endotransglucosylase/hydrolas...    348   4e-114   
ref|XP_010545425.1|  PREDICTED: probable xyloglucan endotransgluc...    348   5e-114   
ref|NP_001242530.1|  uncharacterized protein LOC100785313 precursor     348   5e-114   
ref|XP_002869654.1|  hypothetical protein ARALYDRAFT_354208             348   5e-114   
ref|XP_003601713.1|  Xyloglucan endotransglycosylase/hydrolase XT...    348   5e-114   
ref|XP_004293370.1|  PREDICTED: probable xyloglucan endotransgluc...    348   5e-114   
ref|XP_008362366.1|  PREDICTED: LOW QUALITY PROTEIN: xyloglucan e...    348   5e-114   
gb|AII99393.1|  xyloglucan endotransglucosylase/hydrolase2              348   5e-114   
gb|KHN22712.1|  Putative xyloglucan endotransglucosylase/hydrolas...    348   5e-114   
dbj|BAJ10423.1|  xyloglucan endotransglucosylase/hydrolase              348   6e-114   
ref|XP_009378317.1|  PREDICTED: xyloglucan endotransglucosylase/h...    348   6e-114   
ref|XP_003601714.1|  Xyloglucan endotransglycosylase/hydrolase XT...    348   6e-114   
ref|XP_006474154.1|  PREDICTED: probable xyloglucan endotransgluc...    348   6e-114   
ref|XP_010259797.1|  PREDICTED: xyloglucan endotransglucosylase/h...    348   7e-114   
gb|AII99392.1|  xyloglucan endotransglucosylase/hydrolase2              347   7e-114   
ref|XP_007014172.1|  Xyloglucan endotransglucosylase/hydrolase fa...    347   8e-114   
gb|AAL32550.1|  xyloglucan endo-1, 4-beta-D-glucanase (XTR-6)           347   8e-114   Arabidopsis thaliana [mouse-ear cress]
gb|ACD03218.1|  xyloglucan endotransglucosylase/hydrolase 8             347   9e-114   Actinidia deliciosa [Chinese gooseberry]
ref|XP_006474158.1|  PREDICTED: xyloglucan endotransglucosylase/h...    347   9e-114   
ref|XP_010668001.1|  PREDICTED: probable xyloglucan endotransgluc...    347   1e-113   
ref|XP_011082931.1|  PREDICTED: probable xyloglucan endotransgluc...    347   1e-113   
ref|XP_010656826.1|  PREDICTED: probable xyloglucan endotransgluc...    347   1e-113   
ref|XP_006387118.1|  hypothetical protein POPTR_1795s00200g             344   2e-113   
ref|XP_010259802.1|  PREDICTED: probable xyloglucan endotransgluc...    347   2e-113   
ref|XP_002325068.2|  hypothetical protein POPTR_0018s10300g             347   2e-113   Populus trichocarpa [western balsam poplar]
ref|XP_006474156.1|  PREDICTED: probable xyloglucan endotransgluc...    346   2e-113   
ref|XP_008380219.1|  PREDICTED: xyloglucan endotransglucosylase/h...    346   3e-113   
ref|XP_009108993.1|  PREDICTED: xyloglucan endotransglucosylase/h...    346   3e-113   
gb|AFR46580.2|  xyloglucan endotransglucosylase/hydrolase 12            346   3e-113   
ref|NP_001281042.1|  probable xyloglucan endotransglucosylase/hyd...    346   3e-113   
ref|XP_011006106.1|  PREDICTED: brassinosteroid-regulated protein...    345   3e-113   
ref|XP_003542166.1|  PREDICTED: xyloglucan endotransglucosylase/h...    346   4e-113   
ref|XP_011038986.1|  PREDICTED: probable xyloglucan endotransgluc...    346   4e-113   
ref|XP_003610153.1|  Xyloglucan endotransglucosylase/hydrolase          346   4e-113   
ref|XP_002274601.1|  PREDICTED: probable xyloglucan endotransgluc...    346   4e-113   Vitis vinifera
ref|XP_010259807.1|  PREDICTED: probable xyloglucan endotransgluc...    346   4e-113   
ref|XP_011082928.1|  PREDICTED: probable xyloglucan endotransgluc...    345   4e-113   
gb|AFK40376.1|  unknown                                                 346   5e-113   
ref|XP_002307040.2|  xyloglucan endo-1 family protein                   345   5e-113   Populus trichocarpa [western balsam poplar]
ref|XP_002267890.2|  PREDICTED: brassinosteroid-regulated protein...    345   6e-113   Vitis vinifera
ref|XP_007014171.1|  Xyloglucan endotransglucosylase/hydrolase fa...    345   6e-113   
ref|XP_010536922.1|  PREDICTED: probable xyloglucan endotransgluc...    345   6e-113   
ref|XP_009401564.1|  PREDICTED: probable xyloglucan endotransgluc...    345   7e-113   
ref|NP_001289204.1|  probable xyloglucan endotransglucosylase/hyd...    345   8e-113   
ref|XP_002274858.1|  PREDICTED: xyloglucan endotransglucosylase/h...    345   8e-113   Vitis vinifera
ref|XP_009373581.1|  PREDICTED: brassinosteroid-regulated protein...    344   8e-113   
emb|CAA63663.1|  xyloglucan endotransglycosylase (XET)                  345   9e-113   Hordeum vulgare [barley]
ref|XP_007159516.1|  hypothetical protein PHAVU_002G244000g             345   9e-113   
ref|XP_010927057.1|  PREDICTED: probable xyloglucan endotransgluc...    344   1e-112   
ref|XP_006412723.1|  hypothetical protein EUTSA_v10025933mg             344   1e-112   
ref|XP_008801540.1|  PREDICTED: probable xyloglucan endotransgluc...    344   1e-112   
ref|XP_009628113.1|  PREDICTED: brassinosteroid-regulated protein...    344   1e-112   
gb|AFK33537.1|  unknown                                                 344   1e-112   
ref|XP_009765042.1|  PREDICTED: brassinosteroid-regulated protein...    344   1e-112   
ref|XP_006453420.1|  hypothetical protein CICLE_v10008778mg             347   2e-112   
gb|KHN17579.1|  Putative xyloglucan endotransglucosylase/hydrolas...    344   2e-112   
ref|XP_008223658.1|  PREDICTED: probable xyloglucan endotransgluc...    343   2e-112   
ref|XP_006425209.1|  hypothetical protein CICLE_v10010858mg             343   2e-112   
emb|CDY61576.1|  BnaCnng38050D                                          343   3e-112   
ref|XP_008796499.1|  PREDICTED: xyloglucan endotransglucosylase/h...    343   3e-112   
ref|XP_002270416.1|  PREDICTED: probable xyloglucan endotransgluc...    344   3e-112   Vitis vinifera
ref|XP_006474155.1|  PREDICTED: probable xyloglucan endotransgluc...    343   3e-112   
gb|ABM91073.1|  xyloglucan endotransglycosylase/hydrolase precurs...    343   3e-112   Populus tremula x Populus tremuloides
ref|XP_010442224.1|  PREDICTED: xyloglucan endotransglucosylase/h...    343   3e-112   
ref|XP_006284247.1|  hypothetical protein CARUB_v10005412mg             343   4e-112   
ref|XP_010911439.1|  PREDICTED: probable xyloglucan endotransgluc...    343   4e-112   
ref|XP_007014173.1|  Xyloglucan endotransglycosylase 6                  343   4e-112   
ref|XP_010482054.1|  PREDICTED: xyloglucan endotransglucosylase/h...    343   4e-112   
ref|XP_010439278.1|  PREDICTED: xyloglucan endotransglucosylase/h...    343   4e-112   
ref|XP_003549488.1|  PREDICTED: probable xyloglucan endotransgluc...    343   5e-112   
emb|CAN74784.1|  hypothetical protein VITISV_032594                     343   5e-112   Vitis vinifera
ref|XP_009413334.1|  PREDICTED: xyloglucan endotransglucosylase/h...    343   5e-112   
ref|XP_007223211.1|  hypothetical protein PRUPE_ppa009346mg             343   5e-112   
ref|XP_010046997.1|  PREDICTED: probable xyloglucan endotransgluc...    343   5e-112   
gb|AEL33281.1|  brassinosteroid-regulated protein                       343   5e-112   
ref|NP_199618.1|  xyloglucan endotransglucosylase/hydrolase prote...    343   5e-112   
gb|EYU20918.1|  hypothetical protein MIMGU_mgv1a011123mg                343   6e-112   
emb|CAN80250.1|  hypothetical protein VITISV_036640                     343   6e-112   
ref|XP_009798276.1|  PREDICTED: xyloglucan endotransglucosylase/h...    343   6e-112   
gb|ADV41673.1|  endo-xyloglucan transferase                             343   6e-112   
ref|XP_010448365.1|  PREDICTED: probable xyloglucan endotransgluc...    343   6e-112   
dbj|BAE06063.1|  xyloglucan endotransglucosylase/hydrolase              343   6e-112   
gb|AAT94297.1|  endotransglucosylase/hydrolase XTH5                     342   7e-112   
gb|EMT27816.1|  Putative xyloglucan endotransglucosylase/hydrolas...    342   7e-112   
ref|XP_010042670.1|  PREDICTED: brassinosteroid-regulated protein...    342   7e-112   
ref|XP_010046992.1|  PREDICTED: probable xyloglucan endotransgluc...    343   7e-112   
ref|XP_003524918.1|  PREDICTED: brassinosteroid-regulated protein...    342   8e-112   
ref|XP_008801539.1|  PREDICTED: probable xyloglucan endotransgluc...    342   9e-112   
gb|KHN06450.1|  Putative xyloglucan endotransglucosylase/hydrolas...    342   9e-112   
ref|XP_003524219.1|  PREDICTED: probable xyloglucan endotransgluc...    342   9e-112   
ref|XP_002274552.1|  PREDICTED: probable xyloglucan endotransgluc...    342   9e-112   
gb|KDP36436.1|  hypothetical protein JCGZ_08705                         342   1e-111   
ref|XP_010670335.1|  PREDICTED: probable xyloglucan endotransgluc...    342   1e-111   
ref|XP_004298224.1|  PREDICTED: brassinosteroid-regulated protein...    345   2e-111   
ref|XP_007154784.1|  hypothetical protein PHAVU_003G147700g             342   2e-111   
gb|KHG05436.1|  putative xyloglucan endotransglucosylase/hydrolas...    342   2e-111   
gb|KDO46535.1|  hypothetical protein CISIN_1g023581mg                   341   2e-111   
emb|CAN80252.1|  hypothetical protein VITISV_036642                     341   2e-111   
gb|KDP36435.1|  hypothetical protein JCGZ_08704                         341   2e-111   
ref|XP_010676725.1|  PREDICTED: probable xyloglucan endotransgluc...    341   2e-111   
dbj|BAO57276.1|  xyloglucan endotransglucosylase/hydrolase              341   2e-111   
ref|XP_002519768.1|  Brassinosteroid-regulated protein BRU1 precu...    341   2e-111   
ref|XP_011043991.1|  PREDICTED: xyloglucan endotransglucosylase/h...    341   3e-111   
ref|XP_004507836.1|  PREDICTED: probable xyloglucan endotransgluc...    341   3e-111   
gb|ABE11608.1|  xyloglucan endo-transglycosylase precursor              340   3e-111   
ref|XP_002863854.1|  ATXTH20                                            341   3e-111   
ref|NP_001267579.1|  probable xyloglucan endotransglucosylase/hyd...    341   3e-111   
ref|XP_011007580.1|  PREDICTED: probable xyloglucan endotransgluc...    341   3e-111   
gb|KDP36430.1|  hypothetical protein JCGZ_08699                         341   3e-111   
ref|XP_010047002.1|  PREDICTED: probable xyloglucan endotransgluc...    341   3e-111   
ref|XP_009417169.1|  PREDICTED: probable xyloglucan endotransgluc...    340   3e-111   
ref|XP_002318936.2|  putative xyloglucan endotransglycosylase fam...    342   4e-111   
ref|XP_011007582.1|  PREDICTED: probable xyloglucan endotransgluc...    340   4e-111   
gb|ACD03232.1|  xyloglucan endotransglucosylase/hydrolase 8             340   4e-111   
ref|XP_008229406.1|  PREDICTED: probable xyloglucan endotransgluc...    340   4e-111   
gb|AGT29357.1|  xyloglucan endotransglucosylase/hydrolase 7             340   5e-111   
ref|XP_010095128.1|  putative xyloglucan endotransglucosylase/hyd...    352   5e-111   
ref|XP_010670334.1|  PREDICTED: probable xyloglucan endotransgluc...    340   5e-111   
ref|XP_010046996.1|  PREDICTED: probable xyloglucan endotransgluc...    340   6e-111   
ref|XP_006656424.1|  PREDICTED: xyloglucan endotransglucosylase/h...    340   7e-111   
ref|XP_008453618.1|  PREDICTED: probable xyloglucan endotransgluc...    342   7e-111   
ref|XP_002526224.1|  Xyloglucan endotransglucosylase/hydrolase pr...    340   7e-111   
ref|XP_007163801.1|  hypothetical protein PHAVU_001G265300g             340   7e-111   
ref|XP_009381589.1|  PREDICTED: xyloglucan endotransglucosylase/h...    340   8e-111   
gb|ABK30789.1|  xyloglucan endotransglycosylase 3                       339   8e-111   
gb|ABP04059.1|  xyloglucan endo-transglucosylase/hydrolase 1            340   8e-111   
ref|XP_010932220.1|  PREDICTED: xyloglucan endotransglucosylase/h...    339   8e-111   
gb|ACU23820.1|  unknown                                                 340   8e-111   
ref|XP_009394877.1|  PREDICTED: probable xyloglucan endotransgluc...    340   9e-111   
ref|XP_004507835.1|  PREDICTED: probable xyloglucan endotransgluc...    340   1e-110   
ref|XP_004507837.1|  PREDICTED: probable xyloglucan endotransgluc...    339   1e-110   
ref|XP_010259808.1|  PREDICTED: xyloglucan endotransglucosylase/h...    340   1e-110   
ref|XP_004247897.1|  PREDICTED: brassinosteroid-regulated protein...    339   1e-110   
gb|EYU29578.1|  hypothetical protein MIMGU_mgv1a011198mg                339   2e-110   
ref|XP_003563483.1|  PREDICTED: xyloglucan endotransglucosylase/h...    339   2e-110   
ref|XP_006358761.1|  PREDICTED: brassinosteroid-regulated protein...    338   2e-110   
ref|XP_002302145.2|  hypothetical protein POPTR_0002s06120g             342   2e-110   
ref|XP_010046998.1|  PREDICTED: probable xyloglucan endotransgluc...    339   2e-110   
gb|AAQ82628.1|  xyloglucan endotransglucosylase                         338   2e-110   
ref|XP_003625289.1|  Xyloglucan endotransglucosylase/hydrolase          338   2e-110   
ref|XP_010046993.1|  PREDICTED: probable xyloglucan endotransgluc...    339   2e-110   
gb|ABV46534.1|  xyloglucan endotransglucosylase hydrolase 2             338   2e-110   
ref|XP_007014183.1|  Xyloglucan endotransglycosylase 6                  339   2e-110   
gb|ABL10090.1|  xyloglucan endotransglycosylase                         338   3e-110   
ref|XP_006360667.1|  PREDICTED: probable xyloglucan endotransgluc...    338   3e-110   
emb|CAA10231.1|  xyloglucan endotransglycosylase 1                      338   3e-110   
ref|XP_009343827.1|  PREDICTED: brassinosteroid-regulated protein...    338   3e-110   
ref|XP_010929301.1|  PREDICTED: xyloglucan endotransglucosylase/h...    338   3e-110   
ref|XP_006381821.1|  xyloglucan endo-1 family protein                   338   3e-110   
ref|XP_011069896.1|  PREDICTED: probable xyloglucan endotransgluc...    338   4e-110   
gb|KHG10045.1|  Xyloglucan endotransglucosylase/hydrolase 22 -lik...    338   4e-110   
gb|KHN44468.1|  Brassinosteroid-regulated protein BRU1                  337   4e-110   
ref|XP_002274827.1|  PREDICTED: probable xyloglucan endotransgluc...    338   4e-110   
gb|KFK29589.1|  hypothetical protein AALP_AA7G154000                    337   5e-110   
ref|XP_008799439.1|  PREDICTED: probable xyloglucan endotransgluc...    338   5e-110   
gb|KCW78734.1|  hypothetical protein EUGRSUZ_C00178                     340   5e-110   
ref|XP_010103020.1|  Xyloglucan endotransglucosylase/hydrolase pr...    337   6e-110   
ref|XP_006279674.1|  hypothetical protein CARUB_v10026912mg             337   7e-110   
ref|XP_010690581.1|  PREDICTED: probable xyloglucan endotransgluc...    337   7e-110   
ref|XP_009139558.1|  PREDICTED: probable xyloglucan endotransgluc...    337   7e-110   
gb|KCW78732.1|  hypothetical protein EUGRSUZ_C00176                     342   1e-109   
ref|XP_003552612.1|  PREDICTED: brassinosteroid-regulated protein...    336   1e-109   
gb|EYU25733.1|  hypothetical protein MIMGU_mgv1a011641mg                336   1e-109   
ref|XP_010545428.1|  PREDICTED: xyloglucan endotransglucosylase/h...    337   1e-109   
ref|XP_010433588.1|  PREDICTED: probable xyloglucan endotransgluc...    337   1e-109   
emb|CDP02962.1|  unnamed protein product                                337   1e-109   
emb|CDX94413.1|  BnaC01g17710D                                          337   1e-109   
ref|XP_008799438.1|  PREDICTED: probable xyloglucan endotransgluc...    336   1e-109   
ref|XP_009793860.1|  PREDICTED: probable xyloglucan endotransgluc...    336   2e-109   
ref|XP_010927060.1|  PREDICTED: brassinosteroid-regulated protein...    337   2e-109   
ref|XP_010103015.1|  putative xyloglucan endotransglucosylase/hyd...    336   2e-109   
ref|NP_001276167.1|  uncharacterized protein LOC100784191 precursor     336   2e-109   
ref|XP_009609044.1|  PREDICTED: probable xyloglucan endotransgluc...    336   2e-109   
ref|XP_003542156.1|  PREDICTED: probable xyloglucan endotransgluc...    336   2e-109   
gb|AFK33604.1|  unknown                                                 336   2e-109   
ref|XP_010047000.1|  PREDICTED: probable xyloglucan endotransgluc...    336   2e-109   
ref|XP_009390494.1|  PREDICTED: probable xyloglucan endotransgluc...    335   3e-109   
emb|CAN83588.1|  hypothetical protein VITISV_004806                     335   3e-109   
ref|XP_004966141.1|  PREDICTED: xyloglucan endotransglucosylase/h...    336   3e-109   
ref|XP_009137907.1|  PREDICTED: xyloglucan endotransglucosylase/h...    335   3e-109   
ref|XP_007154781.1|  hypothetical protein PHAVU_003G147400g             335   3e-109   
emb|CDX72228.1|  BnaC07g42500D                                          335   3e-109   
dbj|BAD53910.1|  putative xyloglucan endotransglycosylase               336   4e-109   
dbj|BAH36875.1|  xyloglucan endotransglucosylase/hydrolase              335   4e-109   
gb|ABD98046.1|  xyloglucan endotransglycosylase                         335   4e-109   
ref|XP_010103016.1|  putative xyloglucan endotransglucosylase/hyd...    335   4e-109   
ref|XP_002262761.1|  PREDICTED: brassinosteroid-regulated protein...    335   4e-109   
ref|XP_003532776.1|  PREDICTED: probable xyloglucan endotransgluc...    335   5e-109   
ref|XP_002270182.2|  PREDICTED: probable xyloglucan endotransgluc...    338   5e-109   
ref|XP_008380453.1|  PREDICTED: brassinosteroid-regulated protein...    335   5e-109   
gb|KHN22640.1|  Putative xyloglucan endotransglucosylase/hydrolas...    335   6e-109   
ref|XP_009759293.1|  PREDICTED: xyloglucan endotransglucosylase/h...    334   6e-109   
gb|KDP21183.1|  hypothetical protein JCGZ_21654                         335   6e-109   
dbj|BAJ10395.1|  xyloglucan endotransglucosylase/hydrolase              335   8e-109   
ref|XP_002267838.1|  PREDICTED: brassinosteroid-regulated protein...    334   9e-109   
ref|XP_011023833.1|  PREDICTED: probable xyloglucan endotransgluc...    335   1e-108   
ref|XP_003630685.1|  Xyloglucan endotransglycosylase                    333   1e-108   
gb|KHG09882.1|  Xyloglucan endotransglucosylase/hydrolase 22 -lik...    334   1e-108   
gb|KFK29591.1|  hypothetical protein AALP_AA7G154200                    334   1e-108   
ref|NP_001237075.1|  syringolide-induced protein 19-1-5 precursor       334   1e-108   
gb|KDP32580.1|  hypothetical protein JCGZ_13130                         333   1e-108   
ref|XP_002270299.1|  PREDICTED: probable xyloglucan endotransgluc...    334   1e-108   
ref|XP_010673331.1|  PREDICTED: brassinosteroid-regulated protein...    335   2e-108   
ref|XP_004235156.1|  PREDICTED: probable xyloglucan endotransgluc...    334   2e-108   
ref|XP_010241684.1|  PREDICTED: probable xyloglucan endotransgluc...    333   2e-108   
ref|XP_002266082.1|  PREDICTED: brassinosteroid-regulated protein...    333   2e-108   
ref|NP_001151103.1|  xyloglucan endotransglucosylase/hydrolase pr...    334   2e-108   
ref|XP_010667998.1|  PREDICTED: probable xyloglucan endotransgluc...    333   2e-108   
gb|KEH20644.1|  xyloglucan endotransglucosylase/hydrolase family ...    333   2e-108   
ref|XP_002325067.2|  hypothetical protein POPTR_0018s10290g             333   2e-108   
ref|NP_001242489.1|  uncharacterized protein LOC100807063 precursor     333   2e-108   
ref|XP_004966138.1|  PREDICTED: probable xyloglucan endotransgluc...    333   3e-108   
ref|NP_001238152.1|  xyloglucan endotransglucosylase/hydrolase 2 ...    333   3e-108   
ref|XP_011069899.1|  PREDICTED: probable xyloglucan endotransgluc...    333   3e-108   
ref|XP_009417487.1|  PREDICTED: probable xyloglucan endotransgluc...    332   4e-108   
ref|XP_007221284.1|  hypothetical protein PRUPE_ppa009792mg             332   4e-108   
ref|XP_003610008.1|  Xyloglucan endotransglucosylase/hydrolase          333   4e-108   
gb|AIJ10712.1|  xyloglucan endotransglucosylase/hydrolase 3             333   5e-108   
ref|XP_004299791.1|  PREDICTED: probable xyloglucan endotransgluc...    333   5e-108   
ref|XP_006358262.1|  PREDICTED: probable xyloglucan endotransgluc...    333   5e-108   
ref|NP_001234472.1|  xyloglucan endotransglucosylase-hydrolase XT...    333   5e-108   
gb|EYU38970.1|  hypothetical protein MIMGU_mgv1a011611mg                332   5e-108   
ref|XP_009798277.1|  PREDICTED: probable xyloglucan endotransgluc...    332   5e-108   
gb|AHB60658.1|  xyloglucan endotransglucosylase/hydrolase               333   5e-108   
ref|XP_002518632.1|  Brassinosteroid-regulated protein BRU1 precu...    332   6e-108   
ref|XP_004146309.1|  PREDICTED: xyloglucan endotransglucosylase/h...    332   6e-108   
dbj|BAH36874.1|  xyloglucan endotransglucosylase/hydrolase              332   6e-108   
ref|XP_006349901.1|  PREDICTED: brassinosteroid-regulated protein...    332   6e-108   
ref|XP_006474160.1|  PREDICTED: xyloglucan endotransglucosylase/h...    333   6e-108   
ref|NP_001058455.2|  Os06g0696400                                       331   6e-108   
ref|XP_006453405.1|  hypothetical protein CICLE_v10010151mg             333   6e-108   
ref|XP_004161045.1|  PREDICTED: xyloglucan endotransglucosylase/h...    332   7e-108   
ref|XP_004293368.1|  PREDICTED: probable xyloglucan endotransgluc...    332   7e-108   
ref|XP_007224386.1|  hypothetical protein PRUPE_ppa021675mg             333   7e-108   
gb|KHN48042.1|  Putative xyloglucan endotransglucosylase/hydrolas...    332   7e-108   
gb|KHG21666.1|  putative xyloglucan endotransglucosylase/hydrolas...    332   8e-108   
ref|XP_003549490.2|  PREDICTED: probable xyloglucan endotransgluc...    332   8e-108   
ref|XP_009344503.1|  PREDICTED: probable xyloglucan endotransgluc...    332   8e-108   
gb|AAB18364.1|  xyloglucan endotransglycosylase-related protein         332   8e-108   
ref|XP_010676747.1|  PREDICTED: probable xyloglucan endotransgluc...    332   9e-108   
gb|ACD03219.1|  xyloglucan endotransglucosylase/hydrolase 9             332   9e-108   
ref|XP_010103019.1|  putative xyloglucan endotransglucosylase/hyd...    332   9e-108   
ref|NP_568859.2|  probable xyloglucan endotransglucosylase/hydrol...    332   9e-108   
gb|ACJ84668.1|  unknown                                                 332   1e-107   
gb|KHG04746.1|  putative xyloglucan endotransglucosylase/hydrolas...    332   1e-107   
gb|AFK40018.1|  unknown                                                 332   1e-107   
ref|XP_010446167.1|  PREDICTED: probable xyloglucan endotransgluc...    331   1e-107   
ref|XP_002866212.1|  hypothetical protein ARALYDRAFT_495853             331   1e-107   
ref|XP_004235158.1|  PREDICTED: probable xyloglucan endotransgluc...    331   1e-107   
ref|XP_008222773.1|  PREDICTED: brassinosteroid-regulated protein...    331   2e-107   
ref|NP_001284442.1|  xyloglucan endotransglucosylase/hydrolase pr...    331   2e-107   
ref|XP_007014179.1|  Xyloglucan endotransglycosylase 6 isoform 1        331   2e-107   
ref|XP_009614968.1|  PREDICTED: xyloglucan endotransglucosylase/h...    331   2e-107   
ref|NP_001276139.1|  uncharacterized protein LOC102661404 precursor     331   2e-107   
ref|XP_002519767.1|  Brassinosteroid-regulated protein BRU1 precu...    330   2e-107   
ref|XP_006358261.1|  PREDICTED: probable xyloglucan endotransgluc...    331   2e-107   
ref|XP_004252976.1|  PREDICTED: brassinosteroid-regulated protein...    330   2e-107   
ref|XP_010526338.1|  PREDICTED: probable xyloglucan endotransgluc...    331   3e-107   
ref|XP_008799496.1|  PREDICTED: probable xyloglucan endotransgluc...    332   3e-107   
ref|XP_009341028.1|  PREDICTED: probable xyloglucan endotransgluc...    330   3e-107   
ref|XP_011018195.1|  PREDICTED: probable xyloglucan endotransgluc...    329   3e-107   
dbj|BAO57275.1|  xyloglucan endotransglucosylase/hydrolase              330   4e-107   
ref|XP_004242686.1|  PREDICTED: xyloglucan endotransglucosylase/h...    330   5e-107   
ref|XP_006600497.1|  PREDICTED: probable xyloglucan endotransgluc...    330   5e-107   
ref|XP_002867358.1|  meristem-5                                         329   5e-107   
ref|XP_006474633.1|  PREDICTED: probable xyloglucan endotransgluc...    330   5e-107   
ref|XP_007154667.1|  hypothetical protein PHAVU_003G137600g             330   5e-107   
ref|XP_010673363.1|  PREDICTED: brassinosteroid-regulated protein...    330   6e-107   
gb|ACU23404.1|  unknown                                                 330   7e-107   
ref|XP_009390493.1|  PREDICTED: probable xyloglucan endotransgluc...    329   7e-107   
ref|XP_010929299.1|  PREDICTED: xyloglucan endotransglucosylase/h...    330   9e-107   
gb|KDP42857.1|  hypothetical protein JCGZ_23799                         328   9e-107   
ref|XP_004240131.2|  PREDICTED: probable xyloglucan endotransgluc...    329   9e-107   
ref|XP_007015526.1|  Xyloglucan endotransglycosylase 6                  329   1e-106   
gb|AFK47685.1|  unknown                                                 329   1e-106   
ref|XP_004235157.1|  PREDICTED: probable xyloglucan endotransgluc...    329   1e-106   
ref|XP_004507927.1|  PREDICTED: probable xyloglucan endotransgluc...    329   1e-106   
ref|XP_011045330.1|  PREDICTED: brassinosteroid-regulated protein...    328   1e-106   
ref|XP_006453403.1|  hypothetical protein CICLE_v10010760mg             328   1e-106   
ref|XP_008223719.1|  PREDICTED: xyloglucan endotransglucosylase/h...    329   1e-106   
gb|AAF80590.1|AF223419_1  xyloglucan endotransglycosylase XET1          329   2e-106   
ref|XP_011070177.1|  PREDICTED: xyloglucan endotransglucosylase/h...    329   2e-106   
gb|KDO46531.1|  hypothetical protein CISIN_1g045763mg                   328   2e-106   
ref|XP_004293369.1|  PREDICTED: probable xyloglucan endotransgluc...    329   2e-106   
ref|XP_002317309.1|  xyloglucan endo-1 family protein                   328   2e-106   
ref|XP_006281550.1|  hypothetical protein CARUB_v10027651mg             328   2e-106   
ref|XP_006358259.1|  PREDICTED: probable xyloglucan endotransgluc...    328   2e-106   
gb|AFW69276.1|  xyloglucan endotransglucosylase/hydrolase protein 23    328   2e-106   
gb|EYU20916.1|  hypothetical protein MIMGU_mgv1a011962mg                328   2e-106   
ref|XP_011079307.1|  PREDICTED: probable xyloglucan endotransgluc...    329   2e-106   
ref|XP_009760620.1|  PREDICTED: probable xyloglucan endotransgluc...    328   3e-106   
gb|ACK36945.1|  xyloglucan endotransglycosylase                         328   3e-106   
ref|XP_002437518.1|  hypothetical protein SORBIDRAFT_10g028550          328   3e-106   



>ref|XP_009762863.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Nicotiana 
sylvestris]
Length=290

 Score =   425 bits (1093),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 202/303 (67%), Positives = 238/303 (79%), Gaps = 14/303 (5%)
 Frame = +2

Query  131   AGKMKKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTM  310
             A K       +C+IM I ++A S             NF  D  + +G   G++Q+ G  +
Sbjct  2     ASKFSSVMLLLCIIMSIQLLAAS-----------AGNFYRDAVITWGEGRGKIQEGGRGL  50

Query  311   ALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLG  490
             AL LD+ +GSGF +KNEYLFGRFDMQ+KLV G SAGTVTTF+L+S  G+ HDE+DFEFLG
Sbjct  51    ALTLDKLSGSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFFLSSQ-GEGHDEIDFEFLG  109

Query  491   NATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFN  670
             N + QPYTVHTNVY+QGKGNKEQQFHLWFDPTAAFHTYTI+WNP RI+F+VDN+PIRV+N
Sbjct  110   NVSGQPYTVHTNVYTQGKGNKEQQFHLWFDPTAAFHTYTIVWNPHRIVFLVDNSPIRVYN  169

Query  671   NHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNG  850
             NHESIGIPFP SQ MRVYCSLWNAD+WATQGG VKTDW+ APFTAYYRN N + C V +G
Sbjct  170   NHESIGIPFPKSQAMRVYCSLWNADEWATQGGRVKTDWTLAPFTAYYRNINIDGCAVLSG  229

Query  851   VSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKR  1030
              SSC  K++ S +N + WQT  LDGKGRNR+RWVQS+HMVYNYCAD+KRFPQGFSAECK 
Sbjct  230   TSSC--KSSNSANNAKPWQTHELDGKGRNRLRWVQSRHMVYNYCADSKRFPQGFSAECKS  287

Query  1031  SRF  1039
             SRF
Sbjct  288   SRF  290



>ref|XP_009598225.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Nicotiana 
tomentosiformis]
Length=290

 Score =   423 bits (1088),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 200/303 (66%), Positives = 238/303 (79%), Gaps = 14/303 (5%)
 Frame = +2

Query  131   AGKMKKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTM  310
             A K       +C++M I ++A S             NF  D  + +G   G++Q+ G  +
Sbjct  2     ASKFSSAMLLLCILMSIQLLAAS-----------AGNFYGDTVITWGEGRGKIQEGGRGL  50

Query  311   ALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLG  490
             AL LD+ +GSGF +KNEYLFGRFDMQ+KLV G SAGTVTTF+L+S  G+ HDE+DFEFLG
Sbjct  51    ALTLDKLSGSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFFLSSQ-GEGHDEIDFEFLG  109

Query  491   NATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFN  670
             N + QPYTVHTNVY+QGKGNKEQQFHLWFDPTAAFHTYTI+WNP RI+F+VDN+PIRV+N
Sbjct  110   NVSGQPYTVHTNVYTQGKGNKEQQFHLWFDPTAAFHTYTIVWNPHRIVFLVDNSPIRVYN  169

Query  671   NHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNG  850
             NHE+IGIPFP SQ MRVYCSLWNAD+WATQGG VKTDW+ APFTAYYRN N + C V +G
Sbjct  170   NHENIGIPFPKSQAMRVYCSLWNADEWATQGGRVKTDWTLAPFTAYYRNINIDGCAVLSG  229

Query  851   VSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKR  1030
              SSC  K++ S +N + WQT  LDGKGRNR+RWVQS+HMVYNYCAD+KRFPQGFS ECKR
Sbjct  230   TSSC--KSSNSANNAKPWQTHELDGKGRNRLRWVQSRHMVYNYCADSKRFPQGFSEECKR  287

Query  1031  SRF  1039
             SRF
Sbjct  288   SRF  290



>ref|XP_009598236.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Nicotiana 
tomentosiformis]
Length=290

 Score =   422 bits (1085),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 199/303 (66%), Positives = 236/303 (78%), Gaps = 14/303 (5%)
 Frame = +2

Query  131   AGKMKKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTM  310
             A K       +C++M I ++A S             NF  D  + +G   G++Q+ G  +
Sbjct  2     ASKFSSAMLLLCILMSIQLLAAS-----------AGNFYRDTVITWGEGRGKIQEGGRGL  50

Query  311   ALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLG  490
             AL LD+ +GSGF +KNEYLFGRFDMQ+KLV G SAGTVTTF+L+S  G+ HDE+DFEFLG
Sbjct  51    ALTLDKLSGSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFFLSSQ-GEGHDEIDFEFLG  109

Query  491   NATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFN  670
             N + QPYTVHTNVY+QGKGNKEQQFHLWFDPTAAFHTY+I+WNP RI+F+VDN+PIRV+N
Sbjct  110   NVSGQPYTVHTNVYTQGKGNKEQQFHLWFDPTAAFHTYSIVWNPHRIVFLVDNSPIRVYN  169

Query  671   NHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNG  850
             NHESIGIPFP SQ MRVYCSLWNAD+WATQGG +KTDW  APFTAYYRN N + C V  G
Sbjct  170   NHESIGIPFPKSQAMRVYCSLWNADEWATQGGRIKTDWKLAPFTAYYRNINIDGCAVLAG  229

Query  851   VSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKR  1030
              SSC  K++ S +N + WQT  LDGKGRNR+RWVQS+HMVYNYCAD+KRFPQGFSAECK 
Sbjct  230   TSSC--KSSNSANNAKPWQTHELDGKGRNRLRWVQSRHMVYNYCADSKRFPQGFSAECKS  287

Query  1031  SRF  1039
             SRF
Sbjct  288   SRF  290



>ref|XP_009762866.1| PREDICTED: brassinosteroid-regulated protein BRU1-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009762867.1| PREDICTED: brassinosteroid-regulated protein BRU1-like isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009762869.1| PREDICTED: brassinosteroid-regulated protein BRU1-like isoform 
X3 [Nicotiana sylvestris]
Length=290

 Score =   421 bits (1082),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 199/303 (66%), Positives = 238/303 (79%), Gaps = 14/303 (5%)
 Frame = +2

Query  131   AGKMKKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTM  310
             A K+      + ++M I ++A S             NF  D  + +G   G++Q+ G  +
Sbjct  2     ASKVSTAMLLLSVLMSIQLLAAS-----------AGNFYRDAVITWGEGRGKIQEGGRGL  50

Query  311   ALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLG  490
             AL LD+ +GSGF +KNEYLFGRFDMQ+KLV G SAGTVTTF+L+S  G+ HDE+DFEFLG
Sbjct  51    ALTLDKLSGSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFFLSSQ-GEGHDEIDFEFLG  109

Query  491   NATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFN  670
             N + QPYT+HTNVY+QGKGNKEQQFHLWFDPTAAFHTYTI+WNP RI+F+VDN+PIRV+N
Sbjct  110   NVSGQPYTIHTNVYTQGKGNKEQQFHLWFDPTAAFHTYTIVWNPHRIVFLVDNSPIRVYN  169

Query  671   NHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNG  850
             NHESIGIPFP SQ MRVYCSLWNAD+WATQGG VKTDW+ APFTAYYRN N + C V +G
Sbjct  170   NHESIGIPFPKSQAMRVYCSLWNADEWATQGGRVKTDWTLAPFTAYYRNINIDGCAVLSG  229

Query  851   VSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKR  1030
              SSC  K++ S +N + WQT  LDGKGRNR+RWVQS+HMVYNYCAD+KRFPQGFSAECK 
Sbjct  230   TSSC--KSSNSANNAKPWQTHELDGKGRNRLRWVQSRHMVYNYCADSKRFPQGFSAECKS  287

Query  1031  SRF  1039
             SRF
Sbjct  288   SRF  290



>ref|XP_006350013.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16-like [Solanum tuberosum]
Length=290

 Score =   419 bits (1076),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 193/267 (72%), Positives = 227/267 (85%), Gaps = 3/267 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV + +G   G++Q+ G  +AL+LD+ +GSGF +KNE+LFGRFDMQ+KLV   SAG
Sbjct  27    NFYRDVDITWGEGRGKIQEGGRGLALSLDKLSGSGFQSKNEFLFGRFDMQLKLVPENSAG  86

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTF+L+S  G+ HDE+DFEFLGN + QPYT+HTNVY+QGKGNKEQQFHLWFDPTAAFH
Sbjct  87    TVTTFFLSSQ-GEGHDEIDFEFLGNVSGQPYTIHTNVYTQGKGNKEQQFHLWFDPTAAFH  145

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TYTI+WNP RI+F+VDN+PIRVFNNHESIGIPFP SQ M+VYCSLWNAD+WATQGG VKT
Sbjct  146   TYTIVWNPHRIVFLVDNSPIRVFNNHESIGIPFPKSQAMKVYCSLWNADEWATQGGRVKT  205

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW+ APFTAYYRN N + C V++G SSC  K+  S +N + WQT  LDGKGRNR+RWVQS
Sbjct  206   DWALAPFTAYYRNINIDGCAVSSGTSSC--KSIGSTNNAKPWQTHELDGKGRNRLRWVQS  263

Query  959   KHMVYNYCADAKRFPQGFSAECKRSRF  1039
             KHMVYNYCAD+KRFPQGFS ECKRSRF
Sbjct  264   KHMVYNYCADSKRFPQGFSEECKRSRF  290



>ref|XP_006350014.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16-like [Solanum tuberosum]
Length=290

 Score =   417 bits (1073),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 192/267 (72%), Positives = 227/267 (85%), Gaps = 3/267 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV + +G   G++Q+ G  +AL+LD+ +GSGF +KNE+LFGRFDMQ+KLV   SAG
Sbjct  27    NFYKDVDITWGEGRGKIQEGGRGLALSLDKLSGSGFQSKNEFLFGRFDMQIKLVPENSAG  86

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTF+L+S  G+ HDE+DFEFLGN + QPYT+HTNVY+QGKGNKEQQFHLWFDPTAAFH
Sbjct  87    TVTTFFLSSQ-GEGHDEIDFEFLGNVSGQPYTIHTNVYTQGKGNKEQQFHLWFDPTAAFH  145

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TYTI+WNP RI+F+VDN+PIRVFNNHESIGIPFP SQ M+VYCSLWNAD+WATQGG VKT
Sbjct  146   TYTIVWNPHRIVFLVDNSPIRVFNNHESIGIPFPKSQAMKVYCSLWNADEWATQGGRVKT  205

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW+ APFTAYYRN N + C V++G SSC  K+  S +N + W+T  LDGKGRNR+RWVQS
Sbjct  206   DWALAPFTAYYRNINIDGCAVSSGTSSC--KSIGSTNNAKPWETHELDGKGRNRLRWVQS  263

Query  959   KHMVYNYCADAKRFPQGFSAECKRSRF  1039
             KHMVYNYCAD+KRFPQGFSAECK SRF
Sbjct  264   KHMVYNYCADSKRFPQGFSAECKSSRF  290



>ref|NP_001234478.1| xyloglucan endotransglucosylase-hydrolase XTH9 precursor [Solanum 
lycopersicum]
 gb|AAS46244.1| xyloglucan endotransglucosylase-hydrolase XTH9 [Solanum lycopersicum]
Length=290

 Score =   417 bits (1072),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 191/267 (72%), Positives = 227/267 (85%), Gaps = 3/267 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV + +G   G++Q+ G  +AL+LD+ +GSGF +KNEYLFGRFDMQ+KLV   SAG
Sbjct  27    NFYRDVDITWGEGRGKIQEGGRGLALSLDKLSGSGFQSKNEYLFGRFDMQLKLVPKNSAG  86

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTF+L+S  G+ HDE+DFEFLGN + QPYT+HTNVY+QGKGNKEQQFHLWFDPTAAFH
Sbjct  87    TVTTFFLSSQ-GEGHDEIDFEFLGNVSGQPYTIHTNVYTQGKGNKEQQFHLWFDPTAAFH  145

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TYTI+WNP RI+F+VDN+PIRVFNNHES+GIPFP SQ M+VYCSLWNAD+WATQGG VKT
Sbjct  146   TYTIVWNPHRIVFLVDNSPIRVFNNHESMGIPFPKSQAMKVYCSLWNADEWATQGGRVKT  205

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW+ APFTAYYRN N + C V++G S+C  K+  S +N + WQT  LDGKGRNR+RWVQ+
Sbjct  206   DWALAPFTAYYRNINIDGCAVSSGASTC--KSIGSTNNAKPWQTHELDGKGRNRLRWVQT  263

Query  959   KHMVYNYCADAKRFPQGFSAECKRSRF  1039
             KHMVYNYCAD+KRFPQGFSAECK SRF
Sbjct  264   KHMVYNYCADSKRFPQGFSAECKSSRF  290



>ref|XP_009597029.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16 [Nicotiana tomentosiformis]
Length=284

 Score =   412 bits (1059),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 194/290 (67%), Positives = 231/290 (80%), Gaps = 10/290 (3%)
 Frame = +2

Query  170   IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
             + +I ++  SLV  +        NFNN  ++ +G   G++ + G  ++L+LD+ +GSGF 
Sbjct  5     LFLISILMGSLVAASA-------NFNNLAEITWGEGRGKITEGGKGLSLSLDKLSGSGFQ  57

Query  350   TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
             +KNEYLFGRFDMQ+KLV G SAGTVTTF+L+S  G+ HDE+DFEFLGN T +PYTVHTNV
Sbjct  58    SKNEYLFGRFDMQLKLVPGNSAGTVTTFFLSSQ-GEGHDEIDFEFLGNTTGEPYTVHTNV  116

Query  530   YSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQ  709
             YSQGKGNKEQQFHLWFDPTAAFHTYTI+WN  RI+F+VDN PIRV+NNHE+ GIPFP SQ
Sbjct  117   YSQGKGNKEQQFHLWFDPTAAFHTYTIVWNSNRIVFLVDNIPIRVYNNHENNGIPFPKSQ  176

Query  710   PMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNS  889
             PM+VYCSLWNAD+WATQGG VKTDW+ APFTAYYRNF  + C VT+G SSC  K+  S  
Sbjct  177   PMKVYCSLWNADEWATQGGRVKTDWTHAPFTAYYRNFKIDGCAVTSGASSC--KSTDSAG  234

Query  890   NNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
             N + WQ Q LD KGRNRVRWVQS+HMVYNYCAD KRFPQG+S ECK SRF
Sbjct  235   NAKAWQNQELDAKGRNRVRWVQSRHMVYNYCADKKRFPQGYSHECKSSRF  284



>ref|XP_004243230.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16 [Solanum lycopersicum]
Length=290

 Score =   412 bits (1058),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 187/267 (70%), Positives = 224/267 (84%), Gaps = 1/267 (0%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NFN+  ++ +G+  G++ D G  ++L+LD  +GSGF +KNEYL+GRFDMQ+KLV   SAG
Sbjct  25    NFNDLTEITWGDGRGKILDGGKGLSLSLDNYSGSGFQSKNEYLYGRFDMQLKLVPKNSAG  84

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTF+L+S  G+ HDE+DFEFLGN T +PYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH
Sbjct  85    TVTTFFLSSQ-GEGHDEIDFEFLGNVTGEPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  143

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TYTI+WN  RI+F+VD  PIRV+NNHESIGI +P SQPM+VYCSLWNAD+WATQGG VKT
Sbjct  144   TYTIVWNANRIVFLVDQIPIRVYNNHESIGIAYPKSQPMKVYCSLWNADEWATQGGRVKT  203

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTAYYRN N + CVV +G SSC  ++  S ++ + W+T  LD KGRNRVRWVQS
Sbjct  204   DWSQAPFTAYYRNINIDGCVVKSGASSCASRSTESTNSAKSWETHELDAKGRNRVRWVQS  263

Query  959   KHMVYNYCADAKRFPQGFSAECKRSRF  1039
             KHMVYNYCAD+KRFPQG+S ECKRSRF
Sbjct  264   KHMVYNYCADSKRFPQGYSQECKRSRF  290



>ref|XP_009785048.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16 [Nicotiana sylvestris]
Length=284

 Score =   411 bits (1056),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 194/289 (67%), Positives = 229/289 (79%), Gaps = 10/289 (3%)
 Frame = +2

Query  173   MIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNT  352
             ++I ++  SLV           NFNN  ++ +G   G++ + G  ++L+LD+ +GSGF +
Sbjct  6     LLISILMGSLV-------VASANFNNLAEITWGEGRGKITEGGKGLSLSLDKLSGSGFQS  58

Query  353   KNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVY  532
             KNEYLFGRFDMQ+KLV G SAGTVTTF+L+S  G+ HDE+DFEFLGN T +PYTVHTNVY
Sbjct  59    KNEYLFGRFDMQLKLVPGNSAGTVTTFFLSSQ-GKGHDEIDFEFLGNTTGEPYTVHTNVY  117

Query  533   SQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQP  712
             SQGKGNKEQQFHLWFDPTAAFHTYTI+WN  RI+F+VDN PIRV+NNHES GIPFP SQP
Sbjct  118   SQGKGNKEQQFHLWFDPTAAFHTYTIVWNANRILFLVDNIPIRVYNNHESNGIPFPKSQP  177

Query  713   MRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSN  892
             M+VYCSLWNAD+WATQGG VKTDW+ APFTAYYRNF  + C VT+G SSC  K+  S  N
Sbjct  178   MKVYCSLWNADEWATQGGRVKTDWTHAPFTAYYRNFKIDGCAVTSGASSC--KSTDSAGN  235

Query  893   NQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
              + WQ   LD KGRNRVRWVQS+HMVYNYCAD KRFPQG+S ECK SRF
Sbjct  236   AKAWQNHELDAKGRNRVRWVQSRHMVYNYCADKKRFPQGYSHECKSSRF  284



>ref|XP_009602932.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15 [Nicotiana tomentosiformis]
Length=291

 Score =   411 bits (1057),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 197/290 (68%), Positives = 236/290 (81%), Gaps = 8/290 (3%)
 Frame = +2

Query  170   IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
             ++I+ +V  SL  VA A      NF N   + +G   G++ + G  ++L+LD+ +GSGF 
Sbjct  9     MLILPIVMASLWAVASAG-----NFYNLADITWGEGRGKITEGGRGLSLSLDKFSGSGFQ  63

Query  350   TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
             +KNEYLFGRFDMQ+KLV G SAGTVTTF+L+S  G  HDE+DFEFLGN + QPYTVHTNV
Sbjct  64    SKNEYLFGRFDMQLKLVPGNSAGTVTTFFLSSQ-GAGHDEIDFEFLGNVSGQPYTVHTNV  122

Query  530   YSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQ  709
             YSQGKGNKEQQFHLWFDPTAAFHTY+I+WN Q+IIF+VDN+PIRV+NNHES GIPFP SQ
Sbjct  123   YSQGKGNKEQQFHLWFDPTAAFHTYSIIWNAQKIIFLVDNSPIRVYNNHESAGIPFPKSQ  182

Query  710   PMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNS  889
             PM+VYCSLWNAD+WATQGG VKTDW+ APFTAYYRNFN + C +T+G SSC  K+  S +
Sbjct  183   PMKVYCSLWNADEWATQGGRVKTDWTHAPFTAYYRNFNIDGCAITSGASSC--KSTDSAN  240

Query  890   NNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
             N + WQ Q LD KGRNR+RWVQ++HMVYNYCAD+KRFPQGFS ECKRSRF
Sbjct  241   NARPWQNQELDAKGRNRLRWVQNRHMVYNYCADSKRFPQGFSHECKRSRF  290



>ref|XP_009758414.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15 [Nicotiana sylvestris]
Length=291

 Score =   409 bits (1052),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 196/290 (68%), Positives = 233/290 (80%), Gaps = 8/290 (3%)
 Frame = +2

Query  170   IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
             ++I+ +V  SL   A A      NF N   + +G   G++ + G  ++L+LD+ +GSGF 
Sbjct  9     MLILPIVMASLWAAASAG-----NFYNLADITWGEGRGKITEGGRGLSLSLDKLSGSGFQ  63

Query  350   TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
             +KNEYLFGRFDMQ+KLV G SAGTVTTF+L+S  G  HDE+DFEFLGN + QPYTVHTNV
Sbjct  64    SKNEYLFGRFDMQLKLVPGNSAGTVTTFFLSSQ-GAGHDEIDFEFLGNVSGQPYTVHTNV  122

Query  530   YSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQ  709
             YSQGKGNKEQQFHLWFDPTAAFHTY+I+WN Q+IIF+VDN+PIRV+NNHES GIPFP  Q
Sbjct  123   YSQGKGNKEQQFHLWFDPTAAFHTYSIIWNAQKIIFLVDNSPIRVYNNHESNGIPFPKIQ  182

Query  710   PMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNS  889
             PM+VYCSLWNAD+WATQGG VKTDW+  PFTAYYRNFN + C VT+G SSC  K+  S +
Sbjct  183   PMKVYCSLWNADEWATQGGRVKTDWTHVPFTAYYRNFNIDGCAVTSGTSSC--KSTDSAN  240

Query  890   NNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
             N + WQ Q LD KGRNR+RWVQS+HMVYNYCAD+KRFPQGFS ECKRSRF
Sbjct  241   NARPWQNQELDAKGRNRLRWVQSRHMVYNYCADSKRFPQGFSHECKRSRF  290



>ref|XP_006348946.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16-like [Solanum tuberosum]
Length=290

 Score =   402 bits (1032),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 188/291 (65%), Positives = 233/291 (80%), Gaps = 6/291 (2%)
 Frame = +2

Query  167   MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
             +++I  V+  SLV V  A      NFN+  ++ +G+  G++ D G  ++L+LD+ +GSGF
Sbjct  6     LLLISIVLMGSLVAVLAAG-----NFNDLTEITWGDGRGKILDGGKGLSLSLDKLSGSGF  60

Query  347   NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
              +KNEYL+GRFDMQ+K V   SAGTVTTF+L+S  G+ HDE+DFEFLGN T +PYTVHTN
Sbjct  61    QSKNEYLYGRFDMQIKFVPRNSAGTVTTFFLSSQ-GEGHDEIDFEFLGNVTGEPYTVHTN  119

Query  527   VYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*S  706
             VYSQGKGNKEQQFHLWFDPT AFHTYTI+WN  RI+F+VD  PIRV+NNHESIGI +P S
Sbjct  120   VYSQGKGNKEQQFHLWFDPTTAFHTYTIVWNANRIVFLVDEIPIRVYNNHESIGIAYPKS  179

Query  707   QPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASN  886
             QPM+VYCSLWNAD+WATQGG VKTDW++APFTA Y+N N + CVV +G SSC  ++  S 
Sbjct  180   QPMKVYCSLWNADEWATQGGRVKTDWTQAPFTASYKNINIDGCVVKSGASSCASRSTDSA  239

Query  887   SNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
             +N + W+T  LD KGRNR+RWVQ+KHMVYNYCAD+KRFPQG+S ECKRSRF
Sbjct  240   NNAKPWETHELDAKGRNRLRWVQNKHMVYNYCADSKRFPQGYSQECKRSRF  290



>gb|ABD96607.1| xyloglucan endotransglucosylase XET1 [Capsicum annuum]
Length=287

 Score =   397 bits (1020),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 193/293 (66%), Positives = 225/293 (77%), Gaps = 8/293 (3%)
 Frame = +2

Query  167   MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
             M++ + ++A  L+      P    NF  D  + FG+   Q+QD G  +AL+LD+ +GSGF
Sbjct  1     MLLQLSILAVLLL-----YPVWADNFYQDTTVTFGDQRAQIQDGGRILALSLDKISGSGF  55

Query  347   NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
              +KNEYLFGRFDMQ+KLV G SAGTVTTFYL+S  G  HDE+DFEFLGN++ QPYTVHTN
Sbjct  56    QSKNEYLFGRFDMQLKLVPGNSAGTVTTFYLSSQ-GAGHDEIDFEFLGNSSGQPYTVHTN  114

Query  527   VYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*S  706
             VYSQGKGNKEQQF LWFDPT++FHTY+I+WN QRIIF+VDN PIRVFNNHE+IG+ FP +
Sbjct  115   VYSQGKGNKEQQFRLWFDPTSSFHTYSIVWNSQRIIFLVDNIPIRVFNNHEAIGVAFPKN  174

Query  707   QPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACV--VTNGVSSCNFKAAA  880
             Q MRVY SLWNADDWATQGG VKTDWS APFTA YRNFN NACV       SSC      
Sbjct  175   QAMRVYASLWNADDWATQGGRVKTDWSMAPFTAAYRNFNTNACVWSAATSTSSCGGSKTD  234

Query  881   SNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
             S +N Q WQTQ L+   RNR+RWVQ K+M+YNYCADAKRF QGFS ECKRSRF
Sbjct  235   SVNNAQTWQTQELNASERNRLRWVQQKYMIYNYCADAKRFSQGFSPECKRSRF  287



>ref|XP_006366771.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15-like [Solanum tuberosum]
 ref|XP_006366772.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15-like [Solanum tuberosum]
Length=287

 Score =   395 bits (1016),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 188/269 (70%), Positives = 216/269 (80%), Gaps = 3/269 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + FG+   Q+QD G  +AL+LD+ +GSGF +KNEYLFGRFDMQ+KLV G SAG
Sbjct  20    NFYQDATVTFGDQRAQIQDGGRLLALSLDKISGSGFQSKNEYLFGRFDMQLKLVPGNSAG  79

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL+S  G  HDE+DFEFLGN++ QPYTVHTNVYSQGKGNKEQQF LWFDPT++FH
Sbjct  80    TVTTFYLSSQ-GAGHDEIDFEFLGNSSGQPYTVHTNVYSQGKGNKEQQFRLWFDPTSSFH  138

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN QRIIF+VDN PIRVFNNHE++G+ FP +Q MRVY SLWNADDWATQGG VKT
Sbjct  139   TYSIVWNSQRIIFLVDNIPIRVFNNHEALGVAFPKNQAMRVYASLWNADDWATQGGRVKT  198

Query  779   DWSRAPFTAYYRNFNANACV--VTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWV  952
             DWS APFTA YRNFN NACV       SSC      S +N+Q WQTQ L+  GRNR+RWV
Sbjct  199   DWSMAPFTASYRNFNTNACVWSAATSTSSCGGSKTESVNNDQTWQTQQLNANGRNRLRWV  258

Query  953   QSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
             Q K+M+YNYCADA RF QGFS ECKRSRF
Sbjct  259   QQKYMIYNYCADANRFSQGFSPECKRSRF  287



>ref|XP_010102170.1| putative xyloglucan endotransglucosylase/hydrolase protein 16 
[Morus notabilis]
 gb|EXB92420.1| putative xyloglucan endotransglucosylase/hydrolase protein 16 
[Morus notabilis]
Length=289

 Score =   395 bits (1015),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 184/293 (63%), Positives = 223/293 (76%), Gaps = 11/293 (4%)
 Frame = +2

Query  161   VCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGS  340
             + + M+  ++A +  G          NF  D  + +G+H  Q+ + G  + LNLD+ +GS
Sbjct  7     ITLFMVSWLMAAATAG----------NFYQDFDITWGDHRAQILNGGQLLTLNLDKASGS  56

Query  341   GFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVH  520
             GF +KNEYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PYT+H
Sbjct  57    GFQSKNEYLFGRIDMQIKLVPGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLH  115

Query  521   TNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP  700
             TNV SQGKGN+EQQFHLWFDPT AFHTY+I+WN QRIIF+VDN PIRVFNN ES G+PFP
Sbjct  116   TNVLSQGKGNREQQFHLWFDPTKAFHTYSIVWNKQRIIFLVDNIPIRVFNNLESTGVPFP  175

Query  701   *SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAA  880
              SQPMR+Y SLWNADDWAT+GGLVKTDW++APFTA YRNF ANACV + G SSC+ K+ +
Sbjct  176   KSQPMRIYSSLWNADDWATRGGLVKTDWTKAPFTASYRNFKANACVWSAGKSSCDSKSTS  235

Query  881   SNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
             +   +  WQ QGLD  GRNR+RWVQ K+MVYNYC D+KRFPQG   ECKRSRF
Sbjct  236   AAFEDATWQDQGLDAAGRNRLRWVQQKYMVYNYCTDSKRFPQGLPPECKRSRF  288



>gb|ABD96609.1| xyloglucan endotransglucosylase XET3 [Capsicum annuum]
Length=287

 Score =   395 bits (1014),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 187/269 (70%), Positives = 215/269 (80%), Gaps = 3/269 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + FG+H  Q+QD G  +AL+LD+ +GSGF +KNEYLFGRFDMQ+KLV G SAG
Sbjct  20    NFYQDATVTFGDHRAQIQDGGRVLALSLDKISGSGFQSKNEYLFGRFDMQLKLVPGNSAG  79

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL+S  G  HDE+DFEFLGN++ QPYTVHTNVYSQGKGNKEQQF LWFDPT++FH
Sbjct  80    TVTTFYLSSQ-GAGHDEIDFEFLGNSSGQPYTVHTNVYSQGKGNKEQQFRLWFDPTSSFH  138

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN QRIIF+VD+ PIRVFNNHE++G+ FP +Q MRVY SLWNADDWATQGG VKT
Sbjct  139   TYSIVWNSQRIIFLVDDIPIRVFNNHEALGVAFPKNQAMRVYASLWNADDWATQGGWVKT  198

Query  779   DWSRAPFTAYYRNFNANACV--VTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWV  952
             DWS APFTA YRNFN NACV       SSC      S +N Q WQTQ L+   RNR+RWV
Sbjct  199   DWSMAPFTASYRNFNTNACVWSAATSTSSCGGSKTDSVNNVQTWQTQELNASERNRLRWV  258

Query  953   QSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
             Q K+M+YNYC DAKRF QGFS ECKRSRF
Sbjct  259   QQKYMIYNYCTDAKRFSQGFSPECKRSRF  287



>ref|NP_001234213.1| xyloglucan endo-transglycosylase precursor [Solanum lycopersicum]
 emb|CAA58003.1| xyloglucan endo-transglycosylase [Solanum lycopersicum]
Length=289

 Score =   394 bits (1012),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 188/269 (70%), Positives = 215/269 (80%), Gaps = 3/269 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + FG+   Q+QD G  +AL+LD+ +GSGF +KNEYLFGRFDMQ+KLV G SAG
Sbjct  22    NFYQDATVTFGDQRAQIQDGGRLLALSLDKISGSGFQSKNEYLFGRFDMQLKLVPGNSAG  81

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL+S  G  HDE+DFEFLGN++ QPYTVHTNVYSQGKGNKEQQF LWFDPT+ FH
Sbjct  82    TVTTFYLSSQ-GAGHDEIDFEFLGNSSGQPYTVHTNVYSQGKGNKEQQFRLWFDPTSPFH  140

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN QRIIF+VDN PIRVFNNHE +G+ FP +Q MRVY SLWNADDWATQGG VKT
Sbjct  141   TYSIVWNSQRIIFLVDNIPIRVFNNHEKLGVAFPKNQAMRVYASLWNADDWATQGGRVKT  200

Query  779   DWSRAPFTAYYRNFNANACV--VTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWV  952
             DWS APFTA YRNFN NACV    +  SSC      S +N+Q WQTQ L+G  RNR+RWV
Sbjct  201   DWSMAPFTASYRNFNTNACVWSAASSTSSCGGSKTDSVNNDQAWQTQELNGNDRNRLRWV  260

Query  953   QSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
             Q K+M+YNYCADAKRF QG S ECKRSRF
Sbjct  261   QQKYMIYNYCADAKRFSQGLSPECKRSRF  289



>gb|ABD96608.1| xyloglucan endotransglucosylase XET2 [Capsicum annuum]
Length=288

 Score =   394 bits (1011),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 188/269 (70%), Positives = 215/269 (80%), Gaps = 3/269 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + FG+   Q+QD G   AL+LD+ +GSGF +KNEYLFGRFDMQ+KLV G SAG
Sbjct  21    NFYQDATVTFGDQRAQIQDGGRVFALSLDKISGSGFQSKNEYLFGRFDMQLKLVPGNSAG  80

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL+S  G  HDE+DFEFLGN++ QPYTVHTNVYSQGKGNKEQQF LWFDPT++FH
Sbjct  81    TVTTFYLSSQ-GAGHDEIDFEFLGNSSGQPYTVHTNVYSQGKGNKEQQFRLWFDPTSSFH  139

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN QRIIF+VDN PIRV+NN E+IG+PFP +Q MRVY SLWNADDWATQGG VKT
Sbjct  140   TYSIVWNSQRIIFLVDNIPIRVYNNDEAIGVPFPKNQAMRVYASLWNADDWATQGGRVKT  199

Query  779   DWSRAPFTAYYRNFNANACV--VTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWV  952
             DWS APFTA YRNFN NACV    +  SSC      S +N Q WQTQ L+   RNR+RWV
Sbjct  200   DWSMAPFTASYRNFNTNACVWSAASSTSSCGGSKTDSVNNAQTWQTQELNANERNRLRWV  259

Query  953   QSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
             Q K+M+YNYCADAKRF QGFS ECKRSRF
Sbjct  260   QQKYMIYNYCADAKRFSQGFSPECKRSRF  288



>ref|XP_011082926.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like isoform X1 [Sesamum indicum]
Length=292

 Score =   393 bits (1010),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 183/291 (63%), Positives = 228/291 (78%), Gaps = 12/291 (4%)
 Frame = +2

Query  167   MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
             M++++ ++  ++            +F  D ++ +G+   ++ + G  + L+LDQQ+GSGF
Sbjct  14    MMLLLAILVANIA-------TAAADFYRDAEITWGDGRAKILEGGRMLTLSLDQQSGSGF  66

Query  347   NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
              +KNEYLFGRFD+Q+KLV G SAGTVTTF+L+S  G  HDE+DFEFLGN + +PYTVHTN
Sbjct  67    QSKNEYLFGRFDLQLKLVPGNSAGTVTTFFLSSQ-GAGHDEIDFEFLGNTSGEPYTVHTN  125

Query  527   VYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*S  706
             VY+QGKG+KEQ+FHLWFDPTAAFHTY+I+WNPQRIIF+VDN PIRVF+N+E+IGIP+P S
Sbjct  126   VYAQGKGDKEQRFHLWFDPTAAFHTYSIVWNPQRIIFLVDNIPIRVFSNNEAIGIPYPKS  185

Query  707   QPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASN  886
             Q MRVYCSLWNADDWATQGG VKTDW++APF A YRNFN N CV     SSC  K+A S 
Sbjct  186   QAMRVYCSLWNADDWATQGGRVKTDWTKAPFVASYRNFNINGCVPG---SSCGSKSAES-  241

Query  887   SNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
              N + WQT+ LDGKGRNR+RW Q KHM+YNYC D KRFPQG  AEC+RSRF
Sbjct  242   FNTEAWQTKELDGKGRNRLRWAQQKHMIYNYCTDNKRFPQGTPAECRRSRF  292



>ref|NP_001274880.1| probable xyloglucan endotransglucosylase/hydrolase protein 15-like 
precursor [Solanum tuberosum]
 emb|CAJ77496.1| putative xyloglucan endotransglycosylase precursor [Solanum tuberosum]
Length=287

 Score =   392 bits (1006),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 186/269 (69%), Positives = 215/269 (80%), Gaps = 3/269 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + FG+   Q+QD G  +AL+LD+ +GSGF +KNEYLFGRFDMQ+KLV G SAG
Sbjct  20    NFYQDATVTFGDQRAQIQDGGRLLALSLDKISGSGFQSKNEYLFGRFDMQLKLVPGNSAG  79

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTF L+S  G  HDE+DFEFLGN++ +PYTVHTNVYSQGKGNKEQQF LWFDPT++FH
Sbjct  80    TVTTFLLSSQ-GAGHDEIDFEFLGNSSGKPYTVHTNVYSQGKGNKEQQFRLWFDPTSSFH  138

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN QRIIF+VDN PIRVFNNHE++G+ FP +Q MRVY SLWNADDWATQGG VKT
Sbjct  139   TYSIVWNSQRIIFLVDNIPIRVFNNHEALGVAFPKNQAMRVYASLWNADDWATQGGRVKT  198

Query  779   DWSRAPFTAYYRNFNANACV--VTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWV  952
             DWS APFTA YRNFN NACV       SSC      S +N+Q WQ+Q L+  GRNRVRWV
Sbjct  199   DWSMAPFTASYRNFNTNACVWSAATSTSSCGGSKTESVNNDQTWQSQQLNANGRNRVRWV  258

Query  953   QSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
             Q K+M+YNYCADA RF QGFS ECKRSRF
Sbjct  259   QQKYMIYNYCADANRFSQGFSPECKRSRF  287



>ref|XP_011082922.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase 2-like [Sesamum 
indicum]
Length=287

 Score =   392 bits (1006),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 180/267 (67%), Positives = 218/267 (82%), Gaps = 11/267 (4%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D ++ +G+   ++ + G  ++L+LDQ +GSGF +KNEYL+GRFD+Q+KLV G SAG
Sbjct  32    NFYRDAEITWGDGRAKILEGGRGLSLSLDQYSGSGFQSKNEYLYGRFDLQLKLVPGNSAG  91

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTF+L+S  G+ HDE+DFEFLGN + +PYTVHTNVY+ GKG+KEQQFHLWFDPTAAFH
Sbjct  92    TVTTFFLSSQ-GEGHDEIDFEFLGNVSGEPYTVHTNVYAGGKGDKEQQFHLWFDPTAAFH  150

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+W+PQRIIF+VDN+PIRVFNNH+SIGIPFP SQPMRV+CSLWNADDWATQGG VKT
Sbjct  151   TYSIVWHPQRIIFLVDNSPIRVFNNHKSIGIPFPTSQPMRVHCSLWNADDWATQGGRVKT  210

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW++APF AYYRNF  + C V     SC F++          QTQ LD KGRNR+RWVQ 
Sbjct  211   DWTKAPFVAYYRNFKIDGCPVGTSGGSCGFQS----------QTQELDAKGRNRMRWVQQ  260

Query  959   KHMVYNYCADAKRFPQGFSAECKRSRF  1039
             KHM+YNYCAD +RFPQG SAECKRSRF
Sbjct  261   KHMIYNYCADVRRFPQGSSAECKRSRF  287



>ref|XP_011082921.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase 2-like [Sesamum 
indicum]
Length=287

 Score =   392 bits (1006),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 180/267 (67%), Positives = 217/267 (81%), Gaps = 11/267 (4%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D ++ +G+   ++ + G  ++L+LDQ +GSGF +KNEYLFGRFD+Q+KLV G SAG
Sbjct  32    NFYRDAEITWGDGRAKILEGGRGLSLSLDQYSGSGFQSKNEYLFGRFDLQLKLVPGNSAG  91

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTF+L+S  G+ HDE+DFEFLGN + +PYTVHTNVY+ GKG+KEQQFHLWFDPTAAFH
Sbjct  92    TVTTFFLSSQ-GEGHDEIDFEFLGNVSGEPYTVHTNVYAGGKGDKEQQFHLWFDPTAAFH  150

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+W+PQRIIF+VDN+PIRVFNNH+SIGIPFP SQPMRV+CSLWNADDWATQGG VKT
Sbjct  151   TYSIVWHPQRIIFLVDNSPIRVFNNHKSIGIPFPTSQPMRVHCSLWNADDWATQGGRVKT  210

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW++APF  YYRNF  + C V     SC F++          QTQ LD KGRNR+RWVQ 
Sbjct  211   DWTKAPFVTYYRNFKIDGCPVGTSGGSCGFQS----------QTQELDAKGRNRMRWVQQ  260

Query  959   KHMVYNYCADAKRFPQGFSAECKRSRF  1039
             KHM+YNYCAD +RFPQG SAECKRSRF
Sbjct  261   KHMIYNYCADVRRFPQGSSAECKRSRF  287



>ref|XP_011082925.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase 2-like [Sesamum 
indicum]
Length=288

 Score =   391 bits (1005),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 180/267 (67%), Positives = 218/267 (82%), Gaps = 11/267 (4%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D ++ +G+   ++ + G  ++L+LDQ +GSGF +KNEYLFGRFD+Q+KLV G SAG
Sbjct  33    NFYRDAEITWGDGRAKILEGGRGLSLSLDQYSGSGFQSKNEYLFGRFDLQLKLVPGNSAG  92

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTF+L+S  G+ HDE+DFEFLGN + +PYTVHTNVY+ GKG+KEQQFHLWFDPTAAFH
Sbjct  93    TVTTFFLSSQ-GEGHDEIDFEFLGNVSGEPYTVHTNVYAGGKGDKEQQFHLWFDPTAAFH  151

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+W+PQRIIF+VDN+PIRVFNNH+SIGIPFP SQPMRV+CSLWNADDWATQGG VKT
Sbjct  152   TYSIVWHPQRIIFLVDNSPIRVFNNHKSIGIPFPTSQPMRVHCSLWNADDWATQGGRVKT  211

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW++APF AYYRNF  + C +     SC F++          QTQ LDGKGRNR+RWVQ 
Sbjct  212   DWTKAPFVAYYRNFKIDGCPIGTSGGSCGFQS----------QTQELDGKGRNRMRWVQQ  261

Query  959   KHMVYNYCADAKRFPQGFSAECKRSRF  1039
             KHM+YNYCAD +RFPQG SAECKR RF
Sbjct  262   KHMIYNYCADVRRFPQGTSAECKRPRF  288



>ref|NP_001234207.1| xyloglycan endo-transglycosylase precursor [Solanum lycopersicum]
 emb|CAA58002.1| xyloglycan endo-transglycosylase [Solanum lycopersicum]
Length=287

 Score =   390 bits (1003),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 184/269 (68%), Positives = 214/269 (80%), Gaps = 3/269 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + FG+   Q+QD G  + L+LD+ +GSGF +KNEYLFGRFDMQ+KLV G SAG
Sbjct  20    NFYQDAAVTFGDQRAQIQDGGRLLTLSLDKISGSGFQSKNEYLFGRFDMQLKLVPGNSAG  79

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL+S  G  HDE+DFEFLGN++  PYTVHTNVYSQGKGNKEQQF LWFDPT++FH
Sbjct  80    TVTTFYLSSQ-GAGHDEIDFEFLGNSSGLPYTVHTNVYSQGKGNKEQQFRLWFDPTSSFH  138

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN QRIIF+VDN PIRVFNNHE++G+ +P +Q MRVY SLWNADDWATQGG VKT
Sbjct  139   TYSIVWNSQRIIFLVDNIPIRVFNNHEALGVAYPKNQAMRVYASLWNADDWATQGGRVKT  198

Query  779   DWSRAPFTAYYRNFNANACV--VTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWV  952
             DWS APFTA YRNFN NACV       SSC      S +N++ WQTQ L+  GRNR+RWV
Sbjct  199   DWSMAPFTASYRNFNTNACVWSAATSTSSCGGSKTESVNNDETWQTQQLNANGRNRIRWV  258

Query  953   QSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
             Q K+M+YNYCADA RF QGFS ECKRSRF
Sbjct  259   QQKYMIYNYCADANRFSQGFSPECKRSRF  287



>ref|XP_011082923.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase 2-like [Sesamum 
indicum]
Length=288

 Score =   390 bits (1003),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 179/267 (67%), Positives = 218/267 (82%), Gaps = 11/267 (4%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D ++ +G+   ++ + G  ++L+LDQ +GSGF +KNEYL+GRFD+Q+KLV G SAG
Sbjct  33    NFYRDAEITWGDGRAKILEGGRGLSLSLDQYSGSGFQSKNEYLYGRFDLQLKLVPGNSAG  92

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTF+L+S  G+ HDE+DFEFLGN + +PYTVHTNVY+ GKG+KEQQFHLWFDPTAAFH
Sbjct  93    TVTTFFLSSQ-GEGHDEIDFEFLGNVSGEPYTVHTNVYAGGKGDKEQQFHLWFDPTAAFH  151

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+W+PQRIIF+VDN+PIR+FNNH+SIGIPFP SQPMRV+CSLWNADDWATQGG VKT
Sbjct  152   TYSIVWHPQRIIFLVDNSPIRIFNNHKSIGIPFPTSQPMRVHCSLWNADDWATQGGRVKT  211

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW++APF AYYRNF  + C V     SC F++          QTQ LD KGRNR+RWVQ 
Sbjct  212   DWTKAPFVAYYRNFKIDGCPVGTSGGSCGFQS----------QTQELDAKGRNRMRWVQQ  261

Query  959   KHMVYNYCADAKRFPQGFSAECKRSRF  1039
             KHM+YNYCAD +RFPQG SAECKRSRF
Sbjct  262   KHMIYNYCADVRRFPQGSSAECKRSRF  288



>gb|ACD03217.1| xyloglucan endotransglucosylase/hydrolase 7 [Actinidia deliciosa]
Length=294

 Score =   387 bits (995),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 188/291 (65%), Positives = 228/291 (78%), Gaps = 9/291 (3%)
 Frame = +2

Query  167   MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
             M+M++ +++C LV  +            DV++ +GN  G++ + G  + L+LD  +GSGF
Sbjct  12    MLMLVMLMSC-LVSSSYGSF-------EDVEITWGNGRGKILNGGQLLTLSLDNYSGSGF  63

Query  347   NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
              +KNEYLFGR DMQ+KLV G SAGTVTT+YL+S  G  HDE+DFEFLGN + QPYTVHTN
Sbjct  64    QSKNEYLFGRIDMQLKLVPGNSAGTVTTYYLSSQ-GATHDEIDFEFLGNVSGQPYTVHTN  122

Query  527   VYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*S  706
             V++QGKGN+EQQFHLWFDPT +FHTYTILWNPQRIIF+VDN PIRVFNN+E+IG+PFP S
Sbjct  123   VFAQGKGNREQQFHLWFDPTTSFHTYTILWNPQRIIFLVDNIPIRVFNNNEAIGVPFPTS  182

Query  707   QPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASN  886
             QPMRVY S WNADDWATQGG VKTDW+ APFTA Y+NFNANACV ++G SSC  ++  S 
Sbjct  183   QPMRVYSSFWNADDWATQGGRVKTDWTHAPFTASYKNFNANACVHSSGSSSCGSQSTKSI  242

Query  887   SNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
             SN+Q WQTQ LD  GR R+RWVQ K M+YNYC D +RFPQG   ECKRSRF
Sbjct  243   SNDQAWQTQDLDANGRKRLRWVQQKFMIYNYCTDTQRFPQGLPLECKRSRF  293



>ref|NP_001281066.1| brassinosteroid-regulated protein BRU1-like precursor [Malus 
domestica]
 gb|ACD03231.1| xyloglucan endotransglucosylase/hydrolase 7 [Malus domestica]
Length=295

 Score =   385 bits (988),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 178/291 (61%), Positives = 219/291 (75%), Gaps = 5/291 (2%)
 Frame = +2

Query  167   MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
             M+ ++ +   SL+     +     NF  D  + FG+   ++ + G  + LNLD+ +GSGF
Sbjct  10    MVFLLSLFTTSLM----VMTASAGNFFQDFDITFGDGRAKILNGGQLLTLNLDKASGSGF  65

Query  347   NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
              +KNEYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN+T +PYT+HTN
Sbjct  66    KSKNEYLFGRIDMQIKLVSGNSAGTVTAYYLSSE-GPTHDEIDFEFLGNSTGEPYTLHTN  124

Query  527   VYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*S  706
             V+SQGKGN+EQQFHLWFDPT  FHTY+I+WN QRIIF+VDN PIRVFNN ES G+PFP +
Sbjct  125   VFSQGKGNREQQFHLWFDPTKTFHTYSIVWNSQRIIFLVDNIPIRVFNNLESAGVPFPKN  184

Query  707   QPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASN  886
             QPMR+Y SLWNADDWAT+GGLVKTDW++APFTA YRNF ANAC  ++  S  +  +  S 
Sbjct  185   QPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFKANACTASSPSSCASTTSTNSL  244

Query  887   SNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
             +    W+TQGLD  GRNR+RWVQ K MVYNYC+D KRFPQG   ECKRSRF
Sbjct  245   TEQSAWKTQGLDAAGRNRLRWVQQKFMVYNYCSDLKRFPQGLPTECKRSRF  295



>ref|XP_009356634.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Pyrus 
x bretschneideri]
Length=295

 Score =   384 bits (987),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 178/291 (61%), Positives = 220/291 (76%), Gaps = 5/291 (2%)
 Frame = +2

Query  167   MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
             M+ ++ +   SL+ +  +      NF  D  + FG+   ++ + G  + LNLD+ +GSGF
Sbjct  10    MVFLLSLFTTSLMAMTASAG----NFFQDFDITFGDGRAKILNGGQLLTLNLDKASGSGF  65

Query  347   NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
              +KNEYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN+T +PYT+HTN
Sbjct  66    KSKNEYLFGRIDMQIKLVSGNSAGTVTAYYLSSE-GPTHDEIDFEFLGNSTGEPYTLHTN  124

Query  527   VYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*S  706
             V+SQGKGN+EQQF LWFDPT  FHTY+I+WN QRIIF+VDN PIRVFNN ES G+PFP +
Sbjct  125   VFSQGKGNREQQFQLWFDPTKTFHTYSIVWNSQRIIFLVDNIPIRVFNNLESAGVPFPKN  184

Query  707   QPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASN  886
             QPMR+Y SLWNADDWAT+GGLVKTDW++APFTA YRNF ANAC  ++  S  +  +  S 
Sbjct  185   QPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFKANACTASSPSSCASTTSTNSL  244

Query  887   SNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
             +    W+TQGLD  GRNR+RWVQ K MVYNYC+D KRFPQG  AECKRSRF
Sbjct  245   TEQSAWKTQGLDAAGRNRLRWVQQKFMVYNYCSDLKRFPQGLPAECKRSRF  295



>gb|EYU31577.1| hypothetical protein MIMGU_mgv1a011275mg [Erythranthe guttata]
Length=287

 Score =   384 bits (987),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 180/271 (66%), Positives = 220/271 (81%), Gaps = 7/271 (3%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             +F  D ++ +G+   ++ + G  ++L+LD  +GSGF +KNEYLFGRFD+Q+KLV G SAG
Sbjct  20    DFYRDAEITWGDGRAKILEGGRALSLSLDNYSGSGFQSKNEYLFGRFDIQLKLVPGNSAG  79

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTF+L+S  G  HDE+DFEFLGNAT +PYTVHTNVY++GKG+KEQQF LWFDP++A+H
Sbjct  80    TVTTFFLSSQ-GAGHDEIDFEFLGNATGEPYTVHTNVYAKGKGDKEQQFRLWFDPSSAYH  138

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESI-GIPFP*SQPMRVYCSLWNADDWATQGGLVK  775
             TY+ILWNPQRIIF+VDN PIRVFNN E+I G PFP SQPMRVYCSLWNADDWATQGG VK
Sbjct  139   TYSILWNPQRIIFLVDNIPIRVFNNEEAITGTPFPTSQPMRVYCSLWNADDWATQGGRVK  198

Query  776   TDWSRAPFTAYYRNFNANACVVTNGV---SSCNFKAAASNSNNQEWQTQGLDGKGRNRVR  946
             TDW++APF A YRNFN N CV  +     S  N KA  +N+NN  W+TQGLD  GRNR+R
Sbjct  199   TDWTKAPFVASYRNFNINGCVAGSQCGSGSDSNMKAEGANNNN--WRTQGLDANGRNRLR  256

Query  947   WVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
             WVQ K+++YNYC+D+KRFPQG  AECKRSRF
Sbjct  257   WVQQKYIIYNYCSDSKRFPQGIPAECKRSRF  287



>ref|XP_004303861.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16-like [Fragaria vesca subsp. vesca]
Length=297

 Score =   384 bits (987),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 177/271 (65%), Positives = 210/271 (77%), Gaps = 5/271 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + FG    ++ + G  + L+LDQ +GSGF +KNEYLFGR DMQ++LV G SAG
Sbjct  28    NFYQDFDITFGEQRAKILNGGQLLTLDLDQYSGSGFKSKNEYLFGRIDMQIRLVAGNSAG  87

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN+T +PYT+HTNV+SQGKGN+EQQFHLWFDPT AFH
Sbjct  88    TVTAYYLSSQ-GPTHDEIDFEFLGNSTGEPYTLHTNVFSQGKGNREQQFHLWFDPTKAFH  146

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+++WN QRIIF+VDN PIRVFNN ES+G+PFP +QPMR+Y SLWNADDWATQGG VKT
Sbjct  147   TYSLVWNSQRIIFLVDNIPIRVFNNLESVGVPFPKNQPMRIYSSLWNADDWATQGGRVKT  206

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSN----NQEWQTQGLDGKGRNRVR  946
             DW+ APFTA YRNF ANACV  +  SSC    +AS ++     + W  QGLD  GRNR+R
Sbjct  207   DWTHAPFTASYRNFKANACVAGSSSSSCGVTTSASTNSLTDQQRSWHNQGLDAAGRNRIR  266

Query  947   WVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
             WVQ K MVYNYCAD KRFPQG   EC RSRF
Sbjct  267   WVQQKFMVYNYCADLKRFPQGLPVECSRSRF  297



>ref|XP_009356637.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Pyrus 
x bretschneideri]
Length=295

 Score =   383 bits (984),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 178/291 (61%), Positives = 219/291 (75%), Gaps = 5/291 (2%)
 Frame = +2

Query  167   MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
             M+ ++ +   SL+     +     NF  D  + FG+   ++ + G  + LNLD+ +GSGF
Sbjct  10    MMFLLSLFTTSLM----VMTASAGNFFQDFDITFGDGRAKILNGGQLLTLNLDKASGSGF  65

Query  347   NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
              +KNEYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN+T +PYT+HTN
Sbjct  66    KSKNEYLFGRIDMQIKLVSGNSAGTVTAYYLSSE-GPTHDEIDFEFLGNSTGEPYTLHTN  124

Query  527   VYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*S  706
             V+SQGKGN+EQQF LWFDPT  FHTY+I+WN QRIIF+VDN PIRVFNN ES G+PFP +
Sbjct  125   VFSQGKGNREQQFQLWFDPTKTFHTYSIVWNSQRIIFLVDNIPIRVFNNLESAGVPFPKN  184

Query  707   QPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASN  886
             QPMR+Y SLWNADDWAT+GGLVKTDW++APFTA YRNF ANAC  ++  S  +  +  S 
Sbjct  185   QPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFKANACTASSPSSCASTTSTNSL  244

Query  887   SNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
             +    W+TQGLD  GRNR+RWVQ K MVYNYC+D KRFPQG  AECKRSRF
Sbjct  245   TEQSAWKTQGLDAAGRNRLRWVQQKFMVYNYCSDLKRFPQGLPAECKRSRF  295



>ref|XP_011082924.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase 2-like [Sesamum 
indicum]
Length=288

 Score =   382 bits (981),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 178/267 (67%), Positives = 215/267 (81%), Gaps = 11/267 (4%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D ++ +G+   ++ + G  ++L+LDQ +GSGF +KNEYLFGRFD+Q+KLV G SAG
Sbjct  33    NFYRDAEITWGDGRAKILEGGRGLSLSLDQYSGSGFQSKNEYLFGRFDLQLKLVPGNSAG  92

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTF+L+S  G+ HDE+DFEFLGN + +PYTVHTNVY+ GKG+KEQQFHL  +PTAAFH
Sbjct  93    TVTTFFLSSQ-GEGHDEIDFEFLGNVSGEPYTVHTNVYAGGKGDKEQQFHLRSNPTAAFH  151

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+W+PQRIIF+VDN+PIRVFNNH SIGIPFP SQPMRV+CSLWNADDWATQGG VKT
Sbjct  152   TYSIVWHPQRIIFLVDNSPIRVFNNHNSIGIPFPTSQPMRVHCSLWNADDWATQGGRVKT  211

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW++APF AYYRNF  + C V     SC F++          QTQ LD KGRNR+RWVQ 
Sbjct  212   DWTKAPFVAYYRNFKIDGCPVGTSGGSCGFQS----------QTQELDAKGRNRMRWVQQ  261

Query  959   KHMVYNYCADAKRFPQGFSAECKRSRF  1039
             KHM+YNYCAD +RFPQG SAECKRSRF
Sbjct  262   KHMIYNYCADVRRFPQGSSAECKRSRF  288



>ref|XP_009356635.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16 [Pyrus x bretschneideri]
Length=274

 Score =   381 bits (979),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 175/267 (66%), Positives = 210/267 (79%), Gaps = 1/267 (0%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + FG+   ++ + G  + LNLD+ +GSGF +KNEYLFGR DMQ+KLV G SAG
Sbjct  9     NFFQDFDITFGDGRAKILNGGQLLTLNLDKASGSGFKSKNEYLFGRIDMQIKLVSGNSAG  68

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN+T +PYT+HTNV+SQGKGN+EQQF LWFDPT  FH
Sbjct  69    TVTAYYLSSE-GPTHDEIDFEFLGNSTGEPYTLHTNVFSQGKGNREQQFQLWFDPTKTFH  127

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN QRIIF+VDN PIRVFNN ES G+PFP +QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  128   TYSIVWNSQRIIFLVDNIPIRVFNNLESAGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  187

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW++APFTA YRNF ANAC  ++  S  +  +  S +    W+TQGLD  GRNR+RWVQ 
Sbjct  188   DWTQAPFTASYRNFKANACTASSPSSCASTTSTNSLTEQSAWKTQGLDAAGRNRLRWVQQ  247

Query  959   KHMVYNYCADAKRFPQGFSAECKRSRF  1039
             K MVYNYC+D KRFPQG  AECKRSRF
Sbjct  248   KFMVYNYCSDLKRFPQGLPAECKRSRF  274



>gb|EYU31576.1| hypothetical protein MIMGU_mgv1a011220mg [Erythranthe guttata]
Length=288

 Score =   381 bits (979),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 176/269 (65%), Positives = 217/269 (81%), Gaps = 3/269 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             +F  D ++ +G+   ++ + G  ++L+LD  +GSGF +KNEYLFGRFD+Q+KLV G SAG
Sbjct  21    DFYRDAEITWGDGRAKILEGGRALSLSLDNYSGSGFQSKNEYLFGRFDIQLKLVPGNSAG  80

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTF+L+S  G  HDE+DFEFLGNAT +PYTVHTNVY++GKG+KEQQF LWFDP++A+H
Sbjct  81    TVTTFFLSSQ-GAGHDEIDFEFLGNATGEPYTVHTNVYAKGKGDKEQQFRLWFDPSSAYH  139

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESI-GIPFP*SQPMRVYCSLWNADDWATQGGLVK  775
             TY+ILWNPQRIIF+VDN PIRVFNN E+I G PFP SQPMRVYCSLWNADDWATQGG VK
Sbjct  140   TYSILWNPQRIIFLVDNIPIRVFNNEEAITGTPFPTSQPMRVYCSLWNADDWATQGGRVK  199

Query  776   TDWSRAPFTAYYRNFNANACVVTNGV-SSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWV  952
             TDW++APF A YRNFN N CV  +   S  + K     +NN  W+TQGLD  GRNR+RWV
Sbjct  200   TDWTKAPFVATYRNFNINGCVAGSQCGSGSDSKLKTEGANNNNWRTQGLDANGRNRLRWV  259

Query  953   QSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
             Q K+++YNYC+D+KRFP+G  AECKRSRF
Sbjct  260   QQKYIIYNYCSDSKRFPKGIPAECKRSRF  288



>emb|CDP15955.1| unnamed protein product [Coffea canephora]
Length=291

 Score =   380 bits (977),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 185/268 (69%), Positives = 217/268 (81%), Gaps = 3/268 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D    FG+   ++ + G  ++L+LD+ +GSGF +KNEYLFGRFDMQ+KLV G SAG
Sbjct  26    NFYQDAVTTFGDQRVKIAEGGRLLSLSLDKSSGSGFQSKNEYLFGRFDMQLKLVPGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL+S +GQ HDE+DFEFLGNA+ QPYT+HTNVYSQGKG+KEQQF LWFDPT  FH
Sbjct  86    TVTTFYLSS-VGQGHDEIDFEFLGNASGQPYTLHTNVYSQGKGDKEQQFKLWFDPTTFFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TYTI+WN QRIIF+VDN PIRV+NNHE+IG+PFP +QPMRVYCS WNADDWATQGG VKT
Sbjct  145   TYTIVWNSQRIIFLVDNIPIRVYNNHEAIGVPFPKNQPMRVYCSFWNADDWATQGGQVKT  204

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNS-NNQEWQTQGLDGKGRNRVRWVQ  955
             DW+ APFT YYRNFN    V   G S C   + +++S N QEW+TQGLDGKGRNR+RWVQ
Sbjct  205   DWANAPFTVYYRNFNVKGDVCVPG-SPCGSGSKSTDSLNTQEWETQGLDGKGRNRIRWVQ  263

Query  956   SKHMVYNYCADAKRFPQGFSAECKRSRF  1039
              KHM+YNYCAD KR+PQG   ECKR RF
Sbjct  264   QKHMIYNYCADRKRYPQGLPVECKRPRF  291



>gb|AAR37363.1| xyloglucan endo-transglycosylase, partial [Nicotiana attenuata]
Length=257

 Score =   379 bits (973),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 180/256 (70%), Positives = 207/256 (81%), Gaps = 4/256 (2%)
 Frame = +2

Query  281   GQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQA  460
              Q+QD G  + L+LD+ +GSGF +KNE+LFGRFDMQ+KLV G SAGTVTTFYL+S  G  
Sbjct  3     AQIQDGGRLLTLSLDKISGSGFQSKNEFLFGRFDMQLKLVPGNSAGTVTTFYLSSQ-GAG  61

Query  461   HDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFM  640
             HDE+DFEFLGN++ QPYTVHTNVYSQGKGNKEQQFHLWFDPT +FHTY+I+WN QRIIF+
Sbjct  62    HDEIDFEFLGNSSGQPYTVHTNVYSQGKGNKEQQFHLWFDPTTSFHTYSIIWNSQRIIFL  121

Query  641   VDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNF  820
             VDN PIRV+NNHE++G+ FP +Q MRVY SLWNADDWATQGG VKTDWS APFTA YRNF
Sbjct  122   VDNIPIRVYNNHEALGVAFPKNQAMRVYASLWNADDWATQGGRVKTDWSMAPFTASYRNF  181

Query  821   NANACV--VTNGVSSC-NFKAAASNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADA  991
             N NACV    +  SSC   K+  S +N+Q WQTQ LD  GRNR+RWVQ K+M YNYCAD 
Sbjct  182   NTNACVWSAASSTSSCGGSKSTDSVNNDQTWQTQELDANGRNRLRWVQQKYMTYNYCADV  241

Query  992   KRFPQGFSAECKRSRF  1039
              RF QG   ECKRSRF
Sbjct  242   ARFSQGIPPECKRSRF  257



>ref|XP_004303859.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16-like [Fragaria vesca subsp. vesca]
Length=298

 Score =   380 bits (977),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 185/299 (62%), Positives = 226/299 (76%), Gaps = 10/299 (3%)
 Frame = +2

Query  158   QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
             +V M++++ +   SL+ +  +      NF  D  + FG+   ++ + G ++ LNLDQ +G
Sbjct  5     KVPMVLLLSLFITSLLAMIASAG----NFLQDFDVTFGDQRVKILEGGKSLTLNLDQYSG  60

Query  338   SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
             SGF +KNEYLFGR DMQ+KLV G SAGTVTT+YL+S  G  HDE+DFEFLGN++  PYT+
Sbjct  61    SGFKSKNEYLFGRIDMQIKLVPGNSAGTVTTYYLSSE-GPTHDEIDFEFLGNSSGNPYTL  119

Query  518   HTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPF  697
             HTNV+SQGKG++EQQFHLWFDPT AFHTY+ +WN QRIIF+VDN PIRVFNN ES GIPF
Sbjct  120   HTNVFSQGKGDREQQFHLWFDPTKAFHTYSFVWNSQRIIFLVDNIPIRVFNNLESFGIPF  179

Query  698   P*SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVV-TNGVSSCNFKA  874
             P +QPMR+Y SLWNADDWATQGG VKTDW++APFTA YRNF ANACV  ++  SSC    
Sbjct  180   PKNQPMRIYSSLWNADDWATQGGRVKTDWTQAPFTASYRNFKANACVAGSSSSSSCGVAT  239

Query  875   AASNSN----NQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
              AS ++       WQTQ LD  GRNR+RWVQ K MVYNYC+D KRFPQG  AECKRSRF
Sbjct  240   TASTNSLTDQQSAWQTQTLDAAGRNRLRWVQHKFMVYNYCSDRKRFPQGVPAECKRSRF  298



>ref|XP_002306736.2| xyloglucan endo-1 family protein [Populus trichocarpa]
 gb|EEE93732.2| xyloglucan endo-1 family protein [Populus trichocarpa]
Length=294

 Score =   379 bits (974),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 181/291 (62%), Positives = 224/291 (77%), Gaps = 9/291 (3%)
 Frame = +2

Query  167   MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
             M +   ++AC L+G ++       NF  D  + +G+   ++ + G  + L+LD+ +GSGF
Sbjct  12    MPLFASLLAC-LLGASMGG-----NFFQDFDITWGDQRAKILNGGQLLTLSLDKDSGSGF  65

Query  347   NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
              +KNEYLFGR DMQ+KLV G SAGTVTT+YL+S  G  HDE+DFEFLGN T +PYT+HTN
Sbjct  66    RSKNEYLFGRIDMQIKLVSGNSAGTVTTYYLSSQ-GPTHDEIDFEFLGNVTGEPYTLHTN  124

Query  527   VYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*S  706
             V+SQGKGNKEQQF+LWFDPT AFHTY+I+WN QRIIF+VDN PIRVF+N ESIG+PFP  
Sbjct  125   VFSQGKGNKEQQFYLWFDPTKAFHTYSIVWNQQRIIFLVDNIPIRVFHNSESIGVPFPTK  184

Query  707   QPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASN  886
             QPMR+Y SLWNADDWAT+GGLVKTDW++APFTA YRNF A+ACV + G SSC    + ++
Sbjct  185   QPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFKASACVSSPG-SSCT-STSPNS  242

Query  887   SNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
               +  WQ Q LD  GRNR+RWVQ K+M+YNYC D KRFPQG  AECKRSRF
Sbjct  243   LQDSTWQVQALDASGRNRLRWVQQKYMIYNYCTDLKRFPQGIPAECKRSRF  293



>ref|XP_011044804.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Populus 
euphratica]
Length=295

 Score =   379 bits (972),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 179/268 (67%), Positives = 214/268 (80%), Gaps = 5/268 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + +G+   ++ + G  + L+LD+ +GSGF +KNEYLFGR DMQ+KLV G SAG
Sbjct  31    NFFQDFDITWGDQRAKILNGGQLLTLSLDKDSGSGFRSKNEYLFGRIDMQIKLVSGNSAG  90

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTT+YL+S  G  HDE+DFEFLGN T +PYT+HTNV+SQGKGNKEQQF+LWFDPT AFH
Sbjct  91    TVTTYYLSSQ-GPTHDEIDFEFLGNVTGEPYTLHTNVFSQGKGNKEQQFYLWFDPTKAFH  149

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN QRIIF+VDN PIRVF+N ESIG+PFP  QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  150   TYSIVWNQQRIIFLVDNIPIRVFHNSESIGVPFPTKQPMRIYSSLWNADDWATRGGLVKT  209

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNS-NNQEWQTQGLDGKGRNRVRWVQ  955
             DW++APFTA YRNF A ACV + G SSC   A + NS  +  WQ Q LD  GRNR+RWVQ
Sbjct  210   DWTQAPFTASYRNFKAPACVRSPG-SSCT--ATSPNSVEDSTWQVQALDASGRNRLRWVQ  266

Query  956   SKHMVYNYCADAKRFPQGFSAECKRSRF  1039
              K+M+YNYC+D KRFPQG  AECKRSRF
Sbjct  267   QKYMIYNYCSDLKRFPQGIPAECKRSRF  294



>ref|XP_011044805.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Populus 
euphratica]
Length=342

 Score =   380 bits (975),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 175/267 (66%), Positives = 212/267 (79%), Gaps = 3/267 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + +G+   ++ + G  + L+LD+ +GSGF +KNEYLFGR DMQ+KLV G SAG
Sbjct  78    NFFQDFDITWGDQRAKILNGGQLLTLSLDKDSGSGFRSKNEYLFGRIDMQIKLVSGNSAG  137

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTT+YL+S  G  HDE+DFEFLGN T +PYT+HTNV+SQGKGNKEQQF+LWFDPT AFH
Sbjct  138   TVTTYYLSSQ-GPTHDEIDFEFLGNVTGEPYTLHTNVFSQGKGNKEQQFYLWFDPTKAFH  196

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN QRIIF+VDN P+RVF+N ESIG+PFP  QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  197   TYSIVWNQQRIIFLVDNIPLRVFHNSESIGVPFPTKQPMRIYSSLWNADDWATRGGLVKT  256

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW++APFTA YRNF A ACV + G SSC    + ++  +  WQ Q LD  GRNR+RWVQ 
Sbjct  257   DWTQAPFTASYRNFKATACVRSPG-SSCT-STSPNSVEDSTWQVQALDASGRNRLRWVQQ  314

Query  959   KHMVYNYCADAKRFPQGFSAECKRSRF  1039
             K+M+YNYC D KRFPQG  AECKRSRF
Sbjct  315   KYMIYNYCTDLKRFPQGIPAECKRSRF  341



>ref|XP_004303862.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15-like [Fragaria vesca subsp. vesca]
Length=292

 Score =   378 bits (970),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 179/291 (62%), Positives = 220/291 (76%), Gaps = 7/291 (2%)
 Frame = +2

Query  167   MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
             M++++ VV+C+L+   +A      +F  ++ + FG+   ++ D G  + LNLD+  GSGF
Sbjct  9     MLLMLSVVSCNLL--IMAASSSAGDFYRNIDVTFGDQRAKILDGGKLLTLNLDKTLGSGF  66

Query  347   NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
              +K EYLFGR D+QMKLV G SAGTVTT+YL+S  G  HDE+DFEFLGN+T  PYT+HTN
Sbjct  67    RSKKEYLFGRIDIQMKLVPGNSAGTVTTYYLSSE-GVTHDEIDFEFLGNSTGNPYTLHTN  125

Query  527   VYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*S  706
             V+SQGKG +EQQFHLWFDPT +FHTY+ILWN  RIIF VDN PIRVF+N ESIG+PFP  
Sbjct  126   VFSQGKGEREQQFHLWFDPTKSFHTYSILWNTHRIIFFVDNIPIRVFDNLESIGVPFPKK  185

Query  707   QPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASN  886
             QPMR+Y SLWNADDWATQGGLVKTDW++APFTA YRN  ANAC+  +  S+C    A   
Sbjct  186   QPMRIYSSLWNADDWATQGGLVKTDWAQAPFTASYRNLKANACLAGSSSSTCVSTTA---  242

Query  887   SNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
               ++ WQ Q LD  GR R+RWVQ+K MVYNYC+D KRFPQGF  ECKRSRF
Sbjct  243   -EDKAWQNQALDAAGRKRLRWVQNKFMVYNYCSDRKRFPQGFPPECKRSRF  292



>ref|XP_008229404.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Prunus 
mume]
Length=285

 Score =   376 bits (966),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 176/294 (60%), Positives = 221/294 (75%), Gaps = 17/294 (6%)
 Frame = +2

Query  158   QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
             +V M++++ +   SL+ +  +      NF  D+ + FG+   ++ + G  + LNLD+ +G
Sbjct  9     KVSMVLVVSLFVTSLMAMTASAG----NFFQDIDVTFGDERAKILNGGQLLTLNLDKASG  64

Query  338   SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
             SGF +KNEYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PYT+
Sbjct  65    SGFKSKNEYLFGRIDMQIKLVSGNSAGTVTAYYLSSE-GPTHDEIDFEFLGNLSGDPYTL  123

Query  518   HTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPF  697
             HTNV+SQGKGN+EQQFHLWFDPT AFHTY+I+WN QRIIF+VDN PIRVF N E+IG+PF
Sbjct  124   HTNVFSQGKGNREQQFHLWFDPTKAFHTYSIVWNSQRIIFLVDNIPIRVFTNLETIGVPF  183

Query  698   P*SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAA  877
             P +QPMR+Y SLWNADDWAT+GGLVKTDW++APFTA YRNF A+    T   +S   ++A
Sbjct  184   PKNQPMRIYSSLWNADDWATRGGLVKTDWTKAPFTASYRNFQAS----TTSTNSLTEQSA  239

Query  878   ASNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
                     WQTQGLD +GRNR+RWVQ K MVYNYC+D KRFPQG   EC+RSRF
Sbjct  240   --------WQTQGLDSEGRNRLRWVQQKFMVYNYCSDLKRFPQGLPVECRRSRF  285



>gb|AFR46576.1| xyloglucan endotransglucosylase/hydrolase 7, partial [Rosa x 
borboniana]
Length=257

 Score =   374 bits (960),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 174/258 (67%), Positives = 203/258 (79%), Gaps = 3/258 (1%)
 Frame = +2

Query  272   NHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPI  451
             +   ++ + G  + LNLD+ +GSGF +KNEYLFGR DMQ+KLV G SAGTVTT+YL+S  
Sbjct  1     DQRAKILEGGQFLTLNLDKYSGSGFKSKNEYLFGRIDMQIKLVPGNSAGTVTTYYLSSE-  59

Query  452   GQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRI  631
             G  HDE+DFEFLGN++  PYT+HTNV+SQGKG++EQQFHLWFDPT AFHTY+ +WN QRI
Sbjct  60    GPTHDEIDFEFLGNSSGDPYTLHTNVFSQGKGDREQQFHLWFDPTTAFHTYSFVWNSQRI  119

Query  632   IFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYY  811
             IF VDN PIRVFNN ES G+PFP +QPMR+Y SLWNADDWATQGG VKTDW++APFTA Y
Sbjct  120   IFFVDNIPIRVFNNMESFGVPFPKNQPMRIYSSLWNADDWATQGGRVKTDWTQAPFTASY  179

Query  812   RNFNANACVVTNGVSSCNFKAAASNSNNQE--WQTQGLDGKGRNRVRWVQSKHMVYNYCA  985
             RNF ANACV  +  SSC     AS    Q+  WQTQ LD  GRNR+RWVQ K MVYNYC+
Sbjct  180   RNFKANACVAGSSSSSCGVATVASTDKTQQSAWQTQTLDAAGRNRLRWVQQKFMVYNYCS  239

Query  986   DAKRFPQGFSAECKRSRF  1039
             D KRFPQG   ECKRSRF
Sbjct  240   DLKRFPQGLPVECKRSRF  257



>ref|XP_008348360.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Malus 
domestica]
Length=293

 Score =   375 bits (963),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 177/267 (66%), Positives = 211/267 (79%), Gaps = 2/267 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + FG+   ++ + G  + LNLDQ +GSGF +KNEYLFGR DMQ+KLV G SAG
Sbjct  29    NFYQDFDVTFGDGRAKILNGGQLLTLNLDQTSGSGFKSKNEYLFGRIDMQIKLVSGNSAG  88

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNV+SQGKGN+EQQFHLWFDPT AFH
Sbjct  89    TVTAYYLSSE-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGNREQQFHLWFDPTKAFH  147

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN QRIIF+VD  PIRVFNN ES+G+PFP SQPMR+Y SLWNADDWAT+GGLVKT
Sbjct  148   TYSIVWNAQRIIFLVDKIPIRVFNNLESVGVPFPKSQPMRIYSSLWNADDWATRGGLVKT  207

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW++APFTA YRNF A+AC   +  S  +  A+ S+  +  WQTQGLD  GRNR+RWVQ 
Sbjct  208   DWTQAPFTASYRNFKADACTAGSSSSCAS-TASTSSVGDSAWQTQGLDAAGRNRLRWVQQ  266

Query  959   KHMVYNYCADAKRFPQGFSAECKRSRF  1039
             K MVYNYC+D KRFPQG  AEC+RSRF
Sbjct  267   KFMVYNYCSDLKRFPQGLPAECRRSRF  293



>ref|XP_011082930.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15 [Sesamum indicum]
Length=281

 Score =   375 bits (962),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 179/267 (67%), Positives = 214/267 (80%), Gaps = 4/267 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV + +G+  G++ + G  + L LDQ +GSGF +KNEYLFGRFDMQ++L+ G SAG
Sbjct  19    NFYKDVNVNWGDGRGKIVEGGRGLTLLLDQYSGSGFQSKNEYLFGRFDMQLRLIPGNSAG  78

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTF+L S  G AHDE+DFEFLGN++ +PYTVHTNVY+QGKG+KEQQF LWFDP+AAFH
Sbjct  79    TVTTFFLASQ-GSAHDEIDFEFLGNSSGEPYTVHTNVYAQGKGDKEQQFRLWFDPSAAFH  137

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WNP+RIIF+VDN PIRVF+NH   G+PFP SQPMRV+CSLWNADDWATQGG VKT
Sbjct  138   TYSIVWNPRRIIFLVDNIPIRVFHNHG--GVPFPTSQPMRVHCSLWNADDWATQGGRVKT  195

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW++APF AYYRNF  NACV  +   SC   +A S   ++EWQTQ LD KGRNR+RWV  
Sbjct  196   DWTKAPFVAYYRNFKINACVSGSIGGSCGSTSADS-FGDEEWQTQELDSKGRNRLRWVHQ  254

Query  959   KHMVYNYCADAKRFPQGFSAECKRSRF  1039
             KHM+YNYC D  RFPQG   ECKRSRF
Sbjct  255   KHMIYNYCGDMPRFPQGIPPECKRSRF  281



>ref|XP_009356638.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Pyrus 
x bretschneideri]
Length=293

 Score =   374 bits (961),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 178/295 (60%), Positives = 220/295 (75%), Gaps = 8/295 (3%)
 Frame = +2

Query  158   QVCMIMIIGV-VACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQT  334
             ++ M++++ + + C +            NF  D  + FG+   ++ + G  + LNLDQ +
Sbjct  6     KLSMVVLLSLFITCVMA-----TAASAGNFYQDFDVTFGDGRAKILNGGQLLTLNLDQTS  60

Query  335   GSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYT  514
             GSGF +KNEYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PYT
Sbjct  61    GSGFKSKNEYLFGRIDMQIKLVSGNSAGTVTAYYLSSE-GPTHDEIDFEFLGNLSGDPYT  119

Query  515   VHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIP  694
             +HTNV+SQGKGN+EQQFHLWFDPT AFHTY+I+WN QRIIF+VD  PIRVFNN ES+GIP
Sbjct  120   LHTNVFSQGKGNREQQFHLWFDPTKAFHTYSIVWNAQRIIFLVDKIPIRVFNNLESVGIP  179

Query  695   FP*SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKA  874
             FP +QPMR+Y SLWNADDWAT+GGLVKTDW++APFTA YRNF A+AC   +  S  +  +
Sbjct  180   FPKNQPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFKADACTAGSSSSCASTAS  239

Query  875   AASNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
               S   +  WQTQGLD  GRNR+RWVQ K MVYNYC+D KRFPQG  AEC+RSRF
Sbjct  240   TNS-VGDSAWQTQGLDAAGRNRLRWVQQKFMVYNYCSDLKRFPQGLPAECRRSRF  293



>ref|XP_009377621.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Pyrus 
x bretschneideri]
Length=293

 Score =   374 bits (960),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 177/267 (66%), Positives = 208/267 (78%), Gaps = 2/267 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D    FG+   ++ + G  + LNLDQ +GSGF +KNEYLFGR DMQ+KLV G SAG
Sbjct  29    NFYQDFDFTFGDGRAKILNGGQLLTLNLDQASGSGFKSKNEYLFGRIDMQIKLVAGNSAG  88

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNV+SQGKGN+EQQFHLWFDPT AFH
Sbjct  89    TVTAYYLSSE-GPTHDEIDFEFLGNVSGDPYTLHTNVFSQGKGNREQQFHLWFDPTKAFH  147

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN QRIIF+VDN PIRVFNN ES+G+PFP +QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  148   TYSIVWNTQRIIFLVDNIPIRVFNNLESVGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  207

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW++APFTA YRNF ANAC   +  S  +  +  S   +  WQTQGLD  GRNR+RWVQ 
Sbjct  208   DWTKAPFTASYRNFKANACTAGSSSSCASTASTNS-VGDSAWQTQGLDAAGRNRLRWVQQ  266

Query  959   KHMVYNYCADAKRFPQGFSAECKRSRF  1039
             K MVYNYC D KRFPQG  AEC+RSRF
Sbjct  267   KFMVYNYCNDLKRFPQGLPAECRRSRF  293



>ref|XP_007215791.1| hypothetical protein PRUPE_ppa009863mg [Prunus persica]
 gb|EMJ16990.1| hypothetical protein PRUPE_ppa009863mg [Prunus persica]
Length=274

 Score =   373 bits (957),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 177/291 (61%), Positives = 218/291 (75%), Gaps = 17/291 (6%)
 Frame = +2

Query  167   MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
             M++++ +   SL+ +A +      NF  D  + FG+   ++ + G  + LNLD+ +GSGF
Sbjct  1     MVLVVSLFVTSLMAMAASAG----NFFQDFDVTFGDERAKILNGGQLLTLNLDKASGSGF  56

Query  347   NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
              +KNEYL GR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PYT+HTN
Sbjct  57    KSKNEYLLGRIDMQIKLVSGNSAGTVTAYYLSSE-GPTHDEIDFEFLGNLSGDPYTLHTN  115

Query  527   VYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*S  706
             V+SQGKGN+EQQFHLWFDPT AFHTY+I+WN QRIIF+VDN PIRVF+N E+IG+PFP S
Sbjct  116   VFSQGKGNREQQFHLWFDPTKAFHTYSIVWNSQRIIFLVDNIPIRVFHNLETIGVPFPKS  175

Query  707   QPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASN  886
             QPMR+Y SLWNADDWAT+GGLVKTDW++APFTA YRNF A+        +S N     S 
Sbjct  176   QPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFQAS-------TTSTN-----SL  223

Query  887   SNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
             +    WQTQGLD  GRNR+RWVQ K MVYNYC+D KRFPQG  AEC+RSRF
Sbjct  224   TEQSAWQTQGLDAAGRNRLRWVQQKFMVYNYCSDLKRFPQGLPAECRRSRF  274



>ref|XP_006387415.1| xyloglucan endo-1 family protein, partial [Populus trichocarpa]
 gb|ERP46329.1| xyloglucan endo-1 family protein, partial [Populus trichocarpa]
Length=271

 Score =   371 bits (953),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 173/267 (65%), Positives = 213/267 (80%), Gaps = 3/267 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + +G+   ++ + G  + L+LD+ +GSGF +KNEYLFGR DMQ+KLV G SAG
Sbjct  7     NFFQDFDITWGDQRAKILNGGQLLTLSLDKDSGSGFRSKNEYLFGRIDMQIKLVSGNSAG  66

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTT+YL+S  G  HDE+DFEFLGN T +PYT+HTNV+SQGKGNKEQQF+LWFDPT AFH
Sbjct  67    TVTTYYLSSQ-GPTHDEIDFEFLGNLTGEPYTLHTNVFSQGKGNKEQQFYLWFDPTKAFH  125

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN Q+IIF+VDN PIRVF+N ESIG+PFP  QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  126   TYSIVWNQQQIIFLVDNIPIRVFHNSESIGVPFPTKQPMRIYSSLWNADDWATRGGLVKT  185

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW++APFTA YRNF A+AC V++ VSSC    + ++  +  WQ Q LD  GRNR+RWVQ 
Sbjct  186   DWTQAPFTASYRNFKASAC-VSSPVSSCT-STSPNSLQDSTWQVQALDASGRNRLRWVQQ  243

Query  959   KHMVYNYCADAKRFPQGFSAECKRSRF  1039
             K+M+YNYC D KRFPQG  AE +RSRF
Sbjct  244   KYMIYNYCTDLKRFPQGIPAEMQRSRF  270



>ref|NP_001280908.1| brassinosteroid-regulated protein BRU1-like precursor [Malus 
domestica]
 gb|ACD03230.1| xyloglucan endotransglucosylase/hydrolase 6 [Malus domestica]
Length=294

 Score =   372 bits (954),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 179/293 (61%), Positives = 218/293 (74%), Gaps = 6/293 (2%)
 Frame = +2

Query  161   VCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGS  340
             V M++ + +   SL+     +     NF  D  + FG+   ++ + G  + LNLDQ +GS
Sbjct  8     VNMVLFLFLFTTSLM----LMAASAGNFYQDFDVTFGDGRAKILNGGQLLTLNLDQASGS  63

Query  341   GFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVH  520
             GF +KNEYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PYT+H
Sbjct  64    GFKSKNEYLFGRIDMQIKLVAGNSAGTVTAYYLSSE-GPTHDEIDFEFLGNVSGDPYTLH  122

Query  521   TNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP  700
             TNV+SQGKGN+EQQF LWFDPT AFHTY+I+WN QRIIF+VDN PIRVFNN ES+G+PFP
Sbjct  123   TNVFSQGKGNREQQFQLWFDPTNAFHTYSIVWNSQRIIFLVDNIPIRVFNNLESVGVPFP  182

Query  701   *SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAA  880
              +QPMR+Y SLWNADDWAT+GGLVKTDW++APFTA YRNF ANAC   +  S  +  +  
Sbjct  183   KNQPMRIYSSLWNADDWATRGGLVKTDWTKAPFTASYRNFKANACTADSSSSCASTASTN  242

Query  881   SNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
             S   +  WQTQGLD  GRNR+RWVQ K M+YNYC D KRFPQG  AEC+RSRF
Sbjct  243   S-VGDSAWQTQGLDAAGRNRLRWVQQKFMIYNYCNDLKRFPQGLPAECRRSRF  294



>ref|XP_007215773.1| hypothetical protein PRUPE_ppa009608mg [Prunus persica]
 gb|EMJ16972.1| hypothetical protein PRUPE_ppa009608mg [Prunus persica]
Length=285

 Score =   370 bits (951),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 176/294 (60%), Positives = 218/294 (74%), Gaps = 14/294 (5%)
 Frame = +2

Query  158   QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
             +V M++++ +   SL+ +  +      NF  D  + FG    ++ + G  + LNLD+ +G
Sbjct  6     EVSMVLVVSLFVTSLMALTASAG----NFYQDFDITFGGERAKILNGGQLLTLNLDKFSG  61

Query  338   SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
             SGF +KNEYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PYT+
Sbjct  62    SGFKSKNEYLFGRIDMQIKLVSGNSAGTVTAYYLSSE-GPTHDEIDFEFLGNLSGDPYTL  120

Query  518   HTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPF  697
             HTNV+SQGKGN+EQQFHLWFDPT AFHTY+I+WN QRIIF+VDN PIRVF+N E+IG+PF
Sbjct  121   HTNVFSQGKGNREQQFHLWFDPTKAFHTYSIVWNSQRIIFLVDNIPIRVFHNLETIGVPF  180

Query  698   P*SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAA  877
             P +QPMR+Y SLWNADDWAT+GGLVKTDW++APFTA YRNF          VS+    + 
Sbjct  181   PKNQPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFK---------VSTTTSTST  231

Query  878   ASNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
              S +   EWQTQGLD  GRNR+RWVQ K MVYNYC+D KRFPQG   EC+RSRF
Sbjct  232   NSLTEQSEWQTQGLDAAGRNRLRWVQQKFMVYNYCSDLKRFPQGLPVECRRSRF  285



>ref|XP_009597028.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Nicotiana 
tomentosiformis]
Length=300

 Score =   371 bits (952),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 176/270 (65%), Positives = 212/270 (79%), Gaps = 4/270 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + +G+    +Q+ G  + L+LD+ +GSGF +K+E+LFGRFDMQ+KL+ G SAG
Sbjct  32    NFYQDATVTWGDQRAHIQEGGRLLTLSLDKISGSGFQSKSEFLFGRFDMQLKLIPGNSAG  91

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL+S  G  HDE+DFEFLGN++ QPYTVHTNVYSQGKGNKEQQFHLWFDPT +FH
Sbjct  92    TVTTFYLSSQ-GAGHDEIDFEFLGNSSGQPYTVHTNVYSQGKGNKEQQFHLWFDPTTSFH  150

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN QRIIF+VDN PIRV+NNHE++G+ FP +Q MRVY SLWNADDWATQGG VKT
Sbjct  151   TYSIIWNAQRIIFLVDNIPIRVYNNHEALGVAFPKNQAMRVYASLWNADDWATQGGRVKT  210

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAA---SNSNNQEWQTQGLDGKGRNRVRW  949
             DWS APFTA YRNFN NACV +   S+ +   +    S +N+Q WQTQ LD  GRNR+RW
Sbjct  211   DWSMAPFTASYRNFNTNACVWSAASSTSSCGGSTSTDSANNDQTWQTQELDANGRNRLRW  270

Query  950   VQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
             VQ K+M YNYC DA+RF Q    ECKRSRF
Sbjct  271   VQQKYMTYNYCTDAQRFNQVIPPECKRSRF  300



>ref|XP_008229403.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Prunus 
mume]
Length=285

 Score =   370 bits (950),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 176/294 (60%), Positives = 221/294 (75%), Gaps = 17/294 (6%)
 Frame = +2

Query  158   QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
             +V M++++ +   SL+ +A +      NF  D  + FG+   ++ + G  + LNLD+ +G
Sbjct  9     KVSMVLVVSLFVTSLMAMAASAG----NFFQDFDVTFGDERVKILNGGQLLTLNLDKASG  64

Query  338   SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
             SGF +KNEYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PYT+
Sbjct  65    SGFKSKNEYLFGRIDMQIKLVSGNSAGTVTAYYLSSE-GPTHDEIDFEFLGNLSGDPYTL  123

Query  518   HTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPF  697
             HTNV+SQGKGN+EQQFHLWFDPT AFHTY+I+WN QRIIF+VDN PIRVF+N E+IG+PF
Sbjct  124   HTNVFSQGKGNREQQFHLWFDPTRAFHTYSIVWNSQRIIFLVDNIPIRVFHNLETIGVPF  183

Query  698   P*SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAA  877
             P SQPMR+Y SLWNADDWAT+GGLVKTDW++APFTA YRNF A+    T   +S   ++A
Sbjct  184   PKSQPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFQAS----TTSTNSLTEQSA  239

Query  878   ASNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
                     WQ QGLD  GRNR+RWVQ K M+YNYC+D KRFPQG  AEC++SRF
Sbjct  240   --------WQNQGLDAAGRNRLRWVQQKFMIYNYCSDLKRFPQGLPAECRQSRF  285



>ref|XP_008341405.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Malus 
domestica]
Length=294

 Score =   370 bits (950),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 173/294 (59%), Positives = 217/294 (74%), Gaps = 5/294 (2%)
 Frame = +2

Query  158   QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
             +V MI+ + +   SL+ +A        NF  D  + FG+   ++ D G  + LNLDQ +G
Sbjct  6     KVLMILFLSLFINSLMAMAAQAG----NFYQDFDVTFGDGRAKILDGGKLLTLNLDQVSG  61

Query  338   SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
             SGF +KNEYLFGR DMQ+KLV G SAGTVTT+YL+S  G  HDE+DFEFLGN+T +PYT+
Sbjct  62    SGFKSKNEYLFGRIDMQIKLVPGNSAGTVTTYYLSSE-GLTHDEIDFEFLGNSTGEPYTL  120

Query  518   HTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPF  697
             HTNV+SQGKG +EQQFHLWFDPT  FHTY+I+WN Q IIF+VD+ PIRVFNN ES G+PF
Sbjct  121   HTNVFSQGKGGREQQFHLWFDPTKTFHTYSIVWNRQNIIFLVDSIPIRVFNNLESAGVPF  180

Query  698   P*SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAA  877
             P +QPMRVY SLWNAD+WAT+GGLVKT+W+ APFTA YRNF A+AC+  +  S  +    
Sbjct  181   PKTQPMRVYSSLWNADEWATRGGLVKTNWTLAPFTATYRNFKADACIAGSSSSCASTIPT  240

Query  878   ASNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
                +    W+TQG+D  GR R+RWVQ K M+YNYC+D KRFP+G  AECK+SR 
Sbjct  241   NPLTEKSAWETQGIDAAGRKRLRWVQQKFMIYNYCSDFKRFPEGLPAECKQSRL  294



>ref|XP_004293654.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16-like [Fragaria vesca subsp. vesca]
Length=306

 Score =   370 bits (950),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 180/308 (58%), Positives = 219/308 (71%), Gaps = 18/308 (6%)
 Frame = +2

Query  131   AGKMKKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTM  310
              GKM K      +++    V+C  +  A A      NF  D  + +G+H  ++ D GN +
Sbjct  10    VGKMLK------IVLFFLSVSCPFMAAASAG-----NFYRDFDLTWGDHRAKILDGGNLL  58

Query  311   ALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLG  490
              L+LD+ +GSGF +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLG
Sbjct  59    TLSLDRISGSGFQSKREYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPNHDEIDFEFLG  117

Query  491   NATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFN  670
             N +  PY VHTNVY+QGKG++EQQFHLWFDPT  FHTY+ILWNPQRIIF+VDN PIRVFN
Sbjct  118   NLSGDPYIVHTNVYTQGKGDREQQFHLWFDPTKNFHTYSILWNPQRIIFLVDNTPIRVFN  177

Query  671   NHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNG  850
             N E+IG+ FP  QPM++Y SLWNAD WAT+GGL+KTDWS+APFTAYY+ FNANACV + G
Sbjct  178   NEEAIGVGFPKKQPMKLYSSLWNADQWATRGGLIKTDWSKAPFTAYYKGFNANACVWSRG  237

Query  851   VSSCNFKAAASN------SNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGF  1012
               SC    +         + N  WQTQGLD  GR R+RWVQ  HM+YNYC D KRFPQG 
Sbjct  238   SLSCASGRSTPRPYGLGMNYNNGWQTQGLDAPGRRRLRWVQRYHMIYNYCTDLKRFPQGR  297

Query  1013  SAECKRSR  1036
               EC+RSR
Sbjct  298   PRECRRSR  305



>gb|KFK35964.1| xyloglucan:xyloglucosyl transferase [Arabis alpina]
Length=292

 Score =   369 bits (948),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 170/290 (59%), Positives = 217/290 (75%), Gaps = 6/290 (2%)
 Frame = +2

Query  167   MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
             + M++ V+  ++VG A +      NFN +  + +G H GQ+   G  ++L+LD+ +GSGF
Sbjct  8     LTMLVTVLVLTMVGTAYSG-----NFNEEFDLTWGEHRGQIFGGGKMLSLSLDRVSGSGF  62

Query  347   NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
              +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN T +PY +HTN
Sbjct  63    KSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSE-GPTHDEIDFEFLGNETGKPYVLHTN  121

Query  527   VYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*S  706
             V++QGKGN+EQQF+LWFDPT  FHTY+++W PQ IIFMVDN PIRVFNN E +G+PFP  
Sbjct  122   VFAQGKGNREQQFYLWFDPTKNFHTYSLVWRPQHIIFMVDNVPIRVFNNAEQLGVPFPKK  181

Query  707   QPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASN  886
             QPMR+Y SLWNADDWAT+GGLVKTDWS+APFTAYYR FNA AC V++G S C+ K  +S 
Sbjct  182   QPMRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRGFNAAACTVSSGSSYCDPKFKSSF  241

Query  887   SNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSR  1036
             +N +      L+  GR R+RWVQ   M+Y+YC+D KRF QGF  EC+RSR
Sbjct  242   TNGESQAATELNAYGRRRLRWVQKYFMIYDYCSDVKRFSQGFPPECRRSR  291



>ref|XP_008229401.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Prunus 
mume]
Length=282

 Score =   369 bits (947),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 174/294 (59%), Positives = 218/294 (74%), Gaps = 17/294 (6%)
 Frame = +2

Query  158   QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
             +V M++++ +   SL+ +  +      NF  D  + FG    ++   G  + L+LD+ +G
Sbjct  6     EVSMVLVVSLFVTSLMAITASAG----NFYQDFDITFGGERAKILTGGQLLTLSLDKFSG  61

Query  338   SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
             SGF +KNEYL GR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PYT+
Sbjct  62    SGFKSKNEYLLGRIDMQIKLVSGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTL  120

Query  518   HTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPF  697
             HTNV+SQGKGN+EQQFHLWFDPT AFHTY+I+WN QRIIF+VDN PIRVF+N E+IG+PF
Sbjct  121   HTNVFSQGKGNREQQFHLWFDPTKAFHTYSIVWNSQRIIFLVDNIPIRVFHNLETIGVPF  180

Query  698   P*SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAA  877
             P +QPMR+Y SLWNADDWAT+GGLVKTDW++APFTA YRNF A+    T   +S   ++A
Sbjct  181   PKNQPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFQAS----TTSTNSLTEQSA  236

Query  878   ASNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
                     WQTQGLD  GRNR+RWVQ K M+YNYC+D KRFPQG  AEC+RSRF
Sbjct  237   --------WQTQGLDAAGRNRLRWVQQKFMIYNYCSDLKRFPQGLPAECRRSRF  282



>gb|EPS58668.1| hypothetical protein M569_16144, partial [Genlisea aurea]
Length=273

 Score =   369 bits (946),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 180/288 (63%), Positives = 218/288 (76%), Gaps = 15/288 (5%)
 Frame = +2

Query  176   IIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTK  355
             +  +V C LV  A A      NF +DV + +G+   Q+ D+GN + L+LD+ +GSGF ++
Sbjct  1     VYALVVCVLVATAAA------NFYSDVDVTWGDGRAQILDSGNELTLSLDKSSGSGFQSR  54

Query  356   NEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYS  535
             N+YLFGRFDMQ+KLV G SAGTVTTF+L+S  G  HDE+DFEFLGN++  PYTVHTNV++
Sbjct  55    NQYLFGRFDMQLKLVPGNSAGTVTTFFLSSQ-GADHDEIDFEFLGNSSGDPYTVHTNVFA  113

Query  536   QGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPM  715
             QGKGN+EQQF LWFDPTA FHTY+I+WNPQRIIFMVD  PIRVF+N+++IGIPFP +Q M
Sbjct  114   QGKGNREQQFRLWFDPTADFHTYSIVWNPQRIIFMVDQIPIRVFSNNQAIGIPFPNTQAM  173

Query  716   RVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNN  895
             RVYCSLWNADDWATQGG VKTDWS APFTA YRNF  NAC       S  F + A     
Sbjct  174   RVYCSLWNADDWATQGGRVKTDWSLAPFTASYRNFAINAC-SPGQCGSDTFSSGA-----  227

Query  896   QEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
               W+TQ LD +GRNR+RWVQ  +M+YNYC D KRFPQG   ECK+SRF
Sbjct  228   --WKTQALDAQGRNRLRWVQQNYMIYNYCTDYKRFPQGIPVECKQSRF  273



>ref|XP_009377610.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Pyrus 
x bretschneideri]
Length=294

 Score =   369 bits (948),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 177/293 (60%), Positives = 216/293 (74%), Gaps = 6/293 (2%)
 Frame = +2

Query  161   VCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGS  340
             V M++ + +   SL+     +     NF  D  + FG+   ++ + G  + LNLDQ +GS
Sbjct  8     VNMVLFLSLFTTSLM----VMAASAGNFYQDFDVTFGDGRAKILNGGQLLTLNLDQASGS  63

Query  341   GFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVH  520
             GF +KNEYL GR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PYT+H
Sbjct  64    GFKSKNEYLLGRIDMQIKLVTGNSAGTVTAYYLSSE-GPTHDEIDFEFLGNVSGDPYTLH  122

Query  521   TNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP  700
             TNV+SQGKGN+EQQF LWFDPT AFHTY+I+WN QRIIF+VDN PIRVFNN ES+G+PFP
Sbjct  123   TNVFSQGKGNREQQFQLWFDPTNAFHTYSIVWNSQRIIFLVDNIPIRVFNNLESVGVPFP  182

Query  701   *SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAA  880
              +QPMR+Y SLWNADDWAT+GGLVKTDW++APFTA YRNF ANAC   +  S  +  +  
Sbjct  183   KNQPMRIYSSLWNADDWATRGGLVKTDWTKAPFTASYRNFKANACTADSSSSCASTASTN  242

Query  881   SNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
             S   +  WQTQGLD  GRNR+RWV  K M+YNYC D KRFPQG  AEC+RSRF
Sbjct  243   S-VGDSAWQTQGLDAAGRNRLRWVHQKFMIYNYCNDLKRFPQGLPAECRRSRF  294



>ref|XP_002520387.1| Brassinosteroid-regulated protein BRU1 precursor, putative [Ricinus 
communis]
 gb|EEF42003.1| Brassinosteroid-regulated protein BRU1 precursor, putative [Ricinus 
communis]
Length=287

 Score =   369 bits (946),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 175/290 (60%), Positives = 216/290 (74%), Gaps = 10/290 (3%)
 Frame = +2

Query  170   IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
             ++ + V+ C L            NF     + +G+  G++ + G  + L+LD+ +GSGF 
Sbjct  7     LLSVFVICCLLA-------VSEANFYKHFDITWGDQRGKILNGGQLLTLSLDKASGSGFQ  59

Query  350   TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
             +KNEYLFGR DMQ+KLV G SAGTVTTFYL+S  G  HDE+DFEFLGN +  PY +HTNV
Sbjct  60    SKNEYLFGRIDMQIKLVPGNSAGTVTTFYLSSQ-GPNHDEIDFEFLGNLSGDPYILHTNV  118

Query  530   YSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQ  709
             +SQGKGN+EQQFHLWFDPT AFHTY+I+WN QRI+F+VDN PIRVFNN ESIG+PFP  +
Sbjct  119   FSQGKGNREQQFHLWFDPTLAFHTYSIVWNAQRIMFLVDNIPIRVFNNLESIGVPFPNKK  178

Query  710   PMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNS  889
             PMR+Y SLWNADDWAT+GGLVKTDW++APFTA YRNFNANACV ++G S C   +  S  
Sbjct  179   PMRIYSSLWNADDWATRGGLVKTDWTKAPFTASYRNFNANACVWSSG-SPCELISTNS-L  236

Query  890   NNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
              +  WQ Q L+  GRNR+RWV  K+M+YNYC D KRFP+G   ECKRSRF
Sbjct  237   QDSAWQLQELNASGRNRIRWVHQKYMIYNYCTDFKRFPEGLPPECKRSRF  286



>ref|XP_004303860.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16-like [Fragaria vesca subsp. vesca]
Length=296

 Score =   369 bits (946),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 175/296 (59%), Positives = 218/296 (74%), Gaps = 8/296 (3%)
 Frame = +2

Query  161   VCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGS  340
             +  ++++ +   SL+ +  +      NF  D  + FG+   ++ + G  + LNLD+ +GS
Sbjct  6     ISRMLLLSLFITSLLAMTASAG----NFFQDFDITFGDQRAKILEGGQFLTLNLDKYSGS  61

Query  341   GFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVH  520
             GF +K EYLFGR DMQ+KLV G SAGTVTT+YL+S  G  HDE+DFEFLGN++  PYT+H
Sbjct  62    GFKSKKEYLFGRIDMQIKLVPGNSAGTVTTYYLSSE-GPTHDEIDFEFLGNSSGNPYTLH  120

Query  521   TNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP  700
             TNV+SQGKG++EQQFHLWFDPT AFHTY+ +WN QRIIF+VDN PIRVFNN ES G+PFP
Sbjct  121   TNVFSQGKGDREQQFHLWFDPTKAFHTYSFVWNSQRIIFLVDNIPIRVFNNLESFGVPFP  180

Query  701   *SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYY-RNFNANACVVTNGVSSCNFKAA  877
              +QPMRVY SLWNADDWATQGG VKTDW++APF  +  + + ANACV  +  SSC     
Sbjct  181   KNQPMRVYSSLWNADDWATQGGRVKTDWTQAPFYCFIPKPYKANACVAGSSSSSCGVATT  240

Query  878   ASNSNNQE--WQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
             AS  + Q+  WQTQ LD  GRNR+RWVQ K MVYNYC+D KRFPQG   ECKRSRF
Sbjct  241   ASTDSTQQGAWQTQTLDAAGRNRLRWVQQKFMVYNYCSDLKRFPQGLPVECKRSRF  296



>ref|XP_008229400.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Prunus 
mume]
Length=285

 Score =   368 bits (944),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 175/294 (60%), Positives = 216/294 (73%), Gaps = 14/294 (5%)
 Frame = +2

Query  158   QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
             +V M++++ +   SL+ +  +      NF  D  + FG    ++ + G  + LNLD+ +G
Sbjct  6     EVSMVLVVSLFVTSLMAMTASAG----NFYQDFDITFGGERAKILNGGQLLTLNLDKFSG  61

Query  338   SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
             SGF +KNEYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PYT+
Sbjct  62    SGFKSKNEYLFGRIDMQIKLVSGNSAGTVTAYYLSSE-GPTHDEIDFEFLGNLSGDPYTL  120

Query  518   HTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPF  697
             HTNV+SQGKGN+EQQF LWFDPT AFHTY+I+WN QRIIF+VDN PIRVF+N E+IG+PF
Sbjct  121   HTNVFSQGKGNREQQFQLWFDPTKAFHTYSIVWNSQRIIFLVDNIPIRVFHNLETIGVPF  180

Query  698   P*SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAA  877
             P SQPMR+Y SLWNADDWAT+GGLVKTDW++APFTA YRNF          VS+    + 
Sbjct  181   PKSQPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFK---------VSTTASTST  231

Query  878   ASNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
              S +    WQTQGLD  GRNR+RWVQ K MVYNYC+D KRFPQG   EC+RSRF
Sbjct  232   NSLTEQSAWQTQGLDAAGRNRIRWVQQKFMVYNYCSDLKRFPQGLPVECRRSRF  285



>ref|XP_009356633.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Pyrus 
x bretschneideri]
Length=294

 Score =   368 bits (944),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 173/294 (59%), Positives = 217/294 (74%), Gaps = 5/294 (2%)
 Frame = +2

Query  158   QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
             +V MI+ + +   SL+ +A        NF  D  + FG+   ++ D G  + LNLDQ +G
Sbjct  6     KVSMILFLSLFINSLMAMAAQAG----NFYQDFDITFGDGRAKILDRGKLLTLNLDQVSG  61

Query  338   SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
             SGF +KNEYLFGR DMQ+KLV G SAGTVTT+YL+S  G  HDE+DFEFLGN+T +PYT+
Sbjct  62    SGFKSKNEYLFGRIDMQIKLVPGNSAGTVTTYYLSSE-GLTHDEIDFEFLGNSTGEPYTL  120

Query  518   HTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPF  697
             HTNV+SQGKG +EQQFHLWFDPT  FHTY+I+W+ Q IIF+VD+ PIRVFNN ES G+PF
Sbjct  121   HTNVFSQGKGGREQQFHLWFDPTKTFHTYSIVWSRQNIIFLVDSIPIRVFNNLESAGVPF  180

Query  698   P*SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAA  877
             P +QPMRVY SLWNA+D AT+GGLVKT+W+ APFTA YRNF ANAC+  +  S  +    
Sbjct  181   PKTQPMRVYSSLWNAEDGATRGGLVKTNWTLAPFTATYRNFKANACIAGSSSSCASTIPT  240

Query  878   ASNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
                +    W+TQG+D  GR R+RWVQ K M+YNYC+D KRFP+G  AECK+SRF
Sbjct  241   NPLTEKSAWETQGIDAAGRKRLRWVQQKFMIYNYCSDFKRFPEGLPAECKQSRF  294



>gb|KDP33066.1| hypothetical protein JCGZ_13603 [Jatropha curcas]
Length=271

 Score =   367 bits (942),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 172/267 (64%), Positives = 210/267 (79%), Gaps = 3/267 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  +  + +G+   ++ + G  + L+LD+ +GSGF +KNEYLFGR D+Q+KLV G SAG
Sbjct  7     NFYQNFDITWGDGRAKILNGGQLLTLSLDKASGSGFQSKNEYLFGRIDVQIKLVPGNSAG  66

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL+S  G  HDE+DFEFLGN++  PY +HTNVYSQGKGN+EQQF+LWFDPT  FH
Sbjct  67    TVTTFYLSSQ-GPNHDEIDFEFLGNSSGDPYILHTNVYSQGKGNREQQFYLWFDPTLTFH  125

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN Q+IIFMVDN PIRVFNN ESIG+PFP  QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  126   TYSIVWNAQKIIFMVDNIPIRVFNNLESIGVPFPNKQPMRIYSSLWNADDWATRGGLVKT  185

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW+ APF A YRNF ANACV ++G S C   +  S   + +WQ Q LD  GRNR+RWVQ 
Sbjct  186   DWTNAPFIASYRNFKANACVWSSG-SPCALTSTNS-LQDSKWQVQELDASGRNRLRWVQK  243

Query  959   KHMVYNYCADAKRFPQGFSAECKRSRF  1039
             K+M+YNYC+D KRFPQG  +ECKRSRF
Sbjct  244   KYMIYNYCSDYKRFPQGLPSECKRSRF  270



>ref|XP_008225386.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Prunus 
mume]
Length=282

 Score =   367 bits (942),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 174/290 (60%), Positives = 215/290 (74%), Gaps = 12/290 (4%)
 Frame = +2

Query  170   IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
             +++I +  CS +  + A      NF  D  + +G+H  ++   G+ + L+LDQ +GSGF 
Sbjct  5     LILISLFLCSFMAASSAG-----NFYQDFDLIWGDHRAKILSGGSLLTLSLDQASGSGFQ  59

Query  350   TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
             +K +YLFGR DMQ+KLV G SAGTVT +YL+S  G   DE+DFEFLGN +  PY +HTNV
Sbjct  60    SKRQYLFGRIDMQLKLVAGNSAGTVTAYYLSSE-GPNRDEIDFEFLGNLSGDPYVMHTNV  118

Query  530   YSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQ  709
             Y+QGK ++EQQF+LWFDPT  FHTY+ LWNPQRIIF+VDN PIRVF+N ES G+PFP  Q
Sbjct  119   YTQGKADREQQFYLWFDPTKDFHTYSFLWNPQRIIFLVDNIPIRVFDNGESYGVPFPKRQ  178

Query  710   PMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNS  889
             PM++Y SLWNAD WAT+GGLVKTDWS+APFTA+YRNF ANACV + G SSC     ASN 
Sbjct  179   PMKLYSSLWNADQWATKGGLVKTDWSKAPFTAFYRNFKANACVWSKGSSSC-----ASNK  233

Query  890   NNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
             NN  WQTQGLD   R R+RWVQ   M+YNYC+D KRFPQG   EC+RSRF
Sbjct  234   NN-AWQTQGLDANSRRRLRWVQKYFMIYNYCSDLKRFPQGRPRECRRSRF  282



>ref|XP_007211780.1| hypothetical protein PRUPE_ppa009685mg [Prunus persica]
 gb|EMJ12979.1| hypothetical protein PRUPE_ppa009685mg [Prunus persica]
Length=282

 Score =   367 bits (942),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 172/290 (59%), Positives = 214/290 (74%), Gaps = 12/290 (4%)
 Frame = +2

Query  170   IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
             +++I +  CS +  + A      NF  D  + +G+H  ++   G+ + L+LDQ +GSGF 
Sbjct  5     LILISLFLCSFMAASSAG-----NFYQDFDLIWGDHRAKILSGGSLLTLSLDQASGSGFQ  59

Query  350   TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
             +K +YLFGR DMQ+KLV G SAGTVT +YL+S  G   DE+DFEFLGN +  PY VHTNV
Sbjct  60    SKRQYLFGRIDMQLKLVAGNSAGTVTAYYLSSE-GPNRDEIDFEFLGNLSGDPYIVHTNV  118

Query  530   YSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQ  709
             Y+QGK ++EQQF+LWFDPT  FHTY+ LWNPQRIIF+VDN PIRVF+N ES G+PFP  Q
Sbjct  119   YTQGKADREQQFYLWFDPTKDFHTYSFLWNPQRIIFLVDNIPIRVFDNGESYGVPFPKRQ  178

Query  710   PMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNS  889
             PM++Y SLWNAD WAT+GGLVKTDWS+APFTA+YRNF ANACV + G SSC      +N+
Sbjct  179   PMKLYSSLWNADQWATKGGLVKTDWSKAPFTAFYRNFKANACVWSKGSSSC------ANN  232

Query  890   NNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
              N  WQTQGLD   R R+RWVQ   M+YNYC+D KRFPQG   EC+RSRF
Sbjct  233   KNNAWQTQGLDANSRRRLRWVQKYFMIYNYCSDLKRFPQGRPRECRRSRF  282



>gb|KHG09063.1| Xyloglucan endotransglucosylase/hydrolase 22 -like protein [Gossypium 
arboreum]
Length=292

 Score =   366 bits (940),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 171/289 (59%), Positives = 219/289 (76%), Gaps = 8/289 (3%)
 Frame = +2

Query  170   IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
             +++  +VAC ++  + +      NF+ND  + +G+  G++  NG  + L+LD+Q+GSGF 
Sbjct  11    LLMPLMVACLIMAASGS------NFHNDFDITWGDGRGKIASNGEVLTLSLDKQSGSGFQ  64

Query  350   TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
             +KNEYLFG+ DMQ+KLV G SAGTVT +YL+S  G   DE+DFEFLGN +  PY +HTNV
Sbjct  65    SKNEYLFGKIDMQLKLVPGNSAGTVTAYYLSSK-GSTWDEIDFEFLGNLSGDPYILHTNV  123

Query  530   YSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQ  709
             +SQGKGN+EQQF+LWFDPT  FHTY+ILWNPQRIIF VD+ PIR F N ESIG+PFP +Q
Sbjct  124   FSQGKGNREQQFYLWFDPTTDFHTYSILWNPQRIIFSVDDTPIREFKNMESIGVPFPKNQ  183

Query  710   PMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKA-AASN  886
             PMR+Y SLWNADDWAT+GGL+KTDW++APFTA YRNFNA+ACV +NG SSC   A ++S 
Sbjct  184   PMRIYSSLWNADDWATRGGLLKTDWTQAPFTASYRNFNADACVWSNGASSCKSNAPSSST  243

Query  887   SNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRS  1033
             S N  W +Q +D     R++WVQ  +M+YNYC DAKRFPQG   ECK S
Sbjct  244   STNNAWFSQEMDSAKMQRLQWVQQNYMIYNYCTDAKRFPQGLPPECKMS  292



>gb|EYU29581.1| hypothetical protein MIMGU_mgv1a022262mg [Erythranthe guttata]
Length=272

 Score =   365 bits (938),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 179/286 (63%), Positives = 215/286 (75%), Gaps = 18/286 (6%)
 Frame = +2

Query  182   GVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNE  361
             G+    L+   +A  P   NF  D ++ +G+   ++ D G  ++L+LDQ +GSGF +KNE
Sbjct  5     GISLFVLLACLVAAAPSTANFIRDAEITWGDGRAKIVDGGRGLSLSLDQFSGSGFQSKNE  64

Query  362   YLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQG  541
             YLFGRFDMQ+KLV   SAGTVTTF+L+S  G+ HDE+DFEFLGN+T +PYTVHTNVY+QG
Sbjct  65    YLFGRFDMQLKLVPDNSAGTVTTFFLSSQ-GEGHDEIDFEFLGNSTGEPYTVHTNVYAQG  123

Query  542   KGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRV  721
             KG+KEQQF LWFDPTAAFHTY+I+WNPQRIIF+VDN+PIRVFNNH++ G+ FP SQPMRV
Sbjct  124   KGDKEQQFKLWFDPTAAFHTYSIVWNPQRIIFLVDNSPIRVFNNHKASGVQFPTSQPMRV  183

Query  722   YCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQE  901
             YCSLWNADDWATQGG VKTDW++APF A YRNF   +C            AA +   + E
Sbjct  184   YCSLWNADDWATQGGRVKTDWAKAPFVANYRNFKIESC------------AAGTPCASHE  231

Query  902   WQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
                  LD  GRNR+RWVQ KHMVYNYCADA RFP G S ECKRSRF
Sbjct  232   -----LDSNGRNRLRWVQQKHMVYNYCADATRFPLGTSIECKRSRF  272



>ref|XP_008229405.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Prunus 
mume]
Length=288

 Score =   366 bits (940),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 175/294 (60%), Positives = 215/294 (73%), Gaps = 14/294 (5%)
 Frame = +2

Query  158   QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
             +V M+ I+ +V  SL+ +  +      NF  D  + FG+   ++ + G  + LNLD+ +G
Sbjct  9     KVSMVFILSLVITSLMAMTASAG----NFFQDFDVTFGDERAKILNGGQLLTLNLDKASG  64

Query  338   SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
             SGF +KNEYL GR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PYT+
Sbjct  65    SGFKSKNEYLLGRIDMQIKLVSGNSAGTVTAYYLSSE-GPTHDEIDFEFLGNLSGDPYTL  123

Query  518   HTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPF  697
             HTNV+SQGKGN+EQQFHLWFDPT AFHTY+I+WN QRIIF+VDN PIRVF N E+IG+PF
Sbjct  124   HTNVFSQGKGNREQQFHLWFDPTKAFHTYSIVWNSQRIIFLVDNIPIRVFTNLETIGVPF  183

Query  698   P*SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAA  877
             P +QPMR+Y SLWNADDWAT+GGLVKTDW++APFTA YRNF          VS+    + 
Sbjct  184   PKNQPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFK---------VSTTTSTST  234

Query  878   ASNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
              S +    W TQGLD  GRNR+RWVQ K MVYNYC+D KRFPQG   EC+RSRF
Sbjct  235   NSLTEQSAWPTQGLDAAGRNRLRWVQQKFMVYNYCSDLKRFPQGLPVECRRSRF  288



>gb|KCW89706.1| hypothetical protein EUGRSUZ_A01968 [Eucalyptus grandis]
Length=340

 Score =   367 bits (943),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 176/267 (66%), Positives = 216/267 (81%), Gaps = 2/267 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + +G+H  Q+ + G  + L+LDQ +GSGF +KNEYLFGR DM++KLV+G SAG
Sbjct  75    NFYKDFDITWGDHRSQILNGGQELTLSLDQASGSGFKSKNEYLFGRIDMEIKLVEGNSAG  134

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TV  +YL+S  G  HDE+DFEFLGN +  PYT+HTNV+SQGKGN+EQQFHLWFDPT AFH
Sbjct  135   TVNAYYLSSQ-GPTHDEIDFEFLGNLSGNPYTLHTNVFSQGKGNREQQFHLWFDPTKAFH  193

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN +RIIF+VDN+PIRVFNN ESIG+PFP +QPMR+Y SLWNADDWAT GG VKT
Sbjct  194   TYSIVWNTRRIIFLVDNSPIRVFNNLESIGVPFPSNQPMRIYSSLWNADDWATMGGRVKT  253

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW++APFTA +RNFNANACVV++G SSC  K + +N     WQ Q L+  GRNR+RWVQ 
Sbjct  254   DWTKAPFTASFRNFNANACVVSSGSSSCGSK-STNNLQTSAWQEQSLNAAGRNRLRWVQQ  312

Query  959   KHMVYNYCADAKRFPQGFSAECKRSRF  1039
             K+M+YNYC+D+KRFPQG   ECKRSRF
Sbjct  313   KYMIYNYCSDSKRFPQGLPPECKRSRF  339



>ref|XP_011016785.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15 [Populus euphratica]
Length=294

 Score =   365 bits (938),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 177/298 (59%), Positives = 222/298 (74%), Gaps = 9/298 (3%)
 Frame = +2

Query  146   KQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLD  325
             + ++   M++   + AC L+GV+        NF  D  + +G+   ++ + G  + L+LD
Sbjct  5     RSRKLSSMLLFTLLFAC-LMGVSKGG-----NFFQDFDITWGDQRAKILNGGQLLTLSLD  58

Query  326   QQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQ  505
             + +GSGF +KNEYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGNAT +
Sbjct  59    KASGSGFQSKNEYLFGRIDMQIKLVAGNSAGTVTAYYLSSQ-GSTHDEIDFEFLGNATGE  117

Query  506   PYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESI  685
             PY VHTNV+SQGKG++EQQF+LWFDPT AFHTY+I+WN QRIIF+VDN PIRVF+N ESI
Sbjct  118   PYIVHTNVFSQGKGDREQQFYLWFDPTKAFHTYSIVWNQQRIIFLVDNIPIRVFHNLESI  177

Query  686   GIPFP*SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCN  865
             G+PFP  Q MR++ SLWNADDWAT+GGLVKTDW++APFTA YRNF ANAC+ +   S C 
Sbjct  178   GVPFPNKQAMRIHSSLWNADDWATRGGLVKTDWTQAPFTASYRNFKANACIWSPA-SPCT  236

Query  866   FKAAASNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
               +  S  +N  WQ Q LD  GRNR+RWVQ K+M+YNYC D KRFPQG   ECKRSRF
Sbjct  237   STSPNSVQDN-AWQVQALDAPGRNRLRWVQQKYMIYNYCTDLKRFPQGLPPECKRSRF  293



>ref|XP_010053265.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16 [Eucalyptus grandis]
Length=291

 Score =   365 bits (938),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 176/267 (66%), Positives = 216/267 (81%), Gaps = 2/267 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + +G+H  Q+ + G  + L+LDQ +GSGF +KNEYLFGR DM++KLV+G SAG
Sbjct  26    NFYKDFDITWGDHRSQILNGGQELTLSLDQASGSGFKSKNEYLFGRIDMEIKLVEGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TV  +YL+S  G  HDE+DFEFLGN +  PYT+HTNV+SQGKGN+EQQFHLWFDPT AFH
Sbjct  86    TVNAYYLSSQ-GPTHDEIDFEFLGNLSGNPYTLHTNVFSQGKGNREQQFHLWFDPTKAFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN +RIIF+VDN+PIRVFNN ESIG+PFP +QPMR+Y SLWNADDWAT GG VKT
Sbjct  145   TYSIVWNTRRIIFLVDNSPIRVFNNLESIGVPFPSNQPMRIYSSLWNADDWATMGGRVKT  204

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW++APFTA +RNFNANACVV++G SSC  K + +N     WQ Q L+  GRNR+RWVQ 
Sbjct  205   DWTKAPFTASFRNFNANACVVSSGSSSCGSK-STNNLQTSAWQEQSLNAAGRNRLRWVQQ  263

Query  959   KHMVYNYCADAKRFPQGFSAECKRSRF  1039
             K+M+YNYC+D+KRFPQG   ECKRSRF
Sbjct  264   KYMIYNYCSDSKRFPQGLPPECKRSRF  290



>ref|XP_002520388.1| Brassinosteroid-regulated protein BRU1 precursor, putative [Ricinus 
communis]
 gb|EEF42004.1| Brassinosteroid-regulated protein BRU1 precursor, putative [Ricinus 
communis]
Length=287

 Score =   365 bits (937),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 170/267 (64%), Positives = 209/267 (78%), Gaps = 3/267 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF     + +G+H G++ + G  + L+LD+ +GSGF +KNEYLFGR DMQ+KLV G SAG
Sbjct  23    NFYKHFDITWGDHRGKILNGGQLLTLSLDKASGSGFQSKNEYLFGRIDMQIKLVPGNSAG  82

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL+S  G  HDE+DFEFLGN +  PY +HTNV+SQGKGN+EQQF+LWFDPT AFH
Sbjct  83    TVTTFYLSSQ-GPNHDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTLAFH  141

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN QRI+F+VDN PIRVFNN E  G+PFP  +PMR+Y SLWNADDWAT+GGLVKT
Sbjct  142   TYSIVWNAQRIMFLVDNIPIRVFNNLEPKGVPFPNKKPMRIYSSLWNADDWATRGGLVKT  201

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW++APFTA YRNFNANACV ++G S C    + ++  +  WQ Q LD  GRNR+RWV  
Sbjct  202   DWTKAPFTASYRNFNANACVWSSG-SPCEL-ISTNSLQDSAWQVQELDVAGRNRIRWVHQ  259

Query  959   KHMVYNYCADAKRFPQGFSAECKRSRF  1039
             K+M+YNYC D KRFP+G   ECKRSRF
Sbjct  260   KYMIYNYCTDFKRFPEGLPPECKRSRF  286



>gb|EYU29580.1| hypothetical protein MIMGU_mgv1a018934mg [Erythranthe guttata]
Length=272

 Score =   364 bits (935),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 178/286 (62%), Positives = 215/286 (75%), Gaps = 18/286 (6%)
 Frame = +2

Query  182   GVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNE  361
             G+    L+   +A  P   NF  D ++ +G+   ++ D G  ++L+LDQ +GSGF +KNE
Sbjct  5     GISLFVLLACLVAAAPSTANFIRDAEITWGDGRAKIVDGGRGLSLSLDQFSGSGFQSKNE  64

Query  362   YLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQG  541
             YLFGRFDMQ+KLV   SAGTVTTF+L+S  G+ HDE+DFEFLGN+T +PYTVHTNVY+QG
Sbjct  65    YLFGRFDMQLKLVPDNSAGTVTTFFLSSQ-GEGHDEIDFEFLGNSTGEPYTVHTNVYAQG  123

Query  542   KGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRV  721
             KG+KEQQF LWFDPTAAFHTY+I+WNPQRIIF+VDN+PIRVFNNH++ G+ FP SQPMRV
Sbjct  124   KGDKEQQFKLWFDPTAAFHTYSIVWNPQRIIFLVDNSPIRVFNNHKASGVQFPTSQPMRV  183

Query  722   YCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQE  901
             YCSLWNADDWATQGG VKTDW++APF A YRNF   +C            AA +   + E
Sbjct  184   YCSLWNADDWATQGGRVKTDWAKAPFVANYRNFKIESC------------AAGTPCASHE  231

Query  902   WQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
                  LD  GRNR+RWVQ KHM+YNYCADA RFP G S ECKRSRF
Sbjct  232   -----LDSNGRNRLRWVQQKHMLYNYCADATRFPLGTSIECKRSRF  272



>ref|XP_002302146.2| xyloglucan endo-1 family protein [Populus trichocarpa]
 gb|EEE81419.2| xyloglucan endo-1 family protein [Populus trichocarpa]
Length=294

 Score =   365 bits (937),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 175/298 (59%), Positives = 222/298 (74%), Gaps = 9/298 (3%)
 Frame = +2

Query  146   KQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLD  325
             + ++   M++   + AC L+G +        NF  D  + +G+   ++ + G  + L+LD
Sbjct  5     RSRKLSSMLLFTLLFAC-LMGASKGG-----NFFQDFDITWGDQRAKILNGGQLLTLSLD  58

Query  326   QQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQ  505
             + +GSGF +KNEYLFG+ DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGNAT +
Sbjct  59    KASGSGFQSKNEYLFGQIDMQIKLVAGNSAGTVTAYYLSSQ-GSTHDEIDFEFLGNATGE  117

Query  506   PYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESI  685
             PY +HTNV+SQGKGN+EQQF+LWFDPT AFHTY+I+WN QRIIF+VDN PIRVF+N ESI
Sbjct  118   PYILHTNVFSQGKGNREQQFYLWFDPTKAFHTYSIVWNQQRIIFLVDNIPIRVFHNLESI  177

Query  686   GIPFP*SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCN  865
             G+PFP  Q MR++ SLWNADDWAT+GGLVKTDW++APFTA YRNF ANAC+ ++  S C 
Sbjct  178   GVPFPNKQAMRIHSSLWNADDWATRGGLVKTDWTQAPFTASYRNFKANACIWSSA-SPCT  236

Query  866   FKAAASNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
               +  S  +N  WQ Q LD  GRNR+RWVQ K+M+YNYC D KRFPQG   ECKRSRF
Sbjct  237   STSPNSVQDN-AWQVQALDAPGRNRLRWVQQKYMIYNYCTDLKRFPQGLPPECKRSRF  293



>gb|KDP35747.1| hypothetical protein JCGZ_10519 [Jatropha curcas]
Length=271

 Score =   364 bits (935),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 172/268 (64%), Positives = 211/268 (79%), Gaps = 5/268 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF ND  + +G+   ++ + G  + L+LD+ +GSGF +KNEYLFGR DMQ+KLV G SAG
Sbjct  7     NFYNDFDITWGDGRAKILNGGQLLTLSLDKASGSGFRSKNEYLFGRIDMQIKLVPGNSAG  66

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL+S  G  HDE+D EFLGN++  PY +HTNV+SQGKGN+EQQF+LWFDPT  FH
Sbjct  67    TVTTFYLSSQ-GPNHDEIDLEFLGNSSGDPYILHTNVFSQGKGNREQQFYLWFDPTFTFH  125

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN Q+IIF+VDN PIRVFNN ESIG+PFP  QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  126   TYSIVWNAQKIIFLVDNIPIRVFNNLESIGVPFPSKQPMRIYSSLWNADDWATRGGLVKT  185

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNS-NNQEWQTQGLDGKGRNRVRWVQ  955
             DW+ APF A YRNF ANACV ++G S C     ++NS  + +WQ Q LD  GRNR RWVQ
Sbjct  186   DWTNAPFIASYRNFKANACVWSSG-SPC--AVTSTNSLQDSKWQVQELDASGRNRPRWVQ  242

Query  956   SKHMVYNYCADAKRFPQGFSAECKRSRF  1039
              K+M+YNYC+D +RFPQG  +ECKRSRF
Sbjct  243   KKYMIYNYCSDYQRFPQGLPSECKRSRF  270



>ref|XP_007217342.1| hypothetical protein PRUPE_ppa020825mg [Prunus persica]
 gb|EMJ18541.1| hypothetical protein PRUPE_ppa020825mg [Prunus persica]
Length=260

 Score =   364 bits (934),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 171/267 (64%), Positives = 205/267 (77%), Gaps = 13/267 (5%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + FG+   ++ + G  + LNLD+ +GSGF +KNEYL GR DMQ+KLV G SAG
Sbjct  7     NFFQDFDVTFGDQRAKILNGGQLLTLNLDKASGSGFKSKNEYLLGRIDMQIKLVSGNSAG  66

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNV+SQGKGN+EQQFHLWFDPT AFH
Sbjct  67    TVTAYYLSSE-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGNREQQFHLWFDPTEAFH  125

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN QRIIF+VDN PIRVF N E+IG+PFP +QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  126   TYSIVWNSQRIIFLVDNIPIRVFTNLETIGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  185

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW++APFTA YRNF A+    T   +S   ++A        WQTQGLD  GRNR+RWVQ 
Sbjct  186   DWTQAPFTASYRNFQAS----TTSTNSLTEQSA--------WQTQGLDAAGRNRLRWVQQ  233

Query  959   KHMVYNYCADAKRFPQGFSAECKRSRF  1039
             K MVYNYC+D KRFPQG   EC+RSRF
Sbjct  234   KFMVYNYCSDLKRFPQGLPVECRRSRF  260



>ref|XP_010450105.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15 [Camelina sativa]
Length=289

 Score =   363 bits (933),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 171/289 (59%), Positives = 220/289 (76%), Gaps = 9/289 (3%)
 Frame = +2

Query  170   IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
             I++  V+  S+VG A +      NF N+  + +G+H G++ + G+ ++L+LD+ +GSGF 
Sbjct  9     IVVATVLLMSMVGSAYSG-----NFFNEFDLTWGDHRGKIFNGGSMLSLSLDRVSGSGFK  63

Query  350   TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
             +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G+ HDE+DFEFLGN T +PY +HTNV
Sbjct  64    SKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GETHDEIDFEFLGNETGKPYVLHTNV  122

Query  530   YSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQ  709
             ++QGKGN+EQQF+LWFDPT  FHTY+I+W PQ IIF+VDN PIRVFNN E +G+PFP SQ
Sbjct  123   FAQGKGNREQQFYLWFDPTKNFHTYSIVWRPQHIIFLVDNLPIRVFNNAEKLGVPFPKSQ  182

Query  710   PMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNS  889
             PMR+Y SLWNADDWAT+GGLVKTDWS+APFTAYYR FNA AC V++G   C+ K  +S  
Sbjct  183   PMRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRGFNAAACTVSSG---CDPKFKSSFG  239

Query  890   NNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSR  1036
             + +      L+  GR R+RWVQ   M+YNYC+D KRFP+GF  ECKRSR
Sbjct  240   DGKLQIASELNAYGRRRLRWVQKYFMIYNYCSDLKRFPRGFPPECKRSR  288



>ref|XP_011026280.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15 isoform X1 [Populus euphratica]
Length=294

 Score =   363 bits (933),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 169/267 (63%), Positives = 208/267 (78%), Gaps = 3/267 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + +G+   ++ + G  + L+LD+ +GSGF +KNEYLFGR DMQ+KLV G SAG
Sbjct  30    NFFQDFDITWGDQRAKILNGGQLLTLSLDKASGSGFQSKNEYLFGRIDMQIKLVAGNSAG  89

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGNAT +PY +HTNV+SQGKG++EQQF+LWFDPT AFH
Sbjct  90    TVTAYYLSSQ-GSTHDEIDFEFLGNATGEPYILHTNVFSQGKGDREQQFYLWFDPTKAFH  148

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN QRIIF+VDN PIRVF+N ES+G+PFP  Q MR++ SLWNADDWAT+GGLVKT
Sbjct  149   TYSIVWNKQRIIFLVDNIPIRVFHNLESVGVPFPNKQAMRIHSSLWNADDWATRGGLVKT  208

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW++APFTA YRNF ANAC+ +   S C   +  S  +N  WQ Q LD  GRNR+RWVQ 
Sbjct  209   DWTQAPFTASYRNFKANACIWSPA-SPCTSTSPNSVQDN-AWQVQALDAPGRNRLRWVQQ  266

Query  959   KHMVYNYCADAKRFPQGFSAECKRSRF  1039
             K+M+YNYC D KRFPQG   ECKRSRF
Sbjct  267   KYMIYNYCTDLKRFPQGLPPECKRSRF  293



>ref|XP_002883457.1| hypothetical protein ARALYDRAFT_479888 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59716.1| hypothetical protein ARALYDRAFT_479888 [Arabidopsis lyrata subsp. 
lyrata]
Length=291

 Score =   363 bits (932),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 166/294 (56%), Positives = 221/294 (75%), Gaps = 6/294 (2%)
 Frame = +2

Query  155   QQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQT  334
             Q + + +++ ++  ++VG A +      +FN +  + +G H G++   G  ++L+LD+ +
Sbjct  3     QILNLTVLMTLLVVTMVGTAFSG-----SFNEEFDLTWGEHRGKIFSGGKMLSLSLDRVS  57

Query  335   GSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYT  514
             GSGF +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN T +PY 
Sbjct  58    GSGFKSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSE-GPTHDEIDFEFLGNETGKPYV  116

Query  515   VHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIP  694
             +HTNV++QGKGN+EQQF+LWFDPT  FHTY+++W PQ IIFMVDN PIRVFNN E +G+P
Sbjct  117   LHTNVFAQGKGNREQQFYLWFDPTKNFHTYSLVWRPQHIIFMVDNVPIRVFNNAEKLGVP  176

Query  695   FP*SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKA  874
             FP +QPM++Y SLWNADDWAT+GGLVKTDWS+APFTAYYR FNA AC V++G S C+ K 
Sbjct  177   FPKNQPMKIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRGFNAAACTVSSGSSFCDPKF  236

Query  875   AASNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSR  1036
              +S +N +      L+  GR R+RWVQ   M+Y+YC+D KRFPQGF  EC++SR
Sbjct  237   KSSFTNGESQVANELNAYGRRRLRWVQKYFMIYDYCSDLKRFPQGFPPECRKSR  290



>ref|XP_010246961.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Nelumbo 
nucifera]
Length=291

 Score =   363 bits (931),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 174/290 (60%), Positives = 223/290 (77%), Gaps = 8/290 (3%)
 Frame = +2

Query  170   IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
             +++I +V  SL+           +F  D  + +G+H  ++ + G  ++L+LD+ +GSGF 
Sbjct  9     VLLIALVMSSLMAACAG------SFYQDFDLTWGDHRAKIFNGGQLLSLSLDRTSGSGFQ  62

Query  350   TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
             +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +HTNV
Sbjct  63    SKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILHTNV  121

Query  530   YSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQ  709
             ++QGKGN+EQQF+LWFDPT  FHTY+I+WNPQRIIF+VDN PIR F+N ESIG+PFP +Q
Sbjct  122   FTQGKGNREQQFYLWFDPTRNFHTYSIVWNPQRIIFLVDNVPIREFSNAESIGVPFPKNQ  181

Query  710   PMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNS  889
             PMR+Y SLWNADDWAT+GGLVKTDWS+APFTAYYRNFNANACV ++G SSC+   + ++ 
Sbjct  182   PMRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRNFNANACVWSSGSSSCS-SRSTNSF  240

Query  890   NNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
              + +WQTQ LDG  R R+RWVQ  +M+YNYC D KRFPQG   EC+RSRF
Sbjct  241   KDSDWQTQELDGWSRRRLRWVQKYYMIYNYCTDLKRFPQGLPPECRRSRF  290



>ref|XP_006298237.1| hypothetical protein CARUB_v10014298mg [Capsella rubella]
 gb|EOA31135.1| hypothetical protein CARUB_v10014298mg [Capsella rubella]
Length=291

 Score =   363 bits (931),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 164/266 (62%), Positives = 207/266 (78%), Gaps = 1/266 (0%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             +FN +  + +G H G++   G  ++L+LD+ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  26    SFNEEFDLTWGEHRGKIFSGGKMLSLSLDRVSGSGFKSKKEYLFGRIDMQLKLVAGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN T +PY +HTNV++QGKGN+EQQF+LWFDPT  FH
Sbjct  86    TVTAYYLSSE-GPTHDEIDFEFLGNETGKPYVLHTNVFAQGKGNREQQFYLWFDPTKNFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+++W PQ IIFMVDN PIRVFNN E +G+PFP +QPM++Y SLWNADDWAT+GGLVKT
Sbjct  145   TYSLVWRPQHIIFMVDNVPIRVFNNAEKLGVPFPKNQPMKIYSSLWNADDWATRGGLVKT  204

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWSRAPFTAYYR FNA AC V++G S C+ K  +S +N +      L+  GR R+RWVQ 
Sbjct  205   DWSRAPFTAYYRGFNAAACTVSSGSSFCDPKFKSSFTNGKSQVANELNAYGRRRLRWVQK  264

Query  959   KHMVYNYCADAKRFPQGFSAECKRSR  1036
               M+Y+YC+D KRFPQGF  EC+RSR
Sbjct  265   YFMIYDYCSDLKRFPQGFPPECRRSR  290



>ref|XP_007025220.1| Xyloglucan endotransglucosylase/hydrolase 16 [Theobroma cacao]
 gb|EOY27842.1| Xyloglucan endotransglucosylase/hydrolase 16 [Theobroma cacao]
Length=291

 Score =   363 bits (931),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 170/290 (59%), Positives = 215/290 (74%), Gaps = 8/290 (3%)
 Frame = +2

Query  170   IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
             ++++ +V  S +  +        +F+ + ++ +GN   Q+ D G  + L LD+ +GSGF 
Sbjct  9     MLLLSLVMGSFIAASAG------DFHQEFELTWGNERAQILDGGKLLTLTLDKTSGSGFR  62

Query  350   TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
             +KN+Y+FGR DMQ+KLV G SAGTVT FYL+S  G  HDE+DFEFLGN +  PY +HTNV
Sbjct  63    SKNQYIFGRIDMQIKLVAGNSAGTVTAFYLSSE-GPNHDEIDFEFLGNLSGDPYILHTNV  121

Query  530   YSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQ  709
             YSQGKG++EQQF+LWFDPT  FHTY+I+WN QRIIFMVD+ PIRVFNN ES G+PFP +Q
Sbjct  122   YSQGKGDREQQFYLWFDPTKNFHTYSIVWNLQRIIFMVDDIPIRVFNNEESYGVPFPKNQ  181

Query  710   PMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNS  889
             PM++Y SLW+AD WAT+GGLVKTDWS+APF AY+RNFNANAC  +NG S C  + + S  
Sbjct  182   PMKLYSSLWDADQWATRGGLVKTDWSKAPFKAYFRNFNANACTWSNGESGCASETSGSVR  241

Query  890   NNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
             NN  W+TQ LD  GR  +RWVQ   MVYNYC D KRFPQG   EC+RSRF
Sbjct  242   NNV-WRTQALDASGRRILRWVQKYFMVYNYCTDLKRFPQGRPRECRRSRF  290



>gb|KHF98175.1| putative xyloglucan endotransglucosylase/hydrolase 23 -like protein 
[Gossypium arboreum]
Length=290

 Score =   363 bits (931),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 171/289 (59%), Positives = 215/289 (74%), Gaps = 9/289 (3%)
 Frame = +2

Query  170   IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
             +++  +VAC +   A        NF+ND  + +G+  G++ +NG  + L+LD+ +GSGF 
Sbjct  10    LLVPLLVACLMASSAS-------NFHNDFDITWGDGRGKIVNNGEVLTLSLDKASGSGFQ  62

Query  350   TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
             +KNEYLFG+ DMQ+KLV G SAGTVT +YL+S  G   DE+DFEFLGN +  PY +HTNV
Sbjct  63    SKNEYLFGKIDMQLKLVPGNSAGTVTAYYLSSK-GSTWDEIDFEFLGNLSGDPYILHTNV  121

Query  530   YSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQ  709
             +SQGKGN+EQQF+LWFDPT  FHTY+ILWNPQRIIF VD  PIR F N ES G+PFP +Q
Sbjct  122   FSQGKGNREQQFYLWFDPTVDFHTYSILWNPQRIIFSVDGTPIREFKNMESFGVPFPKNQ  181

Query  710   PMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASN-  886
             PMR+Y SLWNADDWAT+GGLVKTDW+RAPFTA YRNFNA+ACV +NG SSC   A+ S+ 
Sbjct  182   PMRIYSSLWNADDWATRGGLVKTDWTRAPFTASYRNFNADACVWSNGASSCKSNASPSSA  241

Query  887   SNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRS  1033
             S N  W +Q +D   + R++WVQ  +M+YNYC DAKRFPQG   EC  S
Sbjct  242   STNSAWFSQEMDSAKQQRLKWVQKNYMIYNYCNDAKRFPQGLPPECNMS  290



>ref|XP_009108100.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15 [Brassica rapa]
Length=289

 Score =   363 bits (931),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 166/266 (62%), Positives = 210/266 (79%), Gaps = 4/266 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF N+  + +G+H G++ + GN ++L+LD+ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  27    NFFNEFDLTWGDHRGKIFNGGNMLSLSLDRVSGSGFKSKKEYLFGRIDMQLKLVAGNSAG  86

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTT+YL+S  G  HDE+DFEFLGN T +PY +HTNV++QGKGN+EQQF+LWFDPT  FH
Sbjct  87    TVTTYYLSSQ-GATHDEIDFEFLGNETGKPYVLHTNVFAQGKGNREQQFYLWFDPTKNFH  145

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+W PQ IIF+VDN PIRVFNN E +G+PFP +QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  146   TYSIVWRPQHIIFLVDNLPIRVFNNAEKLGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  205

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTAYYR FNA AC V++G   C+ K   S S+++      L+  GR R+RWVQ 
Sbjct  206   DWSKAPFTAYYRGFNAAACTVSSG---CDPKFKTSLSDSELQTANELNAYGRRRLRWVQK  262

Query  959   KHMVYNYCADAKRFPQGFSAECKRSR  1036
               M+YNYC+D KRFP+GF  EC+RSR
Sbjct  263   YFMIYNYCSDLKRFPRGFPPECRRSR  288



>ref|XP_010435185.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15 [Camelina sativa]
Length=289

 Score =   363 bits (931),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 172/289 (60%), Positives = 218/289 (75%), Gaps = 9/289 (3%)
 Frame = +2

Query  170   IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
             I++  V+  S+VG A +      NF N+  + +G+H G++ + GN ++L+LD+ +GSGF 
Sbjct  9     IVVATVLLMSMVGSAYSG-----NFFNEFDLTWGDHRGKIFNGGNMLSLSLDRVSGSGFK  63

Query  350   TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
             +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN T +PY +HTNV
Sbjct  64    SKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GATHDEIDFEFLGNETGKPYVLHTNV  122

Query  530   YSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQ  709
             ++QGKGN+EQQF+LWFDPT  FHTY+I+W PQ IIF+VDN PIRVFNN E +G+PFP SQ
Sbjct  123   FAQGKGNREQQFYLWFDPTKNFHTYSIVWRPQHIIFLVDNLPIRVFNNAEKLGVPFPKSQ  182

Query  710   PMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNS  889
             PMR+Y SLWNADDWAT+GGLVKTDWS+APFTAYYR FNA AC V++G   C+ K   S  
Sbjct  183   PMRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRGFNAAACTVSSG---CDPKFKRSFG  239

Query  890   NNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSR  1036
             + +      L+  GR R+RWVQ   M+YNYC+D KRFP+GF  ECKRSR
Sbjct  240   DGKLQVANELNAYGRRRLRWVQKYFMIYNYCSDLKRFPRGFPPECKRSR  288



>ref|XP_002268708.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Vitis 
vinifera]
Length=294

 Score =   362 bits (930),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 170/266 (64%), Positives = 208/266 (78%), Gaps = 2/266 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + +G+   ++ D G  + L+LD+ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  29    NFYQDFDLTWGDRRAKIVDGGKLLMLSLDRASGSGFQSKKEYLFGRIDMQLKLVSGNSAG  88

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  GQ HDE+DFEFLGN +  PY +HTNV++QGKGN+EQQF+LWFDPT  FH
Sbjct  89    TVTAYYLSSQ-GQTHDEIDFEFLGNLSGDPYILHTNVFTQGKGNREQQFYLWFDPTKNFH  147

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WNPQRIIF+VDN PIR F N ESIGIPFP SQPMR+Y SLWNAD+WAT+GG+VK 
Sbjct  148   TYSIIWNPQRIIFLVDNFPIRQFQNQESIGIPFPKSQPMRIYSSLWNADNWATRGGVVKI  207

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTA+YRNFNA AC+ + G SSC  K+ +  S N  WQTQGLD K R R+RWVQ 
Sbjct  208   DWSKAPFTAFYRNFNAAACIWSYGSSSCASKSVSPMS-NIGWQTQGLDAKSRRRLRWVQR  266

Query  959   KHMVYNYCADAKRFPQGFSAECKRSR  1036
              +M+YNYC D KRFP+G   EC+RSR
Sbjct  267   YYMIYNYCTDMKRFPEGLPPECRRSR  292



>ref|NP_566738.1| xyloglucan endotransglucosylase/hydrolase protein 16 [Arabidopsis 
thaliana]
 sp|Q8LG58.2|XTH16_ARATH RecName: Full=Probable xyloglucan endotransglucosylase/hydrolase 
protein 16; Short=At-XTH16; Short=XTH-16; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB01849.1| endoxyloglucan endotransglycosylase [Arabidopsis thaliana]
 dbj|BAD43567.1| putative xyloglucan endotransglycosylase [Arabidopsis thaliana]
 dbj|BAD43568.1| putative xyloglucan endotransglycosylase [Arabidopsis thaliana]
 gb|AEE76807.1| xyloglucan endotransglucosylase/hydrolase protein 16 [Arabidopsis 
thaliana]
Length=291

 Score =   361 bits (927),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 162/266 (61%), Positives = 207/266 (78%), Gaps = 1/266 (0%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             +FN +  + +G H G++   G  ++L+LD+ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  26    SFNEEFDLTWGEHRGKIFSGGKMLSLSLDRVSGSGFKSKKEYLFGRIDMQLKLVAGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN T +PY +HTNV++QGKGN+EQQF+LWFDPT  FH
Sbjct  86    TVTAYYLSSE-GPTHDEIDFEFLGNETGKPYVLHTNVFAQGKGNREQQFYLWFDPTKNFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+++W PQ IIFMVDN PIRVFNN E +G+PFP +QPM++Y SLWNADDWAT+GGLVKT
Sbjct  145   TYSLVWRPQHIIFMVDNVPIRVFNNAEQLGVPFPKNQPMKIYSSLWNADDWATRGGLVKT  204

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTAYYR FNA AC V++G S C+ K  +S +N +      L+  GR R+RWVQ 
Sbjct  205   DWSKAPFTAYYRGFNAAACTVSSGSSFCDPKFKSSFTNGESQVANELNAYGRRRLRWVQK  264

Query  959   KHMVYNYCADAKRFPQGFSAECKRSR  1036
               M+Y+YC+D KRFPQGF  EC++SR
Sbjct  265   YFMIYDYCSDLKRFPQGFPPECRKSR  290



>ref|XP_010525736.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
20-like [Tarenaya hassleriana]
Length=294

 Score =   361 bits (927),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 176/292 (60%), Positives = 215/292 (74%), Gaps = 9/292 (3%)
 Frame = +2

Query  158   QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
             +   +M+  +V+C  V  A        NF  DVQ+ +G+  G++ DNGN +AL+LDQ +G
Sbjct  12    RFLFLMLSLLVSCFAVAFAG-------NFQRDVQITWGDGRGKILDNGNLLALSLDQFSG  64

Query  338   SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
             SGF +KNE+L+G+ + Q+KLV G SAGTVTTFYL SP G   DE+DFEFLGN +  PYT+
Sbjct  65    SGFQSKNEFLYGKVEAQIKLVPGNSAGTVTTFYLKSP-GSTWDEIDFEFLGNLSGHPYTL  123

Query  518   HTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPF  697
             HTNVY+QGKG+KEQQFHLWFDPTA FHTY+I WNPQRIIF VD  PIR F N ESIG+PF
Sbjct  124   HTNVYTQGKGDKEQQFHLWFDPTADFHTYSITWNPQRIIFTVDGIPIREFKNFESIGVPF  183

Query  698   P*SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAA  877
             P +QPMR+Y SLW AD+WAT+GGLVKTDWS APFTA YRN+N N CV +NG SSC   + 
Sbjct  184   PKNQPMRLYASLWEADEWATRGGLVKTDWSHAPFTASYRNYNENGCVWSNGRSSCPANSP  243

Query  878   ASNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRS  1033
              S      W +Q LD +G+NRV+WVQ ++MVYNYC D KRFPQG   EC  S
Sbjct  244   GSRPGG-AWFSQELDFRGKNRVKWVQRRYMVYNYCTDKKRFPQGAPRECNMS  294



>ref|XP_010440528.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15 [Camelina sativa]
Length=290

 Score =   361 bits (926),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 171/295 (58%), Positives = 216/295 (73%), Gaps = 8/295 (3%)
 Frame = +2

Query  152   QQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQ  331
             Q     I++  V+  S+VG A +      NF N+  + +G+H G++ + GN ++L+LD+ 
Sbjct  3     QNSSLTIVVATVLLMSMVGSAYSG-----NFFNEFDLTWGDHRGKIFNGGNMLSLSLDRV  57

Query  332   TGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPY  511
             +GSGF +K EYLFGR DMQ+KLV G SAGTVT +Y  S  G  HDE+DFEFLGN T +PY
Sbjct  58    SGSGFKSKKEYLFGRIDMQLKLVAGNSAGTVTAYYKLSSQGATHDEIDFEFLGNETGKPY  117

Query  512   TVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGI  691
              +HTNV++QGKGN+EQQF+LWFDPT  FHTY+I+W PQ IIF+VDN PIRVFNN E +G 
Sbjct  118   VLHTNVFAQGKGNREQQFYLWFDPTKNFHTYSIVWRPQHIIFLVDNLPIRVFNNAEKLGA  177

Query  692   PFP*SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFK  871
             PFP SQPMR+Y SLWNADDWAT+GGLVKTDWS+APFTAYYR FNA AC V++G   C+ K
Sbjct  178   PFPKSQPMRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRGFNAAACTVSSG---CDPK  234

Query  872   AAASNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSR  1036
                S  + +      L+  GR R+RWVQ   M+YNYC+D KRFP+GF  ECK+SR
Sbjct  235   FKRSFGDGKLQVANELNAYGRRRLRWVQKYFMIYNYCSDLKRFPRGFPPECKKSR  289



>ref|XP_010512813.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16 [Camelina sativa]
Length=291

 Score =   361 bits (926),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 163/266 (61%), Positives = 205/266 (77%), Gaps = 1/266 (0%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NFN +  + +G H G++   G  ++L+LD+ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  26    NFNEEFDLTWGEHRGKIFSGGKMLSLSLDRVSGSGFKSKKEYLFGRIDMQLKLVAGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN T +PY +HTNV++QGKGN+EQQF+LWFDPT  FH
Sbjct  86    TVTAYYLSSE-GPTHDEIDFEFLGNETGKPYVLHTNVFAQGKGNREQQFYLWFDPTKNFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+++W PQ IIFMVDN PIRVFNN E +G+PFP  QPM++Y SLWNADDWAT+GGLVKT
Sbjct  145   TYSLVWRPQHIIFMVDNVPIRVFNNAEQLGVPFPKKQPMKIYSSLWNADDWATRGGLVKT  204

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTAYYR FNA AC V++G S C+ K  ++ +N +      L+  GR R+RWVQ 
Sbjct  205   DWSKAPFTAYYRGFNAAACTVSSGSSYCDPKFKSTFTNGESQVANELNAYGRRRLRWVQK  264

Query  959   KHMVYNYCADAKRFPQGFSAECKRSR  1036
               M+YNYC+D KRF QGF  EC+RSR
Sbjct  265   YFMIYNYCSDVKRFSQGFPPECRRSR  290



>gb|KFK24577.1| hypothetical protein AALP_AAs45078U000600 [Arabis alpina]
Length=289

 Score =   360 bits (925),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 167/287 (58%), Positives = 217/287 (76%), Gaps = 4/287 (1%)
 Frame = +2

Query  179   IGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKN  358
             +  V  +++ V ++      NF +D  + +G+H G++ + GN ++L+LD+ +GSGF +K 
Sbjct  7     LATVVAAILLVTMSGSAYSGNFLDDFDLTWGDHRGKIFNGGNMLSLSLDKVSGSGFKSKK  66

Query  359   EYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQ  538
             EYLFGR DMQ+KLV G SAGTVTT+YL+S  G  HDE+DFEFLGN T +PY +HTNV++Q
Sbjct  67    EYLFGRIDMQLKLVAGNSAGTVTTYYLSSE-GATHDEIDFEFLGNETGKPYVLHTNVFAQ  125

Query  539   GKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMR  718
             GKGNKEQQF+LWFDPT  FHTY+I+W PQ IIF+VDN PIRVFNN E +G+PFP +QPMR
Sbjct  126   GKGNKEQQFYLWFDPTKNFHTYSIVWRPQHIIFLVDNLPIRVFNNAEKLGVPFPKNQPMR  185

Query  719   VYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQ  898
             +Y SLWNADDWAT+GGLVKTDWS+APFTAYYR F A AC V++G   C+ K  +S ++ +
Sbjct  186   IYSSLWNADDWATRGGLVKTDWSKAPFTAYYRGFKAAACTVSSG---CDPKFKSSFTDGK  242

Query  899   EWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
                   L+  GR R+RWVQ   M+YNYC+D KRFP+ F  ECKRS+F
Sbjct  243   LQVANELNAYGRRRLRWVQKYFMIYNYCSDLKRFPREFPPECKRSKF  289



>ref|XP_010536006.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
20-like [Tarenaya hassleriana]
Length=283

 Score =   360 bits (924),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 172/263 (65%), Positives = 205/263 (78%), Gaps = 9/263 (3%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DVQ+ +GN  G+V +NGN +AL+LDQ +GSGF +KNE+L+GR + Q+KLV G SAG
Sbjct  28    NFERDVQITWGNGRGKVLENGNLLALSLDQFSGSGFQSKNEFLYGRVEAQIKLVPGNSAG  87

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL SP G   DE+DFEFLGN +  PYT+HTNVY+QGKG+KEQQFHLWFDPTA FH
Sbjct  88    TVTTFYLKSP-GATWDEIDFEFLGNLSGHPYTLHTNVYTQGKGDKEQQFHLWFDPTADFH  146

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I WNPQRIIF VD  PIR F N ESIG+PFP +QPMR+Y SLW AD+WAT+GGLVK 
Sbjct  147   TYSITWNPQRIIFTVDGIPIREFKNLESIGVPFPKNQPMRLYASLWEADEWATRGGLVKI  206

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWSRAPFTA YRN+NAN CV ++G SSC          N+ W +Q LD  G+NR++WVQS
Sbjct  207   DWSRAPFTASYRNYNANGCVWSSGRSSC--------PANKPWFSQELDFNGKNRMKWVQS  258

Query  959   KHMVYNYCADAKRFPQGFSAECK  1027
             ++MVYNYC D KR PQG   ECK
Sbjct  259   RYMVYNYCTDRKRSPQGAPPECK  281



>ref|XP_007034180.1| Xyloglucan endotransglucosylase/hydrolase 16 [Theobroma cacao]
 gb|EOY05106.1| Xyloglucan endotransglucosylase/hydrolase 16 [Theobroma cacao]
Length=291

 Score =   360 bits (925),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 174/293 (59%), Positives = 216/293 (74%), Gaps = 9/293 (3%)
 Frame = +2

Query  161   VCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGS  340
             V M++++G+V  SLV     V     +F  D  + +G+H  ++ + G  ++L+LD+ +GS
Sbjct  8     VSMLVLVGLVVNSLV-----VVAYAGDFYQDFDLTWGDHRAKIFNGGKLLSLSLDRVSGS  62

Query  341   GFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVH  520
             GF +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +H
Sbjct  63    GFQSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILH  121

Query  521   TNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP  700
             TNVY+QGKGN+EQQF LWFDPT  FHTY+I+W PQ IIF+VDN PIRVF N ES+G+PFP
Sbjct  122   TNVYTQGKGNREQQFFLWFDPTRNFHTYSIIWKPQHIIFLVDNTPIRVFKNAESVGVPFP  181

Query  701   *SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAA  880
              SQPMR+Y SLWNADDWAT+GGLVKTDW++APFTAYYRNFNA AC  + G SSC   ++ 
Sbjct  182   KSQPMRIYSSLWNADDWATRGGLVKTDWTKAPFTAYYRNFNAKACTWSGGASSCASTSSV  241

Query  881   SNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
             S+     W+T  LD  GR R+RWVQ   M+YNYC D KRFPQG   ECKR RF
Sbjct  242   SDG---VWETNELDAPGRRRLRWVQKYFMIYNYCTDLKRFPQGVPPECKRPRF  291



>ref|XP_008229402.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Prunus 
mume]
Length=279

 Score =   360 bits (924),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 169/267 (63%), Positives = 204/267 (76%), Gaps = 13/267 (5%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + FG+   ++ + G  + LNLD+ +GSGF +KNEYL GR DMQ+KLV G SAG
Sbjct  26    NFYQDFDVTFGDERAKILNGGQLLTLNLDKFSGSGFKSKNEYLLGRIDMQIKLVSGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNV+SQGKGN+EQQF+LWFDPT AFH
Sbjct  86    TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGNREQQFNLWFDPTKAFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN QRIIF+VDN PIRVF N E+IG+PFP +QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  145   TYSIVWNSQRIIFLVDNIPIRVFTNLETIGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  204

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW++APFTA YRNF     V T   +S   ++A        WQTQGLD  GRNR+RWVQ 
Sbjct  205   DWTQAPFTASYRNFQ----VSTTSTNSLTEQSA--------WQTQGLDAAGRNRLRWVQQ  252

Query  959   KHMVYNYCADAKRFPQGFSAECKRSRF  1039
             K M+YNYC+D KRFPQG   EC+RSRF
Sbjct  253   KFMIYNYCSDLKRFPQGLPVECRRSRF  279



>gb|AFR46575.1| xyloglucan endotransglucosylase/hydrolase 6 [Rosa x borboniana]
Length=289

 Score =   360 bits (924),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 175/271 (65%), Positives = 209/271 (77%), Gaps = 5/271 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + FG    ++ + G  + L+LDQ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  20    NFYQDFDITFGEQRAKIFNGGQHLTLDLDQYSGSGFKSKKEYLFGRIDMQIKLVAGNSAG  79

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN++ +PYT+HTNV+SQGKGN+EQQFHLWFDPT AFH
Sbjct  80    TVTAYYLSSQ-GPTHDEIDFEFLGNSSGEPYTLHTNVFSQGKGNREQQFHLWFDPTNAFH  138

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+++WN QRIIF+VDN PIRVFNN ES+G+PFP +QPMR+Y SLWNADDWATQGG VKT
Sbjct  139   TYSLVWNSQRIIFLVDNIPIRVFNNLESVGVPFPKNQPMRIYSSLWNADDWATQGGRVKT  198

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQE----WQTQGLDGKGRNRVR  946
             DW+ APFTA YRNF ANACV  +  SSC    +AS ++  +    W  QGLD  GRNR+R
Sbjct  199   DWTHAPFTASYRNFKANACVAGSSSSSCGVSTSASTNSLTDQQGTWHNQGLDAAGRNRIR  258

Query  947   WVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
             WVQ K MVYNYC D KRFPQG   EC+RSRF
Sbjct  259   WVQQKFMVYNYCTDLKRFPQGLPVECRRSRF  289



>ref|XP_007217276.1| hypothetical protein PRUPE_ppa017487mg [Prunus persica]
 gb|EMJ18475.1| hypothetical protein PRUPE_ppa017487mg [Prunus persica]
Length=263

 Score =   359 bits (922),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 170/267 (64%), Positives = 206/267 (77%), Gaps = 10/267 (4%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF +D  + FG    ++ + G  + LNLD+ +GSGF +KNEYL GR DMQ+KLV G SAG
Sbjct  7     NFYHDFDITFGGERAKILNGGQLLTLNLDKFSGSGFKSKNEYLLGRIDMQIKLVSGNSAG  66

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNV+SQGKGN+EQQFHLWFDPT AFH
Sbjct  67    TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGNREQQFHLWFDPTKAFH  125

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN QRIIF+VDN PIRVF+N E+IG+PFP +QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  126   TYSIVWNSQRIIFLVDNIPIRVFHNLETIGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  185

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW++APFTA YRNF          VS+ +  +  S +    WQTQGLD  GRNR+RWVQ 
Sbjct  186   DWTQAPFTASYRNFK---------VSTTSTTSTNSLTEQSAWQTQGLDAAGRNRLRWVQQ  236

Query  959   KHMVYNYCADAKRFPQGFSAECKRSRF  1039
             K M+YNYC+D KRFPQG  AEC+RSRF
Sbjct  237   KFMIYNYCSDLKRFPQGLPAECRRSRF  263



>ref|XP_010466730.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16 [Camelina sativa]
Length=291

 Score =   360 bits (924),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 162/266 (61%), Positives = 205/266 (77%), Gaps = 1/266 (0%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NFN +  + +G H G++   G  ++L+LD+ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  26    NFNEEFDLTWGEHRGKIFSGGKMLSLSLDRVSGSGFKSKKEYLFGRIDMQLKLVAGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN T +PY +HTNV++QGKGN+EQQF+LWFDPT  FH
Sbjct  86    TVTAYYLSSE-GPTHDEIDFEFLGNETGKPYVLHTNVFAQGKGNREQQFYLWFDPTKNFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+++W PQ IIFMVDN PIRVFNN E +G+PFP  QPM++Y SLWNADDWAT+GGLVKT
Sbjct  145   TYSLVWRPQHIIFMVDNVPIRVFNNAEQLGVPFPKKQPMKIYSSLWNADDWATRGGLVKT  204

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTAYYR FNA AC V++G S C+ K  ++ +N +      L+  GR R+RWVQ 
Sbjct  205   DWSKAPFTAYYRGFNAAACTVSSGSSYCDPKFKSTFTNGESQVANELNAYGRRRLRWVQK  264

Query  959   KHMVYNYCADAKRFPQGFSAECKRSR  1036
               M+Y+YC+D KRF QGF  EC+RSR
Sbjct  265   YFMIYDYCSDVKRFSQGFPPECRRSR  290



>ref|XP_010677921.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Beta vulgaris subsp. vulgaris]
Length=285

 Score =   360 bits (923),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 166/262 (63%), Positives = 203/262 (77%), Gaps = 3/262 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NFNND  + +G+   ++ +NG+ + L+LD+ +GSGF +KNEYLFG  DMQ+KLV G SAG
Sbjct  23    NFNNDFAITWGDGRAKILNNGDDLTLSLDKASGSGFQSKNEYLFGSIDMQLKLVPGNSAG  82

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S +G  HDE+DFEFLGNA+ QPYT+HTNV++QGKGN+EQQFHLWFDPT  FH
Sbjct  83    TVTAYYLSS-LGTTHDEIDFEFLGNASGQPYTLHTNVFAQGKGNREQQFHLWFDPTKDFH  141

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRI+F VD  PIR FNN ES G+ FP +QPMR+Y SLWNADDWATQGG VK 
Sbjct  142   TYSILWNPQRIVFSVDGIPIREFNNMESQGVSFPKNQPMRIYSSLWNADDWATQGGRVKI  201

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW+ APFTA YRNFNANACV  +G SSC    +A + +  +W  Q LD     R+RWVQ+
Sbjct  202   DWTHAPFTASYRNFNANACVWASGSSSCGLSPSADSGS--DWLNQELDSASLERMRWVQT  259

Query  959   KHMVYNYCADAKRFPQGFSAEC  1024
              +MVYNYCAD +RFPQG   EC
Sbjct  260   NYMVYNYCADLQRFPQGLPTEC  281



>emb|CDY27126.1| BnaA08g07640D [Brassica napus]
Length=289

 Score =   360 bits (923),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 165/266 (62%), Positives = 209/266 (79%), Gaps = 4/266 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF N+  + +G+H G++ + GN ++L+LD+ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  27    NFFNEFDLTWGDHRGKIFNGGNMLSLSLDRVSGSGFKSKKEYLFGRIDMQLKLVAGNSAG  86

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTT+YL+S  G  HDE+DFEFLGN T +PY +HTNV++QGKGN+EQQF+LWFDPT  FH
Sbjct  87    TVTTYYLSSQ-GATHDEIDFEFLGNETGKPYVLHTNVFAQGKGNREQQFYLWFDPTKNFH  145

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+W PQ IIF+VDN PIRVFNN E +G+PFP +QPM +Y SLWNADDWAT+GGLVKT
Sbjct  146   TYSIVWRPQHIIFLVDNLPIRVFNNAEKLGVPFPKNQPMMIYSSLWNADDWATRGGLVKT  205

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTAYYR FNA AC V++G   C+ K   S S+++      L+  GR R+RWVQ 
Sbjct  206   DWSKAPFTAYYRGFNAAACTVSSG---CDPKFKTSLSDSELQTANELNAYGRRRLRWVQK  262

Query  959   KHMVYNYCADAKRFPQGFSAECKRSR  1036
               M+YNYC+D KRFP+GF  EC+RSR
Sbjct  263   YFMIYNYCSDLKRFPRGFPPECRRSR  288



>ref|XP_009102589.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16 [Brassica rapa]
Length=291

 Score =   360 bits (923),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 162/266 (61%), Positives = 206/266 (77%), Gaps = 1/266 (0%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             +FN +  + +G H G++   G  ++L+LD+ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  26    SFNEEFDLTWGEHRGKIFSGGKMLSLSLDRVSGSGFKSKKEYLFGRIDMQLKLVAGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN T +PY +HTNV++QGKGN+EQQF+LWFDPT  FH
Sbjct  86    TVTAYYLSSE-GPTHDEIDFEFLGNETGKPYVLHTNVFAQGKGNREQQFYLWFDPTKNFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+++W PQ IIFMVDN PIRVFNN E +G+PFP  QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  145   TYSLVWRPQHIIFMVDNVPIRVFNNAEQLGVPFPKKQPMRIYSSLWNADDWATRGGLVKT  204

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTAYYR FNA AC V++G S C+ K  ++ ++ +      L+  GR R+RWVQ 
Sbjct  205   DWSKAPFTAYYRGFNAAACTVSSGSSFCDPKFRSTFADGESQVPNELNAYGRRRLRWVQK  264

Query  959   KHMVYNYCADAKRFPQGFSAECKRSR  1036
               M+Y+YC+D KRFPQGF  EC+RSR
Sbjct  265   YFMIYDYCSDLKRFPQGFPPECRRSR  290



>ref|XP_007215793.1| hypothetical protein PRUPE_ppa009871mg [Prunus persica]
 gb|EMJ16992.1| hypothetical protein PRUPE_ppa009871mg [Prunus persica]
Length=274

 Score =   359 bits (921),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 169/267 (63%), Positives = 203/267 (76%), Gaps = 10/267 (4%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + FG+   ++ + G  + LNLD+ +GSGF +KNEYL GR DMQ+KLV G SAG
Sbjct  18    NFYQDFDVTFGDERAKILNGGQLLTLNLDKFSGSGFKSKNEYLLGRIDMQIKLVSGNSAG  77

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNV+SQGKGN+EQQFHLWFDPT AFH
Sbjct  78    TVTAYYLSSE-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGNREQQFHLWFDPTKAFH  136

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN QRIIF+VDN PIRVF N E+IG+PFP +QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  137   TYSIVWNSQRIIFLVDNIPIRVFTNLETIGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  196

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW++APFTA YRNF          VS+    +  S +    WQTQGLD  GRNR+RWVQ 
Sbjct  197   DWTQAPFTASYRNFK---------VSTTTSTSTNSLTEQSAWQTQGLDAAGRNRLRWVQQ  247

Query  959   KHMVYNYCADAKRFPQGFSAECKRSRF  1039
             K M+YNYC+D KRFPQG   EC+RSRF
Sbjct  248   KFMIYNYCSDLKRFPQGLPVECRRSRF  274



>ref|XP_010677922.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Beta vulgaris subsp. vulgaris]
Length=285

 Score =   359 bits (922),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 166/265 (63%), Positives = 204/265 (77%), Gaps = 3/265 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NFNND  + +G+   ++ +NG+ + L+LD+ +GSGF +KNEYLFG  DMQ+KLV G SAG
Sbjct  23    NFNNDFAITWGDGRAKILNNGDDLTLSLDKASGSGFQSKNEYLFGNIDMQLKLVPGNSAG  82

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S +G  HDE+DFEFLGNA+ QPYT+HTNV++QGKGN+EQQFHLWFDPT  FH
Sbjct  83    TVTAYYLSS-LGSTHDEIDFEFLGNASGQPYTLHTNVFAQGKGNREQQFHLWFDPTKDFH  141

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRI+F VD  PIR FNN ES G+ FP +QPMR+Y SLWNADDWATQGG VK 
Sbjct  142   TYSILWNPQRIVFSVDGIPIREFNNMESQGVSFPKNQPMRIYSSLWNADDWATQGGRVKI  201

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW+ APFTA YRNFNANACV  +G SSC    +A + +  +W  Q LD     R+RWVQ+
Sbjct  202   DWTHAPFTASYRNFNANACVWASGSSSCGLSPSADSGS--DWLNQELDSASLERMRWVQT  259

Query  959   KHMVYNYCADAKRFPQGFSAECKRS  1033
              +MVYNYCAD +RFPQG   EC  +
Sbjct  260   NYMVYNYCADLQRFPQGLPTECTST  284



>ref|XP_006280918.1| hypothetical protein CARUB_v10026914mg [Capsella rubella]
 gb|EOA13816.1| hypothetical protein CARUB_v10026914mg [Capsella rubella]
Length=284

 Score =   358 bits (920),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 169/286 (59%), Positives = 209/286 (73%), Gaps = 5/286 (2%)
 Frame = +2

Query  167   MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
             M +IIG +   L    + +     NF  DV++ +G+  GQ+++NG  + L+LD+ +GSGF
Sbjct  1     MAIIIGYL-LPLFLSLIIISSVSANFQRDVEITWGDGRGQIKNNGELLTLSLDKSSGSGF  59

Query  347   NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
              ++NEYLFG+ DMQMKLV G SAGTVTT YL SP G   DE+DFEFLGN++ +PYT+HTN
Sbjct  60    QSRNEYLFGKIDMQMKLVPGNSAGTVTTLYLKSP-GTTWDEIDFEFLGNSSGEPYTLHTN  118

Query  527   VYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*S  706
             VY+QGKG+KEQQF LWFDPTA FHTY+ILWNPQRIIF VD  PIR F N ES+G  FP +
Sbjct  119   VYTQGKGDKEQQFKLWFDPTADFHTYSILWNPQRIIFTVDGTPIREFKNMESVGTLFPKN  178

Query  707   QPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASN  886
             +PMR+Y SLWNADDWAT+GGLVKTDWS+APFTA YR F   ACV +NG SSC  K   + 
Sbjct  179   KPMRMYSSLWNADDWATRGGLVKTDWSKAPFTASYRGFKQEACVWSNGKSSCGSKQRTTT  238

Query  887   SNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAEC  1024
              +   W +Q LD   + R+RWVQ  +M+YNYC D KRFPQG   EC
Sbjct  239   GS---WLSQQLDSTAQQRMRWVQRNYMIYNYCTDTKRFPQGLPKEC  281



>ref|XP_008449516.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
melo]
Length=289

 Score =   358 bits (920),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 178/299 (60%), Positives = 219/299 (73%), Gaps = 13/299 (4%)
 Frame = +2

Query  146   KQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLD  325
             +Q  Q+C+ M   ++A +  G          NF  DV + +G    ++ D G  + L+LD
Sbjct  2     RQLLQLCVFMA-SLMAATTAG----------NFLRDVDVTWGGPRAKMLDGGRHLTLSLD  50

Query  326   QQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQ  505
             + +GSGF +K E+LFGRFD++M LV G SAGTVTTFYL+S  G +HDE+DFEFLGN T  
Sbjct  51    KDSGSGFQSKKEFLFGRFDVRMMLVPGNSAGTVTTFYLSSE-GTSHDEIDFEFLGNLTGH  109

Query  506   PYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESI  685
             PYT+HTNVYSQGKG++EQQFHLWFDPT AFHTY+I W+PQ I F+VDN PIRVF+N E I
Sbjct  110   PYTLHTNVYSQGKGDREQQFHLWFDPTKAFHTYSIDWSPQSIKFLVDNIPIRVFHNWEGI  169

Query  686   GIPFP*SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCN  865
             G+ FP SQPM+VY SLWNADDWAT+GGLVKTDW++APFTA YR+FNAN CV +   S  +
Sbjct  170   GVSFPKSQPMKVYSSLWNADDWATRGGLVKTDWTKAPFTASYRDFNANGCVASTSSSLSS  229

Query  866   FKAAASNSNNQEWQTQ-GLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
               +  +N+ +     Q GLD K RNR+RWVQSK MVYNYC D KRFPQG  AECKRSRF
Sbjct  230   CSSKYANTLHGAKNNQGGLDAKSRNRLRWVQSKFMVYNYCTDRKRFPQGIPAECKRSRF  288



>ref|NP_200564.1| xyloglucan endotransglucosylase/hydrolase protein 22 [Arabidopsis 
thaliana]
 sp|Q38857.1|XTH22_ARATH RecName: Full=Xyloglucan endotransglucosylase/hydrolase protein 
22; Short=At-XTH22; Short=XTH-22; AltName: Full=Touch protein 
4; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK56251.1|AF367262_1 AT5g57560/MUA2_13 [Arabidopsis thaliana]
 gb|AAL38614.1|AF446881_1 AT5g57560/MUA2_13 [Arabidopsis thaliana]
 gb|AAA92363.1| TCH4 protein [Arabidopsis thaliana]
 gb|AAC05572.1| xyloglucan endotransglycosylase related protein [Arabidopsis 
thaliana]
 dbj|BAB08791.1| TCH4 protein [Arabidopsis thaliana]
 gb|AAK96616.1| AT5g57560/MUA2_13 [Arabidopsis thaliana]
 gb|AAL05902.1| AT5g57560/MUA2_13 [Arabidopsis thaliana]
 gb|AED96915.1| xyloglucan endotransglucosylase/hydrolase protein 22 [Arabidopsis 
thaliana]
Length=284

 Score =   358 bits (919),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 166/262 (63%), Positives = 200/262 (76%), Gaps = 2/262 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV++ +G+  GQ+++NG  + L+LD+ +GSGF +KNEYLFG+  MQMKLV G SAG
Sbjct  22    NFQRDVEITWGDGRGQIKNNGELLTLSLDKSSGSGFQSKNEYLFGKVSMQMKLVPGNSAG  81

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTT YL SP G   DE+DFEFLGN++ +PYT+HTNVY+QGKG+KEQQF LWFDPTA FH
Sbjct  82    TVTTLYLKSP-GTTWDEIDFEFLGNSSGEPYTLHTNVYTQGKGDKEQQFKLWFDPTANFH  140

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TYTILWNPQRIIF VD  PIR F N ES+G  FP ++PMR+Y SLWNADDWAT+GGLVKT
Sbjct  141   TYTILWNPQRIIFTVDGTPIREFKNMESLGTLFPKNKPMRMYSSLWNADDWATRGGLVKT  200

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTA YR F   ACV +NG SSC   A+   +    W +Q LD   + R+RWVQ 
Sbjct  201   DWSKAPFTASYRGFQQEACVWSNGKSSCP-NASKQGTTTGSWLSQELDSTAQQRMRWVQR  259

Query  959   KHMVYNYCADAKRFPQGFSAEC  1024
              +M+YNYC DAKRFPQG   EC
Sbjct  260   NYMIYNYCTDAKRFPQGLPKEC  281



>ref|XP_006284242.1| hypothetical protein CARUB_v10005405mg [Capsella rubella]
 gb|EOA17140.1| hypothetical protein CARUB_v10005405mg [Capsella rubella]
Length=289

 Score =   358 bits (919),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 167/292 (57%), Positives = 216/292 (74%), Gaps = 14/292 (5%)
 Frame = +2

Query  161   VCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGS  340
             V  ++++ +V  +  G          NF ++  + +G+H G++ + GN ++L+LD+ +GS
Sbjct  11    VATVLLVTMVGSAYSG----------NFFDEFDLTWGDHRGKIFNGGNMLSLSLDRVSGS  60

Query  341   GFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVH  520
             GF +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G AHDE+DFEFLGN T +PY +H
Sbjct  61    GFKSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GAAHDEIDFEFLGNETGKPYVLH  119

Query  521   TNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP  700
             TNV++ GKGN+EQQF+LWFDPT  FHTY+I+W PQ IIF+VDN PIRVFNN E +G+PFP
Sbjct  120   TNVFALGKGNREQQFYLWFDPTKNFHTYSIVWRPQHIIFLVDNLPIRVFNNAEKLGVPFP  179

Query  701   *SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAA  880
              SQPMR+Y SLWNADDWAT+GGLVKTDWS+APFTAYYR F A AC V++G   C+ K  +
Sbjct  180   KSQPMRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRGFKAAACTVSSG---CDPKFKS  236

Query  881   SNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSR  1036
             S  + +      L+  GR R+RWVQ   M+YNYC+D KRFP+GF  ECKRSR
Sbjct  237   SFGDGKLQVANELNAYGRRRLRWVQKYFMIYNYCSDLKRFPRGFPPECKRSR  288



>ref|XP_009120272.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22 [Brassica rapa]
Length=283

 Score =   358 bits (918),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 167/262 (64%), Positives = 197/262 (75%), Gaps = 3/262 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV++ +G+  GQ+++NG  + L+LD+ +GSGF +KNEYLFG+ DMQMKLV G SAG
Sbjct  22    NFQRDVEITWGDGRGQIKNNGELLTLSLDKSSGSGFQSKNEYLFGKIDMQMKLVPGNSAG  81

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTT YL SP G   DE+DFEFLGN +  PYT+HTNVY+QGKG+KEQQF LWFDPTA FH
Sbjct  82    TVTTLYLKSP-GTTWDEIDFEFLGNLSGDPYTLHTNVYTQGKGDKEQQFKLWFDPTADFH  140

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TYTILWNPQRIIF VD  PIR F N ES+G  FP +QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  141   TYTILWNPQRIIFTVDGTPIREFKNMESVGTLFPKNQPMRMYSSLWNADDWATRGGLVKT  200

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTA YR FN  ACV +NG SSC     +       W +Q LD   + R+RWVQ 
Sbjct  201   DWSKAPFTASYRGFNQEACVWSNGKSSC--PNGSGQGTTGSWLSQELDSTAQERMRWVQK  258

Query  959   KHMVYNYCADAKRFPQGFSAEC  1024
              +M+YNYC D KRFPQG   EC
Sbjct  259   NYMIYNYCTDTKRFPQGLPKEC  280



>ref|XP_002868312.1| hypothetical protein ARALYDRAFT_493497 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44571.1| hypothetical protein ARALYDRAFT_493497 [Arabidopsis lyrata subsp. 
lyrata]
Length=289

 Score =   358 bits (919),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 168/288 (58%), Positives = 216/288 (75%), Gaps = 9/288 (3%)
 Frame = +2

Query  173   MIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNT  352
             ++  ++  +LVG A A      NF ++  + +G+H G++ + G  ++L+LD+ +GSGF +
Sbjct  10    VVAAILLVTLVGSAYAS-----NFFDEFDLTWGDHRGKIFNGGTMLSLSLDRVSGSGFKS  64

Query  353   KNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVY  532
             K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN T +PY +HTNV+
Sbjct  65    KKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GATHDEIDFEFLGNETGKPYVLHTNVF  123

Query  533   SQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQP  712
             +QGKG++EQQF+LWFDPT  FHTY+I+W PQ IIF+VDN PIRVFNN E +G+PFP SQP
Sbjct  124   AQGKGDREQQFYLWFDPTKNFHTYSIVWRPQHIIFLVDNLPIRVFNNAERLGVPFPKSQP  183

Query  713   MRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSN  892
             MR+Y SLWNADDWAT+GGLVKTDWS+APFTAYYR FNA AC V++G   C  K  +S  +
Sbjct  184   MRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRGFNAAACTVSSG---CYPKFKSSLGD  240

Query  893   NQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSR  1036
              +      L+  GR R+RWVQ   M+YNYC+D KRFP+GF  ECKRSR
Sbjct  241   GKLQVASELNAYGRRRLRWVQKYFMIYNYCSDLKRFPRGFPPECKRSR  288



>gb|AAM61021.1| xyloglucan endotransglycosylase, putative [Arabidopsis thaliana]
Length=291

 Score =   358 bits (919),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 161/266 (61%), Positives = 206/266 (77%), Gaps = 1/266 (0%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             +FN +  + +G H G++   G  ++L+LD+ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  26    SFNEEFDLTWGEHRGKIFSGGKMLSLSLDRVSGSGFKSKKEYLFGRIDMQLKLVAGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN T +PY +HTNV++QGKGN+EQQF+LWFDPT  FH
Sbjct  86    TVTAYYLSSE-GPTHDEIDFEFLGNETGKPYVLHTNVFAQGKGNREQQFYLWFDPTKNFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+++W PQ IIFMVDN PIRVFNN E +G+PFP +QPM++Y SLWNADDWAT+GGLVKT
Sbjct  145   TYSLVWRPQHIIFMVDNVPIRVFNNAEQLGVPFPKNQPMKIYSSLWNADDWATRGGLVKT  204

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTAYYR FNA AC V++G S C+ K  +S +N +      L+  G  R+RWVQ 
Sbjct  205   DWSKAPFTAYYRGFNAAACTVSSGSSFCDPKFKSSFTNGESQVANELNAYGIRRLRWVQK  264

Query  959   KHMVYNYCADAKRFPQGFSAECKRSR  1036
               M+Y+YC+D KRFPQGF  EC++SR
Sbjct  265   YFMIYDYCSDLKRFPQGFPPECRKSR  290



>ref|XP_010452475.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Camelina sativa]
Length=287

 Score =   357 bits (917),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 165/263 (63%), Positives = 200/263 (76%), Gaps = 2/263 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV++ +G+  GQ+++NG  + L+LD+ +GSGF +KNEYLFG+ DMQMKLV G SAG
Sbjct  23    NFQRDVEITWGDGRGQIKNNGELLTLSLDKSSGSGFQSKNEYLFGKIDMQMKLVPGNSAG  82

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTT YL SP G   DE+DFEFLGN++  PYT+HTNVY+QGKG+KEQQF LWFDPTA FH
Sbjct  83    TVTTLYLKSP-GTTWDEIDFEFLGNSSGDPYTLHTNVYTQGKGDKEQQFKLWFDPTADFH  141

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VD  PIR F N ES+G  FP ++PMR+Y SLWNADDWAT+GGLVKT
Sbjct  142   TYSILWNPQRIIFTVDGTPIREFKNMESLGTLFPKNKPMRMYSSLWNADDWATRGGLVKT  201

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSC-NFKAAASNSNNQEWQTQGLDGKGRNRVRWVQ  955
             DWS+APFTA YR F   ACV +NG SSC N     +   +  W +Q LD   + R+RWVQ
Sbjct  202   DWSKAPFTATYRGFKQEACVWSNGKSSCPNGSKQGTTGTSGSWLSQQLDSTAQQRMRWVQ  261

Query  956   SKHMVYNYCADAKRFPQGFSAEC  1024
               +M+YNYC D+KRFPQG   EC
Sbjct  262   RNYMIYNYCTDSKRFPQGLPKEC  284



>ref|XP_010443442.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22 [Camelina sativa]
 ref|XP_010483278.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22 [Camelina sativa]
Length=287

 Score =   357 bits (917),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 165/263 (63%), Positives = 199/263 (76%), Gaps = 2/263 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV++ +G+  GQ+++NG  + L LD+ +GSGF +KNEYLFG+ DMQMKLV G SAG
Sbjct  23    NFQRDVEITWGDGRGQIKNNGELLTLTLDKSSGSGFQSKNEYLFGKIDMQMKLVPGNSAG  82

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTT YL SP G   DE+DFEFLGN++  PYT+HTNVY+QGKG+KEQQF LWFDPTA FH
Sbjct  83    TVTTLYLKSP-GTTWDEIDFEFLGNSSGDPYTLHTNVYTQGKGDKEQQFKLWFDPTADFH  141

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VD  PIR F N ES+G  FP ++PMR+Y SLWNADDWAT+GGLVKT
Sbjct  142   TYSILWNPQRIIFTVDGTPIREFKNMESLGTLFPKNKPMRMYSSLWNADDWATRGGLVKT  201

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSC-NFKAAASNSNNQEWQTQGLDGKGRNRVRWVQ  955
             DWS+APFTA YR F   ACV +NG SSC N     +   +  W +Q LD   + R+RWVQ
Sbjct  202   DWSKAPFTATYRGFKQEACVWSNGKSSCPNGSKQGTTGTSGSWLSQQLDSTAQQRMRWVQ  261

Query  956   SKHMVYNYCADAKRFPQGFSAEC  1024
               +M+YNYC D+KRFPQG   EC
Sbjct  262   RNYMIYNYCTDSKRFPQGLPKEC  284



>gb|AGI42452.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   357 bits (916),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 163/262 (62%), Positives = 205/262 (78%), Gaps = 5/262 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF+ND  + +G+  G++ +NG  + L LD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  26    NFHNDFDVTWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNV+SQGKG +EQQFHLWFDPTA FH
Sbjct  86    TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGGREQQFHLWFDPTADFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VDN PIR F N ES+G+ +P SQ MR+Y SLWNADDWAT+GGL+KT
Sbjct  145   TYSILWNPQRIIFSVDNTPIREFKNAESVGVAYPKSQAMRIYSSLWNADDWATRGGLIKT  204

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTA YRNFNA AC+ ++G SSCN  A ++N+    W  + LD   + R++WVQ 
Sbjct  205   DWSKAPFTASYRNFNAKACIWSSGRSSCNSNAPSNNA----WLNEELDATSQQRLQWVQK  260

Query  959   KHMVYNYCADAKRFPQGFSAEC  1024
              +M+YNYC DAKRFPQG+  EC
Sbjct  261   NYMIYNYCTDAKRFPQGYPPEC  282



>ref|XP_006401194.1| hypothetical protein EUTSA_v10014326mg [Eutrema salsugineum]
 dbj|BAJ34580.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ42647.1| hypothetical protein EUTSA_v10014326mg [Eutrema salsugineum]
Length=282

 Score =   357 bits (916),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 165/262 (63%), Positives = 199/262 (76%), Gaps = 3/262 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV++ +G+  GQ+++NG  + L+LD+ +GSGF +KNEYLFG+ DMQMKLV G SAG
Sbjct  21    NFQRDVEITWGDGRGQIKNNGELLTLSLDKSSGSGFQSKNEYLFGKIDMQMKLVPGNSAG  80

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTT YL SP G   DE+DFEFLGN +  PYT+HTNVY+QGKG+KEQQF LWFDPTA FH
Sbjct  81    TVTTLYLKSP-GTTWDEIDFEFLGNLSGDPYTLHTNVYTQGKGDKEQQFKLWFDPTADFH  139

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TYTILWNPQRIIF VD  PIR F N ES+G  FP ++PMR+Y SLWNADDWAT+GGLVKT
Sbjct  140   TYTILWNPQRIIFTVDGTPIREFKNMESVGTLFPKNRPMRMYSSLWNADDWATRGGLVKT  199

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTA YR FN  ACV +NG SSC   + +       W +Q LD   + R+RWVQ 
Sbjct  200   DWSKAPFTASYRGFNQEACVWSNGKSSC--PSGSKQGTTGSWLSQELDSTAQERMRWVQR  257

Query  959   KHMVYNYCADAKRFPQGFSAEC  1024
              +M+YNYC D+KRFP+G   EC
Sbjct  258   NYMIYNYCTDSKRFPRGLPKEC  279



>ref|NP_193149.2| probable xyloglucan endotransglucosylase/hydrolase protein 15 
[Arabidopsis thaliana]
 sp|Q38911.1|XTH15_ARATH RecName: Full=Probable xyloglucan endotransglucosylase/hydrolase 
protein 15; Short=At-XTH15; Short=XTH-15; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAB18368.1| xyloglucan endotransglycosylase-related protein [Arabidopsis 
thaliana]
 gb|AAK76539.1| putative xyloglucan endotransglycosylase-related protein XTR-7 
[Arabidopsis thaliana]
 gb|AAM64835.1| xyloglucan endotransglycosylase-related protein XTR-7 [Arabidopsis 
thaliana]
 gb|AAW28549.1| At4g14130 [Arabidopsis thaliana]
 gb|AEE83378.1| probable xyloglucan endotransglucosylase/hydrolase protein 15 
[Arabidopsis thaliana]
Length=289

 Score =   357 bits (916),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 163/266 (61%), Positives = 207/266 (78%), Gaps = 4/266 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF ++  + +G+H G++ + GN ++L+LDQ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  27    NFFDEFDLTWGDHRGKIFNGGNMLSLSLDQVSGSGFKSKKEYLFGRIDMQLKLVAGNSAG  86

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN T +PY +HTNV++QGKG++EQQF+LWFDPT  FH
Sbjct  87    TVTAYYLSSQ-GATHDEIDFEFLGNETGKPYVLHTNVFAQGKGDREQQFYLWFDPTKNFH  145

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+W PQ IIF+VDN PIRVFNN E +G+PFP SQPMR+Y SLWNADDWAT+GGLVKT
Sbjct  146   TYSIVWRPQHIIFLVDNLPIRVFNNAEKLGVPFPKSQPMRIYSSLWNADDWATRGGLVKT  205

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTAYYR FNA AC  ++G   C+ K  +S  + +      L+  GR R+RWVQ 
Sbjct  206   DWSKAPFTAYYRGFNAAACTASSG---CDPKFKSSFGDGKLQVATELNAYGRRRLRWVQK  262

Query  959   KHMVYNYCADAKRFPQGFSAECKRSR  1036
               M+YNYC+D KRFP+GF  ECK+SR
Sbjct  263   YFMIYNYCSDLKRFPRGFPPECKKSR  288



>ref|XP_004140250.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15-like, partial [Cucumis sativus]
Length=286

 Score =   357 bits (916),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 170/267 (64%), Positives = 206/267 (77%), Gaps = 1/267 (0%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV + +G    ++ D G  ++L+LD+ +GSGF +K ++LFGRFD+QM LV G SAG
Sbjct  20    NFLRDVDITWGGPRAKILDGGRHLSLSLDKDSGSGFQSKKQFLFGRFDVQMMLVPGNSAG  79

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL+S  G +HDE+DFEFLGN +  PYT+HTNVYSQGKG++EQQFHLWFDPT AFH
Sbjct  80    TVTTFYLSSE-GTSHDEIDFEFLGNLSGDPYTLHTNVYSQGKGDREQQFHLWFDPTKAFH  138

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I W+PQ I+F+VDN PIRVF+N E IG+ +P SQPM+VY SLWNADDWAT+GG VKT
Sbjct  139   TYSIDWSPQSIMFLVDNIPIRVFHNWEKIGVSYPKSQPMKVYSSLWNADDWATRGGRVKT  198

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW++APFTA YRNFNAN CV + G SS      A+         QGLD K RNR+RWVQS
Sbjct  199   DWTKAPFTASYRNFNANGCVASTGSSSSCSSKYANTQQGGTKNNQGLDAKSRNRLRWVQS  258

Query  959   KHMVYNYCADAKRFPQGFSAECKRSRF  1039
             K MVYNYC D +RFPQG  AEC+RSRF
Sbjct  259   KFMVYNYCTDRQRFPQGIPAECRRSRF  285



>ref|XP_010488450.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16 [Camelina sativa]
Length=291

 Score =   357 bits (916),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 161/266 (61%), Positives = 204/266 (77%), Gaps = 1/266 (0%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NFN +  + +G H G++   G  ++L+LD+ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  26    NFNEEFDLTWGEHRGKIFSGGKMLSLSLDRVSGSGFKSKKEYLFGRIDMQLKLVAGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN T +PY +HTNV++QGKGN+EQQF+LWFDPT  FH
Sbjct  86    TVTAYYLSSE-GPTHDEIDFEFLGNETGKPYVLHTNVFAQGKGNREQQFYLWFDPTKNFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+++W PQ IIFMVDN PIRVFNN E +G+PFP  QPM++Y SLWNAD WAT+GGLVKT
Sbjct  145   TYSLVWRPQHIIFMVDNVPIRVFNNAEQLGVPFPKKQPMKIYSSLWNADGWATRGGLVKT  204

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTAYYR FNA AC V++G S C+ K  ++ +N +      L+  GR R+RWVQ 
Sbjct  205   DWSKAPFTAYYRGFNAAACTVSSGSSYCDPKFKSTFTNGESQVANELNAYGRRRLRWVQK  264

Query  959   KHMVYNYCADAKRFPQGFSAECKRSR  1036
               M+Y+YC+D KRF QGF  EC+RSR
Sbjct  265   YFMIYDYCSDVKRFSQGFPPECRRSR  290



>ref|XP_010532726.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16 [Tarenaya hassleriana]
Length=293

 Score =   357 bits (916),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 167/268 (62%), Positives = 207/268 (77%), Gaps = 3/268 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF ++  + +G + G++   G  ++L LD+ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  28    NFYDEFDLTWGGNRGKIFGGGRMLSLGLDRVSGSGFQSKKEYLFGRIDMQLKLVAGNSAG  87

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN T QPY +HTNV++QGKGN+EQQF+LWFDPT  FH
Sbjct  88    TVTAYYLSSQ-GPTHDEIDFEFLGNETGQPYVLHTNVFTQGKGNREQQFYLWFDPTKNFH  146

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+W PQ IIF+VD+ PIRVF N E +G+PFP SQPMR+Y SLWNADDWAT+GGLVKT
Sbjct  147   TYSIVWRPQHIIFLVDSVPIRVFKNAEQLGVPFPKSQPMRIYSSLWNADDWATRGGLVKT  206

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQT-QGLDGKGRNRVRWVQ  955
             DWS+APFTAYYRNFNA AC V++G S C+ K  +S +N  +WQ    L+  GR R+RWVQ
Sbjct  207   DWSKAPFTAYYRNFNAAACTVSSGSSFCDPKFKSSFTNG-DWQVGNELNAFGRRRLRWVQ  265

Query  956   SKHMVYNYCADAKRFPQGFSAECKRSRF  1039
                M+YNYCAD KRFPQGF  EC+ SR 
Sbjct  266   RYFMIYNYCADLKRFPQGFPPECRSSRL  293



>ref|XP_002866213.1| hypothetical protein ARALYDRAFT_918931 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42472.1| hypothetical protein ARALYDRAFT_918931 [Arabidopsis lyrata subsp. 
lyrata]
Length=282

 Score =   357 bits (915),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 166/262 (63%), Positives = 198/262 (76%), Gaps = 3/262 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV++ +G+  GQ+++NG  + L+LD+ +GSGF +KNEYLFG+  MQMKLV G SAG
Sbjct  21    NFQRDVEITWGDGRGQIKNNGELLTLSLDKSSGSGFQSKNEYLFGKIAMQMKLVPGNSAG  80

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTT YL SP G   DE+DFEFLGN++  PYT+HTNVY+QGKG+KEQQF LWFDPTA FH
Sbjct  81    TVTTLYLKSP-GTTWDEIDFEFLGNSSGDPYTLHTNVYTQGKGDKEQQFKLWFDPTADFH  139

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TYTILWNPQRIIF VD  PIR F N ES+G  FP ++PMR+Y SLWNADDWAT+GGLVKT
Sbjct  140   TYTILWNPQRIIFTVDGTPIREFKNMESLGTLFPKNKPMRMYSSLWNADDWATRGGLVKT  199

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTA YR F   ACV +NG SSC    A+       W +Q LD   + R+RWVQ 
Sbjct  200   DWSKAPFTASYRGFKQEACVWSNGKSSC--PNASKQGTTGSWLSQELDSTAQQRMRWVQR  257

Query  959   KHMVYNYCADAKRFPQGFSAEC  1024
              +M+YNYC DAKRFPQG   EC
Sbjct  258   NYMIYNYCTDAKRFPQGLPKEC  279



>ref|XP_004164863.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
sativus]
 emb|CCH26410.1| xyloglucan endotransglycosylase [Cucumis sativus]
Length=286

 Score =   357 bits (915),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 174/290 (60%), Positives = 214/290 (74%), Gaps = 7/290 (2%)
 Frame = +2

Query  170   IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
             ++++     SLV    A      NF  DV + +G    ++ D G  ++L+LD+ +GSGF 
Sbjct  3     LLLLCAFLASLVAATAA------NFLRDVDITWGGPRAKILDGGRHLSLSLDKDSGSGFQ  56

Query  350   TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
             +K ++LFGRFD+QM LV G SAGTVTTFYL+S  G +HDE+DFEFLGN +  PYT+HTNV
Sbjct  57    SKKQFLFGRFDVQMMLVPGNSAGTVTTFYLSSE-GTSHDEIDFEFLGNLSGDPYTLHTNV  115

Query  530   YSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQ  709
             YSQGKG++EQQFHLWFDPT AFHTY+I W+PQ I+F+VDN PIRVF+N E IG+ +P SQ
Sbjct  116   YSQGKGDREQQFHLWFDPTKAFHTYSIDWSPQSIMFLVDNIPIRVFHNWEKIGVSYPKSQ  175

Query  710   PMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNS  889
             PM+VY SLWNADDWAT+GG VKTDW++APFTA YRNFNAN CV + G SS      A+  
Sbjct  176   PMKVYSSLWNADDWATRGGRVKTDWTKAPFTASYRNFNANGCVASTGSSSSCSSKYANTQ  235

Query  890   NNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
                    QGLD K RNR+RWVQSK MVYNYC D +RFPQG  AEC+RSRF
Sbjct  236   QGGAKNNQGLDAKSRNRLRWVQSKFMVYNYCTDRQRFPQGIPAECRRSRF  285



>gb|KDP36434.1| hypothetical protein JCGZ_08703 [Jatropha curcas]
Length=286

 Score =   357 bits (915),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 165/265 (62%), Positives = 201/265 (76%), Gaps = 4/265 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + +G+   ++ +NG  + LNLD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  26    NFYQDFDITWGDGRAKILNNGQLLTLNLDKASGSGFQSRNEYLFGKIDMQLKLVPGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G   DE+DFEFLGN +  PY +HTN++SQGKGN+EQQF++WFDPTA FH
Sbjct  86    TVTAYYLSSK-GSTWDEIDFEFLGNLSGDPYILHTNLFSQGKGNREQQFYVWFDPTADFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWN QRIIF VD  PIR F N ES G+PFP SQPMR+Y SLWNADDWAT+GGLVKT
Sbjct  145   TYSILWNSQRIIFSVDGTPIREFKNLESAGVPFPKSQPMRIYSSLWNADDWATRGGLVKT  204

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTA YRNFNANACV +NG SSC   AA   SN   W ++ LD   + R++WVQ 
Sbjct  205   DWSQAPFTASYRNFNANACVWSNGASSCGTNAA---SNTTSWLSEELDSTSQERLKWVQK  261

Query  959   KHMVYNYCADAKRFPQGFSAECKRS  1033
              +M+YNYC D KRFPQG   ECK S
Sbjct  262   NYMIYNYCTDIKRFPQGLPTECKLS  286



>gb|KGN47997.1| hypothetical protein Csa_6G423390 [Cucumis sativus]
Length=286

 Score =   357 bits (915),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 174/290 (60%), Positives = 214/290 (74%), Gaps = 7/290 (2%)
 Frame = +2

Query  170   IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
             ++++     SLV    A      NF  DV + +G    ++ D G  ++L+LD+ +GSGF 
Sbjct  3     LLLLCAFLASLVAATAA------NFLRDVDITWGGPRAKILDGGRHLSLSLDKDSGSGFQ  56

Query  350   TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
             +K ++LFGRFD+QM LV G SAGTVTTFYL+S  G +HDE+DFEFLGN +  PYT+HTNV
Sbjct  57    SKKQFLFGRFDVQMMLVPGNSAGTVTTFYLSSE-GTSHDEIDFEFLGNLSGDPYTLHTNV  115

Query  530   YSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQ  709
             YSQGKG++EQQFHLWFDPT AFHTY+I W+PQ I+F+VDN PIRVF+N E IG+ +P SQ
Sbjct  116   YSQGKGDREQQFHLWFDPTKAFHTYSIDWSPQSIMFLVDNIPIRVFHNWEKIGVSYPKSQ  175

Query  710   PMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNS  889
             PM+VY SLWNADDWAT+GG VKTDW++APFTA YRNFNAN CV + G SS      A+  
Sbjct  176   PMKVYSSLWNADDWATRGGRVKTDWTKAPFTASYRNFNANGCVASTGSSSSCSSKYANTQ  235

Query  890   NNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
                    QGLD K RNR+RWVQSK MVYNYC D +RFPQG  AEC+RSRF
Sbjct  236   QGGTKNNQGLDAKSRNRLRWVQSKFMVYNYCTDRQRFPQGIPAECRRSRF  285



>ref|XP_009120273.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Brassica rapa]
Length=283

 Score =   356 bits (914),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 167/262 (64%), Positives = 196/262 (75%), Gaps = 3/262 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV++ +G+  GQ+ +NG  + L+LD+ +GSGF +KNEYLFG+ DMQMKLV G SAG
Sbjct  22    NFQRDVEITWGDGRGQITNNGELLTLSLDKSSGSGFQSKNEYLFGKIDMQMKLVPGNSAG  81

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTT YL SP G   DE+DFEFLGN +  PYT+HTNVY+QGKG+KEQQF LWFDPTA FH
Sbjct  82    TVTTLYLKSP-GTTWDEIDFEFLGNLSGDPYTLHTNVYTQGKGDKEQQFKLWFDPTADFH  140

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TYTILWNPQRIIF VD  PIR F N ES+G  FP +QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  141   TYTILWNPQRIIFTVDGTPIREFKNMESVGTLFPKNQPMRMYSSLWNADDWATRGGLVKT  200

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTA YR FN  ACV +NG SSC     +       W +Q LD   + R+RWVQ 
Sbjct  201   DWSKAPFTASYRGFNQEACVWSNGKSSC--PNGSGQGPTGSWLSQELDSTAQERMRWVQK  258

Query  959   KHMVYNYCADAKRFPQGFSAEC  1024
              +M+YNYC D KRFPQG   EC
Sbjct  259   NYMIYNYCTDTKRFPQGLPKEC  280



>gb|KFK27295.1| hypothetical protein AALP_AA8G363900 [Arabis alpina]
Length=284

 Score =   356 bits (914),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 165/262 (63%), Positives = 198/262 (76%), Gaps = 3/262 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV++ +G+  GQ+++NG  + L+LD+ +GSGF +KNEYLFG+  MQMKLV G SAG
Sbjct  23    NFQRDVEITWGDGRGQIKNNGELLTLSLDKSSGSGFQSKNEYLFGKIGMQMKLVPGNSAG  82

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTT YL SP G   DE+DFEFLGN++ +PYT+HTNVY+QGKG+KEQQF LWFDPTA FH
Sbjct  83    TVTTLYLKSP-GTTWDEIDFEFLGNSSGEPYTLHTNVYTQGKGDKEQQFKLWFDPTADFH  141

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TYTILWNPQRIIF VD  PIR F N ESIG  FP ++PMR+Y SLWNADDWAT+GGLVKT
Sbjct  142   TYTILWNPQRIIFTVDGTPIREFKNMESIGTLFPKNKPMRMYSSLWNADDWATRGGLVKT  201

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTA YR FN   CV +NG SSC     +       W +Q LD   + R+RWVQ 
Sbjct  202   DWSKAPFTASYRGFNQEGCVWSNGKSSC--PNGSKKGTTGSWLSQELDSTAQQRMRWVQR  259

Query  959   KHMVYNYCADAKRFPQGFSAEC  1024
              +M+YNYC D+KRFPQG   EC
Sbjct  260   NYMIYNYCTDSKRFPQGLPKEC  281



>ref|XP_006414798.1| hypothetical protein EUTSA_v10025705mg [Eutrema salsugineum]
 gb|ESQ56251.1| hypothetical protein EUTSA_v10025705mg [Eutrema salsugineum]
Length=326

 Score =   358 bits (918),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 166/296 (56%), Positives = 220/296 (74%), Gaps = 9/296 (3%)
 Frame = +2

Query  149   QQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQ  328
             ++  +   ++  V+  ++ G A +      NF ++  + +G+H G++ + GN ++L+LD+
Sbjct  39    RRSSLTTTVVAAVLLVTMFGSAYSG-----NFFDEFDLTWGDHRGKIFNGGNMLSLSLDR  93

Query  329   QTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQP  508
              +GSGF +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN T +P
Sbjct  94    VSGSGFKSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GATHDEIDFEFLGNETGKP  152

Query  509   YTVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIG  688
             Y +HTNV++QGKGN+EQQF+LWFDPT  FHTY+I+W PQ IIF+VDN PIRVFNN E +G
Sbjct  153   YVLHTNVFAQGKGNREQQFYLWFDPTKNFHTYSIVWRPQHIIFLVDNLPIRVFNNAEKLG  212

Query  689   IPFP*SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNF  868
             +PFP SQPMR+Y SLWNADDWAT+GGLVKTDWS+APFTAYYR F A AC V++G   C+ 
Sbjct  213   VPFPKSQPMRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRGFKAAACTVSSG---CDP  269

Query  869   KAAASNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSR  1036
             K  +S ++ +      L+  GR R+RWVQ   M+Y+YC+D KRFP+GF  ECKRSR
Sbjct  270   KFKSSFTDGKFQVANELNAYGRRRLRWVQRYFMIYDYCSDLKRFPRGFPPECKRSR  325



>gb|AFP93557.1| xyloglucan endotransglycosylase/hydrolase 1 [Neolamarckia cadamba]
 gb|AGI42455.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
 gb|AGI42463.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   356 bits (913),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 162/262 (62%), Positives = 205/262 (78%), Gaps = 5/262 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF+ND  + +G+  G++ +NG  + L LD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  26    NFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNV+SQGKG +EQQFHLWFDPTA FH
Sbjct  86    TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGGREQQFHLWFDPTADFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VDN PIR F N ES+G+ +P +Q MR+Y SLWNADDWAT+GGL+KT
Sbjct  145   TYSILWNPQRIIFSVDNTPIREFKNAESVGVAYPKNQAMRIYSSLWNADDWATRGGLIKT  204

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTA YRNFNA AC+ ++G SSCN  A ++N+    W  + LD   + R++WVQ 
Sbjct  205   DWSKAPFTASYRNFNAKACIWSSGRSSCNSNAPSNNA----WLNEELDATSQQRLQWVQK  260

Query  959   KHMVYNYCADAKRFPQGFSAEC  1024
              +M+YNYC DAKRFPQG+  EC
Sbjct  261   NYMIYNYCTDAKRFPQGYPPEC  282



>ref|XP_002526229.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36170.1| conserved hypothetical protein [Ricinus communis]
Length=284

 Score =   356 bits (913),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 168/265 (63%), Positives = 203/265 (77%), Gaps = 1/265 (0%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF ND  + +G+   ++ +NG  + L LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  21    NFYNDFDITWGDGRAKILNNGELLTLTLDKASGSGFQSKNEYLFGKIDMQIKLVPGNSAG  80

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G A DE+DFEFLGN +  PY +HTNV+SQGKGN+EQQF+LWFDPTA FH
Sbjct  81    TVTAYYLSSK-GSAWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFH  139

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNP RIIF VD  PIR F N ES G+PFP +QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  140   TYSILWNPHRIIFSVDGTPIREFKNMESNGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  199

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTA YRNFNANACV +NG SSC   ++ S SN   W +Q LD   + R++WVQ 
Sbjct  200   DWSQAPFTASYRNFNANACVSSNGASSCGTNSSPSTSNTNSWLSQELDSTSQERLQWVQK  259

Query  959   KHMVYNYCADAKRFPQGFSAECKRS  1033
              +M+YNYC DAKRFPQG   EC  S
Sbjct  260   NYMIYNYCTDAKRFPQGLPTECNLS  284



>gb|AGI42451.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
 gb|AGI42453.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
 gb|AGI42462.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   356 bits (913),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 162/262 (62%), Positives = 205/262 (78%), Gaps = 5/262 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF+ND  + +G+  G++ +NG  + L LD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  26    NFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNV+SQGKG +EQQFHLWFDPTA FH
Sbjct  86    TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGGREQQFHLWFDPTADFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VDN PIR F N ES+G+ +P +Q MR+Y SLWNADDWAT+GGL+KT
Sbjct  145   TYSILWNPQRIIFSVDNTPIREFKNAESVGVAYPKNQAMRIYSSLWNADDWATRGGLIKT  204

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTA YRNFNA AC+ ++G SSCN  A ++N+    W  + LD   + R++WVQ 
Sbjct  205   DWSKAPFTASYRNFNAKACIWSSGRSSCNSNAPSNNA----WLNEELDATSQQRLQWVQK  260

Query  959   KHMVYNYCADAKRFPQGFSAEC  1024
              +M+YNYC DAKRFPQG+  EC
Sbjct  261   NYMIYNYCTDAKRFPQGYPPEC  282



>gb|AGI42449.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   355 bits (912),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 162/262 (62%), Positives = 205/262 (78%), Gaps = 5/262 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF+ND  + +G+  G++ +NG  + L LD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  26    NFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNV+SQGKG +EQQFHLWFDPTA FH
Sbjct  86    TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGGREQQFHLWFDPTADFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VDN PIR F N ES+G+ +P +Q MR+Y SLWNADDWAT+GGL+KT
Sbjct  145   TYSILWNPQRIIFSVDNTPIREFKNAESVGVAYPKNQAMRIYSSLWNADDWATRGGLIKT  204

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTA YRNFNA AC+ ++G SSCN  A ++N+    W  + LD   + R++WVQ 
Sbjct  205   DWSKAPFTASYRNFNAKACIWSSGRSSCNSNAPSNNA----WLNEELDATSQQRLQWVQK  260

Query  959   KHMVYNYCADAKRFPQGFSAEC  1024
              +M+YNYC DAKRFPQG+  EC
Sbjct  261   NYMIYNYCTDAKRFPQGYPPEC  282



>ref|XP_010525737.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
20-like [Tarenaya hassleriana]
Length=283

 Score =   355 bits (912),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 167/263 (63%), Positives = 203/263 (77%), Gaps = 9/263 (3%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DVQ+ +G+  G++ DNGN +AL+LDQ +GSGF +KNE+L+G+ + Q+KLV G SAG
Sbjct  28    NFQRDVQITWGDGRGKILDNGNLLALSLDQFSGSGFQSKNEFLYGKVEAQIKLVPGNSAG  87

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL SP G   DE+DFEFLGN +  PYT+HTNVY+QG+G+KEQQFHLWFDPTA FH
Sbjct  88    TVTTFYLKSP-GSTWDEIDFEFLGNLSGHPYTLHTNVYTQGRGDKEQQFHLWFDPTADFH  146

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I WNPQRIIF VD  PIR F N ESIG+PFP  QPMR+Y SLW AD+WAT+GGLVKT
Sbjct  147   TYSITWNPQRIIFTVDGIPIREFKNFESIGVPFPKDQPMRLYASLWEADEWATRGGLVKT  206

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS APF A YRN+N N CV +NG SSC          ++ W +Q LD KG+NRV+WVQ 
Sbjct  207   DWSHAPFMASYRNYNENGCVWSNGRSSC--------PADKAWFSQELDFKGKNRVKWVQR  258

Query  959   KHMVYNYCADAKRFPQGFSAECK  1027
             ++MVY+YC D KR+PQG   ECK
Sbjct  259   RYMVYDYCTDRKRYPQGAPPECK  281



>ref|XP_004140252.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
sativus]
Length=291

 Score =   355 bits (912),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 175/300 (58%), Positives = 225/300 (75%), Gaps = 10/300 (3%)
 Frame = +2

Query  140   MKKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALN  319
             M    + + +++++ V+  S++           NF  DV + +G    ++ D+G  ++L+
Sbjct  1     MHSPHKGLAIMLLLCVLMASIL------TTSAGNFLQDVDITWGGPRAKILDSGRHLSLS  54

Query  320   LDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNAT  499
             LD+ +GSGF +K E+LFGRFD+QM+LV G SAGTVTTFYL+S  G +HDE+DFEFLGN++
Sbjct  55    LDKDSGSGFQSKQEFLFGRFDVQMQLVPGNSAGTVTTFYLSSQ-GGSHDEIDFEFLGNSS  113

Query  500   FQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHE  679
               PYT+HTNVYSQGKGN+EQQFHLWFDPT  FHTY+I W+P+ I F+VDN PIRVF+N E
Sbjct  114   GDPYTLHTNVYSQGKGNREQQFHLWFDPTKGFHTYSIDWSPESIKFLVDNIPIRVFHNWE  173

Query  680   SIGIPFP*SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSS  859
             +IG+ +P SQPMRVY SLWNADDWAT+GGLVKTDW++APFTA YRNFNAN CV ++G SS
Sbjct  174   NIGVSYPKSQPMRVYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFNANGCVASSGSSS  233

Query  860   CNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
             C  K +++     +    GLD K RNR+RWVQSK MVYNYC D KRFPQG  AEC+R RF
Sbjct  234   CGSKFSSTLQGGAQ---SGLDAKSRNRLRWVQSKFMVYNYCTDHKRFPQGIPAECRRPRF  290



>gb|AGI42460.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   355 bits (912),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 162/262 (62%), Positives = 205/262 (78%), Gaps = 5/262 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF+ND  + +G+  G++ +NG  + L LD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  26    NFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNV+SQGKG +EQQFHLWFDPTA FH
Sbjct  86    TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGGREQQFHLWFDPTADFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VDN PIR F N ES+G+ +P +Q MR+Y SLWNADDWAT+GGL+KT
Sbjct  145   TYSILWNPQRIIFSVDNAPIREFKNAESVGVAYPKNQAMRIYSSLWNADDWATRGGLIKT  204

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTA YRNFNA AC+ ++G SSCN  A ++N+    W  + LD   + R++WVQ 
Sbjct  205   DWSKAPFTASYRNFNAKACIWSSGRSSCNSNAPSNNA----WLNEELDATSQQRLQWVQK  260

Query  959   KHMVYNYCADAKRFPQGFSAEC  1024
              +M+YNYC DAKRFPQG+  EC
Sbjct  261   NYMIYNYCTDAKRFPQGYPPEC  282



>ref|XP_010259800.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Nelumbo nucifera]
Length=325

 Score =   357 bits (915),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 167/265 (63%), Positives = 211/265 (80%), Gaps = 1/265 (0%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NFN D  + +G+   Q+ +NG  + L+LD+ +GSGF +K+EYLFG+ DMQ+KLV G SAG
Sbjct  59    NFNQDFDITWGDGRAQILNNGELLTLSLDKASGSGFQSKHEYLFGKIDMQLKLVAGNSAG  118

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN +  PY +HTNV+SQGKGN+EQQF+LWFDPTA FH
Sbjct  119   TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFH  177

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VD  PIR F N ESIG+PFP +Q MR+Y SLWNADDWAT+GGLVKT
Sbjct  178   TYSILWNPQRIIFSVDGIPIREFKNSESIGVPFPKNQAMRIYSSLWNADDWATRGGLVKT  237

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW++APFTA YRNFNANACV+++G SSC+ K+  S ++N +W +Q LD  G+ R++WVQ+
Sbjct  238   DWTKAPFTASYRNFNANACVMSSGSSSCDSKSPTSTTDNLQWLSQELDSAGQERMKWVQN  297

Query  959   KHMVYNYCADAKRFPQGFSAECKRS  1033
              +M+YNYCAD KRFPQG   EC  +
Sbjct  298   NYMIYNYCADTKRFPQGLPPECSNT  322



>ref|XP_011016106.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Populus 
euphratica]
Length=284

 Score =   355 bits (911),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 166/288 (58%), Positives = 210/288 (73%), Gaps = 8/288 (3%)
 Frame = +2

Query  164   CMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSG  343
             C    + V+ACS+            NF  D  + +G+   ++ + G  ++L+LD+ +GSG
Sbjct  5     CYEFSLFVIACSMA------VVASGNFYQDFDLTWGDRRAKIFNGGQLLSLSLDKVSGSG  58

Query  344   FNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHT  523
             F +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +HT
Sbjct  59    FQSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILHT  117

Query  524   NVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*  703
             NV++QGKGN+EQQF+LWFDPT  FHTY+I+WNPQ IIF+VD+ PIRVF N ESIG+PFP 
Sbjct  118   NVFTQGKGNREQQFYLWFDPTRNFHTYSIIWNPQHIIFLVDSIPIRVFKNAESIGVPFPK  177

Query  704   SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAAS  883
             SQPMR+Y SLWNADDWAT+GGLVKTDW++APFTAYYRNF A+AC  + G SSC  K +++
Sbjct  178   SQPMRIYSSLWNADDWATRGGLVKTDWTKAPFTAYYRNFKASACTWSYGTSSCGSKPSSA  237

Query  884   NSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECK  1027
              S+   W+T  LD   R R+RWVQ   M+YNYC D +RFPQG   ECK
Sbjct  238   FSDG-AWKTNDLDAPSRRRLRWVQKYFMIYNYCTDLRRFPQGPPPECK  284



>ref|XP_009360814.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Pyrus 
x bretschneideri]
Length=296

 Score =   355 bits (912),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 167/267 (63%), Positives = 199/267 (75%), Gaps = 1/267 (0%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + +G+H  ++   GN + L+LDQ +GSGF +  +YLFGR +MQ+KLV G SAG
Sbjct  31    NFQQDFDLTWGDHRAKIIGGGNVLQLSLDQASGSGFQSNKQYLFGRIEMQLKLVAGNSAG  90

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN T +PY VHTNVYSQGKG +EQQF+LWFDPT  FH
Sbjct  91    TVTAYYLSSE-GPNHDEIDFEFLGNVTGEPYIVHTNVYSQGKGGREQQFYLWFDPTKNFH  149

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TYT LWNPQRII +VDN PIRVFNN ES G+PFP S+PM++Y SLWNAD WAT+GGLVKT
Sbjct  150   TYTFLWNPQRIILLVDNIPIRVFNNGESYGVPFPKSKPMKLYSSLWNADQWATRGGLVKT  209

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTAYY+NFNANACV +   S  +       S N  WQTQ  D   R R+RWVQ 
Sbjct  210   DWSKAPFTAYYKNFNANACVWSGSSSCSSTGNIEKGSKNNAWQTQSFDAISRRRLRWVQK  269

Query  959   KHMVYNYCADAKRFPQGFSAECKRSRF  1039
               M+YNYC+D KRFP+G   EC RSRF
Sbjct  270   YFMIYNYCSDLKRFPRGRPRECNRSRF  296



>gb|AGI42456.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   355 bits (911),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 162/262 (62%), Positives = 205/262 (78%), Gaps = 5/262 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF+ND  + +G+  G++ +NG  + L LD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  26    NFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNV+SQGKG +EQQFHLWFDPTA FH
Sbjct  86    TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGGREQQFHLWFDPTADFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VDN PIR F N ES+G+ +P +Q MR+Y SLWNADDWAT+GGL+KT
Sbjct  145   TYSILWNPQRIIFSVDNTPIREFKNAESVGVAYPKNQAMRIYSSLWNADDWATRGGLIKT  204

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTA YRNFNA AC+ ++G SSCN  A ++N+    W  + LD   + R++WVQ 
Sbjct  205   DWSKAPFTASYRNFNAKACIWSSGRSSCNSNAPSNNA----WLNEELDATSQQRLQWVQK  260

Query  959   KHMVYNYCADAKRFPQGFSAEC  1024
              +M+YNYC DAKRFPQG+  EC
Sbjct  261   NYMIYNYCTDAKRFPQGYPPEC  282



>ref|XP_004164865.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
sativus]
 emb|CCH26409.1| xyloglucan endotransglycosylase [Cucumis sativus]
Length=291

 Score =   355 bits (911),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 174/300 (58%), Positives = 225/300 (75%), Gaps = 10/300 (3%)
 Frame = +2

Query  140   MKKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALN  319
             M    + + +++++ V+  S++           NF  DV + +G    ++ D+G  ++L+
Sbjct  1     MHSPHKGLAIMLLLCVLMASIL------TTSAGNFLQDVDITWGGPRAKILDSGRHLSLS  54

Query  320   LDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNAT  499
             LD+ +GSGF +K E+LFGRFD+QM+LV G SAGTVTTFYL+S  G +HDE+DFEFLGN++
Sbjct  55    LDKDSGSGFQSKQEFLFGRFDVQMQLVPGNSAGTVTTFYLSSQ-GGSHDEIDFEFLGNSS  113

Query  500   FQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHE  679
               PYT+HTNVYSQGKGN+EQQFHLWFDPT  FHTY+I W+P+ I F+VDN PIRVF+N E
Sbjct  114   GDPYTLHTNVYSQGKGNREQQFHLWFDPTKGFHTYSIDWSPESIKFLVDNIPIRVFHNWE  173

Query  680   SIGIPFP*SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSS  859
             +IG+ +P SQPMRVY SLWNADDWAT+GGLVKTDW++APFTA YRNFNAN CV ++G SS
Sbjct  174   NIGVSYPKSQPMRVYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFNANGCVASSGSSS  233

Query  860   CNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
             C  K +++     +    GLD K RNR+RWVQSK M+YNYC D KRFPQG  AEC+R RF
Sbjct  234   CGSKFSSTLQGGAQ---SGLDAKSRNRLRWVQSKFMIYNYCTDHKRFPQGIPAECRRPRF  290



>gb|AEX07596.1| xyloglucosyl transferase 1, partial [Brassica juncea]
Length=283

 Score =   355 bits (911),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 166/261 (64%), Positives = 195/261 (75%), Gaps = 3/261 (1%)
 Frame = +2

Query  242   FNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGT  421
             F  DV++ +G+  GQ+ +NG  + L+LD+ +GSGF +KNEYLFG+ DMQMKLV G SAGT
Sbjct  23    FQRDVEITWGDGRGQITNNGELLTLSLDKSSGSGFQSKNEYLFGKIDMQMKLVPGNSAGT  82

Query  422   VTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHT  601
             VTT YL SP G   DE+DFEFLGN +  PYT+HTNVY+QGKG+KEQQF LWFDPTA FHT
Sbjct  83    VTTLYLKSP-GTTWDEIDFEFLGNLSGDPYTLHTNVYTQGKGDKEQQFKLWFDPTADFHT  141

Query  602   YTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKTD  781
             YTILWNPQRIIF VD  PIR F N ES+G  FP +QPMR+Y SLWNADDWAT+GGLVKTD
Sbjct  142   YTILWNPQRIIFTVDGTPIREFKNMESVGTLFPKNQPMRMYSSLWNADDWATRGGLVKTD  201

Query  782   WSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQSK  961
             WS+APFTA YR FN  ACV +NG SSC     +       W +Q LD   + R+RWVQ  
Sbjct  202   WSKAPFTASYRGFNQEACVWSNGKSSC--PNGSGQGTTGSWLSQELDSTAQERMRWVQKN  259

Query  962   HMVYNYCADAKRFPQGFSAEC  1024
             +M+YNYC D KRFPQG   EC
Sbjct  260   YMIYNYCTDTKRFPQGLPKEC  280



>ref|XP_002324480.1| xyloglucan endo-1 family protein [Populus trichocarpa]
 gb|EEF03045.1| xyloglucan endo-1 family protein [Populus trichocarpa]
Length=286

 Score =   355 bits (910),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 161/265 (61%), Positives = 200/265 (75%), Gaps = 1/265 (0%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF ND  + +G+   ++  NG  + LNLD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  23    NFYNDFDITWGDGRAKILSNGELLTLNLDKASGSGFQSRNEYLFGKIDMQLKLVPGNSAG  82

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G A DE+DFEFLGN +  PY +HTNV+SQGKGN+EQQF+LWFDPTA FH
Sbjct  83    TVTAYYLSSK-GSAWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFH  141

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRI+F VD  PIR F N ES+G+PFP +QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  142   TYSILWNPQRIVFSVDGTPIREFKNLESMGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  201

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW+ APFTA YRNFNA ACV++NG SSC    +   S +  W ++ LD   + R++WV+ 
Sbjct  202   DWALAPFTASYRNFNAEACVLSNGASSCGTTTSPPASTSNAWFSEELDSTRQERLKWVRE  261

Query  959   KHMVYNYCADAKRFPQGFSAECKRS  1033
              +MVYNYC D  RFPQG   EC  S
Sbjct  262   NYMVYNYCKDVNRFPQGLPTECSMS  286



>ref|XP_010023598.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Eucalyptus 
grandis]
 gb|KCW59910.1| hypothetical protein EUGRSUZ_H02634 [Eucalyptus grandis]
Length=296

 Score =   355 bits (911),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 164/268 (61%), Positives = 202/268 (75%), Gaps = 3/268 (1%)
 Frame = +2

Query  239   NFNNDVQMYFG-NHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSA  415
             NF  D  + +G +   ++   G  ++L+LD+ +GSGF +K EYLFGR DMQ+KLV G SA
Sbjct  31    NFYQDFDLTWGGSDRAKIFSGGQLLSLSLDRVSGSGFRSKKEYLFGRIDMQLKLVAGNSA  90

Query  416   GTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAF  595
             GTVT +YL+S  G  HDE+DFEFLGN +  PY +HTNV++QGKGN+EQQF+LWFDPT  F
Sbjct  91    GTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILHTNVFTQGKGNREQQFYLWFDPTRNF  149

Query  596   HTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVK  775
             HTY+++W PQ IIF+VDN PIRVF N ESIG+PFP +QPM++Y SLWNADDWAT+GGL+K
Sbjct  150   HTYSVIWKPQHIIFLVDNIPIRVFKNGESIGVPFPKNQPMKIYSSLWNADDWATRGGLIK  209

Query  776   TDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQ  955
             TDWS+APFTAYYR F A AC  + G SSC     AS S +  W+   LD  GR R+RWVQ
Sbjct  210   TDWSKAPFTAYYRKFQATACTWSTGSSSCEIGRPASYSGS-TWKINELDAYGRRRLRWVQ  268

Query  956   SKHMVYNYCADAKRFPQGFSAECKRSRF  1039
                M+Y+YCAD KRFPQG  AECKRSRF
Sbjct  269   KYFMIYDYCADGKRFPQGIPAECKRSRF  296



>ref|XP_004164862.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
sativus]
Length=280

 Score =   355 bits (910),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 174/267 (65%), Positives = 210/267 (79%), Gaps = 4/267 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV + +G    ++ D G  ++L+LD+ +GSGF +K E+LFGRFD+QMKLV G SAG
Sbjct  18    NFLQDVDITWGGPRAKILDGGRHLSLSLDKDSGSGFQSKQEFLFGRFDVQMKLVPGNSAG  77

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL+S  G +HDE+DFEFLGN++  PYT+HTNVYSQGKGN+EQQFHLWFDPT  FH
Sbjct  78    TVTTFYLSSQ-GGSHDEIDFEFLGNSSGDPYTLHTNVYSQGKGNREQQFHLWFDPTKGFH  136

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I W+P+ I F+VDN PIRVF N E+IG+ +P SQPMRVY SLWNADDWAT+GGLVKT
Sbjct  137   TYSIDWSPESIKFLVDNIPIRVFRNWENIGVSYPKSQPMRVYSSLWNADDWATRGGLVKT  196

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW++APFTA YRNFNAN CV ++G SSC  K +++     +    GLD K RNR+RWVQS
Sbjct  197   DWTQAPFTASYRNFNANGCVASSGSSSCGSKFSSTLQGGAQ---SGLDAKSRNRLRWVQS  253

Query  959   KHMVYNYCADAKRFPQGFSAECKRSRF  1039
             K MVYNYC D KRFPQG  AECKR RF
Sbjct  254   KFMVYNYCTDHKRFPQGIPAECKRPRF  280



>ref|NP_001284443.1| probable xyloglucan endotransglucosylase/hydrolase protein 23 
precursor [Cucumis melo]
 gb|ABI94063.1| xyloglucan endotransglucosylase/hydrolase 3 [Cucumis melo]
Length=285

 Score =   355 bits (910),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/287 (57%), Positives = 212/287 (74%), Gaps = 9/287 (3%)
 Frame = +2

Query  167   MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
             M + +   A SL+ ++ A      NFN D Q+ +G+   ++ +NG  + L+LD+ +GSGF
Sbjct  6     MFLTLLFSAASLIAISSA------NFNQDFQITWGDGRAKILNNGELLTLSLDKASGSGF  59

Query  347   NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
              ++NEYLFG+ DMQ+KLV G SAGTVT +YL+S  G   DE+DFEFLGN T  PYT+HTN
Sbjct  60    QSQNEYLFGKIDMQLKLVAGNSAGTVTAYYLSSK-GSTWDEIDFEFLGNLTGDPYTLHTN  118

Query  527   VYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*S  706
             V+SQGKGN+EQQFHLWFDPTA FHTY+ILWNP RI+F VD  PIR F N ES G+PFP  
Sbjct  119   VFSQGKGNREQQFHLWFDPTADFHTYSILWNPNRIVFSVDGTPIREFKNWESNGVPFPKD  178

Query  707   QPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASN  886
             QPMR+Y SLWNADDWAT+GGLVKTDW++APFTA Y+NF A ACV++ G SSC+  A A +
Sbjct  179   QPMRIYSSLWNADDWATRGGLVKTDWTKAPFTASYKNFKAEACVLSGGQSSCSPSAPAGS  238

Query  887   SNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECK  1027
              N+  W ++ +D   + R++WVQ  +M+YNYC D +RFPQG   ECK
Sbjct  239   RNS--WLSEEMDSVSQERLKWVQKNYMIYNYCTDTRRFPQGLPTECK  283



>ref|XP_006412727.1| hypothetical protein EUTSA_v10025941mg [Eutrema salsugineum]
 dbj|BAJ33741.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ54180.1| hypothetical protein EUTSA_v10025941mg [Eutrema salsugineum]
Length=281

 Score =   354 bits (909),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/262 (63%), Positives = 201/262 (77%), Gaps = 7/262 (3%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             +FN+DV + +GN  G++ +NG  + L+LD+ +GSGF +K EYLFG+ DMQ+KLV G SAG
Sbjct  23    DFNSDVNVAWGNGRGKILNNGQLLTLSLDKSSGSGFQSKTEYLFGKIDMQIKLVPGNSAG  82

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL S  G   DE+DFEFLGN +  PYT+HTNVY+QGKG+KEQQFHLWFDP+A FH
Sbjct  83    TVTTFYLKSE-GSTWDEIDFEFLGNMSGDPYTLHTNVYTQGKGDKEQQFHLWFDPSANFH  141

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VDN PIR F N ESIG+ FP ++PMR+Y SLWNADDWAT+GGLVKT
Sbjct  142   TYSILWNPQRIIFTVDNTPIREFKNSESIGVLFPKNKPMRMYASLWNADDWATRGGLVKT  201

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTA YRN   +ACV + G SSC+ K  AS      W TQ +D   + R+RWVQ 
Sbjct  202   DWSKAPFTASYRNIKVDACVNSKGRSSCSSKPNAS------WYTQEMDSTSQARLRWVQK  255

Query  959   KHMVYNYCADAKRFPQGFSAEC  1024
              +M+YNYC D KRFPQG   EC
Sbjct  256   NYMIYNYCTDTKRFPQGIPREC  277



>emb|CAB10192.1| xyloglucan endotransglycosylase-related protein XTR-7 [Arabidopsis 
thaliana]
 emb|CAB78455.1| xyloglucan endotransglycosylase-related protein XTR-7 [Arabidopsis 
thaliana]
Length=289

 Score =   355 bits (910),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 162/266 (61%), Positives = 206/266 (77%), Gaps = 4/266 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF ++  + +G+H G++ + GN ++L+LDQ +GSGF +K EYL GR DMQ+KLV G SAG
Sbjct  27    NFFDEFDLTWGDHRGKIFNGGNMLSLSLDQVSGSGFKSKKEYLVGRIDMQLKLVAGNSAG  86

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN T +PY +HTNV++QGKG++EQQF+LWFDPT  FH
Sbjct  87    TVTAYYLSSQ-GATHDEIDFEFLGNETGKPYVLHTNVFAQGKGDREQQFYLWFDPTKNFH  145

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+W PQ IIF+VDN PIRVFNN E +G+PFP SQPMR+Y SLWNADDWAT+GGLVKT
Sbjct  146   TYSIVWRPQHIIFLVDNLPIRVFNNAEKLGVPFPKSQPMRIYSSLWNADDWATRGGLVKT  205

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTAYYR FNA AC  ++G   C+ K  +S  + +      L+  GR R+RWVQ 
Sbjct  206   DWSKAPFTAYYRGFNAAACTASSG---CDPKFKSSFGDGKLQVATELNAYGRRRLRWVQK  262

Query  959   KHMVYNYCADAKRFPQGFSAECKRSR  1036
               M+YNYC+D KRFP+GF  ECK+SR
Sbjct  263   YFMIYNYCSDLKRFPRGFPPECKKSR  288



>gb|KFK27294.1| hypothetical protein AALP_AA8G363800 [Arabis alpina]
Length=284

 Score =   354 bits (909),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 168/264 (64%), Positives = 200/264 (76%), Gaps = 7/264 (3%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             N   DV++ +G+  GQ+++NG  + L+LD+ +GSGF +KNEYLFG+  MQMKLV G SAG
Sbjct  23    NLQRDVEITWGDGRGQIKNNGELLTLSLDKSSGSGFQSKNEYLFGKIGMQMKLVPGNSAG  82

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTT YL SP G   DE+DFEFLGN++ +PYT+HTNVY+QGKG+KEQQF LWFDPTA FH
Sbjct  83    TVTTLYLKSP-GTTWDEIDFEFLGNSSGEPYTLHTNVYTQGKGHKEQQFKLWFDPTADFH  141

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TYTILWNPQRIIF VD  PIR F N ESIG  FP ++PMR+Y SLWNADDWAT+GGLVKT
Sbjct  142   TYTILWNPQRIIFTVDGTPIREFKNMESIGTLFPKNKPMRMYSSLWNADDWATRGGLVKT  201

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSC--NFKAAASNSNNQEWQTQGLDGKGRNRVRWV  952
             DWS+APFTA YR FN  ACV +NG SSC    K  A+ S    W +Q LD   + R+RWV
Sbjct  202   DWSKAPFTASYRGFNQEACVWSNGKSSCPNGSKKGATGS----WLSQELDSTAQQRMRWV  257

Query  953   QSKHMVYNYCADAKRFPQGFSAEC  1024
             Q   M+YNYC D+KRFPQG   EC
Sbjct  258   QRNFMIYNYCTDSKRFPQGLPKEC  281



>ref|XP_010053241.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Eucalyptus 
grandis]
Length=287

 Score =   354 bits (909),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 171/285 (60%), Positives = 210/285 (74%), Gaps = 4/285 (1%)
 Frame = +2

Query  185   VVACSLVGvalavpppplNF-NNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNE  361
             +VA SLV  +L +      F   D  + +G    ++   G  + L+LD+ +GSGF +KNE
Sbjct  4     LVAVSLVMSSLVMVGAQAGFFYRDFDLTWGGERAKISQGGQLLTLSLDKYSGSGFQSKNE  63

Query  362   YLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQG  541
             YLFGR D+Q+KLV G SAGTVTT+YL+S  G AHDE+DFEFLGN +  PYTVHTNV++QG
Sbjct  64    YLFGRIDLQLKLVPGNSAGTVTTYYLSSQ-GPAHDEIDFEFLGNLSGNPYTVHTNVFTQG  122

Query  542   KGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRV  721
             KGN+EQQF+LWFDPT AFHTY+ILWNPQRI+F+VDN PIR F N ES+G+PFP  Q MR+
Sbjct  123   KGNREQQFYLWFDPTKAFHTYSILWNPQRILFLVDNVPIREFVNKESMGVPFPNKQAMRI  182

Query  722   YCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQE  901
             Y SLWNADDWAT GG VKTDW++APFTA YRNFNANAC  + G SSC      S++ +  
Sbjct  183   YSSLWNADDWATMGGRVKTDWTQAPFTASYRNFNANACAWSAGKSSCASTTTTSSTTSSS  242

Query  902   --WQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKR  1030
               W+TQ LD  GR R++WVQ K M+YNYC D KRFPQG   ECK+
Sbjct  243   DVWRTQALDANGRQRLKWVQKKFMIYNYCTDLKRFPQGLPPECKK  287



>ref|XP_006474161.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like [Citrus sinensis]
 gb|KDO46536.1| hypothetical protein CISIN_1g023337mg [Citrus sinensis]
Length=283

 Score =   354 bits (909),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 165/284 (58%), Positives = 211/284 (74%), Gaps = 13/284 (5%)
 Frame = +2

Query  173   MIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNT  352
             ++I +   SL+           NF  D  + +G+  G++ +NG  ++L+LD+ +GSGF +
Sbjct  9     LLISIAISSLM------VASASNFYQDFDITWGDGRGKILNNGQLLSLSLDKASGSGFQS  62

Query  353   KNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVY  532
             K+EYLFG+ DMQ+KLV G SAGTVT +YL SP G   DE+DFEFLGN +  PYT+HTNV+
Sbjct  63    KSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSP-GSTWDEIDFEFLGNLSGDPYTLHTNVF  121

Query  533   SQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQP  712
             + GKG++EQQFHLWFDPTA FHTY++LWNPQRI+F VD +PIR F N ES G+ FP +QP
Sbjct  122   TNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQP  181

Query  713   MRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSN  892
             MR+Y SLWNADDWAT+GGL+KTDW++APFTA YRNFNANACV +NG SSCN K      N
Sbjct  182   MRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANACVWSNGKSSCNSK------N  235

Query  893   NQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAEC  1024
             N  W +Q LD  G+ R++WVQ  +M+YNYC D+KRFPQG   EC
Sbjct  236   NNPWFSQELDATGQERLKWVQKNYMIYNYCKDSKRFPQGLPKEC  279



>ref|XP_011018193.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Populus euphratica]
Length=289

 Score =   354 bits (909),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 160/265 (60%), Positives = 199/265 (75%), Gaps = 1/265 (0%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF ND  + +G+   ++  NG  + LNLD+ +GSGF ++ EYLFG+ DMQ+KLV G SAG
Sbjct  26    NFYNDFDITWGDGRAKILSNGELLTLNLDKASGSGFQSRKEYLFGKIDMQLKLVPGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G A DE+DFEFLGN +  PY +HTNV+SQGKGN+EQQF+LWFDPTA FH
Sbjct  86    TVTAYYLSSK-GSAWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRI+F VD  PIR F N ES+G+PFP +QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  145   TYSILWNPQRIVFSVDGTPIREFKNLESMGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  204

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW+ APFTA YRNFNA ACV++NG SSC    +   S +  W ++ LD   + R++WV+ 
Sbjct  205   DWALAPFTASYRNFNAEACVLSNGASSCGTTTSPPASTSNAWFSEELDSTRQERLKWVRE  264

Query  959   KHMVYNYCADAKRFPQGFSAECKRS  1033
              +MVYNYC D  RFPQG   EC  S
Sbjct  265   NYMVYNYCKDVNRFPQGLPPECSMS  289



>ref|XP_007014165.1| Xyloglucan endotransglucosylase/hydrolase family protein [Theobroma 
cacao]
 gb|EOY31784.1| Xyloglucan endotransglucosylase/hydrolase family protein [Theobroma 
cacao]
Length=290

 Score =   354 bits (909),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 169/291 (58%), Positives = 213/291 (73%), Gaps = 11/291 (4%)
 Frame = +2

Query  161   VCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGS  340
             + M ++IG +  +             NF  D  + +G+  G++ +NG  ++L+LD+ +GS
Sbjct  11    LLMSLVIGCLMAA----------SASNFYQDFDITWGDGRGKIDNNGEVLSLSLDKASGS  60

Query  341   GFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVH  520
             GF +K+EYLFG+ D Q+KLV G SAGTVT +YL+S  G   DE+DFEFLGN +  PY +H
Sbjct  61    GFQSKDEYLFGKIDTQLKLVPGNSAGTVTAYYLSSK-GSTWDEIDFEFLGNLSGDPYILH  119

Query  521   TNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP  700
             TNV+SQGKGN+EQQFHLWFDPTA FHTY+ILWNPQRIIF VD  PIR F N ES+G+PFP
Sbjct  120   TNVFSQGKGNREQQFHLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNMESLGVPFP  179

Query  701   *SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAA  880
              +QPMR+Y SLWNADDWAT+GGLVKTDW++APFTA YRNFNANACV +NG SSC   + +
Sbjct  180   KNQPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFNANACVWSNGASSCKSNSPS  239

Query  881   SNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRS  1033
             S S N  W +Q LD   + R++WVQ  +M+YNYC DAKRFPQG   EC  S
Sbjct  240   SASTNNAWFSQELDSSSQQRLQWVQKNYMIYNYCTDAKRFPQGLPPECNMS  290



>ref|XP_007048840.1| Xyloglucan endotransglucosylase/hydrolase 15 [Theobroma cacao]
 gb|EOX92997.1| Xyloglucan endotransglucosylase/hydrolase 15 [Theobroma cacao]
Length=294

 Score =   354 bits (909),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 172/257 (67%), Positives = 203/257 (79%), Gaps = 2/257 (1%)
 Frame = +2

Query  269   GNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSP  448
             G+   ++   G  + L+LD+ +GSGF +K+ YLFGR DMQ+KLV G SAGTVTT+YLTS 
Sbjct  39    GDQRAKILHGGQLLTLSLDKDSGSGFRSKHAYLFGRIDMQIKLVPGNSAGTVTTYYLTSE  98

Query  449   IGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQR  628
              G  HDE+DFEFLGN +  PYT+HTNVYSQGKGN+EQQF+LWFDPT AFHTY+I+WN QR
Sbjct  99    -GPNHDEIDFEFLGNLSGDPYTLHTNVYSQGKGNREQQFYLWFDPTKAFHTYSIVWNRQR  157

Query  629   IIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAY  808
             IIFMVDN PIRVFNN ESIG+PFP +QPMR+Y SLWNADDWAT+GGLVKTDW+ APFTA 
Sbjct  158   IIFMVDNIPIRVFNNMESIGVPFPSNQPMRIYSSLWNADDWATRGGLVKTDWTHAPFTAS  217

Query  809   YRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCAD  988
             YRNFNANAC+ ++  SSC  ++  S   N  W+ Q L    RNR+RWVQ+K MVYNYC D
Sbjct  218   YRNFNANACIWSSSQSSCASQSTDSLQAN-AWEDQTLGAADRNRIRWVQNKFMVYNYCTD  276

Query  989   AKRFPQGFSAECKRSRF  1039
              KRFPQG   ECKRSRF
Sbjct  277   LKRFPQGLPPECKRSRF  293



>gb|AGI42450.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   354 bits (908),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 161/262 (61%), Positives = 204/262 (78%), Gaps = 5/262 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF+ND  + +G+  G++ +NG  + L LD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  26    NFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN +  PYT+H NV+SQGKG +EQQFHLWFDPTA FH
Sbjct  86    TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHINVFSQGKGGREQQFHLWFDPTADFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VDN PIR F N ES+G+ +P +Q MR+Y SLWNADDWAT+GGL+KT
Sbjct  145   TYSILWNPQRIIFSVDNTPIREFKNAESVGVAYPKNQAMRIYSSLWNADDWATRGGLIKT  204

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTA YRNFNA AC+ ++G SSCN  A ++N+    W  + LD   + R++WVQ 
Sbjct  205   DWSKAPFTASYRNFNAKACIWSSGRSSCNSNAPSNNA----WLNEELDATSQQRLQWVQK  260

Query  959   KHMVYNYCADAKRFPQGFSAEC  1024
              +M+YNYC DAKRFPQG+  EC
Sbjct  261   NYMIYNYCTDAKRFPQGYPPEC  282



>gb|AGI42458.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   354 bits (908),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 161/262 (61%), Positives = 204/262 (78%), Gaps = 5/262 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF+ND  + +G+  G++ +NG  + L LD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  26    NFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNV+SQGKG +EQQFHLWFDPTA FH
Sbjct  86    TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGGREQQFHLWFDPTADFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VDN PIR F N ES+G+ +P +Q MR+Y SLWNADDWAT+GGL+KT
Sbjct  145   TYSILWNPQRIIFSVDNTPIREFKNAESVGVAYPKNQAMRIYSSLWNADDWATRGGLIKT  204

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTA YRNFNA AC+ ++G SSCN  A ++N+    W  + LD   + R++W Q 
Sbjct  205   DWSKAPFTASYRNFNAKACIWSSGRSSCNSNAPSNNA----WLNEELDATSQQRLQWAQK  260

Query  959   KHMVYNYCADAKRFPQGFSAEC  1024
              +M+YNYC DAKRFPQG+  EC
Sbjct  261   NYMIYNYCTDAKRFPQGYPPEC  282



>gb|KCW89704.1| hypothetical protein EUGRSUZ_A01966 [Eucalyptus grandis]
Length=277

 Score =   353 bits (907),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 165/265 (62%), Positives = 201/265 (76%), Gaps = 3/265 (1%)
 Frame = +2

Query  242   FNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGT  421
             F  D  + +G    ++   G  + L+LD+ +GSGF +KNEYLFGR D+Q+KLV G SAGT
Sbjct  14    FYRDFDLTWGGERAKISQGGQLLTLSLDKYSGSGFQSKNEYLFGRIDLQLKLVPGNSAGT  73

Query  422   VTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHT  601
             VTT+YL+S  G AHDE+DFEFLGN +  PYTVHTNV++QGKGN+EQQF+LWFDPT AFHT
Sbjct  74    VTTYYLSSQ-GPAHDEIDFEFLGNLSGNPYTVHTNVFTQGKGNREQQFYLWFDPTKAFHT  132

Query  602   YTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKTD  781
             Y+ILWNPQRI+F+VDN PIR F N ES+G+PFP  Q MR+Y SLWNADDWAT GG VKTD
Sbjct  133   YSILWNPQRILFLVDNVPIREFVNKESMGVPFPNKQAMRIYSSLWNADDWATMGGRVKTD  192

Query  782   WSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQE--WQTQGLDGKGRNRVRWVQ  955
             W++APFTA YRNFNANAC  + G SSC      S++ +    W+TQ LD  GR R++WVQ
Sbjct  193   WTQAPFTASYRNFNANACAWSAGKSSCASTTTTSSTTSSSDVWRTQALDANGRQRLKWVQ  252

Query  956   SKHMVYNYCADAKRFPQGFSAECKR  1030
              K M+YNYC D KRFPQG   ECK+
Sbjct  253   KKFMIYNYCTDLKRFPQGLPPECKK  277



>ref|XP_010927058.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Elaeis guineensis]
Length=296

 Score =   354 bits (908),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 166/288 (58%), Positives = 214/288 (74%), Gaps = 6/288 (2%)
 Frame = +2

Query  161   VCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGS  340
               M ++  ++ACSL+ +A A      NF+ D Q+ +G+   ++ DNG  + L+LD+ +GS
Sbjct  12    AIMALLFPLLACSLMAIASAG-----NFHRDFQITWGDGRAKILDNGQHLTLSLDKASGS  66

Query  341   GFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVH  520
             GF +KNEYLFG+  MQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PYT+H
Sbjct  67    GFQSKNEYLFGKIHMQLKLVPGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLH  125

Query  521   TNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP  700
             TNV++QGKGN+E QFHLWFDPT  FHTY+ILWNP+ IIFMVD  PIR F N ES GI FP
Sbjct  126   TNVFTQGKGNREMQFHLWFDPTKDFHTYSILWNPRHIIFMVDGIPIRDFKNLESRGIAFP  185

Query  701   *SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAA  880
              +QPMR+Y SLWNADDWATQGG VKTDW++APFTA YRNF A+ACV ++  S+C  K ++
Sbjct  186   KNQPMRIYSSLWNADDWATQGGRVKTDWTKAPFTASYRNFKADACVWSSAASNCPSKKSS  245

Query  881   SNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAEC  1024
             ++S + +W  Q LD   + R+RWVQ+ +M+YNYC D KRFPQG   EC
Sbjct  246   TDSASDDWWNQELDFTSQERMRWVQNNYMIYNYCTDLKRFPQGLPPEC  293



>gb|AGI42454.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=281

 Score =   353 bits (907),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 161/262 (61%), Positives = 204/262 (78%), Gaps = 5/262 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF+ND  + +G+  G++ +NG  + L LD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  22    NFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNSAG  81

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNV+SQGKG +EQQFHLWFDPTA FH
Sbjct  82    TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGGREQQFHLWFDPTADFH  140

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQR IF VDN PIR F N ES+G+ +P +Q MR+Y SLWNADDWAT+GGL+KT
Sbjct  141   TYSILWNPQRTIFSVDNTPIREFKNAESVGVAYPKNQAMRIYSSLWNADDWATRGGLIKT  200

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTA YRNFNA AC+ ++G SSCN  A ++N+    W  + LD   + R++WVQ 
Sbjct  201   DWSKAPFTASYRNFNAKACIWSSGRSSCNSNAPSNNA----WLNEELDATSQQRLQWVQK  256

Query  959   KHMVYNYCADAKRFPQGFSAEC  1024
              +M+YNYC DAKRFPQG+  EC
Sbjct  257   NYMIYNYCTDAKRFPQGYPPEC  278



>ref|XP_002526228.1| Xyloglucan endotransglucosylase/hydrolase protein 22 precursor, 
putative [Ricinus communis]
 gb|EEF36169.1| Xyloglucan endotransglucosylase/hydrolase protein 22 precursor, 
putative [Ricinus communis]
Length=284

 Score =   353 bits (907),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 165/265 (62%), Positives = 202/265 (76%), Gaps = 1/265 (0%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF ND  + +G+   ++ ++G  + L LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  21    NFYNDFDITWGDGRAKILNDGELLTLTLDKASGSGFQSKNEYLFGKIDMQIKLVPGNSAG  80

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G   DE+DFEFLGN +  PY +HTNV+SQGKGN+EQQF+LWFDPTA FH
Sbjct  81    TVTAYYLSSK-GSTWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFH  139

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VD  PIR F N ES G+PFP +QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  140   TYSILWNPQRIIFSVDETPIREFKNMESNGVPFPRNQPMRIYSSLWNADDWATRGGLVKT  199

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTA YRNFNANACV +NG SSC   ++ S S +  W +Q LD   + R++WVQ 
Sbjct  200   DWSQAPFTASYRNFNANACVSSNGASSCGTNSSPSTSTSNSWLSQELDSTSQERLQWVQK  259

Query  959   KHMVYNYCADAKRFPQGFSAECKRS  1033
              +M+YNYC DAKRF QG   EC  S
Sbjct  260   NYMIYNYCTDAKRFAQGLPTECNLS  284



>ref|XP_011043999.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 isoform X2 [Populus euphratica]
Length=289

 Score =   353 bits (907),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 160/265 (60%), Positives = 199/265 (75%), Gaps = 1/265 (0%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF ND  + +G+   ++  NG  + LNLD+ +GSGF ++ EYLFG+ DMQ+KLV G SAG
Sbjct  26    NFYNDFDVTWGDGRAKILSNGELLTLNLDKASGSGFQSRKEYLFGKIDMQLKLVPGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G A DE+DFEFLGN +  PY +HTNV+SQGKGN+EQQF+LWFDPTA FH
Sbjct  86    TVTAYYLSSK-GSAWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRI+F VD  PIR F N ES+G+PFP +QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  145   TYSILWNPQRIVFSVDGTPIREFKNLESMGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  204

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW+ APFTA YRNFNA ACV++NG SSC    +   S +  W ++ LD   + R++WV+ 
Sbjct  205   DWALAPFTASYRNFNAEACVLSNGASSCGTTTSPPASTSNAWFSEELDSTRQERLKWVRE  264

Query  959   KHMVYNYCADAKRFPQGFSAECKRS  1033
              +MVYNYC D  RFPQG   EC  S
Sbjct  265   NYMVYNYCKDVNRFPQGLPPECSMS  289



>ref|XP_008449531.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
melo]
 ref|XP_008449532.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
melo]
Length=291

 Score =   353 bits (907),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 176/300 (59%), Positives = 223/300 (74%), Gaps = 10/300 (3%)
 Frame = +2

Query  140   MKKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALN  319
             M    + + +++ + V+  S++           NF  DV + +G    ++ D G  ++L+
Sbjct  1     MHSPHKGLTIMLPLCVLMASIM------TATAGNFLQDVDVTWGGPRAKILDRGRHLSLS  54

Query  320   LDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNAT  499
             LD+ +GSGF +K E+LFGRFD+QMKLV G SAGTVTTFYL+S  G +HDE+DFEFLGN++
Sbjct  55    LDKDSGSGFQSKQEFLFGRFDVQMKLVPGNSAGTVTTFYLSSQ-GGSHDEIDFEFLGNSS  113

Query  500   FQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHE  679
               PYT+HTNVYSQGKGN+EQQFHLWFDPT  FHTY+I W+P+ I F+VDN PIRVF+N E
Sbjct  114   GHPYTLHTNVYSQGKGNREQQFHLWFDPTKGFHTYSIDWSPESIKFLVDNIPIRVFHNWE  173

Query  680   SIGIPFP*SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSS  859
             ++G+ +P SQPMRVY SLWNADDWAT+GGLVKTDW++APFTA YRNFNAN CV ++G SS
Sbjct  174   NVGVSYPKSQPMRVYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFNANGCVASSGSSS  233

Query  860   CNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
             C  K ++S     +    GLD K RNR+RWVQSK M+YNYC D KRFPQG  AECKR RF
Sbjct  234   CGSKFSSSLQGGAQ---SGLDAKSRNRLRWVQSKFMIYNYCTDHKRFPQGIPAECKRPRF  290



>ref|XP_002321087.1| brassinosteroid-regulated family protein [Populus trichocarpa]
 gb|EEE99402.1| brassinosteroid-regulated family protein [Populus trichocarpa]
Length=284

 Score =   353 bits (906),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 165/281 (59%), Positives = 207/281 (74%), Gaps = 8/281 (3%)
 Frame = +2

Query  185   VVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEY  364
             V+ CS+            NF  D  + +G+   ++ + G  ++L+LD+ +GSGF +K EY
Sbjct  12    VIVCSMA------VVASGNFYQDFDLTWGDRRAKIFNGGQLLSLSLDKVSGSGFQSKKEY  65

Query  365   LFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGK  544
             LFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +HTNV++QGK
Sbjct  66    LFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILHTNVFTQGK  124

Query  545   GNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVY  724
             GN+EQQF+LWFDPT  FHTY+I+WNPQ IIF+VD+ PIRVF N ESIG+PFP SQPMR+Y
Sbjct  125   GNREQQFYLWFDPTRNFHTYSIIWNPQHIIFLVDSIPIRVFKNAESIGVPFPKSQPMRIY  184

Query  725   CSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEW  904
              SLWNADDWAT+GGLVKTDW++APFTAYYRNF ANAC  + G SSC  K +++ S+   W
Sbjct  185   SSLWNADDWATRGGLVKTDWTKAPFTAYYRNFKANACTWSYGTSSCGSKPSSAFSDG-AW  243

Query  905   QTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECK  1027
             +T  LD   R R+RWVQ   M+YNYC D +RFPQG   ECK
Sbjct  244   KTNELDAPSRRRLRWVQKYFMIYNYCTDLRRFPQGPPPECK  284



>gb|AGI42461.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   353 bits (906),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 161/262 (61%), Positives = 204/262 (78%), Gaps = 5/262 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF+ND  + +G+  G++ +NG  + L LD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  26    NFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFL N +  PYT+HTNV+SQGKG +EQQFHLWFDPTA FH
Sbjct  86    TVTAYYLSSQ-GPTHDEIDFEFLENLSGDPYTLHTNVFSQGKGGREQQFHLWFDPTADFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VDN PIR F N ES+G+ +P +Q MR+Y SLWNADDWAT+GGL+KT
Sbjct  145   TYSILWNPQRIIFSVDNTPIREFKNAESVGVAYPKNQAMRIYSSLWNADDWATRGGLIKT  204

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTA YRNFNA AC+ ++G SSCN  A ++N+    W  + LD   + R++WVQ 
Sbjct  205   DWSKAPFTASYRNFNAKACIWSSGRSSCNSNAPSNNA----WLNEELDATSQQRLQWVQE  260

Query  959   KHMVYNYCADAKRFPQGFSAEC  1024
              +M+YNYC DAKRFPQG+  EC
Sbjct  261   NYMIYNYCTDAKRFPQGYPPEC  282



>ref|XP_011043998.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 isoform X1 [Populus euphratica]
Length=289

 Score =   353 bits (906),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 160/265 (60%), Positives = 198/265 (75%), Gaps = 1/265 (0%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF ND  + +G+    +  NG  + LNLD+ +GSGF ++ EYLFG+ DMQ+KLV G SAG
Sbjct  26    NFYNDFDITWGDGRANILSNGELLTLNLDKASGSGFQSRKEYLFGKIDMQLKLVPGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G A DE+DFEFLGN +  PY +HTNV+SQGKGN+EQQF+LWFDPTA FH
Sbjct  86    TVTAYYLSSK-GSAWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRI+F VD  PIR F N ES+G+PFP +QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  145   TYSILWNPQRIVFSVDGTPIREFKNLESMGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  204

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW+ APFTA YRNFNA ACV++NG SSC    +   S +  W ++ LD   + R++WV+ 
Sbjct  205   DWALAPFTASYRNFNAEACVLSNGASSCGTTTSPPASTSNAWFSEELDSTRQERLKWVRE  264

Query  959   KHMVYNYCADAKRFPQGFSAECKRS  1033
              +MVYNYC D  RFPQG   EC  S
Sbjct  265   NYMVYNYCKDVNRFPQGLPPECSMS  289



>gb|EYU37336.1| hypothetical protein MIMGU_mgv1a021219mg, partial [Erythranthe 
guttata]
Length=275

 Score =   352 bits (904),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 162/267 (61%), Positives = 204/267 (76%), Gaps = 7/267 (3%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NFN DV + +G    Q+ + G  ++L+LD  +GSGF +K ++L+GRFD+Q+KL+ G SAG
Sbjct  16    NFNTDVTITWGQPRAQILNKGQLLSLSLDNTSGSGFESKYDFLYGRFDVQLKLIPGNSAG  75

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFY++S  G AHDE+DFEFLGNA+ QPYTVHTNVY+QG GNKEQQF LW+DPT AFH
Sbjct  76    TVTTFYMSSQ-GAAHDEIDFEFLGNASGQPYTVHTNVYAQGVGNKEQQFRLWYDPTLAFH  134

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TYTILWNP RII+MVDN PIRVFNN+ + G+ +P SQPM+VY SLWNADDWATQGG VKT
Sbjct  135   TYTILWNPLRIIYMVDNIPIRVFNNYIANGVQYPTSQPMKVYASLWNADDWATQGGQVKT  194

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW++APFTA Y+N+NAN C+V    +SC      +N   Q WQT GLD   + +++ +Q 
Sbjct  195   DWTKAPFTATYKNYNANGCIVNGTTNSC------TNKPRQSWQTMGLDANAKKKIQTLQQ  248

Query  959   KHMVYNYCADAKRFPQGFSAECKRSRF  1039
             K+M+YNYC D KRFPQG   EC   +F
Sbjct  249   KYMIYNYCTDLKRFPQGLPRECGLPKF  275



>ref|XP_007035759.1| Xyloglucan endotransglucosylase/hydrolase family protein [Theobroma 
cacao]
 gb|EOY06685.1| Xyloglucan endotransglucosylase/hydrolase family protein [Theobroma 
cacao]
Length=290

 Score =   353 bits (905),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 165/288 (57%), Positives = 208/288 (72%), Gaps = 8/288 (3%)
 Frame = +2

Query  170   IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
             +++  V+ C +   A        NF  D  + +G+  G++ +NG  + L+LD+ +GSGF 
Sbjct  11    LLMSLVIGCPVAASAS-------NFYQDFDITWGDGRGKIVNNGEVLTLSLDKASGSGFQ  63

Query  350   TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
             +KNEYLFG+ DMQ+KLV G SAGTVT +YL+S  G   DE+DFEFLGN +  PY +H NV
Sbjct  64    SKNEYLFGKIDMQLKLVPGNSAGTVTAYYLSSK-GSTWDEIDFEFLGNLSGDPYILHANV  122

Query  530   YSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQ  709
             +SQGKGN+EQQF+LWFDPTA FHTY+ILWNPQRIIF VD  PIR F N ES+G+PFP +Q
Sbjct  123   FSQGKGNREQQFYLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNTESLGVPFPKNQ  182

Query  710   PMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNS  889
             PMR+Y S WNADDWAT+GGLVKTDW++APFTA YRNFNA+ACV +N  SSC     +S S
Sbjct  183   PMRIYSSSWNADDWATRGGLVKTDWTQAPFTASYRNFNADACVWSNEASSCKSNPLSSAS  242

Query  890   NNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRS  1033
              N  W +Q LD   + R++WV   +M+YNYC DAKRFPQG   EC  S
Sbjct  243   TNNAWFSQELDSTSQQRLQWVPKNYMIYNYCTDAKRFPQGLPPECNMS  290



>emb|CDX68640.1| BnaC01g08130D [Brassica napus]
Length=282

 Score =   352 bits (904),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 164/262 (63%), Positives = 196/262 (75%), Gaps = 6/262 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             +FN+DV + +GN  G++ +NG  + L LD+ +GSGF +K EYLFG+ DMQ+KLV G SAG
Sbjct  23    DFNSDVNVAWGNGRGKILNNGQLLTLTLDKSSGSGFQSKTEYLFGKIDMQIKLVPGNSAG  82

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL S  G   DE+DFEFLGN T  PYT+HTNVY+QGKG+KEQQFHLWFDPTA FH
Sbjct  83    TVTTFYLKSE-GSTWDEIDFEFLGNMTGDPYTLHTNVYTQGKGDKEQQFHLWFDPTANFH  141

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRII  VD+ PIR F N ES+G+ FP S+PMR+Y SLWNADDWAT+GGLVKT
Sbjct  142   TYSILWNPQRIILTVDDTPIREFKNSESLGVLFPKSKPMRMYASLWNADDWATRGGLVKT  201

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTA YRN   + C  +NG SSC      SN     W TQ +D   + R+RWVQ 
Sbjct  202   DWSKAPFTASYRNIKVDGCAHSNGRSSCTSTKPTSN-----WYTQEMDSTSQARLRWVQK  256

Query  959   KHMVYNYCADAKRFPQGFSAEC  1024
              +M+YNYC D KRFPQG   EC
Sbjct  257   NYMIYNYCTDTKRFPQGIPREC  278



>gb|AGI42459.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   353 bits (905),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 161/262 (61%), Positives = 204/262 (78%), Gaps = 5/262 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             N +ND  + +G+  G++ +NG  + L LD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  26    NSHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNV+SQGKG +EQQFHLWFDPTA FH
Sbjct  86    TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGGREQQFHLWFDPTADFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VDN PIR F N ES+G+ +P +Q MR+Y SLWNADDWAT+GGL+KT
Sbjct  145   TYSILWNPQRIIFSVDNTPIREFKNAESVGVAYPKNQAMRIYSSLWNADDWATRGGLIKT  204

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTA YRNFNA AC+ ++G SSCN  A ++N+    W  + LD   + R++WVQ 
Sbjct  205   DWSKAPFTASYRNFNARACIWSSGRSSCNSNAPSNNA----WLNEELDATSQQRLQWVQK  260

Query  959   KHMVYNYCADAKRFPQGFSAEC  1024
              +M+YNYC DAKRFPQG+  EC
Sbjct  261   NYMIYNYCTDAKRFPQGYPPEC  282



>gb|KGN47998.1| hypothetical protein Csa_6G423400 [Cucumis sativus]
Length=274

 Score =   352 bits (903),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 171/267 (64%), Positives = 210/267 (79%), Gaps = 4/267 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV + +G    ++ D G  ++L+LD+ +GSGF +K E+LFGRFD+QMKLV G SAG
Sbjct  11    NFLQDVDITWGGPRAKILDGGRHLSLSLDKDSGSGFQSKQEFLFGRFDVQMKLVPGNSAG  70

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL+S  G +HDE+DFEFLGN++  PYT+HTNVYSQGKGN+EQQFHLWFDPT  FH
Sbjct  71    TVTTFYLSSQ-GGSHDEIDFEFLGNSSGDPYTLHTNVYSQGKGNREQQFHLWFDPTKGFH  129

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I W+P+ I F+VDN PIRVF+N E+IG+ +P SQPMR Y SLWNADDWAT+GGLVKT
Sbjct  130   TYSIDWSPESIKFLVDNIPIRVFHNWENIGVSYPKSQPMRAYSSLWNADDWATRGGLVKT  189

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW++APFTA YRNFNAN CV ++G SSC  K +++     +    GLD K RNR+RWVQS
Sbjct  190   DWTQAPFTASYRNFNANGCVASSGSSSCGSKFSSTLQGGAQ---SGLDAKSRNRLRWVQS  246

Query  959   KHMVYNYCADAKRFPQGFSAECKRSRF  1039
             K M+YNYC D KRFPQG  AEC+R RF
Sbjct  247   KFMIYNYCTDHKRFPQGIPAECRRPRF  273



>ref|NP_001284418.1| brassinosteroid-regulated protein BRU1-like precursor [Cucumis 
melo]
 gb|ABI94061.1| xyloglucan endotransglucosylase/hydrolase 1 [Cucumis melo]
Length=290

 Score =   352 bits (904),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 175/300 (58%), Positives = 223/300 (74%), Gaps = 10/300 (3%)
 Frame = +2

Query  140   MKKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALN  319
             M    + + +++++ V+  S++           NF  DV + +G    ++ D G  ++L+
Sbjct  1     MHFPHKGLTIMLLLCVLMASIM------TASAGNFLQDVDVTWGGPRAKILDGGRHLSLS  54

Query  320   LDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNAT  499
             LD+ +GSGF +K E+LFGRFD+QMKLV G SAGTVTTFYL+S  G +HDE+DFEFLGN++
Sbjct  55    LDKDSGSGFQSKQEFLFGRFDVQMKLVPGNSAGTVTTFYLSSQ-GGSHDEIDFEFLGNSS  113

Query  500   FQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHE  679
               PYT+HTNVYSQGKGN+EQQFHLWFDPT  FHTY+I W+P+ I F+VDN PIRVF+N E
Sbjct  114   GDPYTLHTNVYSQGKGNREQQFHLWFDPTKGFHTYSIDWSPESIKFLVDNIPIRVFHNWE  173

Query  680   SIGIPFP*SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSS  859
             +IG+ +P SQPMRVY SLWNADDWAT+GGLVKTDW++APFTA YRNFNAN CV ++G SS
Sbjct  174   NIGVSYPKSQPMRVYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFNANGCVASSGSSS  233

Query  860   CNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
             C  K +++     +    GLD   RNR+RWVQSK M+YNYC D KRFPQG  AECKR RF
Sbjct  234   CGSKFSSTLQGGAQ---SGLDANSRNRLRWVQSKFMIYNYCTDHKRFPQGIPAECKRPRF  290



>ref|XP_010243150.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Nelumbo 
nucifera]
Length=288

 Score =   352 bits (904),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 170/292 (58%), Positives = 220/292 (75%), Gaps = 8/292 (3%)
 Frame = +2

Query  155   QQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQT  334
              ++  +++  ++  SL+    A      NF  D  + +G+H  ++ + G  ++L+LD+ +
Sbjct  5     HRLSDLLMSALIMSSLMAAYAA------NFYQDFDLTWGDHRAKIFNGGQLLSLSLDKTS  58

Query  335   GSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYT  514
             GSGF +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY 
Sbjct  59    GSGFQSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYI  117

Query  515   VHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIP  694
             +HTNV++QGKGN+EQQF+LWFDPT  FHTY+I+WNPQRIIF+VDN PIR FNN E+ G+P
Sbjct  118   LHTNVFTQGKGNREQQFYLWFDPTRNFHTYSIVWNPQRIIFLVDNIPIREFNNAEARGVP  177

Query  695   FP*SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKA  874
             FP +QPMR+Y SLWNADDWAT+GGLVKTDW++APFTAYYRNFNANACV + G SSC+ K+
Sbjct  178   FPKNQPMRIYSSLWNADDWATRGGLVKTDWTKAPFTAYYRNFNANACVWSAGSSSCSSKS  237

Query  875   AASNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKR  1030
               S +++  WQTQ LD   R R+RWVQ  +M+YNYC D KRFPQG   EC+R
Sbjct  238   TNSFTDS-AWQTQELDATSRRRLRWVQKYYMIYNYCTDVKRFPQGLPPECRR  288



>emb|CCH26408.1| xyloglucan endotransglycosylase [Cucumis sativus]
Length=280

 Score =   352 bits (903),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 173/267 (65%), Positives = 209/267 (78%), Gaps = 4/267 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV + +G    ++ D G  ++L+LD+ +GSGF +K E+LFGRFD+QMKLV G SAG
Sbjct  18    NFLQDVDITWGGPRAKILDGGRHLSLSLDKDSGSGFQSKQEFLFGRFDVQMKLVPGNSAG  77

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL+S  G +HDE+DFEFLGN++  PYT+HTNVYSQGKGN+EQQFHLWFDPT  FH
Sbjct  78    TVTTFYLSSQ-GGSHDEIDFEFLGNSSGDPYTLHTNVYSQGKGNREQQFHLWFDPTKGFH  136

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I W+P+ I F+VDN PIRVF N E+IG+ +P SQPMRVY SLWNADDWAT+GGLVKT
Sbjct  137   TYSIDWSPESIKFLVDNIPIRVFRNWENIGVSYPKSQPMRVYSSLWNADDWATRGGLVKT  196

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW++APFTA YRNFNAN CV ++G SSC  K +++     +    GLD K RNR+RWVQS
Sbjct  197   DWTQAPFTASYRNFNANGCVASSGSSSCGSKFSSTLQGGAQ---SGLDAKSRNRLRWVQS  253

Query  959   KHMVYNYCADAKRFPQGFSAECKRSRF  1039
             K MVYNYC D KRFPQG  AEC R RF
Sbjct  254   KFMVYNYCTDHKRFPQGIPAECMRPRF  280



>ref|XP_011044000.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Populus euphratica]
Length=289

 Score =   352 bits (904),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 160/265 (60%), Positives = 198/265 (75%), Gaps = 1/265 (0%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF ND  + +G+    +  NG  + LNLD+ +GSGF ++ EYLFG+ DMQ+KLV G SAG
Sbjct  26    NFYNDFDITWGDGRANILSNGELLTLNLDKASGSGFQSRKEYLFGKIDMQLKLVPGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G A DE+DFEFLGN +  PY +HTNV+SQGKGN+EQQF+LWFDPTA FH
Sbjct  86    TVTAYYLSSK-GSAWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRI+F VD  PIR F N ES+G+PFP +QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  145   TYSILWNPQRIVFSVDGTPIREFKNLESMGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  204

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW+ APFTA YRNFNA ACV++NG SSC    +   S +  W ++ LD   + R++WV+ 
Sbjct  205   DWALAPFTASYRNFNAEACVLSNGASSCGTTTSPPASTSNAWFSEELDSTRQERLKWVRE  264

Query  959   KHMVYNYCADAKRFPQGFSAECKRS  1033
              +MVYNYC D  RFPQG   EC  S
Sbjct  265   NYMVYNYCKDVNRFPQGLPPECGMS  289



>ref|XP_003610142.1| Xyloglucan endotransglucosylase/hydrolase [Medicago truncatula]
 gb|AES92339.1| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
Length=283

 Score =   352 bits (903),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 162/287 (56%), Positives = 213/287 (74%), Gaps = 15/287 (5%)
 Frame = +2

Query  167   MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
             +++ I  VA +  G          NF  D  + +G+   ++ ++G  + L+LD+ +GSGF
Sbjct  10    LVIFISTVAIASAG----------NFYQDFDITWGDGRAKILNSGQLLTLSLDKSSGSGF  59

Query  347   NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
              +KNEYLFG+ DMQ+KLV G SAGTVT +YL+S  G A DE+DFEFLGN +  PY +HTN
Sbjct  60    QSKNEYLFGKIDMQLKLVPGNSAGTVTAYYLSSK-GGAWDEIDFEFLGNLSGDPYILHTN  118

Query  527   VYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*S  706
             V+SQGKG++EQQ +LWFDPTA FHTY+ILWNPQRI+F VD  PIR F N ES G+PFP +
Sbjct  119   VFSQGKGDREQQIYLWFDPTADFHTYSILWNPQRIVFSVDGTPIREFKNIESSGVPFPKN  178

Query  707   QPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASN  886
             QPMR+Y SLWNADDWAT+GGLVKTDWS+APFTA YR+FNANAC+V++G+SSC+    ++ 
Sbjct  179   QPMRIYSSLWNADDWATRGGLVKTDWSKAPFTASYRHFNANACIVSSGISSCD----SAQ  234

Query  887   SNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECK  1027
             SN  +W ++ LD     R++WVQ  +M+YNYC+D KRFPQG   EC+
Sbjct  235   SNKNDWFSEELDSTSYERLKWVQKNYMIYNYCSDNKRFPQGLPQECR  281



>ref|XP_009121735.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Brassica rapa]
Length=287

 Score =   352 bits (903),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 165/262 (63%), Positives = 204/262 (78%), Gaps = 2/262 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF+ DV++ +G+  GQ+ +NG+ + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  25    NFHQDVEITWGDGRGQITNNGDLLTLSLDKSSGSGFQSKNEYLFGKIDMQIKLVAGNSAG  84

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL SP G   DE+DFEFLGN +  PYT+HTNV++QGKG++EQQF LWFDPT  FH
Sbjct  85    TVTAYYLKSP-GSTWDEIDFEFLGNLSGDPYTLHTNVFTQGKGDREQQFKLWFDPTIDFH  143

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VD  PIR F N ES G  FP +QPMR+Y SLWNA+DWAT+GGLVKT
Sbjct  144   TYSILWNPQRIIFSVDGTPIREFKNMESQGTLFPKNQPMRMYSSLWNAEDWATRGGLVKT  203

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTA YR F+  ACVV+NG SSC+   +A  S +  W +Q LD  G+ R+RWVQS
Sbjct  204   DWSKAPFTASYRGFSEEACVVSNGKSSCS-NGSAQGSGSGSWLSQELDSTGQERMRWVQS  262

Query  959   KHMVYNYCADAKRFPQGFSAEC  1024
              +M+YNYC DAKRFPQG   EC
Sbjct  263   NYMIYNYCTDAKRFPQGLPREC  284



>ref|XP_002317310.1| xyloglucan endo-1 family protein [Populus trichocarpa]
 gb|EEE97922.1| xyloglucan endo-1 family protein [Populus trichocarpa]
Length=292

 Score =   352 bits (903),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 163/266 (61%), Positives = 209/266 (79%), Gaps = 2/266 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NFN +V + +G    ++   G+ ++L LD+ +GSGF +K+EYLFGR DMQ+KLV G SAG
Sbjct  27    NFNQEVDLTWGGDRAKILSGGSVLSLTLDKVSGSGFQSKSEYLFGRIDMQIKLVGGNSAG  86

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             +VT +YL+S  G  HDE+DFEFLGN + +PYTVHTNVY+QGKG++EQQFHLWFDPT  FH
Sbjct  87    SVTAYYLSSE-GPYHDEIDFEFLGNLSGEPYTVHTNVYTQGKGDREQQFHLWFDPTKDFH  145

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
              Y+++WN QRIIF+VD+ PIRV+ N ESIG+PFP +QPM++Y SLWNAD WAT+GGLVK 
Sbjct  146   LYSVVWNHQRIIFLVDDTPIRVYENQESIGVPFPKNQPMKLYSSLWNADQWATRGGLVKA  205

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTAYYRNF ANAC+ ++G SSC+ K  +S++NN  WQTQGLD   R  +RWVQ 
Sbjct  206   DWSKAPFTAYYRNFKANACLWSSGSSSCSLKTTSSSTNN-AWQTQGLDSTSRRSLRWVQK  264

Query  959   KHMVYNYCADAKRFPQGFSAECKRSR  1036
              +M+YNYC D KRFP G   EC+ S+
Sbjct  265   YYMIYNYCTDYKRFPMGRPRECRLSK  290



>ref|XP_008449536.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
melo]
Length=290

 Score =   352 bits (903),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 175/289 (61%), Positives = 217/289 (75%), Gaps = 6/289 (2%)
 Frame = +2

Query  173   MIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNT  352
             + I ++ C L+   +       NF  DV + +G    ++ D G  ++L+LD+ +GSGF +
Sbjct  8     LTIMLLQCVLMASIMTTSAG--NFFQDVDITWGGPRAKILDGGRHLSLSLDKDSGSGFQS  65

Query  353   KNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVY  532
             K E+LFGRFD+QMKLV G SAGTVTTFYL+S  G +HDE+DFEFLGN++  PYT+HTNVY
Sbjct  66    KQEFLFGRFDVQMKLVPGNSAGTVTTFYLSSQ-GGSHDEIDFEFLGNSSGDPYTLHTNVY  124

Query  533   SQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQP  712
             SQGKGN+EQQFHLWFDPT  FHTY+I W+P+ I F+VDN PIRVF N E+IG+ +P SQP
Sbjct  125   SQGKGNREQQFHLWFDPTKGFHTYSIDWSPESIKFLVDNIPIRVFRNWENIGVSYPKSQP  184

Query  713   MRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSN  892
             MRVY SLWNADDWAT+GGLVKTDW++APFTA YRNFNAN CV ++G SSC  K +++   
Sbjct  185   MRVYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFNANGCVASSGSSSCGSKFSSTLQG  244

Query  893   NQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
               +    GLD   RNR+RWVQSK M+YNYC D KRFPQG  AECKR RF
Sbjct  245   GAQ---SGLDANSRNRMRWVQSKFMIYNYCTDHKRFPQGIPAECKRPRF  290



>gb|AAF80591.1|AF223420_1 xyloglucan endotransglycosylase XET2 [Asparagus officinalis]
Length=284

 Score =   351 bits (901),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 168/284 (59%), Positives = 215/284 (76%), Gaps = 6/284 (2%)
 Frame = +2

Query  173   MIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNT  352
             ++  V+A S VG+A+A      NFN+D ++ +G+  G++ DNG  ++L+LD+ +GSGF +
Sbjct  4     LLFAVLALSSVGIAVAG-----NFNDDFKITWGDGRGRIVDNGQLLSLSLDKASGSGFES  58

Query  353   KNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVY  532
              +EYLFG+ DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNV+
Sbjct  59    THEYLFGKIDMQLKLVPGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVF  117

Query  533   SQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQP  712
             +QGKGN+EQQFHLWFDPT  FHTY+ILWNP  IIF VD  PIR F N ES G+ FP SQP
Sbjct  118   TQGKGNREQQFHLWFDPTKDFHTYSILWNPSHIIFSVDGIPIRDFKNMESRGVAFPKSQP  177

Query  713   MRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSN  892
             M++Y SLWNADDWAT+GGL+KTDW++APFTA YRNFNANACV + G S+C+ K + S S 
Sbjct  178   MKIYSSLWNADDWATRGGLIKTDWTKAPFTASYRNFNANACVWSAGTSTCSSKKSPSASP  237

Query  893   NQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAEC  1024
             +  W  + LD   + R+RWVQ  +M+YNYCAD KRFPQG   EC
Sbjct  238   SNAWLNEELDSTRQERMRWVQKNYMIYNYCADLKRFPQGLPPEC  281



>ref|XP_011024784.1| PREDICTED: brassinosteroid-regulated protein BRU1-like isoform 
X1 [Populus euphratica]
 ref|XP_011024785.1| PREDICTED: brassinosteroid-regulated protein BRU1-like isoform 
X2 [Populus euphratica]
Length=288

 Score =   352 bits (902),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 166/285 (58%), Positives = 213/285 (75%), Gaps = 8/285 (3%)
 Frame = +2

Query  185   VVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEY  364
             ++ACS+V           +F  D  + +G+H  ++ + G  ++L+LD+ +GSGF +K EY
Sbjct  12    LIACSMV------VVASGSFYQDFDLTWGDHRAKIFNGGQLLSLSLDKVSGSGFQSKKEY  65

Query  365   LFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGK  544
             LFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +HTNV++QGK
Sbjct  66    LFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILHTNVFTQGK  124

Query  545   GNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVY  724
             GN+EQQF+LWFDPT  FHTY+I+W+ Q IIF+VDN PIRVF N ESIG+PFP SQPMR+Y
Sbjct  125   GNREQQFYLWFDPTRNFHTYSIIWSHQHIIFLVDNFPIRVFKNAESIGVPFPKSQPMRIY  184

Query  725   CSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEW  904
              SLWNADDWAT+GG+VKTDW++APFTAYYRNF A+AC  + G  S     ++S+ +++ W
Sbjct  185   SSLWNADDWATRGGVVKTDWTKAPFTAYYRNFKADACTWSYG-KSSCGSRSSSSFSDRAW  243

Query  905   QTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
             QT  LD   R R+RWVQ   M+YNYCAD KRFPQG   EC+RSRF
Sbjct  244   QTNALDAPSRRRLRWVQKYFMIYNYCADLKRFPQGLPPECRRSRF  288



>ref|XP_010536923.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Tarenaya hassleriana]
Length=289

 Score =   351 bits (901),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 168/292 (58%), Positives = 211/292 (72%), Gaps = 13/292 (4%)
 Frame = +2

Query  149   QQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQ  328
             +Q  +  +++ GV+  S+            NF  +V++ +G+  GQ+ +NG  + L+LD+
Sbjct  8     RQMLLLPLLVAGVLLSSV----------HANFYQNVEITWGDGRGQINNNGELLTLSLDR  57

Query  329   QTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQP  508
              +GSGF +KNEYLFG+ DMQ+KLV G SAGTVT +YL SP G   DE+DFEFLGN +  P
Sbjct  58    ASGSGFQSKNEYLFGKIDMQIKLVPGNSAGTVTAYYLKSP-GSTWDEIDFEFLGNLSGDP  116

Query  509   YTVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIG  688
             YT+HTNV++QGKGN+EQQF LWFDPT+ FHTY+ILWNPQRIIF VD  PIR F N ES G
Sbjct  117   YTLHTNVFTQGKGNREQQFKLWFDPTSDFHTYSILWNPQRIIFSVDGTPIREFKNMESQG  176

Query  689   IPFP*SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNF  868
             + FP SQPMR+Y SLWNADDWAT+GGLVKTDWS+APFTA YR FN +ACV +NG S+C  
Sbjct  177   VLFPKSQPMRMYSSLWNADDWATRGGLVKTDWSQAPFTASYRGFNEDACVWSNGKSTC--  234

Query  869   KAAASNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAEC  1024
                +S   +  W +Q LD  G+ R+RWVQ   M+YNYCAD KRFPQG   EC
Sbjct  235   PNGSSQGTSGSWLSQELDTTGQERMRWVQRNFMIYNYCADTKRFPQGVPREC  286



>gb|EYU41110.1| hypothetical protein MIMGU_mgv1a011456mg [Erythranthe guttata]
Length=281

 Score =   351 bits (900),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 163/267 (61%), Positives = 203/267 (76%), Gaps = 7/267 (3%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NFN DV + +G    Q+ +NG  ++L+LD  +GSGF +K ++L+GRFD+Q+KL+ G SAG
Sbjct  22    NFNTDVTITWGQPRAQILNNGQLLSLSLDNTSGSGFESKYDFLYGRFDVQLKLIPGNSAG  81

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFY++S  G AHDE+DFEFLGNA+ QPYTVHTNVY+QG GNKEQQF LW+DPT AFH
Sbjct  82    TVTTFYMSSQ-GTAHDEIDFEFLGNASGQPYTVHTNVYAQGVGNKEQQFRLWYDPTLAFH  140

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TYTILWNP RII+MVDN PIRVFNN+ + G+ +P SQPM+VY SLWNADDWATQGG VKT
Sbjct  141   TYTILWNPLRIIYMVDNIPIRVFNNYIANGVQYPTSQPMKVYGSLWNADDWATQGGQVKT  200

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW++APFTA Y+N+NAN C+V    +SC      SN   Q WQT GLD   +  ++ +Q 
Sbjct  201   DWTKAPFTATYKNYNANGCIVNGTTNSC------SNKPRQSWQTMGLDANAKKNIQTLQQ  254

Query  959   KHMVYNYCADAKRFPQGFSAECKRSRF  1039
             K+M+YNYC D  RFPQG   EC   +F
Sbjct  255   KYMIYNYCTDVNRFPQGLPKECGLPKF  281



>gb|ABM91071.1| xyloglucan endotransglycosylase/hydrolase precursor XTH-14 [Populus 
tremula x Populus tremuloides]
Length=284

 Score =   351 bits (900),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 161/263 (61%), Positives = 202/263 (77%), Gaps = 2/263 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF+ D  + +G+   ++ + G  ++L+LD+ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  24    NFHQDFDLTWGDRRAKIFNGGQLLSLSLDKVSGSGFQSKKEYLFGRIDMQLKLVAGNSAG  83

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN +  PY +HTNV++QGKGN+EQQF+LWFDPT  FH
Sbjct  84    TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILHTNVFTQGKGNREQQFYLWFDPTRNFH  142

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WNPQ IIF+VD+ PIRVF N ESIG+PFP SQPMR+Y SLWNADDWAT+GGLVKT
Sbjct  143   TYSIIWNPQHIIFLVDSVPIRVFKNAESIGVPFPKSQPMRIYSSLWNADDWATRGGLVKT  202

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW++APF AYYRNF ANAC  + G SSC  K +++ S+   W+T  LD   R R+RWVQ 
Sbjct  203   DWTKAPFNAYYRNFKANACTWSYGASSCGSKPSSAFSDG-AWKTNELDAPSRRRLRWVQK  261

Query  959   KHMVYNYCADAKRFPQGFSAECK  1027
               M+YNYC D +RFPQG   ECK
Sbjct  262   YFMIYNYCTDLRRFPQGPPPECK  284



>ref|XP_008449534.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
melo]
Length=290

 Score =   351 bits (901),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 172/267 (64%), Positives = 210/267 (79%), Gaps = 4/267 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV + +G    ++ D G  ++L+LD+ +GSGF +K E+LFGRFD+QMKLV G SAG
Sbjct  28    NFLQDVDITWGGPRAKILDGGRHLSLSLDKDSGSGFQSKQEFLFGRFDVQMKLVPGNSAG  87

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL+S  G +HDE+DFEFLGN++  PYT+HTNVYSQGKGN+EQQFHLWFDPT  FH
Sbjct  88    TVTTFYLSSQ-GGSHDEIDFEFLGNSSGDPYTLHTNVYSQGKGNREQQFHLWFDPTKGFH  146

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I W+P+ I F+VDN PIRVF+N E+IG+ +P SQPMRVY SLWNADDWAT+GGLVKT
Sbjct  147   TYSIDWSPESIKFLVDNIPIRVFHNWENIGVSYPKSQPMRVYSSLWNADDWATRGGLVKT  206

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW++APFTA YRNFNAN CV ++G SSC  K +++     +    GLD   RNR+RWVQS
Sbjct  207   DWTQAPFTASYRNFNANGCVASSGSSSCGSKFSSTLQGGAQ---SGLDANSRNRMRWVQS  263

Query  959   KHMVYNYCADAKRFPQGFSAECKRSRF  1039
             K M+YNYC D KRFPQG  AECKR RF
Sbjct  264   KFMIYNYCTDHKRFPQGIPAECKRPRF  290



>ref|XP_010259798.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Nelumbo nucifera]
Length=296

 Score =   351 bits (901),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 164/287 (57%), Positives = 218/287 (76%), Gaps = 10/287 (3%)
 Frame = +2

Query  164   CMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSG  343
             C +++I +   ++            +FN D  + +G+   ++ +NG+ + L+LD+ +GSG
Sbjct  14    CFLVLISLAIATVSAS---------SFNQDFDITWGDGRAKILNNGDLLTLSLDKASGSG  64

Query  344   FNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHT  523
             F +++EYLFG+ DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +HT
Sbjct  65    FQSRHEYLFGKIDMQLKLVAGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILHT  123

Query  524   NVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*  703
             NV+SQGKGN+EQQF+LWFDPTA FHTY+ILWNPQRIIF VD  PIR F N ESIG+PFP 
Sbjct  124   NVFSQGKGNREQQFYLWFDPTADFHTYSILWNPQRIIFSVDGIPIREFKNSESIGVPFPK  183

Query  704   SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAAS  883
             +Q MR+Y SLWNADDWAT+GGLVKTDW++APFTA YRNFNANAC++++G SSC+ K+  S
Sbjct  184   NQAMRIYSSLWNADDWATRGGLVKTDWTKAPFTASYRNFNANACIMSSGSSSCDSKSPTS  243

Query  884   NSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAEC  1024
              ++N +W +Q LD  G+ R++WVQ+ +M+YNYC D KRFPQG   EC
Sbjct  244   TTDNLQWLSQELDSAGQERMKWVQNNYMIYNYCTDTKRFPQGLPPEC  290



>ref|XP_002324481.2| xyloglucan endo-1 family protein [Populus trichocarpa]
 gb|EEF03046.2| xyloglucan endo-1 family protein [Populus trichocarpa]
Length=286

 Score =   351 bits (900),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 159/265 (60%), Positives = 198/265 (75%), Gaps = 1/265 (0%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF ND  + +G+   ++  NG  + LNLD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  23    NFYNDFDITWGDGRAKILSNGELLTLNLDKASGSGFQSRNEYLFGKIDMQLKLVPGNSAG  82

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G A DE+DFEFLGN +  PY +HTNV+SQGKGN+EQQF+LWFDPTA FH
Sbjct  83    TVTAYYLSSK-GSAWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFH  141

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRI+F VD  PIR F N ES+G+PFP +QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  142   TYSILWNPQRIVFSVDGTPIREFKNLESMGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  201

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW+ APFTA YRNFNA ACV++NG SSC    +     +  W ++ LD   + R++W + 
Sbjct  202   DWALAPFTASYRNFNAEACVLSNGASSCGTTTSPPAPTSNAWFSEELDSTRQERLKWARE  261

Query  959   KHMVYNYCADAKRFPQGFSAECKRS  1033
              +MVYNYC D  RFPQG   EC  S
Sbjct  262   NYMVYNYCKDINRFPQGLPPECSMS  286



>ref|XP_002301752.1| brassinosteroid-regulated family protein [Populus trichocarpa]
 gb|ABK93796.1| unknown [Populus trichocarpa]
 gb|EEE81025.1| brassinosteroid-regulated family protein [Populus trichocarpa]
Length=288

 Score =   351 bits (900),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 167/285 (59%), Positives = 213/285 (75%), Gaps = 8/285 (3%)
 Frame = +2

Query  185   VVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEY  364
             ++ CS+V           +F  D  + +G+H  ++ + G  ++L+LD+ +GSGF +K EY
Sbjct  12    LIVCSMV------VVASGSFYQDFDLTWGDHRAKIFNGGQLLSLSLDKVSGSGFQSKKEY  65

Query  365   LFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGK  544
             LFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +HTNV++QGK
Sbjct  66    LFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GATHDEIDFEFLGNLSGDPYILHTNVFTQGK  124

Query  545   GNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVY  724
             GN+EQQF+LWFDPT  FHTY+I+W+ Q IIF+VDN PIRVF N ESIG+PFP SQPMR+Y
Sbjct  125   GNREQQFYLWFDPTRNFHTYSIIWSQQHIIFLVDNFPIRVFKNAESIGVPFPKSQPMRIY  184

Query  725   CSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEW  904
              SLWNADDWAT+GGLVKTDW++APFTAYYRNF A+AC  + G SSC    ++S+ +++ W
Sbjct  185   SSLWNADDWATRGGLVKTDWTKAPFTAYYRNFKADACTWSYGTSSCG-SRSSSSFSDRAW  243

Query  905   QTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
              T  LD   R R+RWVQ   M+YNYCAD KRFPQG   EC+RSRF
Sbjct  244   HTNALDAPSRRRLRWVQKYFMIYNYCADLKRFPQGLPPECRRSRF  288



>ref|XP_009127941.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24 [Brassica rapa]
 emb|CDY28174.1| BnaA01g06750D [Brassica napus]
Length=282

 Score =   350 bits (899),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 163/262 (62%), Positives = 195/262 (74%), Gaps = 6/262 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             +FN+DV + +GN  G++ +NG  + L LD+ +GSGF +K EYLFG+ DMQ+KLV G SAG
Sbjct  23    DFNSDVNVAWGNGRGKILNNGQLLTLTLDKSSGSGFQSKTEYLFGKIDMQIKLVPGNSAG  82

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL S  G   DE+DFEFLGN T  PYT+HTNVY+QGKG+KEQQFHLWFDPTA FH
Sbjct  83    TVTTFYLKSE-GSTWDEIDFEFLGNMTGDPYTLHTNVYTQGKGDKEQQFHLWFDPTANFH  141

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRII  VD+ PIR F N ES+G+ FP S+PMR+Y SLWNADDWAT+GGLVKT
Sbjct  142   TYSILWNPQRIILTVDDTPIREFKNSESLGVLFPKSKPMRMYASLWNADDWATRGGLVKT  201

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTA YRN   + C  +NG SSC      S      W TQ +D   + R+RWVQ 
Sbjct  202   DWSKAPFTASYRNIKIDGCAHSNGRSSC-----TSTKPTSTWYTQEMDSTSQARLRWVQK  256

Query  959   KHMVYNYCADAKRFPQGFSAEC  1024
              +M+YNYC D KRFPQG   EC
Sbjct  257   NYMIYNYCTDTKRFPQGIPREC  278



>ref|XP_010927056.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Elaeis guineensis]
Length=277

 Score =   350 bits (898),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 164/284 (58%), Positives = 207/284 (73%), Gaps = 13/284 (5%)
 Frame = +2

Query  173   MIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNT  352
             ++  ++AC L+  A A      NF  +  + +G+  G++ DNG  + L LD+ +GSGF +
Sbjct  4     LVFPLLACFLMATASAG-----NFYQEFDITWGDGRGKILDNGQLLTLALDKASGSGFQS  58

Query  353   KNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVY  532
             KNEYLFG+ DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN + +PYT+HTNV+
Sbjct  59    KNEYLFGKIDMQLKLVPGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGEPYTLHTNVF  117

Query  533   SQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQP  712
             +QGKGN+E QFHLWF+PT  FHTY+ILWNP+ +IFMVD  PIR F N ES G+ FP SQP
Sbjct  118   TQGKGNREMQFHLWFNPTEDFHTYSILWNPEHVIFMVDGTPIRDFKNMESKGVAFPKSQP  177

Query  713   MRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSN  892
             MR+Y SLWNADDWATQGG VKTDW++APFTA YRNFNA+AC+ ++G SSC       NS 
Sbjct  178   MRIYSSLWNADDWATQGGRVKTDWTKAPFTASYRNFNADACIWSSGTSSC-------NSQ  230

Query  893   NQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAEC  1024
               +W  Q LD  G+ R+RW Q  +M+YNYC D KRFPQG   EC
Sbjct  231   KSDWWNQELDSTGQERMRWAQENYMIYNYCTDLKRFPQGLPPEC  274



>ref|XP_010259803.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Nelumbo nucifera]
Length=295

 Score =   351 bits (900),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 162/289 (56%), Positives = 209/289 (72%), Gaps = 7/289 (2%)
 Frame = +2

Query  161   VCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGS  340
             V  ++I+ ++A S +  + A       F  D  + +G+   ++ +NG  + L+LD+ +GS
Sbjct  9     VSALLIVALLASSFMATSSAR-----TFYQDFDLTWGDGRAKILNNGKLLTLSLDKASGS  63

Query  341   GFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVH  520
             GF +K EYLFG  DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +H
Sbjct  64    GFQSKREYLFGSIDMQLKLVPGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILH  122

Query  521   TNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP  700
             TNV+SQGKGN+EQQF+LWFDPT  FHTY+ILWNPQ IIF VD  PIR F N ESIG+PFP
Sbjct  123   TNVFSQGKGNREQQFYLWFDPTKDFHTYSILWNPQSIIFSVDGIPIREFKNLESIGVPFP  182

Query  701   *SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAA  880
              +QPMR+Y SLWNADDWAT+GGL+KTDW++ PFTA YRNF A ACV ++G SSCN ++ A
Sbjct  183   KNQPMRIYSSLWNADDWATRGGLIKTDWTKVPFTASYRNFKAKACVWSSGASSCNSQSLA  242

Query  881   SNSN-NQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAEC  1024
             S  N N+ W ++ LD   + ++RW Q  +M+YNYC D KRFPQG   EC
Sbjct  243   STRNYNKAWLSRQLDSTSQEKMRWAQRNYMIYNYCTDTKRFPQGLPPEC  291



>ref|NP_001267702.1| probable xyloglucan endotransglucosylase/hydrolase protein 23-like 
precursor [Cucumis sativus]
 emb|CAD87535.1| putative xyloglucan endotransglycosylase [Cucumis sativus]
 emb|CAD87533.1| putative xyloglucan endotransglycosylase [Cucumis sativus]
 gb|KGN65438.1| hypothetical protein Csa_1G422470 [Cucumis sativus]
Length=283

 Score =   350 bits (898),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 160/262 (61%), Positives = 200/262 (76%), Gaps = 4/262 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NFN D Q+ +G+   ++ +NG  + L+LD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  23    NFNQDFQITWGDGRAKILNNGELLTLSLDKASGSGFQSQNEYLFGKIDMQLKLVAGNSAG  82

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G   DE+DFEFLGN +  PYT+HTNV+SQGKGN+EQQFHLWFDPTA FH
Sbjct  83    TVTAYYLSSK-GSTWDEIDFEFLGNLSGDPYTLHTNVFSQGKGNREQQFHLWFDPTADFH  141

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNP RIIF VD  PIR F N ES G+PFP  QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  142   TYSILWNPNRIIFSVDGTPIREFKNWESNGVPFPKDQPMRIYSSLWNADDWATRGGLVKT  201

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW++APFTA Y+NF A ACV + G SSC+   A S+++   W +Q +D   + R++WVQ 
Sbjct  202   DWTKAPFTASYKNFKAEACVWSGGKSSCSPSPAGSSNS---WLSQEMDSASQERLKWVQK  258

Query  959   KHMVYNYCADAKRFPQGFSAEC  1024
              +M+YNYC D KRFPQG   EC
Sbjct  259   NYMIYNYCTDTKRFPQGLPTEC  280



>ref|XP_006453421.1| hypothetical protein CICLE_v10009118mg [Citrus clementina]
 gb|ESR66661.1| hypothetical protein CICLE_v10009118mg [Citrus clementina]
Length=285

 Score =   350 bits (898),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 166/265 (63%), Positives = 206/265 (78%), Gaps = 1/265 (0%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF+ D  + +G+    + +NG  + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  22    NFHQDFDITWGDGRANILNNGQLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSAG  81

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL SP G   DE+DFEFLGN +  PYT+HTNV++ GKG+KEQQFHLWFDPTA FH
Sbjct  82    TVTAYYLKSP-GSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDKEQQFHLWFDPTADFH  140

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRI+F VD  PIR F N ESIG+ FP +QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  141   TYSILWNPQRIVFSVDGTPIREFKNSESIGVAFPKNQPMRIYSSLWNADDWATRGGLVKT  200

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW+ APFTA YRNFNA+ACV +NG SSC   + +S S++  W +Q LD   + R++WVQ 
Sbjct  201   DWTHAPFTASYRNFNADACVWSNGKSSCASSSPSSPSSSSAWFSQELDSTSQERLKWVQK  260

Query  959   KHMVYNYCADAKRFPQGFSAECKRS  1033
              +M+YNYCADAKRFPQG  AEC+ S
Sbjct  261   NYMIYNYCADAKRFPQGLPAECRTS  285



>ref|XP_006453414.1| hypothetical protein CICLE_v10009119mg [Citrus clementina]
 ref|XP_006474157.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like [Citrus sinensis]
 gb|ESR66654.1| hypothetical protein CICLE_v10009119mg [Citrus clementina]
Length=285

 Score =   350 bits (898),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 166/265 (63%), Positives = 206/265 (78%), Gaps = 1/265 (0%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF+ D  + +G+    + +NG  + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  22    NFHQDFDITWGDGRANILNNGQLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSAG  81

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL SP G   DE+DFEFLGN +  PYT+HTNV++ GKG+KEQQFHLWFDPTA FH
Sbjct  82    TVTAYYLKSP-GSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDKEQQFHLWFDPTADFH  140

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRI+F VD  PIR F N ESIG+ FP +QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  141   TYSILWNPQRIVFSVDGTPIREFKNSESIGVAFPKNQPMRIYSSLWNADDWATRGGLVKT  200

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW+ APFTA YRNFNA+ACV +NG SSC   + +S S++  W +Q LD   + R++WVQ 
Sbjct  201   DWTHAPFTASYRNFNADACVWSNGKSSCASSSPSSPSSSSAWFSQELDSTSQERLKWVQK  260

Query  959   KHMVYNYCADAKRFPQGFSAECKRS  1033
              +M+YNYCADAKRFPQG  AEC+ S
Sbjct  261   NYMIYNYCADAKRFPQGLPAECRTS  285



>gb|ABM91075.1| xyloglucan endotransglycosylase/hydrolase precursor XTH-21 [Populus 
tremula x Populus tremuloides]
Length=288

 Score =   350 bits (898),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 170/285 (60%), Positives = 216/285 (76%), Gaps = 8/285 (3%)
 Frame = +2

Query  185   VVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEY  364
             ++ACS+V           +F  D  + +G+H  ++ + G  ++L+LD+ +GSGF +K EY
Sbjct  12    LIACSMV------VVASGSFYQDFDLTWGDHRAKIFNGGQLLSLSLDKVSGSGFKSKKEY  65

Query  365   LFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGK  544
             LFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN T  PY +HTNV++QGK
Sbjct  66    LFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLTGDPYILHTNVFTQGK  124

Query  545   GNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVY  724
             GN+EQQF+LWFDPT  FHTY+I+W+ Q IIF+VDN PIRVF N ESIG+PFP SQPMR+Y
Sbjct  125   GNREQQFYLWFDPTRNFHTYSIIWSQQHIIFLVDNFPIRVFKNAESIGVPFPKSQPMRIY  184

Query  725   CSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEW  904
              SLWNADDWAT+GGLVKTDW++APFTAYYRNF A+AC  + G SSC   +++S+ +++ W
Sbjct  185   SSLWNADDWATRGGLVKTDWTKAPFTAYYRNFKADACTWSYGTSSCG-SSSSSSFSDRSW  243

Query  905   QTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
             QT  LD   R R+RWVQ   M+YNYCAD KRFPQG   EC+RSRF
Sbjct  244   QTNALDAPSRRRLRWVQKYFMIYNYCADLKRFPQGLPPECRRSRF  288



>ref|XP_002270973.2| PREDICTED: brassinosteroid-regulated protein BRU1-like [Vitis 
vinifera]
Length=290

 Score =   350 bits (897),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 160/263 (61%), Positives = 200/263 (76%), Gaps = 2/263 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             +F  D  + +G+H  ++ D    + L+LD+ +GSGF +K EYLFG+ DMQ+KLV G SAG
Sbjct  29    SFYQDFDLTWGDHRAKILDGEKLLTLSLDKASGSGFQSKKEYLFGKIDMQLKLVSGNSAG  88

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN +  PY +HTNV++QGKGN+EQQF+LWFDPT  FH
Sbjct  89    TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILHTNVFTQGKGNREQQFYLWFDPTENFH  147

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN Q IIF+VDN PIR F N ESIG+PFP SQPMR+Y SLWNADDWAT+GGLVK 
Sbjct  148   TYSIIWNLQNIIFLVDNIPIREFKNQESIGVPFPKSQPMRIYSSLWNADDWATRGGLVKI  207

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTA YRNFNA AC+ ++G SSC  K  +  S N  WQ QGLD K R +++WVQ 
Sbjct  208   DWSKAPFTASYRNFNAAACLWSHGSSSCASKFTSPVS-NIAWQNQGLDAKSRRKLQWVQK  266

Query  959   KHMVYNYCADAKRFPQGFSAECK  1027
              +M+YNYC+D KRFP G   EC+
Sbjct  267   NYMIYNYCSDMKRFPGGLPLECR  289



>gb|EYU29579.1| hypothetical protein MIMGU_mgv1a018742mg [Erythranthe guttata]
Length=273

 Score =   349 bits (895),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 162/267 (61%), Positives = 204/267 (76%), Gaps = 1/267 (0%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF    ++ +G+  G++ + G  + L+LD  +GSGF +KN++LFGRFD+Q+KL+   SAG
Sbjct  8     NFTKYAEINWGDGRGKIIEAGRGLTLSLDNSSGSGFQSKNDFLFGRFDIQLKLIPNNSAG  67

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTF+L S  G AHDE+DFEFLGN++ +PYTVHTNVY+QGKG++EQQF LWFDP A FH
Sbjct  68    TVTTFFLASQ-GSAHDEIDFEFLGNSSGEPYTVHTNVYAQGKGDREQQFKLWFDPVATFH  126

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN QRIIF+VDN PIRVFNN+ + G+PFP +QPMRVY SLWNADDWATQGG VKT
Sbjct  127   TYSIVWNSQRIIFLVDNIPIRVFNNNGAFGVPFPTNQPMRVYGSLWNADDWATQGGQVKT  186

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             +W++ PF A YRNF  NAC  ++  +      +    +NQ WQTQ LD  GRNR+RWV  
Sbjct  187   NWTQGPFVANYRNFKINACASSSSSNGTCVSGSGDPFSNQSWQTQELDANGRNRLRWVHQ  246

Query  959   KHMVYNYCADAKRFPQGFSAECKRSRF  1039
             K+M+YNYC D  RFPQG  AECKRSRF
Sbjct  247   KYMIYNYCTDFVRFPQGIPAECKRSRF  273



>gb|KDO46534.1| hypothetical protein CISIN_1g023431mg [Citrus sinensis]
Length=282

 Score =   349 bits (896),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 162/290 (56%), Positives = 210/290 (72%), Gaps = 15/290 (5%)
 Frame = +2

Query  167   MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
             + +++G +  +  G          +F  D  + +G+   ++ +NG  + L+LD+ +GSGF
Sbjct  7     LFLVLGTLMVASAG----------SFYKDFDITWGDGRAKILNNGQLLTLSLDKASGSGF  56

Query  347   NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
              +KNEYL+G+ DMQ+KLV G SAGTVT +YL SP G   DE+DFEFLGN +  PYT+HTN
Sbjct  57    QSKNEYLYGKIDMQLKLVPGNSAGTVTAYYLKSP-GSTWDEIDFEFLGNLSGDPYTLHTN  115

Query  527   VYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*S  706
             V++ GKG++EQQFHLWFDP+AAFHTY+ILWNPQRI+F VD  PIR   N ESIG+PFP +
Sbjct  116   VFTNGKGDREQQFHLWFDPSAAFHTYSILWNPQRIVFFVDGTPIRELKNSESIGVPFPKN  175

Query  707   QPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNA-NACVVTNGVSSCNFKAAAS  883
             QPMR+Y SLWNADDWAT+GGLVKTDW+ APFTA YRNF A NACV +NG SSC   A+ S
Sbjct  176   QPMRIYSSLWNADDWATRGGLVKTDWTHAPFTASYRNFKANNACVWSNGKSSC---ASTS  232

Query  884   NSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRS  1033
               +   W +Q LD   +NR++WVQ  +M+YNYC D KRFP+G   EC+ S
Sbjct  233   FRSRNSWLSQELDSTSQNRLKWVQKNYMIYNYCTDTKRFPRGIPKECRNS  282



>ref|XP_008801408.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Phoenix dactylifera]
Length=283

 Score =   349 bits (896),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 164/286 (57%), Positives = 209/286 (73%), Gaps = 6/286 (2%)
 Frame = +2

Query  167   MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
             M   + ++ CSL+  A A      NF+ D Q+ +G    Q+ +NG  + L+LD+ +GSGF
Sbjct  1     MAFSLLLLVCSLMAGASAG-----NFHQDFQITWGEGRAQILENGQLLTLSLDKASGSGF  55

Query  347   NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
              +KNEYLFG+ DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PYT+HTN
Sbjct  56    QSKNEYLFGKIDMQLKLVPGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTN  114

Query  527   VYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*S  706
             V+  GKGN+E QFHLWFDPT  FHTY+ILWNP+ IIFMVD+ PIR F N ES G+ FP +
Sbjct  115   VFGLGKGNREMQFHLWFDPTNDFHTYSILWNPKHIIFMVDDIPIRDFKNMESRGVAFPRN  174

Query  707   QPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASN  886
             QPMR+Y SLWNADDWATQGG VKTDW+ APFTA YRNF+A+AC+ ++G S+C  K +++ 
Sbjct  175   QPMRIYSSLWNADDWATQGGRVKTDWTNAPFTASYRNFHADACIWSSGASNCPAKKSSTA  234

Query  887   SNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAEC  1024
             S N +W  Q LD   + R+RWVQ  +M+Y+YC D KRFPQG   EC
Sbjct  235   STNSDWWNQELDSTSQERMRWVQKNYMIYDYCTDLKRFPQGLPPEC  280



>ref|XP_006453413.1| hypothetical protein CICLE_v10008951mg [Citrus clementina]
 gb|ESR66653.1| hypothetical protein CICLE_v10008951mg [Citrus clementina]
Length=317

 Score =   350 bits (899),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 171/299 (57%), Positives = 218/299 (73%), Gaps = 8/299 (3%)
 Frame = +2

Query  137   KMKKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMAL  316
             ++ K      M+ +  V+   +   A        NF  D  + +G+   ++ +NG+ + L
Sbjct  27    RLLKHMSMASMLHLFLVLGSLMAASAG-------NFYKDFDITWGDGRAKMLNNGDLLTL  79

Query  317   NLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNA  496
             +LD+ +GSGF +KNEYL+G+ DMQ+KLV G SAGTVT +YL SP G   DE+DFEFLGN+
Sbjct  80    SLDKASGSGFQSKNEYLYGKIDMQLKLVPGNSAGTVTAYYLKSP-GSTWDEIDFEFLGNS  138

Query  497   TFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNH  676
             +  PYT+HTNV++ GKG++EQQFHLWFDPTA FHTY+ILWNPQRIIF VD  PIR F N 
Sbjct  139   SGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNS  198

Query  677   ESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVS  856
             ESIG+PFP +QPMR+Y SLWNADDWAT+GGLVKTDW+ APFTA YRNFNA ACV +NG S
Sbjct  199   ESIGVPFPKNQPMRIYSSLWNADDWATRGGLVKTDWTHAPFTASYRNFNAEACVWSNGKS  258

Query  857   SCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRS  1033
             SC   +A+S S+N  W +Q LD   +NR++WVQ  +M+YNYC D KRFPQG  AEC+ S
Sbjct  259   SCASNSASSTSSNGAWFSQELDSTNQNRLKWVQKNYMIYNYCTDTKRFPQGLPAECRIS  317



>gb|AFK47205.1| unknown [Lotus japonicus]
Length=291

 Score =   349 bits (896),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 174/291 (60%), Positives = 212/291 (73%), Gaps = 8/291 (3%)
 Frame = +2

Query  164   CMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSG  343
              M++I  +V+  +V           NFN D Q+ +G+   ++ +N N + L+LD+ +GSG
Sbjct  8     LMLLIPLLVSSYIV------LSSAGNFNKDFQITWGDGRAKILNNDNLLTLSLDKASGSG  61

Query  344   FNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHT  523
             F +KNEYLFG+ DMQ+KLV G SAGTVT +YL+S  G   DE+DFEFLGN +  PYT+HT
Sbjct  62    FESKNEYLFGKIDMQIKLVPGNSAGTVTAYYLSSK-GSTWDEIDFEFLGNLSGDPYTLHT  120

Query  524   NVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*  703
             NV+SQGKGN+EQQFHLWFDPTA FHTY+ILWNPQRI+F VD  PIR F N ES G+PFP 
Sbjct  121   NVFSQGKGNREQQFHLWFDPTADFHTYSILWNPQRIVFSVDGTPIREFKNLESAGVPFPK  180

Query  704   SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNA-NACVVTNGVSSCNFKAAA  880
             +QPMR+  SLWNADDWAT+GGLVKTDWS+APFTA YRNFNA NACV + G SSC   + +
Sbjct  181   NQPMRLTSSLWNADDWATRGGLVKTDWSKAPFTASYRNFNANNACVWSGGKSSCKSNSPS  240

Query  881   SNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRS  1033
             S S +  W  Q LD  G  R+RWVQ  +MVYNYCAD KRFPQG   EC  S
Sbjct  241   SASGSASWLKQELDSTGYQRLRWVQKNYMVYNYCADKKRFPQGLPTECTHS  291



>ref|XP_011045332.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Populus 
euphratica]
Length=292

 Score =   349 bits (896),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/266 (61%), Positives = 206/266 (77%), Gaps = 2/266 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NFN +V + +G+   ++   GN ++L LD+ +GSGF +KN YLFGR DMQ+KLV G SAG
Sbjct  27    NFNQEVDLTWGDDRAKILSGGNVLSLTLDKVSGSGFQSKNGYLFGRIDMQIKLVGGNSAG  86

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             +VT +YL+S     HDE+DFEFLGN + +PYTVHTNVY+QGKG++EQQFHLWFDPT  FH
Sbjct  87    SVTAYYLSSE-RPYHDEIDFEFLGNLSGEPYTVHTNVYTQGKGDREQQFHLWFDPTKDFH  145

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
              Y+++WN QRIIF+VD+ PIRV+ N ESIG+PFP +QPM++Y SLWNAD WAT+GGLVK 
Sbjct  146   LYSVVWNHQRIIFLVDDTPIRVYENQESIGVPFPKNQPMKLYSSLWNADQWATRGGLVKA  205

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTAYYRNF ANAC+ ++G SSC+ K   S   N+ WQTQGLD  GR  +RWVQ 
Sbjct  206   DWSKAPFTAYYRNFKANACIWSSGSSSCSLKTTGS-IKNKAWQTQGLDSTGRRSLRWVQK  264

Query  959   KHMVYNYCADAKRFPQGFSAECKRSR  1036
              +M+YNYC D KRFP G   EC+ S+
Sbjct  265   YYMIYNYCTDYKRFPMGRPRECRLSK  290



>ref|XP_006474159.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like isoform X2 [Citrus sinensis]
Length=286

 Score =   349 bits (895),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 168/289 (58%), Positives = 216/289 (75%), Gaps = 11/289 (4%)
 Frame = +2

Query  167   MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
             + +++G +  +  G          NF  D  + +G+   ++ +NG+ + L+LD+ +GSGF
Sbjct  9     LFLVLGSLMAASAG----------NFYKDFDITWGDGRAKMLNNGDLLTLSLDKASGSGF  58

Query  347   NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
              +KNEYL+G+ DMQ+KLV G SAGTVT +YL SP G   DE+DFEFLGN++  PYT+HTN
Sbjct  59    QSKNEYLYGKIDMQLKLVPGNSAGTVTAYYLKSP-GSTWDEIDFEFLGNSSGDPYTLHTN  117

Query  527   VYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*S  706
             V++ GKG++EQQFHLWFDPTA FHTY+ILWNPQRIIF VD  PIR F N ESIG+PFP +
Sbjct  118   VFTNGKGDREQQFHLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNSESIGVPFPKN  177

Query  707   QPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASN  886
             QPMR+Y SLWNADDWAT+GGLVKTDW+ APFTA YRNFNA ACV +NG SSC   +A+S 
Sbjct  178   QPMRIYSSLWNADDWATRGGLVKTDWTHAPFTASYRNFNAEACVWSNGKSSCASNSASST  237

Query  887   SNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRS  1033
             S+N  W +Q LD   ++R++WVQ  +M+YNYC D KRFPQG  AEC+ S
Sbjct  238   SSNGAWFSQELDSTNQSRLKWVQKNYMIYNYCTDTKRFPQGLPAECRIS  286



>ref|XP_002273742.2| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Vitis vinifera]
Length=297

 Score =   349 bits (896),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 170/288 (59%), Positives = 215/288 (75%), Gaps = 7/288 (2%)
 Frame = +2

Query  161   VCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGS  340
             V   +++ VV   L+  +        NF  D  + +G+  G++ +NG  + L+LD+ +GS
Sbjct  11    VSTALLMSVVVSFLMAASAG------NFYQDFDITWGDGRGKILNNGELLTLSLDKPSGS  64

Query  341   GFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVH  520
             GF +KNEYLFG+ DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +H
Sbjct  65    GFQSKNEYLFGKIDMQLKLVPGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILH  123

Query  521   TNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP  700
             TNV+SQGKGN+EQQF+LWFDPTA FHTY+ILWNPQRIIF VD  PIR F N ESIG+P+P
Sbjct  124   TNVFSQGKGNREQQFYLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNSESIGVPYP  183

Query  701   *SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAA  880
              +QPMR+Y SLWNADDWAT+GGLVKTDWS+APFTA YRNFNANAC+ ++G SSC+  + +
Sbjct  184   KNQPMRIYSSLWNADDWATRGGLVKTDWSQAPFTASYRNFNANACLWSSGSSSCSSTSPS  243

Query  881   SNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAEC  1024
             S S N  W +Q LD   + R++WVQ  +M+YNYCAD KRFPQG   EC
Sbjct  244   STSTNGGWYSQELDSTSQERMKWVQKNYMIYNYCADTKRFPQGLPPEC  291



>ref|NP_194311.1| probable xyloglucan endotransglucosylase/hydrolase protein 23 
[Arabidopsis thaliana]
 sp|Q38910.1|XTH23_ARATH RecName: Full=Probable xyloglucan endotransglucosylase/hydrolase 
protein 23; Short=At-XTH23; Short=XTH-23; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAB18367.1| xyloglucan endotransglycosylase-related protein [Arabidopsis 
thaliana]
 emb|CAB39602.1| xyloglucan endo-1, 4-beta-D-glucanase (XTR-6) [Arabidopsis thaliana]
 emb|CAB79436.1| xyloglucan endo-1, 4-beta-D-glucanase (XTR-6) [Arabidopsis thaliana]
 gb|AEE85117.1| probable xyloglucan endotransglucosylase/hydrolase protein 23 
[Arabidopsis thaliana]
Length=286

 Score =   349 bits (895),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 161/262 (61%), Positives = 200/262 (76%), Gaps = 3/262 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV++ +G+  GQ+ +NG+ + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  25    NFQRDVEITWGDGRGQITNNGDLLTLSLDKASGSGFQSKNEYLFGKIDMQIKLVAGNSAG  84

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL SP G   DE+DFEFLGN +  PYT+HTNV++QGKG++EQQF LWFDPT+ FH
Sbjct  85    TVTAYYLKSP-GSTWDEIDFEFLGNLSGDPYTLHTNVFTQGKGDREQQFKLWFDPTSDFH  143

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VD  PIR F N ES G  FP +QPMR+Y SLWNA++WAT+GGLVKT
Sbjct  144   TYSILWNPQRIIFSVDGTPIREFKNMESQGTLFPKNQPMRMYSSLWNAEEWATRGGLVKT  203

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTA YR FN  ACVV NG SSC     +   +   W +Q LD  G+ ++RWVQ+
Sbjct  204   DWSKAPFTASYRGFNEEACVVINGQSSC--PNVSGQGSTGSWLSQELDSTGQEQMRWVQN  261

Query  959   KHMVYNYCADAKRFPQGFSAEC  1024
              +M+YNYC DAKRFPQG   EC
Sbjct  262   NYMIYNYCTDAKRFPQGLPREC  283



>ref|XP_011026281.1| PREDICTED: brassinosteroid-regulated protein BRU1-like isoform 
X2 [Populus euphratica]
Length=289

 Score =   349 bits (895),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/263 (62%), Positives = 201/263 (76%), Gaps = 3/263 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + +G+   ++ + G  + L+LD  +GSGF +KNEYLFGR DMQ+KL+ G SAG
Sbjct  30    NFFQDFDITWGDQRAKILNGGQLLTLSLDTASGSGFQSKNEYLFGRIDMQIKLIPGNSAG  89

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTT+YL+S  G  HDE+DFEFLGNAT +PY +HTNV+SQGKG++EQ+F+LWFDP+ AFH
Sbjct  90    TVTTYYLSSQ-GPTHDEIDFEFLGNATGEPYVLHTNVFSQGKGDREQRFYLWFDPSKAFH  148

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN Q IIF+VDN PIRVF N ESIG+ FP  Q MR+Y SLWNADDWAT+GGLVKT
Sbjct  149   TYSIVWNKQLIIFLVDNIPIRVFQNLESIGVAFPNKQAMRIYSSLWNADDWATRGGLVKT  208

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW++APF + YRNF ANAC+ + G S C   +  S  +N  WQ Q LD  GRNR+RWVQ 
Sbjct  209   DWTQAPFISSYRNFKANACIWSPG-SPCTSTSPISVQDN-AWQVQALDAPGRNRLRWVQQ  266

Query  959   KHMVYNYCADAKRFPQGFSAECK  1027
             K+M+YNYC D KRFPQG   ECK
Sbjct  267   KYMIYNYCTDLKRFPQGLPPECK  289



>gb|AEQ37175.1| xyloglucan endotransglucosylase/hydrolase [Diospyros kaki]
Length=287

 Score =   348 bits (894),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 163/291 (56%), Positives = 212/291 (73%), Gaps = 18/291 (6%)
 Frame = +2

Query  170   IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
             + ++ ++A S++           NF  D  + +G+H  ++ + G  ++L+LD+ +GSGF 
Sbjct  13    LFLVALLASSMMAAKGG------NFYQDFDVTWGDHRAKIFNGGQLLSLSLDKTSGSGFR  66

Query  350   TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
             +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY VHTNV
Sbjct  67    SKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYIVHTNV  125

Query  530   YSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQ  709
             ++QGKGN+EQQF+LWFDPT  FHTY+++WNP++IIF++DN PIRVF N ESIG+PFP +Q
Sbjct  126   FTQGKGNREQQFYLWFDPTRNFHTYSVVWNPRQIIFLIDNTPIRVFKNAESIGVPFPKNQ  185

Query  710   PMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNS  889
             PMR+Y SLWNADDWAT+GGLVKTDW++APFTAYYRNFNA  C   +G  + +F   A   
Sbjct  186   PMRIYSSLWNADDWATRGGLVKTDWTKAPFTAYYRNFNAKTC---SGACTESFGDGA---  239

Query  890   NNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAEC-KRSRF  1039
                 WQ+Q LD   R R+RWVQ   M+YNYC D KRFP+G   EC +RSRF
Sbjct  240   ----WQSQELDAHSRRRLRWVQKNFMIYNYCTDLKRFPEGLPKECQRRSRF  286



>ref|XP_009356706.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like [Pyrus x bretschneideri]
Length=292

 Score =   348 bits (894),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 167/293 (57%), Positives = 211/293 (72%), Gaps = 6/293 (2%)
 Frame = +2

Query  158   QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
             +V M+  +  +  SLV +  +      NF  D ++ FG+   +V +NG  + L LD+ +G
Sbjct  5     KVSMLFFLCSITISLVAIVASAG----NFYQDYEVMFGDQHAKVLENGQIITLALDKSSG  60

Query  338   SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
             +GF +KN YLFGRFDMQ+KL  G SAGTVTTFYL+S  G  HDE+DFEFLGN+T +PYT+
Sbjct  61    AGFKSKNAYLFGRFDMQIKLQPGNSAGTVTTFYLSSS-GANHDEIDFEFLGNSTGEPYTI  119

Query  518   HTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPF  697
             HTNVY+QG+G KEQQFHLWFDPT  FHTY+I+WN +RIIF+VD++PIRVFNN ESIG+PF
Sbjct  120   HTNVYAQGQGLKEQQFHLWFDPTQDFHTYSIVWNTKRIIFLVDDSPIRVFNNLESIGLPF  179

Query  698   P*SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAA  877
             P +Q M +Y + WNADDWATQGG VKTDWS APFTA YRNF  NAC+ + G  SC   + 
Sbjct  180   PKNQSMGIYATFWNADDWATQGGRVKTDWSLAPFTASYRNFKINACLGSQG-PSCASTST  238

Query  878   ASNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSR  1036
               +     W+ QGL+   RNR+RWVQSK MVY+YC D  +F +G   ECK SR
Sbjct  239   ERSPVGSSWKNQGLNAAERNRLRWVQSKFMVYDYCTDRIKFNKGLPRECKHSR  291



>ref|XP_010525738.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24 [Tarenaya hassleriana]
Length=280

 Score =   348 bits (893),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 199/265 (75%), Gaps = 8/265 (3%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             +F  +V + +GN  G++ +NG  + L+LD+ +GSGF +KNE+LFG+ DMQ+KLV G SAG
Sbjct  23    DFGREVDITWGNGRGKILNNGELLTLSLDKSSGSGFQSKNEFLFGKIDMQIKLVPGNSAG  82

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL SP G   DE+DFEFLGN +  PY +HTNVY+QGKGNKEQQF+LWFDPTA FH
Sbjct  83    TVTTFYLKSP-GSTWDEIDFEFLGNLSGDPYILHTNVYTQGKGNKEQQFYLWFDPTANFH  141

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VD  PIR F N ESIG+ FP +Q MR+Y SLWNADDWAT+GGLVKT
Sbjct  142   TYSILWNPQRIIFSVDGTPIREFKNFESIGVLFPKNQAMRMYASLWNADDWATRGGLVKT  201

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS++PFTA Y++    ACV +NG SSCN K ++       W TQ +D   + R+RWVQ 
Sbjct  202   DWSKSPFTASYKSLRVEACVWSNGRSSCNSKPSS-------WFTQEMDSTSQARLRWVQK  254

Query  959   KHMVYNYCADAKRFPQGFSAECKRS  1033
              +M+YNYC D KRFPQG   EC  S
Sbjct  255   NYMIYNYCTDGKRFPQGLPRECSMS  279



>gb|AEX07595.1| xyloglucosyl transferase 2, partial [Brassica juncea]
Length=265

 Score =   347 bits (891),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 161/262 (61%), Positives = 194/262 (74%), Gaps = 6/262 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             +FN+DV + +GN  G++ +NG  + L LD+ +G+GF +K EYLFG+ DMQ+KLV G SAG
Sbjct  6     DFNSDVNVAWGNGRGKILNNGQLLTLTLDKSSGAGFQSKTEYLFGKIDMQIKLVPGNSAG  65

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL S  G   DE+DFEFLGN +  PYT+HTNVY+QGKG+KEQQFHLWFDPT  FH
Sbjct  66    TVTTFYLKSE-GTTWDEIDFEFLGNMSGDPYTLHTNVYTQGKGDKEQQFHLWFDPTVNFH  124

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRII  VD  PIR F N ES+G+ FP S+PMR+Y SLWNADDWAT+GGLVKT
Sbjct  125   TYSILWNPQRIILTVDGTPIREFKNSESLGVLFPKSKPMRMYASLWNADDWATRGGLVKT  184

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTA YRN     C  +NG SSC     +SN     W TQ +D   + R+RWVQ 
Sbjct  185   DWSKAPFTASYRNIKIEGCAHSNGRSSCTSTKPSSN-----WYTQEMDSTSQARLRWVQK  239

Query  959   KHMVYNYCADAKRFPQGFSAEC  1024
              +M+YNYC D KRFPQG   EC
Sbjct  240   NYMIYNYCTDTKRFPQGIPREC  261



>ref|XP_006413268.1| hypothetical protein EUTSA_v10025720mg [Eutrema salsugineum]
 gb|ESQ54721.1| hypothetical protein EUTSA_v10025720mg [Eutrema salsugineum]
Length=323

 Score =   350 bits (897),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 164/262 (63%), Positives = 202/262 (77%), Gaps = 2/262 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV++ +G+  GQ+ +NG+ + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  61    NFQRDVEITWGDGRGQITNNGDLLTLSLDKSSGSGFRSKNEYLFGKIDMQIKLVAGNSAG  120

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL SP G   DEVDFEFLGN +  PYT+HTNV++QGKG++EQQF LWFDPT+ FH
Sbjct  121   TVTAYYLKSP-GSTWDEVDFEFLGNLSGDPYTLHTNVFTQGKGDREQQFKLWFDPTSDFH  179

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VD  PIR F N ES G  FP +QPMR+Y SLWNA+DWAT+GGLVKT
Sbjct  180   TYSILWNPQRIIFSVDGTPIREFKNMESQGTLFPKNQPMRMYSSLWNAEDWATRGGLVKT  239

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTA YR FN  ACV++NG SSC    +   S++  W +Q LD  G+ R+RWVQS
Sbjct  240   DWSKAPFTASYRGFNEEACVMSNGKSSCP-NGSGQGSSSGSWLSQELDSTGQERMRWVQS  298

Query  959   KHMVYNYCADAKRFPQGFSAEC  1024
              +M+YNYC D KRFPQG   EC
Sbjct  299   NYMIYNYCTDIKRFPQGLPQEC  320



>gb|KHN22714.1| Putative xyloglucan endotransglucosylase/hydrolase protein 23 
[Glycine soja]
Length=287

 Score =   348 bits (893),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 161/265 (61%), Positives = 199/265 (75%), Gaps = 5/265 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NFN D Q+ +G+   ++ +N N + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  28    NFNQDFQITWGDGRAKILNNANLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSAG  87

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G   DE+DFEFLGN +  PY +HTNV+SQGKGN+EQQF+LWFDPTA FH
Sbjct  88    TVTAYYLSSK-GSTWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFH  146

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRI+F VD  PIR F N ESIG+PFP  QPMR+Y SLWNADDWAT+GG +KT
Sbjct  147   TYSILWNPQRIVFSVDGTPIREFKNLESIGVPFPKRQPMRIYSSLWNADDWATRGGRIKT  206

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTA YRNFNANACV   G S+C   + +SN+    W +Q LD   + R+ WVQ 
Sbjct  207   DWSKAPFTASYRNFNANACVWNRGKSTCKSNSPSSNA----WLSQELDSTAQQRLSWVQK  262

Query  959   KHMVYNYCADAKRFPQGFSAECKRS  1033
              +M+YNYC+D  RF QG   EC  S
Sbjct  263   NYMIYNYCSDKNRFAQGLPLECTHS  287



>ref|XP_010545425.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Tarenaya hassleriana]
Length=290

 Score =   348 bits (893),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 164/285 (58%), Positives = 209/285 (73%), Gaps = 13/285 (5%)
 Frame = +2

Query  170   IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
             +++ GV+  S+V           NF  +V++ +G+  GQ+++NG+ + L+LD+ +GSGF 
Sbjct  16    LLLAGVLLPSVVA----------NFYQNVEITWGDGRGQIKNNGDLLTLSLDKPSGSGFQ  65

Query  350   TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
             +KNEYL+G+ DMQ+KLV G SAGTVT +YL SP G   DE+DFEFLGN +  PYT+HTNV
Sbjct  66    SKNEYLYGKIDMQLKLVAGNSAGTVTAYYLKSP-GTTWDEIDFEFLGNLSGDPYTLHTNV  124

Query  530   YSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQ  709
             ++QGKGN+EQQF LWFDPTA FH+Y+ILWNPQRIIF VD  PIR F N ES G+ FP +Q
Sbjct  125   FTQGKGNREQQFKLWFDPTADFHSYSILWNPQRIIFSVDGTPIREFKNMESQGVLFPKNQ  184

Query  710   PMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNS  889
             PMR+Y SLWNADDWAT+GGLVKTDWS+APFTA YRNF  +ACV +NG SSC     +S  
Sbjct  185   PMRMYSSLWNADDWATRGGLVKTDWSQAPFTASYRNFKEDACVWSNGKSSC--PNGSSQG  242

Query  890   NNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAEC  1024
              +  W +Q LD   + R+RWVQ  +M+YNYC D  RFPQG   EC
Sbjct  243   TSGSWLSQELDTTSQERMRWVQKSYMIYNYCTDTNRFPQGLPKEC  287



>ref|NP_001242530.1| uncharacterized protein LOC100785313 precursor [Glycine max]
 gb|ACU21249.1| unknown [Glycine max]
Length=287

 Score =   348 bits (893),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 161/265 (61%), Positives = 199/265 (75%), Gaps = 5/265 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NFN D Q+ +G+   ++ +N N + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  28    NFNQDFQITWGDGRAKILNNANLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSAG  87

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G   DE+DFEFLGN +  PY +HTNV+SQGKGN+EQQF+LWFDPTA FH
Sbjct  88    TVTAYYLSSK-GSTWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFH  146

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRI+F VD  PIR F N ESIG+PFP  QPMR+Y SLWNADDWAT+GG +KT
Sbjct  147   TYSILWNPQRIVFSVDGTPIREFKNLESIGVPFPKRQPMRIYSSLWNADDWATRGGRIKT  206

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTA YRNFNANACV   G S+C   + +SN+    W +Q LD   + R+ WVQ 
Sbjct  207   DWSKAPFTASYRNFNANACVWNRGKSTCKSNSPSSNA----WLSQELDSTAQQRLSWVQK  262

Query  959   KHMVYNYCADAKRFPQGFSAECKRS  1033
              +M+YNYC+D  RF QG   EC  S
Sbjct  263   NYMIYNYCSDKNRFAQGLPLECTHS  287



>ref|XP_002869654.1| hypothetical protein ARALYDRAFT_354208 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45913.1| hypothetical protein ARALYDRAFT_354208 [Arabidopsis lyrata subsp. 
lyrata]
Length=286

 Score =   348 bits (893),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 162/262 (62%), Positives = 201/262 (77%), Gaps = 3/262 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV++ +G+  GQ+ +NG+ + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  25    NFQRDVEITWGDGRGQITNNGDLLTLSLDKASGSGFQSKNEYLFGKIDMQIKLVAGNSAG  84

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL SP G   DE+DFEFLGN +  PYT+HTNV++QGKG++EQQF LWFDPT+ FH
Sbjct  85    TVTAYYLKSP-GSTWDEIDFEFLGNLSGDPYTLHTNVFTQGKGDREQQFKLWFDPTSDFH  143

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VD  PIR F N ES G  FP +QPMR+Y SLWNA+DWAT+GGLVKT
Sbjct  144   TYSILWNPQRIIFSVDGTPIREFKNMESQGTLFPKNQPMRMYSSLWNAEDWATRGGLVKT  203

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTA YR FN  ACVV NG SSC     +   ++  W +Q LD  G+ ++RWVQ+
Sbjct  204   DWSKAPFTASYRGFNEEACVVINGQSSC--PNGSGQGSSGSWLSQELDSTGQEQMRWVQN  261

Query  959   KHMVYNYCADAKRFPQGFSAEC  1024
              +M+YNYC DAKRFPQG   EC
Sbjct  262   NYMIYNYCTDAKRFPQGLPREC  283



>ref|XP_003601713.1| Xyloglucan endotransglycosylase/hydrolase XTH-21 [Medicago truncatula]
 gb|AES71964.1| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
Length=282

 Score =   348 bits (892),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 168/290 (58%), Positives = 209/290 (72%), Gaps = 18/290 (6%)
 Frame = +2

Query  173   MIIGV-VACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
             M+IGV +  SLV    A      NFN D  + +G+H  ++ + G  ++L+LD+ +GSGF 
Sbjct  10    MLIGVMIISSLVATCSA------NFNQDFDLTWGDHRAKIFNGGQLLSLSLDKTSGSGFQ  63

Query  350   TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
             +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +HTNV
Sbjct  64    SKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNVSGDPYILHTNV  122

Query  530   YSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQ  709
             +SQGKGN+EQQF+LWFDPT  FHTY+I+W PQ IIF+VDN PIR+F N ESIGIPFP +Q
Sbjct  123   FSQGKGNREQQFYLWFDPTKNFHTYSIIWKPQHIIFLVDNTPIRIFKNAESIGIPFPKNQ  182

Query  710   PMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNS  889
             PMR+Y SLWNADDWAT+GGLVKTDWS+APFTAYYRNF A                ++++ 
Sbjct  183   PMRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRNFKATELS----------SVSSTSF  232

Query  890   NNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
             ++   Q+  LD  GR R+RWVQ   M+YNYC D KRFP+G  AECKR RF
Sbjct  233   SDSALQSNELDAYGRRRLRWVQKYFMIYNYCNDLKRFPEGIPAECKRPRF  282



>ref|XP_004293370.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 25-like [Fragaria vesca subsp. vesca]
Length=291

 Score =   348 bits (893),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 164/291 (56%), Positives = 209/291 (72%), Gaps = 10/291 (3%)
 Frame = +2

Query  158   QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
             + C++  I      L+G  +AV     NFN D ++ +G+   ++ +N   + L LD+ +G
Sbjct  4     RYCLVFSIAF----LIGSLMAVISSASNFNQDFEITWGDGRAKILNNNELLVLFLDRISG  59

Query  338   SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
             SGF +K EYLFG+ DMQ+KLV G SAGTVT +YL+S  G A DE+DFEFLGN +  PYT+
Sbjct  60    SGFQSKYEYLFGKIDMQLKLVPGNSAGTVTAYYLSSK-GSAWDEIDFEFLGNLSGDPYTI  118

Query  518   HTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPF  697
             HTNVYSQGKG++EQQFHLWFDPT  FHTY+ILWNP+ I+F VD  PIR F N ESIG+PF
Sbjct  119   HTNVYSQGKGDREQQFHLWFDPTTDFHTYSILWNPRSIVFYVDGTPIREFKNLESIGVPF  178

Query  698   P*SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAA  877
             P  QPMR++ SLW+ADDWAT+GGLVKTDW++APF A YRNFNANAC+ ++G SSC     
Sbjct  179   PKDQPMRLHSSLWSADDWATRGGLVKTDWTKAPFIASYRNFNANACIWSSGTSSC-----  233

Query  878   ASNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKR  1030
              S S   EW +Q +D   + +++ VQ K M+YNYC D KRFPQGF  EC R
Sbjct  234   TSPSTKGEWLSQEMDLASKQKLKMVQEKFMIYNYCTDTKRFPQGFPKECSR  284



>ref|XP_008362366.1| PREDICTED: LOW QUALITY PROTEIN: xyloglucan endotransglucosylase/hydrolase 
protein 22-like [Malus domestica]
Length=292

 Score =   348 bits (893),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 165/294 (56%), Positives = 213/294 (72%), Gaps = 6/294 (2%)
 Frame = +2

Query  158   QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
             +V M+  + ++  SLV V  +      NF  D ++ FG+ L +V +NG  + L+LD+ +G
Sbjct  5     KVSMMFFLSLITISLVAVVASAD----NFYQDFEVMFGDQLAKVLENGQLVTLSLDKSSG  60

Query  338   SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
             +GF +KNEYLFGRFDMQ+KL  G SAGTVTTF L+S  G  HDE+DFEFLGN+T +PYT+
Sbjct  61    AGFKSKNEYLFGRFDMQIKLQPGNSAGTVTTFCLSSS-GSNHDEIDFEFLGNSTGEPYTI  119

Query  518   HTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPF  697
             HTNVY+QG+G KEQQF +WFDPT  FHTY+++WN +RIIF+VDN+PIRVFNN ESIG+PF
Sbjct  120   HTNVYAQGQGLKEQQFRVWFDPTQDFHTYSVVWNTKRIIFLVDNSPIRVFNNLESIGLPF  179

Query  698   P*SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAA  877
             P +QPMR+Y + WNAD WATQGG V+TDWS APFTA YRN N NAC+ + G  SC   + 
Sbjct  180   PKNQPMRIYATFWNADHWATQGGHVRTDWSLAPFTASYRNLNINACLGSQG-PSCASTST  238

Query  878   ASNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
               +++   W  QGL+    NR+RWVQ K MVY+YC D  +F +G   ECK SR 
Sbjct  239   NRSADGASWANQGLNAAEXNRLRWVQHKFMVYDYCTDRIKFTKGLPRECKHSRI  292



>gb|AII99393.1| xyloglucan endotransglucosylase/hydrolase2 [Dianthus caryophyllus]
Length=281

 Score =   348 bits (892),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 165/283 (58%), Positives = 212/283 (75%), Gaps = 11/283 (4%)
 Frame = +2

Query  176   IIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTK  355
             I  ++A +LVG  LA      NF ++  + FG+   ++ +NG+ + L+LD+ +GSGF +K
Sbjct  6     IFLLIATTLVGSTLA------NFYSEFDITFGDGRARLLNNGDDLTLSLDKYSGSGFRSK  59

Query  356   NEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYS  535
             NEYLFG+ DMQ+KLV G SAG+VTT+YL+S +G  HDE+DFEFLGN T +PYT+HTNV++
Sbjct  60    NEYLFGKIDMQIKLVPGNSAGSVTTYYLSS-LGPTHDEIDFEFLGNVTGEPYTLHTNVFA  118

Query  536   QGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPM  715
             QGKGN+EQQFHLWFDPT  FHTY+ILWNPQRI+F VD  P+R F N ES G+ FP SQPM
Sbjct  119   QGKGNREQQFHLWFDPTTEFHTYSILWNPQRIVFSVDGVPLREFKNMESKGVSFPKSQPM  178

Query  716   RVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNN  895
             RVY SLWNADDWATQGG VK DWS+APF A ++ +NANACV  +G  S  +K+ + + +N
Sbjct  179   RVYSSLWNADDWATQGGRVKADWSKAPFVASFKKYNANACVWGSG--SSTYKSGSRSRSN  236

Query  896   QEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAEC  1024
               W T+ LD  G  R++WVQ  +MVYNYCAD +RFPQG   EC
Sbjct  237   --WLTEELDSAGLERMKWVQKNYMVYNYCADVQRFPQGLPTEC  277



>gb|KHN22712.1| Putative xyloglucan endotransglucosylase/hydrolase protein 23 
[Glycine soja]
Length=285

 Score =   348 bits (892),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 159/282 (56%), Positives = 212/282 (75%), Gaps = 5/282 (2%)
 Frame = +2

Query  179   IGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKN  358
             + ++ C+++G  +       NF  D  + +G+   ++ +NG  + L+LD+ +GSGF +KN
Sbjct  6     VALLICTVIGYFVIASAG--NFYQDFDITWGDGRAKILNNGELLTLSLDKASGSGFQSKN  63

Query  359   EYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQ  538
             EYLFG+ DMQ+KLV G SAGTVT +YL+S  G   DE+DFEFLGN + +PY +HTNV+SQ
Sbjct  64    EYLFGKIDMQLKLVPGNSAGTVTAYYLSSK-GATWDEIDFEFLGNLSGEPYILHTNVFSQ  122

Query  539   GKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMR  718
             GKGN+EQQF+LWFDPTA FHTY+ILWNPQRI+F VD +PIR F N ES G+PFP +Q MR
Sbjct  123   GKGNREQQFYLWFDPTADFHTYSILWNPQRIVFSVDGSPIREFKNMESKGVPFPKNQAMR  182

Query  719   VYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQ  898
             +Y SLWNADDWAT+GGLVKTDW++APFTA YRNFNANAC V++G SSC   +   +S+N 
Sbjct  183   IYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFNANACTVSSGTSSCG--SNYPSSSNN  240

Query  899   EWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAEC  1024
              W ++ LD   + R++W+Q  +M+YNYC+D +RFPQG   EC
Sbjct  241   AWLSEELDSTNQERLKWLQKNYMIYNYCSDTQRFPQGLPPEC  282



>dbj|BAJ10423.1| xyloglucan endotransglucosylase/hydrolase [Dianthus caryophyllus]
Length=281

 Score =   348 bits (892),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 166/283 (59%), Positives = 211/283 (75%), Gaps = 11/283 (4%)
 Frame = +2

Query  176   IIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTK  355
             I  ++A +LVG  LA      NF ++  + FG+   ++ +NG+ + L+LD+ +GSGF +K
Sbjct  6     IFLLIATTLVGSTLA------NFYSEFDITFGDGRARLLNNGDDLTLSLDKYSGSGFRSK  59

Query  356   NEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYS  535
             NEYLFG+ DMQ+KLV G SAG+VTT+YL+S +G  HDE+DFEFLGN T +PYT+HTNV++
Sbjct  60    NEYLFGKIDMQIKLVPGNSAGSVTTYYLSS-LGPTHDEIDFEFLGNVTGEPYTLHTNVFA  118

Query  536   QGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPM  715
             QGKGN+EQQFHLWFDPT  FHTY+ILWNPQRI+F VD  P+R F N ES G+ FP +QPM
Sbjct  119   QGKGNREQQFHLWFDPTTEFHTYSILWNPQRIVFSVDGVPLREFKNMESKGVSFPKNQPM  178

Query  716   RVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNN  895
             RVY SLWNADDWATQGG VK DWS+APF A ++ +NANACV  +G S+C    + S SN 
Sbjct  179   RVYSSLWNADDWATQGGRVKADWSKAPFVASFKKYNANACVWGSGSSTCK-SGSRSRSN-  236

Query  896   QEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAEC  1024
               W T+ LD  G  R++WVQ  +MVYNYCAD +RFPQG   EC
Sbjct  237   --WLTEELDSAGLERMKWVQKNYMVYNYCADVQRFPQGLPTEC  277



>ref|XP_009378317.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Pyrus x bretschneideri]
Length=292

 Score =   348 bits (893),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 166/293 (57%), Positives = 213/293 (73%), Gaps = 6/293 (2%)
 Frame = +2

Query  158   QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
             +V M   + ++  S+     AV     NF  D ++ FG+   +V +NG  + L+LD+ +G
Sbjct  5     KVSMTFFLSLITISV----GAVVASADNFYQDFEVMFGDQHAKVLENGQVVTLSLDKSSG  60

Query  338   SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
             +GF +KNEYLFGRFDMQ+KL  G SAGTVTTFYL+S  G  HDE+DFEFLGN+T +PYT+
Sbjct  61    AGFKSKNEYLFGRFDMQIKLQPGNSAGTVTTFYLSSS-GSNHDEIDFEFLGNSTGEPYTI  119

Query  518   HTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPF  697
             HTNVY+QG+G KEQQF +WFDPT  FHTY+++WN +RIIF+VDN+PIRVFNN ESIG+PF
Sbjct  120   HTNVYAQGQGLKEQQFRVWFDPTQDFHTYSVVWNTKRIIFLVDNSPIRVFNNLESIGLPF  179

Query  698   P*SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAA  877
             P +Q MR+Y + WNADDWATQGG VKTDW+ APFTA YRNFN NAC+ + G  SC   + 
Sbjct  180   PKNQLMRIYATFWNADDWATQGGRVKTDWNLAPFTASYRNFNINACLGSQG-PSCASTST  238

Query  878   ASNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSR  1036
               +++   W  QGL+   RNR+RWVQ K MVY+YC D  +F +G   ECK SR
Sbjct  239   NRSADGASWANQGLNAAERNRLRWVQRKFMVYDYCTDRIKFTKGLPRECKHSR  291



>ref|XP_003601714.1| Xyloglucan endotransglycosylase/hydrolase XTH-21 [Medicago truncatula]
 gb|AES71965.1| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
Length=282

 Score =   348 bits (892),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 168/290 (58%), Positives = 209/290 (72%), Gaps = 18/290 (6%)
 Frame = +2

Query  173   MIIGV-VACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
             M+IGV +  SLV    A      NFN D  + +G+H  ++ + G  ++L+LD+ +GSGF 
Sbjct  10    MLIGVMIISSLVATCSA------NFNQDFDLTWGDHRAKIFNGGQLLSLSLDKTSGSGFQ  63

Query  350   TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
             +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +HTNV
Sbjct  64    SKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNVSGDPYILHTNV  122

Query  530   YSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQ  709
             +SQGKGN+EQQF+LWFDPT  FHTY+I+W PQ IIF+VDN PIR+F N ESIGIPFP +Q
Sbjct  123   FSQGKGNREQQFYLWFDPTKNFHTYSIIWKPQHIIFLVDNTPIRIFKNAESIGIPFPKNQ  182

Query  710   PMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNS  889
             PMR+Y SLWNADDWAT+GGLVKTDWS+APFTAYYRNF A                ++++ 
Sbjct  183   PMRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRNFKATELS----------SVSSTSF  232

Query  890   NNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
             ++   Q+  LD  GR R+RWVQ   M+YNYC D KRFP+G  AECKR RF
Sbjct  233   SDSALQSNELDAYGRRRLRWVQKYFMIYNYCNDLKRFPEGIPAECKRPRF  282



>ref|XP_006474154.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like isoform X1 [Citrus sinensis]
 gb|KDO36926.1| hypothetical protein CISIN_1g023204mg [Citrus sinensis]
Length=286

 Score =   348 bits (892),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 167/289 (58%), Positives = 215/289 (74%), Gaps = 11/289 (4%)
 Frame = +2

Query  167   MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
             + +++G +  +  G          NF  D  + +G+   ++ +NG+ + L+LD+ +GSGF
Sbjct  9     LFLVLGSLMVASAG----------NFYKDFDITWGDGRAKMLNNGDLLTLSLDKASGSGF  58

Query  347   NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
              +KNEYL+G+ DMQ+KLV G SAGTVT +YL SP G   DE+DFEFLGN +  PYT+HTN
Sbjct  59    QSKNEYLYGKIDMQLKLVPGNSAGTVTAYYLKSP-GSTWDEIDFEFLGNLSGDPYTLHTN  117

Query  527   VYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*S  706
             V++ GKG++EQQFHLWFDP A FHTY+ILWNPQRI+F VD  PIR F N ESIG+PFP +
Sbjct  118   VFTNGKGDREQQFHLWFDPAADFHTYSILWNPQRIVFSVDGTPIREFKNSESIGVPFPKN  177

Query  707   QPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASN  886
             QPMR+Y SLWNADDWAT+GGLVKTDW+ APFTA YRNFNA ACV +NG SSC   +A+S 
Sbjct  178   QPMRIYSSLWNADDWATRGGLVKTDWTHAPFTASYRNFNAEACVWSNGKSSCASNSASST  237

Query  887   SNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRS  1033
             S+N  W +Q LD   ++R++WVQ  +M+YNYCAD KRFPQG  AEC+ S
Sbjct  238   SSNGAWFSQELDSTNQSRLKWVQKNYMIYNYCADTKRFPQGLPAECRTS  286



>ref|XP_010259797.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Nelumbo nucifera]
Length=290

 Score =   348 bits (892),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 166/289 (57%), Positives = 214/289 (74%), Gaps = 12/289 (4%)
 Frame = +2

Query  161   VCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGS  340
              C++++  +   +L G          NF  D  + +G+   ++ +NG  + L+LD+ +GS
Sbjct  13    ACLVILSSLTVSALSG----------NFYQDFDITWGDGRAKILNNGELLTLSLDKASGS  62

Query  341   GFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVH  520
             GF +KNE+LFG+ DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +H
Sbjct  63    GFQSKNEFLFGKIDMQLKLVPGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILH  121

Query  521   TNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP  700
             TNV+SQGKGN+EQQF+LWFDPTA FHTY+ILWNPQRI+F VD  PIR FNN ESIG+PFP
Sbjct  122   TNVFSQGKGNREQQFYLWFDPTADFHTYSILWNPQRIVFSVDGIPIREFNNSESIGVPFP  181

Query  701   *SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAA  880
              SQPMR+Y SLWNADDWAT+GGLVKTDW++APFTA YRNF A+AC+ ++G SSC+ ++ +
Sbjct  182   KSQPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFKADACIWSSGASSCDSRSPS  241

Query  881   SNSN-NQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAEC  1024
             S SN N  W +Q LD   + R+ WVQ  +M+YNYC D KRFPQG   EC
Sbjct  242   STSNANAWWLSQELDSTSQERMGWVQKNYMIYNYCTDTKRFPQGLPLEC  290



>gb|AII99392.1| xyloglucan endotransglucosylase/hydrolase2 [Dianthus caryophyllus]
Length=281

 Score =   347 bits (891),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 166/283 (59%), Positives = 211/283 (75%), Gaps = 11/283 (4%)
 Frame = +2

Query  176   IIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTK  355
             I  ++A +LVG  LA      NF ++  + FG+   ++ +NG+ + L+LD+ +GSGF +K
Sbjct  6     IYLLIATTLVGSTLA------NFYSEFDITFGDGRARLLNNGDDLTLSLDKYSGSGFRSK  59

Query  356   NEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYS  535
             NEYLFG+ DMQ+KLV G SAG+VTT+YL+S +G  HDE+DFEFLGN T +PYT+HTNV++
Sbjct  60    NEYLFGKIDMQIKLVPGNSAGSVTTYYLSS-LGPTHDEIDFEFLGNVTGEPYTLHTNVFA  118

Query  536   QGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPM  715
             QGKGN+EQQFHLWFDPT  FHTY+ILWNPQRI+F VD  P+R F N ES G+ FP +QPM
Sbjct  119   QGKGNREQQFHLWFDPTTEFHTYSILWNPQRIVFSVDGVPLREFKNMESKGVSFPKNQPM  178

Query  716   RVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNN  895
             RVY SLWNADDWATQGG VK DWS+APF A ++ +NANACV  +G S+C    + S SN 
Sbjct  179   RVYSSLWNADDWATQGGRVKADWSKAPFVASFKKYNANACVWGSGSSTCK-SGSRSRSN-  236

Query  896   QEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAEC  1024
               W T+ LD  G  R++WVQ  +MVYNYCAD +RFPQG   EC
Sbjct  237   --WLTEELDSAGLERMKWVQKNYMVYNYCADVQRFPQGLPTEC  277



>ref|XP_007014172.1| Xyloglucan endotransglucosylase/hydrolase family protein [Theobroma 
cacao]
 gb|EOY31791.1| Xyloglucan endotransglucosylase/hydrolase family protein [Theobroma 
cacao]
Length=290

 Score =   347 bits (891),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 168/291 (58%), Positives = 213/291 (73%), Gaps = 11/291 (4%)
 Frame = +2

Query  161   VCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGS  340
             + M ++IG +  +             NF  D  + +G+  G++ +NG  ++L+LD+ +GS
Sbjct  11    LLMSLVIGCLMAA----------SASNFYQDFDITWGDGRGKIDNNGEVLSLSLDKASGS  60

Query  341   GFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVH  520
             GF +KNEYLFG+ DMQ+KLV G SAGTVT +YL+S  G   DE+DFEFLGN +  PY +H
Sbjct  61    GFQSKNEYLFGKIDMQLKLVPGNSAGTVTAYYLSSK-GSTWDEIDFEFLGNLSGDPYILH  119

Query  521   TNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP  700
             TNV+SQGKGN+EQQF+LWFDPTA FHTY+ILWN QRIIF  D  PIR F N ES+G+PFP
Sbjct  120   TNVFSQGKGNREQQFYLWFDPTADFHTYSILWNSQRIIFSADGTPIREFKNMESLGVPFP  179

Query  701   *SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAA  880
              +QPMR+Y SLWNADDWAT+GGLVKTDW++APFTA YRNFNANACV +NG SSC   + +
Sbjct  180   KNQPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFNANACVWSNGASSCKSNSPS  239

Query  881   SNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRS  1033
             S+S N  W +Q LD   + R++WVQ  +M+YNYC DAKRFPQG   EC  S
Sbjct  240   SSSTNNAWLSQELDSTSQQRLQWVQKNYMIYNYCTDAKRFPQGLPPECNMS  290



>gb|AAL32550.1| xyloglucan endo-1, 4-beta-D-glucanase (XTR-6) [Arabidopsis thaliana]
 gb|AAM13251.1| xyloglucan endo-1, 4-beta-D-glucanase [Arabidopsis thaliana]
Length=286

 Score =   347 bits (891),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 160/262 (61%), Positives = 200/262 (76%), Gaps = 3/262 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV++ +G+  GQ+ +NG+ + L+LD+ +GSGF +KNEYLFG+ DMQ++LV G SAG
Sbjct  25    NFQRDVEITWGDGRGQITNNGDLLTLSLDKASGSGFQSKNEYLFGKIDMQIELVAGNSAG  84

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL SP G   DE+DFEFLGN +  PYT+HTNV++QGKG++EQQF LWFDPT+ FH
Sbjct  85    TVTAYYLKSP-GSTWDEIDFEFLGNLSGDPYTLHTNVFTQGKGDREQQFKLWFDPTSDFH  143

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VD  PIR F N ES G  FP +QPMR+Y SLWNA++WAT+GGLVKT
Sbjct  144   TYSILWNPQRIIFSVDGTPIREFKNMESQGTLFPKNQPMRMYSSLWNAEEWATRGGLVKT  203

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTA YR FN  ACVV NG SSC     +   +   W +Q LD  G+ ++RWVQ+
Sbjct  204   DWSKAPFTASYRGFNEEACVVINGQSSC--PNVSGQGSTGSWLSQELDSTGQEQMRWVQN  261

Query  959   KHMVYNYCADAKRFPQGFSAEC  1024
              +M+YNYC DAKRFPQG   EC
Sbjct  262   NYMIYNYCTDAKRFPQGLPREC  283



>gb|ACD03218.1| xyloglucan endotransglucosylase/hydrolase 8 [Actinidia deliciosa]
Length=285

 Score =   347 bits (891),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 162/267 (61%), Positives = 202/267 (76%), Gaps = 6/267 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF+ D  + +G+   ++ + G  ++L+LD+ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  24    NFHQDFDLTWGDQKAKIFNGGQILSLSLDKTSGSGFKSKQEYLFGRIDMQLKLVAGNSAG  83

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN +  PY VHTNV++QGKGN+EQQF+LWFDPT  FH
Sbjct  84    TVTAYYLSSE-GPTHDEIDFEFLGNLSGDPYIVHTNVFTQGKGNREQQFYLWFDPTRNFH  142

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN Q+IIF+VDN PIRVF N E+IG+PFP +QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  143   TYSIIWNTQQIIFLVDNTPIRVFKNAETIGVPFPKTQPMRIYSSLWNADDWATRGGLVKT  202

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW++APFTAYYRNFN   C            ++AS+ +N  WQ Q LD   R R+RWVQ 
Sbjct  203   DWTKAPFTAYYRNFNVQTC-----SPRSCTSSSASSISNGAWQGQELDAYSRRRLRWVQK  257

Query  959   KHMVYNYCADAKRFPQGFSAECKRSRF  1039
               M+YNYC D KRFPQG  AEC+RSRF
Sbjct  258   HFMIYNYCTDLKRFPQGIPAECRRSRF  284



>ref|XP_006474158.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like isoform X1 [Citrus sinensis]
Length=292

 Score =   347 bits (891),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 173/298 (58%), Positives = 218/298 (73%), Gaps = 6/298 (2%)
 Frame = +2

Query  140   MKKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALN  319
             M   +  V +IM+  +++ S V     +  P  NF  D  + +G    +++++G  + L 
Sbjct  1     MAAAKSLVVLIMLSALLSNSFV-----LVLPASNFYQDFDIIWGIDKVRIRNDGEVLNLY  55

Query  320   LDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNAT  499
             L + TGSGF +KNEYLFG+ DMQ KLV G SAGTVT +YL SP G   DE+DFEFLGN++
Sbjct  56    LGKDTGSGFQSKNEYLFGKIDMQFKLVPGNSAGTVTAYYLKSP-GSTWDEIDFEFLGNSS  114

Query  500   FQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHE  679
               PYT+HTNV++ GKG++EQQFHLWFDPTA FHTY+ILWNPQRIIF VD  PIR F N E
Sbjct  115   GDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNSE  174

Query  680   SIGIPFP*SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSS  859
             SIG+PFP +QPMR+Y SLWNADDWAT+GGLVKTDW+ APFTA YRNFNA ACV +NG SS
Sbjct  175   SIGVPFPKNQPMRIYSSLWNADDWATRGGLVKTDWTHAPFTASYRNFNAEACVWSNGKSS  234

Query  860   CNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRS  1033
             C   +A+S S+N  W +Q LD   ++R++WVQ  +M+YNYC D KRFPQG  AEC+ S
Sbjct  235   CASNSASSTSSNGAWFSQELDSTNQSRLKWVQKNYMIYNYCTDTKRFPQGLPAECRIS  292



>ref|XP_010668001.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Beta vulgaris subsp. vulgaris]
Length=290

 Score =   347 bits (891),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/262 (62%), Positives = 200/262 (76%), Gaps = 6/262 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  +  + +G+   ++ +NG  + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  25    NFYQNFDITWGDGRAKIMNNGLLLTLSLDKASGSGFKSKNEYLFGKIDMQIKLVPGNSAG  84

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTT+YL+S  G  HDE+DFEFLGNAT QPYT+HTNV++QGKG++EQQF LWFDPTA FH
Sbjct  85    TVTTYYLSSQ-GPNHDEIDFEFLGNATGQPYTLHTNVFAQGKGDREQQFRLWFDPTADFH  143

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VD  PIR F N E+IG+ FP SQ MR+Y SLW+A+DWATQGG +KT
Sbjct  144   TYSILWNPQRIIFAVDGTPIREFKNMEAIGVSFPKSQAMRMYSSLWDAEDWATQGGRIKT  203

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APF A YRNFNANACV +NG SSC    A+S      W  Q LDG  + R++WVQ 
Sbjct  204   DWSKAPFVASYRNFNANACVWSNGRSSCRGSGASS-----AWMNQQLDGTSQQRLQWVQR  258

Query  959   KHMVYNYCADAKRFPQGFSAEC  1024
              +M+YNYC D +RFPQG   EC
Sbjct  259   NYMIYNYCTDIQRFPQGLPKEC  280



>ref|XP_011082931.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Sesamum indicum]
Length=289

 Score =   347 bits (891),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 164/268 (61%), Positives = 201/268 (75%), Gaps = 7/268 (3%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV + +G    Q+ + G  ++L+LD  +GSGF + NEYL+GRFD+Q+KLV G SAG
Sbjct  28    NFYKDVTITWGGPRAQILNGGQVLSLSLDNVSGSGFQSNNEYLYGRFDVQLKLVPGNSAG  87

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTF+L S  G AHDE+DFEFLGN++ QPYTVHTN+Y++G GN+EQQF LWFDPT AFH
Sbjct  88    TVTTFFLASQ-GSAHDEIDFEFLGNSSGQPYTVHTNIYTRGVGNREQQFRLWFDPTVAFH  146

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWN Q II+MVDN PIRVF N+ + G+ FP SQPMR+  SL NA+   TQGG VKT
Sbjct  147   TYSILWNSQNIIYMVDNIPIRVFKNYAAYGVAFPTSQPMRLLASLCNAEPMTTQGGRVKT  206

Query  779   DWSRAPFTAYYRNFNANACVVT-NGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQ  955
             DW++APFTA YRN+NA  CVV+  G +SCN  A     N+Q W TQGLD  GRNR+RWVQ
Sbjct  207   DWTKAPFTATYRNYNATGCVVSATGTNSCNGAA-----NSQAWLTQGLDANGRNRIRWVQ  261

Query  956   SKHMVYNYCADAKRFPQGFSAECKRSRF  1039
              K M+YNYC D KR+PQG   EC+  RF
Sbjct  262   QKQMIYNYCTDVKRYPQGLPKECRLPRF  289



>ref|XP_010656826.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Vitis vinifera]
Length=297

 Score =   347 bits (891),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 169/288 (59%), Positives = 213/288 (74%), Gaps = 7/288 (2%)
 Frame = +2

Query  161   VCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGS  340
             V   ++I VVA  L+  +        NF  D  + +G+   ++ +NG  + L+LD+ +GS
Sbjct  11    VSTALLISVVASFLMAASAG------NFYQDFDITWGDGRAKILNNGELLTLSLDKTSGS  64

Query  341   GFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVH  520
             GF +KNEYLFG+ DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +H
Sbjct  65    GFQSKNEYLFGKIDMQLKLVPGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILH  123

Query  521   TNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP  700
             TNV+SQGKGN+EQQF+LWFDPTA FHTY+ILWNPQRIIF VD  PIR F N ESIG+ +P
Sbjct  124   TNVFSQGKGNREQQFYLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNSESIGVSYP  183

Query  701   *SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAA  880
              +QPMR+Y SLWNADDWAT+GGLVKTDWS+APFTA YRNFNA+AC+ ++G SSC+     
Sbjct  184   KNQPMRIYSSLWNADDWATRGGLVKTDWSQAPFTASYRNFNADACIWSSGASSCSSNTPT  243

Query  881   SNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAEC  1024
             S S N EW +Q LD   + R++WVQ  +M+YNYC+D KRFPQG   EC
Sbjct  244   STSTNTEWYSQELDSTSQERMKWVQKNYMIYNYCSDTKRFPQGLPPEC  291



>ref|XP_006387118.1| hypothetical protein POPTR_1795s00200g, partial [Populus trichocarpa]
 gb|ERP46032.1| hypothetical protein POPTR_1795s00200g, partial [Populus trichocarpa]
Length=214

 Score =   344 bits (882),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/233 (69%), Positives = 184/233 (79%), Gaps = 20/233 (9%)
 Frame = +2

Query  341   GFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVH  520
             GF +KNEYLFGR DMQ+KLV G SAGTVTT+YL+S  G  HDE+DFEFLGN T +PYT+H
Sbjct  1     GFRSKNEYLFGRIDMQIKLVSGNSAGTVTTYYLSSQ-GPTHDEIDFEFLGNVTGEPYTLH  59

Query  521   TNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP  700
             TNV+SQGKGNKEQQF+LWFDPT AFHTY+I+WN QRIIF+VDN PIRVF+N ESIG+PFP
Sbjct  60    TNVFSQGKGNKEQQFYLWFDPTKAFHTYSIVWNQQRIIFLVDNIPIRVFHNSESIGVPFP  119

Query  701   *SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAA  880
               QPMR+Y SLWNADDWAT+GGLVKTDW++APFTA YRNF A+AC               
Sbjct  120   TKQPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFKASAC---------------  164

Query  881   SNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1039
                 +  WQ Q LD  GRNR+RWVQ K+M+YNYC D KRFPQG  AECKRSRF
Sbjct  165   ----DSTWQVQALDASGRNRLRWVQQKYMIYNYCTDLKRFPQGIPAECKRSRF  213



>ref|XP_010259802.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Nelumbo nucifera]
Length=300

 Score =   347 bits (890),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 165/285 (58%), Positives = 218/285 (76%), Gaps = 2/285 (1%)
 Frame = +2

Query  173   MIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNT  352
             + +  ++C LV  +LA+     +F  D  + +G+   ++ + G  + L+LD+ +GSGF +
Sbjct  11    LSLKFLSCLLVLGSLAIVASASSFYQDFDVTWGDGRAKILNTGELLTLSLDKASGSGFQS  70

Query  353   KNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVY  532
             K+EYLFG+ DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +HTNV+
Sbjct  71    KHEYLFGKIDMQLKLVPGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILHTNVF  129

Query  533   SQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQP  712
             SQGKGN+EQQF+LWFDPTA FHTY+ILWNP+RIIF VD  PIR F N ESIG+PFP +QP
Sbjct  130   SQGKGNREQQFYLWFDPTADFHTYSILWNPRRIIFSVDGTPIREFKNSESIGVPFPKNQP  189

Query  713   MRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNA-NACVVTNGVSSCNFKAAASNS  889
             MR+Y SLWNADDWAT+GGLVKTDW++APFTA YRNFNA NAC+ ++G SSC+ K+  S +
Sbjct  190   MRIYSSLWNADDWATRGGLVKTDWTKAPFTASYRNFNANNACIWSSGSSSCDSKSPTSTT  249

Query  890   NNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAEC  1024
             N+ +W +Q LD  G+ ++RWVQ  +M+YNYC D KRFP+G  +EC
Sbjct  250   NDSQWLSQELDSAGQEKMRWVQKNYMIYNYCTDTKRFPRGLPSEC  294



>ref|XP_002325068.2| hypothetical protein POPTR_0018s10300g [Populus trichocarpa]
 gb|EEF03633.2| hypothetical protein POPTR_0018s10300g [Populus trichocarpa]
Length=291

 Score =   347 bits (889),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/266 (60%), Positives = 203/266 (76%), Gaps = 7/266 (3%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             +F  DV + +G+   ++ +NGN + L+LD+ +GSGF +KNEY FG+FD+Q+KLV G SAG
Sbjct  32    SFYQDVDIIWGDGRAKILNNGNLLTLSLDRASGSGFQSKNEYFFGKFDIQLKLVPGNSAG  91

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL S  G A DE+DFEFLGN +  PY VHTNVY+QGKG++EQQF+LWFDPTA FH
Sbjct  92    TVTTFYLHSQ-GSAWDEIDFEFLGNLSGDPYLVHTNVYTQGKGDREQQFYLWFDPTADFH  150

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY++LWNP+ I+F VD  PIR F N ESIG+P+P  Q MR+Y S+WNADDWAT+GGLVKT
Sbjct  151   TYSVLWNPRHIVFYVDGRPIREFKNMESIGVPYPKRQSMRMYASIWNADDWATRGGLVKT  210

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW++APFT  YRNFNA AC+ +NGVSSCN      NS N  W +Q LD   + +++WV+ 
Sbjct  211   DWTQAPFTVSYRNFNAEACMGSNGVSSCN------NSTNNRWYSQELDSTSQKQLKWVRE  264

Query  959   KHMVYNYCADAKRFPQGFSAECKRSR  1036
              +MVYNYCAD KRFPQG   EC  ++
Sbjct  265   NYMVYNYCADTKRFPQGLPLECNATK  290



>ref|XP_006474156.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like isoform X3 [Citrus sinensis]
Length=285

 Score =   346 bits (888),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 164/265 (62%), Positives = 204/265 (77%), Gaps = 1/265 (0%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF+ D  + +G+    + +NG  + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  22    NFHQDFDITWGDGRANILNNGQLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSAG  81

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL SP G   DE+DFEFLGN +  PYT+HTNV++ GKG+KEQQFHLWFDPTA FH
Sbjct  82    TVTAYYLKSP-GSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDKEQQFHLWFDPTADFH  140

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRI+F VD  PIR F N ESIG+ FP +QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  141   TYSILWNPQRIVFSVDGTPIREFKNSESIGVAFPKNQPMRIYSSLWNADDWATRGGLVKT  200

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW+ APFTA YRNFNA+ACV +NG SSC   + +S S++  W +Q LD   + R++WVQ 
Sbjct  201   DWTHAPFTASYRNFNADACVWSNGKSSCASSSPSSPSSSSAWFSQELDSTSQERLKWVQK  260

Query  959   KHMVYNYCADAKRFPQGFSAECKRS  1033
              +M+YNYC D KRFPQG  AEC+ S
Sbjct  261   NYMIYNYCTDTKRFPQGLPAECRIS  285



>ref|XP_008380219.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like [Malus domestica]
Length=292

 Score =   346 bits (888),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 167/293 (57%), Positives = 211/293 (72%), Gaps = 6/293 (2%)
 Frame = +2

Query  158   QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
             +V M+  +  +  SLV V  +      NF  D ++ FG+   +V +NG  + L LD+ +G
Sbjct  5     KVSMLFFLCSITISLVAVVASAG----NFYQDYEVMFGDQHAKVLENGQIITLALDKSSG  60

Query  338   SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
             +GF +KN YLFG+FDMQ+KL  G SAGTVTTFYL+S  G  HDE+DFEFLGN+T +PYT+
Sbjct  61    AGFKSKNAYLFGKFDMQIKLQPGNSAGTVTTFYLSSS-GANHDEIDFEFLGNSTGEPYTI  119

Query  518   HTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPF  697
             HTNVY+QG+G KEQQFHLWFDPT  FHTY+I+WN +RIIF+VD++PIRVFNN ESIG+PF
Sbjct  120   HTNVYAQGQGLKEQQFHLWFDPTQDFHTYSIVWNTKRIIFLVDDSPIRVFNNLESIGLPF  179

Query  698   P*SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAA  877
             P +Q M +Y + WNADDWATQGG VKTDWS APFTA YRNFN NAC  + G  SC   + 
Sbjct  180   PKNQSMGIYATFWNADDWATQGGRVKTDWSLAPFTASYRNFNINACPGSQG-PSCTSTST  238

Query  878   ASNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSR  1036
               ++    W+ QGL+   RNR+RWVQSK MVY+YC D  +F +    ECK SR
Sbjct  239   ERSAVGSSWKNQGLNAAERNRLRWVQSKFMVYDYCTDRIKFNKXLPRECKHSR  291



>ref|XP_009108993.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like [Brassica rapa]
Length=282

 Score =   346 bits (887),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 197/265 (74%), Gaps = 6/265 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             +FN+DV + +GN  G++ +NG  + L LD+ +GSGF +K EYLFG+ DMQ+KLV G SAG
Sbjct  23    DFNSDVNVAWGNGRGKILNNGQLLTLTLDKSSGSGFQSKAEYLFGKIDMQIKLVPGNSAG  82

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL S  G   DE+DFEFLGN +  PYT+HTNVY+QGKG+KEQQFHLWFDP A FH
Sbjct  83    TVTTFYLKSE-GSTWDEIDFEFLGNMSGDPYTLHTNVYTQGKGDKEQQFHLWFDPAANFH  141

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRII+ VDN PIR F N E +G+ FP S+PMR+Y SLWNADDWAT+GGLVKT
Sbjct  142   TYSILWNPQRIIWTVDNTPIREFKNSEPLGVLFPKSKPMRMYASLWNADDWATRGGLVKT  201

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APF A YR+   + CV  NG SSC+     SN     W TQ +D   + R+RWVQ 
Sbjct  202   DWSKAPFVASYRHIKCDGCVHANGRSSCSSTRPTSN-----WYTQQMDSTSQARLRWVQK  256

Query  959   KHMVYNYCADAKRFPQGFSAECKRS  1033
              +M+YNYC D+KRFPQG   EC  S
Sbjct  257   NYMIYNYCTDSKRFPQGIPRECATS  281



>gb|AFR46580.2| xyloglucan endotransglucosylase/hydrolase 12 [Rosa x borboniana]
Length=281

 Score =   346 bits (887),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 161/289 (56%), Positives = 208/289 (72%), Gaps = 18/289 (6%)
 Frame = +2

Query  164   CMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSG  343
             C+++++G+   SL+     V     NF  D  + +G H  ++   G  ++L+LD+ +GSG
Sbjct  9     CLVLLVGLALSSLI-----VGSYAGNFYQDFDLTWGGHRPKIFKGGQLLSLSLDKVSGSG  63

Query  344   FNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHT  523
             F +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +HT
Sbjct  64    FQSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNVSGDPYVLHT  122

Query  524   NVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*  703
             N+++QGKGN+EQQF+LWFDP+  FHTY+I+W PQ IIF+VDN PIRVF N ES+G+PFP 
Sbjct  123   NIFTQGKGNREQQFYLWFDPSKNFHTYSIIWKPQHIIFLVDNTPIRVFKNAESLGVPFPK  182

Query  704   SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAAS  883
             +Q MR+Y SLWNADDWAT+GGLVKTDWS+APFTAYYRNFN             + K++ S
Sbjct  183   NQAMRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRNFNV-----------IDAKSSKS  231

Query  884   NSNNQ-EWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECK  1027
              S++Q  WQT  LD   R R+RWVQ   M+YNYC D KRFP+GF AEC+
Sbjct  232   FSDSQPSWQTNALDAPSRRRLRWVQKYFMIYNYCTDLKRFPRGFPAECR  280



>ref|NP_001281042.1| probable xyloglucan endotransglucosylase/hydrolase protein 23 
precursor [Malus domestica]
 gb|AAN07898.1| xyloglucan endotransglycosylase [Malus domestica]
 gb|ACD03226.1| xyloglucan endotransglucosylase/hydrolase 2 [Malus domestica]
Length=282

 Score =   346 bits (887),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 158/262 (60%), Positives = 196/262 (75%), Gaps = 5/262 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NFN D  + +G+   ++ DNG ++ L+LD+ +GSGF +KN+YLFG+ DMQ+KLV G SAG
Sbjct  23    NFNQDFDITWGDGRAKILDNGQSLTLSLDKTSGSGFQSKNQYLFGKIDMQIKLVPGNSAG  82

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S +G  HDE+DFEFLGN +  PY +HTN+++QGKGN+EQQF+LWFDPT  FH
Sbjct  83    TVTAYYLSS-LGSTHDEIDFEFLGNLSGDPYILHTNIFTQGKGNREQQFYLWFDPTKDFH  141

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQ IIF VD  PIR F N ES G+ FP  Q M +Y SLWNADDWAT+GGLVKT
Sbjct  142   TYSILWNPQTIIFSVDGTPIREFKNLESKGVSFPKDQGMWIYSSLWNADDWATRGGLVKT  201

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTA YRNFNA AC  ++G S C  K+     N   W TQ LD  G+ R++WVQ 
Sbjct  202   DWSKAPFTASYRNFNAQACTWSSGTSRCPSKSP----NESSWLTQSLDSTGQERIKWVQK  257

Query  959   KHMVYNYCADAKRFPQGFSAEC  1024
              +M+YNYC D KRFPQGF  EC
Sbjct  258   NYMIYNYCRDTKRFPQGFPPEC  279



>ref|XP_011006106.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Populus 
euphratica]
Length=282

 Score =   345 bits (886),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 165/288 (57%), Positives = 208/288 (72%), Gaps = 10/288 (3%)
 Frame = +2

Query  164   CMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSG  343
             C    + V+ACS+            +F  D  + +G+   ++ + G  ++L+LD+ +GSG
Sbjct  5     CYEFSLFVIACSMA------VVASGSFYQDFDLTWGDRRAKIFNGGQLLSLSLDKVSGSG  58

Query  344   FNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHT  523
             F +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +HT
Sbjct  59    FQSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILHT  117

Query  524   NVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*  703
             NV++QGKGN+EQQF+LWFDPT  FHTY+I+WNPQ IIF+VD+ PIRVF N ESIG+PFP 
Sbjct  118   NVFTQGKGNREQQFYLWFDPTRNFHTYSIIWNPQHIIFLVDSIPIRVFKNAESIGVPFPK  177

Query  704   SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAAS  883
             SQPMR+Y SLWNADDWAT+GGLVKTDW++APFTAYYRNF ANA   + G SSC  K +++
Sbjct  178   SQPMRIYSSLWNADDWATRGGLVKTDWTKAPFTAYYRNFKANAW--SYGTSSCGSKPSSA  235

Query  884   NSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECK  1027
              S    W+T  LD   R R+RWVQ   M+YNYC D +RFPQG   ECK
Sbjct  236   FSYG-AWKTNELDAPSRRRLRWVQKYFMIYNYCTDLRRFPQGPPPECK  282



>ref|XP_003542166.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22 [Glycine max]
Length=285

 Score =   346 bits (887),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 156/265 (59%), Positives = 201/265 (76%), Gaps = 1/265 (0%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             + N D  + +G+   ++ ++G  + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  22    DLNKDFDITWGDGRSKILNHGELLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSAG  81

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G   DE+D+EFLGN +  PY +HTNV+SQGKG++EQQF+LWFDPTA FH
Sbjct  82    TVTAYYLSSK-GSTWDEIDYEFLGNLSGDPYILHTNVFSQGKGDREQQFYLWFDPTADFH  140

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WNPQRIIF VD  PIR F N E+IG+PFP +QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  141   TYSIMWNPQRIIFSVDGTPIREFKNSEAIGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  200

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DW++APFTA YRNFNA AC+ ++G SSC   ++   S +  W +Q LD  G  R++WVQ 
Sbjct  201   DWTQAPFTASYRNFNAEACIWSSGASSCAKTSSTPTSGSGSWLSQELDATGHQRLKWVQK  260

Query  959   KHMVYNYCADAKRFPQGFSAECKRS  1033
              +M+YNYC D KRFPQG   EC  S
Sbjct  261   NYMIYNYCTDTKRFPQGLPPECNIS  285



>ref|XP_011038986.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Populus euphratica]
Length=291

 Score =   346 bits (887),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 169/290 (58%), Positives = 212/290 (73%), Gaps = 12/290 (4%)
 Frame = +2

Query  167   MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
             +++++     SL+G +L       NF  D  + +G+    + ++G  + LNLDQ +GSGF
Sbjct  13    LVVVVLFTLASLMGSSLG------NFYQDFDIIWGDWRAMILNDGELLNLNLDQASGSGF  66

Query  347   NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
              +KNEYLFG+ DMQ+KLV G SAGTVT +YL S  G A DE+DFEFLGN +  PY +HTN
Sbjct  67    QSKNEYLFGKIDMQLKLVPGNSAGTVTAYYLQSK-GSAWDEIDFEFLGNLSGDPYILHTN  125

Query  527   VYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*S  706
             VYSQGKG+KEQQF+LWFDPTA FHTY+ILWNPQRIIF VD  PIR F N ESIG+PFP  
Sbjct  126   VYSQGKGDKEQQFYLWFDPTADFHTYSILWNPQRIIFFVDGTPIREFKNMESIGVPFPKY  185

Query  707   QPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNA-NACVVTNGVSSCNFKAAAS  883
             QPMR+Y +LWNAD+WAT+GGLVKTDWS+APFTA Y NFNA NACV  NG SSC+     +
Sbjct  186   QPMRLYSTLWNADNWATRGGLVKTDWSQAPFTASYTNFNANNACVWFNGASSCD----TN  241

Query  884   NSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRS  1033
             N +   W ++ LD    ++++WVQ+ +M+YNYC DAKRFPQGF  EC  S
Sbjct  242   NFSPPSWLSEDLDSADLDKLQWVQTNNMIYNYCTDAKRFPQGFPPECNMS  291



>ref|XP_003610153.1| Xyloglucan endotransglucosylase/hydrolase [Medicago truncatula]
 gb|AES92350.1| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
Length=288

 Score =   346 bits (887),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 203/265 (77%), Gaps = 1/265 (0%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NFN D Q+ +G+   ++ +N N + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  25    NFNKDFQITWGDGRAKILNNANLLTLSLDKASGSGFQSKNEYLFGKIDMQIKLVPGNSAG  84

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G A DE+DFEFLGN +  PY +HTNV+SQGKGN+EQQF+LWFDPTA FH
Sbjct  85    TVTAYYLSSK-GGAWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFH  143

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRI+F VD  PIR F N ES G+PFP +QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  144   TYSILWNPQRIVFSVDGTPIREFKNMESNGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  203

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTA YRNFNAN   + NG  S    ++  ++++  W +Q LD  G+ R+RWVQ 
Sbjct  204   DWSKAPFTASYRNFNANNACIWNGGKSSCKSSSKPSASSASWLSQQLDSTGQQRLRWVQK  263

Query  959   KHMVYNYCADAKRFPQGFSAECKRS  1033
              +M+YNYC+D KRFPQG   EC  S
Sbjct  264   NYMIYNYCSDKKRFPQGLPVECTHS  288



>ref|XP_002274601.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Vitis vinifera]
Length=297

 Score =   346 bits (887),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 165/288 (57%), Positives = 211/288 (73%), Gaps = 7/288 (2%)
 Frame = +2

Query  161   VCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGS  340
             V   ++I VV   L+  +        NF  D  + +G+   ++ DNG  + L+LD+ +GS
Sbjct  11    VSTALLISVVVSFLMAASAG------NFYQDFGITWGDGRAKILDNGEFLTLSLDKTSGS  64

Query  341   GFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVH  520
             GF +KNEYLFG+ DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +H
Sbjct  65    GFQSKNEYLFGKIDMQLKLVPGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILH  123

Query  521   TNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP  700
             TNV+SQGKGN+EQQF+LWFDPTA FHTY+ILWNPQRIIF VD  PIR F N ESIG+P+ 
Sbjct  124   TNVFSQGKGNREQQFYLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNSESIGVPYL  183

Query  701   *SQPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAA  880
              +QPMR+Y SLWNADDWAT+GGL+KTDW++APFTA YRNFNA+AC+ ++G SSC+     
Sbjct  184   KNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNADACIWSSGASSCSSNTPT  243

Query  881   SNSNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAEC  1024
             S S + +W +Q LD   + R++WVQ  +M+YNYC D KRFPQG   EC
Sbjct  244   SISPSTDWYSQELDSTSQERMKWVQKNYMIYNYCTDTKRFPQGLPPEC  291



>ref|XP_010259807.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Nelumbo nucifera]
Length=301

 Score =   346 bits (888),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 168/289 (58%), Positives = 219/289 (76%), Gaps = 3/289 (1%)
 Frame = +2

Query  173   MIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNT  352
             + +  ++C LV  +LA+     NF  D  + +G+   ++ +NG  + L+LD+ +GSGF +
Sbjct  11    LSLKFLSCLLVLGSLAIVASASNFYQDFDVSWGDGRAKILNNGELLTLSLDKASGSGFQS  70

Query  353   KNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVY  532
             K+EYLFG+ D+Q+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +HTNV+
Sbjct  71    KHEYLFGKIDIQLKLVPGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILHTNVF  129

Query  533   SQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQP  712
             SQGKGN+EQQF+LWFDPTA FHTY+ILWNPQRIIF VD  PIR F N ESIG+PFP +QP
Sbjct  130   SQGKGNREQQFYLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNSESIGVPFPKNQP  189

Query  713   MRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNA-NACVVTNGVSSCNFKAAASNS  889
             MR+Y SLWNADDWAT+GGLVKTDW++APFTA YRNFNA NAC+ ++G SSC+ K+  S +
Sbjct  190   MRIYSSLWNADDWATRGGLVKTDWTKAPFTASYRNFNANNACIWSSGSSSCDSKSPTSTT  249

Query  890   NN-QEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRS  1033
             NN  +W +Q LD  G+ +++WVQ  +M+YNYC D KRFPQG   EC  +
Sbjct  250   NNPHQWLSQELDSAGQEKMKWVQKNYMIYNYCTDTKRFPQGLPPECSNT  298



>ref|XP_011082928.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15 isoform X2 [Sesamum indicum]
Length=274

 Score =   345 bits (885),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 162/266 (61%), Positives = 205/266 (77%), Gaps = 12/266 (5%)
 Frame = +2

Query  167  MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
            M++++ ++  ++            +F  D ++ +G+   ++ + G  + L+LDQQ+GSGF
Sbjct  14   MMLLLAILVANIA-------TAAADFYRDAEITWGDGRAKILEGGRMLTLSLDQQSGSGF  66

Query  347  NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
             +KNEYLFGRFD+Q+KLV G SAGTVTTF+L+S  G  HDE+DFEFLGN + +PYTVHTN
Sbjct  67   QSKNEYLFGRFDLQLKLVPGNSAGTVTTFFLSSQ-GAGHDEIDFEFLGNTSGEPYTVHTN  125

Query  527  VYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*S  706
            VY+QGKG+KEQ+FHLWFDPTAAFHTY+I+WNPQRIIF+VDN PIRVF+N+E+IGIP+P S
Sbjct  126  VYAQGKGDKEQRFHLWFDPTAAFHTYSIVWNPQRIIFLVDNIPIRVFSNNEAIGIPYPKS  185

Query  707  QPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASN  886
            Q MRVYCSLWNADDWATQGG VKTDW++APF A YRNFN N CV     SSC  K+A S 
Sbjct  186  QAMRVYCSLWNADDWATQGGRVKTDWTKAPFVASYRNFNINGCVPG---SSCGSKSAES-  241

Query  887  SNNQEWQTQGLDGKGRNRVRWVQSKH  964
             N + WQT+ LDGKGRNR+RW    H
Sbjct  242  FNTEAWQTKELDGKGRNRLRWDTETH  267



>gb|AFK40376.1| unknown [Lotus japonicus]
Length=293

 Score =   346 bits (887),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 169/266 (64%), Positives = 202/266 (76%), Gaps = 2/266 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NFN D Q+ +G+   ++  N N + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  29    NFNKDFQITWGDGRAKILSNANLLTLSLDKASGSGFESKNEYLFGKIDMQIKLVPGNSAG  88

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G   DE+DFEFLGN +  PYT+HTNV+SQGKGN+EQQFHLWFDPTA FH
Sbjct  89    TVTAYYLSSK-GSTWDEIDFEFLGNLSGDPYTLHTNVFSQGKGNREQQFHLWFDPTADFH  147

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRI+F VD  PIR F N ES G+PFP +QPMR+  SLWNAD+WAT+GGLVKT
Sbjct  148   TYSILWNPQRIVFSVDGTPIREFKNLESAGVPFPKNQPMRLTSSLWNADNWATRGGLVKT  207

Query  779   DWSRAPFTAYYRNFNA-NACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQ  955
             DWS+APFTA YRNFNA NACV + G SSC   + +S S +  W  Q LD  G  R+RWVQ
Sbjct  208   DWSKAPFTASYRNFNANNACVWSGGKSSCKSNSPSSASGSASWLKQELDSTGYQRLRWVQ  267

Query  956   SKHMVYNYCADAKRFPQGFSAECKRS  1033
               +MVYNYCAD KRFPQG   EC  S
Sbjct  268   KNYMVYNYCADKKRFPQGLPTECTHS  293



>ref|XP_002307040.2| xyloglucan endo-1 family protein [Populus trichocarpa]
 gb|EEE94036.2| xyloglucan endo-1 family protein [Populus trichocarpa]
Length=267

 Score =   345 bits (884),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 166/266 (62%), Positives = 203/266 (76%), Gaps = 6/266 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + +G+    + ++G  + LNLDQ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  7     NFYQDFDIMWGDWRAMILNDGELLNLNLDQASGSGFQSKNEYLFGKIDMQLKLVPGNSAG  66

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL S  G A DE+DFEFLGN +  PY +HTNVYSQGKG+KEQQF+LWFDPTA FH
Sbjct  67    TVTAYYLQSK-GSAWDEIDFEFLGNLSGDPYILHTNVYSQGKGDKEQQFYLWFDPTADFH  125

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VD  PIR F N ESIG+PFP  QPMR+Y +LWNAD+WAT+GGLVKT
Sbjct  126   TYSILWNPQRIIFFVDGTPIREFKNMESIGVPFPKYQPMRLYSTLWNADNWATRGGLVKT  185

Query  779   DWSRAPFTAYYRNFNA-NACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQ  955
             DWS+APFTA Y NFNA NACV  NG SSC+    ++N +   W ++ LD    ++++WVQ
Sbjct  186   DWSQAPFTASYTNFNANNACVWFNGASSCD----SNNFSPPSWLSEDLDSANLDKLQWVQ  241

Query  956   SKHMVYNYCADAKRFPQGFSAECKRS  1033
             + +M+YNYCADAKRFPQGF  EC  S
Sbjct  242   TNNMIYNYCADAKRFPQGFPPECNMS  267



>ref|XP_002267890.2| PREDICTED: brassinosteroid-regulated protein BRU1-like [Vitis 
vinifera]
Length=281

 Score =   345 bits (885),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 160/267 (60%), Positives = 197/267 (74%), Gaps = 13/267 (5%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + +G++  ++ + G  ++L+LDQ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  26    NFYQDFDLTWGDNRAKIFNGGQLLSLSLDQASGSGFQSKKEYLFGRIDMQLKLVAGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN +  PY +HTNV++QGKGN+EQQF+LWFDPT  FH
Sbjct  86    TVTAYYLSSQ-GSTHDEIDFEFLGNLSGDPYILHTNVFTQGKGNREQQFYLWFDPTRNFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+W  + IIF+VDN PIR+F N ES+G+PFP +QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  145   TYSIIWTARHIIFLVDNVPIRLFKNAESMGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  204

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTAYYRNF AN+   T+      F            QTQ LD   R R+RWVQ 
Sbjct  205   DWSKAPFTAYYRNFRANSSTPTSSFPDSTF------------QTQELDSYSRRRLRWVQK  252

Query  959   KHMVYNYCADAKRFPQGFSAECKRSRF  1039
               M+YNYC D KRFPQG  AECKRSRF
Sbjct  253   NFMIYNYCTDLKRFPQGVPAECKRSRF  279



>ref|XP_007014171.1| Xyloglucan endotransglucosylase/hydrolase family protein [Theobroma 
cacao]
 gb|EOY31790.1| Xyloglucan endotransglucosylase/hydrolase family protein [Theobroma 
cacao]
Length=290

 Score =   345 bits (886),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 167/288 (58%), Positives = 214/288 (74%), Gaps = 7/288 (2%)
 Frame = +2

Query  170   IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
             I+++ +V   L+  + +      NF  D  + +G+  G++ +NG  + L+LD+ +GSGF 
Sbjct  10    ILLMSLVMGCLMAASAS------NFYQDFDITWGDGRGKIDNNGEVLTLSLDKASGSGFQ  63

Query  350   TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
             +K+EYLFG+ DMQ+KLV G SAGTVT +YL+S  G   DE+DFEFLGN +  PY +HTNV
Sbjct  64    SKDEYLFGKIDMQLKLVHGNSAGTVTAYYLSSK-GSTWDEIDFEFLGNLSGDPYILHTNV  122

Query  530   YSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQ  709
             +SQGKGN+EQQF+LWFDPTA FHTY+ILWN QRIIF VD  PIR F N ES+G+PFP +Q
Sbjct  123   FSQGKGNREQQFYLWFDPTADFHTYSILWNSQRIIFSVDGTPIREFKNMESLGVPFPKNQ  182

Query  710   PMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNS  889
             PMR+Y SLWNADDWAT+GGLVKTDW++APFTA YR FNANACV +NG SSC   + +S+S
Sbjct  183   PMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYREFNANACVWSNGASSCKSNSPSSSS  242

Query  890   NNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRS  1033
              N  W +Q LD   + R++WVQ  +M+YNYC DAKRFPQG   EC  S
Sbjct  243   TNNAWLSQELDSTSQQRLQWVQKNYMIYNYCTDAKRFPQGLPPECNMS  290



>ref|XP_010536922.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Tarenaya hassleriana]
Length=293

 Score =   345 bits (886),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 159/262 (61%), Positives = 199/262 (76%), Gaps = 3/262 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  +V++ +G+  GQ+++NG  + L+LD+ +GSGF +KNE+LFG+ DMQ+KLV G SAG
Sbjct  32    NFYRNVEITWGDGRGQIKNNGELLTLSLDKPSGSGFQSKNEFLFGKIDMQIKLVAGNSAG  91

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL SP G   DE+DFEFLGN +  PYT+HTNV++QGKGN+EQQF LWFDPT+ FH
Sbjct  92    TVTAYYLKSP-GSTWDEIDFEFLGNLSGDPYTLHTNVFTQGKGNREQQFKLWFDPTSDFH  150

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*SQPMRVYCSLWNADDWATQGGLVKT  778
             +Y+I WNPQRIIF VD  PIR F N ES G+ FP SQPMR+Y SLWNADDWAT+GGLVKT
Sbjct  151   SYSITWNPQRIIFSVDGTPIREFKNMESQGVLFPKSQPMRMYSSLWNADDWATRGGLVKT  210

Query  779   DWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASNSNNQEWQTQGLDGKGRNRVRWVQS  958
             DWS+APFTA YR FN +ACV +NG SSC     +S      W +Q LD  G+ R+RWV+ 
Sbjct  211   DWSQAPFTASYRGFNEDACVWSNGKSSC--PNGSSQGTGGSWLSQELDTAGQERMRWVER  268

Query  959   KHMVYNYCADAKRFPQGFSAEC  1024
              +M+YNYC D +RFPQG   EC
Sbjct  269   NYMIYNYCTDTQRFPQGLPKEC  290



>ref|XP_009401564.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Musa acuminata subsp. malaccensis]
Length=280

 Score =   345 bits (884),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 169/286 (59%), Positives = 206/286 (72%), Gaps = 9/286 (3%)
 Frame = +2

Query  167   MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
             M M   +VACSLV +A A      NF  +  + +G    +  DNG  + L+LD+ +GSGF
Sbjct  1     MAMRFLLVACSLVAIASAG-----NFYQEFDVTWGGDRAKNLDNGQLLTLSLDKASGSGF  55

Query  347   NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
              +KN+YLFG+ DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PYT+HTN
Sbjct  56    QSKNQYLFGKIDMQIKLVPGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTN  114

Query  527   VYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP*S  706
             V++QGKGN+E QF LWFDPT  FHTY+ILWNP+ +IFMVD  PIR F N ES GI FP S
Sbjct  115   VFTQGKGNREMQFKLWFDPTDDFHTYSILWNPRHVIFMVDGTPIRDFKNLESRGIAFPNS  174

Query  707   QPMRVYCSLWNADDWATQGGLVKTDWSRAPFTAYYRNFNANACVVTNGVSSCNFKAAASN  886
             QPMR+Y SLWNADDWAT+GGLVKTDWSRAPFTA YRNF AN CV ++  S C   A+ S 
Sbjct  175   QPMRIYSSLWNADDWATRGGLVKTDWSRAPFTASYRNFKANTCVPSSATSEC---ASNSV  231

Query  887   SNNQEWQTQGLDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAEC  1024
              +N  W  Q LD  G+ R++WVQ  +M+YNYC+D KRFPQG   EC
Sbjct  232   PSNGGWWNQELDSMGQQRMKWVQKNYMIYNYCSDLKRFPQGLPPEC  277



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3368954703288