BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24083_g1_i1 len=1247 path=[841:0-529 3322:530-551 5133:552-563
4981:564-585 1426:586-699 4818:700-711 1552:712-787 4732:788-807
1648:808-854 615:855-927 688:928-1016 1857:1017-1246]

Length=1247
                                                                      Score     E

ref|XP_009762863.1|  PREDICTED: brassinosteroid-regulated protein...    414   3e-140   
ref|XP_009598225.1|  PREDICTED: brassinosteroid-regulated protein...    412   2e-139   
ref|XP_009598236.1|  PREDICTED: brassinosteroid-regulated protein...    411   6e-139   
ref|XP_009762866.1|  PREDICTED: brassinosteroid-regulated protein...    410   2e-138   
ref|XP_006350014.1|  PREDICTED: probable xyloglucan endotransgluc...    406   4e-137   
ref|XP_006350013.1|  PREDICTED: probable xyloglucan endotransgluc...    406   4e-137   
ref|NP_001234478.1|  xyloglucan endotransglucosylase-hydrolase XT...    406   7e-137   
ref|XP_009597029.1|  PREDICTED: probable xyloglucan endotransgluc...    404   2e-136   
ref|XP_009602932.1|  PREDICTED: probable xyloglucan endotransgluc...    404   3e-136   
ref|XP_009785048.1|  PREDICTED: probable xyloglucan endotransgluc...    404   4e-136   
ref|XP_009758414.1|  PREDICTED: probable xyloglucan endotransgluc...    402   3e-135   
ref|XP_004243230.1|  PREDICTED: probable xyloglucan endotransgluc...    401   5e-135   
gb|ABD96607.1|  xyloglucan endotransglucosylase XET1                    391   4e-131   Capsicum annuum
ref|XP_006348946.1|  PREDICTED: probable xyloglucan endotransgluc...    389   2e-130   
gb|ABD96609.1|  xyloglucan endotransglucosylase XET3                    389   3e-130   Capsicum annuum
ref|XP_006366771.1|  PREDICTED: probable xyloglucan endotransgluc...    387   1e-129   
gb|ABD96608.1|  xyloglucan endotransglucosylase XET2                    387   2e-129   Capsicum annuum
ref|XP_011082926.1|  PREDICTED: xyloglucan endotransglucosylase/h...    385   7e-129   
ref|NP_001234213.1|  xyloglucan endo-transglycosylase precursor         385   8e-129   
ref|NP_001274880.1|  probable xyloglucan endotransglucosylase/hyd...    384   3e-128   
ref|NP_001234207.1|  xyloglycan endo-transglycosylase precursor         382   9e-128   
ref|XP_011082922.1|  PREDICTED: xyloglucan endotransglucosylase/h...    382   2e-127   
ref|XP_011082921.1|  PREDICTED: xyloglucan endotransglucosylase/h...    382   2e-127   
ref|XP_011082925.1|  PREDICTED: xyloglucan endotransglucosylase/h...    381   3e-127   
ref|XP_011082923.1|  PREDICTED: xyloglucan endotransglucosylase/h...    380   6e-127   
ref|XP_004303859.1|  PREDICTED: probable xyloglucan endotransgluc...    380   1e-126   
gb|ACD03217.1|  xyloglucan endotransglucosylase/hydrolase 7             379   2e-126   Actinidia deliciosa [Chinese gooseberry]
ref|XP_004303861.1|  PREDICTED: probable xyloglucan endotransgluc...    378   8e-126   
ref|XP_009356634.1|  PREDICTED: brassinosteroid-regulated protein...    378   9e-126   
ref|NP_001281066.1|  brassinosteroid-regulated protein BRU1-like ...    377   1e-125   
ref|XP_009356637.1|  PREDICTED: brassinosteroid-regulated protein...    376   4e-125   
ref|XP_009356635.1|  PREDICTED: probable xyloglucan endotransgluc...    375   6e-125   
ref|XP_010102170.1|  putative xyloglucan endotransglucosylase/hyd...    375   6e-125   
ref|XP_011082930.1|  PREDICTED: probable xyloglucan endotransgluc...    374   2e-124   
ref|XP_008348360.1|  PREDICTED: brassinosteroid-regulated protein...    374   2e-124   
ref|XP_004303862.1|  PREDICTED: probable xyloglucan endotransgluc...    374   3e-124   
ref|XP_009356638.1|  PREDICTED: brassinosteroid-regulated protein...    373   4e-124   
gb|AAR37363.1|  xyloglucan endo-transglycosylase                        372   5e-124   Nicotiana attenuata
ref|XP_011082924.1|  PREDICTED: xyloglucan endotransglucosylase/h...    372   8e-124   
ref|XP_009377621.1|  PREDICTED: brassinosteroid-regulated protein...    372   1e-123   
gb|EYU31577.1|  hypothetical protein MIMGU_mgv1a011275mg                372   2e-123   
ref|XP_008229404.1|  PREDICTED: brassinosteroid-regulated protein...    371   2e-123   
ref|XP_002306736.2|  xyloglucan endo-1 family protein                   371   4e-123   Populus trichocarpa [western balsam poplar]
emb|CDP15955.1|  unnamed protein product                                370   5e-123   
gb|EYU31576.1|  hypothetical protein MIMGU_mgv1a011220mg                370   8e-123   
ref|NP_001280908.1|  brassinosteroid-regulated protein BRU1-like ...    370   1e-122   
ref|XP_011044804.1|  PREDICTED: brassinosteroid-regulated protein...    369   2e-122   
ref|XP_007215791.1|  hypothetical protein PRUPE_ppa009863mg             368   2e-122   
ref|XP_011044805.1|  PREDICTED: brassinosteroid-regulated protein...    370   3e-122   
ref|XP_009597028.1|  PREDICTED: brassinosteroid-regulated protein...    369   4e-122   
ref|XP_009377610.1|  PREDICTED: brassinosteroid-regulated protein...    367   8e-122   
gb|EYU29581.1|  hypothetical protein MIMGU_mgv1a022262mg                367   9e-122   
ref|XP_010246961.1|  PREDICTED: brassinosteroid-regulated protein...    367   1e-121   
gb|EYU29580.1|  hypothetical protein MIMGU_mgv1a018934mg                365   2e-121   
ref|XP_008229403.1|  PREDICTED: brassinosteroid-regulated protein...    365   3e-121   
gb|EPS58668.1|  hypothetical protein M569_16144                         365   4e-121   
ref|XP_008229401.1|  PREDICTED: brassinosteroid-regulated protein...    365   7e-121   
ref|XP_007215773.1|  hypothetical protein PRUPE_ppa009608mg             364   1e-120   
gb|KDP33066.1|  hypothetical protein JCGZ_13603                         363   1e-120   
ref|XP_010525736.1|  PREDICTED: xyloglucan endotransglucosylase/h...    364   1e-120   
ref|XP_010450105.1|  PREDICTED: probable xyloglucan endotransgluc...    364   2e-120   
ref|XP_002520387.1|  Brassinosteroid-regulated protein BRU1 precu...    363   3e-120   Ricinus communis
ref|XP_006387415.1|  xyloglucan endo-1 family protein                   363   3e-120   
ref|XP_010435185.1|  PREDICTED: probable xyloglucan endotransgluc...    363   3e-120   
gb|KDP35747.1|  hypothetical protein JCGZ_10519                         362   5e-120   
ref|XP_008341405.1|  PREDICTED: brassinosteroid-regulated protein...    362   7e-120   
ref|XP_008229405.1|  PREDICTED: brassinosteroid-regulated protein...    362   7e-120   
gb|KCW89706.1|  hypothetical protein EUGRSUZ_A01968                     364   8e-120   
ref|XP_010053265.1|  PREDICTED: probable xyloglucan endotransgluc...    362   9e-120   
ref|XP_008229400.1|  PREDICTED: brassinosteroid-regulated protein...    362   9e-120   
gb|AFR46576.1|  xyloglucan endotransglucosylase/hydrolase 7             361   1e-119   
ref|XP_010440528.1|  PREDICTED: probable xyloglucan endotransgluc...    362   1e-119   
ref|XP_007034180.1|  Xyloglucan endotransglucosylase/hydrolase 16       361   2e-119   
ref|XP_007217342.1|  hypothetical protein PRUPE_ppa020825mg             360   3e-119   
ref|XP_009108100.1|  PREDICTED: probable xyloglucan endotransgluc...    360   6e-119   
ref|XP_009356633.1|  PREDICTED: brassinosteroid-regulated protein...    360   6e-119   
ref|XP_010677921.1|  PREDICTED: probable xyloglucan endotransgluc...    360   6e-119   
gb|KFK24577.1|  hypothetical protein AALP_AAs45078U000600               360   8e-119   
ref|XP_002520388.1|  Brassinosteroid-regulated protein BRU1 precu...    360   8e-119   Ricinus communis
ref|XP_010677922.1|  PREDICTED: probable xyloglucan endotransgluc...    359   8e-119   
ref|NP_200564.1|  xyloglucan endotransglucosylase/hydrolase prote...    358   2e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002868312.1|  hypothetical protein ARALYDRAFT_493497             359   2e-118   
ref|XP_010525737.1|  PREDICTED: xyloglucan endotransglucosylase/h...    358   3e-118   
ref|XP_006284242.1|  hypothetical protein CARUB_v10005405mg             358   3e-118   
ref|XP_007048840.1|  Xyloglucan endotransglucosylase/hydrolase 15       358   4e-118   
ref|XP_002268708.1|  PREDICTED: brassinosteroid-regulated protein...    358   4e-118   Vitis vinifera
gb|KHG09063.1|  Xyloglucan endotransglucosylase/hydrolase 22 -lik...    358   5e-118   
ref|XP_004293654.1|  PREDICTED: probable xyloglucan endotransgluc...    358   6e-118   
emb|CDY27126.1|  BnaA08g07640D                                          357   8e-118   
gb|KFK35964.1|  xyloglucan:xyloglucosyl transferase                     357   9e-118   
ref|NP_193149.2|  probable xyloglucan endotransglucosylase/hydrol...    357   1e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011016785.1|  PREDICTED: probable xyloglucan endotransgluc...    357   1e-117   
ref|XP_002302146.2|  xyloglucan endo-1 family protein                   357   2e-117   Populus trichocarpa [western balsam poplar]
ref|XP_010536006.1|  PREDICTED: xyloglucan endotransglucosylase/h...    356   2e-117   
ref|XP_010243150.1|  PREDICTED: brassinosteroid-regulated protein...    356   2e-117   
gb|AFR46575.1|  xyloglucan endotransglucosylase/hydrolase 6             356   2e-117   
ref|XP_009120272.1|  PREDICTED: xyloglucan endotransglucosylase/h...    355   2e-117   
ref|XP_008229402.1|  PREDICTED: brassinosteroid-regulated protein...    355   3e-117   
ref|XP_006414798.1|  hypothetical protein EUTSA_v10025705mg             357   3e-117   
ref|XP_006453414.1|  hypothetical protein CICLE_v10009119mg             355   4e-117   
ref|XP_006453421.1|  hypothetical protein CICLE_v10009118mg             355   4e-117   
ref|XP_006453413.1|  hypothetical protein CICLE_v10008951mg             356   4e-117   
ref|XP_011026280.1|  PREDICTED: probable xyloglucan endotransgluc...    355   5e-117   
ref|XP_009121735.1|  PREDICTED: probable xyloglucan endotransgluc...    355   6e-117   
ref|XP_006401194.1|  hypothetical protein EUTSA_v10014326mg             355   6e-117   
ref|XP_007025220.1|  Xyloglucan endotransglucosylase/hydrolase 16       355   7e-117   
ref|XP_009120273.1|  PREDICTED: xyloglucan endotransglucosylase/h...    354   8e-117   
emb|CAB10192.1|  xyloglucan endotransglycosylase-related protein ...    354   9e-117   Arabidopsis thaliana [mouse-ear cress]
gb|KFK27295.1|  hypothetical protein AALP_AA8G363900                    354   1e-116   
ref|XP_007217276.1|  hypothetical protein PRUPE_ppa017487mg             353   1e-116   
ref|XP_004140252.1|  PREDICTED: brassinosteroid-regulated protein...    354   1e-116   
ref|XP_007215793.1|  hypothetical protein PRUPE_ppa009871mg             353   1e-116   
ref|XP_006474159.1|  PREDICTED: xyloglucan endotransglucosylase/h...    354   1e-116   
ref|XP_002866213.1|  hypothetical protein ARALYDRAFT_918931             353   1e-116   
ref|XP_004164862.1|  PREDICTED: brassinosteroid-regulated protein...    353   2e-116   
ref|XP_004164865.1|  PREDICTED: brassinosteroid-regulated protein...    353   2e-116   
ref|XP_004303860.1|  PREDICTED: probable xyloglucan endotransgluc...    354   2e-116   
ref|XP_006280918.1|  hypothetical protein CARUB_v10026914mg             353   2e-116   
ref|XP_007014165.1|  Xyloglucan endotransglucosylase/hydrolase fa...    353   3e-116   
gb|AEX07596.1|  xyloglucosyl transferase 1                              352   4e-116   
gb|KHF98175.1|  putative xyloglucan endotransglucosylase/hydrolas...    353   4e-116   
ref|XP_006474154.1|  PREDICTED: probable xyloglucan endotransgluc...    352   4e-116   
gb|KFK27294.1|  hypothetical protein AALP_AA8G363800                    352   5e-116   
ref|XP_002301752.1|  brassinosteroid-regulated family protein           352   5e-116   Populus trichocarpa [western balsam poplar]
ref|XP_002883457.1|  hypothetical protein ARALYDRAFT_479888             352   5e-116   
ref|XP_006425209.1|  hypothetical protein CICLE_v10010858mg             352   5e-116   
ref|XP_010259800.1|  PREDICTED: probable xyloglucan endotransgluc...    353   5e-116   
ref|XP_008449516.1|  PREDICTED: brassinosteroid-regulated protein...    352   6e-116   
ref|XP_008449531.1|  PREDICTED: brassinosteroid-regulated protein...    352   6e-116   
ref|XP_010452475.1|  PREDICTED: xyloglucan endotransglucosylase/h...    352   7e-116   
ref|XP_006474158.1|  PREDICTED: xyloglucan endotransglucosylase/h...    352   8e-116   
ref|XP_010443442.1|  PREDICTED: xyloglucan endotransglucosylase/h...    352   9e-116   
ref|XP_011024784.1|  PREDICTED: brassinosteroid-regulated protein...    352   1e-115   
ref|XP_006413268.1|  hypothetical protein EUTSA_v10025720mg             353   1e-115   
ref|XP_009102589.1|  PREDICTED: probable xyloglucan endotransgluc...    352   1e-115   
emb|CCH26408.1|  xyloglucan endotransglycosylase                        351   1e-115   
gb|KGN47998.1|  hypothetical protein Csa_6G423400                       351   1e-115   
ref|XP_010512813.1|  PREDICTED: probable xyloglucan endotransgluc...    352   1e-115   
ref|XP_002526229.1|  conserved hypothetical protein                     351   1e-115   Ricinus communis
ref|XP_010532726.1|  PREDICTED: probable xyloglucan endotransgluc...    352   1e-115   
gb|ABM91075.1|  xyloglucan endotransglycosylase/hydrolase precurs...    351   2e-115   Populus tremula x Populus tremuloides
ref|NP_001284418.1|  brassinosteroid-regulated protein BRU1-like ...    351   2e-115   
ref|XP_006474156.1|  PREDICTED: probable xyloglucan endotransgluc...    351   2e-115   
ref|XP_006298237.1|  hypothetical protein CARUB_v10014298mg             351   2e-115   
gb|AFK47205.1|  unknown                                                 351   2e-115   
gb|KHN17579.1|  Putative xyloglucan endotransglucosylase/hydrolas...    351   2e-115   
ref|XP_008449536.1|  PREDICTED: brassinosteroid-regulated protein...    351   2e-115   
ref|XP_003610153.1|  Xyloglucan endotransglucosylase/hydrolase          351   2e-115   
ref|NP_566738.1|  xyloglucan endotransglucosylase/hydrolase prote...    351   2e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007014172.1|  Xyloglucan endotransglucosylase/hydrolase fa...    350   3e-115   
gb|AGI42452.1|  xyloglucan endotransglycosylase/hydrolase               350   3e-115   
ref|XP_007211780.1|  hypothetical protein PRUPE_ppa009685mg             350   3e-115   
ref|XP_010466730.1|  PREDICTED: probable xyloglucan endotransgluc...    350   4e-115   
gb|KDO46535.1|  hypothetical protein CISIN_1g023581mg                   350   4e-115   
ref|XP_007014173.1|  Xyloglucan endotransglycosylase 6                  350   4e-115   
gb|KDO46534.1|  hypothetical protein CISIN_1g023431mg                   350   4e-115   
ref|XP_010536923.1|  PREDICTED: probable xyloglucan endotransgluc...    350   4e-115   
gb|KDP36434.1|  hypothetical protein JCGZ_08703                         350   5e-115   
ref|XP_008449534.1|  PREDICTED: brassinosteroid-regulated protein...    350   5e-115   
ref|XP_008225386.1|  PREDICTED: brassinosteroid-regulated protein...    350   5e-115   
ref|XP_003549488.1|  PREDICTED: probable xyloglucan endotransgluc...    350   6e-115   
ref|XP_003601713.1|  Xyloglucan endotransglycosylase/hydrolase XT...    349   7e-115   
ref|XP_003601714.1|  Xyloglucan endotransglycosylase/hydrolase XT...    349   7e-115   
ref|XP_007154784.1|  hypothetical protein PHAVU_003G147700g             349   7e-115   
ref|XP_006453420.1|  hypothetical protein CICLE_v10008778mg             352   9e-115   
gb|AFK33537.1|  unknown                                                 349   1e-114   
ref|XP_008223658.1|  PREDICTED: probable xyloglucan endotransgluc...    349   1e-114   
ref|XP_010259797.1|  PREDICTED: xyloglucan endotransglucosylase/h...    349   1e-114   
gb|AGI42451.1|  xyloglucan endotransglycosylase/hydrolase               349   1e-114   
ref|XP_004140250.1|  PREDICTED: probable xyloglucan endotransgluc...    348   1e-114   
ref|NP_001284443.1|  probable xyloglucan endotransglucosylase/hyd...    348   1e-114   
gb|AII99393.1|  xyloglucan endotransglucosylase/hydrolase2              348   1e-114   
ref|XP_006474155.1|  PREDICTED: probable xyloglucan endotransgluc...    348   1e-114   
ref|XP_002526228.1|  Xyloglucan endotransglucosylase/hydrolase pr...    348   1e-114   Ricinus communis
gb|AFP93557.1|  xyloglucan endotransglycosylase/hydrolase 1             348   2e-114   
ref|XP_010023598.1|  PREDICTED: brassinosteroid-regulated protein...    349   2e-114   
gb|AGI42460.1|  xyloglucan endotransglycosylase/hydrolase               348   2e-114   
gb|AGI42449.1|  xyloglucan endotransglycosylase/hydrolase               348   2e-114   
ref|XP_002324480.1|  xyloglucan endo-1 family protein                   348   2e-114   Populus trichocarpa [western balsam poplar]
ref|XP_007223211.1|  hypothetical protein PRUPE_ppa009346mg             348   2e-114   
gb|KGN47997.1|  hypothetical protein Csa_6G423390                       348   2e-114   
ref|XP_010046997.1|  PREDICTED: probable xyloglucan endotransgluc...    348   2e-114   
gb|AGI42456.1|  xyloglucan endotransglycosylase/hydrolase               348   2e-114   
ref|XP_010046992.1|  PREDICTED: probable xyloglucan endotransgluc...    348   2e-114   
ref|XP_010656826.1|  PREDICTED: probable xyloglucan endotransgluc...    348   3e-114   
ref|XP_007014171.1|  Xyloglucan endotransglucosylase/hydrolase fa...    348   3e-114   
ref|XP_002869654.1|  hypothetical protein ARALYDRAFT_354208             348   3e-114   
ref|XP_006412727.1|  hypothetical protein EUTSA_v10025941mg             347   3e-114   
ref|XP_002273742.2|  PREDICTED: probable xyloglucan endotransgluc...    348   3e-114   Vitis vinifera
ref|XP_010670335.1|  PREDICTED: probable xyloglucan endotransgluc...    348   4e-114   
ref|XP_004164863.1|  PREDICTED: brassinosteroid-regulated protein...    348   4e-114   
ref|XP_010259798.1|  PREDICTED: probable xyloglucan endotransgluc...    348   4e-114   
ref|XP_010488450.1|  PREDICTED: probable xyloglucan endotransgluc...    348   4e-114   
gb|AAQ82628.1|  xyloglucan endotransglucosylase                         347   4e-114   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011018193.1|  PREDICTED: probable xyloglucan endotransgluc...    347   4e-114   
ref|XP_002321087.1|  brassinosteroid-regulated family protein           347   4e-114   Populus trichocarpa [western balsam poplar]
ref|NP_194311.1|  probable xyloglucan endotransglucosylase/hydrol...    347   5e-114   Arabidopsis thaliana [mouse-ear cress]
gb|AFK40376.1|  unknown                                                 348   5e-114   
ref|XP_011016106.1|  PREDICTED: brassinosteroid-regulated protein...    347   5e-114   
gb|AAM61021.1|  xyloglucan endotransglycosylase, putative               347   5e-114   Arabidopsis thaliana [mouse-ear cress]
gb|AGI42458.1|  xyloglucan endotransglycosylase/hydrolase               347   6e-114   
emb|CDX68640.1|  BnaC01g08130D                                          347   6e-114   
gb|KHG05436.1|  putative xyloglucan endotransglucosylase/hydrolas...    347   6e-114   
gb|AAF80591.1|AF223420_1  xyloglucan endotransglycosylase XET2          347   8e-114   Asparagus officinalis
ref|XP_009127941.1|  PREDICTED: xyloglucan endotransglucosylase/h...    347   9e-114   
ref|XP_009360814.1|  PREDICTED: brassinosteroid-regulated protein...    347   9e-114   
gb|KDP36435.1|  hypothetical protein JCGZ_08704                         347   1e-113   
ref|XP_011043999.1|  PREDICTED: probable xyloglucan endotransgluc...    347   1e-113   
gb|AGI42454.1|  xyloglucan endotransglycosylase/hydrolase               346   1e-113   
gb|AGI42450.1|  xyloglucan endotransglycosylase/hydrolase               346   1e-113   
ref|XP_011043998.1|  PREDICTED: probable xyloglucan endotransgluc...    347   1e-113   
ref|XP_006474161.1|  PREDICTED: probable xyloglucan endotransgluc...    346   1e-113   
ref|NP_001267702.1|  probable xyloglucan endotransglucosylase/hyd...    346   1e-113   
dbj|BAJ10423.1|  xyloglucan endotransglucosylase/hydrolase              346   1e-113   
ref|XP_010047002.1|  PREDICTED: probable xyloglucan endotransgluc...    346   1e-113   
gb|AII99392.1|  xyloglucan endotransglucosylase/hydrolase2              346   1e-113   
gb|AAL32550.1|  xyloglucan endo-1, 4-beta-D-glucanase (XTR-6)           346   2e-113   Arabidopsis thaliana [mouse-ear cress]
gb|ACD03218.1|  xyloglucan endotransglucosylase/hydrolase 8             346   2e-113   Actinidia deliciosa [Chinese gooseberry]
gb|AGI42459.1|  xyloglucan endotransglycosylase/hydrolase               346   2e-113   
ref|XP_002274858.1|  PREDICTED: xyloglucan endotransglucosylase/h...    346   2e-113   Vitis vinifera
gb|AEQ37175.1|  xyloglucan endotransglucosylase/hydrolase               346   2e-113   
ref|XP_011044000.1|  PREDICTED: probable xyloglucan endotransgluc...    346   2e-113   
ref|XP_002324481.2|  xyloglucan endo-1 family protein                   345   2e-113   Populus trichocarpa [western balsam poplar]
gb|AGI42461.1|  xyloglucan endotransglycosylase/hydrolase               345   2e-113   
ref|XP_010046996.1|  PREDICTED: probable xyloglucan endotransgluc...    346   2e-113   
ref|XP_009356706.1|  PREDICTED: xyloglucan endotransglucosylase/h...    345   3e-113   
ref|XP_010053241.1|  PREDICTED: brassinosteroid-regulated protein...    345   3e-113   
ref|XP_010545425.1|  PREDICTED: probable xyloglucan endotransgluc...    345   3e-113   
ref|NP_001237075.1|  syringolide-induced protein 19-1-5 precursor       345   3e-113   
gb|ABM91071.1|  xyloglucan endotransglycosylase/hydrolase precurs...    345   3e-113   Populus tremula x Populus tremuloides
dbj|BAJ10395.1|  xyloglucan endotransglucosylase/hydrolase              345   4e-113   
emb|CDY61576.1|  BnaCnng38050D                                          345   4e-113   
gb|KHN22714.1|  Putative xyloglucan endotransglucosylase/hydrolas...    345   4e-113   
ref|XP_009378317.1|  PREDICTED: xyloglucan endotransglucosylase/h...    345   4e-113   
ref|XP_010259807.1|  PREDICTED: probable xyloglucan endotransgluc...    345   5e-113   
ref|XP_008362366.1|  PREDICTED: LOW QUALITY PROTEIN: xyloglucan e...    345   6e-113   
ref|XP_010670334.1|  PREDICTED: probable xyloglucan endotransgluc...    344   6e-113   
ref|NP_001242530.1|  uncharacterized protein LOC100785313 precursor     344   6e-113   
ref|XP_006387118.1|  hypothetical protein POPTR_1795s00200g             342   6e-113   
ref|XP_009373581.1|  PREDICTED: brassinosteroid-regulated protein...    344   6e-113   
ref|XP_010046998.1|  PREDICTED: probable xyloglucan endotransgluc...    345   7e-113   
ref|XP_002267890.2|  PREDICTED: brassinosteroid-regulated protein...    344   7e-113   Vitis vinifera
ref|XP_003610142.1|  Xyloglucan endotransglucosylase/hydrolase          344   7e-113   
ref|XP_009139558.1|  PREDICTED: probable xyloglucan endotransgluc...    344   7e-113   
gb|KCW89704.1|  hypothetical protein EUGRSUZ_A01966                     344   7e-113   
ref|XP_004293370.1|  PREDICTED: probable xyloglucan endotransgluc...    344   8e-113   
ref|XP_010046993.1|  PREDICTED: probable xyloglucan endotransgluc...    344   9e-113   
ref|XP_010103020.1|  Xyloglucan endotransglucosylase/hydrolase pr...    344   9e-113   
ref|XP_002274601.1|  PREDICTED: probable xyloglucan endotransgluc...    344   9e-113   Vitis vinifera
gb|KHN22712.1|  Putative xyloglucan endotransglucosylase/hydrolas...    344   1e-112   
gb|ABP04059.1|  xyloglucan endo-transglucosylase/hydrolase 1            344   1e-112   
dbj|BAE06063.1|  xyloglucan endotransglucosylase/hydrolase              345   1e-112   Sagittaria pygmaea
emb|CAN80250.1|  hypothetical protein VITISV_036640                     343   1e-112   Vitis vinifera
gb|AIJ10712.1|  xyloglucan endotransglucosylase/hydrolase 3             343   2e-112   
ref|XP_010536922.1|  PREDICTED: probable xyloglucan endotransgluc...    343   2e-112   
emb|CDX94413.1|  BnaC01g17710D                                          343   2e-112   
emb|CAN74784.1|  hypothetical protein VITISV_032594                     343   2e-112   Vitis vinifera
ref|XP_003542156.1|  PREDICTED: probable xyloglucan endotransgluc...    343   2e-112   
ref|XP_009628113.1|  PREDICTED: brassinosteroid-regulated protein...    343   2e-112   
ref|XP_010927056.1|  PREDICTED: probable xyloglucan endotransgluc...    343   2e-112   
ref|XP_009765042.1|  PREDICTED: brassinosteroid-regulated protein...    342   2e-112   
ref|XP_003625289.1|  Xyloglucan endotransglucosylase/hydrolase          343   2e-112   
ref|XP_010259802.1|  PREDICTED: probable xyloglucan endotransgluc...    343   2e-112   
gb|KCW78734.1|  hypothetical protein EUGRSUZ_C00178                     345   2e-112   
ref|XP_010047000.1|  PREDICTED: probable xyloglucan endotransgluc...    343   3e-112   
ref|XP_007035759.1|  Xyloglucan endotransglucosylase/hydrolase fa...    343   3e-112   
ref|XP_003542166.1|  PREDICTED: xyloglucan endotransglucosylase/h...    343   3e-112   
ref|XP_010525738.1|  PREDICTED: xyloglucan endotransglucosylase/h...    342   3e-112   
emb|CAA63663.1|  xyloglucan endotransglycosylase (XET)                  343   3e-112   Hordeum vulgare [barley]
gb|EYU29579.1|  hypothetical protein MIMGU_mgv1a018742mg                342   3e-112   
gb|ACD03232.1|  xyloglucan endotransglucosylase/hydrolase 8             342   4e-112   Malus domestica [apple tree]
ref|XP_010103016.1|  putative xyloglucan endotransglucosylase/hyd...    342   4e-112   
gb|KCW78732.1|  hypothetical protein EUGRSUZ_C00176                     347   5e-112   
ref|XP_008380219.1|  PREDICTED: xyloglucan endotransglucosylase/h...    342   5e-112   
ref|XP_010927058.1|  PREDICTED: probable xyloglucan endotransgluc...    343   5e-112   
ref|XP_002270416.1|  PREDICTED: probable xyloglucan endotransgluc...    342   5e-112   Vitis vinifera
ref|NP_001276139.1|  uncharacterized protein LOC102661404 precursor     342   5e-112   
gb|AEX07595.1|  xyloglucosyl transferase 2                              341   5e-112   
emb|CAN80252.1|  hypothetical protein VITISV_036642                     342   6e-112   Vitis vinifera
ref|XP_006284247.1|  hypothetical protein CARUB_v10005412mg             342   8e-112   
dbj|BAO57276.1|  xyloglucan endotransglucosylase/hydrolase              341   8e-112   
ref|XP_004507835.1|  PREDICTED: probable xyloglucan endotransgluc...    342   1e-111   
ref|XP_002270299.1|  PREDICTED: probable xyloglucan endotransgluc...    341   1e-111   
ref|XP_010668001.1|  PREDICTED: probable xyloglucan endotransgluc...    341   1e-111   
ref|XP_003524918.1|  PREDICTED: brassinosteroid-regulated protein...    341   1e-111   
ref|XP_010448365.1|  PREDICTED: probable xyloglucan endotransgluc...    341   1e-111   
ref|XP_004507837.1|  PREDICTED: probable xyloglucan endotransgluc...    341   1e-111   
gb|AEL33281.1|  brassinosteroid-regulated protein                       341   1e-111   
ref|XP_011038986.1|  PREDICTED: probable xyloglucan endotransgluc...    341   1e-111   
ref|XP_010911439.1|  PREDICTED: probable xyloglucan endotransgluc...    341   1e-111   
ref|XP_006656424.1|  PREDICTED: xyloglucan endotransglucosylase/h...    341   1e-111   
ref|XP_004507836.1|  PREDICTED: probable xyloglucan endotransgluc...    341   2e-111   
ref|XP_011045332.1|  PREDICTED: brassinosteroid-regulated protein...    341   2e-111   
gb|ACD03219.1|  xyloglucan endotransglucosylase/hydrolase 9             341   2e-111   
dbj|BAH36874.1|  xyloglucan endotransglucosylase/hydrolase              341   2e-111   
ref|XP_002307040.2|  xyloglucan endo-1 family protein                   340   2e-111   
ref|XP_004235156.1|  PREDICTED: probable xyloglucan endotransgluc...    341   2e-111   
ref|XP_011006106.1|  PREDICTED: brassinosteroid-regulated protein...    340   2e-111   
gb|AFR46580.2|  xyloglucan endotransglucosylase/hydrolase 12            340   2e-111   
ref|XP_010259808.1|  PREDICTED: xyloglucan endotransglucosylase/h...    341   2e-111   
gb|AAT94297.1|  endotransglucosylase/hydrolase XTH5                     340   2e-111   
ref|XP_002274552.1|  PREDICTED: probable xyloglucan endotransgluc...    341   2e-111   
gb|EMT27816.1|  Putative xyloglucan endotransglucosylase/hydrolas...    340   2e-111   
gb|KFK29589.1|  hypothetical protein AALP_AA7G154000                    340   3e-111   
gb|KHG10045.1|  Xyloglucan endotransglucosylase/hydrolase 22 -lik...    340   3e-111   
ref|XP_007154781.1|  hypothetical protein PHAVU_003G147400g             340   3e-111   
ref|XP_002317310.1|  xyloglucan endo-1 family protein                   340   3e-111   
ref|NP_001267579.1|  probable xyloglucan endotransglucosylase/hyd...    340   3e-111   
ref|NP_001281042.1|  probable xyloglucan endotransglucosylase/hyd...    340   3e-111   
ref|XP_009108993.1|  PREDICTED: xyloglucan endotransglucosylase/h...    340   4e-111   
ref|XP_010103015.1|  putative xyloglucan endotransglucosylase/hyd...    340   4e-111   
ref|NP_001234472.1|  xyloglucan endotransglucosylase-hydrolase XT...    340   4e-111   
gb|ABK30789.1|  xyloglucan endotransglycosylase 3                       339   4e-111   
ref|NP_001289204.1|  probable xyloglucan endotransglucosylase/hyd...    339   5e-111   
ref|XP_011026281.1|  PREDICTED: brassinosteroid-regulated protein...    340   5e-111   
gb|KHN22640.1|  Putative xyloglucan endotransglucosylase/hydrolas...    339   5e-111   
gb|ABE11608.1|  xyloglucan endo-transglycosylase precursor              339   6e-111   
ref|XP_011043991.1|  PREDICTED: xyloglucan endotransglucosylase/h...    340   6e-111   
ref|XP_002318936.2|  putative xyloglucan endotransglycosylase fam...    340   7e-111   
ref|XP_006412723.1|  hypothetical protein EUTSA_v10025933mg             339   8e-111   
emb|CDX72228.1|  BnaC07g42500D                                          339   9e-111   
ref|XP_003549490.2|  PREDICTED: probable xyloglucan endotransgluc...    339   9e-111   
ref|XP_007014183.1|  Xyloglucan endotransglycosylase 6                  339   1e-110   
ref|XP_009793860.1|  PREDICTED: probable xyloglucan endotransgluc...    338   1e-110   
ref|XP_009137907.1|  PREDICTED: xyloglucan endotransglucosylase/h...    338   1e-110   
ref|XP_004247897.1|  PREDICTED: brassinosteroid-regulated protein...    338   1e-110   
ref|XP_009609044.1|  PREDICTED: probable xyloglucan endotransgluc...    338   1e-110   
ref|XP_011069896.1|  PREDICTED: probable xyloglucan endotransgluc...    339   1e-110   
gb|EYU37336.1|  hypothetical protein MIMGU_mgv1a021219mg                338   1e-110   
ref|XP_008453618.1|  PREDICTED: probable xyloglucan endotransgluc...    341   1e-110   
ref|XP_008796499.1|  PREDICTED: xyloglucan endotransglucosylase/h...    338   1e-110   
ref|XP_006358262.1|  PREDICTED: probable xyloglucan endotransgluc...    338   1e-110   
ref|XP_003630685.1|  Xyloglucan endotransglycosylase                    338   1e-110   
ref|XP_010042670.1|  PREDICTED: brassinosteroid-regulated protein...    338   1e-110   
ref|XP_006358761.1|  PREDICTED: brassinosteroid-regulated protein...    338   2e-110   
gb|ACU23820.1|  unknown                                                 338   2e-110   
ref|XP_010103019.1|  putative xyloglucan endotransglucosylase/hyd...    338   2e-110   
ref|XP_004235158.1|  PREDICTED: probable xyloglucan endotransgluc...    338   2e-110   
ref|XP_010676725.1|  PREDICTED: probable xyloglucan endotransgluc...    338   2e-110   
ref|XP_009343827.1|  PREDICTED: brassinosteroid-regulated protein...    338   2e-110   
ref|XP_006358261.1|  PREDICTED: probable xyloglucan endotransgluc...    338   2e-110   
ref|XP_003563483.1|  PREDICTED: xyloglucan endotransglucosylase/h...    338   2e-110   
ref|XP_010259803.1|  PREDICTED: probable xyloglucan endotransgluc...    338   2e-110   
ref|XP_008801540.1|  PREDICTED: probable xyloglucan endotransgluc...    337   2e-110   
ref|NP_001242489.1|  uncharacterized protein LOC100807063 precursor     338   2e-110   
ref|XP_007163801.1|  hypothetical protein PHAVU_001G265300g             338   2e-110   
ref|NP_001058455.2|  Os06g0696400                                       337   2e-110   
ref|XP_007224386.1|  hypothetical protein PRUPE_ppa021675mg             338   3e-110   
dbj|BAH36875.1|  xyloglucan endotransglucosylase/hydrolase              338   3e-110   
ref|XP_002270973.2|  PREDICTED: brassinosteroid-regulated protein...    338   3e-110   
ref|XP_009759293.1|  PREDICTED: xyloglucan endotransglucosylase/h...    337   3e-110   
ref|XP_008801408.1|  PREDICTED: probable xyloglucan endotransgluc...    337   4e-110   
ref|XP_010526338.1|  PREDICTED: probable xyloglucan endotransgluc...    338   4e-110   
gb|EYU20918.1|  hypothetical protein MIMGU_mgv1a011123mg                337   4e-110   
gb|KHG09882.1|  Xyloglucan endotransglucosylase/hydrolase 22 -lik...    337   4e-110   
gb|ABM91073.1|  xyloglucan endotransglycosylase/hydrolase precurs...    337   5e-110   
ref|XP_011082928.1|  PREDICTED: probable xyloglucan endotransgluc...    337   5e-110   
ref|XP_002274827.1|  PREDICTED: probable xyloglucan endotransgluc...    337   5e-110   
ref|XP_008229406.1|  PREDICTED: probable xyloglucan endotransgluc...    337   6e-110   
ref|XP_007014179.1|  Xyloglucan endotransglycosylase 6 isoform 1        337   6e-110   
ref|XP_003552612.1|  PREDICTED: brassinosteroid-regulated protein...    337   7e-110   
ref|XP_011082931.1|  PREDICTED: probable xyloglucan endotransgluc...    337   8e-110   
ref|XP_004293368.1|  PREDICTED: probable xyloglucan endotransgluc...    336   9e-110   
ref|XP_009798276.1|  PREDICTED: xyloglucan endotransglucosylase/h...    336   1e-109   
ref|XP_006360667.1|  PREDICTED: probable xyloglucan endotransgluc...    336   1e-109   
gb|ADV41673.1|  endo-xyloglucan transferase                             336   1e-109   
gb|EYU41110.1|  hypothetical protein MIMGU_mgv1a011456mg                336   1e-109   
ref|XP_004966138.1|  PREDICTED: probable xyloglucan endotransgluc...    336   1e-109   
ref|XP_009394877.1|  PREDICTED: probable xyloglucan endotransgluc...    336   1e-109   
ref|XP_004235157.1|  PREDICTED: probable xyloglucan endotransgluc...    336   1e-109   
ref|XP_004298224.1|  PREDICTED: brassinosteroid-regulated protein...    339   1e-109   
ref|XP_002270182.2|  PREDICTED: probable xyloglucan endotransgluc...    339   1e-109   
ref|XP_008380453.1|  PREDICTED: brassinosteroid-regulated protein...    335   1e-109   
ref|XP_002519768.1|  Brassinosteroid-regulated protein BRU1 precu...    335   1e-109   
ref|XP_006358259.1|  PREDICTED: probable xyloglucan endotransgluc...    336   1e-109   
ref|XP_002325068.2|  hypothetical protein POPTR_0018s10300g             336   2e-109   
ref|XP_010927057.1|  PREDICTED: probable xyloglucan endotransgluc...    335   2e-109   
ref|XP_009413334.1|  PREDICTED: xyloglucan endotransglucosylase/h...    335   2e-109   
gb|KHN44468.1|  Brassinosteroid-regulated protein BRU1                  335   2e-109   
ref|XP_007159516.1|  hypothetical protein PHAVU_002G244000g             336   2e-109   
ref|XP_002267838.1|  PREDICTED: brassinosteroid-regulated protein...    335   2e-109   
emb|CAN83588.1|  hypothetical protein VITISV_004806                     335   2e-109   
ref|XP_010442224.1|  PREDICTED: xyloglucan endotransglucosylase/h...    335   2e-109   
gb|KDP32580.1|  hypothetical protein JCGZ_13130                         335   2e-109   
ref|XP_009401564.1|  PREDICTED: probable xyloglucan endotransgluc...    335   2e-109   
ref|XP_009381589.1|  PREDICTED: xyloglucan endotransglucosylase/h...    335   2e-109   
gb|EYU25733.1|  hypothetical protein MIMGU_mgv1a011641mg                335   2e-109   
ref|XP_008801539.1|  PREDICTED: probable xyloglucan endotransgluc...    335   3e-109   
ref|XP_003524219.1|  PREDICTED: probable xyloglucan endotransgluc...    335   3e-109   
ref|XP_010482054.1|  PREDICTED: xyloglucan endotransglucosylase/h...    335   3e-109   
emb|CDP02962.1|  unnamed protein product                                335   3e-109   
ref|XP_010439278.1|  PREDICTED: xyloglucan endotransglucosylase/h...    335   3e-109   
ref|XP_002262761.1|  PREDICTED: brassinosteroid-regulated protein...    335   3e-109   
ref|XP_010241684.1|  PREDICTED: probable xyloglucan endotransgluc...    335   3e-109   
ref|XP_010433588.1|  PREDICTED: probable xyloglucan endotransgluc...    335   3e-109   
gb|KHN06450.1|  Putative xyloglucan endotransglucosylase/hydrolas...    335   3e-109   
ref|NP_199618.1|  xyloglucan endotransglucosylase/hydrolase prote...    335   3e-109   
ref|XP_004299791.1|  PREDICTED: probable xyloglucan endotransgluc...    335   3e-109   
ref|NP_001238152.1|  xyloglucan endotransglucosylase/hydrolase 2 ...    335   3e-109   
ref|XP_010932220.1|  PREDICTED: xyloglucan endotransglucosylase/h...    335   3e-109   
dbj|BAD53910.1|  putative xyloglucan endotransglycosylase               335   3e-109   
ref|XP_004966141.1|  PREDICTED: xyloglucan endotransglucosylase/h...    335   4e-109   
gb|KHG21666.1|  putative xyloglucan endotransglucosylase/hydrolas...    334   4e-109   
gb|KDP36430.1|  hypothetical protein JCGZ_08699                         335   5e-109   
ref|XP_002863854.1|  ATXTH20                                            334   5e-109   
gb|KDP36436.1|  hypothetical protein JCGZ_08705                         335   6e-109   
gb|AHB60658.1|  xyloglucan endotransglucosylase/hydrolase               334   6e-109   
ref|XP_011070177.1|  PREDICTED: xyloglucan endotransglucosylase/h...    335   6e-109   
ref|XP_009344503.1|  PREDICTED: probable xyloglucan endotransgluc...    334   6e-109   
ref|NP_001276167.1|  uncharacterized protein LOC100784191 precursor     334   7e-109   
ref|XP_008223719.1|  PREDICTED: xyloglucan endotransglucosylase/h...    335   7e-109   
ref|XP_002867358.1|  meristem-5                                         333   7e-109   
gb|KHG04746.1|  putative xyloglucan endotransglucosylase/hydrolas...    334   7e-109   
ref|XP_006279674.1|  hypothetical protein CARUB_v10026912mg             334   9e-109   
ref|XP_009614968.1|  PREDICTED: xyloglucan endotransglucosylase/h...    334   9e-109   
ref|XP_011023833.1|  PREDICTED: probable xyloglucan endotransgluc...    335   1e-108   
ref|XP_006358260.1|  PREDICTED: probable xyloglucan endotransgluc...    333   1e-108   
ref|XP_002266082.1|  PREDICTED: brassinosteroid-regulated protein...    333   1e-108   
ref|XP_009390494.1|  PREDICTED: probable xyloglucan endotransgluc...    333   1e-108   
ref|XP_002518632.1|  Brassinosteroid-regulated protein BRU1 precu...    333   1e-108   
ref|XP_002526224.1|  Xyloglucan endotransglucosylase/hydrolase pr...    334   1e-108   
ref|XP_003610008.1|  Xyloglucan endotransglucosylase/hydrolase          333   1e-108   
gb|KDP42857.1|  hypothetical protein JCGZ_23799                         333   1e-108   
gb|AGT29357.1|  xyloglucan endotransglucosylase/hydrolase 7             333   1e-108   
ref|XP_008223655.1|  PREDICTED: xyloglucan endotransglucosylase/h...    333   1e-108   
ref|XP_007154667.1|  hypothetical protein PHAVU_003G137600g             333   2e-108   
ref|XP_009417169.1|  PREDICTED: probable xyloglucan endotransgluc...    333   2e-108   
ref|XP_007015526.1|  Xyloglucan endotransglycosylase 6                  333   2e-108   
ref|XP_003532776.1|  PREDICTED: probable xyloglucan endotransgluc...    333   2e-108   
gb|ABV46534.1|  xyloglucan endotransglucosylase hydrolase 2             333   2e-108   
ref|XP_004146309.1|  PREDICTED: xyloglucan endotransglucosylase/h...    333   2e-108   
ref|XP_010690581.1|  PREDICTED: probable xyloglucan endotransgluc...    332   2e-108   
ref|XP_009626663.1|  PREDICTED: probable xyloglucan endotransgluc...    332   2e-108   
ref|XP_010929301.1|  PREDICTED: xyloglucan endotransglucosylase/h...    333   2e-108   
ref|XP_006358258.1|  PREDICTED: probable xyloglucan endotransgluc...    333   2e-108   
gb|KEH20644.1|  xyloglucan endotransglucosylase/hydrolase family ...    333   2e-108   
ref|XP_009341028.1|  PREDICTED: probable xyloglucan endotransgluc...    333   3e-108   
ref|XP_004293369.1|  PREDICTED: probable xyloglucan endotransgluc...    333   3e-108   
ref|XP_007221284.1|  hypothetical protein PRUPE_ppa009792mg             332   3e-108   
ref|XP_011045330.1|  PREDICTED: brassinosteroid-regulated protein...    332   3e-108   
ref|XP_002317309.1|  xyloglucan endo-1 family protein                   332   3e-108   
ref|XP_004161045.1|  PREDICTED: xyloglucan endotransglucosylase/h...    332   4e-108   
gb|AGT29355.1|  xyloglucan endotransglucosylase/hydrolase 5             332   4e-108   
ref|XP_010095128.1|  putative xyloglucan endotransglucosylase/hyd...    344   4e-108   
gb|ACK36945.1|  xyloglucan endotransglycosylase                         332   5e-108   
ref|NP_001284442.1|  xyloglucan endotransglucosylase/hydrolase pr...    332   5e-108   
ref|XP_011043995.1|  PREDICTED: xyloglucan endotransglucosylase/h...    332   5e-108   
dbj|BAO57275.1|  xyloglucan endotransglucosylase/hydrolase              332   6e-108   
ref|XP_002325067.2|  hypothetical protein POPTR_0018s10290g             332   6e-108   
ref|XP_011043994.1|  PREDICTED: xyloglucan endotransglucosylase/h...    332   6e-108   
ref|XP_010039803.1|  PREDICTED: probable xyloglucan endotransgluc...    332   6e-108   
ref|NP_194756.1|  xyloglucan endotransglucosylase/hydrolase prote...    331   8e-108   
ref|XP_011007580.1|  PREDICTED: probable xyloglucan endotransgluc...    331   9e-108   
ref|XP_006349901.1|  PREDICTED: brassinosteroid-regulated protein...    331   1e-107   
ref|XP_004309952.1|  PREDICTED: xyloglucan endotransglucosylase/h...    331   1e-107   
gb|ABL10090.1|  xyloglucan endotransglycosylase                         331   1e-107   
emb|CAA10231.1|  xyloglucan endotransglycosylase 1                      331   1e-107   
gb|ABD98046.1|  xyloglucan endotransglycosylase                         331   1e-107   
ref|XP_002274404.1|  PREDICTED: brassinosteroid-regulated protein...    331   1e-107   
gb|EYU38970.1|  hypothetical protein MIMGU_mgv1a011611mg                330   1e-107   
gb|AFK40018.1|  unknown                                                 331   1e-107   
ref|XP_008799439.1|  PREDICTED: probable xyloglucan endotransgluc...    331   1e-107   
ref|XP_009760620.1|  PREDICTED: probable xyloglucan endotransgluc...    330   1e-107   
ref|XP_010545428.1|  PREDICTED: xyloglucan endotransglucosylase/h...    331   1e-107   
gb|ACJ84668.1|  unknown                                                 331   1e-107   
ref|XP_008222773.1|  PREDICTED: brassinosteroid-regulated protein...    330   1e-107   
ref|XP_004240131.2|  PREDICTED: probable xyloglucan endotransgluc...    331   1e-107   
ref|XP_011007582.1|  PREDICTED: probable xyloglucan endotransgluc...    331   1e-107   
ref|NP_001151103.1|  xyloglucan endotransglucosylase/hydrolase pr...    331   2e-107   
ref|XP_004252976.1|  PREDICTED: brassinosteroid-regulated protein...    330   2e-107   
ref|XP_009344504.1|  PREDICTED: xyloglucan endotransglucosylase/h...    331   2e-107   
gb|AFK47685.1|  unknown                                                 330   2e-107   
ref|XP_009341025.1|  PREDICTED: xyloglucan endotransglucosylase/h...    330   3e-107   
ref|XP_002302145.2|  hypothetical protein POPTR_0002s06120g             333   3e-107   
ref|XP_011045331.1|  PREDICTED: brassinosteroid-regulated protein...    329   3e-107   
gb|KHN48042.1|  Putative xyloglucan endotransglucosylase/hydrolas...    330   3e-107   
gb|AFK33604.1|  unknown                                                 330   3e-107   
emb|CDY66832.1|  BnaAnng23050D                                          329   3e-107   
ref|XP_007223160.1|  hypothetical protein PRUPE_ppa009417mg             330   4e-107   
ref|XP_006600497.1|  PREDICTED: probable xyloglucan endotransgluc...    330   4e-107   
ref|XP_008223830.1|  PREDICTED: probable xyloglucan endotransgluc...    329   5e-107   
ref|XP_007222107.1|  hypothetical protein PRUPE_ppa009610mg             329   5e-107   
ref|XP_010527137.1|  PREDICTED: probable xyloglucan endotransgluc...    328   5e-107   
ref|XP_011069899.1|  PREDICTED: probable xyloglucan endotransgluc...    329   5e-107   
ref|XP_008799438.1|  PREDICTED: probable xyloglucan endotransgluc...    329   5e-107   
ref|XP_003595145.1|  Xyloglucan endotransglucosylase/hydrolase          330   5e-107   
ref|XP_002438936.1|  hypothetical protein SORBIDRAFT_10g028580          330   6e-107   
gb|AAM63080.1|  xyloglucan endo-1,4-beta-D-glucanase precursor          328   6e-107   
ref|XP_009798277.1|  PREDICTED: probable xyloglucan endotransgluc...    329   6e-107   
ref|XP_010438197.1|  PREDICTED: xyloglucan endotransglucosylase/h...    328   7e-107   
ref|XP_010433006.1|  PREDICTED: xyloglucan endotransglucosylase/h...    328   8e-107   
ref|XP_010667998.1|  PREDICTED: probable xyloglucan endotransgluc...    329   8e-107   
emb|CDY14905.1|  BnaA02g22470D                                          328   9e-107   
ref|XP_006474160.1|  PREDICTED: xyloglucan endotransglucosylase/h...    329   9e-107   
ref|XP_007014176.1|  Xyloglucan endotransglycosylase 6                  329   1e-106   
ref|XP_008453623.1|  PREDICTED: xyloglucan endotransglucosylase/h...    329   1e-106   
ref|XP_004165696.1|  PREDICTED: xyloglucan endotransglucosylase/h...    328   1e-106   
emb|CDY39193.1|  BnaA03g50050D                                          328   1e-106   
ref|XP_009390493.1|  PREDICTED: probable xyloglucan endotransgluc...    328   1e-106   
ref|XP_008223656.1|  PREDICTED: xyloglucan endotransglucosylase/h...    328   2e-106   



>ref|XP_009762863.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Nicotiana 
sylvestris]
Length=290

 Score =   414 bits (1064),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 199/302 (66%), Positives = 236/302 (78%), Gaps = 13/302 (4%)
 Frame = +2

Query  131   AGKMKKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTM  310
             A K       +C+IM I ++A S             NF  D  + +G   G++Q+ G  +
Sbjct  2     ASKFSSVMLLLCIIMSIQLLAAS-----------AGNFYRDAVITWGEGRGKIQEGGRGL  50

Query  311   ALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLG  490
             AL LD+ +GSGF +KNEYLFGRFDMQ+KLV G SAGTVTTF+L+S  G+ HDE+DFEFLG
Sbjct  51    ALTLDKLSGSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFFLSSQ-GEGHDEIDFEFLG  109

Query  491   NATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFN  670
             N + QPYTVHTNVY+QGKGNKEQQFHLWFDPTAAFHTYTI+WNP RI+F+VDN+PIRV+N
Sbjct  110   NVSGQPYTVHTNVYTQGKGNKEQQFHLWFDPTAAFHTYTIVWNPHRIVFLVDNSPIRVYN  169

Query  671   NHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNG  850
             NHESIGIPFPKSQ MRVYCSLWNAD+WATQGG VKTDW+ APFTAYYRN N + C V +G
Sbjct  170   NHESIGIPFPKSQAMRVYCSLWNADEWATQGGRVKTDWTLAPFTAYYRNINIDGCAVLSG  229

Query  851   VsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRS  1030
               S    + ++N+ + W T ELDGKGRNR+RWVQS+HMVYNYCAD+KRFPQGFSAECK S
Sbjct  230   T-SSCKSSNSANNAKPWQTHELDGKGRNRLRWVQSRHMVYNYCADSKRFPQGFSAECKSS  288

Query  1031  RF  1036
             RF
Sbjct  289   RF  290



>ref|XP_009598225.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Nicotiana 
tomentosiformis]
Length=290

 Score =   412 bits (1060),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 197/302 (65%), Positives = 236/302 (78%), Gaps = 13/302 (4%)
 Frame = +2

Query  131   AGKMKKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTM  310
             A K       +C++M I ++A S             NF  D  + +G   G++Q+ G  +
Sbjct  2     ASKFSSAMLLLCILMSIQLLAAS-----------AGNFYGDTVITWGEGRGKIQEGGRGL  50

Query  311   ALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLG  490
             AL LD+ +GSGF +KNEYLFGRFDMQ+KLV G SAGTVTTF+L+S  G+ HDE+DFEFLG
Sbjct  51    ALTLDKLSGSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFFLSSQ-GEGHDEIDFEFLG  109

Query  491   NATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFN  670
             N + QPYTVHTNVY+QGKGNKEQQFHLWFDPTAAFHTYTI+WNP RI+F+VDN+PIRV+N
Sbjct  110   NVSGQPYTVHTNVYTQGKGNKEQQFHLWFDPTAAFHTYTIVWNPHRIVFLVDNSPIRVYN  169

Query  671   NHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNG  850
             NHE+IGIPFPKSQ MRVYCSLWNAD+WATQGG VKTDW+ APFTAYYRN N + C V +G
Sbjct  170   NHENIGIPFPKSQAMRVYCSLWNADEWATQGGRVKTDWTLAPFTAYYRNINIDGCAVLSG  229

Query  851   VsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRS  1030
               S    + ++N+ + W T ELDGKGRNR+RWVQS+HMVYNYCAD+KRFPQGFS ECKRS
Sbjct  230   T-SSCKSSNSANNAKPWQTHELDGKGRNRLRWVQSRHMVYNYCADSKRFPQGFSEECKRS  288

Query  1031  RF  1036
             RF
Sbjct  289   RF  290



>ref|XP_009598236.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Nicotiana 
tomentosiformis]
Length=290

 Score =   411 bits (1056),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 196/302 (65%), Positives = 234/302 (77%), Gaps = 13/302 (4%)
 Frame = +2

Query  131   AGKMKKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTM  310
             A K       +C++M I ++A S             NF  D  + +G   G++Q+ G  +
Sbjct  2     ASKFSSAMLLLCILMSIQLLAAS-----------AGNFYRDTVITWGEGRGKIQEGGRGL  50

Query  311   ALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLG  490
             AL LD+ +GSGF +KNEYLFGRFDMQ+KLV G SAGTVTTF+L+S  G+ HDE+DFEFLG
Sbjct  51    ALTLDKLSGSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFFLSSQ-GEGHDEIDFEFLG  109

Query  491   NATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFN  670
             N + QPYTVHTNVY+QGKGNKEQQFHLWFDPTAAFHTY+I+WNP RI+F+VDN+PIRV+N
Sbjct  110   NVSGQPYTVHTNVYTQGKGNKEQQFHLWFDPTAAFHTYSIVWNPHRIVFLVDNSPIRVYN  169

Query  671   NHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNG  850
             NHESIGIPFPKSQ MRVYCSLWNAD+WATQGG +KTDW  APFTAYYRN N + C V  G
Sbjct  170   NHESIGIPFPKSQAMRVYCSLWNADEWATQGGRIKTDWKLAPFTAYYRNINIDGCAVLAG  229

Query  851   VsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRS  1030
               S    + ++N+ + W T ELDGKGRNR+RWVQS+HMVYNYCAD+KRFPQGFSAECK S
Sbjct  230   T-SSCKSSNSANNAKPWQTHELDGKGRNRLRWVQSRHMVYNYCADSKRFPQGFSAECKSS  288

Query  1031  RF  1036
             RF
Sbjct  289   RF  290



>ref|XP_009762866.1| PREDICTED: brassinosteroid-regulated protein BRU1-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009762867.1| PREDICTED: brassinosteroid-regulated protein BRU1-like isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009762869.1| PREDICTED: brassinosteroid-regulated protein BRU1-like isoform 
X3 [Nicotiana sylvestris]
Length=290

 Score =   410 bits (1053),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 196/302 (65%), Positives = 236/302 (78%), Gaps = 13/302 (4%)
 Frame = +2

Query  131   AGKMKKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTM  310
             A K+      + ++M I ++A S             NF  D  + +G   G++Q+ G  +
Sbjct  2     ASKVSTAMLLLSVLMSIQLLAAS-----------AGNFYRDAVITWGEGRGKIQEGGRGL  50

Query  311   ALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLG  490
             AL LD+ +GSGF +KNEYLFGRFDMQ+KLV G SAGTVTTF+L+S  G+ HDE+DFEFLG
Sbjct  51    ALTLDKLSGSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFFLSSQ-GEGHDEIDFEFLG  109

Query  491   NATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFN  670
             N + QPYT+HTNVY+QGKGNKEQQFHLWFDPTAAFHTYTI+WNP RI+F+VDN+PIRV+N
Sbjct  110   NVSGQPYTIHTNVYTQGKGNKEQQFHLWFDPTAAFHTYTIVWNPHRIVFLVDNSPIRVYN  169

Query  671   NHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNG  850
             NHESIGIPFPKSQ MRVYCSLWNAD+WATQGG VKTDW+ APFTAYYRN N + C V +G
Sbjct  170   NHESIGIPFPKSQAMRVYCSLWNADEWATQGGRVKTDWTLAPFTAYYRNINIDGCAVLSG  229

Query  851   VsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRS  1030
               S    + ++N+ + W T ELDGKGRNR+RWVQS+HMVYNYCAD+KRFPQGFSAECK S
Sbjct  230   T-SSCKSSNSANNAKPWQTHELDGKGRNRLRWVQSRHMVYNYCADSKRFPQGFSAECKSS  288

Query  1031  RF  1036
             RF
Sbjct  289   RF  290



>ref|XP_006350014.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16-like [Solanum tuberosum]
Length=290

 Score =   406 bits (1044),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 190/266 (71%), Positives = 225/266 (85%), Gaps = 2/266 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV + +G   G++Q+ G  +AL+LD+ +GSGF +KNE+LFGRFDMQ+KLV   SAG
Sbjct  27    NFYKDVDITWGEGRGKIQEGGRGLALSLDKLSGSGFQSKNEFLFGRFDMQIKLVPENSAG  86

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTF+L+S  G+ HDE+DFEFLGN + QPYT+HTNVY+QGKGNKEQQFHLWFDPTAAFH
Sbjct  87    TVTTFFLSSQ-GEGHDEIDFEFLGNVSGQPYTIHTNVYTQGKGNKEQQFHLWFDPTAAFH  145

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TYTI+WNP RI+F+VDN+PIRVFNNHESIGIPFPKSQ M+VYCSLWNAD+WATQGG VKT
Sbjct  146   TYTIVWNPHRIVFLVDNSPIRVFNNHESIGIPFPKSQAMKVYCSLWNADEWATQGGRVKT  205

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DW+ APFTAYYRN N + C V++G  S      ++N+ + W T ELDGKGRNR+RWVQSK
Sbjct  206   DWALAPFTAYYRNINIDGCAVSSGT-SSCKSIGSTNNAKPWETHELDGKGRNRLRWVQSK  264

Query  959   HMVYNYCADAKRFPQGFSAECKRSRF  1036
             HMVYNYCAD+KRFPQGFSAECK SRF
Sbjct  265   HMVYNYCADSKRFPQGFSAECKSSRF  290



>ref|XP_006350013.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16-like [Solanum tuberosum]
Length=290

 Score =   406 bits (1044),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 190/266 (71%), Positives = 225/266 (85%), Gaps = 2/266 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV + +G   G++Q+ G  +AL+LD+ +GSGF +KNE+LFGRFDMQ+KLV   SAG
Sbjct  27    NFYRDVDITWGEGRGKIQEGGRGLALSLDKLSGSGFQSKNEFLFGRFDMQLKLVPENSAG  86

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTF+L+S  G+ HDE+DFEFLGN + QPYT+HTNVY+QGKGNKEQQFHLWFDPTAAFH
Sbjct  87    TVTTFFLSSQ-GEGHDEIDFEFLGNVSGQPYTIHTNVYTQGKGNKEQQFHLWFDPTAAFH  145

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TYTI+WNP RI+F+VDN+PIRVFNNHESIGIPFPKSQ M+VYCSLWNAD+WATQGG VKT
Sbjct  146   TYTIVWNPHRIVFLVDNSPIRVFNNHESIGIPFPKSQAMKVYCSLWNADEWATQGGRVKT  205

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DW+ APFTAYYRN N + C V++G  S      ++N+ + W T ELDGKGRNR+RWVQSK
Sbjct  206   DWALAPFTAYYRNINIDGCAVSSGT-SSCKSIGSTNNAKPWQTHELDGKGRNRLRWVQSK  264

Query  959   HMVYNYCADAKRFPQGFSAECKRSRF  1036
             HMVYNYCAD+KRFPQGFS ECKRSRF
Sbjct  265   HMVYNYCADSKRFPQGFSEECKRSRF  290



>ref|NP_001234478.1| xyloglucan endotransglucosylase-hydrolase XTH9 precursor [Solanum 
lycopersicum]
 gb|AAS46244.1| xyloglucan endotransglucosylase-hydrolase XTH9 [Solanum lycopersicum]
Length=290

 Score =   406 bits (1043),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 189/266 (71%), Positives = 225/266 (85%), Gaps = 2/266 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV + +G   G++Q+ G  +AL+LD+ +GSGF +KNEYLFGRFDMQ+KLV   SAG
Sbjct  27    NFYRDVDITWGEGRGKIQEGGRGLALSLDKLSGSGFQSKNEYLFGRFDMQLKLVPKNSAG  86

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTF+L+S  G+ HDE+DFEFLGN + QPYT+HTNVY+QGKGNKEQQFHLWFDPTAAFH
Sbjct  87    TVTTFFLSSQ-GEGHDEIDFEFLGNVSGQPYTIHTNVYTQGKGNKEQQFHLWFDPTAAFH  145

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TYTI+WNP RI+F+VDN+PIRVFNNHES+GIPFPKSQ M+VYCSLWNAD+WATQGG VKT
Sbjct  146   TYTIVWNPHRIVFLVDNSPIRVFNNHESMGIPFPKSQAMKVYCSLWNADEWATQGGRVKT  205

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DW+ APFTAYYRN N + C V++G  S      ++N+ + W T ELDGKGRNR+RWVQ+K
Sbjct  206   DWALAPFTAYYRNINIDGCAVSSGA-STCKSIGSTNNAKPWQTHELDGKGRNRLRWVQTK  264

Query  959   HMVYNYCADAKRFPQGFSAECKRSRF  1036
             HMVYNYCAD+KRFPQGFSAECK SRF
Sbjct  265   HMVYNYCADSKRFPQGFSAECKSSRF  290



>ref|XP_009597029.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16 [Nicotiana tomentosiformis]
Length=284

 Score =   404 bits (1039),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 191/289 (66%), Positives = 230/289 (80%), Gaps = 9/289 (3%)
 Frame = +2

Query  170   IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
             + +I ++  SLV  +        NFNN  ++ +G   G++ + G  ++L+LD+ +GSGF 
Sbjct  5     LFLISILMGSLVAASA-------NFNNLAEITWGEGRGKITEGGKGLSLSLDKLSGSGFQ  57

Query  350   TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
             +KNEYLFGRFDMQ+KLV G SAGTVTTF+L+S  G+ HDE+DFEFLGN T +PYTVHTNV
Sbjct  58    SKNEYLFGRFDMQLKLVPGNSAGTVTTFFLSSQ-GEGHDEIDFEFLGNTTGEPYTVHTNV  116

Query  530   YSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQ  709
             YSQGKGNKEQQFHLWFDPTAAFHTYTI+WN  RI+F+VDN PIRV+NNHE+ GIPFPKSQ
Sbjct  117   YSQGKGNKEQQFHLWFDPTAAFHTYTIVWNSNRIVFLVDNIPIRVYNNHENNGIPFPKSQ  176

Query  710   PMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasns  889
             PM+VYCSLWNAD+WATQGG VKTDW+HAPFTAYYRNF  + C VT+G  S      ++ +
Sbjct  177   PMKVYCSLWNADEWATQGGRVKTDWTHAPFTAYYRNFKIDGCAVTSGA-SSCKSTDSAGN  235

Query  890   nQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
              + W  QELD KGRNRVRWVQS+HMVYNYCAD KRFPQG+S ECK SRF
Sbjct  236   AKAWQNQELDAKGRNRVRWVQSRHMVYNYCADKKRFPQGYSHECKSSRF  284



>ref|XP_009602932.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15 [Nicotiana tomentosiformis]
Length=291

 Score =   404 bits (1038),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 195/289 (67%), Positives = 235/289 (81%), Gaps = 7/289 (2%)
 Frame = +2

Query  170   IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
             ++I+ +V  SL  VA A      NF N   + +G   G++ + G  ++L+LD+ +GSGF 
Sbjct  9     MLILPIVMASLWAVASAG-----NFYNLADITWGEGRGKITEGGRGLSLSLDKFSGSGFQ  63

Query  350   TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
             +KNEYLFGRFDMQ+KLV G SAGTVTTF+L+S  G  HDE+DFEFLGN + QPYTVHTNV
Sbjct  64    SKNEYLFGRFDMQLKLVPGNSAGTVTTFFLSSQ-GAGHDEIDFEFLGNVSGQPYTVHTNV  122

Query  530   YSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQ  709
             YSQGKGNKEQQFHLWFDPTAAFHTY+I+WN Q+IIF+VDN+PIRV+NNHES GIPFPKSQ
Sbjct  123   YSQGKGNKEQQFHLWFDPTAAFHTYSIIWNAQKIIFLVDNSPIRVYNNHESAGIPFPKSQ  182

Query  710   PMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasns  889
             PM+VYCSLWNAD+WATQGG VKTDW+HAPFTAYYRNFN + C +T+G  S      ++N+
Sbjct  183   PMKVYCSLWNADEWATQGGRVKTDWTHAPFTAYYRNFNIDGCAITSGA-SSCKSTDSANN  241

Query  890   nQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
              + W  QELD KGRNR+RWVQ++HMVYNYCAD+KRFPQGFS ECKRSRF
Sbjct  242   ARPWQNQELDAKGRNRLRWVQNRHMVYNYCADSKRFPQGFSHECKRSRF  290



>ref|XP_009785048.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16 [Nicotiana sylvestris]
Length=284

 Score =   404 bits (1037),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 191/288 (66%), Positives = 228/288 (79%), Gaps = 9/288 (3%)
 Frame = +2

Query  173   MIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNT  352
             ++I ++  SLV           NFNN  ++ +G   G++ + G  ++L+LD+ +GSGF +
Sbjct  6     LLISILMGSLV-------VASANFNNLAEITWGEGRGKITEGGKGLSLSLDKLSGSGFQS  58

Query  353   KNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVY  532
             KNEYLFGRFDMQ+KLV G SAGTVTTF+L+S  G+ HDE+DFEFLGN T +PYTVHTNVY
Sbjct  59    KNEYLFGRFDMQLKLVPGNSAGTVTTFFLSSQ-GKGHDEIDFEFLGNTTGEPYTVHTNVY  117

Query  533   SQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQP  712
             SQGKGNKEQQFHLWFDPTAAFHTYTI+WN  RI+F+VDN PIRV+NNHES GIPFPKSQP
Sbjct  118   SQGKGNKEQQFHLWFDPTAAFHTYTIVWNANRILFLVDNIPIRVYNNHESNGIPFPKSQP  177

Query  713   MRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsn  892
             M+VYCSLWNAD+WATQGG VKTDW+HAPFTAYYRNF  + C VT+G  S      ++ + 
Sbjct  178   MKVYCSLWNADEWATQGGRVKTDWTHAPFTAYYRNFKIDGCAVTSGA-SSCKSTDSAGNA  236

Query  893   QEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
             + W   ELD KGRNRVRWVQS+HMVYNYCAD KRFPQG+S ECK SRF
Sbjct  237   KAWQNHELDAKGRNRVRWVQSRHMVYNYCADKKRFPQGYSHECKSSRF  284



>ref|XP_009758414.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15 [Nicotiana sylvestris]
Length=291

 Score =   402 bits (1032),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 194/289 (67%), Positives = 232/289 (80%), Gaps = 7/289 (2%)
 Frame = +2

Query  170   IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
             ++I+ +V  SL   A A      NF N   + +G   G++ + G  ++L+LD+ +GSGF 
Sbjct  9     MLILPIVMASLWAAASAG-----NFYNLADITWGEGRGKITEGGRGLSLSLDKLSGSGFQ  63

Query  350   TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
             +KNEYLFGRFDMQ+KLV G SAGTVTTF+L+S  G  HDE+DFEFLGN + QPYTVHTNV
Sbjct  64    SKNEYLFGRFDMQLKLVPGNSAGTVTTFFLSSQ-GAGHDEIDFEFLGNVSGQPYTVHTNV  122

Query  530   YSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQ  709
             YSQGKGNKEQQFHLWFDPTAAFHTY+I+WN Q+IIF+VDN+PIRV+NNHES GIPFPK Q
Sbjct  123   YSQGKGNKEQQFHLWFDPTAAFHTYSIIWNAQKIIFLVDNSPIRVYNNHESNGIPFPKIQ  182

Query  710   PMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasns  889
             PM+VYCSLWNAD+WATQGG VKTDW+H PFTAYYRNFN + C VT+G  S      ++N+
Sbjct  183   PMKVYCSLWNADEWATQGGRVKTDWTHVPFTAYYRNFNIDGCAVTSGT-SSCKSTDSANN  241

Query  890   nQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
              + W  QELD KGRNR+RWVQS+HMVYNYCAD+KRFPQGFS ECKRSRF
Sbjct  242   ARPWQNQELDAKGRNRLRWVQSRHMVYNYCADSKRFPQGFSHECKRSRF  290



>ref|XP_004243230.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16 [Solanum lycopersicum]
Length=290

 Score =   401 bits (1030),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 189/267 (71%), Positives = 223/267 (84%), Gaps = 2/267 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NFN+  ++ +G+  G++ D G  ++L+LD  +GSGF +KNEYL+GRFDMQ+KLV   SAG
Sbjct  25    NFNDLTEITWGDGRGKILDGGKGLSLSLDNYSGSGFQSKNEYLYGRFDMQLKLVPKNSAG  84

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTF+L+S  G+ HDE+DFEFLGN T +PYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH
Sbjct  85    TVTTFFLSSQ-GEGHDEIDFEFLGNVTGEPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  143

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TYTI+WN  RI+F+VD  PIRV+NNHESIGI +PKSQPM+VYCSLWNAD+WATQGG VKT
Sbjct  144   TYTIVWNANRIVFLVDQIPIRVYNNHESIGIAYPKSQPMKVYCSLWNADEWATQGGRVKT  203

Query  779   DWSHAPFTAYYRNFNANACVVTNGVss-cnsiaaasnsnQEWLTQELDGKGRNRVRWVQS  955
             DWS APFTAYYRN N + CVV +G SS  +    ++NS + W T ELD KGRNRVRWVQS
Sbjct  204   DWSQAPFTAYYRNINIDGCVVKSGASSCASRSTESTNSAKSWETHELDAKGRNRVRWVQS  263

Query  956   KHMVYNYCADAKRFPQGFSAECKRSRF  1036
             KHMVYNYCAD+KRFPQG+S ECKRSRF
Sbjct  264   KHMVYNYCADSKRFPQGYSQECKRSRF  290



>gb|ABD96607.1| xyloglucan endotransglucosylase XET1 [Capsicum annuum]
Length=287

 Score =   391 bits (1004),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 189/269 (70%), Positives = 217/269 (81%), Gaps = 4/269 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + FG+   Q+QD G  +AL+LD+ +GSGF +KNEYLFGRFDMQ+KLV G SAG
Sbjct  20    NFYQDTTVTFGDQRAQIQDGGRILALSLDKISGSGFQSKNEYLFGRFDMQLKLVPGNSAG  79

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL+S  G  HDE+DFEFLGN++ QPYTVHTNVYSQGKGNKEQQF LWFDPT++FH
Sbjct  80    TVTTFYLSSQ-GAGHDEIDFEFLGNSSGQPYTVHTNVYSQGKGNKEQQFRLWFDPTSSFH  138

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN QRIIF+VDN PIRVFNNHE+IG+ FPK+Q MRVY SLWNADDWATQGG VKT
Sbjct  139   TYSIVWNSQRIIFLVDNIPIRVFNNHEAIGVAFPKNQAMRVYASLWNADDWATQGGRVKT  198

Query  779   DWSHAPFTAYYRNFNANACV---VTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWV  949
             DWS APFTA YRNFN NACV    T+  S   S   + N+ Q W TQEL+   RNR+RWV
Sbjct  199   DWSMAPFTAAYRNFNTNACVWSAATSTSSCGGSKTDSVNNAQTWQTQELNASERNRLRWV  258

Query  950   QSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
             Q K+M+YNYCADAKRF QGFS ECKRSRF
Sbjct  259   QQKYMIYNYCADAKRFSQGFSPECKRSRF  287



>ref|XP_006348946.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16-like [Solanum tuberosum]
Length=290

 Score =   389 bits (1000),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 188/291 (65%), Positives = 232/291 (80%), Gaps = 7/291 (2%)
 Frame = +2

Query  167   MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
             +++I  V+  SLV V  A      NFN+  ++ +G+  G++ D G  ++L+LD+ +GSGF
Sbjct  6     LLLISIVLMGSLVAVLAAG-----NFNDLTEITWGDGRGKILDGGKGLSLSLDKLSGSGF  60

Query  347   NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
              +KNEYL+GRFDMQ+K V   SAGTVTTF+L+S  G+ HDE+DFEFLGN T +PYTVHTN
Sbjct  61    QSKNEYLYGRFDMQIKFVPRNSAGTVTTFFLSSQ-GEGHDEIDFEFLGNVTGEPYTVHTN  119

Query  527   VYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKS  706
             VYSQGKGNKEQQFHLWFDPT AFHTYTI+WN  RI+F+VD  PIRV+NNHESIGI +PKS
Sbjct  120   VYSQGKGNKEQQFHLWFDPTTAFHTYTIVWNANRIVFLVDEIPIRVYNNHESIGIAYPKS  179

Query  707   QPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVss-cnsiaaas  883
             QPM+VYCSLWNAD+WATQGG VKTDW+ APFTA Y+N N + CVV +G SS  +    ++
Sbjct  180   QPMKVYCSLWNADEWATQGGRVKTDWTQAPFTASYKNINIDGCVVKSGASSCASRSTDSA  239

Query  884   nsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
             N+ + W T ELD KGRNR+RWVQ+KHMVYNYCAD+KRFPQG+S ECKRSRF
Sbjct  240   NNAKPWETHELDAKGRNRLRWVQNKHMVYNYCADSKRFPQGYSQECKRSRF  290



>gb|ABD96609.1| xyloglucan endotransglucosylase XET3 [Capsicum annuum]
Length=287

 Score =   389 bits (999),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 187/269 (70%), Positives = 217/269 (81%), Gaps = 4/269 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + FG+H  Q+QD G  +AL+LD+ +GSGF +KNEYLFGRFDMQ+KLV G SAG
Sbjct  20    NFYQDATVTFGDHRAQIQDGGRVLALSLDKISGSGFQSKNEYLFGRFDMQLKLVPGNSAG  79

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL+S  G  HDE+DFEFLGN++ QPYTVHTNVYSQGKGNKEQQF LWFDPT++FH
Sbjct  80    TVTTFYLSSQ-GAGHDEIDFEFLGNSSGQPYTVHTNVYSQGKGNKEQQFRLWFDPTSSFH  138

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN QRIIF+VD+ PIRVFNNHE++G+ FPK+Q MRVY SLWNADDWATQGG VKT
Sbjct  139   TYSIVWNSQRIIFLVDDIPIRVFNNHEALGVAFPKNQAMRVYASLWNADDWATQGGWVKT  198

Query  779   DWSHAPFTAYYRNFNANACV---VTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWV  949
             DWS APFTA YRNFN NACV    T+  S   S   + N+ Q W TQEL+   RNR+RWV
Sbjct  199   DWSMAPFTASYRNFNTNACVWSAATSTSSCGGSKTDSVNNVQTWQTQELNASERNRLRWV  258

Query  950   QSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
             Q K+M+YNYC DAKRF QGFS ECKRSRF
Sbjct  259   QQKYMIYNYCTDAKRFSQGFSPECKRSRF  287



>ref|XP_006366771.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15-like [Solanum tuberosum]
 ref|XP_006366772.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15-like [Solanum tuberosum]
Length=287

 Score =   387 bits (994),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/269 (70%), Positives = 218/269 (81%), Gaps = 4/269 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + FG+   Q+QD G  +AL+LD+ +GSGF +KNEYLFGRFDMQ+KLV G SAG
Sbjct  20    NFYQDATVTFGDQRAQIQDGGRLLALSLDKISGSGFQSKNEYLFGRFDMQLKLVPGNSAG  79

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL+S  G  HDE+DFEFLGN++ QPYTVHTNVYSQGKGNKEQQF LWFDPT++FH
Sbjct  80    TVTTFYLSSQ-GAGHDEIDFEFLGNSSGQPYTVHTNVYSQGKGNKEQQFRLWFDPTSSFH  138

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN QRIIF+VDN PIRVFNNHE++G+ FPK+Q MRVY SLWNADDWATQGG VKT
Sbjct  139   TYSIVWNSQRIIFLVDNIPIRVFNNHEALGVAFPKNQAMRVYASLWNADDWATQGGRVKT  198

Query  779   DWSHAPFTAYYRNFNANACV---VTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWV  949
             DWS APFTA YRNFN NACV    T+  S   S   + N++Q W TQ+L+  GRNR+RWV
Sbjct  199   DWSMAPFTASYRNFNTNACVWSAATSTSSCGGSKTESVNNDQTWQTQQLNANGRNRLRWV  258

Query  950   QSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
             Q K+M+YNYCADA RF QGFS ECKRSRF
Sbjct  259   QQKYMIYNYCADANRFSQGFSPECKRSRF  287



>gb|ABD96608.1| xyloglucan endotransglucosylase XET2 [Capsicum annuum]
Length=288

 Score =   387 bits (993),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/269 (70%), Positives = 216/269 (80%), Gaps = 4/269 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + FG+   Q+QD G   AL+LD+ +GSGF +KNEYLFGRFDMQ+KLV G SAG
Sbjct  21    NFYQDATVTFGDQRAQIQDGGRVFALSLDKISGSGFQSKNEYLFGRFDMQLKLVPGNSAG  80

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL+S  G  HDE+DFEFLGN++ QPYTVHTNVYSQGKGNKEQQF LWFDPT++FH
Sbjct  81    TVTTFYLSSQ-GAGHDEIDFEFLGNSSGQPYTVHTNVYSQGKGNKEQQFRLWFDPTSSFH  139

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN QRIIF+VDN PIRV+NN E+IG+PFPK+Q MRVY SLWNADDWATQGG VKT
Sbjct  140   TYSIVWNSQRIIFLVDNIPIRVYNNDEAIGVPFPKNQAMRVYASLWNADDWATQGGRVKT  199

Query  779   DWSHAPFTAYYRNFNANACV---VTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWV  949
             DWS APFTA YRNFN NACV    ++  S   S   + N+ Q W TQEL+   RNR+RWV
Sbjct  200   DWSMAPFTASYRNFNTNACVWSAASSTSSCGGSKTDSVNNAQTWQTQELNANERNRLRWV  259

Query  950   QSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
             Q K+M+YNYCADAKRF QGFS ECKRSRF
Sbjct  260   QQKYMIYNYCADAKRFSQGFSPECKRSRF  288



>ref|XP_011082926.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like isoform X1 [Sesamum indicum]
Length=292

 Score =   385 bits (990),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 180/290 (62%), Positives = 226/290 (78%), Gaps = 11/290 (4%)
 Frame = +2

Query  167   MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
             M++++ ++  ++            +F  D ++ +G+   ++ + G  + L+LDQQ+GSGF
Sbjct  14    MMLLLAILVANIA-------TAAADFYRDAEITWGDGRAKILEGGRMLTLSLDQQSGSGF  66

Query  347   NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
              +KNEYLFGRFD+Q+KLV G SAGTVTTF+L+S  G  HDE+DFEFLGN + +PYTVHTN
Sbjct  67    QSKNEYLFGRFDLQLKLVPGNSAGTVTTFFLSSQ-GAGHDEIDFEFLGNTSGEPYTVHTN  125

Query  527   VYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKS  706
             VY+QGKG+KEQ+FHLWFDPTAAFHTY+I+WNPQRIIF+VDN PIRVF+N+E+IGIP+PKS
Sbjct  126   VYAQGKGDKEQRFHLWFDPTAAFHTYSIVWNPQRIIFLVDNIPIRVFSNNEAIGIPYPKS  185

Query  707   QPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasn  886
             Q MRVYCSLWNADDWATQGG VKTDW+ APF A YRNFN N CV  +      S +A S 
Sbjct  186   QAMRVYCSLWNADDWATQGGRVKTDWTKAPFVASYRNFNINGCVPGSSC---GSKSAESF  242

Query  887   snQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
             + + W T+ELDGKGRNR+RW Q KHM+YNYC D KRFPQG  AEC+RSRF
Sbjct  243   NTEAWQTKELDGKGRNRLRWAQQKHMIYNYCTDNKRFPQGTPAECRRSRF  292



>ref|NP_001234213.1| xyloglucan endo-transglycosylase precursor [Solanum lycopersicum]
 emb|CAA58003.1| xyloglucan endo-transglycosylase [Solanum lycopersicum]
Length=289

 Score =   385 bits (989),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 187/269 (70%), Positives = 216/269 (80%), Gaps = 4/269 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + FG+   Q+QD G  +AL+LD+ +GSGF +KNEYLFGRFDMQ+KLV G SAG
Sbjct  22    NFYQDATVTFGDQRAQIQDGGRLLALSLDKISGSGFQSKNEYLFGRFDMQLKLVPGNSAG  81

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL+S  G  HDE+DFEFLGN++ QPYTVHTNVYSQGKGNKEQQF LWFDPT+ FH
Sbjct  82    TVTTFYLSSQ-GAGHDEIDFEFLGNSSGQPYTVHTNVYSQGKGNKEQQFRLWFDPTSPFH  140

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN QRIIF+VDN PIRVFNNHE +G+ FPK+Q MRVY SLWNADDWATQGG VKT
Sbjct  141   TYSIVWNSQRIIFLVDNIPIRVFNNHEKLGVAFPKNQAMRVYASLWNADDWATQGGRVKT  200

Query  779   DWSHAPFTAYYRNFNANACV---VTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWV  949
             DWS APFTA YRNFN NACV    ++  S   S   + N++Q W TQEL+G  RNR+RWV
Sbjct  201   DWSMAPFTASYRNFNTNACVWSAASSTSSCGGSKTDSVNNDQAWQTQELNGNDRNRLRWV  260

Query  950   QSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
             Q K+M+YNYCADAKRF QG S ECKRSRF
Sbjct  261   QQKYMIYNYCADAKRFSQGLSPECKRSRF  289



>ref|NP_001274880.1| probable xyloglucan endotransglucosylase/hydrolase protein 15-like 
precursor [Solanum tuberosum]
 emb|CAJ77496.1| putative xyloglucan endotransglycosylase precursor [Solanum tuberosum]
Length=287

 Score =   384 bits (985),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 185/269 (69%), Positives = 217/269 (81%), Gaps = 4/269 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + FG+   Q+QD G  +AL+LD+ +GSGF +KNEYLFGRFDMQ+KLV G SAG
Sbjct  20    NFYQDATVTFGDQRAQIQDGGRLLALSLDKISGSGFQSKNEYLFGRFDMQLKLVPGNSAG  79

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTF L+S  G  HDE+DFEFLGN++ +PYTVHTNVYSQGKGNKEQQF LWFDPT++FH
Sbjct  80    TVTTFLLSSQ-GAGHDEIDFEFLGNSSGKPYTVHTNVYSQGKGNKEQQFRLWFDPTSSFH  138

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN QRIIF+VDN PIRVFNNHE++G+ FPK+Q MRVY SLWNADDWATQGG VKT
Sbjct  139   TYSIVWNSQRIIFLVDNIPIRVFNNHEALGVAFPKNQAMRVYASLWNADDWATQGGRVKT  198

Query  779   DWSHAPFTAYYRNFNANACV---VTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWV  949
             DWS APFTA YRNFN NACV    T+  S   S   + N++Q W +Q+L+  GRNRVRWV
Sbjct  199   DWSMAPFTASYRNFNTNACVWSAATSTSSCGGSKTESVNNDQTWQSQQLNANGRNRVRWV  258

Query  950   QSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
             Q K+M+YNYCADA RF QGFS ECKRSRF
Sbjct  259   QQKYMIYNYCADANRFSQGFSPECKRSRF  287



>ref|NP_001234207.1| xyloglycan endo-transglycosylase precursor [Solanum lycopersicum]
 emb|CAA58002.1| xyloglycan endo-transglycosylase [Solanum lycopersicum]
Length=287

 Score =   382 bits (982),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 183/269 (68%), Positives = 216/269 (80%), Gaps = 4/269 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + FG+   Q+QD G  + L+LD+ +GSGF +KNEYLFGRFDMQ+KLV G SAG
Sbjct  20    NFYQDAAVTFGDQRAQIQDGGRLLTLSLDKISGSGFQSKNEYLFGRFDMQLKLVPGNSAG  79

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL+S  G  HDE+DFEFLGN++  PYTVHTNVYSQGKGNKEQQF LWFDPT++FH
Sbjct  80    TVTTFYLSSQ-GAGHDEIDFEFLGNSSGLPYTVHTNVYSQGKGNKEQQFRLWFDPTSSFH  138

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN QRIIF+VDN PIRVFNNHE++G+ +PK+Q MRVY SLWNADDWATQGG VKT
Sbjct  139   TYSIVWNSQRIIFLVDNIPIRVFNNHEALGVAYPKNQAMRVYASLWNADDWATQGGRVKT  198

Query  779   DWSHAPFTAYYRNFNANACV---VTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWV  949
             DWS APFTA YRNFN NACV    T+  S   S   + N+++ W TQ+L+  GRNR+RWV
Sbjct  199   DWSMAPFTASYRNFNTNACVWSAATSTSSCGGSKTESVNNDETWQTQQLNANGRNRIRWV  258

Query  950   QSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
             Q K+M+YNYCADA RF QGFS ECKRSRF
Sbjct  259   QQKYMIYNYCADANRFSQGFSPECKRSRF  287



>ref|XP_011082922.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase 2-like [Sesamum 
indicum]
Length=287

 Score =   382 bits (980),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 180/267 (67%), Positives = 216/267 (81%), Gaps = 12/267 (4%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D ++ +G+   ++ + G  ++L+LDQ +GSGF +KNEYL+GRFD+Q+KLV G SAG
Sbjct  32    NFYRDAEITWGDGRAKILEGGRGLSLSLDQYSGSGFQSKNEYLYGRFDLQLKLVPGNSAG  91

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTF+L+S  G+ HDE+DFEFLGN + +PYTVHTNVY+ GKG+KEQQFHLWFDPTAAFH
Sbjct  92    TVTTFFLSSQ-GEGHDEIDFEFLGNVSGEPYTVHTNVYAGGKGDKEQQFHLWFDPTAAFH  150

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+W+PQRIIF+VDN+PIRVFNNH+SIGIPFP SQPMRV+CSLWNADDWATQGG VKT
Sbjct  151   TYSIVWHPQRIIFLVDNSPIRVFNNHKSIGIPFPTSQPMRVHCSLWNADDWATQGGRVKT  210

Query  779   DWSHAPFTAYYRNFNANACVV-TNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQS  955
             DW+ APF AYYRNF  + C V T+G S                TQELD KGRNR+RWVQ 
Sbjct  211   DWTKAPFVAYYRNFKIDGCPVGTSGGSCGFQSQ----------TQELDAKGRNRMRWVQQ  260

Query  956   KHMVYNYCADAKRFPQGFSAECKRSRF  1036
             KHM+YNYCAD +RFPQG SAECKRSRF
Sbjct  261   KHMIYNYCADVRRFPQGSSAECKRSRF  287



>ref|XP_011082921.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase 2-like [Sesamum 
indicum]
Length=287

 Score =   382 bits (980),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 180/267 (67%), Positives = 215/267 (81%), Gaps = 12/267 (4%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D ++ +G+   ++ + G  ++L+LDQ +GSGF +KNEYLFGRFD+Q+KLV G SAG
Sbjct  32    NFYRDAEITWGDGRAKILEGGRGLSLSLDQYSGSGFQSKNEYLFGRFDLQLKLVPGNSAG  91

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTF+L+S  G+ HDE+DFEFLGN + +PYTVHTNVY+ GKG+KEQQFHLWFDPTAAFH
Sbjct  92    TVTTFFLSSQ-GEGHDEIDFEFLGNVSGEPYTVHTNVYAGGKGDKEQQFHLWFDPTAAFH  150

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+W+PQRIIF+VDN+PIRVFNNH+SIGIPFP SQPMRV+CSLWNADDWATQGG VKT
Sbjct  151   TYSIVWHPQRIIFLVDNSPIRVFNNHKSIGIPFPTSQPMRVHCSLWNADDWATQGGRVKT  210

Query  779   DWSHAPFTAYYRNFNANACVV-TNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQS  955
             DW+ APF  YYRNF  + C V T+G S                TQELD KGRNR+RWVQ 
Sbjct  211   DWTKAPFVTYYRNFKIDGCPVGTSGGSCGFQSQ----------TQELDAKGRNRMRWVQQ  260

Query  956   KHMVYNYCADAKRFPQGFSAECKRSRF  1036
             KHM+YNYCAD +RFPQG SAECKRSRF
Sbjct  261   KHMIYNYCADVRRFPQGSSAECKRSRF  287



>ref|XP_011082925.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase 2-like [Sesamum 
indicum]
Length=288

 Score =   381 bits (979),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 180/267 (67%), Positives = 216/267 (81%), Gaps = 12/267 (4%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D ++ +G+   ++ + G  ++L+LDQ +GSGF +KNEYLFGRFD+Q+KLV G SAG
Sbjct  33    NFYRDAEITWGDGRAKILEGGRGLSLSLDQYSGSGFQSKNEYLFGRFDLQLKLVPGNSAG  92

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTF+L+S  G+ HDE+DFEFLGN + +PYTVHTNVY+ GKG+KEQQFHLWFDPTAAFH
Sbjct  93    TVTTFFLSSQ-GEGHDEIDFEFLGNVSGEPYTVHTNVYAGGKGDKEQQFHLWFDPTAAFH  151

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+W+PQRIIF+VDN+PIRVFNNH+SIGIPFP SQPMRV+CSLWNADDWATQGG VKT
Sbjct  152   TYSIVWHPQRIIFLVDNSPIRVFNNHKSIGIPFPTSQPMRVHCSLWNADDWATQGGRVKT  211

Query  779   DWSHAPFTAYYRNFNANACVV-TNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQS  955
             DW+ APF AYYRNF  + C + T+G S                TQELDGKGRNR+RWVQ 
Sbjct  212   DWTKAPFVAYYRNFKIDGCPIGTSGGSCGFQSQ----------TQELDGKGRNRMRWVQQ  261

Query  956   KHMVYNYCADAKRFPQGFSAECKRSRF  1036
             KHM+YNYCAD +RFPQG SAECKR RF
Sbjct  262   KHMIYNYCADVRRFPQGTSAECKRPRF  288



>ref|XP_011082923.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase 2-like [Sesamum 
indicum]
Length=288

 Score =   380 bits (977),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 179/267 (67%), Positives = 216/267 (81%), Gaps = 12/267 (4%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D ++ +G+   ++ + G  ++L+LDQ +GSGF +KNEYL+GRFD+Q+KLV G SAG
Sbjct  33    NFYRDAEITWGDGRAKILEGGRGLSLSLDQYSGSGFQSKNEYLYGRFDLQLKLVPGNSAG  92

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTF+L+S  G+ HDE+DFEFLGN + +PYTVHTNVY+ GKG+KEQQFHLWFDPTAAFH
Sbjct  93    TVTTFFLSSQ-GEGHDEIDFEFLGNVSGEPYTVHTNVYAGGKGDKEQQFHLWFDPTAAFH  151

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+W+PQRIIF+VDN+PIR+FNNH+SIGIPFP SQPMRV+CSLWNADDWATQGG VKT
Sbjct  152   TYSIVWHPQRIIFLVDNSPIRIFNNHKSIGIPFPTSQPMRVHCSLWNADDWATQGGRVKT  211

Query  779   DWSHAPFTAYYRNFNANACVV-TNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQS  955
             DW+ APF AYYRNF  + C V T+G S                TQELD KGRNR+RWVQ 
Sbjct  212   DWTKAPFVAYYRNFKIDGCPVGTSGGSCGFQSQ----------TQELDAKGRNRMRWVQQ  261

Query  956   KHMVYNYCADAKRFPQGFSAECKRSRF  1036
             KHM+YNYCAD +RFPQG SAECKRSRF
Sbjct  262   KHMIYNYCADVRRFPQGSSAECKRSRF  288



>ref|XP_004303859.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16-like [Fragaria vesca subsp. vesca]
Length=298

 Score =   380 bits (975),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 183/299 (61%), Positives = 225/299 (75%), Gaps = 11/299 (4%)
 Frame = +2

Query  158   QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
             +V M++++ +   SL+ +  +      NF  D  + FG+   ++ + G ++ LNLDQ +G
Sbjct  5     KVPMVLLLSLFITSLLAMIASAG----NFLQDFDVTFGDQRVKILEGGKSLTLNLDQYSG  60

Query  338   SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
             SGF +KNEYLFGR DMQ+KLV G SAGTVTT+YL+S  G  HDE+DFEFLGN++  PYT+
Sbjct  61    SGFKSKNEYLFGRIDMQIKLVPGNSAGTVTTYYLSSE-GPTHDEIDFEFLGNSSGNPYTL  119

Query  518   HTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPF  697
             HTNV+SQGKG++EQQFHLWFDPT AFHTY+ +WN QRIIF+VDN PIRVFNN ES GIPF
Sbjct  120   HTNVFSQGKGDREQQFHLWFDPTKAFHTYSFVWNSQRIIFLVDNIPIRVFNNLESFGIPF  179

Query  698   PKSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTN------GVss  859
             PK+QPMR+Y SLWNADDWATQGG VKTDW+ APFTA YRNF ANACV  +      GV++
Sbjct  180   PKNQPMRIYSSLWNADDWATQGGRVKTDWTQAPFTASYRNFKANACVAGSSSSSSCGVAT  239

Query  860   cnsiaaasnsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
               S  + ++    W TQ LD  GRNR+RWVQ K MVYNYC+D KRFPQG  AECKRSRF
Sbjct  240   TASTNSLTDQQSAWQTQTLDAAGRNRLRWVQHKFMVYNYCSDRKRFPQGVPAECKRSRF  298



>gb|ACD03217.1| xyloglucan endotransglucosylase/hydrolase 7 [Actinidia deliciosa]
Length=294

 Score =   379 bits (974),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 180/291 (62%), Positives = 223/291 (77%), Gaps = 10/291 (3%)
 Frame = +2

Query  167   MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
             M+M++ +++C +     +          DV++ +GN  G++ + G  + L+LD  +GSGF
Sbjct  12    MLMLVMLMSCLVSSSYGSF--------EDVEITWGNGRGKILNGGQLLTLSLDNYSGSGF  63

Query  347   NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
              +KNEYLFGR DMQ+KLV G SAGTVTT+YL+S  G  HDE+DFEFLGN + QPYTVHTN
Sbjct  64    QSKNEYLFGRIDMQLKLVPGNSAGTVTTYYLSSQ-GATHDEIDFEFLGNVSGQPYTVHTN  122

Query  527   VYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKS  706
             V++QGKGN+EQQFHLWFDPT +FHTYTILWNPQRIIF+VDN PIRVFNN+E+IG+PFP S
Sbjct  123   VFAQGKGNREQQFHLWFDPTTSFHTYTILWNPQRIIFLVDNIPIRVFNNNEAIGVPFPTS  182

Query  707   QPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACV-VTNGVsscnsiaaas  883
             QPMRVY S WNADDWATQGG VKTDW+HAPFTA Y+NFNANACV  +   S  +    + 
Sbjct  183   QPMRVYSSFWNADDWATQGGRVKTDWTHAPFTASYKNFNANACVHSSGSSSCGSQSTKSI  242

Query  884   nsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
             +++Q W TQ+LD  GR R+RWVQ K M+YNYC D +RFPQG   ECKRSRF
Sbjct  243   SNDQAWQTQDLDANGRKRLRWVQQKFMIYNYCTDTQRFPQGLPLECKRSRF  293



>ref|XP_004303861.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16-like [Fragaria vesca subsp. vesca]
Length=297

 Score =   378 bits (970),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 176/271 (65%), Positives = 211/271 (78%), Gaps = 6/271 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + FG    ++ + G  + L+LDQ +GSGF +KNEYLFGR DMQ++LV G SAG
Sbjct  28    NFYQDFDITFGEQRAKILNGGQLLTLDLDQYSGSGFKSKNEYLFGRIDMQIRLVAGNSAG  87

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN+T +PYT+HTNV+SQGKGN+EQQFHLWFDPT AFH
Sbjct  88    TVTAYYLSSQ-GPTHDEIDFEFLGNSTGEPYTLHTNVFSQGKGNREQQFHLWFDPTKAFH  146

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+++WN QRIIF+VDN PIRVFNN ES+G+PFPK+QPMR+Y SLWNADDWATQGG VKT
Sbjct  147   TYSLVWNSQRIIFLVDNIPIRVFNNLESVGVPFPKNQPMRIYSSLWNADDWATQGGRVKT  206

Query  779   DWSHAPFTAYYRNFNANACVVTN-----GVsscnsiaaasnsnQEWLTQELDGKGRNRVR  943
             DW+HAPFTA YRNF ANACV  +     GV++  S  + ++  + W  Q LD  GRNR+R
Sbjct  207   DWTHAPFTASYRNFKANACVAGSSSSSCGVTTSASTNSLTDQQRSWHNQGLDAAGRNRIR  266

Query  944   WVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
             WVQ K MVYNYCAD KRFPQG   EC RSRF
Sbjct  267   WVQQKFMVYNYCADLKRFPQGLPVECSRSRF  297



>ref|XP_009356634.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Pyrus 
x bretschneideri]
Length=295

 Score =   378 bits (970),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 179/291 (62%), Positives = 220/291 (76%), Gaps = 6/291 (2%)
 Frame = +2

Query  167   MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
             M+ ++ +   SL+ +  +      NF  D  + FG+   ++ + G  + LNLD+ +GSGF
Sbjct  10    MVFLLSLFTTSLMAMTASAG----NFFQDFDITFGDGRAKILNGGQLLTLNLDKASGSGF  65

Query  347   NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
              +KNEYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN+T +PYT+HTN
Sbjct  66    KSKNEYLFGRIDMQIKLVSGNSAGTVTAYYLSSE-GPTHDEIDFEFLGNSTGEPYTLHTN  124

Query  527   VYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKS  706
             V+SQGKGN+EQQF LWFDPT  FHTY+I+WN QRIIF+VDN PIRVFNN ES G+PFPK+
Sbjct  125   VFSQGKGNREQQFQLWFDPTKTFHTYSIVWNSQRIIFLVDNIPIRVFNNLESAGVPFPKN  184

Query  707   QPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasn  886
             QPMR+Y SLWNADDWAT+GGLVKTDW+ APFTA YRNF ANAC  ++  S  ++ +  S 
Sbjct  185   QPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFKANACTASSPSSCASTTSTNSL  244

Query  887   snQE-WLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
             + Q  W TQ LD  GRNR+RWVQ K MVYNYC+D KRFPQG  AECKRSRF
Sbjct  245   TEQSAWKTQGLDAAGRNRLRWVQQKFMVYNYCSDLKRFPQGLPAECKRSRF  295



>ref|NP_001281066.1| brassinosteroid-regulated protein BRU1-like precursor [Malus 
domestica]
 gb|ACD03231.1| xyloglucan endotransglucosylase/hydrolase 7 [Malus domestica]
Length=295

 Score =   377 bits (969),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 179/291 (62%), Positives = 219/291 (75%), Gaps = 6/291 (2%)
 Frame = +2

Query  167   MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
             M+ ++ +   SL+     +     NF  D  + FG+   ++ + G  + LNLD+ +GSGF
Sbjct  10    MVFLLSLFTTSLM----VMTASAGNFFQDFDITFGDGRAKILNGGQLLTLNLDKASGSGF  65

Query  347   NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
              +KNEYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN+T +PYT+HTN
Sbjct  66    KSKNEYLFGRIDMQIKLVSGNSAGTVTAYYLSSE-GPTHDEIDFEFLGNSTGEPYTLHTN  124

Query  527   VYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKS  706
             V+SQGKGN+EQQFHLWFDPT  FHTY+I+WN QRIIF+VDN PIRVFNN ES G+PFPK+
Sbjct  125   VFSQGKGNREQQFHLWFDPTKTFHTYSIVWNSQRIIFLVDNIPIRVFNNLESAGVPFPKN  184

Query  707   QPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasn  886
             QPMR+Y SLWNADDWAT+GGLVKTDW+ APFTA YRNF ANAC  ++  S  ++ +  S 
Sbjct  185   QPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFKANACTASSPSSCASTTSTNSL  244

Query  887   snQE-WLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
             + Q  W TQ LD  GRNR+RWVQ K MVYNYC+D KRFPQG   ECKRSRF
Sbjct  245   TEQSAWKTQGLDAAGRNRLRWVQQKFMVYNYCSDLKRFPQGLPTECKRSRF  295



>ref|XP_009356637.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Pyrus 
x bretschneideri]
Length=295

 Score =   376 bits (965),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 179/291 (62%), Positives = 219/291 (75%), Gaps = 6/291 (2%)
 Frame = +2

Query  167   MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
             M+ ++ +   SL+     +     NF  D  + FG+   ++ + G  + LNLD+ +GSGF
Sbjct  10    MMFLLSLFTTSLM----VMTASAGNFFQDFDITFGDGRAKILNGGQLLTLNLDKASGSGF  65

Query  347   NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
              +KNEYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN+T +PYT+HTN
Sbjct  66    KSKNEYLFGRIDMQIKLVSGNSAGTVTAYYLSSE-GPTHDEIDFEFLGNSTGEPYTLHTN  124

Query  527   VYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKS  706
             V+SQGKGN+EQQF LWFDPT  FHTY+I+WN QRIIF+VDN PIRVFNN ES G+PFPK+
Sbjct  125   VFSQGKGNREQQFQLWFDPTKTFHTYSIVWNSQRIIFLVDNIPIRVFNNLESAGVPFPKN  184

Query  707   QPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasn  886
             QPMR+Y SLWNADDWAT+GGLVKTDW+ APFTA YRNF ANAC  ++  S  ++ +  S 
Sbjct  185   QPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFKANACTASSPSSCASTTSTNSL  244

Query  887   snQE-WLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
             + Q  W TQ LD  GRNR+RWVQ K MVYNYC+D KRFPQG  AECKRSRF
Sbjct  245   TEQSAWKTQGLDAAGRNRLRWVQQKFMVYNYCSDLKRFPQGLPAECKRSRF  295



>ref|XP_009356635.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16 [Pyrus x bretschneideri]
Length=274

 Score =   375 bits (962),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 176/267 (66%), Positives = 210/267 (79%), Gaps = 2/267 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + FG+   ++ + G  + LNLD+ +GSGF +KNEYLFGR DMQ+KLV G SAG
Sbjct  9     NFFQDFDITFGDGRAKILNGGQLLTLNLDKASGSGFKSKNEYLFGRIDMQIKLVSGNSAG  68

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN+T +PYT+HTNV+SQGKGN+EQQF LWFDPT  FH
Sbjct  69    TVTAYYLSSE-GPTHDEIDFEFLGNSTGEPYTLHTNVFSQGKGNREQQFQLWFDPTKTFH  127

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN QRIIF+VDN PIRVFNN ES G+PFPK+QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  128   TYSIVWNSQRIIFLVDNIPIRVFNNLESAGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  187

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQE-WLTQELDGKGRNRVRWVQS  955
             DW+ APFTA YRNF ANAC  ++  S  ++ +  S + Q  W TQ LD  GRNR+RWVQ 
Sbjct  188   DWTQAPFTASYRNFKANACTASSPSSCASTTSTNSLTEQSAWKTQGLDAAGRNRLRWVQQ  247

Query  956   KHMVYNYCADAKRFPQGFSAECKRSRF  1036
             K MVYNYC+D KRFPQG  AECKRSRF
Sbjct  248   KFMVYNYCSDLKRFPQGLPAECKRSRF  274



>ref|XP_010102170.1| putative xyloglucan endotransglucosylase/hydrolase protein 16 
[Morus notabilis]
 gb|EXB92420.1| putative xyloglucan endotransglucosylase/hydrolase protein 16 
[Morus notabilis]
Length=289

 Score =   375 bits (963),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 183/293 (62%), Positives = 220/293 (75%), Gaps = 12/293 (4%)
 Frame = +2

Query  161   VCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGS  340
             + + M+  ++A +  G          NF  D  + +G+H  Q+ + G  + LNLD+ +GS
Sbjct  7     ITLFMVSWLMAAATAG----------NFYQDFDITWGDHRAQILNGGQLLTLNLDKASGS  56

Query  341   GFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVH  520
             GF +KNEYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PYT+H
Sbjct  57    GFQSKNEYLFGRIDMQIKLVPGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLH  115

Query  521   TNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP  700
             TNV SQGKGN+EQQFHLWFDPT AFHTY+I+WN QRIIF+VDN PIRVFNN ES G+PFP
Sbjct  116   TNVLSQGKGNREQQFHLWFDPTKAFHTYSIVWNKQRIIFLVDNIPIRVFNNLESTGVPFP  175

Query  701   KSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaa  880
             KSQPMR+Y SLWNADDWAT+GGLVKTDW+ APFTA YRNF ANACV + G SSC+S + +
Sbjct  176   KSQPMRIYSSLWNADDWATRGGLVKTDWTKAPFTASYRNFKANACVWSAGKSSCDSKSTS  235

Query  881   snsnQE-WLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
             +      W  Q LD  GRNR+RWVQ K+MVYNYC D+KRFPQG   ECKRSRF
Sbjct  236   AAFEDATWQDQGLDAAGRNRLRWVQQKYMVYNYCTDSKRFPQGLPPECKRSRF  288



>ref|XP_011082930.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15 [Sesamum indicum]
Length=281

 Score =   374 bits (960),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 180/266 (68%), Positives = 214/266 (80%), Gaps = 3/266 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV + +G+  G++ + G  + L LDQ +GSGF +KNEYLFGRFDMQ++L+ G SAG
Sbjct  19    NFYKDVNVNWGDGRGKIVEGGRGLTLLLDQYSGSGFQSKNEYLFGRFDMQLRLIPGNSAG  78

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTF+L S  G AHDE+DFEFLGN++ +PYTVHTNVY+QGKG+KEQQF LWFDP+AAFH
Sbjct  79    TVTTFFLASQ-GSAHDEIDFEFLGNSSGEPYTVHTNVYAQGKGDKEQQFRLWFDPSAAFH  137

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WNP+RIIF+VDN PIRVF+NH   G+PFP SQPMRV+CSLWNADDWATQGG VKT
Sbjct  138   TYSIVWNPRRIIFLVDNIPIRVFHNHG--GVPFPTSQPMRVHCSLWNADDWATQGGRVKT  195

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DW+ APF AYYRNF  NACV  +   SC S +A S  ++EW TQELD KGRNR+RWV  K
Sbjct  196   DWTKAPFVAYYRNFKINACVSGSIGGSCGSTSADSFGDEEWQTQELDSKGRNRLRWVHQK  255

Query  959   HMVYNYCADAKRFPQGFSAECKRSRF  1036
             HM+YNYC D  RFPQG   ECKRSRF
Sbjct  256   HMIYNYCGDMPRFPQGIPPECKRSRF  281



>ref|XP_008348360.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Malus 
domestica]
Length=293

 Score =   374 bits (961),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 175/266 (66%), Positives = 209/266 (79%), Gaps = 1/266 (0%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + FG+   ++ + G  + LNLDQ +GSGF +KNEYLFGR DMQ+KLV G SAG
Sbjct  29    NFYQDFDVTFGDGRAKILNGGQLLTLNLDQTSGSGFKSKNEYLFGRIDMQIKLVSGNSAG  88

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNV+SQGKGN+EQQFHLWFDPT AFH
Sbjct  89    TVTAYYLSSE-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGNREQQFHLWFDPTKAFH  147

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN QRIIF+VD  PIRVFNN ES+G+PFPKSQPMR+Y SLWNADDWAT+GGLVKT
Sbjct  148   TYSIVWNAQRIIFLVDKIPIRVFNNLESVGVPFPKSQPMRIYSSLWNADDWATRGGLVKT  207

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DW+ APFTA YRNF A+AC   +  S  ++ + +S  +  W TQ LD  GRNR+RWVQ K
Sbjct  208   DWTQAPFTASYRNFKADACTAGSSSSCASTASTSSVGDSAWQTQGLDAAGRNRLRWVQQK  267

Query  959   HMVYNYCADAKRFPQGFSAECKRSRF  1036
              MVYNYC+D KRFPQG  AEC+RSRF
Sbjct  268   FMVYNYCSDLKRFPQGLPAECRRSRF  293



>ref|XP_004303862.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15-like [Fragaria vesca subsp. vesca]
Length=292

 Score =   374 bits (959),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 177/290 (61%), Positives = 220/290 (76%), Gaps = 6/290 (2%)
 Frame = +2

Query  167   MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
             M++++ VV+C+L+   +A      +F  ++ + FG+   ++ D G  + LNLD+  GSGF
Sbjct  9     MLLMLSVVSCNLL--IMAASSSAGDFYRNIDVTFGDQRAKILDGGKLLTLNLDKTLGSGF  66

Query  347   NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
              +K EYLFGR D+QMKLV G SAGTVTT+YL+S  G  HDE+DFEFLGN+T  PYT+HTN
Sbjct  67    RSKKEYLFGRIDIQMKLVPGNSAGTVTTYYLSSE-GVTHDEIDFEFLGNSTGNPYTLHTN  125

Query  527   VYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKS  706
             V+SQGKG +EQQFHLWFDPT +FHTY+ILWN  RIIF VDN PIRVF+N ESIG+PFPK 
Sbjct  126   VFSQGKGEREQQFHLWFDPTKSFHTYSILWNTHRIIFFVDNIPIRVFDNLESIGVPFPKK  185

Query  707   QPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasn  886
             QPMR+Y SLWNADDWATQGGLVKTDW+ APFTA YRN  ANAC+  +   S ++  + + 
Sbjct  186   QPMRIYSSLWNADDWATQGGLVKTDWAQAPFTASYRNLKANACLAGS---SSSTCVSTTA  242

Query  887   snQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
              ++ W  Q LD  GR R+RWVQ+K MVYNYC+D KRFPQGF  ECKRSRF
Sbjct  243   EDKAWQNQALDAAGRKRLRWVQNKFMVYNYCSDRKRFPQGFPPECKRSRF  292



>ref|XP_009356638.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Pyrus 
x bretschneideri]
Length=293

 Score =   373 bits (958),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 177/294 (60%), Positives = 219/294 (74%), Gaps = 7/294 (2%)
 Frame = +2

Query  158   QVCMIMIIGV-VACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQT  334
             ++ M++++ + + C +            NF  D  + FG+   ++ + G  + LNLDQ +
Sbjct  6     KLSMVVLLSLFITCVMA-----TAASAGNFYQDFDVTFGDGRAKILNGGQLLTLNLDQTS  60

Query  335   GSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYT  514
             GSGF +KNEYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PYT
Sbjct  61    GSGFKSKNEYLFGRIDMQIKLVSGNSAGTVTAYYLSSE-GPTHDEIDFEFLGNLSGDPYT  119

Query  515   VHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIP  694
             +HTNV+SQGKGN+EQQFHLWFDPT AFHTY+I+WN QRIIF+VD  PIRVFNN ES+GIP
Sbjct  120   LHTNVFSQGKGNREQQFHLWFDPTKAFHTYSIVWNAQRIIFLVDKIPIRVFNNLESVGIP  179

Query  695   FPKSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsia  874
             FPK+QPMR+Y SLWNADDWAT+GGLVKTDW+ APFTA YRNF A+AC   +  S  ++ +
Sbjct  180   FPKNQPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFKADACTAGSSSSCASTAS  239

Query  875   aasnsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
               S  +  W TQ LD  GRNR+RWVQ K MVYNYC+D KRFPQG  AEC+RSRF
Sbjct  240   TNSVGDSAWQTQGLDAAGRNRLRWVQQKFMVYNYCSDLKRFPQGLPAECRRSRF  293



>gb|AAR37363.1| xyloglucan endo-transglycosylase, partial [Nicotiana attenuata]
Length=257

 Score =   372 bits (954),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 177/256 (69%), Positives = 206/256 (80%), Gaps = 5/256 (2%)
 Frame = +2

Query  281   GQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQA  460
              Q+QD G  + L+LD+ +GSGF +KNE+LFGRFDMQ+KLV G SAGTVTTFYL+S  G  
Sbjct  3     AQIQDGGRLLTLSLDKISGSGFQSKNEFLFGRFDMQLKLVPGNSAGTVTTFYLSSQ-GAG  61

Query  461   HDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFM  640
             HDE+DFEFLGN++ QPYTVHTNVYSQGKGNKEQQFHLWFDPT +FHTY+I+WN QRIIF+
Sbjct  62    HDEIDFEFLGNSSGQPYTVHTNVYSQGKGNKEQQFHLWFDPTTSFHTYSIIWNSQRIIFL  121

Query  641   VDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNF  820
             VDN PIRV+NNHE++G+ FPK+Q MRVY SLWNADDWATQGG VKTDWS APFTA YRNF
Sbjct  122   VDNIPIRVYNNHEALGVAFPKNQAMRVYASLWNADDWATQGGRVKTDWSMAPFTASYRNF  181

Query  821   NANACVVTNGVssc----nsiaaasnsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADA  988
             N NACV +   S+     +    + N++Q W TQELD  GRNR+RWVQ K+M YNYCAD 
Sbjct  182   NTNACVWSAASSTSSCGGSKSTDSVNNDQTWQTQELDANGRNRLRWVQQKYMTYNYCADV  241

Query  989   KRFPQGFSAECKRSRF  1036
              RF QG   ECKRSRF
Sbjct  242   ARFSQGIPPECKRSRF  257



>ref|XP_011082924.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase 2-like [Sesamum 
indicum]
Length=288

 Score =   372 bits (956),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 178/267 (67%), Positives = 213/267 (80%), Gaps = 12/267 (4%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D ++ +G+   ++ + G  ++L+LDQ +GSGF +KNEYLFGRFD+Q+KLV G SAG
Sbjct  33    NFYRDAEITWGDGRAKILEGGRGLSLSLDQYSGSGFQSKNEYLFGRFDLQLKLVPGNSAG  92

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTF+L+S  G+ HDE+DFEFLGN + +PYTVHTNVY+ GKG+KEQQFHL  +PTAAFH
Sbjct  93    TVTTFFLSSQ-GEGHDEIDFEFLGNVSGEPYTVHTNVYAGGKGDKEQQFHLRSNPTAAFH  151

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+W+PQRIIF+VDN+PIRVFNNH SIGIPFP SQPMRV+CSLWNADDWATQGG VKT
Sbjct  152   TYSIVWHPQRIIFLVDNSPIRVFNNHNSIGIPFPTSQPMRVHCSLWNADDWATQGGRVKT  211

Query  779   DWSHAPFTAYYRNFNANACVV-TNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQS  955
             DW+ APF AYYRNF  + C V T+G S                TQELD KGRNR+RWVQ 
Sbjct  212   DWTKAPFVAYYRNFKIDGCPVGTSGGSCGFQSQ----------TQELDAKGRNRMRWVQQ  261

Query  956   KHMVYNYCADAKRFPQGFSAECKRSRF  1036
             KHM+YNYCAD +RFPQG SAECKRSRF
Sbjct  262   KHMIYNYCADVRRFPQGSSAECKRSRF  288



>ref|XP_009377621.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Pyrus 
x bretschneideri]
Length=293

 Score =   372 bits (955),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 176/266 (66%), Positives = 207/266 (78%), Gaps = 1/266 (0%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D    FG+   ++ + G  + LNLDQ +GSGF +KNEYLFGR DMQ+KLV G SAG
Sbjct  29    NFYQDFDFTFGDGRAKILNGGQLLTLNLDQASGSGFKSKNEYLFGRIDMQIKLVAGNSAG  88

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNV+SQGKGN+EQQFHLWFDPT AFH
Sbjct  89    TVTAYYLSSE-GPTHDEIDFEFLGNVSGDPYTLHTNVFSQGKGNREQQFHLWFDPTKAFH  147

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN QRIIF+VDN PIRVFNN ES+G+PFPK+QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  148   TYSIVWNTQRIIFLVDNIPIRVFNNLESVGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  207

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DW+ APFTA YRNF ANAC   +  S  ++ +  S  +  W TQ LD  GRNR+RWVQ K
Sbjct  208   DWTKAPFTASYRNFKANACTAGSSSSCASTASTNSVGDSAWQTQGLDAAGRNRLRWVQQK  267

Query  959   HMVYNYCADAKRFPQGFSAECKRSRF  1036
              MVYNYC D KRFPQG  AEC+RSRF
Sbjct  268   FMVYNYCNDLKRFPQGLPAECRRSRF  293



>gb|EYU31577.1| hypothetical protein MIMGU_mgv1a011275mg [Erythranthe guttata]
Length=287

 Score =   372 bits (954),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 176/269 (65%), Positives = 216/269 (80%), Gaps = 4/269 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             +F  D ++ +G+   ++ + G  ++L+LD  +GSGF +KNEYLFGRFD+Q+KLV G SAG
Sbjct  20    DFYRDAEITWGDGRAKILEGGRALSLSLDNYSGSGFQSKNEYLFGRFDIQLKLVPGNSAG  79

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTF+L+S  G  HDE+DFEFLGNAT +PYTVHTNVY++GKG+KEQQF LWFDP++A+H
Sbjct  80    TVTTFFLSSQ-GAGHDEIDFEFLGNATGEPYTVHTNVYAKGKGDKEQQFRLWFDPSSAYH  138

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESI-GIPFPKSQPMRVYCSLWNADDWATQGGLVK  775
             TY+ILWNPQRIIF+VDN PIRVFNN E+I G PFP SQPMRVYCSLWNADDWATQGG VK
Sbjct  139   TYSILWNPQRIIFLVDNIPIRVFNNEEAITGTPFPTSQPMRVYCSLWNADDWATQGGRVK  198

Query  776   TDWSHAPFTAYYRNFNANACVVTN--GVsscnsiaaasnsnQEWLTQELDGKGRNRVRWV  949
             TDW+ APF A YRNFN N CV  +  G  S +++ A   +N  W TQ LD  GRNR+RWV
Sbjct  199   TDWTKAPFVASYRNFNINGCVAGSQCGSGSDSNMKAEGANNNNWRTQGLDANGRNRLRWV  258

Query  950   QSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
             Q K+++YNYC+D+KRFPQG  AECKRSRF
Sbjct  259   QQKYIIYNYCSDSKRFPQGIPAECKRSRF  287



>ref|XP_008229404.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Prunus 
mume]
Length=285

 Score =   371 bits (952),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 174/293 (59%), Positives = 216/293 (74%), Gaps = 16/293 (5%)
 Frame = +2

Query  158   QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
             +V M++++ +   SL+ +  +      NF  D+ + FG+   ++ + G  + LNLD+ +G
Sbjct  9     KVSMVLVVSLFVTSLMAMTASAG----NFFQDIDVTFGDERAKILNGGQLLTLNLDKASG  64

Query  338   SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
             SGF +KNEYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PYT+
Sbjct  65    SGFKSKNEYLFGRIDMQIKLVSGNSAGTVTAYYLSSE-GPTHDEIDFEFLGNLSGDPYTL  123

Query  518   HTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPF  697
             HTNV+SQGKGN+EQQFHLWFDPT AFHTY+I+WN QRIIF+VDN PIRVF N E+IG+PF
Sbjct  124   HTNVFSQGKGNREQQFHLWFDPTKAFHTYSIVWNSQRIIFLVDNIPIRVFTNLETIGVPF  183

Query  698   PKSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaa  877
             PK+QPMR+Y SLWNADDWAT+GGLVKTDW+ APFTA YRNF A +   TN +        
Sbjct  184   PKNQPMRIYSSLWNADDWATRGGLVKTDWTKAPFTASYRNFQA-STTSTNSL--------  234

Query  878   asnsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
                    W TQ LD +GRNR+RWVQ K MVYNYC+D KRFPQG   EC+RSRF
Sbjct  235   --TEQSAWQTQGLDSEGRNRLRWVQQKFMVYNYCSDLKRFPQGLPVECRRSRF  285



>ref|XP_002306736.2| xyloglucan endo-1 family protein [Populus trichocarpa]
 gb|EEE93732.2| xyloglucan endo-1 family protein [Populus trichocarpa]
Length=294

 Score =   371 bits (952),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 182/290 (63%), Positives = 222/290 (77%), Gaps = 8/290 (3%)
 Frame = +2

Query  167   MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
             M +   ++AC L+G ++       NF  D  + +G+   ++ + G  + L+LD+ +GSGF
Sbjct  12    MPLFASLLAC-LLGASMGG-----NFFQDFDITWGDQRAKILNGGQLLTLSLDKDSGSGF  65

Query  347   NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
              +KNEYLFGR DMQ+KLV G SAGTVTT+YL+S  G  HDE+DFEFLGN T +PYT+HTN
Sbjct  66    RSKNEYLFGRIDMQIKLVSGNSAGTVTTYYLSSQ-GPTHDEIDFEFLGNVTGEPYTLHTN  124

Query  527   VYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKS  706
             V+SQGKGNKEQQF+LWFDPT AFHTY+I+WN QRIIF+VDN PIRVF+N ESIG+PFP  
Sbjct  125   VFSQGKGNKEQQFYLWFDPTKAFHTYSIVWNQQRIIFLVDNIPIRVFHNSESIGVPFPTK  184

Query  707   QPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasn  886
             QPMR+Y SLWNADDWAT+GGLVKTDW+ APFTA YRNF A+ACV + G SSC S +  S 
Sbjct  185   QPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFKASACVSSPG-SSCTSTSPNSL  243

Query  887   snQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
              +  W  Q LD  GRNR+RWVQ K+M+YNYC D KRFPQG  AECKRSRF
Sbjct  244   QDSTWQVQALDASGRNRLRWVQQKYMIYNYCTDLKRFPQGIPAECKRSRF  293



>emb|CDP15955.1| unnamed protein product [Coffea canephora]
Length=291

 Score =   370 bits (951),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 183/267 (69%), Positives = 213/267 (80%), Gaps = 2/267 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D    FG+   ++ + G  ++L+LD+ +GSGF +KNEYLFGRFDMQ+KLV G SAG
Sbjct  26    NFYQDAVTTFGDQRVKIAEGGRLLSLSLDKSSGSGFQSKNEYLFGRFDMQLKLVPGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL+S +GQ HDE+DFEFLGNA+ QPYT+HTNVYSQGKG+KEQQF LWFDPT  FH
Sbjct  86    TVTTFYLSS-VGQGHDEIDFEFLGNASGQPYTLHTNVYSQGKGDKEQQFKLWFDPTTFFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TYTI+WN QRIIF+VDN PIRV+NNHE+IG+PFPK+QPMRVYCS WNADDWATQGG VKT
Sbjct  145   TYTIVWNSQRIIFLVDNIPIRVYNNHEAIGVPFPKNQPMRVYCSFWNADDWATQGGQVKT  204

Query  779   DWSHAPFTAYYRNFNANACVVTNGVs-scnsiaaasnsnQEWLTQELDGKGRNRVRWVQS  955
             DW++APFT YYRNFN    V   G      S +  S + QEW TQ LDGKGRNR+RWVQ 
Sbjct  205   DWANAPFTVYYRNFNVKGDVCVPGSPCGSGSKSTDSLNTQEWETQGLDGKGRNRIRWVQQ  264

Query  956   KHMVYNYCADAKRFPQGFSAECKRSRF  1036
             KHM+YNYCAD KR+PQG   ECKR RF
Sbjct  265   KHMIYNYCADRKRYPQGLPVECKRPRF  291



>gb|EYU31576.1| hypothetical protein MIMGU_mgv1a011220mg [Erythranthe guttata]
Length=288

 Score =   370 bits (949),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 174/269 (65%), Positives = 214/269 (80%), Gaps = 4/269 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             +F  D ++ +G+   ++ + G  ++L+LD  +GSGF +KNEYLFGRFD+Q+KLV G SAG
Sbjct  21    DFYRDAEITWGDGRAKILEGGRALSLSLDNYSGSGFQSKNEYLFGRFDIQLKLVPGNSAG  80

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTF+L+S  G  HDE+DFEFLGNAT +PYTVHTNVY++GKG+KEQQF LWFDP++A+H
Sbjct  81    TVTTFFLSSQ-GAGHDEIDFEFLGNATGEPYTVHTNVYAKGKGDKEQQFRLWFDPSSAYH  139

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESI-GIPFPKSQPMRVYCSLWNADDWATQGGLVK  775
             TY+ILWNPQRIIF+VDN PIRVFNN E+I G PFP SQPMRVYCSLWNADDWATQGG VK
Sbjct  140   TYSILWNPQRIIFLVDNIPIRVFNNEEAITGTPFPTSQPMRVYCSLWNADDWATQGGRVK  199

Query  776   TDWSHAPFTAYYRNFNANACVVTN--GVsscnsiaaasnsnQEWLTQELDGKGRNRVRWV  949
             TDW+ APF A YRNFN N CV  +  G  S + +     +N  W TQ LD  GRNR+RWV
Sbjct  200   TDWTKAPFVATYRNFNINGCVAGSQCGSGSDSKLKTEGANNNNWRTQGLDANGRNRLRWV  259

Query  950   QSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
             Q K+++YNYC+D+KRFP+G  AECKRSRF
Sbjct  260   QQKYIIYNYCSDSKRFPKGIPAECKRSRF  288



>ref|NP_001280908.1| brassinosteroid-regulated protein BRU1-like precursor [Malus 
domestica]
 gb|ACD03230.1| xyloglucan endotransglucosylase/hydrolase 6 [Malus domestica]
Length=294

 Score =   370 bits (949),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 178/292 (61%), Positives = 217/292 (74%), Gaps = 5/292 (2%)
 Frame = +2

Query  161   VCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGS  340
             V M++ + +   SL+     +     NF  D  + FG+   ++ + G  + LNLDQ +GS
Sbjct  8     VNMVLFLFLFTTSLM----LMAASAGNFYQDFDVTFGDGRAKILNGGQLLTLNLDQASGS  63

Query  341   GFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVH  520
             GF +KNEYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PYT+H
Sbjct  64    GFKSKNEYLFGRIDMQIKLVAGNSAGTVTAYYLSSE-GPTHDEIDFEFLGNVSGDPYTLH  122

Query  521   TNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP  700
             TNV+SQGKGN+EQQF LWFDPT AFHTY+I+WN QRIIF+VDN PIRVFNN ES+G+PFP
Sbjct  123   TNVFSQGKGNREQQFQLWFDPTNAFHTYSIVWNSQRIIFLVDNIPIRVFNNLESVGVPFP  182

Query  701   KSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaa  880
             K+QPMR+Y SLWNADDWAT+GGLVKTDW+ APFTA YRNF ANAC   +  S  ++ +  
Sbjct  183   KNQPMRIYSSLWNADDWATRGGLVKTDWTKAPFTASYRNFKANACTADSSSSCASTASTN  242

Query  881   snsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
             S  +  W TQ LD  GRNR+RWVQ K M+YNYC D KRFPQG  AEC+RSRF
Sbjct  243   SVGDSAWQTQGLDAAGRNRLRWVQQKFMIYNYCNDLKRFPQGLPAECRRSRF  294



>ref|XP_011044804.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Populus 
euphratica]
Length=295

 Score =   369 bits (947),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 176/266 (66%), Positives = 211/266 (79%), Gaps = 2/266 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + +G+   ++ + G  + L+LD+ +GSGF +KNEYLFGR DMQ+KLV G SAG
Sbjct  31    NFFQDFDITWGDQRAKILNGGQLLTLSLDKDSGSGFRSKNEYLFGRIDMQIKLVSGNSAG  90

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTT+YL+S  G  HDE+DFEFLGN T +PYT+HTNV+SQGKGNKEQQF+LWFDPT AFH
Sbjct  91    TVTTYYLSSQ-GPTHDEIDFEFLGNVTGEPYTLHTNVFSQGKGNKEQQFYLWFDPTKAFH  149

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN QRIIF+VDN PIRVF+N ESIG+PFP  QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  150   TYSIVWNQQRIIFLVDNIPIRVFHNSESIGVPFPTKQPMRIYSSLWNADDWATRGGLVKT  209

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DW+ APFTA YRNF A ACV + G SSC + +  S  +  W  Q LD  GRNR+RWVQ K
Sbjct  210   DWTQAPFTASYRNFKAPACVRSPG-SSCTATSPNSVEDSTWQVQALDASGRNRLRWVQQK  268

Query  959   HMVYNYCADAKRFPQGFSAECKRSRF  1036
             +M+YNYC+D KRFPQG  AECKRSRF
Sbjct  269   YMIYNYCSDLKRFPQGIPAECKRSRF  294



>ref|XP_007215791.1| hypothetical protein PRUPE_ppa009863mg [Prunus persica]
 gb|EMJ16990.1| hypothetical protein PRUPE_ppa009863mg [Prunus persica]
Length=274

 Score =   368 bits (945),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 175/290 (60%), Positives = 214/290 (74%), Gaps = 16/290 (6%)
 Frame = +2

Query  167   MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
             M++++ +   SL+ +A +      NF  D  + FG+   ++ + G  + LNLD+ +GSGF
Sbjct  1     MVLVVSLFVTSLMAMAASAG----NFFQDFDVTFGDERAKILNGGQLLTLNLDKASGSGF  56

Query  347   NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
              +KNEYL GR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PYT+HTN
Sbjct  57    KSKNEYLLGRIDMQIKLVSGNSAGTVTAYYLSSE-GPTHDEIDFEFLGNLSGDPYTLHTN  115

Query  527   VYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKS  706
             V+SQGKGN+EQQFHLWFDPT AFHTY+I+WN QRIIF+VDN PIRVF+N E+IG+PFPKS
Sbjct  116   VFSQGKGNREQQFHLWFDPTKAFHTYSIVWNSQRIIFLVDNIPIRVFHNLETIGVPFPKS  175

Query  707   QPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasn  886
             QPMR+Y SLWNADDWAT+GGLVKTDW+ APFTA YRNF A +   TN +           
Sbjct  176   QPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFQA-STTSTNSL----------T  224

Query  887   snQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
                 W TQ LD  GRNR+RWVQ K MVYNYC+D KRFPQG  AEC+RSRF
Sbjct  225   EQSAWQTQGLDAAGRNRLRWVQQKFMVYNYCSDLKRFPQGLPAECRRSRF  274



>ref|XP_011044805.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Populus 
euphratica]
Length=342

 Score =   370 bits (951),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 176/266 (66%), Positives = 210/266 (79%), Gaps = 2/266 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + +G+   ++ + G  + L+LD+ +GSGF +KNEYLFGR DMQ+KLV G SAG
Sbjct  78    NFFQDFDITWGDQRAKILNGGQLLTLSLDKDSGSGFRSKNEYLFGRIDMQIKLVSGNSAG  137

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTT+YL+S  G  HDE+DFEFLGN T +PYT+HTNV+SQGKGNKEQQF+LWFDPT AFH
Sbjct  138   TVTTYYLSSQ-GPTHDEIDFEFLGNVTGEPYTLHTNVFSQGKGNKEQQFYLWFDPTKAFH  196

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN QRIIF+VDN P+RVF+N ESIG+PFP  QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  197   TYSIVWNQQRIIFLVDNIPLRVFHNSESIGVPFPTKQPMRIYSSLWNADDWATRGGLVKT  256

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DW+ APFTA YRNF A ACV + G SSC S +  S  +  W  Q LD  GRNR+RWVQ K
Sbjct  257   DWTQAPFTASYRNFKATACVRSPG-SSCTSTSPNSVEDSTWQVQALDASGRNRLRWVQQK  315

Query  959   HMVYNYCADAKRFPQGFSAECKRSRF  1036
             +M+YNYC D KRFPQG  AECKRSRF
Sbjct  316   YMIYNYCTDLKRFPQGIPAECKRSRF  341



>ref|XP_009597028.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Nicotiana 
tomentosiformis]
Length=300

 Score =   369 bits (946),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 176/270 (65%), Positives = 214/270 (79%), Gaps = 5/270 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + +G+    +Q+ G  + L+LD+ +GSGF +K+E+LFGRFDMQ+KL+ G SAG
Sbjct  32    NFYQDATVTWGDQRAHIQEGGRLLTLSLDKISGSGFQSKSEFLFGRFDMQLKLIPGNSAG  91

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL+S  G  HDE+DFEFLGN++ QPYTVHTNVYSQGKGNKEQQFHLWFDPT +FH
Sbjct  92    TVTTFYLSSQ-GAGHDEIDFEFLGNSSGQPYTVHTNVYSQGKGNKEQQFHLWFDPTTSFH  150

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN QRIIF+VDN PIRV+NNHE++G+ FPK+Q MRVY SLWNADDWATQGG VKT
Sbjct  151   TYSIIWNAQRIIFLVDNIPIRVYNNHEALGVAFPKNQAMRVYASLWNADDWATQGGRVKT  210

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaa----asnsnQEWLTQELDGKGRNRVRW  946
             DWS APFTA YRNFN NACV +   S+ +   +    ++N++Q W TQELD  GRNR+RW
Sbjct  211   DWSMAPFTASYRNFNTNACVWSAASSTSSCGGSTSTDSANNDQTWQTQELDANGRNRLRW  270

Query  947   VQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
             VQ K+M YNYC DA+RF Q    ECKRSRF
Sbjct  271   VQQKYMTYNYCTDAQRFNQVIPPECKRSRF  300



>ref|XP_009377610.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Pyrus 
x bretschneideri]
Length=294

 Score =   367 bits (943),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 176/292 (60%), Positives = 215/292 (74%), Gaps = 5/292 (2%)
 Frame = +2

Query  161   VCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGS  340
             V M++ + +   SL+     +     NF  D  + FG+   ++ + G  + LNLDQ +GS
Sbjct  8     VNMVLFLSLFTTSLM----VMAASAGNFYQDFDVTFGDGRAKILNGGQLLTLNLDQASGS  63

Query  341   GFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVH  520
             GF +KNEYL GR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PYT+H
Sbjct  64    GFKSKNEYLLGRIDMQIKLVTGNSAGTVTAYYLSSE-GPTHDEIDFEFLGNVSGDPYTLH  122

Query  521   TNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP  700
             TNV+SQGKGN+EQQF LWFDPT AFHTY+I+WN QRIIF+VDN PIRVFNN ES+G+PFP
Sbjct  123   TNVFSQGKGNREQQFQLWFDPTNAFHTYSIVWNSQRIIFLVDNIPIRVFNNLESVGVPFP  182

Query  701   KSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaa  880
             K+QPMR+Y SLWNADDWAT+GGLVKTDW+ APFTA YRNF ANAC   +  S  ++ +  
Sbjct  183   KNQPMRIYSSLWNADDWATRGGLVKTDWTKAPFTASYRNFKANACTADSSSSCASTASTN  242

Query  881   snsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
             S  +  W TQ LD  GRNR+RWV  K M+YNYC D KRFPQG  AEC+RSRF
Sbjct  243   SVGDSAWQTQGLDAAGRNRLRWVHQKFMIYNYCNDLKRFPQGLPAECRRSRF  294



>gb|EYU29581.1| hypothetical protein MIMGU_mgv1a022262mg [Erythranthe guttata]
Length=272

 Score =   367 bits (941),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 177/285 (62%), Positives = 212/285 (74%), Gaps = 17/285 (6%)
 Frame = +2

Query  182   GVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNE  361
             G+    L+   +A  P   NF  D ++ +G+   ++ D G  ++L+LDQ +GSGF +KNE
Sbjct  5     GISLFVLLACLVAAAPSTANFIRDAEITWGDGRAKIVDGGRGLSLSLDQFSGSGFQSKNE  64

Query  362   YLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQG  541
             YLFGRFDMQ+KLV   SAGTVTTF+L+S  G+ HDE+DFEFLGN+T +PYTVHTNVY+QG
Sbjct  65    YLFGRFDMQLKLVPDNSAGTVTTFFLSSQ-GEGHDEIDFEFLGNSTGEPYTVHTNVYAQG  123

Query  542   KGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRV  721
             KG+KEQQF LWFDPTAAFHTY+I+WNPQRIIF+VDN+PIRVFNNH++ G+ FP SQPMRV
Sbjct  124   KGDKEQQFKLWFDPTAAFHTYSIVWNPQRIIFLVDNSPIRVFNNHKASGVQFPTSQPMRV  183

Query  722   YCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEW  901
             YCSLWNADDWATQGG VKTDW+ APF A YRNF   +C      +               
Sbjct  184   YCSLWNADDWATQGGRVKTDWAKAPFVANYRNFKIESCAAGTPCA---------------  228

Query  902   LTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
              + ELD  GRNR+RWVQ KHMVYNYCADA RFP G S ECKRSRF
Sbjct  229   -SHELDSNGRNRLRWVQQKHMVYNYCADATRFPLGTSIECKRSRF  272



>ref|XP_010246961.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Nelumbo 
nucifera]
Length=291

 Score =   367 bits (942),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 177/289 (61%), Positives = 223/289 (77%), Gaps = 7/289 (2%)
 Frame = +2

Query  170   IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
             +++I +V  SL+           +F  D  + +G+H  ++ + G  ++L+LD+ +GSGF 
Sbjct  9     VLLIALVMSSLMAACAG------SFYQDFDLTWGDHRAKIFNGGQLLSLSLDRTSGSGFQ  62

Query  350   TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
             +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +HTNV
Sbjct  63    SKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILHTNV  121

Query  530   YSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQ  709
             ++QGKGN+EQQF+LWFDPT  FHTY+I+WNPQRIIF+VDN PIR F+N ESIG+PFPK+Q
Sbjct  122   FTQGKGNREQQFYLWFDPTRNFHTYSIVWNPQRIIFLVDNVPIREFSNAESIGVPFPKNQ  181

Query  710   PMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasns  889
             PMR+Y SLWNADDWAT+GGLVKTDWS APFTAYYRNFNANACV ++G SSC+S +  S  
Sbjct  182   PMRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRNFNANACVWSSGSSSCSSRSTNSFK  241

Query  890   nQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
             + +W TQELDG  R R+RWVQ  +M+YNYC D KRFPQG   EC+RSRF
Sbjct  242   DSDWQTQELDGWSRRRLRWVQKYYMIYNYCTDLKRFPQGLPPECRRSRF  290



>gb|EYU29580.1| hypothetical protein MIMGU_mgv1a018934mg [Erythranthe guttata]
Length=272

 Score =   365 bits (938),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 176/285 (62%), Positives = 212/285 (74%), Gaps = 17/285 (6%)
 Frame = +2

Query  182   GVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNE  361
             G+    L+   +A  P   NF  D ++ +G+   ++ D G  ++L+LDQ +GSGF +KNE
Sbjct  5     GISLFVLLACLVAAAPSTANFIRDAEITWGDGRAKIVDGGRGLSLSLDQFSGSGFQSKNE  64

Query  362   YLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQG  541
             YLFGRFDMQ+KLV   SAGTVTTF+L+S  G+ HDE+DFEFLGN+T +PYTVHTNVY+QG
Sbjct  65    YLFGRFDMQLKLVPDNSAGTVTTFFLSSQ-GEGHDEIDFEFLGNSTGEPYTVHTNVYAQG  123

Query  542   KGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRV  721
             KG+KEQQF LWFDPTAAFHTY+I+WNPQRIIF+VDN+PIRVFNNH++ G+ FP SQPMRV
Sbjct  124   KGDKEQQFKLWFDPTAAFHTYSIVWNPQRIIFLVDNSPIRVFNNHKASGVQFPTSQPMRV  183

Query  722   YCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEW  901
             YCSLWNADDWATQGG VKTDW+ APF A YRNF   +C      +               
Sbjct  184   YCSLWNADDWATQGGRVKTDWAKAPFVANYRNFKIESCAAGTPCA---------------  228

Query  902   LTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
              + ELD  GRNR+RWVQ KHM+YNYCADA RFP G S ECKRSRF
Sbjct  229   -SHELDSNGRNRLRWVQQKHMLYNYCADATRFPLGTSIECKRSRF  272



>ref|XP_008229403.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Prunus 
mume]
Length=285

 Score =   365 bits (938),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 174/293 (59%), Positives = 216/293 (74%), Gaps = 16/293 (5%)
 Frame = +2

Query  158   QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
             +V M++++ +   SL+ +A +      NF  D  + FG+   ++ + G  + LNLD+ +G
Sbjct  9     KVSMVLVVSLFVTSLMAMAASAG----NFFQDFDVTFGDERVKILNGGQLLTLNLDKASG  64

Query  338   SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
             SGF +KNEYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PYT+
Sbjct  65    SGFKSKNEYLFGRIDMQIKLVSGNSAGTVTAYYLSSE-GPTHDEIDFEFLGNLSGDPYTL  123

Query  518   HTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPF  697
             HTNV+SQGKGN+EQQFHLWFDPT AFHTY+I+WN QRIIF+VDN PIRVF+N E+IG+PF
Sbjct  124   HTNVFSQGKGNREQQFHLWFDPTRAFHTYSIVWNSQRIIFLVDNIPIRVFHNLETIGVPF  183

Query  698   PKSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaa  877
             PKSQPMR+Y SLWNADDWAT+GGLVKTDW+ APFTA YRNF A +   TN +        
Sbjct  184   PKSQPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFQA-STTSTNSL--------  234

Query  878   asnsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
                    W  Q LD  GRNR+RWVQ K M+YNYC+D KRFPQG  AEC++SRF
Sbjct  235   --TEQSAWQNQGLDAAGRNRLRWVQQKFMIYNYCSDLKRFPQGLPAECRQSRF  285



>gb|EPS58668.1| hypothetical protein M569_16144, partial [Genlisea aurea]
Length=273

 Score =   365 bits (936),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 179/287 (62%), Positives = 218/287 (76%), Gaps = 14/287 (5%)
 Frame = +2

Query  176   IIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTK  355
             +  +V C LV  A A      NF +DV + +G+   Q+ D+GN + L+LD+ +GSGF ++
Sbjct  1     VYALVVCVLVATAAA------NFYSDVDVTWGDGRAQILDSGNELTLSLDKSSGSGFQSR  54

Query  356   NEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYS  535
             N+YLFGRFDMQ+KLV G SAGTVTTF+L+S  G  HDE+DFEFLGN++  PYTVHTNV++
Sbjct  55    NQYLFGRFDMQLKLVPGNSAGTVTTFFLSSQ-GADHDEIDFEFLGNSSGDPYTVHTNVFA  113

Query  536   QGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPM  715
             QGKGN+EQQF LWFDPTA FHTY+I+WNPQRIIFMVD  PIRVF+N+++IGIPFP +Q M
Sbjct  114   QGKGNREQQFRLWFDPTADFHTYSIVWNPQRIIFMVDQIPIRVFSNNQAIGIPFPNTQAM  173

Query  716   RVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQ  895
             RVYCSLWNADDWATQGG VKTDWS APFTA YRNF  NAC       S     + + S+ 
Sbjct  174   RVYCSLWNADDWATQGGRVKTDWSLAPFTASYRNFAINAC-------SPGQCGSDTFSSG  226

Query  896   EWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
              W TQ LD +GRNR+RWVQ  +M+YNYC D KRFPQG   ECK+SRF
Sbjct  227   AWKTQALDAQGRNRLRWVQQNYMIYNYCTDYKRFPQGIPVECKQSRF  273



>ref|XP_008229401.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Prunus 
mume]
Length=282

 Score =   365 bits (936),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 172/293 (59%), Positives = 213/293 (73%), Gaps = 16/293 (5%)
 Frame = +2

Query  158   QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
             +V M++++ +   SL+ +  +      NF  D  + FG    ++   G  + L+LD+ +G
Sbjct  6     EVSMVLVVSLFVTSLMAITASAG----NFYQDFDITFGGERAKILTGGQLLTLSLDKFSG  61

Query  338   SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
             SGF +KNEYL GR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PYT+
Sbjct  62    SGFKSKNEYLLGRIDMQIKLVSGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTL  120

Query  518   HTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPF  697
             HTNV+SQGKGN+EQQFHLWFDPT AFHTY+I+WN QRIIF+VDN PIRVF+N E+IG+PF
Sbjct  121   HTNVFSQGKGNREQQFHLWFDPTKAFHTYSIVWNSQRIIFLVDNIPIRVFHNLETIGVPF  180

Query  698   PKSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaa  877
             PK+QPMR+Y SLWNADDWAT+GGLVKTDW+ APFTA YRNF A +   TN +        
Sbjct  181   PKNQPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFQA-STTSTNSL--------  231

Query  878   asnsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
                    W TQ LD  GRNR+RWVQ K M+YNYC+D KRFPQG  AEC+RSRF
Sbjct  232   --TEQSAWQTQGLDAAGRNRLRWVQQKFMIYNYCSDLKRFPQGLPAECRRSRF  282



>ref|XP_007215773.1| hypothetical protein PRUPE_ppa009608mg [Prunus persica]
 gb|EMJ16972.1| hypothetical protein PRUPE_ppa009608mg [Prunus persica]
Length=285

 Score =   364 bits (935),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 173/293 (59%), Positives = 214/293 (73%), Gaps = 13/293 (4%)
 Frame = +2

Query  158   QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
             +V M++++ +   SL+ +  +      NF  D  + FG    ++ + G  + LNLD+ +G
Sbjct  6     EVSMVLVVSLFVTSLMALTASAG----NFYQDFDITFGGERAKILNGGQLLTLNLDKFSG  61

Query  338   SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
             SGF +KNEYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PYT+
Sbjct  62    SGFKSKNEYLFGRIDMQIKLVSGNSAGTVTAYYLSSE-GPTHDEIDFEFLGNLSGDPYTL  120

Query  518   HTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPF  697
             HTNV+SQGKGN+EQQFHLWFDPT AFHTY+I+WN QRIIF+VDN PIRVF+N E+IG+PF
Sbjct  121   HTNVFSQGKGNREQQFHLWFDPTKAFHTYSIVWNSQRIIFLVDNIPIRVFHNLETIGVPF  180

Query  698   PKSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaa  877
             PK+QPMR+Y SLWNADDWAT+GGLVKTDW+ APFTA YRNF  +    T+          
Sbjct  181   PKNQPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFKVSTTTSTS--------TN  232

Query  878   asnsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
             +     EW TQ LD  GRNR+RWVQ K MVYNYC+D KRFPQG   EC+RSRF
Sbjct  233   SLTEQSEWQTQGLDAAGRNRLRWVQQKFMVYNYCSDLKRFPQGLPVECRRSRF  285



>gb|KDP33066.1| hypothetical protein JCGZ_13603 [Jatropha curcas]
Length=271

 Score =   363 bits (933),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 172/266 (65%), Positives = 211/266 (79%), Gaps = 2/266 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  +  + +G+   ++ + G  + L+LD+ +GSGF +KNEYLFGR D+Q+KLV G SAG
Sbjct  7     NFYQNFDITWGDGRAKILNGGQLLTLSLDKASGSGFQSKNEYLFGRIDVQIKLVPGNSAG  66

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL+S  G  HDE+DFEFLGN++  PY +HTNVYSQGKGN+EQQF+LWFDPT  FH
Sbjct  67    TVTTFYLSSQ-GPNHDEIDFEFLGNSSGDPYILHTNVYSQGKGNREQQFYLWFDPTLTFH  125

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN Q+IIFMVDN PIRVFNN ESIG+PFP  QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  126   TYSIVWNAQKIIFMVDNIPIRVFNNLESIGVPFPNKQPMRIYSSLWNADDWATRGGLVKT  185

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DW++APF A YRNF ANACV ++G S C   +  S  + +W  QELD  GRNR+RWVQ K
Sbjct  186   DWTNAPFIASYRNFKANACVWSSG-SPCALTSTNSLQDSKWQVQELDASGRNRLRWVQKK  244

Query  959   HMVYNYCADAKRFPQGFSAECKRSRF  1036
             +M+YNYC+D KRFPQG  +ECKRSRF
Sbjct  245   YMIYNYCSDYKRFPQGLPSECKRSRF  270



>ref|XP_010525736.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
20-like [Tarenaya hassleriana]
Length=294

 Score =   364 bits (935),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 179/291 (62%), Positives = 219/291 (75%), Gaps = 8/291 (3%)
 Frame = +2

Query  158   QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
             +   +M+  +V+C  V  A        NF  DVQ+ +G+  G++ DNGN +AL+LDQ +G
Sbjct  12    RFLFLMLSLLVSCFAVAFAG-------NFQRDVQITWGDGRGKILDNGNLLALSLDQFSG  64

Query  338   SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
             SGF +KNE+L+G+ + Q+KLV G SAGTVTTFYL SP G   DE+DFEFLGN +  PYT+
Sbjct  65    SGFQSKNEFLYGKVEAQIKLVPGNSAGTVTTFYLKSP-GSTWDEIDFEFLGNLSGHPYTL  123

Query  518   HTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPF  697
             HTNVY+QGKG+KEQQFHLWFDPTA FHTY+I WNPQRIIF VD  PIR F N ESIG+PF
Sbjct  124   HTNVYTQGKGDKEQQFHLWFDPTADFHTYSITWNPQRIIFTVDGIPIREFKNFESIGVPF  183

Query  698   PKSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaa  877
             PK+QPMR+Y SLW AD+WAT+GGLVKTDWSHAPFTA YRN+N N CV +NG SSC + + 
Sbjct  184   PKNQPMRLYASLWEADEWATRGGLVKTDWSHAPFTASYRNYNENGCVWSNGRSSCPANSP  243

Query  878   asnsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRS  1030
              S     W +QELD +G+NRV+WVQ ++MVYNYC D KRFPQG   EC  S
Sbjct  244   GSRPGGAWFSQELDFRGKNRVKWVQRRYMVYNYCTDKKRFPQGAPRECNMS  294



>ref|XP_010450105.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15 [Camelina sativa]
Length=289

 Score =   364 bits (934),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 171/288 (59%), Positives = 217/288 (75%), Gaps = 8/288 (3%)
 Frame = +2

Query  170   IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
             I++  V+  S+VG A +      NF N+  + +G+H G++ + G+ ++L+LD+ +GSGF 
Sbjct  9     IVVATVLLMSMVGSAYSG-----NFFNEFDLTWGDHRGKIFNGGSMLSLSLDRVSGSGFK  63

Query  350   TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
             +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G+ HDE+DFEFLGN T +PY +HTNV
Sbjct  64    SKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GETHDEIDFEFLGNETGKPYVLHTNV  122

Query  530   YSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQ  709
             ++QGKGN+EQQF+LWFDPT  FHTY+I+W PQ IIF+VDN PIRVFNN E +G+PFPKSQ
Sbjct  123   FAQGKGNREQQFYLWFDPTKNFHTYSIVWRPQHIIFLVDNLPIRVFNNAEKLGVPFPKSQ  182

Query  710   PMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasns  889
             PMR+Y SLWNADDWAT+GGLVKTDWS APFTAYYR FNA AC V++G       +     
Sbjct  183   PMRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRGFNAAACTVSSGCDPKFKSSFGDGK  242

Query  890   nQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSR  1033
              Q  +  EL+  GR R+RWVQ   M+YNYC+D KRFP+GF  ECKRSR
Sbjct  243   LQ--IASELNAYGRRRLRWVQKYFMIYNYCSDLKRFPRGFPPECKRSR  288



>ref|XP_002520387.1| Brassinosteroid-regulated protein BRU1 precursor, putative [Ricinus 
communis]
 gb|EEF42003.1| Brassinosteroid-regulated protein BRU1 precursor, putative [Ricinus 
communis]
Length=287

 Score =   363 bits (932),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 176/289 (61%), Positives = 216/289 (75%), Gaps = 9/289 (3%)
 Frame = +2

Query  170   IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
             ++ + V+ C L            NF     + +G+  G++ + G  + L+LD+ +GSGF 
Sbjct  7     LLSVFVICCLLA-------VSEANFYKHFDITWGDQRGKILNGGQLLTLSLDKASGSGFQ  59

Query  350   TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
             +KNEYLFGR DMQ+KLV G SAGTVTTFYL+S  G  HDE+DFEFLGN +  PY +HTNV
Sbjct  60    SKNEYLFGRIDMQIKLVPGNSAGTVTTFYLSSQ-GPNHDEIDFEFLGNLSGDPYILHTNV  118

Query  530   YSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQ  709
             +SQGKGN+EQQFHLWFDPT AFHTY+I+WN QRI+F+VDN PIRVFNN ESIG+PFP  +
Sbjct  119   FSQGKGNREQQFHLWFDPTLAFHTYSIVWNAQRIMFLVDNIPIRVFNNLESIGVPFPNKK  178

Query  710   PMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasns  889
             PMR+Y SLWNADDWAT+GGLVKTDW+ APFTA YRNFNANACV ++G S C  I+  S  
Sbjct  179   PMRIYSSLWNADDWATRGGLVKTDWTKAPFTASYRNFNANACVWSSG-SPCELISTNSLQ  237

Query  890   nQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
             +  W  QEL+  GRNR+RWV  K+M+YNYC D KRFP+G   ECKRSRF
Sbjct  238   DSAWQLQELNASGRNRIRWVHQKYMIYNYCTDFKRFPEGLPPECKRSRF  286



>ref|XP_006387415.1| xyloglucan endo-1 family protein, partial [Populus trichocarpa]
 gb|ERP46329.1| xyloglucan endo-1 family protein, partial [Populus trichocarpa]
Length=271

 Score =   363 bits (931),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 174/266 (65%), Positives = 211/266 (79%), Gaps = 2/266 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + +G+   ++ + G  + L+LD+ +GSGF +KNEYLFGR DMQ+KLV G SAG
Sbjct  7     NFFQDFDITWGDQRAKILNGGQLLTLSLDKDSGSGFRSKNEYLFGRIDMQIKLVSGNSAG  66

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTT+YL+S  G  HDE+DFEFLGN T +PYT+HTNV+SQGKGNKEQQF+LWFDPT AFH
Sbjct  67    TVTTYYLSSQ-GPTHDEIDFEFLGNLTGEPYTLHTNVFSQGKGNKEQQFYLWFDPTKAFH  125

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN Q+IIF+VDN PIRVF+N ESIG+PFP  QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  126   TYSIVWNQQQIIFLVDNIPIRVFHNSESIGVPFPTKQPMRIYSSLWNADDWATRGGLVKT  185

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DW+ APFTA YRNF A+AC V++ VSSC S +  S  +  W  Q LD  GRNR+RWVQ K
Sbjct  186   DWTQAPFTASYRNFKASAC-VSSPVSSCTSTSPNSLQDSTWQVQALDASGRNRLRWVQQK  244

Query  959   HMVYNYCADAKRFPQGFSAECKRSRF  1036
             +M+YNYC D KRFPQG  AE +RSRF
Sbjct  245   YMIYNYCTDLKRFPQGIPAEMQRSRF  270



>ref|XP_010435185.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15 [Camelina sativa]
Length=289

 Score =   363 bits (932),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 172/288 (60%), Positives = 216/288 (75%), Gaps = 8/288 (3%)
 Frame = +2

Query  170   IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
             I++  V+  S+VG A +      NF N+  + +G+H G++ + GN ++L+LD+ +GSGF 
Sbjct  9     IVVATVLLMSMVGSAYSG-----NFFNEFDLTWGDHRGKIFNGGNMLSLSLDRVSGSGFK  63

Query  350   TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
             +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN T +PY +HTNV
Sbjct  64    SKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GATHDEIDFEFLGNETGKPYVLHTNV  122

Query  530   YSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQ  709
             ++QGKGN+EQQF+LWFDPT  FHTY+I+W PQ IIF+VDN PIRVFNN E +G+PFPKSQ
Sbjct  123   FAQGKGNREQQFYLWFDPTKNFHTYSIVWRPQHIIFLVDNLPIRVFNNAEKLGVPFPKSQ  182

Query  710   PMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasns  889
             PMR+Y SLWNADDWAT+GGLVKTDWS APFTAYYR FNA AC V++G       +     
Sbjct  183   PMRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRGFNAAACTVSSGCDPKFKRSFGDGK  242

Query  890   nQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSR  1033
              Q  +  EL+  GR R+RWVQ   M+YNYC+D KRFP+GF  ECKRSR
Sbjct  243   LQ--VANELNAYGRRRLRWVQKYFMIYNYCSDLKRFPRGFPPECKRSR  288



>gb|KDP35747.1| hypothetical protein JCGZ_10519 [Jatropha curcas]
Length=271

 Score =   362 bits (929),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 171/266 (64%), Positives = 210/266 (79%), Gaps = 2/266 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF ND  + +G+   ++ + G  + L+LD+ +GSGF +KNEYLFGR DMQ+KLV G SAG
Sbjct  7     NFYNDFDITWGDGRAKILNGGQLLTLSLDKASGSGFRSKNEYLFGRIDMQIKLVPGNSAG  66

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL+S  G  HDE+D EFLGN++  PY +HTNV+SQGKGN+EQQF+LWFDPT  FH
Sbjct  67    TVTTFYLSSQ-GPNHDEIDLEFLGNSSGDPYILHTNVFSQGKGNREQQFYLWFDPTFTFH  125

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN Q+IIF+VDN PIRVFNN ESIG+PFP  QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  126   TYSIVWNAQKIIFLVDNIPIRVFNNLESIGVPFPSKQPMRIYSSLWNADDWATRGGLVKT  185

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DW++APF A YRNF ANACV ++G S C   +  S  + +W  QELD  GRNR RWVQ K
Sbjct  186   DWTNAPFIASYRNFKANACVWSSG-SPCAVTSTNSLQDSKWQVQELDASGRNRPRWVQKK  244

Query  959   HMVYNYCADAKRFPQGFSAECKRSRF  1036
             +M+YNYC+D +RFPQG  +ECKRSRF
Sbjct  245   YMIYNYCSDYQRFPQGLPSECKRSRF  270



>ref|XP_008341405.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Malus 
domestica]
Length=294

 Score =   362 bits (930),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 172/294 (59%), Positives = 215/294 (73%), Gaps = 6/294 (2%)
 Frame = +2

Query  158   QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
             +V MI+ + +   SL+ +A        NF  D  + FG+   ++ D G  + LNLDQ +G
Sbjct  6     KVLMILFLSLFINSLMAMAAQAG----NFYQDFDVTFGDGRAKILDGGKLLTLNLDQVSG  61

Query  338   SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
             SGF +KNEYLFGR DMQ+KLV G SAGTVTT+YL+S  G  HDE+DFEFLGN+T +PYT+
Sbjct  62    SGFKSKNEYLFGRIDMQIKLVPGNSAGTVTTYYLSSE-GLTHDEIDFEFLGNSTGEPYTL  120

Query  518   HTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPF  697
             HTNV+SQGKG +EQQFHLWFDPT  FHTY+I+WN Q IIF+VD+ PIRVFNN ES G+PF
Sbjct  121   HTNVFSQGKGGREQQFHLWFDPTKTFHTYSIVWNRQNIIFLVDSIPIRVFNNLESAGVPF  180

Query  698   PKSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVV-TNGVsscnsia  874
             PK+QPMRVY SLWNAD+WAT+GGLVKT+W+ APFTA YRNF A+AC+  ++   +     
Sbjct  181   PKTQPMRVYSSLWNADEWATRGGLVKTNWTLAPFTATYRNFKADACIAGSSSSCASTIPT  240

Query  875   aasnsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
                     W TQ +D  GR R+RWVQ K M+YNYC+D KRFP+G  AECK+SR 
Sbjct  241   NPLTEKSAWETQGIDAAGRKRLRWVQQKFMIYNYCSDFKRFPEGLPAECKQSRL  294



>ref|XP_008229405.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Prunus 
mume]
Length=288

 Score =   362 bits (930),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 173/293 (59%), Positives = 212/293 (72%), Gaps = 13/293 (4%)
 Frame = +2

Query  158   QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
             +V M+ I+ +V  SL+ +  +      NF  D  + FG+   ++ + G  + LNLD+ +G
Sbjct  9     KVSMVFILSLVITSLMAMTASAG----NFFQDFDVTFGDERAKILNGGQLLTLNLDKASG  64

Query  338   SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
             SGF +KNEYL GR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PYT+
Sbjct  65    SGFKSKNEYLLGRIDMQIKLVSGNSAGTVTAYYLSSE-GPTHDEIDFEFLGNLSGDPYTL  123

Query  518   HTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPF  697
             HTNV+SQGKGN+EQQFHLWFDPT AFHTY+I+WN QRIIF+VDN PIRVF N E+IG+PF
Sbjct  124   HTNVFSQGKGNREQQFHLWFDPTKAFHTYSIVWNSQRIIFLVDNIPIRVFTNLETIGVPF  183

Query  698   PKSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaa  877
             PK+QPMR+Y SLWNADDWAT+GGLVKTDW+ APFTA YRNF  +    T+          
Sbjct  184   PKNQPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFKVSTTTSTS--------TN  235

Query  878   asnsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
             +      W TQ LD  GRNR+RWVQ K MVYNYC+D KRFPQG   EC+RSRF
Sbjct  236   SLTEQSAWPTQGLDAAGRNRLRWVQQKFMVYNYCSDLKRFPQGLPVECRRSRF  288



>gb|KCW89706.1| hypothetical protein EUGRSUZ_A01968 [Eucalyptus grandis]
Length=340

 Score =   364 bits (934),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 174/266 (65%), Positives = 213/266 (80%), Gaps = 1/266 (0%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + +G+H  Q+ + G  + L+LDQ +GSGF +KNEYLFGR DM++KLV+G SAG
Sbjct  75    NFYKDFDITWGDHRSQILNGGQELTLSLDQASGSGFKSKNEYLFGRIDMEIKLVEGNSAG  134

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TV  +YL+S  G  HDE+DFEFLGN +  PYT+HTNV+SQGKGN+EQQFHLWFDPT AFH
Sbjct  135   TVNAYYLSSQ-GPTHDEIDFEFLGNLSGNPYTLHTNVFSQGKGNREQQFHLWFDPTKAFH  193

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN +RIIF+VDN+PIRVFNN ESIG+PFP +QPMR+Y SLWNADDWAT GG VKT
Sbjct  194   TYSIVWNTRRIIFLVDNSPIRVFNNLESIGVPFPSNQPMRIYSSLWNADDWATMGGRVKT  253

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DW+ APFTA +RNFNANACVV++G SSC S +  +     W  Q L+  GRNR+RWVQ K
Sbjct  254   DWTKAPFTASFRNFNANACVVSSGSSSCGSKSTNNLQTSAWQEQSLNAAGRNRLRWVQQK  313

Query  959   HMVYNYCADAKRFPQGFSAECKRSRF  1036
             +M+YNYC+D+KRFPQG   ECKRSRF
Sbjct  314   YMIYNYCSDSKRFPQGLPPECKRSRF  339



>ref|XP_010053265.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16 [Eucalyptus grandis]
Length=291

 Score =   362 bits (929),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 174/266 (65%), Positives = 213/266 (80%), Gaps = 1/266 (0%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + +G+H  Q+ + G  + L+LDQ +GSGF +KNEYLFGR DM++KLV+G SAG
Sbjct  26    NFYKDFDITWGDHRSQILNGGQELTLSLDQASGSGFKSKNEYLFGRIDMEIKLVEGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TV  +YL+S  G  HDE+DFEFLGN +  PYT+HTNV+SQGKGN+EQQFHLWFDPT AFH
Sbjct  86    TVNAYYLSSQ-GPTHDEIDFEFLGNLSGNPYTLHTNVFSQGKGNREQQFHLWFDPTKAFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN +RIIF+VDN+PIRVFNN ESIG+PFP +QPMR+Y SLWNADDWAT GG VKT
Sbjct  145   TYSIVWNTRRIIFLVDNSPIRVFNNLESIGVPFPSNQPMRIYSSLWNADDWATMGGRVKT  204

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DW+ APFTA +RNFNANACVV++G SSC S +  +     W  Q L+  GRNR+RWVQ K
Sbjct  205   DWTKAPFTASFRNFNANACVVSSGSSSCGSKSTNNLQTSAWQEQSLNAAGRNRLRWVQQK  264

Query  959   HMVYNYCADAKRFPQGFSAECKRSRF  1036
             +M+YNYC+D+KRFPQG   ECKRSRF
Sbjct  265   YMIYNYCSDSKRFPQGLPPECKRSRF  290



>ref|XP_008229400.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Prunus 
mume]
Length=285

 Score =   362 bits (929),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 172/293 (59%), Positives = 212/293 (72%), Gaps = 13/293 (4%)
 Frame = +2

Query  158   QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
             +V M++++ +   SL+ +  +      NF  D  + FG    ++ + G  + LNLD+ +G
Sbjct  6     EVSMVLVVSLFVTSLMAMTASAG----NFYQDFDITFGGERAKILNGGQLLTLNLDKFSG  61

Query  338   SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
             SGF +KNEYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PYT+
Sbjct  62    SGFKSKNEYLFGRIDMQIKLVSGNSAGTVTAYYLSSE-GPTHDEIDFEFLGNLSGDPYTL  120

Query  518   HTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPF  697
             HTNV+SQGKGN+EQQF LWFDPT AFHTY+I+WN QRIIF+VDN PIRVF+N E+IG+PF
Sbjct  121   HTNVFSQGKGNREQQFQLWFDPTKAFHTYSIVWNSQRIIFLVDNIPIRVFHNLETIGVPF  180

Query  698   PKSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaa  877
             PKSQPMR+Y SLWNADDWAT+GGLVKTDW+ APFTA YRNF  +    T+          
Sbjct  181   PKSQPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFKVSTTASTS--------TN  232

Query  878   asnsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
             +      W TQ LD  GRNR+RWVQ K MVYNYC+D KRFPQG   EC+RSRF
Sbjct  233   SLTEQSAWQTQGLDAAGRNRIRWVQQKFMVYNYCSDLKRFPQGLPVECRRSRF  285



>gb|AFR46576.1| xyloglucan endotransglucosylase/hydrolase 7, partial [Rosa x 
borboniana]
Length=257

 Score =   361 bits (926),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 168/258 (65%), Positives = 197/258 (76%), Gaps = 4/258 (2%)
 Frame = +2

Query  272   NHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPI  451
             +   ++ + G  + LNLD+ +GSGF +KNEYLFGR DMQ+KLV G SAGTVTT+YL+S  
Sbjct  1     DQRAKILEGGQFLTLNLDKYSGSGFKSKNEYLFGRIDMQIKLVPGNSAGTVTTYYLSSE-  59

Query  452   GQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRI  631
             G  HDE+DFEFLGN++  PYT+HTNV+SQGKG++EQQFHLWFDPT AFHTY+ +WN QRI
Sbjct  60    GPTHDEIDFEFLGNSSGDPYTLHTNVFSQGKGDREQQFHLWFDPTTAFHTYSFVWNSQRI  119

Query  632   IFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYY  811
             IF VDN PIRVFNN ES G+PFPK+QPMR+Y SLWNADDWATQGG VKTDW+ APFTA Y
Sbjct  120   IFFVDNIPIRVFNNMESFGVPFPKNQPMRIYSSLWNADDWATQGGRVKTDWTQAPFTASY  179

Query  812   RNFNANACVV---TNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCA  982
             RNF ANACV    ++        +        W TQ LD  GRNR+RWVQ K MVYNYC+
Sbjct  180   RNFKANACVAGSSSSSCGVATVASTDKTQQSAWQTQTLDAAGRNRLRWVQQKFMVYNYCS  239

Query  983   DAKRFPQGFSAECKRSRF  1036
             D KRFPQG   ECKRSRF
Sbjct  240   DLKRFPQGLPVECKRSRF  257



>ref|XP_010440528.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15 [Camelina sativa]
Length=290

 Score =   362 bits (929),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 171/294 (58%), Positives = 214/294 (73%), Gaps = 7/294 (2%)
 Frame = +2

Query  152   QQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQ  331
             Q     I++  V+  S+VG A +      NF N+  + +G+H G++ + GN ++L+LD+ 
Sbjct  3     QNSSLTIVVATVLLMSMVGSAYSG-----NFFNEFDLTWGDHRGKIFNGGNMLSLSLDRV  57

Query  332   TGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPY  511
             +GSGF +K EYLFGR DMQ+KLV G SAGTVT +Y  S  G  HDE+DFEFLGN T +PY
Sbjct  58    SGSGFKSKKEYLFGRIDMQLKLVAGNSAGTVTAYYKLSSQGATHDEIDFEFLGNETGKPY  117

Query  512   TVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGI  691
              +HTNV++QGKGN+EQQF+LWFDPT  FHTY+I+W PQ IIF+VDN PIRVFNN E +G 
Sbjct  118   VLHTNVFAQGKGNREQQFYLWFDPTKNFHTYSIVWRPQHIIFLVDNLPIRVFNNAEKLGA  177

Query  692   PFPKSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsi  871
             PFPKSQPMR+Y SLWNADDWAT+GGLVKTDWS APFTAYYR FNA AC V++G       
Sbjct  178   PFPKSQPMRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRGFNAAACTVSSGCDPKFKR  237

Query  872   aaasnsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSR  1033
             +      Q  +  EL+  GR R+RWVQ   M+YNYC+D KRFP+GF  ECK+SR
Sbjct  238   SFGDGKLQ--VANELNAYGRRRLRWVQKYFMIYNYCSDLKRFPRGFPPECKKSR  289



>ref|XP_007034180.1| Xyloglucan endotransglucosylase/hydrolase 16 [Theobroma cacao]
 gb|EOY05106.1| Xyloglucan endotransglucosylase/hydrolase 16 [Theobroma cacao]
Length=291

 Score =   361 bits (927),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 177/292 (61%), Positives = 217/292 (74%), Gaps = 8/292 (3%)
 Frame = +2

Query  161   VCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGS  340
             V M++++G+V  SLV     V     +F  D  + +G+H  ++ + G  ++L+LD+ +GS
Sbjct  8     VSMLVLVGLVVNSLV-----VVAYAGDFYQDFDLTWGDHRAKIFNGGKLLSLSLDRVSGS  62

Query  341   GFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVH  520
             GF +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +H
Sbjct  63    GFQSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILH  121

Query  521   TNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP  700
             TNVY+QGKGN+EQQF LWFDPT  FHTY+I+W PQ IIF+VDN PIRVF N ES+G+PFP
Sbjct  122   TNVYTQGKGNREQQFFLWFDPTRNFHTYSIIWKPQHIIFLVDNTPIRVFKNAESVGVPFP  181

Query  701   KSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaa  880
             KSQPMR+Y SLWNADDWAT+GGLVKTDW+ APFTAYYRNFNA AC  + G SSC S ++ 
Sbjct  182   KSQPMRIYSSLWNADDWATRGGLVKTDWTKAPFTAYYRNFNAKACTWSGGASSCASTSSV  241

Query  881   snsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
             S+    W T ELD  GR R+RWVQ   M+YNYC D KRFPQG   ECKR RF
Sbjct  242   SDGV--WETNELDAPGRRRLRWVQKYFMIYNYCTDLKRFPQGVPPECKRPRF  291



>ref|XP_007217342.1| hypothetical protein PRUPE_ppa020825mg [Prunus persica]
 gb|EMJ18541.1| hypothetical protein PRUPE_ppa020825mg [Prunus persica]
Length=260

 Score =   360 bits (923),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 169/266 (64%), Positives = 200/266 (75%), Gaps = 12/266 (5%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + FG+   ++ + G  + LNLD+ +GSGF +KNEYL GR DMQ+KLV G SAG
Sbjct  7     NFFQDFDVTFGDQRAKILNGGQLLTLNLDKASGSGFKSKNEYLLGRIDMQIKLVSGNSAG  66

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNV+SQGKGN+EQQFHLWFDPT AFH
Sbjct  67    TVTAYYLSSE-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGNREQQFHLWFDPTEAFH  125

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN QRIIF+VDN PIRVF N E+IG+PFPK+QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  126   TYSIVWNSQRIIFLVDNIPIRVFTNLETIGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  185

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DW+ APFTA YRNF A +   TN +               W TQ LD  GRNR+RWVQ K
Sbjct  186   DWTQAPFTASYRNFQA-STTSTNSL----------TEQSAWQTQGLDAAGRNRLRWVQQK  234

Query  959   HMVYNYCADAKRFPQGFSAECKRSRF  1036
              MVYNYC+D KRFPQG   EC+RSRF
Sbjct  235   FMVYNYCSDLKRFPQGLPVECRRSRF  260



>ref|XP_009108100.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15 [Brassica rapa]
Length=289

 Score =   360 bits (924),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 165/265 (62%), Positives = 207/265 (78%), Gaps = 3/265 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF N+  + +G+H G++ + GN ++L+LD+ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  27    NFFNEFDLTWGDHRGKIFNGGNMLSLSLDRVSGSGFKSKKEYLFGRIDMQLKLVAGNSAG  86

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTT+YL+S  G  HDE+DFEFLGN T +PY +HTNV++QGKGN+EQQF+LWFDPT  FH
Sbjct  87    TVTTYYLSSQ-GATHDEIDFEFLGNETGKPYVLHTNVFAQGKGNREQQFYLWFDPTKNFH  145

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+W PQ IIF+VDN PIRVFNN E +G+PFPK+QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  146   TYSIVWRPQHIIFLVDNLPIRVFNNAEKLGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  205

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DWS APFTAYYR FNA AC V++G       + + +  Q     EL+  GR R+RWVQ  
Sbjct  206   DWSKAPFTAYYRGFNAAACTVSSGCDPKFKTSLSDSELQT--ANELNAYGRRRLRWVQKY  263

Query  959   HMVYNYCADAKRFPQGFSAECKRSR  1033
              M+YNYC+D KRFP+GF  EC+RSR
Sbjct  264   FMIYNYCSDLKRFPRGFPPECRRSR  288



>ref|XP_009356633.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Pyrus 
x bretschneideri]
Length=294

 Score =   360 bits (924),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 172/294 (59%), Positives = 215/294 (73%), Gaps = 6/294 (2%)
 Frame = +2

Query  158   QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
             +V MI+ + +   SL+ +A        NF  D  + FG+   ++ D G  + LNLDQ +G
Sbjct  6     KVSMILFLSLFINSLMAMAAQAG----NFYQDFDITFGDGRAKILDRGKLLTLNLDQVSG  61

Query  338   SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
             SGF +KNEYLFGR DMQ+KLV G SAGTVTT+YL+S  G  HDE+DFEFLGN+T +PYT+
Sbjct  62    SGFKSKNEYLFGRIDMQIKLVPGNSAGTVTTYYLSSE-GLTHDEIDFEFLGNSTGEPYTL  120

Query  518   HTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPF  697
             HTNV+SQGKG +EQQFHLWFDPT  FHTY+I+W+ Q IIF+VD+ PIRVFNN ES G+PF
Sbjct  121   HTNVFSQGKGGREQQFHLWFDPTKTFHTYSIVWSRQNIIFLVDSIPIRVFNNLESAGVPF  180

Query  698   PKSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVV-TNGVsscnsia  874
             PK+QPMRVY SLWNA+D AT+GGLVKT+W+ APFTA YRNF ANAC+  ++   +     
Sbjct  181   PKTQPMRVYSSLWNAEDGATRGGLVKTNWTLAPFTATYRNFKANACIAGSSSSCASTIPT  240

Query  875   aasnsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
                     W TQ +D  GR R+RWVQ K M+YNYC+D KRFP+G  AECK+SRF
Sbjct  241   NPLTEKSAWETQGIDAAGRKRLRWVQQKFMIYNYCSDFKRFPEGLPAECKQSRF  294



>ref|XP_010677921.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Beta vulgaris subsp. vulgaris]
Length=285

 Score =   360 bits (923),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 169/261 (65%), Positives = 208/261 (80%), Gaps = 2/261 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NFNND  + +G+   ++ +NG+ + L+LD+ +GSGF +KNEYLFG  DMQ+KLV G SAG
Sbjct  23    NFNNDFAITWGDGRAKILNNGDDLTLSLDKASGSGFQSKNEYLFGSIDMQLKLVPGNSAG  82

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S +G  HDE+DFEFLGNA+ QPYT+HTNV++QGKGN+EQQFHLWFDPT  FH
Sbjct  83    TVTAYYLSS-LGTTHDEIDFEFLGNASGQPYTLHTNVFAQGKGNREQQFHLWFDPTKDFH  141

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRI+F VD  PIR FNN ES G+ FPK+QPMR+Y SLWNADDWATQGG VK 
Sbjct  142   TYSILWNPQRIVFSVDGIPIREFNNMESQGVSFPKNQPMRIYSSLWNADDWATQGGRVKI  201

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DW+HAPFTA YRNFNANACV  +G SS   ++ +++S  +WL QELD     R+RWVQ+ 
Sbjct  202   DWTHAPFTASYRNFNANACVWASG-SSSCGLSPSADSGSDWLNQELDSASLERMRWVQTN  260

Query  959   HMVYNYCADAKRFPQGFSAEC  1021
             +MVYNYCAD +RFPQG   EC
Sbjct  261   YMVYNYCADLQRFPQGLPTEC  281



>gb|KFK24577.1| hypothetical protein AALP_AAs45078U000600 [Arabis alpina]
Length=289

 Score =   360 bits (923),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 167/286 (58%), Positives = 213/286 (74%), Gaps = 3/286 (1%)
 Frame = +2

Query  179   IGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKN  358
             +  V  +++ V ++      NF +D  + +G+H G++ + GN ++L+LD+ +GSGF +K 
Sbjct  7     LATVVAAILLVTMSGSAYSGNFLDDFDLTWGDHRGKIFNGGNMLSLSLDKVSGSGFKSKK  66

Query  359   EYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQ  538
             EYLFGR DMQ+KLV G SAGTVTT+YL+S  G  HDE+DFEFLGN T +PY +HTNV++Q
Sbjct  67    EYLFGRIDMQLKLVAGNSAGTVTTYYLSSE-GATHDEIDFEFLGNETGKPYVLHTNVFAQ  125

Query  539   GKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMR  718
             GKGNKEQQF+LWFDPT  FHTY+I+W PQ IIF+VDN PIRVFNN E +G+PFPK+QPMR
Sbjct  126   GKGNKEQQFYLWFDPTKNFHTYSIVWRPQHIIFLVDNLPIRVFNNAEKLGVPFPKNQPMR  185

Query  719   VYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQE  898
             +Y SLWNADDWAT+GGLVKTDWS APFTAYYR F A AC V++G       +      Q 
Sbjct  186   IYSSLWNADDWATRGGLVKTDWSKAPFTAYYRGFKAAACTVSSGCDPKFKSSFTDGKLQ-  244

Query  899   WLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
              +  EL+  GR R+RWVQ   M+YNYC+D KRFP+ F  ECKRS+F
Sbjct  245   -VANELNAYGRRRLRWVQKYFMIYNYCSDLKRFPREFPPECKRSKF  289



>ref|XP_002520388.1| Brassinosteroid-regulated protein BRU1 precursor, putative [Ricinus 
communis]
 gb|EEF42004.1| Brassinosteroid-regulated protein BRU1 precursor, putative [Ricinus 
communis]
Length=287

 Score =   360 bits (923),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 172/266 (65%), Positives = 208/266 (78%), Gaps = 2/266 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF     + +G+H G++ + G  + L+LD+ +GSGF +KNEYLFGR DMQ+KLV G SAG
Sbjct  23    NFYKHFDITWGDHRGKILNGGQLLTLSLDKASGSGFQSKNEYLFGRIDMQIKLVPGNSAG  82

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL+S  G  HDE+DFEFLGN +  PY +HTNV+SQGKGN+EQQF+LWFDPT AFH
Sbjct  83    TVTTFYLSSQ-GPNHDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTLAFH  141

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN QRI+F+VDN PIRVFNN E  G+PFP  +PMR+Y SLWNADDWAT+GGLVKT
Sbjct  142   TYSIVWNAQRIMFLVDNIPIRVFNNLEPKGVPFPNKKPMRIYSSLWNADDWATRGGLVKT  201

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DW+ APFTA YRNFNANACV ++G S C  I+  S  +  W  QELD  GRNR+RWV  K
Sbjct  202   DWTKAPFTASYRNFNANACVWSSG-SPCELISTNSLQDSAWQVQELDVAGRNRIRWVHQK  260

Query  959   HMVYNYCADAKRFPQGFSAECKRSRF  1036
             +M+YNYC D KRFP+G   ECKRSRF
Sbjct  261   YMIYNYCTDFKRFPEGLPPECKRSRF  286



>ref|XP_010677922.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Beta vulgaris subsp. vulgaris]
Length=285

 Score =   359 bits (922),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 169/264 (64%), Positives = 209/264 (79%), Gaps = 2/264 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NFNND  + +G+   ++ +NG+ + L+LD+ +GSGF +KNEYLFG  DMQ+KLV G SAG
Sbjct  23    NFNNDFAITWGDGRAKILNNGDDLTLSLDKASGSGFQSKNEYLFGNIDMQLKLVPGNSAG  82

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S +G  HDE+DFEFLGNA+ QPYT+HTNV++QGKGN+EQQFHLWFDPT  FH
Sbjct  83    TVTAYYLSS-LGSTHDEIDFEFLGNASGQPYTLHTNVFAQGKGNREQQFHLWFDPTKDFH  141

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRI+F VD  PIR FNN ES G+ FPK+QPMR+Y SLWNADDWATQGG VK 
Sbjct  142   TYSILWNPQRIVFSVDGIPIREFNNMESQGVSFPKNQPMRIYSSLWNADDWATQGGRVKI  201

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DW+HAPFTA YRNFNANACV  +G SS   ++ +++S  +WL QELD     R+RWVQ+ 
Sbjct  202   DWTHAPFTASYRNFNANACVWASG-SSSCGLSPSADSGSDWLNQELDSASLERMRWVQTN  260

Query  959   HMVYNYCADAKRFPQGFSAECKRS  1030
             +MVYNYCAD +RFPQG   EC  +
Sbjct  261   YMVYNYCADLQRFPQGLPTECTST  284



>ref|NP_200564.1| xyloglucan endotransglucosylase/hydrolase protein 22 [Arabidopsis 
thaliana]
 sp|Q38857.1|XTH22_ARATH RecName: Full=Xyloglucan endotransglucosylase/hydrolase protein 
22; Short=At-XTH22; Short=XTH-22; AltName: Full=Touch protein 
4; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK56251.1|AF367262_1 AT5g57560/MUA2_13 [Arabidopsis thaliana]
 gb|AAL38614.1|AF446881_1 AT5g57560/MUA2_13 [Arabidopsis thaliana]
 gb|AAA92363.1| TCH4 protein [Arabidopsis thaliana]
 gb|AAC05572.1| xyloglucan endotransglycosylase related protein [Arabidopsis 
thaliana]
 dbj|BAB08791.1| TCH4 protein [Arabidopsis thaliana]
 gb|AAK96616.1| AT5g57560/MUA2_13 [Arabidopsis thaliana]
 gb|AAL05902.1| AT5g57560/MUA2_13 [Arabidopsis thaliana]
 gb|AED96915.1| xyloglucan endotransglucosylase/hydrolase protein 22 [Arabidopsis 
thaliana]
Length=284

 Score =   358 bits (920),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 168/261 (64%), Positives = 202/261 (77%), Gaps = 1/261 (0%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV++ +G+  GQ+++NG  + L+LD+ +GSGF +KNEYLFG+  MQMKLV G SAG
Sbjct  22    NFQRDVEITWGDGRGQIKNNGELLTLSLDKSSGSGFQSKNEYLFGKVSMQMKLVPGNSAG  81

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTT YL SP G   DE+DFEFLGN++ +PYT+HTNVY+QGKG+KEQQF LWFDPTA FH
Sbjct  82    TVTTLYLKSP-GTTWDEIDFEFLGNSSGEPYTLHTNVYTQGKGDKEQQFKLWFDPTANFH  140

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TYTILWNPQRIIF VD  PIR F N ES+G  FPK++PMR+Y SLWNADDWAT+GGLVKT
Sbjct  141   TYTILWNPQRIIFTVDGTPIREFKNMESLGTLFPKNKPMRMYSSLWNADDWATRGGLVKT  200

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DWS APFTA YR F   ACV +NG SSC + +    +   WL+QELD   + R+RWVQ  
Sbjct  201   DWSKAPFTASYRGFQQEACVWSNGKSSCPNASKQGTTTGSWLSQELDSTAQQRMRWVQRN  260

Query  959   HMVYNYCADAKRFPQGFSAEC  1021
             +M+YNYC DAKRFPQG   EC
Sbjct  261   YMIYNYCTDAKRFPQGLPKEC  281



>ref|XP_002868312.1| hypothetical protein ARALYDRAFT_493497 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44571.1| hypothetical protein ARALYDRAFT_493497 [Arabidopsis lyrata subsp. 
lyrata]
Length=289

 Score =   359 bits (921),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 168/287 (59%), Positives = 214/287 (75%), Gaps = 8/287 (3%)
 Frame = +2

Query  173   MIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNT  352
             ++  ++  +LVG A A      NF ++  + +G+H G++ + G  ++L+LD+ +GSGF +
Sbjct  10    VVAAILLVTLVGSAYAS-----NFFDEFDLTWGDHRGKIFNGGTMLSLSLDRVSGSGFKS  64

Query  353   KNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVY  532
             K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN T +PY +HTNV+
Sbjct  65    KKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GATHDEIDFEFLGNETGKPYVLHTNVF  123

Query  533   SQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQP  712
             +QGKG++EQQF+LWFDPT  FHTY+I+W PQ IIF+VDN PIRVFNN E +G+PFPKSQP
Sbjct  124   AQGKGDREQQFYLWFDPTKNFHTYSIVWRPQHIIFLVDNLPIRVFNNAERLGVPFPKSQP  183

Query  713   MRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsn  892
             MR+Y SLWNADDWAT+GGLVKTDWS APFTAYYR FNA AC V++G       +      
Sbjct  184   MRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRGFNAAACTVSSGCYPKFKSSLGDGKL  243

Query  893   QEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSR  1033
             Q  +  EL+  GR R+RWVQ   M+YNYC+D KRFP+GF  ECKRSR
Sbjct  244   Q--VASELNAYGRRRLRWVQKYFMIYNYCSDLKRFPRGFPPECKRSR  288



>ref|XP_010525737.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
20-like [Tarenaya hassleriana]
Length=283

 Score =   358 bits (918),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 167/262 (64%), Positives = 206/262 (79%), Gaps = 8/262 (3%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DVQ+ +G+  G++ DNGN +AL+LDQ +GSGF +KNE+L+G+ + Q+KLV G SAG
Sbjct  28    NFQRDVQITWGDGRGKILDNGNLLALSLDQFSGSGFQSKNEFLYGKVEAQIKLVPGNSAG  87

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL SP G   DE+DFEFLGN +  PYT+HTNVY+QG+G+KEQQFHLWFDPTA FH
Sbjct  88    TVTTFYLKSP-GSTWDEIDFEFLGNLSGHPYTLHTNVYTQGRGDKEQQFHLWFDPTADFH  146

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I WNPQRIIF VD  PIR F N ESIG+PFPK QPMR+Y SLW AD+WAT+GGLVKT
Sbjct  147   TYSITWNPQRIIFTVDGIPIREFKNFESIGVPFPKDQPMRLYASLWEADEWATRGGLVKT  206

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DWSHAPF A YRN+N N CV +NG        ++  +++ W +QELD KG+NRV+WVQ +
Sbjct  207   DWSHAPFMASYRNYNENGCVWSNG-------RSSCPADKAWFSQELDFKGKNRVKWVQRR  259

Query  959   HMVYNYCADAKRFPQGFSAECK  1024
             +MVY+YC D KR+PQG   ECK
Sbjct  260   YMVYDYCTDRKRYPQGAPPECK  281



>ref|XP_006284242.1| hypothetical protein CARUB_v10005405mg [Capsella rubella]
 gb|EOA17140.1| hypothetical protein CARUB_v10005405mg [Capsella rubella]
Length=289

 Score =   358 bits (919),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 168/300 (56%), Positives = 215/300 (72%), Gaps = 13/300 (4%)
 Frame = +2

Query  134   GKMKKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMA  313
             G+       V  ++++ +V  +  G          NF ++  + +G+H G++ + GN ++
Sbjct  2     GRNSSLTTLVATVLLVTMVGSAYSG----------NFFDEFDLTWGDHRGKIFNGGNMLS  51

Query  314   LNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGN  493
             L+LD+ +GSGF +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G AHDE+DFEFLGN
Sbjct  52    LSLDRVSGSGFKSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GAAHDEIDFEFLGN  110

Query  494   ATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNN  673
              T +PY +HTNV++ GKGN+EQQF+LWFDPT  FHTY+I+W PQ IIF+VDN PIRVFNN
Sbjct  111   ETGKPYVLHTNVFALGKGNREQQFYLWFDPTKNFHTYSIVWRPQHIIFLVDNLPIRVFNN  170

Query  674   HESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGV  853
              E +G+PFPKSQPMR+Y SLWNADDWAT+GGLVKTDWS APFTAYYR F A AC V++G 
Sbjct  171   AEKLGVPFPKSQPMRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRGFKAAACTVSSGC  230

Query  854   sscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSR  1033
                   +      Q  +  EL+  GR R+RWVQ   M+YNYC+D KRFP+GF  ECKRSR
Sbjct  231   DPKFKSSFGDGKLQ--VANELNAYGRRRLRWVQKYFMIYNYCSDLKRFPRGFPPECKRSR  288



>ref|XP_007048840.1| Xyloglucan endotransglucosylase/hydrolase 15 [Theobroma cacao]
 gb|EOX92997.1| Xyloglucan endotransglucosylase/hydrolase 15 [Theobroma cacao]
Length=294

 Score =   358 bits (919),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 173/256 (68%), Positives = 202/256 (79%), Gaps = 1/256 (0%)
 Frame = +2

Query  269   GNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSP  448
             G+   ++   G  + L+LD+ +GSGF +K+ YLFGR DMQ+KLV G SAGTVTT+YLTS 
Sbjct  39    GDQRAKILHGGQLLTLSLDKDSGSGFRSKHAYLFGRIDMQIKLVPGNSAGTVTTYYLTSE  98

Query  449   IGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQR  628
              G  HDE+DFEFLGN +  PYT+HTNVYSQGKGN+EQQF+LWFDPT AFHTY+I+WN QR
Sbjct  99    -GPNHDEIDFEFLGNLSGDPYTLHTNVYSQGKGNREQQFYLWFDPTKAFHTYSIVWNRQR  157

Query  629   IIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAY  808
             IIFMVDN PIRVFNN ESIG+PFP +QPMR+Y SLWNADDWAT+GGLVKTDW+HAPFTA 
Sbjct  158   IIFMVDNIPIRVFNNMESIGVPFPSNQPMRIYSSLWNADDWATRGGLVKTDWTHAPFTAS  217

Query  809   YRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADA  988
             YRNFNANAC+ ++  SSC S +  S     W  Q L    RNR+RWVQ+K MVYNYC D 
Sbjct  218   YRNFNANACIWSSSQSSCASQSTDSLQANAWEDQTLGAADRNRIRWVQNKFMVYNYCTDL  277

Query  989   KRFPQGFSAECKRSRF  1036
             KRFPQG   ECKRSRF
Sbjct  278   KRFPQGLPPECKRSRF  293



>ref|XP_002268708.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Vitis 
vinifera]
Length=294

 Score =   358 bits (919),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 169/265 (64%), Positives = 206/265 (78%), Gaps = 1/265 (0%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + +G+   ++ D G  + L+LD+ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  29    NFYQDFDLTWGDRRAKIVDGGKLLMLSLDRASGSGFQSKKEYLFGRIDMQLKLVSGNSAG  88

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  GQ HDE+DFEFLGN +  PY +HTNV++QGKGN+EQQF+LWFDPT  FH
Sbjct  89    TVTAYYLSSQ-GQTHDEIDFEFLGNLSGDPYILHTNVFTQGKGNREQQFYLWFDPTKNFH  147

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WNPQRIIF+VDN PIR F N ESIGIPFPKSQPMR+Y SLWNAD+WAT+GG+VK 
Sbjct  148   TYSIIWNPQRIIFLVDNFPIRQFQNQESIGIPFPKSQPMRIYSSLWNADNWATRGGVVKI  207

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DWS APFTA+YRNFNA AC+ + G SSC S + +  SN  W TQ LD K R R+RWVQ  
Sbjct  208   DWSKAPFTAFYRNFNAAACIWSYGSSSCASKSVSPMSNIGWQTQGLDAKSRRRLRWVQRY  267

Query  959   HMVYNYCADAKRFPQGFSAECKRSR  1033
             +M+YNYC D KRFP+G   EC+RSR
Sbjct  268   YMIYNYCTDMKRFPEGLPPECRRSR  292



>gb|KHG09063.1| Xyloglucan endotransglucosylase/hydrolase 22 -like protein [Gossypium 
arboreum]
Length=292

 Score =   358 bits (918),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 170/289 (59%), Positives = 222/289 (77%), Gaps = 9/289 (3%)
 Frame = +2

Query  170   IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
             +++  +VAC ++  + +      NF+ND  + +G+  G++  NG  + L+LD+Q+GSGF 
Sbjct  11    LLMPLMVACLIMAASGS------NFHNDFDITWGDGRGKIASNGEVLTLSLDKQSGSGFQ  64

Query  350   TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
             +KNEYLFG+ DMQ+KLV G SAGTVT +YL+S  G   DE+DFEFLGN +  PY +HTNV
Sbjct  65    SKNEYLFGKIDMQLKLVPGNSAGTVTAYYLSSK-GSTWDEIDFEFLGNLSGDPYILHTNV  123

Query  530   YSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQ  709
             +SQGKGN+EQQF+LWFDPT  FHTY+ILWNPQRIIF VD+ PIR F N ESIG+PFPK+Q
Sbjct  124   FSQGKGNREQQFYLWFDPTTDFHTYSILWNPQRIIFSVDDTPIREFKNMESIGVPFPKNQ  183

Query  710   PMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVss--cnsiaaas  883
             PMR+Y SLWNADDWAT+GGL+KTDW+ APFTA YRNFNA+ACV +NG SS   N+ ++++
Sbjct  184   PMRIYSSLWNADDWATRGGLLKTDWTQAPFTASYRNFNADACVWSNGASSCKSNAPSSST  243

Query  884   nsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRS  1030
             ++N  W +QE+D     R++WVQ  +M+YNYC DAKRFPQG   ECK S
Sbjct  244   STNNAWFSQEMDSAKMQRLQWVQQNYMIYNYCTDAKRFPQGLPPECKMS  292



>ref|XP_004293654.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16-like [Fragaria vesca subsp. vesca]
Length=306

 Score =   358 bits (918),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 181/308 (59%), Positives = 218/308 (71%), Gaps = 19/308 (6%)
 Frame = +2

Query  131   AGKMKKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTM  310
              GKM K      +++    V+C  +  A A      NF  D  + +G+H  ++ D GN +
Sbjct  10    VGKMLK------IVLFFLSVSCPFMAAASAG-----NFYRDFDLTWGDHRAKILDGGNLL  58

Query  311   ALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLG  490
              L+LD+ +GSGF +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLG
Sbjct  59    TLSLDRISGSGFQSKREYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPNHDEIDFEFLG  117

Query  491   NATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFN  670
             N +  PY VHTNVY+QGKG++EQQFHLWFDPT  FHTY+ILWNPQRIIF+VDN PIRVFN
Sbjct  118   NLSGDPYIVHTNVYTQGKGDREQQFHLWFDPTKNFHTYSILWNPQRIIFLVDNTPIRVFN  177

Query  671   NHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNG  850
             N E+IG+ FPK QPM++Y SLWNAD WAT+GGL+KTDWS APFTAYY+ FNANACV + G
Sbjct  178   NEEAIGVGFPKKQPMKLYSSLWNADQWATRGGLIKTDWSKAPFTAYYKGFNANACVWSRG  237

Query  851   Vsscnsiaaa-------snsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGF  1009
               SC S  +         N N  W TQ LD  GR R+RWVQ  HM+YNYC D KRFPQG 
Sbjct  238   SLSCASGRSTPRPYGLGMNYNNGWQTQGLDAPGRRRLRWVQRYHMIYNYCTDLKRFPQGR  297

Query  1010  SAECKRSR  1033
               EC+RSR
Sbjct  298   PRECRRSR  305



>emb|CDY27126.1| BnaA08g07640D [Brassica napus]
Length=289

 Score =   357 bits (916),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 164/265 (62%), Positives = 206/265 (78%), Gaps = 3/265 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF N+  + +G+H G++ + GN ++L+LD+ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  27    NFFNEFDLTWGDHRGKIFNGGNMLSLSLDRVSGSGFKSKKEYLFGRIDMQLKLVAGNSAG  86

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTT+YL+S  G  HDE+DFEFLGN T +PY +HTNV++QGKGN+EQQF+LWFDPT  FH
Sbjct  87    TVTTYYLSSQ-GATHDEIDFEFLGNETGKPYVLHTNVFAQGKGNREQQFYLWFDPTKNFH  145

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+W PQ IIF+VDN PIRVFNN E +G+PFPK+QPM +Y SLWNADDWAT+GGLVKT
Sbjct  146   TYSIVWRPQHIIFLVDNLPIRVFNNAEKLGVPFPKNQPMMIYSSLWNADDWATRGGLVKT  205

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DWS APFTAYYR FNA AC V++G       + + +  Q     EL+  GR R+RWVQ  
Sbjct  206   DWSKAPFTAYYRGFNAAACTVSSGCDPKFKTSLSDSELQT--ANELNAYGRRRLRWVQKY  263

Query  959   HMVYNYCADAKRFPQGFSAECKRSR  1033
              M+YNYC+D KRFP+GF  EC+RSR
Sbjct  264   FMIYNYCSDLKRFPRGFPPECRRSR  288



>gb|KFK35964.1| xyloglucan:xyloglucosyl transferase [Arabis alpina]
Length=292

 Score =   357 bits (916),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 172/290 (59%), Positives = 217/290 (75%), Gaps = 7/290 (2%)
 Frame = +2

Query  167   MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
             + M++ V+  ++VG A +      NFN +  + +G H GQ+   G  ++L+LD+ +GSGF
Sbjct  8     LTMLVTVLVLTMVGTAYSG-----NFNEEFDLTWGEHRGQIFGGGKMLSLSLDRVSGSGF  62

Query  347   NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
              +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN T +PY +HTN
Sbjct  63    KSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSE-GPTHDEIDFEFLGNETGKPYVLHTN  121

Query  527   VYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKS  706
             V++QGKGN+EQQF+LWFDPT  FHTY+++W PQ IIFMVDN PIRVFNN E +G+PFPK 
Sbjct  122   VFAQGKGNREQQFYLWFDPTKNFHTYSLVWRPQHIIFMVDNVPIRVFNNAEQLGVPFPKK  181

Query  707   QPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasn  886
             QPMR+Y SLWNADDWAT+GGLVKTDWS APFTAYYR FNA AC V++G S C+    +S 
Sbjct  182   QPMRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRGFNAAACTVSSGSSYCDPKFKSSF  241

Query  887   snQE-WLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSR  1033
             +N E     EL+  GR R+RWVQ   M+Y+YC+D KRF QGF  EC+RSR
Sbjct  242   TNGESQAATELNAYGRRRLRWVQKYFMIYDYCSDVKRFSQGFPPECRRSR  291



>ref|NP_193149.2| probable xyloglucan endotransglucosylase/hydrolase protein 15 
[Arabidopsis thaliana]
 sp|Q38911.1|XTH15_ARATH RecName: Full=Probable xyloglucan endotransglucosylase/hydrolase 
protein 15; Short=At-XTH15; Short=XTH-15; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAB18368.1| xyloglucan endotransglycosylase-related protein [Arabidopsis 
thaliana]
 gb|AAK76539.1| putative xyloglucan endotransglycosylase-related protein XTR-7 
[Arabidopsis thaliana]
 gb|AAM64835.1| xyloglucan endotransglycosylase-related protein XTR-7 [Arabidopsis 
thaliana]
 gb|AAW28549.1| At4g14130 [Arabidopsis thaliana]
 gb|AEE83378.1| probable xyloglucan endotransglucosylase/hydrolase protein 15 
[Arabidopsis thaliana]
Length=289

 Score =   357 bits (915),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 163/265 (62%), Positives = 204/265 (77%), Gaps = 3/265 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF ++  + +G+H G++ + GN ++L+LDQ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  27    NFFDEFDLTWGDHRGKIFNGGNMLSLSLDQVSGSGFKSKKEYLFGRIDMQLKLVAGNSAG  86

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN T +PY +HTNV++QGKG++EQQF+LWFDPT  FH
Sbjct  87    TVTAYYLSSQ-GATHDEIDFEFLGNETGKPYVLHTNVFAQGKGDREQQFYLWFDPTKNFH  145

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+W PQ IIF+VDN PIRVFNN E +G+PFPKSQPMR+Y SLWNADDWAT+GGLVKT
Sbjct  146   TYSIVWRPQHIIFLVDNLPIRVFNNAEKLGVPFPKSQPMRIYSSLWNADDWATRGGLVKT  205

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DWS APFTAYYR FNA AC  ++G       +      Q  +  EL+  GR R+RWVQ  
Sbjct  206   DWSKAPFTAYYRGFNAAACTASSGCDPKFKSSFGDGKLQ--VATELNAYGRRRLRWVQKY  263

Query  959   HMVYNYCADAKRFPQGFSAECKRSR  1033
              M+YNYC+D KRFP+GF  ECK+SR
Sbjct  264   FMIYNYCSDLKRFPRGFPPECKKSR  288



>ref|XP_011016785.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15 [Populus euphratica]
Length=294

 Score =   357 bits (915),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 176/297 (59%), Positives = 220/297 (74%), Gaps = 8/297 (3%)
 Frame = +2

Query  146   KQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLD  325
             + ++   M++   + AC L+GV+        NF  D  + +G+   ++ + G  + L+LD
Sbjct  5     RSRKLSSMLLFTLLFAC-LMGVSKGG-----NFFQDFDITWGDQRAKILNGGQLLTLSLD  58

Query  326   QQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQ  505
             + +GSGF +KNEYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGNAT +
Sbjct  59    KASGSGFQSKNEYLFGRIDMQIKLVAGNSAGTVTAYYLSSQ-GSTHDEIDFEFLGNATGE  117

Query  506   PYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESI  685
             PY VHTNV+SQGKG++EQQF+LWFDPT AFHTY+I+WN QRIIF+VDN PIRVF+N ESI
Sbjct  118   PYIVHTNVFSQGKGDREQQFYLWFDPTKAFHTYSIVWNQQRIIFLVDNIPIRVFHNLESI  177

Query  686   GIPFPKSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscn  865
             G+PFP  Q MR++ SLWNADDWAT+GGLVKTDW+ APFTA YRNF ANAC+ +   S C 
Sbjct  178   GVPFPNKQAMRIHSSLWNADDWATRGGLVKTDWTQAPFTASYRNFKANACIWSPA-SPCT  236

Query  866   siaaasnsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
             S +  S  +  W  Q LD  GRNR+RWVQ K+M+YNYC D KRFPQG   ECKRSRF
Sbjct  237   STSPNSVQDNAWQVQALDAPGRNRLRWVQQKYMIYNYCTDLKRFPQGLPPECKRSRF  293



>ref|XP_002302146.2| xyloglucan endo-1 family protein [Populus trichocarpa]
 gb|EEE81419.2| xyloglucan endo-1 family protein [Populus trichocarpa]
Length=294

 Score =   357 bits (915),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 174/297 (59%), Positives = 220/297 (74%), Gaps = 8/297 (3%)
 Frame = +2

Query  146   KQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLD  325
             + ++   M++   + AC L+G +        NF  D  + +G+   ++ + G  + L+LD
Sbjct  5     RSRKLSSMLLFTLLFAC-LMGASKGG-----NFFQDFDITWGDQRAKILNGGQLLTLSLD  58

Query  326   QQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQ  505
             + +GSGF +KNEYLFG+ DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGNAT +
Sbjct  59    KASGSGFQSKNEYLFGQIDMQIKLVAGNSAGTVTAYYLSSQ-GSTHDEIDFEFLGNATGE  117

Query  506   PYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESI  685
             PY +HTNV+SQGKGN+EQQF+LWFDPT AFHTY+I+WN QRIIF+VDN PIRVF+N ESI
Sbjct  118   PYILHTNVFSQGKGNREQQFYLWFDPTKAFHTYSIVWNQQRIIFLVDNIPIRVFHNLESI  177

Query  686   GIPFPKSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscn  865
             G+PFP  Q MR++ SLWNADDWAT+GGLVKTDW+ APFTA YRNF ANAC+ ++  S C 
Sbjct  178   GVPFPNKQAMRIHSSLWNADDWATRGGLVKTDWTQAPFTASYRNFKANACIWSSA-SPCT  236

Query  866   siaaasnsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
             S +  S  +  W  Q LD  GRNR+RWVQ K+M+YNYC D KRFPQG   ECKRSRF
Sbjct  237   STSPNSVQDNAWQVQALDAPGRNRLRWVQQKYMIYNYCTDLKRFPQGLPPECKRSRF  293



>ref|XP_010536006.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
20-like [Tarenaya hassleriana]
Length=283

 Score =   356 bits (914),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 170/262 (65%), Positives = 206/262 (79%), Gaps = 8/262 (3%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DVQ+ +GN  G+V +NGN +AL+LDQ +GSGF +KNE+L+GR + Q+KLV G SAG
Sbjct  28    NFERDVQITWGNGRGKVLENGNLLALSLDQFSGSGFQSKNEFLYGRVEAQIKLVPGNSAG  87

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL SP G   DE+DFEFLGN +  PYT+HTNVY+QGKG+KEQQFHLWFDPTA FH
Sbjct  88    TVTTFYLKSP-GATWDEIDFEFLGNLSGHPYTLHTNVYTQGKGDKEQQFHLWFDPTADFH  146

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I WNPQRIIF VD  PIR F N ESIG+PFPK+QPMR+Y SLW AD+WAT+GGLVK 
Sbjct  147   TYSITWNPQRIIFTVDGIPIREFKNLESIGVPFPKNQPMRLYASLWEADEWATRGGLVKI  206

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DWS APFTA YRN+NAN CV ++G        ++  +N+ W +QELD  G+NR++WVQS+
Sbjct  207   DWSRAPFTASYRNYNANGCVWSSG-------RSSCPANKPWFSQELDFNGKNRMKWVQSR  259

Query  959   HMVYNYCADAKRFPQGFSAECK  1024
             +MVYNYC D KR PQG   ECK
Sbjct  260   YMVYNYCTDRKRSPQGAPPECK  281



>ref|XP_010243150.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Nelumbo 
nucifera]
Length=288

 Score =   356 bits (914),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 171/291 (59%), Positives = 219/291 (75%), Gaps = 7/291 (2%)
 Frame = +2

Query  155   QQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQT  334
              ++  +++  ++  SL+    A      NF  D  + +G+H  ++ + G  ++L+LD+ +
Sbjct  5     HRLSDLLMSALIMSSLMAAYAA------NFYQDFDLTWGDHRAKIFNGGQLLSLSLDKTS  58

Query  335   GSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYT  514
             GSGF +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY 
Sbjct  59    GSGFQSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYI  117

Query  515   VHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIP  694
             +HTNV++QGKGN+EQQF+LWFDPT  FHTY+I+WNPQRIIF+VDN PIR FNN E+ G+P
Sbjct  118   LHTNVFTQGKGNREQQFYLWFDPTRNFHTYSIVWNPQRIIFLVDNIPIREFNNAEARGVP  177

Query  695   FPKSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsia  874
             FPK+QPMR+Y SLWNADDWAT+GGLVKTDW+ APFTAYYRNFNANACV + G SSC+S +
Sbjct  178   FPKNQPMRIYSSLWNADDWATRGGLVKTDWTKAPFTAYYRNFNANACVWSAGSSSCSSKS  237

Query  875   aasnsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKR  1027
               S ++  W TQELD   R R+RWVQ  +M+YNYC D KRFPQG   EC+R
Sbjct  238   TNSFTDSAWQTQELDATSRRRLRWVQKYYMIYNYCTDVKRFPQGLPPECRR  288



>gb|AFR46575.1| xyloglucan endotransglucosylase/hydrolase 6 [Rosa x borboniana]
Length=289

 Score =   356 bits (914),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 172/271 (63%), Positives = 207/271 (76%), Gaps = 6/271 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + FG    ++ + G  + L+LDQ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  20    NFYQDFDITFGEQRAKIFNGGQHLTLDLDQYSGSGFKSKKEYLFGRIDMQIKLVAGNSAG  79

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN++ +PYT+HTNV+SQGKGN+EQQFHLWFDPT AFH
Sbjct  80    TVTAYYLSSQ-GPTHDEIDFEFLGNSSGEPYTLHTNVFSQGKGNREQQFHLWFDPTNAFH  138

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+++WN QRIIF+VDN PIRVFNN ES+G+PFPK+QPMR+Y SLWNADDWATQGG VKT
Sbjct  139   TYSLVWNSQRIIFLVDNIPIRVFNNLESVGVPFPKNQPMRIYSSLWNADDWATQGGRVKT  198

Query  779   DWSHAPFTAYYRNFNAN-----ACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVR  943
             DW+HAPFTA YRNF AN     +   + GVS+  S  + ++    W  Q LD  GRNR+R
Sbjct  199   DWTHAPFTASYRNFKANACVAGSSSSSCGVSTSASTNSLTDQQGTWHNQGLDAAGRNRIR  258

Query  944   WVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
             WVQ K MVYNYC D KRFPQG   EC+RSRF
Sbjct  259   WVQQKFMVYNYCTDLKRFPQGLPVECRRSRF  289



>ref|XP_009120272.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22 [Brassica rapa]
Length=283

 Score =   355 bits (912),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 168/261 (64%), Positives = 198/261 (76%), Gaps = 2/261 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV++ +G+  GQ+++NG  + L+LD+ +GSGF +KNEYLFG+ DMQMKLV G SAG
Sbjct  22    NFQRDVEITWGDGRGQIKNNGELLTLSLDKSSGSGFQSKNEYLFGKIDMQMKLVPGNSAG  81

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTT YL SP G   DE+DFEFLGN +  PYT+HTNVY+QGKG+KEQQF LWFDPTA FH
Sbjct  82    TVTTLYLKSP-GTTWDEIDFEFLGNLSGDPYTLHTNVYTQGKGDKEQQFKLWFDPTADFH  140

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TYTILWNPQRIIF VD  PIR F N ES+G  FPK+QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  141   TYTILWNPQRIIFTVDGTPIREFKNMESVGTLFPKNQPMRMYSSLWNADDWATRGGLVKT  200

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DWS APFTA YR FN  ACV +NG  S     +   +   WL+QELD   + R+RWVQ  
Sbjct  201   DWSKAPFTASYRGFNQEACVWSNG-KSSCPNGSGQGTTGSWLSQELDSTAQERMRWVQKN  259

Query  959   HMVYNYCADAKRFPQGFSAEC  1021
             +M+YNYC D KRFPQG   EC
Sbjct  260   YMIYNYCTDTKRFPQGLPKEC  280



>ref|XP_008229402.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Prunus 
mume]
Length=279

 Score =   355 bits (912),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 166/266 (62%), Positives = 199/266 (75%), Gaps = 12/266 (5%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + FG+   ++ + G  + LNLD+ +GSGF +KNEYL GR DMQ+KLV G SAG
Sbjct  26    NFYQDFDVTFGDERAKILNGGQLLTLNLDKFSGSGFKSKNEYLLGRIDMQIKLVSGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNV+SQGKGN+EQQF+LWFDPT AFH
Sbjct  86    TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGNREQQFNLWFDPTKAFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN QRIIF+VDN PIRVF N E+IG+PFPK+QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  145   TYSIVWNSQRIIFLVDNIPIRVFTNLETIGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  204

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DW+ APFTA YRNF   +   TN +               W TQ LD  GRNR+RWVQ K
Sbjct  205   DWTQAPFTASYRNFQV-STTSTNSL----------TEQSAWQTQGLDAAGRNRLRWVQQK  253

Query  959   HMVYNYCADAKRFPQGFSAECKRSRF  1036
              M+YNYC+D KRFPQG   EC+RSRF
Sbjct  254   FMIYNYCSDLKRFPQGLPVECRRSRF  279



>ref|XP_006414798.1| hypothetical protein EUTSA_v10025705mg [Eutrema salsugineum]
 gb|ESQ56251.1| hypothetical protein EUTSA_v10025705mg [Eutrema salsugineum]
Length=326

 Score =   357 bits (916),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 166/295 (56%), Positives = 216/295 (73%), Gaps = 8/295 (3%)
 Frame = +2

Query  149   QQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQ  328
             ++  +   ++  V+  ++ G A +      NF ++  + +G+H G++ + GN ++L+LD+
Sbjct  39    RRSSLTTTVVAAVLLVTMFGSAYSG-----NFFDEFDLTWGDHRGKIFNGGNMLSLSLDR  93

Query  329   QTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQP  508
              +GSGF +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN T +P
Sbjct  94    VSGSGFKSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GATHDEIDFEFLGNETGKP  152

Query  509   YTVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIG  688
             Y +HTNV++QGKGN+EQQF+LWFDPT  FHTY+I+W PQ IIF+VDN PIRVFNN E +G
Sbjct  153   YVLHTNVFAQGKGNREQQFYLWFDPTKNFHTYSIVWRPQHIIFLVDNLPIRVFNNAEKLG  212

Query  689   IPFPKSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscns  868
             +PFPKSQPMR+Y SLWNADDWAT+GGLVKTDWS APFTAYYR F A AC V++G      
Sbjct  213   VPFPKSQPMRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRGFKAAACTVSSGCDPKFK  272

Query  869   iaaasnsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSR  1033
              +      Q  +  EL+  GR R+RWVQ   M+Y+YC+D KRFP+GF  ECKRSR
Sbjct  273   SSFTDGKFQ--VANELNAYGRRRLRWVQRYFMIYDYCSDLKRFPRGFPPECKRSR  325



>ref|XP_006453414.1| hypothetical protein CICLE_v10009119mg [Citrus clementina]
 ref|XP_006474157.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like [Citrus sinensis]
 gb|ESR66654.1| hypothetical protein CICLE_v10009119mg [Citrus clementina]
Length=285

 Score =   355 bits (911),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 167/265 (63%), Positives = 208/265 (78%), Gaps = 2/265 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF+ D  + +G+    + +NG  + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  22    NFHQDFDITWGDGRANILNNGQLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSAG  81

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL SP G   DE+DFEFLGN +  PYT+HTNV++ GKG+KEQQFHLWFDPTA FH
Sbjct  82    TVTAYYLKSP-GSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDKEQQFHLWFDPTADFH  140

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRI+F VD  PIR F N ESIG+ FPK+QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  141   TYSILWNPQRIVFSVDGTPIREFKNSESIGVAFPKNQPMRIYSSLWNADDWATRGGLVKT  200

Query  779   DWSHAPFTAYYRNFNANACVVTNG-VsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQS  955
             DW+HAPFTA YRNFNA+ACV +NG  S  +S  ++ +S+  W +QELD   + R++WVQ 
Sbjct  201   DWTHAPFTASYRNFNADACVWSNGKSSCASSSPSSPSSSSAWFSQELDSTSQERLKWVQK  260

Query  956   KHMVYNYCADAKRFPQGFSAECKRS  1030
              +M+YNYCADAKRFPQG  AEC+ S
Sbjct  261   NYMIYNYCADAKRFPQGLPAECRTS  285



>ref|XP_006453421.1| hypothetical protein CICLE_v10009118mg [Citrus clementina]
 gb|ESR66661.1| hypothetical protein CICLE_v10009118mg [Citrus clementina]
Length=285

 Score =   355 bits (911),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 167/265 (63%), Positives = 208/265 (78%), Gaps = 2/265 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF+ D  + +G+    + +NG  + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  22    NFHQDFDITWGDGRANILNNGQLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSAG  81

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL SP G   DE+DFEFLGN +  PYT+HTNV++ GKG+KEQQFHLWFDPTA FH
Sbjct  82    TVTAYYLKSP-GSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDKEQQFHLWFDPTADFH  140

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRI+F VD  PIR F N ESIG+ FPK+QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  141   TYSILWNPQRIVFSVDGTPIREFKNSESIGVAFPKNQPMRIYSSLWNADDWATRGGLVKT  200

Query  779   DWSHAPFTAYYRNFNANACVVTNG-VsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQS  955
             DW+HAPFTA YRNFNA+ACV +NG  S  +S  ++ +S+  W +QELD   + R++WVQ 
Sbjct  201   DWTHAPFTASYRNFNADACVWSNGKSSCASSSPSSPSSSSAWFSQELDSTSQERLKWVQK  260

Query  956   KHMVYNYCADAKRFPQGFSAECKRS  1030
              +M+YNYCADAKRFPQG  AEC+ S
Sbjct  261   NYMIYNYCADAKRFPQGLPAECRTS  285



>ref|XP_006453413.1| hypothetical protein CICLE_v10008951mg [Citrus clementina]
 gb|ESR66653.1| hypothetical protein CICLE_v10008951mg [Citrus clementina]
Length=317

 Score =   356 bits (914),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 173/299 (58%), Positives = 221/299 (74%), Gaps = 12/299 (4%)
 Frame = +2

Query  137   KMKKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMAL  316
             K       + + +++G +  +  G          NF  D  + +G+   ++ +NG+ + L
Sbjct  30    KHMSMASMLHLFLVLGSLMAASAG----------NFYKDFDITWGDGRAKMLNNGDLLTL  79

Query  317   NLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNA  496
             +LD+ +GSGF +KNEYL+G+ DMQ+KLV G SAGTVT +YL SP G   DE+DFEFLGN+
Sbjct  80    SLDKASGSGFQSKNEYLYGKIDMQLKLVPGNSAGTVTAYYLKSP-GSTWDEIDFEFLGNS  138

Query  497   TFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNH  676
             +  PYT+HTNV++ GKG++EQQFHLWFDPTA FHTY+ILWNPQRIIF VD  PIR F N 
Sbjct  139   SGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNS  198

Query  677   ESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVs  856
             ESIG+PFPK+QPMR+Y SLWNADDWAT+GGLVKTDW+HAPFTA YRNFNA ACV +NG S
Sbjct  199   ESIGVPFPKNQPMRIYSSLWNADDWATRGGLVKTDWTHAPFTASYRNFNAEACVWSNGKS  258

Query  857   scnsiaaasnsnQ-EWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRS  1030
             SC S +A+S S+   W +QELD   +NR++WVQ  +M+YNYC D KRFPQG  AEC+ S
Sbjct  259   SCASNSASSTSSNGAWFSQELDSTNQNRLKWVQKNYMIYNYCTDTKRFPQGLPAECRIS  317



>ref|XP_011026280.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15 isoform X1 [Populus euphratica]
Length=294

 Score =   355 bits (911),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 168/266 (63%), Positives = 206/266 (77%), Gaps = 2/266 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + +G+   ++ + G  + L+LD+ +GSGF +KNEYLFGR DMQ+KLV G SAG
Sbjct  30    NFFQDFDITWGDQRAKILNGGQLLTLSLDKASGSGFQSKNEYLFGRIDMQIKLVAGNSAG  89

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGNAT +PY +HTNV+SQGKG++EQQF+LWFDPT AFH
Sbjct  90    TVTAYYLSSQ-GSTHDEIDFEFLGNATGEPYILHTNVFSQGKGDREQQFYLWFDPTKAFH  148

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN QRIIF+VDN PIRVF+N ES+G+PFP  Q MR++ SLWNADDWAT+GGLVKT
Sbjct  149   TYSIVWNKQRIIFLVDNIPIRVFHNLESVGVPFPNKQAMRIHSSLWNADDWATRGGLVKT  208

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DW+ APFTA YRNF ANAC+ +   S C S +  S  +  W  Q LD  GRNR+RWVQ K
Sbjct  209   DWTQAPFTASYRNFKANACIWS-PASPCTSTSPNSVQDNAWQVQALDAPGRNRLRWVQQK  267

Query  959   HMVYNYCADAKRFPQGFSAECKRSRF  1036
             +M+YNYC D KRFPQG   ECKRSRF
Sbjct  268   YMIYNYCTDLKRFPQGLPPECKRSRF  293



>ref|XP_009121735.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Brassica rapa]
Length=287

 Score =   355 bits (910),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 167/261 (64%), Positives = 207/261 (79%), Gaps = 1/261 (0%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF+ DV++ +G+  GQ+ +NG+ + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  25    NFHQDVEITWGDGRGQITNNGDLLTLSLDKSSGSGFQSKNEYLFGKIDMQIKLVAGNSAG  84

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL SP G   DE+DFEFLGN +  PYT+HTNV++QGKG++EQQF LWFDPT  FH
Sbjct  85    TVTAYYLKSP-GSTWDEIDFEFLGNLSGDPYTLHTNVFTQGKGDREQQFKLWFDPTIDFH  143

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VD  PIR F N ES G  FPK+QPMR+Y SLWNA+DWAT+GGLVKT
Sbjct  144   TYSILWNPQRIIFSVDGTPIREFKNMESQGTLFPKNQPMRMYSSLWNAEDWATRGGLVKT  203

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DWS APFTA YR F+  ACVV+NG SSC++ +A  + +  WL+QELD  G+ R+RWVQS 
Sbjct  204   DWSKAPFTASYRGFSEEACVVSNGKSSCSNGSAQGSGSGSWLSQELDSTGQERMRWVQSN  263

Query  959   HMVYNYCADAKRFPQGFSAEC  1021
             +M+YNYC DAKRFPQG   EC
Sbjct  264   YMIYNYCTDAKRFPQGLPREC  284



>ref|XP_006401194.1| hypothetical protein EUTSA_v10014326mg [Eutrema salsugineum]
 dbj|BAJ34580.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ42647.1| hypothetical protein EUTSA_v10014326mg [Eutrema salsugineum]
Length=282

 Score =   355 bits (910),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 166/261 (64%), Positives = 199/261 (76%), Gaps = 2/261 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV++ +G+  GQ+++NG  + L+LD+ +GSGF +KNEYLFG+ DMQMKLV G SAG
Sbjct  21    NFQRDVEITWGDGRGQIKNNGELLTLSLDKSSGSGFQSKNEYLFGKIDMQMKLVPGNSAG  80

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTT YL SP G   DE+DFEFLGN +  PYT+HTNVY+QGKG+KEQQF LWFDPTA FH
Sbjct  81    TVTTLYLKSP-GTTWDEIDFEFLGNLSGDPYTLHTNVYTQGKGDKEQQFKLWFDPTADFH  139

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TYTILWNPQRIIF VD  PIR F N ES+G  FPK++PMR+Y SLWNADDWAT+GGLVKT
Sbjct  140   TYTILWNPQRIIFTVDGTPIREFKNMESVGTLFPKNRPMRMYSSLWNADDWATRGGLVKT  199

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DWS APFTA YR FN  ACV +NG  S     +   +   WL+QELD   + R+RWVQ  
Sbjct  200   DWSKAPFTASYRGFNQEACVWSNG-KSSCPSGSKQGTTGSWLSQELDSTAQERMRWVQRN  258

Query  959   HMVYNYCADAKRFPQGFSAEC  1021
             +M+YNYC D+KRFP+G   EC
Sbjct  259   YMIYNYCTDSKRFPRGLPKEC  279



>ref|XP_007025220.1| Xyloglucan endotransglucosylase/hydrolase 16 [Theobroma cacao]
 gb|EOY27842.1| Xyloglucan endotransglucosylase/hydrolase 16 [Theobroma cacao]
Length=291

 Score =   355 bits (910),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 171/289 (59%), Positives = 213/289 (74%), Gaps = 7/289 (2%)
 Frame = +2

Query  170   IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
             ++++ +V  S +  +        +F+ + ++ +GN   Q+ D G  + L LD+ +GSGF 
Sbjct  9     MLLLSLVMGSFIAASAG------DFHQEFELTWGNERAQILDGGKLLTLTLDKTSGSGFR  62

Query  350   TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
             +KN+Y+FGR DMQ+KLV G SAGTVT FYL+S  G  HDE+DFEFLGN +  PY +HTNV
Sbjct  63    SKNQYIFGRIDMQIKLVAGNSAGTVTAFYLSSE-GPNHDEIDFEFLGNLSGDPYILHTNV  121

Query  530   YSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQ  709
             YSQGKG++EQQF+LWFDPT  FHTY+I+WN QRIIFMVD+ PIRVFNN ES G+PFPK+Q
Sbjct  122   YSQGKGDREQQFYLWFDPTKNFHTYSIVWNLQRIIFMVDDIPIRVFNNEESYGVPFPKNQ  181

Query  710   PMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasns  889
             PM++Y SLW+AD WAT+GGLVKTDWS APF AY+RNFNANAC  +NG S C S  + S  
Sbjct  182   PMKLYSSLWDADQWATRGGLVKTDWSKAPFKAYFRNFNANACTWSNGESGCASETSGSVR  241

Query  890   nQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
             N  W TQ LD  GR  +RWVQ   MVYNYC D KRFPQG   EC+RSRF
Sbjct  242   NNVWRTQALDASGRRILRWVQKYFMVYNYCTDLKRFPQGRPRECRRSRF  290



>ref|XP_009120273.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Brassica rapa]
Length=283

 Score =   354 bits (909),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 168/261 (64%), Positives = 196/261 (75%), Gaps = 2/261 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV++ +G+  GQ+ +NG  + L+LD+ +GSGF +KNEYLFG+ DMQMKLV G SAG
Sbjct  22    NFQRDVEITWGDGRGQITNNGELLTLSLDKSSGSGFQSKNEYLFGKIDMQMKLVPGNSAG  81

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTT YL SP G   DE+DFEFLGN +  PYT+HTNVY+QGKG+KEQQF LWFDPTA FH
Sbjct  82    TVTTLYLKSP-GTTWDEIDFEFLGNLSGDPYTLHTNVYTQGKGDKEQQFKLWFDPTADFH  140

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TYTILWNPQRIIF VD  PIR F N ES+G  FPK+QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  141   TYTILWNPQRIIFTVDGTPIREFKNMESVGTLFPKNQPMRMYSSLWNADDWATRGGLVKT  200

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DWS APFTA YR FN  ACV +NG  S     +       WL+QELD   + R+RWVQ  
Sbjct  201   DWSKAPFTASYRGFNQEACVWSNG-KSSCPNGSGQGPTGSWLSQELDSTAQERMRWVQKN  259

Query  959   HMVYNYCADAKRFPQGFSAEC  1021
             +M+YNYC D KRFPQG   EC
Sbjct  260   YMIYNYCTDTKRFPQGLPKEC  280



>emb|CAB10192.1| xyloglucan endotransglycosylase-related protein XTR-7 [Arabidopsis 
thaliana]
 emb|CAB78455.1| xyloglucan endotransglycosylase-related protein XTR-7 [Arabidopsis 
thaliana]
Length=289

 Score =   354 bits (909),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 203/265 (77%), Gaps = 3/265 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF ++  + +G+H G++ + GN ++L+LDQ +GSGF +K EYL GR DMQ+KLV G SAG
Sbjct  27    NFFDEFDLTWGDHRGKIFNGGNMLSLSLDQVSGSGFKSKKEYLVGRIDMQLKLVAGNSAG  86

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN T +PY +HTNV++QGKG++EQQF+LWFDPT  FH
Sbjct  87    TVTAYYLSSQ-GATHDEIDFEFLGNETGKPYVLHTNVFAQGKGDREQQFYLWFDPTKNFH  145

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+W PQ IIF+VDN PIRVFNN E +G+PFPKSQPMR+Y SLWNADDWAT+GGLVKT
Sbjct  146   TYSIVWRPQHIIFLVDNLPIRVFNNAEKLGVPFPKSQPMRIYSSLWNADDWATRGGLVKT  205

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DWS APFTAYYR FNA AC  ++G       +      Q  +  EL+  GR R+RWVQ  
Sbjct  206   DWSKAPFTAYYRGFNAAACTASSGCDPKFKSSFGDGKLQ--VATELNAYGRRRLRWVQKY  263

Query  959   HMVYNYCADAKRFPQGFSAECKRSR  1033
              M+YNYC+D KRFP+GF  ECK+SR
Sbjct  264   FMIYNYCSDLKRFPRGFPPECKKSR  288



>gb|KFK27295.1| hypothetical protein AALP_AA8G363900 [Arabis alpina]
Length=284

 Score =   354 bits (908),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/261 (64%), Positives = 199/261 (76%), Gaps = 2/261 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV++ +G+  GQ+++NG  + L+LD+ +GSGF +KNEYLFG+  MQMKLV G SAG
Sbjct  23    NFQRDVEITWGDGRGQIKNNGELLTLSLDKSSGSGFQSKNEYLFGKIGMQMKLVPGNSAG  82

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTT YL SP G   DE+DFEFLGN++ +PYT+HTNVY+QGKG+KEQQF LWFDPTA FH
Sbjct  83    TVTTLYLKSP-GTTWDEIDFEFLGNSSGEPYTLHTNVYTQGKGDKEQQFKLWFDPTADFH  141

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TYTILWNPQRIIF VD  PIR F N ESIG  FPK++PMR+Y SLWNADDWAT+GGLVKT
Sbjct  142   TYTILWNPQRIIFTVDGTPIREFKNMESIGTLFPKNKPMRMYSSLWNADDWATRGGLVKT  201

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DWS APFTA YR FN   CV +NG  S     +   +   WL+QELD   + R+RWVQ  
Sbjct  202   DWSKAPFTASYRGFNQEGCVWSNG-KSSCPNGSKKGTTGSWLSQELDSTAQQRMRWVQRN  260

Query  959   HMVYNYCADAKRFPQGFSAEC  1021
             +M+YNYC D+KRFPQG   EC
Sbjct  261   YMIYNYCTDSKRFPQGLPKEC  281



>ref|XP_007217276.1| hypothetical protein PRUPE_ppa017487mg [Prunus persica]
 gb|EMJ18475.1| hypothetical protein PRUPE_ppa017487mg [Prunus persica]
Length=263

 Score =   353 bits (906),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 167/266 (63%), Positives = 201/266 (76%), Gaps = 9/266 (3%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF +D  + FG    ++ + G  + LNLD+ +GSGF +KNEYL GR DMQ+KLV G SAG
Sbjct  7     NFYHDFDITFGGERAKILNGGQLLTLNLDKFSGSGFKSKNEYLLGRIDMQIKLVSGNSAG  66

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNV+SQGKGN+EQQFHLWFDPT AFH
Sbjct  67    TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGNREQQFHLWFDPTKAFH  125

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN QRIIF+VDN PIRVF+N E+IG+PFPK+QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  126   TYSIVWNSQRIIFLVDNIPIRVFHNLETIGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  185

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DW+ APFTA YRNF  +    T+          +      W TQ LD  GRNR+RWVQ K
Sbjct  186   DWTQAPFTASYRNFKVSTTSTTS--------TNSLTEQSAWQTQGLDAAGRNRLRWVQQK  237

Query  959   HMVYNYCADAKRFPQGFSAECKRSRF  1036
              M+YNYC+D KRFPQG  AEC+RSRF
Sbjct  238   FMIYNYCSDLKRFPQGLPAECRRSRF  263



>ref|XP_004140252.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
sativus]
Length=291

 Score =   354 bits (909),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 173/299 (58%), Positives = 221/299 (74%), Gaps = 9/299 (3%)
 Frame = +2

Query  140   MKKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALN  319
             M    + + +++++ V+  S++           NF  DV + +G    ++ D+G  ++L+
Sbjct  1     MHSPHKGLAIMLLLCVLMASIL------TTSAGNFLQDVDITWGGPRAKILDSGRHLSLS  54

Query  320   LDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNAT  499
             LD+ +GSGF +K E+LFGRFD+QM+LV G SAGTVTTFYL+S  G +HDE+DFEFLGN++
Sbjct  55    LDKDSGSGFQSKQEFLFGRFDVQMQLVPGNSAGTVTTFYLSSQ-GGSHDEIDFEFLGNSS  113

Query  500   FQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHE  679
               PYT+HTNVYSQGKGN+EQQFHLWFDPT  FHTY+I W+P+ I F+VDN PIRVF+N E
Sbjct  114   GDPYTLHTNVYSQGKGNREQQFHLWFDPTKGFHTYSIDWSPESIKFLVDNIPIRVFHNWE  173

Query  680   SIGIPFPKSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVss  859
             +IG+ +PKSQPMRVY SLWNADDWAT+GGLVKTDW+ APFTA YRNFNAN CV +    S
Sbjct  174   NIGVSYPKSQPMRVYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFNANGCVAS--SGS  231

Query  860   cnsiaaasnsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
              +  +  S++ Q      LD K RNR+RWVQSK MVYNYC D KRFPQG  AEC+R RF
Sbjct  232   SSCGSKFSSTLQGGAQSGLDAKSRNRLRWVQSKFMVYNYCTDHKRFPQGIPAECRRPRF  290



>ref|XP_007215793.1| hypothetical protein PRUPE_ppa009871mg [Prunus persica]
 gb|EMJ16992.1| hypothetical protein PRUPE_ppa009871mg [Prunus persica]
Length=274

 Score =   353 bits (907),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/266 (62%), Positives = 199/266 (75%), Gaps = 9/266 (3%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + FG+   ++ + G  + LNLD+ +GSGF +KNEYL GR DMQ+KLV G SAG
Sbjct  18    NFYQDFDVTFGDERAKILNGGQLLTLNLDKFSGSGFKSKNEYLLGRIDMQIKLVSGNSAG  77

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNV+SQGKGN+EQQFHLWFDPT AFH
Sbjct  78    TVTAYYLSSE-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGNREQQFHLWFDPTKAFH  136

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN QRIIF+VDN PIRVF N E+IG+PFPK+QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  137   TYSIVWNSQRIIFLVDNIPIRVFTNLETIGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  196

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DW+ APFTA YRNF  +    T+          +      W TQ LD  GRNR+RWVQ K
Sbjct  197   DWTQAPFTASYRNFKVSTTTSTS--------TNSLTEQSAWQTQGLDAAGRNRLRWVQQK  248

Query  959   HMVYNYCADAKRFPQGFSAECKRSRF  1036
              M+YNYC+D KRFPQG   EC+RSRF
Sbjct  249   FMIYNYCSDLKRFPQGLPVECRRSRF  274



>ref|XP_006474159.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like isoform X2 [Citrus sinensis]
Length=286

 Score =   354 bits (908),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 171/289 (59%), Positives = 219/289 (76%), Gaps = 12/289 (4%)
 Frame = +2

Query  167   MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
             + +++G +  +  G          NF  D  + +G+   ++ +NG+ + L+LD+ +GSGF
Sbjct  9     LFLVLGSLMAASAG----------NFYKDFDITWGDGRAKMLNNGDLLTLSLDKASGSGF  58

Query  347   NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
              +KNEYL+G+ DMQ+KLV G SAGTVT +YL SP G   DE+DFEFLGN++  PYT+HTN
Sbjct  59    QSKNEYLYGKIDMQLKLVPGNSAGTVTAYYLKSP-GSTWDEIDFEFLGNSSGDPYTLHTN  117

Query  527   VYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKS  706
             V++ GKG++EQQFHLWFDPTA FHTY+ILWNPQRIIF VD  PIR F N ESIG+PFPK+
Sbjct  118   VFTNGKGDREQQFHLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNSESIGVPFPKN  177

Query  707   QPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasn  886
             QPMR+Y SLWNADDWAT+GGLVKTDW+HAPFTA YRNFNA ACV +NG SSC S +A+S 
Sbjct  178   QPMRIYSSLWNADDWATRGGLVKTDWTHAPFTASYRNFNAEACVWSNGKSSCASNSASST  237

Query  887   snQ-EWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRS  1030
             S+   W +QELD   ++R++WVQ  +M+YNYC D KRFPQG  AEC+ S
Sbjct  238   SSNGAWFSQELDSTNQSRLKWVQKNYMIYNYCTDTKRFPQGLPAECRIS  286



>ref|XP_002866213.1| hypothetical protein ARALYDRAFT_918931 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42472.1| hypothetical protein ARALYDRAFT_918931 [Arabidopsis lyrata subsp. 
lyrata]
Length=282

 Score =   353 bits (907),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 167/261 (64%), Positives = 199/261 (76%), Gaps = 2/261 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV++ +G+  GQ+++NG  + L+LD+ +GSGF +KNEYLFG+  MQMKLV G SAG
Sbjct  21    NFQRDVEITWGDGRGQIKNNGELLTLSLDKSSGSGFQSKNEYLFGKIAMQMKLVPGNSAG  80

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTT YL SP G   DE+DFEFLGN++  PYT+HTNVY+QGKG+KEQQF LWFDPTA FH
Sbjct  81    TVTTLYLKSP-GTTWDEIDFEFLGNSSGDPYTLHTNVYTQGKGDKEQQFKLWFDPTADFH  139

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TYTILWNPQRIIF VD  PIR F N ES+G  FPK++PMR+Y SLWNADDWAT+GGLVKT
Sbjct  140   TYTILWNPQRIIFTVDGTPIREFKNMESLGTLFPKNKPMRMYSSLWNADDWATRGGLVKT  199

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DWS APFTA YR F   ACV +NG  S    A+   +   WL+QELD   + R+RWVQ  
Sbjct  200   DWSKAPFTASYRGFKQEACVWSNG-KSSCPNASKQGTTGSWLSQELDSTAQQRMRWVQRN  258

Query  959   HMVYNYCADAKRFPQGFSAEC  1021
             +M+YNYC DAKRFPQG   EC
Sbjct  259   YMIYNYCTDAKRFPQGLPKEC  279



>ref|XP_004164862.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
sativus]
Length=280

 Score =   353 bits (907),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 172/266 (65%), Positives = 206/266 (77%), Gaps = 3/266 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV + +G    ++ D G  ++L+LD+ +GSGF +K E+LFGRFD+QMKLV G SAG
Sbjct  18    NFLQDVDITWGGPRAKILDGGRHLSLSLDKDSGSGFQSKQEFLFGRFDVQMKLVPGNSAG  77

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL+S  G +HDE+DFEFLGN++  PYT+HTNVYSQGKGN+EQQFHLWFDPT  FH
Sbjct  78    TVTTFYLSSQ-GGSHDEIDFEFLGNSSGDPYTLHTNVYSQGKGNREQQFHLWFDPTKGFH  136

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I W+P+ I F+VDN PIRVF N E+IG+ +PKSQPMRVY SLWNADDWAT+GGLVKT
Sbjct  137   TYSIDWSPESIKFLVDNIPIRVFRNWENIGVSYPKSQPMRVYSSLWNADDWATRGGLVKT  196

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DW+ APFTA YRNFNAN CV +    S +  +  S++ Q      LD K RNR+RWVQSK
Sbjct  197   DWTQAPFTASYRNFNANGCVAS--SGSSSCGSKFSSTLQGGAQSGLDAKSRNRLRWVQSK  254

Query  959   HMVYNYCADAKRFPQGFSAECKRSRF  1036
              MVYNYC D KRFPQG  AECKR RF
Sbjct  255   FMVYNYCTDHKRFPQGIPAECKRPRF  280



>ref|XP_004164865.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
sativus]
 emb|CCH26409.1| xyloglucan endotransglycosylase [Cucumis sativus]
Length=291

 Score =   353 bits (907),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 172/299 (58%), Positives = 221/299 (74%), Gaps = 9/299 (3%)
 Frame = +2

Query  140   MKKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALN  319
             M    + + +++++ V+  S++           NF  DV + +G    ++ D+G  ++L+
Sbjct  1     MHSPHKGLAIMLLLCVLMASIL------TTSAGNFLQDVDITWGGPRAKILDSGRHLSLS  54

Query  320   LDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNAT  499
             LD+ +GSGF +K E+LFGRFD+QM+LV G SAGTVTTFYL+S  G +HDE+DFEFLGN++
Sbjct  55    LDKDSGSGFQSKQEFLFGRFDVQMQLVPGNSAGTVTTFYLSSQ-GGSHDEIDFEFLGNSS  113

Query  500   FQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHE  679
               PYT+HTNVYSQGKGN+EQQFHLWFDPT  FHTY+I W+P+ I F+VDN PIRVF+N E
Sbjct  114   GDPYTLHTNVYSQGKGNREQQFHLWFDPTKGFHTYSIDWSPESIKFLVDNIPIRVFHNWE  173

Query  680   SIGIPFPKSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVss  859
             +IG+ +PKSQPMRVY SLWNADDWAT+GGLVKTDW+ APFTA YRNFNAN CV +    S
Sbjct  174   NIGVSYPKSQPMRVYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFNANGCVAS--SGS  231

Query  860   cnsiaaasnsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
              +  +  S++ Q      LD K RNR+RWVQSK M+YNYC D KRFPQG  AEC+R RF
Sbjct  232   SSCGSKFSSTLQGGAQSGLDAKSRNRLRWVQSKFMIYNYCTDHKRFPQGIPAECRRPRF  290



>ref|XP_004303860.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16-like [Fragaria vesca subsp. vesca]
Length=296

 Score =   354 bits (908),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 170/296 (57%), Positives = 213/296 (72%), Gaps = 9/296 (3%)
 Frame = +2

Query  161   VCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGS  340
             +  ++++ +   SL+ +  +      NF  D  + FG+   ++ + G  + LNLD+ +GS
Sbjct  6     ISRMLLLSLFITSLLAMTASAG----NFFQDFDITFGDQRAKILEGGQFLTLNLDKYSGS  61

Query  341   GFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVH  520
             GF +K EYLFGR DMQ+KLV G SAGTVTT+YL+S  G  HDE+DFEFLGN++  PYT+H
Sbjct  62    GFKSKKEYLFGRIDMQIKLVPGNSAGTVTTYYLSSE-GPTHDEIDFEFLGNSSGNPYTLH  120

Query  521   TNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP  700
             TNV+SQGKG++EQQFHLWFDPT AFHTY+ +WN QRIIF+VDN PIRVFNN ES G+PFP
Sbjct  121   TNVFSQGKGDREQQFHLWFDPTKAFHTYSFVWNSQRIIFLVDNIPIRVFNNLESFGVPFP  180

Query  701   KSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYY-RNFNANACVV---TNGVsscns  868
             K+QPMRVY SLWNADDWATQGG VKTDW+ APF  +  + + ANACV    ++      +
Sbjct  181   KNQPMRVYSSLWNADDWATQGGRVKTDWTQAPFYCFIPKPYKANACVAGSSSSSCGVATT  240

Query  869   iaaasnsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
              +  S     W TQ LD  GRNR+RWVQ K MVYNYC+D KRFPQG   ECKRSRF
Sbjct  241   ASTDSTQQGAWQTQTLDAAGRNRLRWVQQKFMVYNYCSDLKRFPQGLPVECKRSRF  296



>ref|XP_006280918.1| hypothetical protein CARUB_v10026914mg [Capsella rubella]
 gb|EOA13816.1| hypothetical protein CARUB_v10026914mg [Capsella rubella]
Length=284

 Score =   353 bits (907),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 167/285 (59%), Positives = 208/285 (73%), Gaps = 4/285 (1%)
 Frame = +2

Query  167   MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
             M +IIG +   L    + +     NF  DV++ +G+  GQ+++NG  + L+LD+ +GSGF
Sbjct  1     MAIIIGYL-LPLFLSLIIISSVSANFQRDVEITWGDGRGQIKNNGELLTLSLDKSSGSGF  59

Query  347   NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
              ++NEYLFG+ DMQMKLV G SAGTVTT YL SP G   DE+DFEFLGN++ +PYT+HTN
Sbjct  60    QSRNEYLFGKIDMQMKLVPGNSAGTVTTLYLKSP-GTTWDEIDFEFLGNSSGEPYTLHTN  118

Query  527   VYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKS  706
             VY+QGKG+KEQQF LWFDPTA FHTY+ILWNPQRIIF VD  PIR F N ES+G  FPK+
Sbjct  119   VYTQGKGDKEQQFKLWFDPTADFHTYSILWNPQRIIFTVDGTPIREFKNMESVGTLFPKN  178

Query  707   QPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasn  886
             +PMR+Y SLWNADDWAT+GGLVKTDWS APFTA YR F   ACV +NG    +  +    
Sbjct  179   KPMRMYSSLWNADDWATRGGLVKTDWSKAPFTASYRGFKQEACVWSNG--KSSCGSKQRT  236

Query  887   snQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAEC  1021
             +   WL+Q+LD   + R+RWVQ  +M+YNYC D KRFPQG   EC
Sbjct  237   TTGSWLSQQLDSTAQQRMRWVQRNYMIYNYCTDTKRFPQGLPKEC  281



>ref|XP_007014165.1| Xyloglucan endotransglucosylase/hydrolase family protein [Theobroma 
cacao]
 gb|EOY31784.1| Xyloglucan endotransglucosylase/hydrolase family protein [Theobroma 
cacao]
Length=290

 Score =   353 bits (906),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 171/291 (59%), Positives = 214/291 (74%), Gaps = 12/291 (4%)
 Frame = +2

Query  161   VCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGS  340
             + M ++IG +  +             NF  D  + +G+  G++ +NG  ++L+LD+ +GS
Sbjct  11    LLMSLVIGCLMAA----------SASNFYQDFDITWGDGRGKIDNNGEVLSLSLDKASGS  60

Query  341   GFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVH  520
             GF +K+EYLFG+ D Q+KLV G SAGTVT +YL+S  G   DE+DFEFLGN +  PY +H
Sbjct  61    GFQSKDEYLFGKIDTQLKLVPGNSAGTVTAYYLSSK-GSTWDEIDFEFLGNLSGDPYILH  119

Query  521   TNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP  700
             TNV+SQGKGN+EQQFHLWFDPTA FHTY+ILWNPQRIIF VD  PIR F N ES+G+PFP
Sbjct  120   TNVFSQGKGNREQQFHLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNMESLGVPFP  179

Query  701   KSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaa  880
             K+QPMR+Y SLWNADDWAT+GGLVKTDW+ APFTA YRNFNANACV +NG SSC S + +
Sbjct  180   KNQPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFNANACVWSNGASSCKSNSPS  239

Query  881   snsn-QEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRS  1030
             S S    W +QELD   + R++WVQ  +M+YNYC DAKRFPQG   EC  S
Sbjct  240   SASTNNAWFSQELDSSSQQRLQWVQKNYMIYNYCTDAKRFPQGLPPECNMS  290



>gb|AEX07596.1| xyloglucosyl transferase 1, partial [Brassica juncea]
Length=283

 Score =   352 bits (904),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 167/260 (64%), Positives = 196/260 (75%), Gaps = 2/260 (1%)
 Frame = +2

Query  242   FNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGT  421
             F  DV++ +G+  GQ+ +NG  + L+LD+ +GSGF +KNEYLFG+ DMQMKLV G SAGT
Sbjct  23    FQRDVEITWGDGRGQITNNGELLTLSLDKSSGSGFQSKNEYLFGKIDMQMKLVPGNSAGT  82

Query  422   VTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHT  601
             VTT YL SP G   DE+DFEFLGN +  PYT+HTNVY+QGKG+KEQQF LWFDPTA FHT
Sbjct  83    VTTLYLKSP-GTTWDEIDFEFLGNLSGDPYTLHTNVYTQGKGDKEQQFKLWFDPTADFHT  141

Query  602   YTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKTD  781
             YTILWNPQRIIF VD  PIR F N ES+G  FPK+QPMR+Y SLWNADDWAT+GGLVKTD
Sbjct  142   YTILWNPQRIIFTVDGTPIREFKNMESVGTLFPKNQPMRMYSSLWNADDWATRGGLVKTD  201

Query  782   WSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSKH  961
             WS APFTA YR FN  ACV +NG  S     +   +   WL+QELD   + R+RWVQ  +
Sbjct  202   WSKAPFTASYRGFNQEACVWSNG-KSSCPNGSGQGTTGSWLSQELDSTAQERMRWVQKNY  260

Query  962   MVYNYCADAKRFPQGFSAEC  1021
             M+YNYC D KRFPQG   EC
Sbjct  261   MIYNYCTDTKRFPQGLPKEC  280



>gb|KHF98175.1| putative xyloglucan endotransglucosylase/hydrolase 23 -like protein 
[Gossypium arboreum]
Length=290

 Score =   353 bits (905),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 169/289 (58%), Positives = 217/289 (75%), Gaps = 10/289 (3%)
 Frame = +2

Query  170   IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
             +++  +VAC +   A        NF+ND  + +G+  G++ +NG  + L+LD+ +GSGF 
Sbjct  10    LLVPLLVACLMASSAS-------NFHNDFDITWGDGRGKIVNNGEVLTLSLDKASGSGFQ  62

Query  350   TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
             +KNEYLFG+ DMQ+KLV G SAGTVT +YL+S  G   DE+DFEFLGN +  PY +HTNV
Sbjct  63    SKNEYLFGKIDMQLKLVPGNSAGTVTAYYLSSK-GSTWDEIDFEFLGNLSGDPYILHTNV  121

Query  530   YSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQ  709
             +SQGKGN+EQQF+LWFDPT  FHTY+ILWNPQRIIF VD  PIR F N ES G+PFPK+Q
Sbjct  122   FSQGKGNREQQFYLWFDPTVDFHTYSILWNPQRIIFSVDGTPIREFKNMESFGVPFPKNQ  181

Query  710   PMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVss--cnsiaaas  883
             PMR+Y SLWNADDWAT+GGLVKTDW+ APFTA YRNFNA+ACV +NG SS   N+  +++
Sbjct  182   PMRIYSSLWNADDWATRGGLVKTDWTRAPFTASYRNFNADACVWSNGASSCKSNASPSSA  241

Query  884   nsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRS  1030
             ++N  W +QE+D   + R++WVQ  +M+YNYC DAKRFPQG   EC  S
Sbjct  242   STNSAWFSQEMDSAKQQRLKWVQKNYMIYNYCNDAKRFPQGLPPECNMS  290



>ref|XP_006474154.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like isoform X1 [Citrus sinensis]
 gb|KDO36926.1| hypothetical protein CISIN_1g023204mg [Citrus sinensis]
Length=286

 Score =   352 bits (904),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 170/289 (59%), Positives = 218/289 (75%), Gaps = 12/289 (4%)
 Frame = +2

Query  167   MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
             + +++G +  +  G          NF  D  + +G+   ++ +NG+ + L+LD+ +GSGF
Sbjct  9     LFLVLGSLMVASAG----------NFYKDFDITWGDGRAKMLNNGDLLTLSLDKASGSGF  58

Query  347   NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
              +KNEYL+G+ DMQ+KLV G SAGTVT +YL SP G   DE+DFEFLGN +  PYT+HTN
Sbjct  59    QSKNEYLYGKIDMQLKLVPGNSAGTVTAYYLKSP-GSTWDEIDFEFLGNLSGDPYTLHTN  117

Query  527   VYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKS  706
             V++ GKG++EQQFHLWFDP A FHTY+ILWNPQRI+F VD  PIR F N ESIG+PFPK+
Sbjct  118   VFTNGKGDREQQFHLWFDPAADFHTYSILWNPQRIVFSVDGTPIREFKNSESIGVPFPKN  177

Query  707   QPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasn  886
             QPMR+Y SLWNADDWAT+GGLVKTDW+HAPFTA YRNFNA ACV +NG SSC S +A+S 
Sbjct  178   QPMRIYSSLWNADDWATRGGLVKTDWTHAPFTASYRNFNAEACVWSNGKSSCASNSASST  237

Query  887   snQ-EWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRS  1030
             S+   W +QELD   ++R++WVQ  +M+YNYCAD KRFPQG  AEC+ S
Sbjct  238   SSNGAWFSQELDSTNQSRLKWVQKNYMIYNYCADTKRFPQGLPAECRTS  286



>gb|KFK27294.1| hypothetical protein AALP_AA8G363800 [Arabis alpina]
Length=284

 Score =   352 bits (904),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 166/261 (64%), Positives = 198/261 (76%), Gaps = 2/261 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             N   DV++ +G+  GQ+++NG  + L+LD+ +GSGF +KNEYLFG+  MQMKLV G SAG
Sbjct  23    NLQRDVEITWGDGRGQIKNNGELLTLSLDKSSGSGFQSKNEYLFGKIGMQMKLVPGNSAG  82

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTT YL SP G   DE+DFEFLGN++ +PYT+HTNVY+QGKG+KEQQF LWFDPTA FH
Sbjct  83    TVTTLYLKSP-GTTWDEIDFEFLGNSSGEPYTLHTNVYTQGKGHKEQQFKLWFDPTADFH  141

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TYTILWNPQRIIF VD  PIR F N ESIG  FPK++PMR+Y SLWNADDWAT+GGLVKT
Sbjct  142   TYTILWNPQRIIFTVDGTPIREFKNMESIGTLFPKNKPMRMYSSLWNADDWATRGGLVKT  201

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DWS APFTA YR FN  ACV +NG  S     +   +   WL+QELD   + R+RWVQ  
Sbjct  202   DWSKAPFTASYRGFNQEACVWSNG-KSSCPNGSKKGATGSWLSQELDSTAQQRMRWVQRN  260

Query  959   HMVYNYCADAKRFPQGFSAEC  1021
              M+YNYC D+KRFPQG   EC
Sbjct  261   FMIYNYCTDSKRFPQGLPKEC  281



>ref|XP_002301752.1| brassinosteroid-regulated family protein [Populus trichocarpa]
 gb|ABK93796.1| unknown [Populus trichocarpa]
 gb|EEE81025.1| brassinosteroid-regulated family protein [Populus trichocarpa]
Length=288

 Score =   352 bits (904),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 171/291 (59%), Positives = 216/291 (74%), Gaps = 7/291 (2%)
 Frame = +2

Query  164   CMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSG  343
             C    + ++ CS+V           +F  D  + +G+H  ++ + G  ++L+LD+ +GSG
Sbjct  5     CNGFSLFLIVCSMV------VVASGSFYQDFDLTWGDHRAKIFNGGQLLSLSLDKVSGSG  58

Query  344   FNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHT  523
             F +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +HT
Sbjct  59    FQSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GATHDEIDFEFLGNLSGDPYILHT  117

Query  524   NVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPK  703
             NV++QGKGN+EQQF+LWFDPT  FHTY+I+W+ Q IIF+VDN PIRVF N ESIG+PFPK
Sbjct  118   NVFTQGKGNREQQFYLWFDPTRNFHTYSIIWSQQHIIFLVDNFPIRVFKNAESIGVPFPK  177

Query  704   SQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaas  883
             SQPMR+Y SLWNADDWAT+GGLVKTDW+ APFTAYYRNF A+AC  + G SSC S +++S
Sbjct  178   SQPMRIYSSLWNADDWATRGGLVKTDWTKAPFTAYYRNFKADACTWSYGTSSCGSRSSSS  237

Query  884   nsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
              S++ W T  LD   R R+RWVQ   M+YNYCAD KRFPQG   EC+RSRF
Sbjct  238   FSDRAWHTNALDAPSRRRLRWVQKYFMIYNYCADLKRFPQGLPPECRRSRF  288



>ref|XP_002883457.1| hypothetical protein ARALYDRAFT_479888 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59716.1| hypothetical protein ARALYDRAFT_479888 [Arabidopsis lyrata subsp. 
lyrata]
Length=291

 Score =   352 bits (904),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 168/294 (57%), Positives = 222/294 (76%), Gaps = 7/294 (2%)
 Frame = +2

Query  155   QQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQT  334
             Q + + +++ ++  ++VG A +      +FN +  + +G H G++   G  ++L+LD+ +
Sbjct  3     QILNLTVLMTLLVVTMVGTAFSG-----SFNEEFDLTWGEHRGKIFSGGKMLSLSLDRVS  57

Query  335   GSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYT  514
             GSGF +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN T +PY 
Sbjct  58    GSGFKSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSE-GPTHDEIDFEFLGNETGKPYV  116

Query  515   VHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIP  694
             +HTNV++QGKGN+EQQF+LWFDPT  FHTY+++W PQ IIFMVDN PIRVFNN E +G+P
Sbjct  117   LHTNVFAQGKGNREQQFYLWFDPTKNFHTYSLVWRPQHIIFMVDNVPIRVFNNAEKLGVP  176

Query  695   FPKSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsia  874
             FPK+QPM++Y SLWNADDWAT+GGLVKTDWS APFTAYYR FNA AC V++G S C+   
Sbjct  177   FPKNQPMKIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRGFNAAACTVSSGSSFCDPKF  236

Query  875   aasnsnQE-WLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSR  1033
              +S +N E  +  EL+  GR R+RWVQ   M+Y+YC+D KRFPQGF  EC++SR
Sbjct  237   KSSFTNGESQVANELNAYGRRRLRWVQKYFMIYDYCSDLKRFPQGFPPECRKSR  290



>ref|XP_006425209.1| hypothetical protein CICLE_v10010858mg [Citrus clementina]
 ref|XP_006474162.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Citrus sinensis]
 gb|ESR38449.1| hypothetical protein CICLE_v10010858mg [Citrus clementina]
Length=280

 Score =   352 bits (903),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 163/288 (57%), Positives = 215/288 (75%), Gaps = 14/288 (5%)
 Frame = +2

Query  167   MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
             + +++G +  +  G          +F  D  + +G+   ++ +NG  + L+LD+ +GSGF
Sbjct  7     LFLVLGTLMVASAG----------SFYQDFDITWGDGRAKIHNNGQFLTLSLDKASGSGF  56

Query  347   NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
              +KNEYLFG+ DMQ+KLV G SAGTVT +YL SP G   DE+DFEFLGN +  PYT+HTN
Sbjct  57    QSKNEYLFGKIDMQLKLVPGNSAGTVTAYYLKSP-GSTWDEIDFEFLGNLSGDPYTLHTN  115

Query  527   VYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKS  706
             V++ GKGN+EQQFHLWFDPTAAFHTY+ILWNPQRI+F VD  PIR F N ESIG+PFPK+
Sbjct  116   VFTNGKGNREQQFHLWFDPTAAFHTYSILWNPQRIVFSVDGTPIREFKNSESIGVPFPKN  175

Query  707   QPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasn  886
             QPMR+Y SLWNADDWAT+GGLVKTDW+HAPFTA YRNF A+AC+ +NG    +S A++ +
Sbjct  176   QPMRIYSSLWNADDWATRGGLVKTDWTHAPFTASYRNFKADACLWSNGK---SSCASSKS  232

Query  887   snQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRS  1030
              ++ W +QELD   +N+++WVQ  +M+YNYC D KRFPQG   EC+ +
Sbjct  233   RSRAWFSQELDSSSQNKLKWVQKNYMIYNYCTDTKRFPQGLPVECRTA  280



>ref|XP_010259800.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Nelumbo nucifera]
Length=325

 Score =   353 bits (907),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 169/265 (64%), Positives = 212/265 (80%), Gaps = 2/265 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NFN D  + +G+   Q+ +NG  + L+LD+ +GSGF +K+EYLFG+ DMQ+KLV G SAG
Sbjct  59    NFNQDFDITWGDGRAQILNNGELLTLSLDKASGSGFQSKHEYLFGKIDMQLKLVAGNSAG  118

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN +  PY +HTNV+SQGKGN+EQQF+LWFDPTA FH
Sbjct  119   TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFH  177

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VD  PIR F N ESIG+PFPK+Q MR+Y SLWNADDWAT+GGLVKT
Sbjct  178   TYSILWNPQRIIFSVDGIPIREFKNSESIGVPFPKNQAMRIYSSLWNADDWATRGGLVKT  237

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQ-EWLTQELDGKGRNRVRWVQS  955
             DW+ APFTA YRNFNANACV+++G SSC+S +  S ++  +WL+QELD  G+ R++WVQ+
Sbjct  238   DWTKAPFTASYRNFNANACVMSSGSSSCDSKSPTSTTDNLQWLSQELDSAGQERMKWVQN  297

Query  956   KHMVYNYCADAKRFPQGFSAECKRS  1030
              +M+YNYCAD KRFPQG   EC  +
Sbjct  298   NYMIYNYCADTKRFPQGLPPECSNT  322



>ref|XP_008449516.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
melo]
Length=289

 Score =   352 bits (904),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 177/299 (59%), Positives = 217/299 (73%), Gaps = 14/299 (5%)
 Frame = +2

Query  146   KQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLD  325
             +Q  Q+C+ M   ++A +  G          NF  DV + +G    ++ D G  + L+LD
Sbjct  2     RQLLQLCVFMA-SLMAATTAG----------NFLRDVDVTWGGPRAKMLDGGRHLTLSLD  50

Query  326   QQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQ  505
             + +GSGF +K E+LFGRFD++M LV G SAGTVTTFYL+S  G +HDE+DFEFLGN T  
Sbjct  51    KDSGSGFQSKKEFLFGRFDVRMMLVPGNSAGTVTTFYLSSE-GTSHDEIDFEFLGNLTGH  109

Query  506   PYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESI  685
             PYT+HTNVYSQGKG++EQQFHLWFDPT AFHTY+I W+PQ I F+VDN PIRVF+N E I
Sbjct  110   PYTLHTNVYSQGKGDREQQFHLWFDPTKAFHTYSIDWSPQSIKFLVDNIPIRVFHNWEGI  169

Query  686   GIPFPKSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscn  865
             G+ FPKSQPM+VY SLWNADDWAT+GGLVKTDW+ APFTA YR+FNAN CV +   S  +
Sbjct  170   GVSFPKSQPMKVYSSLWNADDWATRGGLVKTDWTKAPFTASYRDFNANGCVASTSSSLSS  229

Query  866   siaaasnsnQEWLTQE--LDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
               +  +N+       +  LD K RNR+RWVQSK MVYNYC D KRFPQG  AECKRSRF
Sbjct  230   CSSKYANTLHGAKNNQGGLDAKSRNRLRWVQSKFMVYNYCTDRKRFPQGIPAECKRSRF  288



>ref|XP_008449531.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
melo]
 ref|XP_008449532.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
melo]
Length=291

 Score =   352 bits (904),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 174/299 (58%), Positives = 219/299 (73%), Gaps = 9/299 (3%)
 Frame = +2

Query  140   MKKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALN  319
             M    + + +++ + V+  S++           NF  DV + +G    ++ D G  ++L+
Sbjct  1     MHSPHKGLTIMLPLCVLMASIM------TATAGNFLQDVDVTWGGPRAKILDRGRHLSLS  54

Query  320   LDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNAT  499
             LD+ +GSGF +K E+LFGRFD+QMKLV G SAGTVTTFYL+S  G +HDE+DFEFLGN++
Sbjct  55    LDKDSGSGFQSKQEFLFGRFDVQMKLVPGNSAGTVTTFYLSSQ-GGSHDEIDFEFLGNSS  113

Query  500   FQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHE  679
               PYT+HTNVYSQGKGN+EQQFHLWFDPT  FHTY+I W+P+ I F+VDN PIRVF+N E
Sbjct  114   GHPYTLHTNVYSQGKGNREQQFHLWFDPTKGFHTYSIDWSPESIKFLVDNIPIRVFHNWE  173

Query  680   SIGIPFPKSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVss  859
             ++G+ +PKSQPMRVY SLWNADDWAT+GGLVKTDW+ APFTA YRNFNAN CV +    S
Sbjct  174   NVGVSYPKSQPMRVYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFNANGCVAS--SGS  231

Query  860   cnsiaaasnsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
              +  +  S+S Q      LD K RNR+RWVQSK M+YNYC D KRFPQG  AECKR RF
Sbjct  232   SSCGSKFSSSLQGGAQSGLDAKSRNRLRWVQSKFMIYNYCTDHKRFPQGIPAECKRPRF  290



>ref|XP_010452475.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Camelina sativa]
Length=287

 Score =   352 bits (903),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 166/263 (63%), Positives = 202/263 (77%), Gaps = 3/263 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV++ +G+  GQ+++NG  + L+LD+ +GSGF +KNEYLFG+ DMQMKLV G SAG
Sbjct  23    NFQRDVEITWGDGRGQIKNNGELLTLSLDKSSGSGFQSKNEYLFGKIDMQMKLVPGNSAG  82

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTT YL SP G   DE+DFEFLGN++  PYT+HTNVY+QGKG+KEQQF LWFDPTA FH
Sbjct  83    TVTTLYLKSP-GTTWDEIDFEFLGNSSGDPYTLHTNVYTQGKGDKEQQFKLWFDPTADFH  141

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VD  PIR F N ES+G  FPK++PMR+Y SLWNADDWAT+GGLVKT
Sbjct  142   TYSILWNPQRIIFTVDGTPIREFKNMESLGTLFPKNKPMRMYSSLWNADDWATRGGLVKT  201

Query  779   DWSHAPFTAYYRNFNANACVVTNGVss--cnsiaaasnsnQEWLTQELDGKGRNRVRWVQ  952
             DWS APFTA YR F   ACV +NG SS    S    + ++  WL+Q+LD   + R+RWVQ
Sbjct  202   DWSKAPFTATYRGFKQEACVWSNGKSSCPNGSKQGTTGTSGSWLSQQLDSTAQQRMRWVQ  261

Query  953   SKHMVYNYCADAKRFPQGFSAEC  1021
               +M+YNYC D+KRFPQG   EC
Sbjct  262   RNYMIYNYCTDSKRFPQGLPKEC  284



>ref|XP_006474158.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like isoform X1 [Citrus sinensis]
Length=292

 Score =   352 bits (903),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 176/298 (59%), Positives = 221/298 (74%), Gaps = 7/298 (2%)
 Frame = +2

Query  140   MKKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALN  319
             M   +  V +IM+  +++ S V     +  P  NF  D  + +G    +++++G  + L 
Sbjct  1     MAAAKSLVVLIMLSALLSNSFV-----LVLPASNFYQDFDIIWGIDKVRIRNDGEVLNLY  55

Query  320   LDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNAT  499
             L + TGSGF +KNEYLFG+ DMQ KLV G SAGTVT +YL SP G   DE+DFEFLGN++
Sbjct  56    LGKDTGSGFQSKNEYLFGKIDMQFKLVPGNSAGTVTAYYLKSP-GSTWDEIDFEFLGNSS  114

Query  500   FQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHE  679
               PYT+HTNV++ GKG++EQQFHLWFDPTA FHTY+ILWNPQRIIF VD  PIR F N E
Sbjct  115   GDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNSE  174

Query  680   SIGIPFPKSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVss  859
             SIG+PFPK+QPMR+Y SLWNADDWAT+GGLVKTDW+HAPFTA YRNFNA ACV +NG SS
Sbjct  175   SIGVPFPKNQPMRIYSSLWNADDWATRGGLVKTDWTHAPFTASYRNFNAEACVWSNGKSS  234

Query  860   cnsiaaasnsnQ-EWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRS  1030
             C S +A+S S+   W +QELD   ++R++WVQ  +M+YNYC D KRFPQG  AEC+ S
Sbjct  235   CASNSASSTSSNGAWFSQELDSTNQSRLKWVQKNYMIYNYCTDTKRFPQGLPAECRIS  292



>ref|XP_010443442.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22 [Camelina sativa]
 ref|XP_010483278.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22 [Camelina sativa]
Length=287

 Score =   352 bits (902),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 166/263 (63%), Positives = 201/263 (76%), Gaps = 3/263 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV++ +G+  GQ+++NG  + L LD+ +GSGF +KNEYLFG+ DMQMKLV G SAG
Sbjct  23    NFQRDVEITWGDGRGQIKNNGELLTLTLDKSSGSGFQSKNEYLFGKIDMQMKLVPGNSAG  82

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTT YL SP G   DE+DFEFLGN++  PYT+HTNVY+QGKG+KEQQF LWFDPTA FH
Sbjct  83    TVTTLYLKSP-GTTWDEIDFEFLGNSSGDPYTLHTNVYTQGKGDKEQQFKLWFDPTADFH  141

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VD  PIR F N ES+G  FPK++PMR+Y SLWNADDWAT+GGLVKT
Sbjct  142   TYSILWNPQRIIFTVDGTPIREFKNMESLGTLFPKNKPMRMYSSLWNADDWATRGGLVKT  201

Query  779   DWSHAPFTAYYRNFNANACVVTNGVss--cnsiaaasnsnQEWLTQELDGKGRNRVRWVQ  952
             DWS APFTA YR F   ACV +NG SS    S    + ++  WL+Q+LD   + R+RWVQ
Sbjct  202   DWSKAPFTATYRGFKQEACVWSNGKSSCPNGSKQGTTGTSGSWLSQQLDSTAQQRMRWVQ  261

Query  953   SKHMVYNYCADAKRFPQGFSAEC  1021
               +M+YNYC D+KRFPQG   EC
Sbjct  262   RNYMIYNYCTDSKRFPQGLPKEC  284



>ref|XP_011024784.1| PREDICTED: brassinosteroid-regulated protein BRU1-like isoform 
X1 [Populus euphratica]
 ref|XP_011024785.1| PREDICTED: brassinosteroid-regulated protein BRU1-like isoform 
X2 [Populus euphratica]
Length=288

 Score =   352 bits (902),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 171/291 (59%), Positives = 217/291 (75%), Gaps = 7/291 (2%)
 Frame = +2

Query  164   CMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSG  343
             C    + ++ACS+V           +F  D  + +G+H  ++ + G  ++L+LD+ +GSG
Sbjct  5     CNGFSLFLIACSMV------VVASGSFYQDFDLTWGDHRAKIFNGGQLLSLSLDKVSGSG  58

Query  344   FNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHT  523
             F +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +HT
Sbjct  59    FQSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILHT  117

Query  524   NVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPK  703
             NV++QGKGN+EQQF+LWFDPT  FHTY+I+W+ Q IIF+VDN PIRVF N ESIG+PFPK
Sbjct  118   NVFTQGKGNREQQFYLWFDPTRNFHTYSIIWSHQHIIFLVDNFPIRVFKNAESIGVPFPK  177

Query  704   SQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaas  883
             SQPMR+Y SLWNADDWAT+GG+VKTDW+ APFTAYYRNF A+AC  + G SSC S +++S
Sbjct  178   SQPMRIYSSLWNADDWATRGGVVKTDWTKAPFTAYYRNFKADACTWSYGKSSCGSRSSSS  237

Query  884   nsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
              S++ W T  LD   R R+RWVQ   M+YNYCAD KRFPQG   EC+RSRF
Sbjct  238   FSDRAWQTNALDAPSRRRLRWVQKYFMIYNYCADLKRFPQGLPPECRRSRF  288



>ref|XP_006413268.1| hypothetical protein EUTSA_v10025720mg [Eutrema salsugineum]
 gb|ESQ54721.1| hypothetical protein EUTSA_v10025720mg [Eutrema salsugineum]
Length=323

 Score =   353 bits (906),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 167/261 (64%), Positives = 205/261 (79%), Gaps = 1/261 (0%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV++ +G+  GQ+ +NG+ + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  61    NFQRDVEITWGDGRGQITNNGDLLTLSLDKSSGSGFRSKNEYLFGKIDMQIKLVAGNSAG  120

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL SP G   DEVDFEFLGN +  PYT+HTNV++QGKG++EQQF LWFDPT+ FH
Sbjct  121   TVTAYYLKSP-GSTWDEVDFEFLGNLSGDPYTLHTNVFTQGKGDREQQFKLWFDPTSDFH  179

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VD  PIR F N ES G  FPK+QPMR+Y SLWNA+DWAT+GGLVKT
Sbjct  180   TYSILWNPQRIIFSVDGTPIREFKNMESQGTLFPKNQPMRMYSSLWNAEDWATRGGLVKT  239

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DWS APFTA YR FN  ACV++NG SSC + +   +S+  WL+QELD  G+ R+RWVQS 
Sbjct  240   DWSKAPFTASYRGFNEEACVMSNGKSSCPNGSGQGSSSGSWLSQELDSTGQERMRWVQSN  299

Query  959   HMVYNYCADAKRFPQGFSAEC  1021
             +M+YNYC D KRFPQG   EC
Sbjct  300   YMIYNYCTDIKRFPQGLPQEC  320



>ref|XP_009102589.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16 [Brassica rapa]
Length=291

 Score =   352 bits (902),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 164/266 (62%), Positives = 207/266 (78%), Gaps = 2/266 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             +FN +  + +G H G++   G  ++L+LD+ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  26    SFNEEFDLTWGEHRGKIFSGGKMLSLSLDRVSGSGFKSKKEYLFGRIDMQLKLVAGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN T +PY +HTNV++QGKGN+EQQF+LWFDPT  FH
Sbjct  86    TVTAYYLSSE-GPTHDEIDFEFLGNETGKPYVLHTNVFAQGKGNREQQFYLWFDPTKNFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+++W PQ IIFMVDN PIRVFNN E +G+PFPK QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  145   TYSLVWRPQHIIFMVDNVPIRVFNNAEQLGVPFPKKQPMRIYSSLWNADDWATRGGLVKT  204

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQE-WLTQELDGKGRNRVRWVQS  955
             DWS APFTAYYR FNA AC V++G S C+    ++ ++ E  +  EL+  GR R+RWVQ 
Sbjct  205   DWSKAPFTAYYRGFNAAACTVSSGSSFCDPKFRSTFADGESQVPNELNAYGRRRLRWVQK  264

Query  956   KHMVYNYCADAKRFPQGFSAECKRSR  1033
               M+Y+YC+D KRFPQGF  EC+RSR
Sbjct  265   YFMIYDYCSDLKRFPQGFPPECRRSR  290



>emb|CCH26408.1| xyloglucan endotransglycosylase [Cucumis sativus]
Length=280

 Score =   351 bits (901),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 171/266 (64%), Positives = 205/266 (77%), Gaps = 3/266 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV + +G    ++ D G  ++L+LD+ +GSGF +K E+LFGRFD+QMKLV G SAG
Sbjct  18    NFLQDVDITWGGPRAKILDGGRHLSLSLDKDSGSGFQSKQEFLFGRFDVQMKLVPGNSAG  77

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL+S  G +HDE+DFEFLGN++  PYT+HTNVYSQGKGN+EQQFHLWFDPT  FH
Sbjct  78    TVTTFYLSSQ-GGSHDEIDFEFLGNSSGDPYTLHTNVYSQGKGNREQQFHLWFDPTKGFH  136

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I W+P+ I F+VDN PIRVF N E+IG+ +PKSQPMRVY SLWNADDWAT+GGLVKT
Sbjct  137   TYSIDWSPESIKFLVDNIPIRVFRNWENIGVSYPKSQPMRVYSSLWNADDWATRGGLVKT  196

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DW+ APFTA YRNFNAN CV +    S +  +  S++ Q      LD K RNR+RWVQSK
Sbjct  197   DWTQAPFTASYRNFNANGCVAS--SGSSSCGSKFSSTLQGGAQSGLDAKSRNRLRWVQSK  254

Query  959   HMVYNYCADAKRFPQGFSAECKRSRF  1036
              MVYNYC D KRFPQG  AEC R RF
Sbjct  255   FMVYNYCTDHKRFPQGIPAECMRPRF  280



>gb|KGN47998.1| hypothetical protein Csa_6G423400 [Cucumis sativus]
Length=274

 Score =   351 bits (900),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 169/266 (64%), Positives = 206/266 (77%), Gaps = 3/266 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV + +G    ++ D G  ++L+LD+ +GSGF +K E+LFGRFD+QMKLV G SAG
Sbjct  11    NFLQDVDITWGGPRAKILDGGRHLSLSLDKDSGSGFQSKQEFLFGRFDVQMKLVPGNSAG  70

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL+S  G +HDE+DFEFLGN++  PYT+HTNVYSQGKGN+EQQFHLWFDPT  FH
Sbjct  71    TVTTFYLSSQ-GGSHDEIDFEFLGNSSGDPYTLHTNVYSQGKGNREQQFHLWFDPTKGFH  129

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I W+P+ I F+VDN PIRVF+N E+IG+ +PKSQPMR Y SLWNADDWAT+GGLVKT
Sbjct  130   TYSIDWSPESIKFLVDNIPIRVFHNWENIGVSYPKSQPMRAYSSLWNADDWATRGGLVKT  189

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DW+ APFTA YRNFNAN CV +    S +  +  S++ Q      LD K RNR+RWVQSK
Sbjct  190   DWTQAPFTASYRNFNANGCVAS--SGSSSCGSKFSSTLQGGAQSGLDAKSRNRLRWVQSK  247

Query  959   HMVYNYCADAKRFPQGFSAECKRSRF  1036
              M+YNYC D KRFPQG  AEC+R RF
Sbjct  248   FMIYNYCTDHKRFPQGIPAECRRPRF  273



>ref|XP_010512813.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16 [Camelina sativa]
Length=291

 Score =   352 bits (902),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 165/266 (62%), Positives = 206/266 (77%), Gaps = 2/266 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NFN +  + +G H G++   G  ++L+LD+ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  26    NFNEEFDLTWGEHRGKIFSGGKMLSLSLDRVSGSGFKSKKEYLFGRIDMQLKLVAGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN T +PY +HTNV++QGKGN+EQQF+LWFDPT  FH
Sbjct  86    TVTAYYLSSE-GPTHDEIDFEFLGNETGKPYVLHTNVFAQGKGNREQQFYLWFDPTKNFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+++W PQ IIFMVDN PIRVFNN E +G+PFPK QPM++Y SLWNADDWAT+GGLVKT
Sbjct  145   TYSLVWRPQHIIFMVDNVPIRVFNNAEQLGVPFPKKQPMKIYSSLWNADDWATRGGLVKT  204

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQE-WLTQELDGKGRNRVRWVQS  955
             DWS APFTAYYR FNA AC V++G S C+    ++ +N E  +  EL+  GR R+RWVQ 
Sbjct  205   DWSKAPFTAYYRGFNAAACTVSSGSSYCDPKFKSTFTNGESQVANELNAYGRRRLRWVQK  264

Query  956   KHMVYNYCADAKRFPQGFSAECKRSR  1033
               M+YNYC+D KRF QGF  EC+RSR
Sbjct  265   YFMIYNYCSDVKRFSQGFPPECRRSR  290



>ref|XP_002526229.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36170.1| conserved hypothetical protein [Ricinus communis]
Length=284

 Score =   351 bits (901),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 167/265 (63%), Positives = 205/265 (77%), Gaps = 2/265 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF ND  + +G+   ++ +NG  + L LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  21    NFYNDFDITWGDGRAKILNNGELLTLTLDKASGSGFQSKNEYLFGKIDMQIKLVPGNSAG  80

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G A DE+DFEFLGN +  PY +HTNV+SQGKGN+EQQF+LWFDPTA FH
Sbjct  81    TVTAYYLSSK-GSAWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFH  139

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNP RIIF VD  PIR F N ES G+PFPK+QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  140   TYSILWNPHRIIFSVDGTPIREFKNMESNGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  199

Query  779   DWSHAPFTAYYRNFNANACVVTNGVss-cnsiaaasnsnQEWLTQELDGKGRNRVRWVQS  955
             DWS APFTA YRNFNANACV +NG SS   + + ++++   WL+QELD   + R++WVQ 
Sbjct  200   DWSQAPFTASYRNFNANACVSSNGASSCGTNSSPSTSNTNSWLSQELDSTSQERLQWVQK  259

Query  956   KHMVYNYCADAKRFPQGFSAECKRS  1030
              +M+YNYC DAKRFPQG   EC  S
Sbjct  260   NYMIYNYCTDAKRFPQGLPTECNLS  284



>ref|XP_010532726.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16 [Tarenaya hassleriana]
Length=293

 Score =   352 bits (902),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 167/267 (63%), Positives = 207/267 (78%), Gaps = 2/267 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF ++  + +G + G++   G  ++L LD+ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  28    NFYDEFDLTWGGNRGKIFGGGRMLSLGLDRVSGSGFQSKKEYLFGRIDMQLKLVAGNSAG  87

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN T QPY +HTNV++QGKGN+EQQF+LWFDPT  FH
Sbjct  88    TVTAYYLSSQ-GPTHDEIDFEFLGNETGQPYVLHTNVFTQGKGNREQQFYLWFDPTKNFH  146

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+W PQ IIF+VD+ PIRVF N E +G+PFPKSQPMR+Y SLWNADDWAT+GGLVKT
Sbjct  147   TYSIVWRPQHIIFLVDSVPIRVFKNAEQLGVPFPKSQPMRIYSSLWNADDWATRGGLVKT  206

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEW-LTQELDGKGRNRVRWVQS  955
             DWS APFTAYYRNFNA AC V++G S C+    +S +N +W +  EL+  GR R+RWVQ 
Sbjct  207   DWSKAPFTAYYRNFNAAACTVSSGSSFCDPKFKSSFTNGDWQVGNELNAFGRRRLRWVQR  266

Query  956   KHMVYNYCADAKRFPQGFSAECKRSRF  1036
               M+YNYCAD KRFPQGF  EC+ SR 
Sbjct  267   YFMIYNYCADLKRFPQGFPPECRSSRL  293



>gb|ABM91075.1| xyloglucan endotransglycosylase/hydrolase precursor XTH-21 [Populus 
tremula x Populus tremuloides]
Length=288

 Score =   351 bits (901),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 173/291 (59%), Positives = 217/291 (75%), Gaps = 7/291 (2%)
 Frame = +2

Query  164   CMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSG  343
             C    + ++ACS+V           +F  D  + +G+H  ++ + G  ++L+LD+ +GSG
Sbjct  5     CNGFSLFLIACSMV------VVASGSFYQDFDLTWGDHRAKIFNGGQLLSLSLDKVSGSG  58

Query  344   FNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHT  523
             F +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN T  PY +HT
Sbjct  59    FKSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLTGDPYILHT  117

Query  524   NVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPK  703
             NV++QGKGN+EQQF+LWFDPT  FHTY+I+W+ Q IIF+VDN PIRVF N ESIG+PFPK
Sbjct  118   NVFTQGKGNREQQFYLWFDPTRNFHTYSIIWSQQHIIFLVDNFPIRVFKNAESIGVPFPK  177

Query  704   SQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaas  883
             SQPMR+Y SLWNADDWAT+GGLVKTDW+ APFTAYYRNF A+AC  + G SSC S +++S
Sbjct  178   SQPMRIYSSLWNADDWATRGGLVKTDWTKAPFTAYYRNFKADACTWSYGTSSCGSSSSSS  237

Query  884   nsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
              S++ W T  LD   R R+RWVQ   M+YNYCAD KRFPQG   EC+RSRF
Sbjct  238   FSDRSWQTNALDAPSRRRLRWVQKYFMIYNYCADLKRFPQGLPPECRRSRF  288



>ref|NP_001284418.1| brassinosteroid-regulated protein BRU1-like precursor [Cucumis 
melo]
 gb|ABI94061.1| xyloglucan endotransglucosylase/hydrolase 1 [Cucumis melo]
Length=290

 Score =   351 bits (901),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 173/299 (58%), Positives = 219/299 (73%), Gaps = 9/299 (3%)
 Frame = +2

Query  140   MKKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALN  319
             M    + + +++++ V+  S++           NF  DV + +G    ++ D G  ++L+
Sbjct  1     MHFPHKGLTIMLLLCVLMASIM------TASAGNFLQDVDVTWGGPRAKILDGGRHLSLS  54

Query  320   LDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNAT  499
             LD+ +GSGF +K E+LFGRFD+QMKLV G SAGTVTTFYL+S  G +HDE+DFEFLGN++
Sbjct  55    LDKDSGSGFQSKQEFLFGRFDVQMKLVPGNSAGTVTTFYLSSQ-GGSHDEIDFEFLGNSS  113

Query  500   FQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHE  679
               PYT+HTNVYSQGKGN+EQQFHLWFDPT  FHTY+I W+P+ I F+VDN PIRVF+N E
Sbjct  114   GDPYTLHTNVYSQGKGNREQQFHLWFDPTKGFHTYSIDWSPESIKFLVDNIPIRVFHNWE  173

Query  680   SIGIPFPKSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVss  859
             +IG+ +PKSQPMRVY SLWNADDWAT+GGLVKTDW+ APFTA YRNFNAN CV +    S
Sbjct  174   NIGVSYPKSQPMRVYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFNANGCVAS--SGS  231

Query  860   cnsiaaasnsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
              +  +  S++ Q      LD   RNR+RWVQSK M+YNYC D KRFPQG  AECKR RF
Sbjct  232   SSCGSKFSSTLQGGAQSGLDANSRNRLRWVQSKFMIYNYCTDHKRFPQGIPAECKRPRF  290



>ref|XP_006474156.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like isoform X3 [Citrus sinensis]
Length=285

 Score =   351 bits (900),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 165/265 (62%), Positives = 206/265 (78%), Gaps = 2/265 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF+ D  + +G+    + +NG  + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  22    NFHQDFDITWGDGRANILNNGQLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSAG  81

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL SP G   DE+DFEFLGN +  PYT+HTNV++ GKG+KEQQFHLWFDPTA FH
Sbjct  82    TVTAYYLKSP-GSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDKEQQFHLWFDPTADFH  140

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRI+F VD  PIR F N ESIG+ FPK+QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  141   TYSILWNPQRIVFSVDGTPIREFKNSESIGVAFPKNQPMRIYSSLWNADDWATRGGLVKT  200

Query  779   DWSHAPFTAYYRNFNANACVVTNG-VsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQS  955
             DW+HAPFTA YRNFNA+ACV +NG  S  +S  ++ +S+  W +QELD   + R++WVQ 
Sbjct  201   DWTHAPFTASYRNFNADACVWSNGKSSCASSSPSSPSSSSAWFSQELDSTSQERLKWVQK  260

Query  956   KHMVYNYCADAKRFPQGFSAECKRS  1030
              +M+YNYC D KRFPQG  AEC+ S
Sbjct  261   NYMIYNYCTDTKRFPQGLPAECRIS  285



>ref|XP_006298237.1| hypothetical protein CARUB_v10014298mg [Capsella rubella]
 gb|EOA31135.1| hypothetical protein CARUB_v10014298mg [Capsella rubella]
Length=291

 Score =   351 bits (900),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 161/266 (61%), Positives = 205/266 (77%), Gaps = 2/266 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             +FN +  + +G H G++   G  ++L+LD+ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  26    SFNEEFDLTWGEHRGKIFSGGKMLSLSLDRVSGSGFKSKKEYLFGRIDMQLKLVAGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN T +PY +HTNV++QGKGN+EQQF+LWFDPT  FH
Sbjct  86    TVTAYYLSSE-GPTHDEIDFEFLGNETGKPYVLHTNVFAQGKGNREQQFYLWFDPTKNFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+++W PQ IIFMVDN PIRVFNN E +G+PFPK+QPM++Y SLWNADDWAT+GGLVKT
Sbjct  145   TYSLVWRPQHIIFMVDNVPIRVFNNAEKLGVPFPKNQPMKIYSSLWNADDWATRGGLVKT  204

Query  779   DWSHAPFTAYYRNFNANACVVTNGVss-cnsiaaasnsnQEWLTQELDGKGRNRVRWVQS  955
             DWS APFTAYYR FNA AC V++G S       ++  + +  +  EL+  GR R+RWVQ 
Sbjct  205   DWSRAPFTAYYRGFNAAACTVSSGSSFCDPKFKSSFTNGKSQVANELNAYGRRRLRWVQK  264

Query  956   KHMVYNYCADAKRFPQGFSAECKRSR  1033
               M+Y+YC+D KRFPQGF  EC+RSR
Sbjct  265   YFMIYDYCSDLKRFPQGFPPECRRSR  290



>gb|AFK47205.1| unknown [Lotus japonicus]
Length=291

 Score =   351 bits (900),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 172/294 (59%), Positives = 215/294 (73%), Gaps = 8/294 (3%)
 Frame = +2

Query  155   QQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQT  334
                 ++++I ++  S +     V     NFN D Q+ +G+   ++ +N N + L+LD+ +
Sbjct  4     SSTSLMLLIPLLVSSYI-----VLSSAGNFNKDFQITWGDGRAKILNNDNLLTLSLDKAS  58

Query  335   GSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYT  514
             GSGF +KNEYLFG+ DMQ+KLV G SAGTVT +YL+S  G   DE+DFEFLGN +  PYT
Sbjct  59    GSGFESKNEYLFGKIDMQIKLVPGNSAGTVTAYYLSSK-GSTWDEIDFEFLGNLSGDPYT  117

Query  515   VHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIP  694
             +HTNV+SQGKGN+EQQFHLWFDPTA FHTY+ILWNPQRI+F VD  PIR F N ES G+P
Sbjct  118   LHTNVFSQGKGNREQQFHLWFDPTADFHTYSILWNPQRIVFSVDGTPIREFKNLESAGVP  177

Query  695   FPKSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNA-NACVVTNG-Vsscns  868
             FPK+QPMR+  SLWNADDWAT+GGLVKTDWS APFTA YRNFNA NACV + G  S  ++
Sbjct  178   FPKNQPMRLTSSLWNADDWATRGGLVKTDWSKAPFTASYRNFNANNACVWSGGKSSCKSN  237

Query  869   iaaasnsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRS  1030
               ++++ +  WL QELD  G  R+RWVQ  +MVYNYCAD KRFPQG   EC  S
Sbjct  238   SPSSASGSASWLKQELDSTGYQRLRWVQKNYMVYNYCADKKRFPQGLPTECTHS  291



>gb|KHN17579.1| Putative xyloglucan endotransglucosylase/hydrolase protein 23 
[Glycine soja]
Length=287

 Score =   351 bits (900),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 165/266 (62%), Positives = 202/266 (76%), Gaps = 3/266 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             N N D Q+ +G+   ++ +N N + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  23    NLNQDFQLTWGDGRAKILNNENLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSAG  82

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G   DE+DFEFLGN +  PY +HTNV+SQGKGN+EQQF+LWFDPTA FH
Sbjct  83    TVTAYYLSSK-GSTWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFH  141

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRI+F VD  PIR F N ESIG+PFPKSQPMR+Y SLWNADDWAT+GGL+KT
Sbjct  142   TYSILWNPQRIVFSVDGTPIREFKNLESIGVPFPKSQPMRIYSSLWNADDWATRGGLIKT  201

Query  779   DWSHAPFTAYYRNFNANACV--VTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQ  952
             DWS APFTA YRNFNANACV          NS  ++++    WL+QELD   + R+RWVQ
Sbjct  202   DWSKAPFTASYRNFNANACVWNSGKSSCKSNSSPSSASPTNAWLSQELDSTAQQRLRWVQ  261

Query  953   SKHMVYNYCADAKRFPQGFSAECKRS  1030
               +++YNYC D KRFPQG   ECK S
Sbjct  262   KNYLIYNYCTDNKRFPQGLPLECKHS  287



>ref|XP_008449536.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
melo]
Length=290

 Score =   351 bits (900),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 173/288 (60%), Positives = 213/288 (74%), Gaps = 5/288 (2%)
 Frame = +2

Query  173   MIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNT  352
             + I ++ C L+   +       NF  DV + +G    ++ D G  ++L+LD+ +GSGF +
Sbjct  8     LTIMLLQCVLMASIMTTSAG--NFFQDVDITWGGPRAKILDGGRHLSLSLDKDSGSGFQS  65

Query  353   KNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVY  532
             K E+LFGRFD+QMKLV G SAGTVTTFYL+S  G +HDE+DFEFLGN++  PYT+HTNVY
Sbjct  66    KQEFLFGRFDVQMKLVPGNSAGTVTTFYLSSQ-GGSHDEIDFEFLGNSSGDPYTLHTNVY  124

Query  533   SQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQP  712
             SQGKGN+EQQFHLWFDPT  FHTY+I W+P+ I F+VDN PIRVF N E+IG+ +PKSQP
Sbjct  125   SQGKGNREQQFHLWFDPTKGFHTYSIDWSPESIKFLVDNIPIRVFRNWENIGVSYPKSQP  184

Query  713   MRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsn  892
             MRVY SLWNADDWAT+GGLVKTDW+ APFTA YRNFNAN CV +    S +  +  S++ 
Sbjct  185   MRVYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFNANGCVAS--SGSSSCGSKFSSTL  242

Query  893   QEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
             Q      LD   RNR+RWVQSK M+YNYC D KRFPQG  AECKR RF
Sbjct  243   QGGAQSGLDANSRNRMRWVQSKFMIYNYCTDHKRFPQGIPAECKRPRF  290



>ref|XP_003610153.1| Xyloglucan endotransglucosylase/hydrolase [Medicago truncatula]
 gb|AES92350.1| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
Length=288

 Score =   351 bits (900),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 170/265 (64%), Positives = 207/265 (78%), Gaps = 2/265 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NFN D Q+ +G+   ++ +N N + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  25    NFNKDFQITWGDGRAKILNNANLLTLSLDKASGSGFQSKNEYLFGKIDMQIKLVPGNSAG  84

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G A DE+DFEFLGN +  PY +HTNV+SQGKGN+EQQF+LWFDPTA FH
Sbjct  85    TVTAYYLSSK-GGAWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFH  143

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRI+F VD  PIR F N ES G+PFPK+QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  144   TYSILWNPQRIVFSVDGTPIREFKNMESNGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  203

Query  779   DWSHAPFTAYYRNFNA-NACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQS  955
             DWS APFTA YRNFNA NAC+   G SSC S +  S S+  WL+Q+LD  G+ R+RWVQ 
Sbjct  204   DWSKAPFTASYRNFNANNACIWNGGKSSCKSSSKPSASSASWLSQQLDSTGQQRLRWVQK  263

Query  956   KHMVYNYCADAKRFPQGFSAECKRS  1030
              +M+YNYC+D KRFPQG   EC  S
Sbjct  264   NYMIYNYCSDKKRFPQGLPVECTHS  288



>ref|NP_566738.1| xyloglucan endotransglucosylase/hydrolase protein 16 [Arabidopsis 
thaliana]
 sp|Q8LG58.2|XTH16_ARATH RecName: Full=Probable xyloglucan endotransglucosylase/hydrolase 
protein 16; Short=At-XTH16; Short=XTH-16; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB01849.1| endoxyloglucan endotransglycosylase [Arabidopsis thaliana]
 dbj|BAD43567.1| putative xyloglucan endotransglycosylase [Arabidopsis thaliana]
 dbj|BAD43568.1| putative xyloglucan endotransglycosylase [Arabidopsis thaliana]
 gb|AEE76807.1| xyloglucan endotransglucosylase/hydrolase protein 16 [Arabidopsis 
thaliana]
Length=291

 Score =   351 bits (900),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 164/266 (62%), Positives = 208/266 (78%), Gaps = 2/266 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             +FN +  + +G H G++   G  ++L+LD+ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  26    SFNEEFDLTWGEHRGKIFSGGKMLSLSLDRVSGSGFKSKKEYLFGRIDMQLKLVAGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN T +PY +HTNV++QGKGN+EQQF+LWFDPT  FH
Sbjct  86    TVTAYYLSSE-GPTHDEIDFEFLGNETGKPYVLHTNVFAQGKGNREQQFYLWFDPTKNFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+++W PQ IIFMVDN PIRVFNN E +G+PFPK+QPM++Y SLWNADDWAT+GGLVKT
Sbjct  145   TYSLVWRPQHIIFMVDNVPIRVFNNAEQLGVPFPKNQPMKIYSSLWNADDWATRGGLVKT  204

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQE-WLTQELDGKGRNRVRWVQS  955
             DWS APFTAYYR FNA AC V++G S C+    +S +N E  +  EL+  GR R+RWVQ 
Sbjct  205   DWSKAPFTAYYRGFNAAACTVSSGSSFCDPKFKSSFTNGESQVANELNAYGRRRLRWVQK  264

Query  956   KHMVYNYCADAKRFPQGFSAECKRSR  1033
               M+Y+YC+D KRFPQGF  EC++SR
Sbjct  265   YFMIYDYCSDLKRFPQGFPPECRKSR  290



>ref|XP_007014172.1| Xyloglucan endotransglucosylase/hydrolase family protein [Theobroma 
cacao]
 gb|EOY31791.1| Xyloglucan endotransglucosylase/hydrolase family protein [Theobroma 
cacao]
Length=290

 Score =   350 bits (899),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 168/291 (58%), Positives = 215/291 (74%), Gaps = 12/291 (4%)
 Frame = +2

Query  161   VCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGS  340
             + M ++IG +  +             NF  D  + +G+  G++ +NG  ++L+LD+ +GS
Sbjct  11    LLMSLVIGCLMAA----------SASNFYQDFDITWGDGRGKIDNNGEVLSLSLDKASGS  60

Query  341   GFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVH  520
             GF +KNEYLFG+ DMQ+KLV G SAGTVT +YL+S  G   DE+DFEFLGN +  PY +H
Sbjct  61    GFQSKNEYLFGKIDMQLKLVPGNSAGTVTAYYLSSK-GSTWDEIDFEFLGNLSGDPYILH  119

Query  521   TNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP  700
             TNV+SQGKGN+EQQF+LWFDPTA FHTY+ILWN QRIIF  D  PIR F N ES+G+PFP
Sbjct  120   TNVFSQGKGNREQQFYLWFDPTADFHTYSILWNSQRIIFSADGTPIREFKNMESLGVPFP  179

Query  701   KSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGV-sscnsiaa  877
             K+QPMR+Y SLWNADDWAT+GGLVKTDW+ APFTA YRNFNANACV +NG  S  ++  +
Sbjct  180   KNQPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFNANACVWSNGASSCKSNSPS  239

Query  878   asnsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRS  1030
             +S++N  WL+QELD   + R++WVQ  +M+YNYC DAKRFPQG   EC  S
Sbjct  240   SSSTNNAWLSQELDSTSQQRLQWVQKNYMIYNYCTDAKRFPQGLPPECNMS  290



>gb|AGI42452.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   350 bits (898),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 163/261 (62%), Positives = 204/261 (78%), Gaps = 4/261 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF+ND  + +G+  G++ +NG  + L LD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  26    NFHNDFDVTWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNV+SQGKG +EQQFHLWFDPTA FH
Sbjct  86    TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGGREQQFHLWFDPTADFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VDN PIR F N ES+G+ +PKSQ MR+Y SLWNADDWAT+GGL+KT
Sbjct  145   TYSILWNPQRIIFSVDNTPIREFKNAESVGVAYPKSQAMRIYSSLWNADDWATRGGLIKT  204

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DWS APFTA YRNFNA AC+ ++G    +S  + + SN  WL +ELD   + R++WVQ  
Sbjct  205   DWSKAPFTASYRNFNAKACIWSSG---RSSCNSNAPSNNAWLNEELDATSQQRLQWVQKN  261

Query  959   HMVYNYCADAKRFPQGFSAEC  1021
             +M+YNYC DAKRFPQG+  EC
Sbjct  262   YMIYNYCTDAKRFPQGYPPEC  282



>ref|XP_007211780.1| hypothetical protein PRUPE_ppa009685mg [Prunus persica]
 gb|EMJ12979.1| hypothetical protein PRUPE_ppa009685mg [Prunus persica]
Length=282

 Score =   350 bits (898),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 170/289 (59%), Positives = 211/289 (73%), Gaps = 11/289 (4%)
 Frame = +2

Query  170   IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
             +++I +  CS +  + A      NF  D  + +G+H  ++   G+ + L+LDQ +GSGF 
Sbjct  5     LILISLFLCSFMAASSAG-----NFYQDFDLIWGDHRAKILSGGSLLTLSLDQASGSGFQ  59

Query  350   TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
             +K +YLFGR DMQ+KLV G SAGTVT +YL+S  G   DE+DFEFLGN +  PY VHTNV
Sbjct  60    SKRQYLFGRIDMQLKLVAGNSAGTVTAYYLSSE-GPNRDEIDFEFLGNLSGDPYIVHTNV  118

Query  530   YSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQ  709
             Y+QGK ++EQQF+LWFDPT  FHTY+ LWNPQRIIF+VDN PIRVF+N ES G+PFPK Q
Sbjct  119   YTQGKADREQQFYLWFDPTKDFHTYSFLWNPQRIIFLVDNIPIRVFDNGESYGVPFPKRQ  178

Query  710   PMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasns  889
             PM++Y SLWNAD WAT+GGLVKTDWS APFTA+YRNF ANACV + G     S + A+N 
Sbjct  179   PMKLYSSLWNADQWATKGGLVKTDWSKAPFTAFYRNFKANACVWSKG-----SSSCANNK  233

Query  890   nQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
             N  W TQ LD   R R+RWVQ   M+YNYC+D KRFPQG   EC+RSRF
Sbjct  234   NNAWQTQGLDANSRRRLRWVQKYFMIYNYCSDLKRFPQGRPRECRRSRF  282



>ref|XP_010466730.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16 [Camelina sativa]
Length=291

 Score =   350 bits (899),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 164/266 (62%), Positives = 206/266 (77%), Gaps = 2/266 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NFN +  + +G H G++   G  ++L+LD+ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  26    NFNEEFDLTWGEHRGKIFSGGKMLSLSLDRVSGSGFKSKKEYLFGRIDMQLKLVAGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN T +PY +HTNV++QGKGN+EQQF+LWFDPT  FH
Sbjct  86    TVTAYYLSSE-GPTHDEIDFEFLGNETGKPYVLHTNVFAQGKGNREQQFYLWFDPTKNFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+++W PQ IIFMVDN PIRVFNN E +G+PFPK QPM++Y SLWNADDWAT+GGLVKT
Sbjct  145   TYSLVWRPQHIIFMVDNVPIRVFNNAEQLGVPFPKKQPMKIYSSLWNADDWATRGGLVKT  204

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQE-WLTQELDGKGRNRVRWVQS  955
             DWS APFTAYYR FNA AC V++G S C+    ++ +N E  +  EL+  GR R+RWVQ 
Sbjct  205   DWSKAPFTAYYRGFNAAACTVSSGSSYCDPKFKSTFTNGESQVANELNAYGRRRLRWVQK  264

Query  956   KHMVYNYCADAKRFPQGFSAECKRSR  1033
               M+Y+YC+D KRF QGF  EC+RSR
Sbjct  265   YFMIYDYCSDVKRFSQGFPPECRRSR  290



>gb|KDO46535.1| hypothetical protein CISIN_1g023581mg [Citrus sinensis]
Length=280

 Score =   350 bits (898),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 160/264 (61%), Positives = 207/264 (78%), Gaps = 4/264 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             +F  +  + +G+   ++ +NG  + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  21    SFYQEFDITWGDGRAKIHNNGQFLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSAG  80

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL SP G   DE+DFEFLGN +  PYT+HTNV++ GKGN+EQQFHLWFDPTAAFH
Sbjct  81    TVTAYYLKSP-GSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGNREQQFHLWFDPTAAFH  139

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRI+F VD  PIR F N ESIG+PFPK+QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  140   TYSILWNPQRIVFSVDGTPIREFKNSESIGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  199

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DW+HAPFTA YRNF A+AC+ +NG    +S A++ + ++ W +QELD   +N+++WVQ  
Sbjct  200   DWTHAPFTASYRNFKADACLWSNGK---SSCASSKSRSRAWFSQELDSSSQNKLKWVQKN  256

Query  959   HMVYNYCADAKRFPQGFSAECKRS  1030
             +M+YNYC D KRFPQG   EC+ +
Sbjct  257   YMIYNYCTDTKRFPQGLPVECRTA  280



>ref|XP_007014173.1| Xyloglucan endotransglycosylase 6 [Theobroma cacao]
 gb|EOY31792.1| Xyloglucan endotransglycosylase 6 [Theobroma cacao]
Length=294

 Score =   350 bits (899),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 169/267 (63%), Positives = 204/267 (76%), Gaps = 4/267 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + +G+   ++ +NG  + L LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  29    NFYQDFDLTWGDGRAKILNNGQLLTLALDKASGSGFQSKNEYLFGKIDMQLKLVPGNSAG  88

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G   DE+DFEFLGN +  PY +HTNVYSQGKGN+EQQF+LWFDPTA FH
Sbjct  89    TVTAYYLSSK-GSTWDEIDFEFLGNLSGDPYILHTNVYSQGKGNREQQFYLWFDPTADFH  147

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VD  PIR F N ES G+PFPK QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  148   TYSILWNPQRIIFSVDGTPIREFKNLESNGVPFPKKQPMRIYSSLWNADDWATRGGLVKT  207

Query  779   DWSHAPFTAYYRNFNANACVVTNGV---sscnsiaaasnsnQEWLTQELDGKGRNRVRWV  949
             DWS APFTA YRNFNA ACV TNG    SS +S +++ + +  WL+QELD  G+ R++WV
Sbjct  208   DWSQAPFTASYRNFNAKACVWTNGASSCSSSSSSSSSGSKSNAWLSQELDITGQQRLKWV  267

Query  950   QSKHMVYNYCADAKRFPQGFSAECKRS  1030
             Q  +M+YNYC D KRFPQG   ECK S
Sbjct  268   QKNYMIYNYCTDTKRFPQGLPLECKMS  294



>gb|KDO46534.1| hypothetical protein CISIN_1g023431mg [Citrus sinensis]
Length=282

 Score =   350 bits (897),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 162/289 (56%), Positives = 211/289 (73%), Gaps = 14/289 (5%)
 Frame = +2

Query  167   MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
             + +++G +  +  G          +F  D  + +G+   ++ +NG  + L+LD+ +GSGF
Sbjct  7     LFLVLGTLMVASAG----------SFYKDFDITWGDGRAKILNNGQLLTLSLDKASGSGF  56

Query  347   NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
              +KNEYL+G+ DMQ+KLV G SAGTVT +YL SP G   DE+DFEFLGN +  PYT+HTN
Sbjct  57    QSKNEYLYGKIDMQLKLVPGNSAGTVTAYYLKSP-GSTWDEIDFEFLGNLSGDPYTLHTN  115

Query  527   VYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKS  706
             V++ GKG++EQQFHLWFDP+AAFHTY+ILWNPQRI+F VD  PIR   N ESIG+PFPK+
Sbjct  116   VFTNGKGDREQQFHLWFDPSAAFHTYSILWNPQRIVFFVDGTPIRELKNSESIGVPFPKN  175

Query  707   QPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNA-NACVVTNGVsscnsiaaas  883
             QPMR+Y SLWNADDWAT+GGLVKTDW+HAPFTA YRNF A NACV +NG    +  + + 
Sbjct  176   QPMRIYSSLWNADDWATRGGLVKTDWTHAPFTASYRNFKANNACVWSNG--KSSCASTSF  233

Query  884   nsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRS  1030
              S   WL+QELD   +NR++WVQ  +M+YNYC D KRFP+G   EC+ S
Sbjct  234   RSRNSWLSQELDSTSQNRLKWVQKNYMIYNYCTDTKRFPRGIPKECRNS  282



>ref|XP_010536923.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Tarenaya hassleriana]
Length=289

 Score =   350 bits (898),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 169/293 (58%), Positives = 212/293 (72%), Gaps = 12/293 (4%)
 Frame = +2

Query  143   KKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNL  322
               +Q  +  +++ GV+  S+            NF  +V++ +G+  GQ+ +NG  + L+L
Sbjct  6     SSRQMLLLPLLVAGVLLSSV----------HANFYQNVEITWGDGRGQINNNGELLTLSL  55

Query  323   DQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATF  502
             D+ +GSGF +KNEYLFG+ DMQ+KLV G SAGTVT +YL SP G   DE+DFEFLGN + 
Sbjct  56    DRASGSGFQSKNEYLFGKIDMQIKLVPGNSAGTVTAYYLKSP-GSTWDEIDFEFLGNLSG  114

Query  503   QPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHES  682
              PYT+HTNV++QGKGN+EQQF LWFDPT+ FHTY+ILWNPQRIIF VD  PIR F N ES
Sbjct  115   DPYTLHTNVFTQGKGNREQQFKLWFDPTSDFHTYSILWNPQRIIFSVDGTPIREFKNMES  174

Query  683   IGIPFPKSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVssc  862
              G+ FPKSQPMR+Y SLWNADDWAT+GGLVKTDWS APFTA YR FN +ACV +NG  S 
Sbjct  175   QGVLFPKSQPMRMYSSLWNADDWATRGGLVKTDWSQAPFTASYRGFNEDACVWSNG-KST  233

Query  863   nsiaaasnsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAEC  1021
                 ++  ++  WL+QELD  G+ R+RWVQ   M+YNYCAD KRFPQG   EC
Sbjct  234   CPNGSSQGTSGSWLSQELDTTGQERMRWVQRNFMIYNYCADTKRFPQGVPREC  286



>gb|KDP36434.1| hypothetical protein JCGZ_08703 [Jatropha curcas]
Length=286

 Score =   350 bits (897),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 166/264 (63%), Positives = 205/264 (78%), Gaps = 3/264 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + +G+   ++ +NG  + LNLD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  26    NFYQDFDITWGDGRAKILNNGQLLTLNLDKASGSGFQSRNEYLFGKIDMQLKLVPGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G   DE+DFEFLGN +  PY +HTN++SQGKGN+EQQF++WFDPTA FH
Sbjct  86    TVTAYYLSSK-GSTWDEIDFEFLGNLSGDPYILHTNLFSQGKGNREQQFYVWFDPTADFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWN QRIIF VD  PIR F N ES G+PFPKSQPMR+Y SLWNADDWAT+GGLVKT
Sbjct  145   TYSILWNSQRIIFSVDGTPIREFKNLESAGVPFPKSQPMRIYSSLWNADDWATRGGLVKT  204

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DWS APFTA YRNFNANACV +NG SSC + AA++ +   WL++ELD   + R++WVQ  
Sbjct  205   DWSQAPFTASYRNFNANACVWSNGASSCGTNAASNTT--SWLSEELDSTSQERLKWVQKN  262

Query  959   HMVYNYCADAKRFPQGFSAECKRS  1030
             +M+YNYC D KRFPQG   ECK S
Sbjct  263   YMIYNYCTDIKRFPQGLPTECKLS  286



>ref|XP_008449534.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
melo]
Length=290

 Score =   350 bits (898),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 170/266 (64%), Positives = 206/266 (77%), Gaps = 3/266 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV + +G    ++ D G  ++L+LD+ +GSGF +K E+LFGRFD+QMKLV G SAG
Sbjct  28    NFLQDVDITWGGPRAKILDGGRHLSLSLDKDSGSGFQSKQEFLFGRFDVQMKLVPGNSAG  87

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL+S  G +HDE+DFEFLGN++  PYT+HTNVYSQGKGN+EQQFHLWFDPT  FH
Sbjct  88    TVTTFYLSSQ-GGSHDEIDFEFLGNSSGDPYTLHTNVYSQGKGNREQQFHLWFDPTKGFH  146

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I W+P+ I F+VDN PIRVF+N E+IG+ +PKSQPMRVY SLWNADDWAT+GGLVKT
Sbjct  147   TYSIDWSPESIKFLVDNIPIRVFHNWENIGVSYPKSQPMRVYSSLWNADDWATRGGLVKT  206

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DW+ APFTA YRNFNAN CV +    S +  +  S++ Q      LD   RNR+RWVQSK
Sbjct  207   DWTQAPFTASYRNFNANGCVAS--SGSSSCGSKFSSTLQGGAQSGLDANSRNRMRWVQSK  264

Query  959   HMVYNYCADAKRFPQGFSAECKRSRF  1036
              M+YNYC D KRFPQG  AECKR RF
Sbjct  265   FMIYNYCTDHKRFPQGIPAECKRPRF  290



>ref|XP_008225386.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Prunus 
mume]
Length=282

 Score =   350 bits (897),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 170/289 (59%), Positives = 211/289 (73%), Gaps = 11/289 (4%)
 Frame = +2

Query  170   IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
             +++I +  CS +  + A      NF  D  + +G+H  ++   G+ + L+LDQ +GSGF 
Sbjct  5     LILISLFLCSFMAASSAG-----NFYQDFDLIWGDHRAKILSGGSLLTLSLDQASGSGFQ  59

Query  350   TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
             +K +YLFGR DMQ+KLV G SAGTVT +YL+S  G   DE+DFEFLGN +  PY +HTNV
Sbjct  60    SKRQYLFGRIDMQLKLVAGNSAGTVTAYYLSSE-GPNRDEIDFEFLGNLSGDPYVMHTNV  118

Query  530   YSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQ  709
             Y+QGK ++EQQF+LWFDPT  FHTY+ LWNPQRIIF+VDN PIRVF+N ES G+PFPK Q
Sbjct  119   YTQGKADREQQFYLWFDPTKDFHTYSFLWNPQRIIFLVDNIPIRVFDNGESYGVPFPKRQ  178

Query  710   PMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasns  889
             PM++Y SLWNAD WAT+GGLVKTDWS APFTA+YRNF ANACV + G     S + ASN 
Sbjct  179   PMKLYSSLWNADQWATKGGLVKTDWSKAPFTAFYRNFKANACVWSKG-----SSSCASNK  233

Query  890   nQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
             N  W TQ LD   R R+RWVQ   M+YNYC+D KRFPQG   EC+RSRF
Sbjct  234   NNAWQTQGLDANSRRRLRWVQKYFMIYNYCSDLKRFPQGRPRECRRSRF  282



>ref|XP_003549488.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Glycine max]
Length=287

 Score =   350 bits (897),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 164/266 (62%), Positives = 202/266 (76%), Gaps = 3/266 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             N N D Q+ +G+   ++ +N N + L+LD+ +GSGF +KNEYL+G+ DMQ+KLV G SAG
Sbjct  23    NLNQDFQLTWGDGRAKILNNENLLTLSLDKASGSGFQSKNEYLYGKIDMQLKLVPGNSAG  82

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G   DE+DFEFLGN +  PY +HTNV+SQGKGN+EQQF+LWFDPTA FH
Sbjct  83    TVTAYYLSSK-GSTWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFH  141

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRI+F VD  PIR F N ESIG+PFPKSQPMR+Y SLWNADDWAT+GGL+KT
Sbjct  142   TYSILWNPQRIVFSVDGTPIREFKNLESIGVPFPKSQPMRIYSSLWNADDWATRGGLIKT  201

Query  779   DWSHAPFTAYYRNFNANACV--VTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQ  952
             DWS APFTA YRNFNANACV          NS  ++++    WL+QELD   + R+RWVQ
Sbjct  202   DWSKAPFTASYRNFNANACVWNSGKSSCKSNSSPSSASPTNAWLSQELDSTAQQRLRWVQ  261

Query  953   SKHMVYNYCADAKRFPQGFSAECKRS  1030
               +++YNYC D KRFPQG   ECK S
Sbjct  262   KNYLIYNYCTDNKRFPQGLPLECKHS  287



>ref|XP_003601713.1| Xyloglucan endotransglycosylase/hydrolase XTH-21 [Medicago truncatula]
 gb|AES71964.1| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
Length=282

 Score =   349 bits (896),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 171/289 (59%), Positives = 207/289 (72%), Gaps = 17/289 (6%)
 Frame = +2

Query  173   MIIGV-VACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
             M+IGV +  SLV    A      NFN D  + +G+H  ++ + G  ++L+LD+ +GSGF 
Sbjct  10    MLIGVMIISSLVATCSA------NFNQDFDLTWGDHRAKIFNGGQLLSLSLDKTSGSGFQ  63

Query  350   TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
             +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +HTNV
Sbjct  64    SKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNVSGDPYILHTNV  122

Query  530   YSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQ  709
             +SQGKGN+EQQF+LWFDPT  FHTY+I+W PQ IIF+VDN PIR+F N ESIGIPFPK+Q
Sbjct  123   FSQGKGNREQQFYLWFDPTKNFHTYSIIWKPQHIIFLVDNTPIRIFKNAESIGIPFPKNQ  182

Query  710   PMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasns  889
             PMR+Y SLWNADDWAT+GGLVKTDWS APFTAYYRNF A      +  S  +S       
Sbjct  183   PMRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRNFKATELSSVSSTSFSDSALQ----  238

Query  890   nQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
                  + ELD  GR R+RWVQ   M+YNYC D KRFP+G  AECKR RF
Sbjct  239   -----SNELDAYGRRRLRWVQKYFMIYNYCNDLKRFPEGIPAECKRPRF  282



>ref|XP_003601714.1| Xyloglucan endotransglycosylase/hydrolase XTH-21 [Medicago truncatula]
 gb|AES71965.1| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
Length=282

 Score =   349 bits (896),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 171/289 (59%), Positives = 207/289 (72%), Gaps = 17/289 (6%)
 Frame = +2

Query  173   MIIGV-VACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
             M+IGV +  SLV    A      NFN D  + +G+H  ++ + G  ++L+LD+ +GSGF 
Sbjct  10    MLIGVMIISSLVATCSA------NFNQDFDLTWGDHRAKIFNGGQLLSLSLDKTSGSGFQ  63

Query  350   TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
             +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +HTNV
Sbjct  64    SKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNVSGDPYILHTNV  122

Query  530   YSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQ  709
             +SQGKGN+EQQF+LWFDPT  FHTY+I+W PQ IIF+VDN PIR+F N ESIGIPFPK+Q
Sbjct  123   FSQGKGNREQQFYLWFDPTKNFHTYSIIWKPQHIIFLVDNTPIRIFKNAESIGIPFPKNQ  182

Query  710   PMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasns  889
             PMR+Y SLWNADDWAT+GGLVKTDWS APFTAYYRNF A      +  S  +S       
Sbjct  183   PMRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRNFKATELSSVSSTSFSDSALQ----  238

Query  890   nQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
                  + ELD  GR R+RWVQ   M+YNYC D KRFP+G  AECKR RF
Sbjct  239   -----SNELDAYGRRRLRWVQKYFMIYNYCNDLKRFPEGIPAECKRPRF  282



>ref|XP_007154784.1| hypothetical protein PHAVU_003G147700g [Phaseolus vulgaris]
 gb|ESW26778.1| hypothetical protein PHAVU_003G147700g [Phaseolus vulgaris]
Length=284

 Score =   349 bits (896),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 165/264 (63%), Positives = 207/264 (78%), Gaps = 1/264 (0%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             +FN D  + +G+   ++ +NG  + L LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  22    DFNKDFDLTWGDGRARILNNGELLTLTLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSAG  81

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G   DE+D+EFLGN +  PY +HTNV+SQGKGN+EQQF+LWFDPTA FH
Sbjct  82    TVTAYYLSSK-GTTWDEIDYEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFH  140

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WNPQRIIF VD  PIR F N E+IG+PFPK+QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  141   TYSIMWNPQRIIFSVDGTPIREFKNSEAIGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  200

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DW+ APFTA YRNFNA AC+ ++G SSC S A+ S     WL+QE+D  G+ R++WVQ  
Sbjct  201   DWTRAPFTASYRNFNAQACIWSSGASSCGSSASESTGGSSWLSQEMDATGQQRLKWVQRN  260

Query  959   HMVYNYCADAKRFPQGFSAECKRS  1030
             +M+YNYC+DAKRFPQGF  EC  S
Sbjct  261   YMIYNYCSDAKRFPQGFPPECNIS  284



>ref|XP_006453420.1| hypothetical protein CICLE_v10008778mg [Citrus clementina]
 gb|ESR66660.1| hypothetical protein CICLE_v10008778mg [Citrus clementina]
Length=353

 Score =   352 bits (902),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 168/265 (63%), Positives = 209/265 (79%), Gaps = 2/265 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + +G+   ++ +NG+ + L+LD+ +GSGF +KNEYL+G+ DMQ+KLV G SAG
Sbjct  90    NFYKDFDITWGDGRAKMLNNGDLLTLSLDKASGSGFQSKNEYLYGKIDMQLKLVPGNSAG  149

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL SP G   DE+DFEFLGN +  PYT+HTNV++ GKG++EQQFHLWFDP A FH
Sbjct  150   TVTAYYLKSP-GSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPAADFH  208

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRI+F VD  PIR F N ESIG+PFPK+QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  209   TYSILWNPQRIVFSVDGTPIREFKNSESIGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  268

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQ-EWLTQELDGKGRNRVRWVQS  955
             DW+HAPFTA YRNFNA ACV +NG SSC S +A+S S+   W +QELD   +NR++WVQ 
Sbjct  269   DWTHAPFTASYRNFNAEACVWSNGKSSCASNSASSTSSNGAWFSQELDSTNQNRLKWVQK  328

Query  956   KHMVYNYCADAKRFPQGFSAECKRS  1030
              +M+YNYC D KRFPQG  AEC+ S
Sbjct  329   NYMIYNYCTDTKRFPQGLPAECRIS  353



>gb|AFK33537.1| unknown [Medicago truncatula]
Length=288

 Score =   349 bits (896),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 170/265 (64%), Positives = 206/265 (78%), Gaps = 2/265 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NFN D Q+ +G+   ++ +N N + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  25    NFNKDFQITWGDGRAKILNNANLLTLSLDKASGSGFQSKNEYLFGKIDMQIKLVPGNSAG  84

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G A DE+DFEFLGN +  PY +HTNV SQGKGN+EQQF+LWFDPTA FH
Sbjct  85    TVTAYYLSSK-GGAWDEIDFEFLGNLSGDPYILHTNVSSQGKGNREQQFYLWFDPTADFH  143

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRI+F VD  PIR F N ES G+PFPK+QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  144   TYSILWNPQRIVFSVDGTPIREFKNMESNGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  203

Query  779   DWSHAPFTAYYRNFNA-NACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQS  955
             DWS APFTA YRNFNA NAC+   G SSC S +  S S+  WL+Q+LD  G+ R+RWVQ 
Sbjct  204   DWSKAPFTASYRNFNANNACIWNGGKSSCKSSSKPSASSASWLSQQLDSTGQQRLRWVQK  263

Query  956   KHMVYNYCADAKRFPQGFSAECKRS  1030
              +M+YNYC+D KRFPQG   EC  S
Sbjct  264   NYMIYNYCSDKKRFPQGLPVECTHS  288



>ref|XP_008223658.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Prunus mume]
 ref|XP_008223659.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Prunus mume]
Length=286

 Score =   349 bits (895),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 169/296 (57%), Positives = 216/296 (73%), Gaps = 12/296 (4%)
 Frame = +2

Query  140   MKKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALN  319
             M   +  +  I++I ++A S +     V     NFN D Q+ +G+   ++ +NG  + L 
Sbjct  1     MASFKSSLSFILLIALLAASFM-----VVANAGNFNQDFQITWGDGRAKILNNGELLTLL  55

Query  320   LDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNAT  499
             LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAGTVT +YL+S  G   DE+DFEFLGN +
Sbjct  56    LDKASGSGFQSKNEYLFGKIDMQLKLVPGNSAGTVTAYYLSSK-GSTWDEIDFEFLGNLS  114

Query  500   FQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHE  679
               PY +HTNV+SQGKGN+EQQF+LWFDPTA FHTY+ILWNPQRI+F VD  PIR F N E
Sbjct  115   GDPYILHTNVFSQGKGNREQQFYLWFDPTADFHTYSILWNPQRIVFSVDGTPIREFKNQE  174

Query  680   SIGIPFPKSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNA-NACVVTNGVs  856
             S G+PFPK+QPMR+Y SLWNADDWAT+GGL+KTDWS APFTA YRNFNA NACV +    
Sbjct  175   SNGVPFPKNQPMRIYSSLWNADDWATRGGLIKTDWSRAPFTASYRNFNANNACVSS----  230

Query  857   scnsiaaasnsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECK  1024
                + + +S+++  WL++ELD   + R+RWVQ  +M+YNYC DAKRFPQG   ECK
Sbjct  231   -NGASSCSSSTSNAWLSEELDLTRQERLRWVQKNYMIYNYCTDAKRFPQGLPTECK  285



>ref|XP_010259797.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Nelumbo nucifera]
Length=290

 Score =   349 bits (896),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 169/289 (58%), Positives = 215/289 (74%), Gaps = 13/289 (4%)
 Frame = +2

Query  161   VCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGS  340
              C++++  +   +L G          NF  D  + +G+   ++ +NG  + L+LD+ +GS
Sbjct  13    ACLVILSSLTVSALSG----------NFYQDFDITWGDGRAKILNNGELLTLSLDKASGS  62

Query  341   GFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVH  520
             GF +KNE+LFG+ DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +H
Sbjct  63    GFQSKNEFLFGKIDMQLKLVPGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILH  121

Query  521   TNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP  700
             TNV+SQGKGN+EQQF+LWFDPTA FHTY+ILWNPQRI+F VD  PIR FNN ESIG+PFP
Sbjct  122   TNVFSQGKGNREQQFYLWFDPTADFHTYSILWNPQRIVFSVDGIPIREFNNSESIGVPFP  181

Query  701   KSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaa  880
             KSQPMR+Y SLWNADDWAT+GGLVKTDW+ APFTA YRNF A+AC+ ++G SSC+S + +
Sbjct  182   KSQPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFKADACIWSSGASSCDSRSPS  241

Query  881   snsnQE--WLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAEC  1021
             S SN    WL+QELD   + R+ WVQ  +M+YNYC D KRFPQG   EC
Sbjct  242   STSNANAWWLSQELDSTSQERMGWVQKNYMIYNYCTDTKRFPQGLPLEC  290



>gb|AGI42451.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
 gb|AGI42453.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
 gb|AGI42462.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   349 bits (895),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 162/261 (62%), Positives = 204/261 (78%), Gaps = 4/261 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF+ND  + +G+  G++ +NG  + L LD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  26    NFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNV+SQGKG +EQQFHLWFDPTA FH
Sbjct  86    TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGGREQQFHLWFDPTADFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VDN PIR F N ES+G+ +PK+Q MR+Y SLWNADDWAT+GGL+KT
Sbjct  145   TYSILWNPQRIIFSVDNTPIREFKNAESVGVAYPKNQAMRIYSSLWNADDWATRGGLIKT  204

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DWS APFTA YRNFNA AC+ ++G    +S  + + SN  WL +ELD   + R++WVQ  
Sbjct  205   DWSKAPFTASYRNFNAKACIWSSG---RSSCNSNAPSNNAWLNEELDATSQQRLQWVQKN  261

Query  959   HMVYNYCADAKRFPQGFSAEC  1021
             +M+YNYC DAKRFPQG+  EC
Sbjct  262   YMIYNYCTDAKRFPQGYPPEC  282



>ref|XP_004140250.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15-like, partial [Cucumis sativus]
Length=286

 Score =   348 bits (894),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 170/269 (63%), Positives = 209/269 (78%), Gaps = 6/269 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV + +G    ++ D G  ++L+LD+ +GSGF +K ++LFGRFD+QM LV G SAG
Sbjct  20    NFLRDVDITWGGPRAKILDGGRHLSLSLDKDSGSGFQSKKQFLFGRFDVQMMLVPGNSAG  79

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL+S  G +HDE+DFEFLGN +  PYT+HTNVYSQGKG++EQQFHLWFDPT AFH
Sbjct  80    TVTTFYLSSE-GTSHDEIDFEFLGNLSGDPYTLHTNVYSQGKGDREQQFHLWFDPTKAFH  138

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I W+PQ I+F+VDN PIRVF+N E IG+ +PKSQPM+VY SLWNADDWAT+GG VKT
Sbjct  139   TYSIDWSPQSIMFLVDNIPIRVFHNWEKIGVSYPKSQPMKVYSSLWNADDWATRGGRVKT  198

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLT---QELDGKGRNRVRWV  949
             DW+ APFTA YRNFNAN CV +    S +S ++   + Q+  T   Q LD K RNR+RWV
Sbjct  199   DWTKAPFTASYRNFNANGCVAS--TGSSSSCSSKYANTQQGGTKNNQGLDAKSRNRLRWV  256

Query  950   QSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
             QSK MVYNYC D +RFPQG  AEC+RSRF
Sbjct  257   QSKFMVYNYCTDRQRFPQGIPAECRRSRF  285



>ref|NP_001284443.1| probable xyloglucan endotransglucosylase/hydrolase protein 23 
precursor [Cucumis melo]
 gb|ABI94063.1| xyloglucan endotransglucosylase/hydrolase 3 [Cucumis melo]
Length=285

 Score =   348 bits (894),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 166/286 (58%), Positives = 211/286 (74%), Gaps = 8/286 (3%)
 Frame = +2

Query  167   MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
             M + +   A SL+ ++ A      NFN D Q+ +G+   ++ +NG  + L+LD+ +GSGF
Sbjct  6     MFLTLLFSAASLIAISSA------NFNQDFQITWGDGRAKILNNGELLTLSLDKASGSGF  59

Query  347   NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
              ++NEYLFG+ DMQ+KLV G SAGTVT +YL+S  G   DE+DFEFLGN T  PYT+HTN
Sbjct  60    QSQNEYLFGKIDMQLKLVAGNSAGTVTAYYLSSK-GSTWDEIDFEFLGNLTGDPYTLHTN  118

Query  527   VYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKS  706
             V+SQGKGN+EQQFHLWFDPTA FHTY+ILWNP RI+F VD  PIR F N ES G+PFPK 
Sbjct  119   VFSQGKGNREQQFHLWFDPTADFHTYSILWNPNRIVFSVDGTPIREFKNWESNGVPFPKD  178

Query  707   QPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasn  886
             QPMR+Y SLWNADDWAT+GGLVKTDW+ APFTA Y+NF A ACV++ G  S  S +A + 
Sbjct  179   QPMRIYSSLWNADDWATRGGLVKTDWTKAPFTASYKNFKAEACVLSGG-QSSCSPSAPAG  237

Query  887   snQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECK  1024
             S   WL++E+D   + R++WVQ  +M+YNYC D +RFPQG   ECK
Sbjct  238   SRNSWLSEEMDSVSQERLKWVQKNYMIYNYCTDTRRFPQGLPTECK  283



>gb|AII99393.1| xyloglucan endotransglucosylase/hydrolase2 [Dianthus caryophyllus]
Length=281

 Score =   348 bits (894),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 167/282 (59%), Positives = 211/282 (75%), Gaps = 10/282 (4%)
 Frame = +2

Query  176   IIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTK  355
             I  ++A +LVG  LA      NF ++  + FG+   ++ +NG+ + L+LD+ +GSGF +K
Sbjct  6     IFLLIATTLVGSTLA------NFYSEFDITFGDGRARLLNNGDDLTLSLDKYSGSGFRSK  59

Query  356   NEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYS  535
             NEYLFG+ DMQ+KLV G SAG+VTT+YL+S +G  HDE+DFEFLGN T +PYT+HTNV++
Sbjct  60    NEYLFGKIDMQIKLVPGNSAGSVTTYYLSS-LGPTHDEIDFEFLGNVTGEPYTLHTNVFA  118

Query  536   QGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPM  715
             QGKGN+EQQFHLWFDPT  FHTY+ILWNPQRI+F VD  P+R F N ES G+ FPKSQPM
Sbjct  119   QGKGNREQQFHLWFDPTTEFHTYSILWNPQRIVFSVDGVPLREFKNMESKGVSFPKSQPM  178

Query  716   RVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQ  895
             RVY SLWNADDWATQGG VK DWS APF A ++ +NANACV  +G    ++  + S S  
Sbjct  179   RVYSSLWNADDWATQGGRVKADWSKAPFVASFKKYNANACVWGSG---SSTYKSGSRSRS  235

Query  896   EWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAEC  1021
              WLT+ELD  G  R++WVQ  +MVYNYCAD +RFPQG   EC
Sbjct  236   NWLTEELDSAGLERMKWVQKNYMVYNYCADVQRFPQGLPTEC  277



>ref|XP_006474155.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like isoform X2 [Citrus sinensis]
Length=286

 Score =   348 bits (894),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 164/289 (57%), Positives = 214/289 (74%), Gaps = 12/289 (4%)
 Frame = +2

Query  167   MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
             + +++G +  +  G          NF  D  + +G+   ++ +NG+ + L+LD+ +GSGF
Sbjct  9     LFLVLGSLMVASAG----------NFYKDFDITWGDGRAKMLNNGDLLTLSLDKASGSGF  58

Query  347   NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
              +KNEYL+G+ DMQ+KLV G SAGTVT +YL SP G   DE+DFEFLGN +  PYT+HTN
Sbjct  59    QSKNEYLYGKIDMQLKLVPGNSAGTVTAYYLKSP-GSTWDEIDFEFLGNLSGDPYTLHTN  117

Query  527   VYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKS  706
             V++ GKG++EQQFHLWFDP A FHTY+ILWNPQRI+F VD  PIR F N ESIG+ FPK+
Sbjct  118   VFTNGKGDREQQFHLWFDPAADFHTYSILWNPQRIVFSVDGTPIREFKNSESIGVAFPKN  177

Query  707   QPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNG-Vsscnsiaaas  883
             QPMR+Y SLWNADDWAT+GGLVKTDW+HAPFTA YRNFNA+ACV +NG  S  +S  ++ 
Sbjct  178   QPMRIYSSLWNADDWATRGGLVKTDWTHAPFTASYRNFNADACVWSNGKSSCASSSPSSP  237

Query  884   nsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRS  1030
             +S+  W +QELD   + R++WVQ  +M+YNYC D KRFPQG  AEC+ S
Sbjct  238   SSSSAWFSQELDSTSQERLKWVQKNYMIYNYCTDTKRFPQGLPAECRIS  286



>ref|XP_002526228.1| Xyloglucan endotransglucosylase/hydrolase protein 22 precursor, 
putative [Ricinus communis]
 gb|EEF36169.1| Xyloglucan endotransglucosylase/hydrolase protein 22 precursor, 
putative [Ricinus communis]
Length=284

 Score =   348 bits (894),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 164/265 (62%), Positives = 205/265 (77%), Gaps = 2/265 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF ND  + +G+   ++ ++G  + L LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  21    NFYNDFDITWGDGRAKILNDGELLTLTLDKASGSGFQSKNEYLFGKIDMQIKLVPGNSAG  80

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G   DE+DFEFLGN +  PY +HTNV+SQGKGN+EQQF+LWFDPTA FH
Sbjct  81    TVTAYYLSSK-GSTWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFH  139

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VD  PIR F N ES G+PFP++QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  140   TYSILWNPQRIIFSVDETPIREFKNMESNGVPFPRNQPMRIYSSLWNADDWATRGGLVKT  199

Query  779   DWSHAPFTAYYRNFNANACVVTNGVss-cnsiaaasnsnQEWLTQELDGKGRNRVRWVQS  955
             DWS APFTA YRNFNANACV +NG SS   + + +++++  WL+QELD   + R++WVQ 
Sbjct  200   DWSQAPFTASYRNFNANACVSSNGASSCGTNSSPSTSTSNSWLSQELDSTSQERLQWVQK  259

Query  956   KHMVYNYCADAKRFPQGFSAECKRS  1030
              +M+YNYC DAKRF QG   EC  S
Sbjct  260   NYMIYNYCTDAKRFAQGLPTECNLS  284



>gb|AFP93557.1| xyloglucan endotransglycosylase/hydrolase 1 [Neolamarckia cadamba]
 gb|AGI42455.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
 gb|AGI42463.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   348 bits (894),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/261 (62%), Positives = 204/261 (78%), Gaps = 4/261 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF+ND  + +G+  G++ +NG  + L LD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  26    NFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNV+SQGKG +EQQFHLWFDPTA FH
Sbjct  86    TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGGREQQFHLWFDPTADFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VDN PIR F N ES+G+ +PK+Q MR+Y SLWNADDWAT+GGL+KT
Sbjct  145   TYSILWNPQRIIFSVDNTPIREFKNAESVGVAYPKNQAMRIYSSLWNADDWATRGGLIKT  204

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DWS APFTA YRNFNA AC+ ++G    +S  + + SN  WL +ELD   + R++WVQ  
Sbjct  205   DWSKAPFTASYRNFNAKACIWSSG---RSSCNSNAPSNNAWLNEELDATSQQRLQWVQKN  261

Query  959   HMVYNYCADAKRFPQGFSAEC  1021
             +M+YNYC DAKRFPQG+  EC
Sbjct  262   YMIYNYCTDAKRFPQGYPPEC  282



>ref|XP_010023598.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Eucalyptus 
grandis]
 gb|KCW59910.1| hypothetical protein EUGRSUZ_H02634 [Eucalyptus grandis]
Length=296

 Score =   349 bits (895),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 166/267 (62%), Positives = 201/267 (75%), Gaps = 2/267 (1%)
 Frame = +2

Query  239   NFNNDVQM-YFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSA  415
             NF  D  + + G+   ++   G  ++L+LD+ +GSGF +K EYLFGR DMQ+KLV G SA
Sbjct  31    NFYQDFDLTWGGSDRAKIFSGGQLLSLSLDRVSGSGFRSKKEYLFGRIDMQLKLVAGNSA  90

Query  416   GTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAF  595
             GTVT +YL+S  G  HDE+DFEFLGN +  PY +HTNV++QGKGN+EQQF+LWFDPT  F
Sbjct  91    GTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILHTNVFTQGKGNREQQFYLWFDPTRNF  149

Query  596   HTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVK  775
             HTY+++W PQ IIF+VDN PIRVF N ESIG+PFPK+QPM++Y SLWNADDWAT+GGL+K
Sbjct  150   HTYSVIWKPQHIIFLVDNIPIRVFKNGESIGVPFPKNQPMKIYSSLWNADDWATRGGLIK  209

Query  776   TDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQS  955
             TDWS APFTAYYR F A AC  + G SSC     AS S   W   ELD  GR R+RWVQ 
Sbjct  210   TDWSKAPFTAYYRKFQATACTWSTGSSSCEIGRPASYSGSTWKINELDAYGRRRLRWVQK  269

Query  956   KHMVYNYCADAKRFPQGFSAECKRSRF  1036
               M+Y+YCAD KRFPQG  AECKRSRF
Sbjct  270   YFMIYDYCADGKRFPQGIPAECKRSRF  296



>gb|AGI42460.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   348 bits (894),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/261 (62%), Positives = 204/261 (78%), Gaps = 4/261 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF+ND  + +G+  G++ +NG  + L LD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  26    NFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNV+SQGKG +EQQFHLWFDPTA FH
Sbjct  86    TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGGREQQFHLWFDPTADFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VDN PIR F N ES+G+ +PK+Q MR+Y SLWNADDWAT+GGL+KT
Sbjct  145   TYSILWNPQRIIFSVDNAPIREFKNAESVGVAYPKNQAMRIYSSLWNADDWATRGGLIKT  204

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DWS APFTA YRNFNA AC+ ++G    +S  + + SN  WL +ELD   + R++WVQ  
Sbjct  205   DWSKAPFTASYRNFNAKACIWSSG---RSSCNSNAPSNNAWLNEELDATSQQRLQWVQKN  261

Query  959   HMVYNYCADAKRFPQGFSAEC  1021
             +M+YNYC DAKRFPQG+  EC
Sbjct  262   YMIYNYCTDAKRFPQGYPPEC  282



>gb|AGI42449.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   348 bits (894),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/261 (62%), Positives = 204/261 (78%), Gaps = 4/261 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF+ND  + +G+  G++ +NG  + L LD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  26    NFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNV+SQGKG +EQQFHLWFDPTA FH
Sbjct  86    TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGGREQQFHLWFDPTADFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VDN PIR F N ES+G+ +PK+Q MR+Y SLWNADDWAT+GGL+KT
Sbjct  145   TYSILWNPQRIIFSVDNTPIREFKNAESVGVAYPKNQAMRIYSSLWNADDWATRGGLIKT  204

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DWS APFTA YRNFNA AC+ ++G    +S  + + SN  WL +ELD   + R++WVQ  
Sbjct  205   DWSKAPFTASYRNFNAKACIWSSG---RSSCNSNAPSNNAWLNEELDATSQQRLQWVQKN  261

Query  959   HMVYNYCADAKRFPQGFSAEC  1021
             +M+YNYC DAKRFPQG+  EC
Sbjct  262   YMIYNYCTDAKRFPQGYPPEC  282



>ref|XP_002324480.1| xyloglucan endo-1 family protein [Populus trichocarpa]
 gb|EEF03045.1| xyloglucan endo-1 family protein [Populus trichocarpa]
Length=286

 Score =   348 bits (894),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 161/265 (61%), Positives = 204/265 (77%), Gaps = 2/265 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF ND  + +G+   ++  NG  + LNLD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  23    NFYNDFDITWGDGRAKILSNGELLTLNLDKASGSGFQSRNEYLFGKIDMQLKLVPGNSAG  82

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G A DE+DFEFLGN +  PY +HTNV+SQGKGN+EQQF+LWFDPTA FH
Sbjct  83    TVTAYYLSSK-GSAWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFH  141

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRI+F VD  PIR F N ES+G+PFPK+QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  142   TYSILWNPQRIVFSVDGTPIREFKNLESMGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  201

Query  779   DWSHAPFTAYYRNFNANACVVTNGVss-cnsiaaasnsnQEWLTQELDGKGRNRVRWVQS  955
             DW+ APFTA YRNFNA ACV++NG SS   + +  ++++  W ++ELD   + R++WV+ 
Sbjct  202   DWALAPFTASYRNFNAEACVLSNGASSCGTTTSPPASTSNAWFSEELDSTRQERLKWVRE  261

Query  956   KHMVYNYCADAKRFPQGFSAECKRS  1030
              +MVYNYC D  RFPQG   EC  S
Sbjct  262   NYMVYNYCKDVNRFPQGLPTECSMS  286



>ref|XP_007223211.1| hypothetical protein PRUPE_ppa009346mg [Prunus persica]
 gb|EMJ24410.1| hypothetical protein PRUPE_ppa009346mg [Prunus persica]
Length=296

 Score =   348 bits (894),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 170/301 (56%), Positives = 219/301 (73%), Gaps = 12/301 (4%)
 Frame = +2

Query  140   MKKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALN  319
             M   +     I++I ++A S +     V     NFN D Q+ +G+   ++ +NG  + L+
Sbjct  1     MASLKSSFSFILLIALLAASSL-----VVASAGNFNQDFQITWGDGRAKILNNGELLTLS  55

Query  320   LDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNAT  499
             LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAGTVT +YL+S  G   DE+DFEFLGN +
Sbjct  56    LDKASGSGFQSKNEYLFGKIDMQLKLVPGNSAGTVTAYYLSSK-GSTWDEIDFEFLGNLS  114

Query  500   FQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHE  679
               PY +HTNV+SQGKGN+EQQF+LWFDPTA FHTY+ILWNPQRI+F VD  PIR F N E
Sbjct  115   GDPYILHTNVFSQGKGNREQQFYLWFDPTADFHTYSILWNPQRIVFSVDGTPIREFKNQE  174

Query  680   SIGIPFPKSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNA-NACV-----V  841
             S G+PFPK+QPMR+Y SLWNADDWAT+GGL+KTDWS APFTA YRNFNA NACV      
Sbjct  175   SNGVPFPKNQPMRIYSSLWNADDWATRGGLIKTDWSRAPFTASYRNFNANNACVSSNGAS  234

Query  842   TNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAEC  1021
             +   SS  + +++++++  WL++ELD   + R+RWVQ  +M+YNYC DAKRFPQG   EC
Sbjct  235   SCSSSSSQNSSSSASTSNAWLSEELDLTRQERLRWVQKNYMIYNYCTDAKRFPQGLPTEC  294

Query  1022  K  1024
             K
Sbjct  295   K  295



>gb|KGN47997.1| hypothetical protein Csa_6G423390 [Cucumis sativus]
Length=286

 Score =   348 bits (893),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 174/292 (60%), Positives = 217/292 (74%), Gaps = 12/292 (4%)
 Frame = +2

Query  170   IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
             ++++     SLV    A      NF  DV + +G    ++ D G  ++L+LD+ +GSGF 
Sbjct  3     LLLLCAFLASLVAATAA------NFLRDVDITWGGPRAKILDGGRHLSLSLDKDSGSGFQ  56

Query  350   TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
             +K ++LFGRFD+QM LV G SAGTVTTFYL+S  G +HDE+DFEFLGN +  PYT+HTNV
Sbjct  57    SKKQFLFGRFDVQMMLVPGNSAGTVTTFYLSSE-GTSHDEIDFEFLGNLSGDPYTLHTNV  115

Query  530   YSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQ  709
             YSQGKG++EQQFHLWFDPT AFHTY+I W+PQ I+F+VDN PIRVF+N E IG+ +PKSQ
Sbjct  116   YSQGKGDREQQFHLWFDPTKAFHTYSIDWSPQSIMFLVDNIPIRVFHNWEKIGVSYPKSQ  175

Query  710   PMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasns  889
             PM+VY SLWNADDWAT+GG VKTDW+ APFTA YRNFNAN CV +    S +S ++   +
Sbjct  176   PMKVYSSLWNADDWATRGGRVKTDWTKAPFTASYRNFNANGCVAS--TGSSSSCSSKYAN  233

Query  890   nQEWLT---QELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
              Q+  T   Q LD K RNR+RWVQSK MVYNYC D +RFPQG  AEC+RSRF
Sbjct  234   TQQGGTKNNQGLDAKSRNRLRWVQSKFMVYNYCTDRQRFPQGIPAECRRSRF  285



>ref|XP_010046997.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Eucalyptus grandis]
Length=291

 Score =   348 bits (893),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 164/264 (62%), Positives = 205/264 (78%), Gaps = 1/264 (0%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + +G+   Q+ +NG+ + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  29    NFYQDFDITWGDGRAQILNNGDLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSAG  88

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G A DE+DFEFLGN +  PY +HTNV+SQGKGN+EQQF+LWFDPTA FH
Sbjct  89    TVTAYYLSSN-GSAWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFH  147

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VD  PIR F N ESIG+PFPK+QPMR++ SLWNADDWAT+GGLVKT
Sbjct  148   TYSILWNPQRIIFSVDGTPIREFKNAESIGVPFPKAQPMRIFSSLWNADDWATRGGLVKT  207

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DW+ APFTA YRNFNA+   V +  SS  + +++S+    WL +ELD   + R++WVQS 
Sbjct  208   DWTQAPFTASYRNFNADNACVWSSGSSSCTSSSSSSDGNAWLAEELDSTSQERLKWVQSN  267

Query  959   HMVYNYCADAKRFPQGFSAECKRS  1030
             +M+YNYC DAKRFPQGF  EC  S
Sbjct  268   YMIYNYCTDAKRFPQGFPPECSMS  291



>gb|AGI42456.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   348 bits (893),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/261 (62%), Positives = 204/261 (78%), Gaps = 4/261 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF+ND  + +G+  G++ +NG  + L LD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  26    NFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNV+SQGKG +EQQFHLWFDPTA FH
Sbjct  86    TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGGREQQFHLWFDPTADFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VDN PIR F N ES+G+ +PK+Q MR+Y SLWNADDWAT+GGL+KT
Sbjct  145   TYSILWNPQRIIFSVDNTPIREFKNAESVGVAYPKNQAMRIYSSLWNADDWATRGGLIKT  204

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DWS APFTA YRNFNA AC+ ++G    +S  + + SN  WL +ELD   + R++WVQ  
Sbjct  205   DWSKAPFTASYRNFNAKACIWSSG---RSSCNSNAPSNNAWLNEELDATSQQRLQWVQKN  261

Query  959   HMVYNYCADAKRFPQGFSAEC  1021
             +M+YNYC DAKRFPQG+  EC
Sbjct  262   YMIYNYCTDAKRFPQGYPPEC  282



>ref|XP_010046992.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Eucalyptus grandis]
Length=292

 Score =   348 bits (893),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 165/296 (56%), Positives = 214/296 (72%), Gaps = 6/296 (2%)
 Frame = +2

Query  143   KKQQQQVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNL  322
              +    +C   ++ ++  S             NF  D  + +G+   Q+ +NG+ + L+L
Sbjct  3     SRSTSSLCTAALLLIMVVSWA-----TSASARNFYQDFDITWGDGRAQILNNGDLLTLSL  57

Query  323   DQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATF  502
             D+ +GSGF +KNEYLFG+ DMQ+KLV G SAGTVT +YL+S  G   DE+DFEFLGN + 
Sbjct  58    DKASGSGFQSKNEYLFGKIDMQLKLVPGNSAGTVTAYYLSSN-GSTWDEIDFEFLGNLSG  116

Query  503   QPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHES  682
              PY +HTNV+SQGKGN+EQQF+LWFDPTA FHTY+ILWNPQRIIF VD  PIR F N ES
Sbjct  117   DPYILHTNVFSQGKGNREQQFYLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNAES  176

Query  683   IGIPFPKSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVssc  862
             IG+PFPK+QPMR++ SLWNADDWAT+GGLVKTDW+ APFTA YRNFNA+   V +  SS 
Sbjct  177   IGVPFPKAQPMRIFSSLWNADDWATRGGLVKTDWTQAPFTASYRNFNADNACVWSSGSSS  236

Query  863   nsiaaasnsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRS  1030
              + +++S+    WL++ELD   + R++WVQS +M+YNYC+DAKRFPQGF  EC  S
Sbjct  237   CTSSSSSSDGNAWLSEELDSTSQERLKWVQSNYMIYNYCSDAKRFPQGFPPECTMS  292



>ref|XP_010656826.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Vitis vinifera]
Length=297

 Score =   348 bits (894),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 166/288 (58%), Positives = 213/288 (74%), Gaps = 8/288 (3%)
 Frame = +2

Query  161   VCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGS  340
             V   ++I VVA  L+  +        NF  D  + +G+   ++ +NG  + L+LD+ +GS
Sbjct  11    VSTALLISVVASFLMAASAG------NFYQDFDITWGDGRAKILNNGELLTLSLDKTSGS  64

Query  341   GFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVH  520
             GF +KNEYLFG+ DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +H
Sbjct  65    GFQSKNEYLFGKIDMQLKLVPGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILH  123

Query  521   TNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP  700
             TNV+SQGKGN+EQQF+LWFDPTA FHTY+ILWNPQRIIF VD  PIR F N ESIG+ +P
Sbjct  124   TNVFSQGKGNREQQFYLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNSESIGVSYP  183

Query  701   KSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACV-VTNGVsscnsiaa  877
             K+QPMR+Y SLWNADDWAT+GGLVKTDWS APFTA YRNFNA+AC+  +   S  ++   
Sbjct  184   KNQPMRIYSSLWNADDWATRGGLVKTDWSQAPFTASYRNFNADACIWSSGASSCSSNTPT  243

Query  878   asnsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAEC  1021
             ++++N EW +QELD   + R++WVQ  +M+YNYC+D KRFPQG   EC
Sbjct  244   STSTNTEWYSQELDSTSQERMKWVQKNYMIYNYCSDTKRFPQGLPPEC  291



>ref|XP_007014171.1| Xyloglucan endotransglucosylase/hydrolase family protein [Theobroma 
cacao]
 gb|EOY31790.1| Xyloglucan endotransglucosylase/hydrolase family protein [Theobroma 
cacao]
Length=290

 Score =   348 bits (892),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 167/288 (58%), Positives = 216/288 (75%), Gaps = 8/288 (3%)
 Frame = +2

Query  170   IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
             I+++ +V   L+  + +      NF  D  + +G+  G++ +NG  + L+LD+ +GSGF 
Sbjct  10    ILLMSLVMGCLMAASAS------NFYQDFDITWGDGRGKIDNNGEVLTLSLDKASGSGFQ  63

Query  350   TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
             +K+EYLFG+ DMQ+KLV G SAGTVT +YL+S  G   DE+DFEFLGN +  PY +HTNV
Sbjct  64    SKDEYLFGKIDMQLKLVHGNSAGTVTAYYLSSK-GSTWDEIDFEFLGNLSGDPYILHTNV  122

Query  530   YSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQ  709
             +SQGKGN+EQQF+LWFDPTA FHTY+ILWN QRIIF VD  PIR F N ES+G+PFPK+Q
Sbjct  123   FSQGKGNREQQFYLWFDPTADFHTYSILWNSQRIIFSVDGTPIREFKNMESLGVPFPKNQ  182

Query  710   PMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGV-sscnsiaaasn  886
             PMR+Y SLWNADDWAT+GGLVKTDW+ APFTA YR FNANACV +NG  S  ++  ++S+
Sbjct  183   PMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYREFNANACVWSNGASSCKSNSPSSSS  242

Query  887   snQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRS  1030
             +N  WL+QELD   + R++WVQ  +M+YNYC DAKRFPQG   EC  S
Sbjct  243   TNNAWLSQELDSTSQQRLQWVQKNYMIYNYCTDAKRFPQGLPPECNMS  290



>ref|XP_002869654.1| hypothetical protein ARALYDRAFT_354208 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45913.1| hypothetical protein ARALYDRAFT_354208 [Arabidopsis lyrata subsp. 
lyrata]
Length=286

 Score =   348 bits (892),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 164/261 (63%), Positives = 201/261 (77%), Gaps = 2/261 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV++ +G+  GQ+ +NG+ + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  25    NFQRDVEITWGDGRGQITNNGDLLTLSLDKASGSGFQSKNEYLFGKIDMQIKLVAGNSAG  84

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL SP G   DE+DFEFLGN +  PYT+HTNV++QGKG++EQQF LWFDPT+ FH
Sbjct  85    TVTAYYLKSP-GSTWDEIDFEFLGNLSGDPYTLHTNVFTQGKGDREQQFKLWFDPTSDFH  143

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VD  PIR F N ES G  FPK+QPMR+Y SLWNA+DWAT+GGLVKT
Sbjct  144   TYSILWNPQRIIFSVDGTPIREFKNMESQGTLFPKNQPMRMYSSLWNAEDWATRGGLVKT  203

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DWS APFTA YR FN  ACVV NG  S     +   S+  WL+QELD  G+ ++RWVQ+ 
Sbjct  204   DWSKAPFTASYRGFNEEACVVING-QSSCPNGSGQGSSGSWLSQELDSTGQEQMRWVQNN  262

Query  959   HMVYNYCADAKRFPQGFSAEC  1021
             +M+YNYC DAKRFPQG   EC
Sbjct  263   YMIYNYCTDAKRFPQGLPREC  283



>ref|XP_006412727.1| hypothetical protein EUTSA_v10025941mg [Eutrema salsugineum]
 dbj|BAJ33741.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ54180.1| hypothetical protein EUTSA_v10025941mg [Eutrema salsugineum]
Length=281

 Score =   347 bits (891),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 164/261 (63%), Positives = 199/261 (76%), Gaps = 6/261 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             +FN+DV + +GN  G++ +NG  + L+LD+ +GSGF +K EYLFG+ DMQ+KLV G SAG
Sbjct  23    DFNSDVNVAWGNGRGKILNNGQLLTLSLDKSSGSGFQSKTEYLFGKIDMQIKLVPGNSAG  82

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL S  G   DE+DFEFLGN +  PYT+HTNVY+QGKG+KEQQFHLWFDP+A FH
Sbjct  83    TVTTFYLKSE-GSTWDEIDFEFLGNMSGDPYTLHTNVYTQGKGDKEQQFHLWFDPSANFH  141

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VDN PIR F N ESIG+ FPK++PMR+Y SLWNADDWAT+GGLVKT
Sbjct  142   TYSILWNPQRIIFTVDNTPIREFKNSESIGVLFPKNKPMRMYASLWNADDWATRGGLVKT  201

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DWS APFTA YRN   +ACV + G       + +S  N  W TQE+D   + R+RWVQ  
Sbjct  202   DWSKAPFTASYRNIKVDACVNSKG-----RSSCSSKPNASWYTQEMDSTSQARLRWVQKN  256

Query  959   HMVYNYCADAKRFPQGFSAEC  1021
             +M+YNYC D KRFPQG   EC
Sbjct  257   YMIYNYCTDTKRFPQGIPREC  277



>ref|XP_002273742.2| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Vitis vinifera]
Length=297

 Score =   348 bits (893),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 167/289 (58%), Positives = 214/289 (74%), Gaps = 8/289 (3%)
 Frame = +2

Query  161   VCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGS  340
             V   +++ VV   L+  +        NF  D  + +G+  G++ +NG  + L+LD+ +GS
Sbjct  11    VSTALLMSVVVSFLMAASAG------NFYQDFDITWGDGRGKILNNGELLTLSLDKPSGS  64

Query  341   GFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVH  520
             GF +KNEYLFG+ DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +H
Sbjct  65    GFQSKNEYLFGKIDMQLKLVPGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILH  123

Query  521   TNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP  700
             TNV+SQGKGN+EQQF+LWFDPTA FHTY+ILWNPQRIIF VD  PIR F N ESIG+P+P
Sbjct  124   TNVFSQGKGNREQQFYLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNSESIGVPYP  183

Query  701   KSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACV-VTNGVsscnsiaa  877
             K+QPMR+Y SLWNADDWAT+GGLVKTDWS APFTA YRNFNANAC+  +   S  ++  +
Sbjct  184   KNQPMRIYSSLWNADDWATRGGLVKTDWSQAPFTASYRNFNANACLWSSGSSSCSSTSPS  243

Query  878   asnsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECK  1024
             ++++N  W +QELD   + R++WVQ  +M+YNYCAD KRFPQG   EC 
Sbjct  244   STSTNGGWYSQELDSTSQERMKWVQKNYMIYNYCADTKRFPQGLPPECS  292



>ref|XP_010670335.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Beta vulgaris subsp. vulgaris]
Length=290

 Score =   348 bits (892),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 167/265 (63%), Positives = 202/265 (76%), Gaps = 5/265 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF+ D  + +G+  G++ ++G  + L+LD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  22    NFHRDFDITWGDGRGKILNSGRQLTLSLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNSAG  81

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN + QPYT+HTNV+SQGKG +EQQF LWFDPT  FH
Sbjct  82    TVTAYYLSSQ-GPTHDEIDFEFLGNVSGQPYTLHTNVFSQGKGGREQQFRLWFDPTTDFH  140

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNP+RIIF VD  PIR F N ESIGIPFPKSQPM++Y SLWNADDWATQGG VK 
Sbjct  141   TYSILWNPKRIIFSVDATPIREFKNWESIGIPFPKSQPMKLYSSLWNADDWATQGGRVKA  200

Query  779   DWSHAPFTAYYRNFNANACVVTNG----VsscnsiaaasnsnQEWLTQELDGKGRNRVRW  946
             DWS APFTA YRNFNANACVV  G     S+  S +A+  +N  WL QELD   + R++W
Sbjct  201   DWSKAPFTASYRNFNANACVVAKGKSSCSSNSASASASRTANSAWLRQELDNASQARMKW  260

Query  947   VQSKHMVYNYCADAKRFPQGFSAEC  1021
             VQ   M+YNYC DAKRFPQG   EC
Sbjct  261   VQKNFMIYNYCTDAKRFPQGLPKEC  285



>ref|XP_004164863.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
sativus]
 emb|CCH26410.1| xyloglucan endotransglycosylase [Cucumis sativus]
Length=286

 Score =   348 bits (892),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 175/290 (60%), Positives = 214/290 (74%), Gaps = 8/290 (3%)
 Frame = +2

Query  170   IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
             ++++     SLV    A      NF  DV + +G    ++ D G  ++L+LD+ +GSGF 
Sbjct  3     LLLLCAFLASLVAATAA------NFLRDVDITWGGPRAKILDGGRHLSLSLDKDSGSGFQ  56

Query  350   TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
             +K ++LFGRFD+QM LV G SAGTVTTFYL+S  G +HDE+DFEFLGN +  PYT+HTNV
Sbjct  57    SKKQFLFGRFDVQMMLVPGNSAGTVTTFYLSSE-GTSHDEIDFEFLGNLSGDPYTLHTNV  115

Query  530   YSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQ  709
             YSQGKG++EQQFHLWFDPT AFHTY+I W+PQ I+F+VDN PIRVF+N E IG+ +PKSQ
Sbjct  116   YSQGKGDREQQFHLWFDPTKAFHTYSIDWSPQSIMFLVDNIPIRVFHNWEKIGVSYPKSQ  175

Query  710   PMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasns  889
             PM+VY SLWNADDWAT+GG VKTDW+ APFTA YRNFNAN CV + G SS  S   A+  
Sbjct  176   PMKVYSSLWNADDWATRGGRVKTDWTKAPFTASYRNFNANGCVASTGSSSSCSSKYANTQ  235

Query  890   nQEWL-TQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
                    Q LD K RNR+RWVQSK MVYNYC D +RFPQG  AEC+RSRF
Sbjct  236   QGGAKNNQGLDAKSRNRLRWVQSKFMVYNYCTDRQRFPQGIPAECRRSRF  285



>ref|XP_010259798.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Nelumbo nucifera]
Length=296

 Score =   348 bits (892),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 166/288 (58%), Positives = 219/288 (76%), Gaps = 11/288 (4%)
 Frame = +2

Query  164   CMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSG  343
             C +++I +   ++            +FN D  + +G+   ++ +NG+ + L+LD+ +GSG
Sbjct  14    CFLVLISLAIATVSAS---------SFNQDFDITWGDGRAKILNNGDLLTLSLDKASGSG  64

Query  344   FNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHT  523
             F +++EYLFG+ DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +HT
Sbjct  65    FQSRHEYLFGKIDMQLKLVAGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILHT  123

Query  524   NVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPK  703
             NV+SQGKGN+EQQF+LWFDPTA FHTY+ILWNPQRIIF VD  PIR F N ESIG+PFPK
Sbjct  124   NVFSQGKGNREQQFYLWFDPTADFHTYSILWNPQRIIFSVDGIPIREFKNSESIGVPFPK  183

Query  704   SQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaas  883
             +Q MR+Y SLWNADDWAT+GGLVKTDW+ APFTA YRNFNANAC++++G SSC+S +  S
Sbjct  184   NQAMRIYSSLWNADDWATRGGLVKTDWTKAPFTASYRNFNANACIMSSGSSSCDSKSPTS  243

Query  884   nsnQ-EWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECK  1024
              ++  +WL+QELD  G+ R++WVQ+ +M+YNYC D KRFPQG   EC 
Sbjct  244   TTDNLQWLSQELDSAGQERMKWVQNNYMIYNYCTDTKRFPQGLPPECS  291



>ref|XP_010488450.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16 [Camelina sativa]
Length=291

 Score =   348 bits (892),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 163/266 (61%), Positives = 205/266 (77%), Gaps = 2/266 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NFN +  + +G H G++   G  ++L+LD+ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  26    NFNEEFDLTWGEHRGKIFSGGKMLSLSLDRVSGSGFKSKKEYLFGRIDMQLKLVAGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN T +PY +HTNV++QGKGN+EQQF+LWFDPT  FH
Sbjct  86    TVTAYYLSSE-GPTHDEIDFEFLGNETGKPYVLHTNVFAQGKGNREQQFYLWFDPTKNFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+++W PQ IIFMVDN PIRVFNN E +G+PFPK QPM++Y SLWNAD WAT+GGLVKT
Sbjct  145   TYSLVWRPQHIIFMVDNVPIRVFNNAEQLGVPFPKKQPMKIYSSLWNADGWATRGGLVKT  204

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQE-WLTQELDGKGRNRVRWVQS  955
             DWS APFTAYYR FNA AC V++G S C+    ++ +N E  +  EL+  GR R+RWVQ 
Sbjct  205   DWSKAPFTAYYRGFNAAACTVSSGSSYCDPKFKSTFTNGESQVANELNAYGRRRLRWVQK  264

Query  956   KHMVYNYCADAKRFPQGFSAECKRSR  1033
               M+Y+YC+D KRF QGF  EC+RSR
Sbjct  265   YFMIYDYCSDVKRFSQGFPPECRRSR  290



>gb|AAQ82628.1| xyloglucan endotransglucosylase [Beta vulgaris subsp. vulgaris]
Length=284

 Score =   347 bits (891),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 167/261 (64%), Positives = 203/261 (78%), Gaps = 2/261 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NFNND  + +G+   ++ +NG+ + L+LD+ TGSGF +KNEYLFG  DMQ+KLV G SAG
Sbjct  23    NFNNDFAITWGDGRAKILNNGDDLTLSLDKATGSGFQSKNEYLFGSIDMQLKLVPGNSAG  82

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
              VT +YL+S  G   DE+DFEFLGNA+ QPYT+HTNV++QGKGN+EQQFHLWFDPT  FH
Sbjct  83    HVTAYYLSS-FGYNPDEIDFEFLGNASGQPYTLHTNVFAQGKGNREQQFHLWFDPTKDFH  141

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRI+F VD  PIR F N ES G+ FPK+QPMR+Y SLWNADDWATQGG VKT
Sbjct  142   TYSILWNPQRIVFSVDGIPIREFKNMESQGVSFPKNQPMRIYSSLWNADDWATQGGRVKT  201

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DW+HAPFTA YRNFNANACV  +  SS    + +++S  +WL QELD     R+RWVQ+ 
Sbjct  202   DWTHAPFTASYRNFNANACVWAS-GSSSCGSSPSADSGSDWLNQELDSASLERMRWVQTN  260

Query  959   HMVYNYCADAKRFPQGFSAEC  1021
             +MVYNYCAD +RFPQG   EC
Sbjct  261   YMVYNYCADLQRFPQGLPTEC  281



>ref|XP_011018193.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Populus euphratica]
Length=289

 Score =   347 bits (891),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 160/265 (60%), Positives = 203/265 (77%), Gaps = 2/265 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF ND  + +G+   ++  NG  + LNLD+ +GSGF ++ EYLFG+ DMQ+KLV G SAG
Sbjct  26    NFYNDFDITWGDGRAKILSNGELLTLNLDKASGSGFQSRKEYLFGKIDMQLKLVPGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G A DE+DFEFLGN +  PY +HTNV+SQGKGN+EQQF+LWFDPTA FH
Sbjct  86    TVTAYYLSSK-GSAWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRI+F VD  PIR F N ES+G+PFPK+QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  145   TYSILWNPQRIVFSVDGTPIREFKNLESMGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  204

Query  779   DWSHAPFTAYYRNFNANACVVTNGVss-cnsiaaasnsnQEWLTQELDGKGRNRVRWVQS  955
             DW+ APFTA YRNFNA ACV++NG SS   + +  ++++  W ++ELD   + R++WV+ 
Sbjct  205   DWALAPFTASYRNFNAEACVLSNGASSCGTTTSPPASTSNAWFSEELDSTRQERLKWVRE  264

Query  956   KHMVYNYCADAKRFPQGFSAECKRS  1030
              +MVYNYC D  RFPQG   EC  S
Sbjct  265   NYMVYNYCKDVNRFPQGLPPECSMS  289



>ref|XP_002321087.1| brassinosteroid-regulated family protein [Populus trichocarpa]
 gb|EEE99402.1| brassinosteroid-regulated family protein [Populus trichocarpa]
Length=284

 Score =   347 bits (891),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 168/287 (59%), Positives = 209/287 (73%), Gaps = 7/287 (2%)
 Frame = +2

Query  164   CMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSG  343
             C    + V+ CS+            NF  D  + +G+   ++ + G  ++L+LD+ +GSG
Sbjct  5     CNGFSLFVIVCSMA------VVASGNFYQDFDLTWGDRRAKIFNGGQLLSLSLDKVSGSG  58

Query  344   FNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHT  523
             F +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +HT
Sbjct  59    FQSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILHT  117

Query  524   NVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPK  703
             NV++QGKGN+EQQF+LWFDPT  FHTY+I+WNPQ IIF+VD+ PIRVF N ESIG+PFPK
Sbjct  118   NVFTQGKGNREQQFYLWFDPTRNFHTYSIIWNPQHIIFLVDSIPIRVFKNAESIGVPFPK  177

Query  704   SQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaas  883
             SQPMR+Y SLWNADDWAT+GGLVKTDW+ APFTAYYRNF ANAC  + G SSC S  +++
Sbjct  178   SQPMRIYSSLWNADDWATRGGLVKTDWTKAPFTAYYRNFKANACTWSYGTSSCGSKPSSA  237

Query  884   nsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECK  1024
              S+  W T ELD   R R+RWVQ   M+YNYC D +RFPQG   ECK
Sbjct  238   FSDGAWKTNELDAPSRRRLRWVQKYFMIYNYCTDLRRFPQGPPPECK  284



>ref|NP_194311.1| probable xyloglucan endotransglucosylase/hydrolase protein 23 
[Arabidopsis thaliana]
 sp|Q38910.1|XTH23_ARATH RecName: Full=Probable xyloglucan endotransglucosylase/hydrolase 
protein 23; Short=At-XTH23; Short=XTH-23; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAB18367.1| xyloglucan endotransglycosylase-related protein [Arabidopsis 
thaliana]
 emb|CAB39602.1| xyloglucan endo-1, 4-beta-D-glucanase (XTR-6) [Arabidopsis thaliana]
 emb|CAB79436.1| xyloglucan endo-1, 4-beta-D-glucanase (XTR-6) [Arabidopsis thaliana]
 gb|AEE85117.1| probable xyloglucan endotransglucosylase/hydrolase protein 23 
[Arabidopsis thaliana]
Length=286

 Score =   347 bits (891),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 163/261 (62%), Positives = 200/261 (77%), Gaps = 2/261 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV++ +G+  GQ+ +NG+ + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  25    NFQRDVEITWGDGRGQITNNGDLLTLSLDKASGSGFQSKNEYLFGKIDMQIKLVAGNSAG  84

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL SP G   DE+DFEFLGN +  PYT+HTNV++QGKG++EQQF LWFDPT+ FH
Sbjct  85    TVTAYYLKSP-GSTWDEIDFEFLGNLSGDPYTLHTNVFTQGKGDREQQFKLWFDPTSDFH  143

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VD  PIR F N ES G  FPK+QPMR+Y SLWNA++WAT+GGLVKT
Sbjct  144   TYSILWNPQRIIFSVDGTPIREFKNMESQGTLFPKNQPMRMYSSLWNAEEWATRGGLVKT  203

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DWS APFTA YR FN  ACVV NG  S     +   S   WL+QELD  G+ ++RWVQ+ 
Sbjct  204   DWSKAPFTASYRGFNEEACVVING-QSSCPNVSGQGSTGSWLSQELDSTGQEQMRWVQNN  262

Query  959   HMVYNYCADAKRFPQGFSAEC  1021
             +M+YNYC DAKRFPQG   EC
Sbjct  263   YMIYNYCTDAKRFPQGLPREC  283



>gb|AFK40376.1| unknown [Lotus japonicus]
Length=293

 Score =   348 bits (892),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 168/266 (63%), Positives = 204/266 (77%), Gaps = 3/266 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NFN D Q+ +G+   ++  N N + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  29    NFNKDFQITWGDGRAKILSNANLLTLSLDKASGSGFESKNEYLFGKIDMQIKLVPGNSAG  88

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G   DE+DFEFLGN +  PYT+HTNV+SQGKGN+EQQFHLWFDPTA FH
Sbjct  89    TVTAYYLSSK-GSTWDEIDFEFLGNLSGDPYTLHTNVFSQGKGNREQQFHLWFDPTADFH  147

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRI+F VD  PIR F N ES G+PFPK+QPMR+  SLWNAD+WAT+GGLVKT
Sbjct  148   TYSILWNPQRIVFSVDGTPIREFKNLESAGVPFPKNQPMRLTSSLWNADNWATRGGLVKT  207

Query  779   DWSHAPFTAYYRNFNA-NACVVTNG-VsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQ  952
             DWS APFTA YRNFNA NACV + G  S  ++  ++++ +  WL QELD  G  R+RWVQ
Sbjct  208   DWSKAPFTASYRNFNANNACVWSGGKSSCKSNSPSSASGSASWLKQELDSTGYQRLRWVQ  267

Query  953   SKHMVYNYCADAKRFPQGFSAECKRS  1030
               +MVYNYCAD KRFPQG   EC  S
Sbjct  268   KNYMVYNYCADKKRFPQGLPTECTHS  293



>ref|XP_011016106.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Populus 
euphratica]
Length=284

 Score =   347 bits (891),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 167/287 (58%), Positives = 210/287 (73%), Gaps = 7/287 (2%)
 Frame = +2

Query  164   CMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSG  343
             C    + V+ACS+            NF  D  + +G+   ++ + G  ++L+LD+ +GSG
Sbjct  5     CYEFSLFVIACSMA------VVASGNFYQDFDLTWGDRRAKIFNGGQLLSLSLDKVSGSG  58

Query  344   FNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHT  523
             F +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +HT
Sbjct  59    FQSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILHT  117

Query  524   NVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPK  703
             NV++QGKGN+EQQF+LWFDPT  FHTY+I+WNPQ IIF+VD+ PIRVF N ESIG+PFPK
Sbjct  118   NVFTQGKGNREQQFYLWFDPTRNFHTYSIIWNPQHIIFLVDSIPIRVFKNAESIGVPFPK  177

Query  704   SQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaas  883
             SQPMR+Y SLWNADDWAT+GGLVKTDW+ APFTAYYRNF A+AC  + G SSC S  +++
Sbjct  178   SQPMRIYSSLWNADDWATRGGLVKTDWTKAPFTAYYRNFKASACTWSYGTSSCGSKPSSA  237

Query  884   nsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECK  1024
              S+  W T +LD   R R+RWVQ   M+YNYC D +RFPQG   ECK
Sbjct  238   FSDGAWKTNDLDAPSRRRLRWVQKYFMIYNYCTDLRRFPQGPPPECK  284



>gb|AAM61021.1| xyloglucan endotransglycosylase, putative [Arabidopsis thaliana]
Length=291

 Score =   347 bits (891),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 163/266 (61%), Positives = 207/266 (78%), Gaps = 2/266 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             +FN +  + +G H G++   G  ++L+LD+ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  26    SFNEEFDLTWGEHRGKIFSGGKMLSLSLDRVSGSGFKSKKEYLFGRIDMQLKLVAGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN T +PY +HTNV++QGKGN+EQQF+LWFDPT  FH
Sbjct  86    TVTAYYLSSE-GPTHDEIDFEFLGNETGKPYVLHTNVFAQGKGNREQQFYLWFDPTKNFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+++W PQ IIFMVDN PIRVFNN E +G+PFPK+QPM++Y SLWNADDWAT+GGLVKT
Sbjct  145   TYSLVWRPQHIIFMVDNVPIRVFNNAEQLGVPFPKNQPMKIYSSLWNADDWATRGGLVKT  204

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQE-WLTQELDGKGRNRVRWVQS  955
             DWS APFTAYYR FNA AC V++G S C+    +S +N E  +  EL+  G  R+RWVQ 
Sbjct  205   DWSKAPFTAYYRGFNAAACTVSSGSSFCDPKFKSSFTNGESQVANELNAYGIRRLRWVQK  264

Query  956   KHMVYNYCADAKRFPQGFSAECKRSR  1033
               M+Y+YC+D KRFPQGF  EC++SR
Sbjct  265   YFMIYDYCSDLKRFPQGFPPECRKSR  290



>gb|AGI42458.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   347 bits (890),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 161/261 (62%), Positives = 203/261 (78%), Gaps = 4/261 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF+ND  + +G+  G++ +NG  + L LD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  26    NFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNV+SQGKG +EQQFHLWFDPTA FH
Sbjct  86    TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGGREQQFHLWFDPTADFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VDN PIR F N ES+G+ +PK+Q MR+Y SLWNADDWAT+GGL+KT
Sbjct  145   TYSILWNPQRIIFSVDNTPIREFKNAESVGVAYPKNQAMRIYSSLWNADDWATRGGLIKT  204

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DWS APFTA YRNFNA AC+ ++G    +S  + + SN  WL +ELD   + R++W Q  
Sbjct  205   DWSKAPFTASYRNFNAKACIWSSG---RSSCNSNAPSNNAWLNEELDATSQQRLQWAQKN  261

Query  959   HMVYNYCADAKRFPQGFSAEC  1021
             +M+YNYC DAKRFPQG+  EC
Sbjct  262   YMIYNYCTDAKRFPQGYPPEC  282



>emb|CDX68640.1| BnaC01g08130D [Brassica napus]
Length=282

 Score =   347 bits (890),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 162/261 (62%), Positives = 195/261 (75%), Gaps = 5/261 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             +FN+DV + +GN  G++ +NG  + L LD+ +GSGF +K EYLFG+ DMQ+KLV G SAG
Sbjct  23    DFNSDVNVAWGNGRGKILNNGQLLTLTLDKSSGSGFQSKTEYLFGKIDMQIKLVPGNSAG  82

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL S  G   DE+DFEFLGN T  PYT+HTNVY+QGKG+KEQQFHLWFDPTA FH
Sbjct  83    TVTTFYLKSE-GSTWDEIDFEFLGNMTGDPYTLHTNVYTQGKGDKEQQFHLWFDPTANFH  141

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRII  VD+ PIR F N ES+G+ FPKS+PMR+Y SLWNADDWAT+GGLVKT
Sbjct  142   TYSILWNPQRIILTVDDTPIREFKNSESLGVLFPKSKPMRMYASLWNADDWATRGGLVKT  201

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DWS APFTA YRN   + C  +NG     S   ++     W TQE+D   + R+RWVQ  
Sbjct  202   DWSKAPFTASYRNIKVDGCAHSNG----RSSCTSTKPTSNWYTQEMDSTSQARLRWVQKN  257

Query  959   HMVYNYCADAKRFPQGFSAEC  1021
             +M+YNYC D KRFPQG   EC
Sbjct  258   YMIYNYCTDTKRFPQGIPREC  278



>gb|KHG05436.1| putative xyloglucan endotransglucosylase/hydrolase 21 -like protein 
[Gossypium arboreum]
 gb|KHG17444.1| putative xyloglucan endotransglucosylase/hydrolase 21 -like protein 
[Gossypium arboreum]
Length=297

 Score =   347 bits (891),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 163/281 (58%), Positives = 213/281 (76%), Gaps = 4/281 (1%)
 Frame = +2

Query  179   IGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKN  358
             +G++  + + V   +     NFN DV + +G+  G++ +NG  + L+LD+ +GSGF ++N
Sbjct  11    LGMLLITFLMVETFMVASAGNFNKDVDITWGDSRGKILNNGQLLTLSLDKASGSGFQSRN  70

Query  359   EYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQ  538
             EYL+G+FDMQ+KLV G SAGTVT +YL S  G + DE+DFEFLGN +  PY VHTNVY++
Sbjct  71    EYLYGKFDMQLKLVPGNSAGTVTAYYLKSQ-GSSWDEIDFEFLGNLSGDPYIVHTNVYTK  129

Query  539   GKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMR  718
             GKG++EQQF+LWFDPTA FHTY+ILWNP  +IF VD  PIR F N ES+G+P+PK+QPMR
Sbjct  130   GKGDREQQFYLWFDPTADFHTYSILWNPGHVIFYVDGRPIREFKNLESLGVPYPKNQPMR  189

Query  719   VYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQE  898
             +YCSLWNADDWAT+GGLVKTDWS APFTA +RNF ANAC ++NGV   +S +  S+SN  
Sbjct  190   MYCSLWNADDWATRGGLVKTDWSQAPFTASFRNFTANACALSNGV---SSCSTNSSSNNA  246

Query  899   WLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAEC  1021
             W +QELD   +  ++WVQ  +MVYNYC DAKRFP+G   EC
Sbjct  247   WFSQELDSSSQKVLKWVQKNYMVYNYCKDAKRFPKGLPVEC  287



>gb|AAF80591.1|AF223420_1 xyloglucan endotransglycosylase XET2 [Asparagus officinalis]
Length=284

 Score =   347 bits (889),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 167/284 (59%), Positives = 216/284 (76%), Gaps = 7/284 (2%)
 Frame = +2

Query  173   MIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNT  352
             ++  V+A S VG+A+A      NFN+D ++ +G+  G++ DNG  ++L+LD+ +GSGF +
Sbjct  4     LLFAVLALSSVGIAVAG-----NFNDDFKITWGDGRGRIVDNGQLLSLSLDKASGSGFES  58

Query  353   KNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVY  532
              +EYLFG+ DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNV+
Sbjct  59    THEYLFGKIDMQLKLVPGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVF  117

Query  533   SQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQP  712
             +QGKGN+EQQFHLWFDPT  FHTY+ILWNP  IIF VD  PIR F N ES G+ FPKSQP
Sbjct  118   TQGKGNREQQFHLWFDPTKDFHTYSILWNPSHIIFSVDGIPIRDFKNMESRGVAFPKSQP  177

Query  713   MRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVss-cnsiaaasns  889
             M++Y SLWNADDWAT+GGL+KTDW+ APFTA YRNFNANACV + G S+  +  + +++ 
Sbjct  178   MKIYSSLWNADDWATRGGLIKTDWTKAPFTASYRNFNANACVWSAGTSTCSSKKSPSASP  237

Query  890   nQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAEC  1021
             +  WL +ELD   + R+RWVQ  +M+YNYCAD KRFPQG   EC
Sbjct  238   SNAWLNEELDSTRQERMRWVQKNYMIYNYCADLKRFPQGLPPEC  281



>ref|XP_009127941.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24 [Brassica rapa]
 emb|CDY28174.1| BnaA01g06750D [Brassica napus]
Length=282

 Score =   347 bits (889),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 162/261 (62%), Positives = 195/261 (75%), Gaps = 5/261 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             +FN+DV + +GN  G++ +NG  + L LD+ +GSGF +K EYLFG+ DMQ+KLV G SAG
Sbjct  23    DFNSDVNVAWGNGRGKILNNGQLLTLTLDKSSGSGFQSKTEYLFGKIDMQIKLVPGNSAG  82

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVTTFYL S  G   DE+DFEFLGN T  PYT+HTNVY+QGKG+KEQQFHLWFDPTA FH
Sbjct  83    TVTTFYLKSE-GSTWDEIDFEFLGNMTGDPYTLHTNVYTQGKGDKEQQFHLWFDPTANFH  141

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRII  VD+ PIR F N ES+G+ FPKS+PMR+Y SLWNADDWAT+GGLVKT
Sbjct  142   TYSILWNPQRIILTVDDTPIREFKNSESLGVLFPKSKPMRMYASLWNADDWATRGGLVKT  201

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DWS APFTA YRN   + C  +NG     S   ++     W TQE+D   + R+RWVQ  
Sbjct  202   DWSKAPFTASYRNIKIDGCAHSNG----RSSCTSTKPTSTWYTQEMDSTSQARLRWVQKN  257

Query  959   HMVYNYCADAKRFPQGFSAEC  1021
             +M+YNYC D KRFPQG   EC
Sbjct  258   YMIYNYCTDTKRFPQGIPREC  278



>ref|XP_009360814.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Pyrus 
x bretschneideri]
Length=296

 Score =   347 bits (890),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 166/267 (62%), Positives = 197/267 (74%), Gaps = 2/267 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + +G+H  ++   GN + L+LDQ +GSGF +  +YLFGR +MQ+KLV G SAG
Sbjct  31    NFQQDFDLTWGDHRAKIIGGGNVLQLSLDQASGSGFQSNKQYLFGRIEMQLKLVAGNSAG  90

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN T +PY VHTNVYSQGKG +EQQF+LWFDPT  FH
Sbjct  91    TVTAYYLSSE-GPNHDEIDFEFLGNVTGEPYIVHTNVYSQGKGGREQQFYLWFDPTKNFH  149

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TYT LWNPQRII +VDN PIRVFNN ES G+PFPKS+PM++Y SLWNAD WAT+GGLVKT
Sbjct  150   TYTFLWNPQRIILLVDNIPIRVFNNGESYGVPFPKSKPMKLYSSLWNADQWATRGGLVKT  209

Query  779   DWSHAPFTAYYRNFNANACV-VTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQS  955
             DWS APFTAYY+NFNANACV   +   S        + N  W TQ  D   R R+RWVQ 
Sbjct  210   DWSKAPFTAYYKNFNANACVWSGSSSCSSTGNIEKGSKNNAWQTQSFDAISRRRLRWVQK  269

Query  956   KHMVYNYCADAKRFPQGFSAECKRSRF  1036
               M+YNYC+D KRFP+G   EC RSRF
Sbjct  270   YFMIYNYCSDLKRFPRGRPRECNRSRF  296



>gb|KDP36435.1| hypothetical protein JCGZ_08704 [Jatropha curcas]
Length=286

 Score =   347 bits (889),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 167/264 (63%), Positives = 205/264 (78%), Gaps = 3/264 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + +G+   ++ +NG  + LNLD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  26    NFYQDFDITWGDGRAKILNNGQLLTLNLDKASGSGFQSRNEYLFGKIDMQLKLVPGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G   DE+DFEFLGN +  PY +HTNV+SQGKGN+EQQF+LWFDPTA FH
Sbjct  86    TVTAYYLSSK-GSTWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VD  PIR F N ES G+PFPKSQPMR+Y SL NADDWAT+GGLVKT
Sbjct  145   TYSILWNPQRIIFSVDGTPIREFKNLESAGVPFPKSQPMRIYSSLGNADDWATRGGLVKT  204

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DWS APFTA YRNFNANAC+ +NG SSC S + +S++   WL+QELD   ++R++WVQ  
Sbjct  205   DWSRAPFTASYRNFNANACIWSNGASSCKSSSPSSSNV--WLSQELDATSQDRLQWVQQN  262

Query  959   HMVYNYCADAKRFPQGFSAECKRS  1030
             +M+YNYC D KRFPQG   EC  S
Sbjct  263   YMIYNYCTDTKRFPQGIPPECSMS  286



>ref|XP_011043999.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 isoform X2 [Populus euphratica]
Length=289

 Score =   347 bits (889),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 160/265 (60%), Positives = 203/265 (77%), Gaps = 2/265 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF ND  + +G+   ++  NG  + LNLD+ +GSGF ++ EYLFG+ DMQ+KLV G SAG
Sbjct  26    NFYNDFDVTWGDGRAKILSNGELLTLNLDKASGSGFQSRKEYLFGKIDMQLKLVPGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G A DE+DFEFLGN +  PY +HTNV+SQGKGN+EQQF+LWFDPTA FH
Sbjct  86    TVTAYYLSSK-GSAWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRI+F VD  PIR F N ES+G+PFPK+QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  145   TYSILWNPQRIVFSVDGTPIREFKNLESMGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  204

Query  779   DWSHAPFTAYYRNFNANACVVTNGVss-cnsiaaasnsnQEWLTQELDGKGRNRVRWVQS  955
             DW+ APFTA YRNFNA ACV++NG SS   + +  ++++  W ++ELD   + R++WV+ 
Sbjct  205   DWALAPFTASYRNFNAEACVLSNGASSCGTTTSPPASTSNAWFSEELDSTRQERLKWVRE  264

Query  956   KHMVYNYCADAKRFPQGFSAECKRS  1030
              +MVYNYC D  RFPQG   EC  S
Sbjct  265   NYMVYNYCKDVNRFPQGLPPECSMS  289



>gb|AGI42454.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=281

 Score =   346 bits (888),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/261 (62%), Positives = 203/261 (78%), Gaps = 4/261 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF+ND  + +G+  G++ +NG  + L LD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  22    NFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNSAG  81

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNV+SQGKG +EQQFHLWFDPTA FH
Sbjct  82    TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGGREQQFHLWFDPTADFH  140

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQR IF VDN PIR F N ES+G+ +PK+Q MR+Y SLWNADDWAT+GGL+KT
Sbjct  141   TYSILWNPQRTIFSVDNTPIREFKNAESVGVAYPKNQAMRIYSSLWNADDWATRGGLIKT  200

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DWS APFTA YRNFNA AC+ ++G    +S  + + SN  WL +ELD   + R++WVQ  
Sbjct  201   DWSKAPFTASYRNFNAKACIWSSG---RSSCNSNAPSNNAWLNEELDATSQQRLQWVQKN  257

Query  959   HMVYNYCADAKRFPQGFSAEC  1021
             +M+YNYC DAKRFPQG+  EC
Sbjct  258   YMIYNYCTDAKRFPQGYPPEC  278



>gb|AGI42450.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   346 bits (888),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/261 (62%), Positives = 203/261 (78%), Gaps = 4/261 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF+ND  + +G+  G++ +NG  + L LD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  26    NFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN +  PYT+H NV+SQGKG +EQQFHLWFDPTA FH
Sbjct  86    TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHINVFSQGKGGREQQFHLWFDPTADFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VDN PIR F N ES+G+ +PK+Q MR+Y SLWNADDWAT+GGL+KT
Sbjct  145   TYSILWNPQRIIFSVDNTPIREFKNAESVGVAYPKNQAMRIYSSLWNADDWATRGGLIKT  204

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DWS APFTA YRNFNA AC+ ++G    +S  + + SN  WL +ELD   + R++WVQ  
Sbjct  205   DWSKAPFTASYRNFNAKACIWSSG---RSSCNSNAPSNNAWLNEELDATSQQRLQWVQKN  261

Query  959   HMVYNYCADAKRFPQGFSAEC  1021
             +M+YNYC DAKRFPQG+  EC
Sbjct  262   YMIYNYCTDAKRFPQGYPPEC  282



>ref|XP_011043998.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 isoform X1 [Populus euphratica]
Length=289

 Score =   347 bits (889),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 160/265 (60%), Positives = 202/265 (76%), Gaps = 2/265 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF ND  + +G+    +  NG  + LNLD+ +GSGF ++ EYLFG+ DMQ+KLV G SAG
Sbjct  26    NFYNDFDITWGDGRANILSNGELLTLNLDKASGSGFQSRKEYLFGKIDMQLKLVPGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G A DE+DFEFLGN +  PY +HTNV+SQGKGN+EQQF+LWFDPTA FH
Sbjct  86    TVTAYYLSSK-GSAWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRI+F VD  PIR F N ES+G+PFPK+QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  145   TYSILWNPQRIVFSVDGTPIREFKNLESMGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  204

Query  779   DWSHAPFTAYYRNFNANACVVTNGVss-cnsiaaasnsnQEWLTQELDGKGRNRVRWVQS  955
             DW+ APFTA YRNFNA ACV++NG SS   + +  ++++  W ++ELD   + R++WV+ 
Sbjct  205   DWALAPFTASYRNFNAEACVLSNGASSCGTTTSPPASTSNAWFSEELDSTRQERLKWVRE  264

Query  956   KHMVYNYCADAKRFPQGFSAECKRS  1030
              +MVYNYC D  RFPQG   EC  S
Sbjct  265   NYMVYNYCKDVNRFPQGLPPECSMS  289



>ref|XP_006474161.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like [Citrus sinensis]
 gb|KDO46536.1| hypothetical protein CISIN_1g023337mg [Citrus sinensis]
Length=283

 Score =   346 bits (888),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/283 (57%), Positives = 209/283 (74%), Gaps = 12/283 (4%)
 Frame = +2

Query  173   MIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNT  352
             ++I +   SL+           NF  D  + +G+  G++ +NG  ++L+LD+ +GSGF +
Sbjct  9     LLISIAISSLM------VASASNFYQDFDITWGDGRGKILNNGQLLSLSLDKASGSGFQS  62

Query  353   KNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVY  532
             K+EYLFG+ DMQ+KLV G SAGTVT +YL SP G   DE+DFEFLGN +  PYT+HTNV+
Sbjct  63    KSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSP-GSTWDEIDFEFLGNLSGDPYTLHTNVF  121

Query  533   SQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQP  712
             + GKG++EQQFHLWFDPTA FHTY++LWNPQRI+F VD +PIR F N ES G+ FPK+QP
Sbjct  122   TNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQP  181

Query  713   MRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsn  892
             MR+Y SLWNADDWAT+GGL+KTDW+ APFTA YRNFNANACV +NG       +  S +N
Sbjct  182   MRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANACVWSNG-----KSSCNSKNN  236

Query  893   QEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAEC  1021
               W +QELD  G+ R++WVQ  +M+YNYC D+KRFPQG   EC
Sbjct  237   NPWFSQELDATGQERLKWVQKNYMIYNYCKDSKRFPQGLPKEC  279



>ref|NP_001267702.1| probable xyloglucan endotransglucosylase/hydrolase protein 23-like 
precursor [Cucumis sativus]
 emb|CAD87535.1| putative xyloglucan endotransglycosylase [Cucumis sativus]
 emb|CAD87533.1| putative xyloglucan endotransglycosylase [Cucumis sativus]
 gb|KGN65438.1| hypothetical protein Csa_1G422470 [Cucumis sativus]
Length=283

 Score =   346 bits (888),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 159/261 (61%), Positives = 198/261 (76%), Gaps = 3/261 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NFN D Q+ +G+   ++ +NG  + L+LD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  23    NFNQDFQITWGDGRAKILNNGELLTLSLDKASGSGFQSQNEYLFGKIDMQLKLVAGNSAG  82

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G   DE+DFEFLGN +  PYT+HTNV+SQGKGN+EQQFHLWFDPTA FH
Sbjct  83    TVTAYYLSSK-GSTWDEIDFEFLGNLSGDPYTLHTNVFSQGKGNREQQFHLWFDPTADFH  141

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNP RIIF VD  PIR F N ES G+PFPK QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  142   TYSILWNPNRIIFSVDGTPIREFKNWESNGVPFPKDQPMRIYSSLWNADDWATRGGLVKT  201

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DW+ APFTA Y+NF A ACV + G    +   + + S+  WL+QE+D   + R++WVQ  
Sbjct  202   DWTKAPFTASYKNFKAEACVWSGG--KSSCSPSPAGSSNSWLSQEMDSASQERLKWVQKN  259

Query  959   HMVYNYCADAKRFPQGFSAEC  1021
             +M+YNYC D KRFPQG   EC
Sbjct  260   YMIYNYCTDTKRFPQGLPTEC  280



>dbj|BAJ10423.1| xyloglucan endotransglucosylase/hydrolase [Dianthus caryophyllus]
Length=281

 Score =   346 bits (887),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 166/282 (59%), Positives = 211/282 (75%), Gaps = 10/282 (4%)
 Frame = +2

Query  176   IIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTK  355
             I  ++A +LVG  LA      NF ++  + FG+   ++ +NG+ + L+LD+ +GSGF +K
Sbjct  6     IFLLIATTLVGSTLA------NFYSEFDITFGDGRARLLNNGDDLTLSLDKYSGSGFRSK  59

Query  356   NEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYS  535
             NEYLFG+ DMQ+KLV G SAG+VTT+YL+S +G  HDE+DFEFLGN T +PYT+HTNV++
Sbjct  60    NEYLFGKIDMQIKLVPGNSAGSVTTYYLSS-LGPTHDEIDFEFLGNVTGEPYTLHTNVFA  118

Query  536   QGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPM  715
             QGKGN+EQQFHLWFDPT  FHTY+ILWNPQRI+F VD  P+R F N ES G+ FPK+QPM
Sbjct  119   QGKGNREQQFHLWFDPTTEFHTYSILWNPQRIVFSVDGVPLREFKNMESKGVSFPKNQPM  178

Query  716   RVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQ  895
             RVY SLWNADDWATQGG VK DWS APF A ++ +NANACV  +G    ++  + S S  
Sbjct  179   RVYSSLWNADDWATQGGRVKADWSKAPFVASFKKYNANACVWGSG---SSTCKSGSRSRS  235

Query  896   EWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAEC  1021
              WLT+ELD  G  R++WVQ  +MVYNYCAD +RFPQG   EC
Sbjct  236   NWLTEELDSAGLERMKWVQKNYMVYNYCADVQRFPQGLPTEC  277



>ref|XP_010047002.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Eucalyptus grandis]
 gb|KCW78743.1| hypothetical protein EUGRSUZ_C00184 [Eucalyptus grandis]
Length=287

 Score =   346 bits (888),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 170/290 (59%), Positives = 212/290 (73%), Gaps = 8/290 (3%)
 Frame = +2

Query  161   VCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGS  340
             + MI+   ++  SL+           N N +  + +G+   Q+ +NG+ + L+LD+ +GS
Sbjct  6     LAMILFTSILLKSLM------VASAGNLNQEFDITWGDGRAQILNNGDLLTLSLDKASGS  59

Query  341   GFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVH  520
             GF +KNEYLFG+ DMQ+KLV G SAGTVT +YL+S  G   DE+DFEFLGN +  PY +H
Sbjct  60    GFQSKNEYLFGKIDMQLKLVPGNSAGTVTAYYLSSK-GSTWDEIDFEFLGNLSGDPYILH  118

Query  521   TNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP  700
             TNV+SQGKGN+EQQF+LWFDPTA FHTY+ILWNPQRIIF VD  PIR F N ES G+PFP
Sbjct  119   TNVFSQGKGNREQQFYLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNAESSGVPFP  178

Query  701   KSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaa  880
             KSQPMR+Y SLWNADDWAT+GGLVKTDWS APF A YRNFNA+ACV ++  SS     AA
Sbjct  179   KSQPMRIYSSLWNADDWATRGGLVKTDWSRAPFMASYRNFNADACVWSS-GSSSCGSGAA  237

Query  881   snsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRS  1030
             S+    WLTQELD   + R++WVQ  +M+YNYC+D+KRFPQG   EC  S
Sbjct  238   SSDGSSWLTQELDTTSQQRLKWVQQNYMIYNYCSDSKRFPQGPPPECNLS  287



>gb|AII99392.1| xyloglucan endotransglucosylase/hydrolase2 [Dianthus caryophyllus]
Length=281

 Score =   346 bits (887),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 166/282 (59%), Positives = 211/282 (75%), Gaps = 10/282 (4%)
 Frame = +2

Query  176   IIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTK  355
             I  ++A +LVG  LA      NF ++  + FG+   ++ +NG+ + L+LD+ +GSGF +K
Sbjct  6     IYLLIATTLVGSTLA------NFYSEFDITFGDGRARLLNNGDDLTLSLDKYSGSGFRSK  59

Query  356   NEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYS  535
             NEYLFG+ DMQ+KLV G SAG+VTT+YL+S +G  HDE+DFEFLGN T +PYT+HTNV++
Sbjct  60    NEYLFGKIDMQIKLVPGNSAGSVTTYYLSS-LGPTHDEIDFEFLGNVTGEPYTLHTNVFA  118

Query  536   QGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPM  715
             QGKGN+EQQFHLWFDPT  FHTY+ILWNPQRI+F VD  P+R F N ES G+ FPK+QPM
Sbjct  119   QGKGNREQQFHLWFDPTTEFHTYSILWNPQRIVFSVDGVPLREFKNMESKGVSFPKNQPM  178

Query  716   RVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQ  895
             RVY SLWNADDWATQGG VK DWS APF A ++ +NANACV  +G    ++  + S S  
Sbjct  179   RVYSSLWNADDWATQGGRVKADWSKAPFVASFKKYNANACVWGSG---SSTCKSGSRSRS  235

Query  896   EWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAEC  1021
              WLT+ELD  G  R++WVQ  +MVYNYCAD +RFPQG   EC
Sbjct  236   NWLTEELDSAGLERMKWVQKNYMVYNYCADVQRFPQGLPTEC  277



>gb|AAL32550.1| xyloglucan endo-1, 4-beta-D-glucanase (XTR-6) [Arabidopsis thaliana]
 gb|AAM13251.1| xyloglucan endo-1, 4-beta-D-glucanase [Arabidopsis thaliana]
Length=286

 Score =   346 bits (887),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 162/261 (62%), Positives = 200/261 (77%), Gaps = 2/261 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  DV++ +G+  GQ+ +NG+ + L+LD+ +GSGF +KNEYLFG+ DMQ++LV G SAG
Sbjct  25    NFQRDVEITWGDGRGQITNNGDLLTLSLDKASGSGFQSKNEYLFGKIDMQIELVAGNSAG  84

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL SP G   DE+DFEFLGN +  PYT+HTNV++QGKG++EQQF LWFDPT+ FH
Sbjct  85    TVTAYYLKSP-GSTWDEIDFEFLGNLSGDPYTLHTNVFTQGKGDREQQFKLWFDPTSDFH  143

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VD  PIR F N ES G  FPK+QPMR+Y SLWNA++WAT+GGLVKT
Sbjct  144   TYSILWNPQRIIFSVDGTPIREFKNMESQGTLFPKNQPMRMYSSLWNAEEWATRGGLVKT  203

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DWS APFTA YR FN  ACVV NG  S     +   S   WL+QELD  G+ ++RWVQ+ 
Sbjct  204   DWSKAPFTASYRGFNEEACVVING-QSSCPNVSGQGSTGSWLSQELDSTGQEQMRWVQNN  262

Query  959   HMVYNYCADAKRFPQGFSAEC  1021
             +M+YNYC DAKRFPQG   EC
Sbjct  263   YMIYNYCTDAKRFPQGLPREC  283



>gb|ACD03218.1| xyloglucan endotransglucosylase/hydrolase 8 [Actinidia deliciosa]
Length=285

 Score =   346 bits (887),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 167/266 (63%), Positives = 204/266 (77%), Gaps = 5/266 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF+ D  + +G+   ++ + G  ++L+LD+ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  24    NFHQDFDLTWGDQKAKIFNGGQILSLSLDKTSGSGFKSKQEYLFGRIDMQLKLVAGNSAG  83

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN +  PY VHTNV++QGKGN+EQQF+LWFDPT  FH
Sbjct  84    TVTAYYLSSE-GPTHDEIDFEFLGNLSGDPYIVHTNVFTQGKGNREQQFYLWFDPTRNFH  142

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+WN Q+IIF+VDN PIRVF N E+IG+PFPK+QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  143   TYSIIWNTQQIIFLVDNTPIRVFKNAETIGVPFPKTQPMRIYSSLWNADDWATRGGLVKT  202

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DW+ APFTAYYRNFN   C       SC S +A+S SN  W  QELD   R R+RWVQ  
Sbjct  203   DWTKAPFTAYYRNFNVQTC----SPRSCTSSSASSISNGAWQGQELDAYSRRRLRWVQKH  258

Query  959   HMVYNYCADAKRFPQGFSAECKRSRF  1036
              M+YNYC D KRFPQG  AEC+RSRF
Sbjct  259   FMIYNYCTDLKRFPQGIPAECRRSRF  284



>gb|AGI42459.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   346 bits (887),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/261 (62%), Positives = 203/261 (78%), Gaps = 4/261 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             N +ND  + +G+  G++ +NG  + L LD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  26    NSHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN +  PYT+HTNV+SQGKG +EQQFHLWFDPTA FH
Sbjct  86    TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGGREQQFHLWFDPTADFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VDN PIR F N ES+G+ +PK+Q MR+Y SLWNADDWAT+GGL+KT
Sbjct  145   TYSILWNPQRIIFSVDNTPIREFKNAESVGVAYPKNQAMRIYSSLWNADDWATRGGLIKT  204

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DWS APFTA YRNFNA AC+ ++G    +S  + + SN  WL +ELD   + R++WVQ  
Sbjct  205   DWSKAPFTASYRNFNARACIWSSG---RSSCNSNAPSNNAWLNEELDATSQQRLQWVQKN  261

Query  959   HMVYNYCADAKRFPQGFSAEC  1021
             +M+YNYC DAKRFPQG+  EC
Sbjct  262   YMIYNYCTDAKRFPQGYPPEC  282



>ref|XP_002274858.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22 [Vitis vinifera]
Length=296

 Score =   346 bits (888),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 163/262 (62%), Positives = 203/262 (77%), Gaps = 2/262 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             N   D  + +G+   ++ +NG  + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  30    NLYQDFDLTWGDGRAKILNNGQLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSAG  89

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN +  PY +HTNV+SQGKGN+EQQF+LWFDPTA FH
Sbjct  90    TVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFH  148

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VD  PIR F N ESIG+PFPK+QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  149   TYSILWNPQRIIFSVDGTPIREFKNSESIGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  208

Query  779   DWSHAPFTAYYRNFNANACV-VTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQS  955
             DWS APFTA YRNFNANACV  +   S  ++  +++++N  W +QELD   + R++WVQ 
Sbjct  209   DWSQAPFTASYRNFNANACVWSSGSSSCSSTSPSSTSTNSGWYSQELDSTSQERMKWVQK  268

Query  956   KHMVYNYCADAKRFPQGFSAEC  1021
              +M+YNYC D KRFPQG S EC
Sbjct  269   NYMIYNYCTDTKRFPQGLSPEC  290



>gb|AEQ37175.1| xyloglucan endotransglucosylase/hydrolase [Diospyros kaki]
Length=287

 Score =   346 bits (887),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 162/290 (56%), Positives = 209/290 (72%), Gaps = 17/290 (6%)
 Frame = +2

Query  170   IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
             + ++ ++A S++           NF  D  + +G+H  ++ + G  ++L+LD+ +GSGF 
Sbjct  13    LFLVALLASSMMAAKGG------NFYQDFDVTWGDHRAKIFNGGQLLSLSLDKTSGSGFR  66

Query  350   TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
             +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY VHTNV
Sbjct  67    SKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYIVHTNV  125

Query  530   YSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQ  709
             ++QGKGN+EQQF+LWFDPT  FHTY+++WNP++IIF++DN PIRVF N ESIG+PFPK+Q
Sbjct  126   FTQGKGNREQQFYLWFDPTRNFHTYSVVWNPRQIIFLIDNTPIRVFKNAESIGVPFPKNQ  185

Query  710   PMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasns  889
             PMR+Y SLWNADDWAT+GGLVKTDW+ APFTAYYRNFNA  C         +     S  
Sbjct  186   PMRIYSSLWNADDWATRGGLVKTDWTKAPFTAYYRNFNAKTC---------SGACTESFG  236

Query  890   nQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAEC-KRSRF  1036
             +  W +QELD   R R+RWVQ   M+YNYC D KRFP+G   EC +RSRF
Sbjct  237   DGAWQSQELDAHSRRRLRWVQKNFMIYNYCTDLKRFPEGLPKECQRRSRF  286



>ref|XP_011044000.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Populus euphratica]
Length=289

 Score =   346 bits (887),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/265 (60%), Positives = 202/265 (76%), Gaps = 2/265 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF ND  + +G+    +  NG  + LNLD+ +GSGF ++ EYLFG+ DMQ+KLV G SAG
Sbjct  26    NFYNDFDITWGDGRANILSNGELLTLNLDKASGSGFQSRKEYLFGKIDMQLKLVPGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G A DE+DFEFLGN +  PY +HTNV+SQGKGN+EQQF+LWFDPTA FH
Sbjct  86    TVTAYYLSSK-GSAWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRI+F VD  PIR F N ES+G+PFPK+QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  145   TYSILWNPQRIVFSVDGTPIREFKNLESMGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  204

Query  779   DWSHAPFTAYYRNFNANACVVTNGVss-cnsiaaasnsnQEWLTQELDGKGRNRVRWVQS  955
             DW+ APFTA YRNFNA ACV++NG SS   + +  ++++  W ++ELD   + R++WV+ 
Sbjct  205   DWALAPFTASYRNFNAEACVLSNGASSCGTTTSPPASTSNAWFSEELDSTRQERLKWVRE  264

Query  956   KHMVYNYCADAKRFPQGFSAECKRS  1030
              +MVYNYC D  RFPQG   EC  S
Sbjct  265   NYMVYNYCKDVNRFPQGLPPECGMS  289



>ref|XP_002324481.2| xyloglucan endo-1 family protein [Populus trichocarpa]
 gb|EEF03046.2| xyloglucan endo-1 family protein [Populus trichocarpa]
Length=286

 Score =   345 bits (886),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/265 (60%), Positives = 202/265 (76%), Gaps = 2/265 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF ND  + +G+   ++  NG  + LNLD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  23    NFYNDFDITWGDGRAKILSNGELLTLNLDKASGSGFQSRNEYLFGKIDMQLKLVPGNSAG  82

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G A DE+DFEFLGN +  PY +HTNV+SQGKGN+EQQF+LWFDPTA FH
Sbjct  83    TVTAYYLSSK-GSAWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFH  141

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRI+F VD  PIR F N ES+G+PFPK+QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  142   TYSILWNPQRIVFSVDGTPIREFKNLESMGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  201

Query  779   DWSHAPFTAYYRNFNANACVVTNGVss-cnsiaaasnsnQEWLTQELDGKGRNRVRWVQS  955
             DW+ APFTA YRNFNA ACV++NG SS   + +  + ++  W ++ELD   + R++W + 
Sbjct  202   DWALAPFTASYRNFNAEACVLSNGASSCGTTTSPPAPTSNAWFSEELDSTRQERLKWARE  261

Query  956   KHMVYNYCADAKRFPQGFSAECKRS  1030
              +MVYNYC D  RFPQG   EC  S
Sbjct  262   NYMVYNYCKDINRFPQGLPPECSMS  286



>gb|AGI42461.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   345 bits (886),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/261 (62%), Positives = 203/261 (78%), Gaps = 4/261 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF+ND  + +G+  G++ +NG  + L LD+ +GSGF ++NEYLFG+ DMQ+KLV G SAG
Sbjct  26    NFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFL N +  PYT+HTNV+SQGKG +EQQFHLWFDPTA FH
Sbjct  86    TVTAYYLSSQ-GPTHDEIDFEFLENLSGDPYTLHTNVFSQGKGGREQQFHLWFDPTADFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VDN PIR F N ES+G+ +PK+Q MR+Y SLWNADDWAT+GGL+KT
Sbjct  145   TYSILWNPQRIIFSVDNTPIREFKNAESVGVAYPKNQAMRIYSSLWNADDWATRGGLIKT  204

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DWS APFTA YRNFNA AC+ ++G    +S  + + SN  WL +ELD   + R++WVQ  
Sbjct  205   DWSKAPFTASYRNFNAKACIWSSG---RSSCNSNAPSNNAWLNEELDATSQQRLQWVQEN  261

Query  959   HMVYNYCADAKRFPQGFSAEC  1021
             +M+YNYC DAKRFPQG+  EC
Sbjct  262   YMIYNYCTDAKRFPQGYPPEC  282



>ref|XP_010046996.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Eucalyptus grandis]
Length=291

 Score =   346 bits (887),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 162/264 (61%), Positives = 204/264 (77%), Gaps = 1/264 (0%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + +G+   Q+ +NG+ + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  29    NFYQDFDITWGDGRAQILNNGDLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSAG  88

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G   DE+DFEFLGN +  PY +HTNV+SQGKGN+EQQF+LWFDPTA FH
Sbjct  89    TVTAYYLSSN-GSTWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFH  147

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VD  PIR F N ES+G+PFPK+QPMR++ SLWNADDWAT+GGLVKT
Sbjct  148   TYSILWNPQRIIFSVDGTPIREFKNAESVGVPFPKAQPMRIFSSLWNADDWATRGGLVKT  207

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DW+ APFTA YRNFNA+   V +  SS  + +++S+    WL +ELD   + R++WVQS 
Sbjct  208   DWTQAPFTASYRNFNADNACVWSSGSSSCTSSSSSSDGNAWLAEELDSTSQERLKWVQSN  267

Query  959   HMVYNYCADAKRFPQGFSAECKRS  1030
             +M+YNYC DAKRFPQGF  EC  S
Sbjct  268   YMIYNYCTDAKRFPQGFPPECSMS  291



>ref|XP_009356706.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like [Pyrus x bretschneideri]
Length=292

 Score =   345 bits (886),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 167/292 (57%), Positives = 210/292 (72%), Gaps = 5/292 (2%)
 Frame = +2

Query  158   QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
             +V M+  +  +  SLV +  +      NF  D ++ FG+   +V +NG  + L LD+ +G
Sbjct  5     KVSMLFFLCSITISLVAIVASAG----NFYQDYEVMFGDQHAKVLENGQIITLALDKSSG  60

Query  338   SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
             +GF +KN YLFGRFDMQ+KL  G SAGTVTTFYL+S  G  HDE+DFEFLGN+T +PYT+
Sbjct  61    AGFKSKNAYLFGRFDMQIKLQPGNSAGTVTTFYLSSS-GANHDEIDFEFLGNSTGEPYTI  119

Query  518   HTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPF  697
             HTNVY+QG+G KEQQFHLWFDPT  FHTY+I+WN +RIIF+VD++PIRVFNN ESIG+PF
Sbjct  120   HTNVYAQGQGLKEQQFHLWFDPTQDFHTYSIVWNTKRIIFLVDDSPIRVFNNLESIGLPF  179

Query  698   PKSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaa  877
             PK+Q M +Y + WNADDWATQGG VKTDWS APFTA YRNF  NAC+ + G S  ++   
Sbjct  180   PKNQSMGIYATFWNADDWATQGGRVKTDWSLAPFTASYRNFKINACLGSQGPSCASTSTE  239

Query  878   asnsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSR  1033
              S     W  Q L+   RNR+RWVQSK MVY+YC D  +F +G   ECK SR
Sbjct  240   RSPVGSSWKNQGLNAAERNRLRWVQSKFMVYDYCTDRIKFNKGLPRECKHSR  291



>ref|XP_010053241.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Eucalyptus 
grandis]
Length=287

 Score =   345 bits (886),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 166/265 (63%), Positives = 199/265 (75%), Gaps = 4/265 (2%)
 Frame = +2

Query  242   FNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGT  421
             F  D  + +G    ++   G  + L+LD+ +GSGF +KNEYLFGR D+Q+KLV G SAGT
Sbjct  24    FYRDFDLTWGGERAKISQGGQLLTLSLDKYSGSGFQSKNEYLFGRIDLQLKLVPGNSAGT  83

Query  422   VTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHT  601
             VTT+YL+S  G AHDE+DFEFLGN +  PYTVHTNV++QGKGN+EQQF+LWFDPT AFHT
Sbjct  84    VTTYYLSSQ-GPAHDEIDFEFLGNLSGNPYTVHTNVFTQGKGNREQQFYLWFDPTKAFHT  142

Query  602   YTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKTD  781
             Y+ILWNPQRI+F+VDN PIR F N ES+G+PFP  Q MR+Y SLWNADDWAT GG VKTD
Sbjct  143   YSILWNPQRILFLVDNVPIREFVNKESMGVPFPNKQAMRIYSSLWNADDWATMGGRVKTD  202

Query  782   WSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQE---WLTQELDGKGRNRVRWVQ  952
             W+ APFTA YRNFNANAC  + G SSC S    S++      W TQ LD  GR R++WVQ
Sbjct  203   WTQAPFTASYRNFNANACAWSAGKSSCASTTTTSSTTSSSDVWRTQALDANGRQRLKWVQ  262

Query  953   SKHMVYNYCADAKRFPQGFSAECKR  1027
              K M+YNYC D KRFPQG   ECK+
Sbjct  263   KKFMIYNYCTDLKRFPQGLPPECKK  287



>ref|XP_010545425.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Tarenaya hassleriana]
Length=290

 Score =   345 bits (886),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 164/284 (58%), Positives = 210/284 (74%), Gaps = 12/284 (4%)
 Frame = +2

Query  170   IMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFN  349
             +++ GV+  S+V           NF  +V++ +G+  GQ+++NG+ + L+LD+ +GSGF 
Sbjct  16    LLLAGVLLPSVVA----------NFYQNVEITWGDGRGQIKNNGDLLTLSLDKPSGSGFQ  65

Query  350   TKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNV  529
             +KNEYL+G+ DMQ+KLV G SAGTVT +YL SP G   DE+DFEFLGN +  PYT+HTNV
Sbjct  66    SKNEYLYGKIDMQLKLVAGNSAGTVTAYYLKSP-GTTWDEIDFEFLGNLSGDPYTLHTNV  124

Query  530   YSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQ  709
             ++QGKGN+EQQF LWFDPTA FH+Y+ILWNPQRIIF VD  PIR F N ES G+ FPK+Q
Sbjct  125   FTQGKGNREQQFKLWFDPTADFHSYSILWNPQRIIFSVDGTPIREFKNMESQGVLFPKNQ  184

Query  710   PMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasns  889
             PMR+Y SLWNADDWAT+GGLVKTDWS APFTA YRNF  +ACV +NG  S     ++  +
Sbjct  185   PMRMYSSLWNADDWATRGGLVKTDWSQAPFTASYRNFKEDACVWSNG-KSSCPNGSSQGT  243

Query  890   nQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAEC  1021
             +  WL+QELD   + R+RWVQ  +M+YNYC D  RFPQG   EC
Sbjct  244   SGSWLSQELDTTSQERMRWVQKSYMIYNYCTDTNRFPQGLPKEC  287



>ref|NP_001237075.1| syringolide-induced protein 19-1-5 precursor [Glycine max]
 dbj|BAB86890.1| syringolide-induced protein 19-1-5 [Glycine max]
 gb|KHN17580.1| Putative xyloglucan endotransglucosylase/hydrolase protein 23 
[Glycine soja]
Length=285

 Score =   345 bits (885),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 161/261 (62%), Positives = 207/261 (79%), Gaps = 1/261 (0%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF+ D  + +G+   ++ +NG  + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  23    NFHQDFDITWGDGRAKILNNGELLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSAG  82

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G   DE+DFEFLGN +  PY +HTNV+SQGKGN+EQQF+LWFDPTA FH
Sbjct  83    TVTAYYLSSK-GATWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFH  141

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRI+F VD +PIR F N ES G+PFPK+Q MR+Y SLWNADDWAT+GGLVKT
Sbjct  142   TYSILWNPQRIVFSVDGSPIREFKNMESKGVPFPKNQAMRIYSSLWNADDWATRGGLVKT  201

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DW+ APFTA YRNFNANAC +++G SSC S   +S++N  WL++ELD   + R++WVQ  
Sbjct  202   DWTQAPFTASYRNFNANACTMSSGTSSCGSNNPSSSNNNVWLSEELDSTDQERLKWVQKN  261

Query  959   HMVYNYCADAKRFPQGFSAEC  1021
             +M+YNYC+D +RFPQG  +EC
Sbjct  262   YMIYNYCSDTQRFPQGLPSEC  282



>gb|ABM91071.1| xyloglucan endotransglycosylase/hydrolase precursor XTH-14 [Populus 
tremula x Populus tremuloides]
Length=284

 Score =   345 bits (885),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 167/287 (58%), Positives = 209/287 (73%), Gaps = 7/287 (2%)
 Frame = +2

Query  164   CMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSG  343
             C    + V+ CS+            NF+ D  + +G+   ++ + G  ++L+LD+ +GSG
Sbjct  5     CNGFSLFVMVCSMA------VVASGNFHQDFDLTWGDRRAKIFNGGQLLSLSLDKVSGSG  58

Query  344   FNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHT  523
             F +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +HT
Sbjct  59    FQSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILHT  117

Query  524   NVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPK  703
             NV++QGKGN+EQQF+LWFDPT  FHTY+I+WNPQ IIF+VD+ PIRVF N ESIG+PFPK
Sbjct  118   NVFTQGKGNREQQFYLWFDPTRNFHTYSIIWNPQHIIFLVDSVPIRVFKNAESIGVPFPK  177

Query  704   SQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaas  883
             SQPMR+Y SLWNADDWAT+GGLVKTDW+ APF AYYRNF ANAC  + G SSC S  +++
Sbjct  178   SQPMRIYSSLWNADDWATRGGLVKTDWTKAPFNAYYRNFKANACTWSYGASSCGSKPSSA  237

Query  884   nsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECK  1024
              S+  W T ELD   R R+RWVQ   M+YNYC D +RFPQG   ECK
Sbjct  238   FSDGAWKTNELDAPSRRRLRWVQKYFMIYNYCTDLRRFPQGPPPECK  284



>dbj|BAJ10395.1| xyloglucan endotransglucosylase/hydrolase [Dianthus caryophyllus]
 gb|AHN05516.1| xyloglucan endotransglucosyase/hydrolase [Dianthus caryophyllus]
Length=289

 Score =   345 bits (885),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 162/261 (62%), Positives = 200/261 (77%), Gaps = 1/261 (0%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF +D  + FG+   +V +NG  + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  26    NFYSDFDITFGDGRARVLNNGEDLTLSLDKYSGSGFRSKNEYLFGKIDMQIKLVPGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             +VTT+YL+S +G AHDE+DFEFLGN T +PYT+HTNV++QGKGN+EQQFHLWFDPT  FH
Sbjct  86    SVTTYYLSS-LGSAHDEIDFEFLGNVTGEPYTLHTNVFAQGKGNREQQFHLWFDPTTEFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRI+F VD  PIR F N ES G+ FPK+QPMRVY SLWNADDWATQGG VK 
Sbjct  145   TYSILWNPQRIVFSVDGIPIREFKNMESKGVSFPKNQPMRVYSSLWNADDWATQGGRVKA  204

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DW+ APF A ++ +NA+ACV T+  SS     + S S   WLT+ELD     R++WVQ  
Sbjct  205   DWTQAPFVASFKKYNADACVWTSSGSSSCGSGSTSVSRSNWLTEELDSTRLERMKWVQKN  264

Query  959   HMVYNYCADAKRFPQGFSAEC  1021
             +MVYNYCAD +RFPQG   EC
Sbjct  265   YMVYNYCADVQRFPQGLPTEC  285



>emb|CDY61576.1| BnaCnng38050D [Brassica napus]
Length=280

 Score =   345 bits (884),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 158/265 (60%), Positives = 196/265 (74%), Gaps = 11/265 (4%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             +FN +  + +G H G++   G  ++L+LD+ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  26    SFNEEFDLTWGEHRGKIFSGGKMLSLSLDRVSGSGFKSKKEYLFGRIDMQLKLVAGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN T +PY +HTNV++QGKGN+EQQF+LWFDPT  FH
Sbjct  86    TVTAYYLSSE-GPTHDEIDFEFLGNETGKPYVLHTNVFAQGKGNREQQFYLWFDPTKNFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+++W PQ IIFMVDN PIRVFNN E +G+PFPK QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  145   TYSLVWRPQHIIFMVDNVPIRVFNNAEQLGVPFPKKQPMRIYSSLWNADDWATRGGLVKT  204

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DWS APF AYYR FNA AC   +               +  +  EL+  GR R+RWVQ  
Sbjct  205   DWSKAPFIAYYRGFNAAACTFRS----------TFADGESQVPNELNAYGRRRLRWVQKY  254

Query  959   HMVYNYCADAKRFPQGFSAECKRSR  1033
              M+Y+YC+D KRFPQGF  EC+RSR
Sbjct  255   FMIYDYCSDLKRFPQGFPPECRRSR  279



>gb|KHN22714.1| Putative xyloglucan endotransglucosylase/hydrolase protein 23 
[Glycine soja]
Length=287

 Score =   345 bits (885),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 162/264 (61%), Positives = 199/264 (75%), Gaps = 4/264 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NFN D Q+ +G+   ++ +N N + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  28    NFNQDFQITWGDGRAKILNNANLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSAG  87

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G   DE+DFEFLGN +  PY +HTNV+SQGKGN+EQQF+LWFDPTA FH
Sbjct  88    TVTAYYLSSK-GSTWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFH  146

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRI+F VD  PIR F N ESIG+PFPK QPMR+Y SLWNADDWAT+GG +KT
Sbjct  147   TYSILWNPQRIVFSVDGTPIREFKNLESIGVPFPKRQPMRIYSSLWNADDWATRGGRIKT  206

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DWS APFTA YRNFNANACV   G    ++  + S S+  WL+QELD   + R+ WVQ  
Sbjct  207   DWSKAPFTASYRNFNANACVWNRG---KSTCKSNSPSSNAWLSQELDSTAQQRLSWVQKN  263

Query  959   HMVYNYCADAKRFPQGFSAECKRS  1030
             +M+YNYC+D  RF QG   EC  S
Sbjct  264   YMIYNYCSDKNRFAQGLPLECTHS  287



>ref|XP_009378317.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Pyrus x bretschneideri]
Length=292

 Score =   345 bits (885),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 166/292 (57%), Positives = 211/292 (72%), Gaps = 5/292 (2%)
 Frame = +2

Query  158   QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
             +V M   + ++  S+     AV     NF  D ++ FG+   +V +NG  + L+LD+ +G
Sbjct  5     KVSMTFFLSLITISV----GAVVASADNFYQDFEVMFGDQHAKVLENGQVVTLSLDKSSG  60

Query  338   SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
             +GF +KNEYLFGRFDMQ+KL  G SAGTVTTFYL+S  G  HDE+DFEFLGN+T +PYT+
Sbjct  61    AGFKSKNEYLFGRFDMQIKLQPGNSAGTVTTFYLSSS-GSNHDEIDFEFLGNSTGEPYTI  119

Query  518   HTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPF  697
             HTNVY+QG+G KEQQF +WFDPT  FHTY+++WN +RIIF+VDN+PIRVFNN ESIG+PF
Sbjct  120   HTNVYAQGQGLKEQQFRVWFDPTQDFHTYSVVWNTKRIIFLVDNSPIRVFNNLESIGLPF  179

Query  698   PKSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaa  877
             PK+Q MR+Y + WNADDWATQGG VKTDW+ APFTA YRNFN NAC+ + G S  ++   
Sbjct  180   PKNQLMRIYATFWNADDWATQGGRVKTDWNLAPFTASYRNFNINACLGSQGPSCASTSTN  239

Query  878   asnsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSR  1033
              S     W  Q L+   RNR+RWVQ K MVY+YC D  +F +G   ECK SR
Sbjct  240   RSADGASWANQGLNAAERNRLRWVQRKFMVYDYCTDRIKFTKGLPRECKHSR  291



>ref|XP_010259807.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Nelumbo nucifera]
Length=301

 Score =   345 bits (885),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 165/289 (57%), Positives = 214/289 (74%), Gaps = 4/289 (1%)
 Frame = +2

Query  173   MIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNT  352
             + +  ++C LV  +LA+     NF  D  + +G+   ++ +NG  + L+LD+ +GSGF +
Sbjct  11    LSLKFLSCLLVLGSLAIVASASNFYQDFDVSWGDGRAKILNNGELLTLSLDKASGSGFQS  70

Query  353   KNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVY  532
             K+EYLFG+ D+Q+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +HTNV+
Sbjct  71    KHEYLFGKIDIQLKLVPGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILHTNVF  129

Query  533   SQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQP  712
             SQGKGN+EQQF+LWFDPTA FHTY+ILWNPQRIIF VD  PIR F N ESIG+PFPK+QP
Sbjct  130   SQGKGNREQQFYLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNSESIGVPFPKNQP  189

Query  713   MRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNA-NACV--VTNGVsscnsiaaas  883
             MR+Y SLWNADDWAT+GGLVKTDW+ APFTA YRNFNA NAC+    +      S  + +
Sbjct  190   MRIYSSLWNADDWATRGGLVKTDWTKAPFTASYRNFNANNACIWSSGSSSCDSKSPTSTT  249

Query  884   nsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRS  1030
             N+  +WL+QELD  G+ +++WVQ  +M+YNYC D KRFPQG   EC  +
Sbjct  250   NNPHQWLSQELDSAGQEKMKWVQKNYMIYNYCTDTKRFPQGLPPECSNT  298



>ref|XP_008362366.1| PREDICTED: LOW QUALITY PROTEIN: xyloglucan endotransglucosylase/hydrolase 
protein 22-like [Malus domestica]
Length=292

 Score =   345 bits (884),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 165/292 (57%), Positives = 211/292 (72%), Gaps = 5/292 (2%)
 Frame = +2

Query  158   QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
             +V M+  + ++  SLV V  +      NF  D ++ FG+ L +V +NG  + L+LD+ +G
Sbjct  5     KVSMMFFLSLITISLVAVVASAD----NFYQDFEVMFGDQLAKVLENGQLVTLSLDKSSG  60

Query  338   SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
             +GF +KNEYLFGRFDMQ+KL  G SAGTVTTF L+S  G  HDE+DFEFLGN+T +PYT+
Sbjct  61    AGFKSKNEYLFGRFDMQIKLQPGNSAGTVTTFCLSSS-GSNHDEIDFEFLGNSTGEPYTI  119

Query  518   HTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPF  697
             HTNVY+QG+G KEQQF +WFDPT  FHTY+++WN +RIIF+VDN+PIRVFNN ESIG+PF
Sbjct  120   HTNVYAQGQGLKEQQFRVWFDPTQDFHTYSVVWNTKRIIFLVDNSPIRVFNNLESIGLPF  179

Query  698   PKSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaa  877
             PK+QPMR+Y + WNAD WATQGG V+TDWS APFTA YRN N NAC+ + G S  ++   
Sbjct  180   PKNQPMRIYATFWNADHWATQGGHVRTDWSLAPFTASYRNLNINACLGSQGPSCASTSTN  239

Query  878   asnsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSR  1033
              S     W  Q L+    NR+RWVQ K MVY+YC D  +F +G   ECK SR
Sbjct  240   RSADGASWANQGLNAAEXNRLRWVQHKFMVYDYCTDRIKFTKGLPRECKHSR  291



>ref|XP_010670334.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Beta vulgaris subsp. vulgaris]
Length=284

 Score =   344 bits (883),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 161/262 (61%), Positives = 200/262 (76%), Gaps = 2/262 (1%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + +G+  G++ +NG  + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  23    NFYKDFDITWGDGRGKIINNGQLLTLSLDKTSGSGFQSKNEYLFGKIDMQLKLVGGNSAG  82

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G +HDE+DFEFLGN + QPYT+HTNV+SQGKG +EQQF LWFDPT  FH
Sbjct  83    TVTAYYLSSQ-GASHDEIDFEFLGNVSGQPYTLHTNVFSQGKGGREQQFRLWFDPTTDFH  141

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VD  PIR F N ES+G+PFPK+QPMR+Y SLWNADDWATQGG VKT
Sbjct  142   TYSILWNPQRIIFSVDGTPIREFKNSESMGMPFPKNQPMRIYSSLWNADDWATQGGRVKT  201

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DWS APFTA YRNFNANACV +    S    ++ ++    W TQE+D   + R++WVQ  
Sbjct  202   DWSKAPFTASYRNFNANACVWSK-GKSSCKSSSVASKINPWFTQEMDSTSQARMKWVQKN  260

Query  959   HMVYNYCADAKRFPQGFSAECK  1024
             +M+YNYC D +RFPQG   EC+
Sbjct  261   YMIYNYCTDRQRFPQGLPKECR  282



>ref|NP_001242530.1| uncharacterized protein LOC100785313 precursor [Glycine max]
 gb|ACU21249.1| unknown [Glycine max]
Length=287

 Score =   344 bits (883),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 162/264 (61%), Positives = 199/264 (75%), Gaps = 4/264 (2%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NFN D Q+ +G+   ++ +N N + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  28    NFNQDFQITWGDGRAKILNNANLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSAG  87

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G   DE+DFEFLGN +  PY +HTNV+SQGKGN+EQQF+LWFDPTA FH
Sbjct  88    TVTAYYLSSK-GSTWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFH  146

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRI+F VD  PIR F N ESIG+PFPK QPMR+Y SLWNADDWAT+GG +KT
Sbjct  147   TYSILWNPQRIVFSVDGTPIREFKNLESIGVPFPKRQPMRIYSSLWNADDWATRGGRIKT  206

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DWS APFTA YRNFNANACV   G    ++  + S S+  WL+QELD   + R+ WVQ  
Sbjct  207   DWSKAPFTASYRNFNANACVWNRG---KSTCKSNSPSSNAWLSQELDSTAQQRLSWVQKN  263

Query  959   HMVYNYCADAKRFPQGFSAECKRS  1030
             +M+YNYC+D  RF QG   EC  S
Sbjct  264   YMIYNYCSDKNRFAQGLPLECTHS  287



>ref|XP_006387118.1| hypothetical protein POPTR_1795s00200g, partial [Populus trichocarpa]
 gb|ERP46032.1| hypothetical protein POPTR_1795s00200g, partial [Populus trichocarpa]
Length=214

 Score =   342 bits (876),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 161/232 (69%), Positives = 182/232 (78%), Gaps = 19/232 (8%)
 Frame = +2

Query  341   GFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVH  520
             GF +KNEYLFGR DMQ+KLV G SAGTVTT+YL+S  G  HDE+DFEFLGN T +PYT+H
Sbjct  1     GFRSKNEYLFGRIDMQIKLVSGNSAGTVTTYYLSSQ-GPTHDEIDFEFLGNVTGEPYTLH  59

Query  521   TNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP  700
             TNV+SQGKGNKEQQF+LWFDPT AFHTY+I+WN QRIIF+VDN PIRVF+N ESIG+PFP
Sbjct  60    TNVFSQGKGNKEQQFYLWFDPTKAFHTYSIVWNQQRIIFLVDNIPIRVFHNSESIGVPFP  119

Query  701   KSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaa  880
               QPMR+Y SLWNADDWAT+GGLVKTDW+ APFTA YRNF A+AC  T            
Sbjct  120   TKQPMRIYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFKASACDST------------  167

Query  881   snsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRSRF  1036
                   W  Q LD  GRNR+RWVQ K+M+YNYC D KRFPQG  AECKRSRF
Sbjct  168   ------WQVQALDASGRNRLRWVQQKYMIYNYCTDLKRFPQGIPAECKRSRF  213



>ref|XP_009373581.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Pyrus 
x bretschneideri]
Length=275

 Score =   344 bits (882),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 159/289 (55%), Positives = 202/289 (70%), Gaps = 19/289 (7%)
 Frame = +2

Query  164   CMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSG  343
              +++++G+V  SL+     +     NF  D  + +G H  ++   G  ++L+LD+ +GSG
Sbjct  5     SLVLLVGLVCSSLM-----IATYAGNFYQDFDLTWGGHRPKIFKGGQLLSLSLDKVSGSG  59

Query  344   FNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHT  523
             F +K EYLFGR DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +HT
Sbjct  60    FQSKKEYLFGRIDMQLKLVPGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNVSGDPYILHT  118

Query  524   NVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPK  703
             N+++QGKGN+EQQF+LWFDP+  FHTY+++W PQ IIF+VD  PIRVF N E++G+PFPK
Sbjct  119   NIFTQGKGNREQQFYLWFDPSKNFHTYSVIWKPQHIIFLVDKTPIRVFKNAEAVGVPFPK  178

Query  704   SQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaas  883
             SQPMR+Y SLWNADDWAT+GGLVKTDWS APFTAYYRNFN      +N            
Sbjct  179   SQPMRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRNFNVIDSRSSNSF----------  228

Query  884   nsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKRS  1030
                 EW T ELD   R R+RWVQ   M+YNYC D KRFPQG   EC+RS
Sbjct  229   ---SEWQTNELDAPSRRRLRWVQKYFMIYNYCTDLKRFPQGAPPECRRS  274



>ref|XP_010046998.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Eucalyptus grandis]
Length=291

 Score =   345 bits (884),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 162/264 (61%), Positives = 204/264 (77%), Gaps = 1/264 (0%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + +G+  GQ+ +NG+ + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  29    NFYQDFDITWGDGRGQILNNGDLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSAG  88

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G   DE+DFEFLGN +  PY +HTNV+SQGKGN+EQQF+LWFDPTA FH
Sbjct  89    TVTAYYLSSN-GSTWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFH  147

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VD  PIR F N ESIG+PFPK+QPMR++ SLWNADDWAT+GGLVKT
Sbjct  148   TYSILWNPQRIIFSVDGTPIREFKNAESIGVPFPKAQPMRIFSSLWNADDWATRGGLVKT  207

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DW+ APFTA Y NFNA+   V +  SS  + +++S+    WL++ELD   +  ++WVQS 
Sbjct  208   DWTQAPFTASYSNFNADNACVWSSGSSSCTSSSSSSDGNAWLSEELDSTSQESLKWVQSN  267

Query  959   HMVYNYCADAKRFPQGFSAECKRS  1030
             +M+YNYC DAKRFPQGF  EC  S
Sbjct  268   YMIYNYCTDAKRFPQGFPPECSMS  291



>ref|XP_002267890.2| PREDICTED: brassinosteroid-regulated protein BRU1-like [Vitis 
vinifera]
Length=281

 Score =   344 bits (883),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 160/266 (60%), Positives = 198/266 (74%), Gaps = 12/266 (5%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + +G++  ++ + G  ++L+LDQ +GSGF +K EYLFGR DMQ+KLV G SAG
Sbjct  26    NFYQDFDLTWGDNRAKIFNGGQLLSLSLDQASGSGFQSKKEYLFGRIDMQLKLVAGNSAG  85

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G  HDE+DFEFLGN +  PY +HTNV++QGKGN+EQQF+LWFDPT  FH
Sbjct  86    TVTAYYLSSQ-GSTHDEIDFEFLGNLSGDPYILHTNVFTQGKGNREQQFYLWFDPTRNFH  144

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+I+W  + IIF+VDN PIR+F N ES+G+PFPK+QPMR+Y SLWNADDWAT+GGLVKT
Sbjct  145   TYSIIWTARHIIFLVDNVPIRLFKNAESMGVPFPKNQPMRIYSSLWNADDWATRGGLVKT  204

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DWS APFTAYYRNF AN+   T+              +  + TQELD   R R+RWVQ  
Sbjct  205   DWSKAPFTAYYRNFRANSSTPTSSF-----------PDSTFQTQELDSYSRRRLRWVQKN  253

Query  959   HMVYNYCADAKRFPQGFSAECKRSRF  1036
              M+YNYC D KRFPQG  AECKRSRF
Sbjct  254   FMIYNYCTDLKRFPQGVPAECKRSRF  279



>ref|XP_003610142.1| Xyloglucan endotransglucosylase/hydrolase [Medicago truncatula]
 gb|AES92339.1| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
Length=283

 Score =   344 bits (883),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 161/286 (56%), Positives = 212/286 (74%), Gaps = 14/286 (5%)
 Frame = +2

Query  167   MIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGF  346
             +++ I  VA +  G          NF  D  + +G+   ++ ++G  + L+LD+ +GSGF
Sbjct  10    LVIFISTVAIASAG----------NFYQDFDITWGDGRAKILNSGQLLTLSLDKSSGSGF  59

Query  347   NTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTN  526
              +KNEYLFG+ DMQ+KLV G SAGTVT +YL+S  G A DE+DFEFLGN +  PY +HTN
Sbjct  60    QSKNEYLFGKIDMQLKLVPGNSAGTVTAYYLSSK-GGAWDEIDFEFLGNLSGDPYILHTN  118

Query  527   VYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKS  706
             V+SQGKG++EQQ +LWFDPTA FHTY+ILWNPQRI+F VD  PIR F N ES G+PFPK+
Sbjct  119   VFSQGKGDREQQIYLWFDPTADFHTYSILWNPQRIVFSVDGTPIREFKNIESSGVPFPKN  178

Query  707   QPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasn  886
             QPMR+Y SLWNADDWAT+GGLVKTDWS APFTA YR+FNANAC+V++G+   +S  +A +
Sbjct  179   QPMRIYSSLWNADDWATRGGLVKTDWSKAPFTASYRHFNANACIVSSGI---SSCDSAQS  235

Query  887   snQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECK  1024
             +  +W ++ELD     R++WVQ  +M+YNYC+D KRFPQG   EC+
Sbjct  236   NKNDWFSEELDSTSYERLKWVQKNYMIYNYCSDNKRFPQGLPQECR  281



>ref|XP_009139558.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Brassica rapa]
 emb|CDX89393.1| BnaA01g15000D [Brassica napus]
Length=287

 Score =   344 bits (883),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 166/261 (64%), Positives = 206/261 (79%), Gaps = 1/261 (0%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF+ DV++ +G+  GQ+ +NG+ + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  25    NFHQDVEITWGDGRGQITNNGDLLTLSLDKSSGSGFQSKNEYLFGKIDMQIKLVAGNSAG  84

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL S  G   DE+DFEFLGN +  PYT+HTNV++QGKG++EQQF LWFDPT  FH
Sbjct  85    TVTAYYLKSS-GSTWDEIDFEFLGNLSGDPYTLHTNVFTQGKGDREQQFKLWFDPTIDFH  143

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VD  PIR F N ES G  FPK+QPMR+Y SLWNA+DWAT+GGLVKT
Sbjct  144   TYSILWNPQRIIFSVDGTPIREFKNMESQGTLFPKNQPMRMYSSLWNAEDWATRGGLVKT  203

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DWS APFTA YR F+  ACVV+NG SSC++ +   +S+  WL+QELD  G+ R+RWVQS 
Sbjct  204   DWSKAPFTASYRGFSEEACVVSNGKSSCSNGSGQGSSSGSWLSQELDSTGQERMRWVQSN  263

Query  959   HMVYNYCADAKRFPQGFSAEC  1021
             +M+YNYC DAKRFPQG   EC
Sbjct  264   YMIYNYCTDAKRFPQGLPREC  284



>gb|KCW89704.1| hypothetical protein EUGRSUZ_A01966 [Eucalyptus grandis]
Length=277

 Score =   344 bits (882),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 166/265 (63%), Positives = 199/265 (75%), Gaps = 4/265 (2%)
 Frame = +2

Query  242   FNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAGT  421
             F  D  + +G    ++   G  + L+LD+ +GSGF +KNEYLFGR D+Q+KLV G SAGT
Sbjct  14    FYRDFDLTWGGERAKISQGGQLLTLSLDKYSGSGFQSKNEYLFGRIDLQLKLVPGNSAGT  73

Query  422   VTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFHT  601
             VTT+YL+S  G AHDE+DFEFLGN +  PYTVHTNV++QGKGN+EQQF+LWFDPT AFHT
Sbjct  74    VTTYYLSSQ-GPAHDEIDFEFLGNLSGNPYTVHTNVFTQGKGNREQQFYLWFDPTKAFHT  132

Query  602   YTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKTD  781
             Y+ILWNPQRI+F+VDN PIR F N ES+G+PFP  Q MR+Y SLWNADDWAT GG VKTD
Sbjct  133   YSILWNPQRILFLVDNVPIREFVNKESMGVPFPNKQAMRIYSSLWNADDWATMGGRVKTD  192

Query  782   WSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQE---WLTQELDGKGRNRVRWVQ  952
             W+ APFTA YRNFNANAC  + G SSC S    S++      W TQ LD  GR R++WVQ
Sbjct  193   WTQAPFTASYRNFNANACAWSAGKSSCASTTTTSSTTSSSDVWRTQALDANGRQRLKWVQ  252

Query  953   SKHMVYNYCADAKRFPQGFSAECKR  1027
              K M+YNYC D KRFPQG   ECK+
Sbjct  253   KKFMIYNYCTDLKRFPQGLPPECKK  277



>ref|XP_004293370.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 25-like [Fragaria vesca subsp. vesca]
Length=291

 Score =   344 bits (883),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 166/290 (57%), Positives = 211/290 (73%), Gaps = 9/290 (3%)
 Frame = +2

Query  158   QVCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTG  337
             + C++  I      L+G  +AV     NFN D ++ +G+   ++ +N   + L LD+ +G
Sbjct  4     RYCLVFSIAF----LIGSLMAVISSASNFNQDFEITWGDGRAKILNNNELLVLFLDRISG  59

Query  338   SGFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTV  517
             SGF +K EYLFG+ DMQ+KLV G SAGTVT +YL+S  G A DE+DFEFLGN +  PYT+
Sbjct  60    SGFQSKYEYLFGKIDMQLKLVPGNSAGTVTAYYLSSK-GSAWDEIDFEFLGNLSGDPYTI  118

Query  518   HTNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPF  697
             HTNVYSQGKG++EQQFHLWFDPT  FHTY+ILWNP+ I+F VD  PIR F N ESIG+PF
Sbjct  119   HTNVYSQGKGDREQQFHLWFDPTTDFHTYSILWNPRSIVFYVDGTPIREFKNLESIGVPF  178

Query  698   PKSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaa  877
             PK QPMR++ SLW+ADDWAT+GGLVKTDW+ APF A YRNFNANAC+ ++G SSC S + 
Sbjct  179   PKDQPMRLHSSLWSADDWATRGGLVKTDWTKAPFIASYRNFNANACIWSSGTSSCTSPST  238

Query  878   asnsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAECKR  1027
                   EWL+QE+D   + +++ VQ K M+YNYC D KRFPQGF  EC R
Sbjct  239   KG----EWLSQEMDLASKQKLKMVQEKFMIYNYCTDTKRFPQGFPKECSR  284



>ref|XP_010046993.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Eucalyptus grandis]
 ref|XP_010046995.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Eucalyptus grandis]
 ref|XP_010046999.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Eucalyptus grandis]
 gb|KCW78736.1| hypothetical protein EUGRSUZ_C00180 [Eucalyptus grandis]
 gb|KCW78737.1| hypothetical protein EUGRSUZ_C00180 [Eucalyptus grandis]
 gb|KCW78738.1| hypothetical protein EUGRSUZ_C00181 [Eucalyptus grandis]
Length=291

 Score =   344 bits (883),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 161/264 (61%), Positives = 205/264 (78%), Gaps = 1/264 (0%)
 Frame = +2

Query  239   NFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKNEYLFGRFDMQMKLVKGFSAG  418
             NF  D  + +G+   Q+ ++G+ + L+LD+ +GSGF +KNEYLFG+ DMQ+KLV G SAG
Sbjct  29    NFYQDFDITWGDGRAQILNSGDLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSAG  88

Query  419   TVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQGKGNKEQQFHLWFDPTAAFH  598
             TVT +YL+S  G   DE+DFEFLGN +  PY +HTNV+SQGKGN+EQQF+LWFDPTA FH
Sbjct  89    TVTAYYLSSN-GSTWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTADFH  147

Query  599   TYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMRVYCSLWNADDWATQGGLVKT  778
             TY+ILWNPQRIIF VD  PIR F N ESIG+PFPK+QPMR++ SLWNADDWAT+GGLVKT
Sbjct  148   TYSILWNPQRIIFSVDGTPIREFKNAESIGVPFPKAQPMRIFSSLWNADDWATRGGLVKT  207

Query  779   DWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQEWLTQELDGKGRNRVRWVQSK  958
             DW+ APFTA YRNFNA+   V++  SS  + +++S+    WL++ELD   + R++WVQS 
Sbjct  208   DWTQAPFTASYRNFNADNACVSSSGSSSCTSSSSSSDGNAWLSEELDSTSQERLKWVQSN  267

Query  959   HMVYNYCADAKRFPQGFSAECKRS  1030
             +M+YNYC DAKRFPQG   EC  S
Sbjct  268   YMIYNYCTDAKRFPQGVPPECTMS  291



>ref|XP_010103020.1| Xyloglucan endotransglucosylase/hydrolase protein 22 [Morus notabilis]
 gb|EXB94587.1| Xyloglucan endotransglucosylase/hydrolase protein 22 [Morus notabilis]
Length=286

 Score =   344 bits (882),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 159/287 (55%), Positives = 214/287 (75%), Gaps = 7/287 (2%)
 Frame = +2

Query  161   VCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGS  340
             + +++++ ++ CS++ V         NF  D  + +G++ G++ +NG  + L+LD+ +GS
Sbjct  1     MMLLIVMPLLFCSILAVEAG------NFYQDFDISWGDNRGKILNNGELLTLSLDRTSGS  54

Query  341   GFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVH  520
             GF +KNEY++G+ DMQ+KLV G SAGTVT +YL+S  G   DE+DFEFLGN +  PYT+H
Sbjct  55    GFQSKNEYMYGKIDMQIKLVPGNSAGTVTAYYLSSE-GPTWDEIDFEFLGNLSGDPYTIH  113

Query  521   TNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP  700
             TNVY+QGKG++EQQFHLWFDP + FHTY+ILWNPQRIIF VD  PIR F N ESIGIPFP
Sbjct  114   TNVYTQGKGDREQQFHLWFDPASDFHTYSILWNPQRIIFYVDGTPIREFKNMESIGIPFP  173

Query  701   KSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaa  880
             K+QPMR+Y SLWNADDWAT+GGLVKTDWS+APFTA YRNF+A    V +   S    + +
Sbjct  174   KTQPMRIYSSLWNADDWATRGGLVKTDWSNAPFTASYRNFDAKTSCVWSAGKSSCGSSDS  233

Query  881   snsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAEC  1021
             ++ ++ WLT++LD   + R+RWVQ   M+Y+YC D+ RFPQGF  EC
Sbjct  234   NSKDRAWLTEDLDATSQERLRWVQRNFMIYDYCTDSNRFPQGFPREC  280



>ref|XP_002274601.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Vitis vinifera]
Length=297

 Score =   344 bits (883),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 162/288 (56%), Positives = 209/288 (73%), Gaps = 8/288 (3%)
 Frame = +2

Query  161   VCMIMIIGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGS  340
             V   ++I VV   L+  +        NF  D  + +G+   ++ DNG  + L+LD+ +GS
Sbjct  11    VSTALLISVVVSFLMAASAG------NFYQDFGITWGDGRAKILDNGEFLTLSLDKTSGS  64

Query  341   GFNTKNEYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVH  520
             GF +KNEYLFG+ DMQ+KLV G SAGTVT +YL+S  G  HDE+DFEFLGN +  PY +H
Sbjct  65    GFQSKNEYLFGKIDMQLKLVPGNSAGTVTAYYLSSQ-GPTHDEIDFEFLGNLSGDPYILH  123

Query  521   TNVYSQGKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFP  700
             TNV+SQGKGN+EQQF+LWFDPTA FHTY+ILWNPQRIIF VD  PIR F N ESIG+P+ 
Sbjct  124   TNVFSQGKGNREQQFYLWFDPTADFHTYSILWNPQRIIFSVDGTPIREFKNSESIGVPYL  183

Query  701   KSQPMRVYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACV-VTNGVsscnsiaa  877
             K+QPMR+Y SLWNADDWAT+GGL+KTDW+ APFTA YRNFNA+AC+  +   S  ++   
Sbjct  184   KNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNADACIWSSGASSCSSNTPT  243

Query  878   asnsnQEWLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAEC  1021
             + + + +W +QELD   + R++WVQ  +M+YNYC D KRFPQG   EC
Sbjct  244   SISPSTDWYSQELDSTSQERMKWVQKNYMIYNYCTDTKRFPQGLPPEC  291



>gb|KHN22712.1| Putative xyloglucan endotransglucosylase/hydrolase protein 23 
[Glycine soja]
Length=285

 Score =   344 bits (882),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/281 (57%), Positives = 211/281 (75%), Gaps = 4/281 (1%)
 Frame = +2

Query  179   IGVVACSLVGvalavpppplNFNNDVQMYFGNHLGQVQDNGNTMALNLDQQTGSGFNTKN  358
             + ++ C+++G  +       NF  D  + +G+   ++ +NG  + L+LD+ +GSGF +KN
Sbjct  6     VALLICTVIGYFVIASAG--NFYQDFDITWGDGRAKILNNGELLTLSLDKASGSGFQSKN  63

Query  359   EYLFGRFDMQMKLVKGFSAGTVTTFYLTSPIGQAHDEVDFEFLGNATFQPYTVHTNVYSQ  538
             EYLFG+ DMQ+KLV G SAGTVT +YL+S  G   DE+DFEFLGN + +PY +HTNV+SQ
Sbjct  64    EYLFGKIDMQLKLVPGNSAGTVTAYYLSSK-GATWDEIDFEFLGNLSGEPYILHTNVFSQ  122

Query  539   GKGNKEQQFHLWFDPTAAFHTYTILWNPQRIIFMVDNNPIRVFNNHESIGIPFPKSQPMR  718
             GKGN+EQQF+LWFDPTA FHTY+ILWNPQRI+F VD +PIR F N ES G+PFPK+Q MR
Sbjct  123   GKGNREQQFYLWFDPTADFHTYSILWNPQRIVFSVDGSPIREFKNMESKGVPFPKNQAMR  182

Query  719   VYCSLWNADDWATQGGLVKTDWSHAPFTAYYRNFNANACVVTNGVsscnsiaaasnsnQE  898
             +Y SLWNADDWAT+GGLVKTDW+ APFTA YRNFNANAC V++G  S       S+SN  
Sbjct  183   IYSSLWNADDWATRGGLVKTDWTQAPFTASYRNFNANACTVSSGT-SSCGSNYPSSSNNA  241

Query  899   WLTQELDGKGRNRVRWVQSKHMVYNYCADAKRFPQGFSAEC  1021
             WL++ELD   + R++W+Q  +M+YNYC+D +RFPQG   EC
Sbjct  242   WLSEELDSTNQERLKWLQKNYMIYNYCSDTQRFPQGLPPEC  282



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3215844022030