BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24075_g1_i3 len=350 path=[2253:0-99 160:100-140 2061:141-308
393:309-349]

Length=350
                                                                      Score     E

ref|XP_009593292.1|  PREDICTED: defensin-like protein P322            67.0    5e-12   
ref|XP_009768915.1|  PREDICTED: defensin-like protein isoform X2      65.5    2e-11   
ref|XP_009769844.1|  PREDICTED: defensin-like protein P322            65.1    3e-11   
ref|XP_002274353.1|  PREDICTED: defensin Ec-AMP-D2                    63.9    8e-11   Vitis vinifera
ref|NP_178320.1|  defensin-like protein 4                             63.9    9e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010513972.1|  PREDICTED: defensin-like protein 2               63.5    1e-10   
ref|XP_009604566.1|  PREDICTED: defensin J1-2-like                    63.2    2e-10   
ref|XP_010502227.1|  PREDICTED: defensin-like protein 2               63.2    2e-10   
ref|XP_009800136.1|  PREDICTED: defensin J1-2-like                    62.8    2e-10   
ref|XP_006292781.1|  hypothetical protein CARUB_v10019030mg           62.8    2e-10   
ref|XP_009614488.1|  PREDICTED: defensin J1-2-like                    62.8    2e-10   
ref|XP_009614667.1|  PREDICTED: defensin-like protein                 62.4    3e-10   
ref|XP_006395809.1|  hypothetical protein EUTSA_v10005228mg           62.0    5e-10   
ref|XP_009768914.1|  PREDICTED: defensin-like protein isoform X1      61.6    5e-10   
emb|CDY48618.1|  BnaC09g20670D                                        61.6    6e-10   
gb|ABO36641.1|  defensin protein                                      61.2    7e-10   Solanum pimpinellifolium [currant tomato]
ref|XP_009129168.1|  PREDICTED: defensin-like protein 1               61.2    7e-10   
gb|AGT51229.1|  defensin                                              61.2    8e-10   
ref|XP_010513973.1|  PREDICTED: defensin-like protein 1               61.2    8e-10   
gb|ABO36637.1|  defensin protein                                      61.2    9e-10   Solanum lycopersicum
ref|XP_009101273.1|  PREDICTED: defensin-like protein 2               60.8    1e-09   
gb|AAL35366.1|AF442388_1  defensin protein precursor                  60.8    1e-09   Capsicum annuum
gb|AAA91049.1|  protease inhibitor II                                 60.8    1e-09   Brassica rapa
ref|XP_009114206.1|  PREDICTED: defensin-like protein 1               60.5    1e-09   
ref|XP_010495961.1|  PREDICTED: defensin-like protein 1               60.1    2e-09   
gb|ADK87340.1|  defensin                                              60.1    2e-09   
ref|XP_009610211.1|  PREDICTED: defensin J1-2                         60.1    2e-09   
ref|XP_006292136.1|  hypothetical protein CARUB_v10018340mg           59.7    3e-09   
ref|XP_009593293.1|  PREDICTED: defensin-like protein P322            59.7    3e-09   
ref|XP_009351645.1|  PREDICTED: defensin Ec-AMP-D2-like               59.7    3e-09   
ref|XP_006367978.1|  PREDICTED: defensin-like protein P322-like       59.7    3e-09   
emb|CDP10468.1|  unnamed protein product                              59.7    3e-09   
gb|ACB32234.1|  gamma-thionin/defensin                                59.3    4e-09   Solanum chacoense
ref|XP_006392063.1|  hypothetical protein EUTSA_v10023787mg           59.7    4e-09   
ref|XP_010250779.1|  PREDICTED: defensin Ec-AMP-D2-like               59.3    4e-09   
ref|NP_001234872.1|  gamma-thionin precursor                          59.3    4e-09   
ref|XP_006359485.1|  PREDICTED: defensin-like protein-like            59.3    5e-09   
ref|XP_006359486.1|  PREDICTED: defensin-like protein-like            58.9    5e-09   
ref|XP_006395808.1|  hypothetical protein EUTSA_v10005229mg           58.9    6e-09   
ref|XP_009351646.1|  PREDICTED: defensin Ec-AMP-D2-like               58.5    7e-09   
ref|NP_178321.1|  defensin-like protein 1                             58.5    8e-09   Arabidopsis thaliana [mouse-ear cress]
gb|AGT51227.1|  defensin                                              58.5    8e-09   
ref|NP_178319.1|  defensin-like protein 2                             58.5    9e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004151187.1|  PREDICTED: defensin J1-2-like                    58.2    1e-08   
ref|XP_009784025.1|  PREDICTED: defensin J1-2                         58.2    1e-08   
ref|XP_002875115.1|  hypothetical protein ARALYDRAFT_484136           58.2    1e-08   
ref|XP_002865329.1|  hypothetical protein ARALYDRAFT_917107           58.2    1e-08   
sp|Q40901.1|DEF_PETIN  RecName: Full=Defensin-like protein; AltNa...  58.2    1e-08   Petunia integrifolia [violet-flowered petunia]
ref|XP_008389119.1|  PREDICTED: defensin Ec-AMP-D2-like               57.8    1e-08   
ref|XP_009354384.1|  PREDICTED: defensin Ec-AMP-D2-like               57.8    2e-08   
ref|XP_010910081.1|  PREDICTED: defensin Ec-AMP-D2-like               57.4    2e-08   
dbj|BAA95697.1|  thionin like protein                                 57.4    2e-08   Nicotiana tabacum [American tobacco]
ref|XP_004297787.1|  PREDICTED: defensin-like protein 2-like          57.4    2e-08   
ref|XP_008340514.1|  PREDICTED: defensin Ec-AMP-D2-like               57.0    3e-08   
gb|AGT51228.1|  defensin                                              57.0    3e-08   
ref|XP_004242750.1|  PREDICTED: defensin-like protein P322            57.0    3e-08   
gb|EYU30124.1|  hypothetical protein MIMGU_mgv1a017438mg              57.0    3e-08   
ref|XP_009413079.1|  PREDICTED: defensin Ec-AMP-D2 {ECO:0000303|P...  57.0    3e-08   
gb|ACJ26760.1|  protease inhibitor-related protein                    56.6    4e-08   Solanum tuberosum [potatoes]
ref|XP_006585876.1|  PREDICTED: defensin-like protein-like            57.4    4e-08   
gb|KHN06998.1|  Defensin-like protein                                 56.6    4e-08   
ref|XP_007223891.1|  hypothetical protein PRUPE_ppa014246mg           56.6    4e-08   
ref|XP_004242748.1|  PREDICTED: defensin-like protein                 56.2    5e-08   
ref|XP_006292097.1|  hypothetical protein CARUB_v10018292mg           56.6    5e-08   
ref|XP_009599356.1|  PREDICTED: defensin-like protein                 55.8    7e-08   
ref|XP_007159919.1|  hypothetical protein PHAVU_002G278700g           55.8    7e-08   
gb|AAL85480.1|  defensin protein 1                                    55.8    7e-08   Prunus persica
gb|AFW90621.1|  protease inhibitor-related protein                    55.8    8e-08   
gb|AIT42148.1|  defensin-like protein                                 55.5    1e-07   
ref|XP_006359487.1|  PREDICTED: defensin-like protein-like            55.5    1e-07   
ref|XP_004242747.1|  PREDICTED: defensin-like protein                 55.5    1e-07   
ref|XP_002862935.1|  low-molecular-weight cysteine-rich 76            55.5    1e-07   
ref|XP_007159918.1|  hypothetical protein PHAVU_002G278600g           54.7    2e-07   
ref|XP_011070574.1|  PREDICTED: defensin J1-2-like                    54.7    2e-07   
ref|XP_006420697.1|  hypothetical protein CICLE_v10006362mg           54.7    2e-07   
ref|XP_006367121.1|  PREDICTED: defensin J1-2-like                    54.7    2e-07   
ref|XP_009802655.1|  PREDICTED: defensin-like protein                 54.7    2e-07   
emb|CDP16306.1|  unnamed protein product                              54.7    2e-07   
gb|AFE88173.1|  g-thionin                                             54.3    2e-07   
sp|O65740.1|DEF2_CAPAN  RecName: Full=Defensin J1-2; Flags: Precu...  53.9    3e-07   Capsicum annuum
ref|XP_010043884.1|  PREDICTED: defensin Ec-AMP-D2-like               53.9    3e-07   
ref|XP_007202934.1|  hypothetical protein PRUPE_ppa016748mg           53.9    4e-07   
ref|XP_004297786.1|  PREDICTED: defensin-like protein 2-like          53.9    4e-07   
gb|AIT42153.1|  defensin-like protein                                 53.9    4e-07   
ref|XP_011070572.1|  PREDICTED: defensin J1-2-like                    53.5    4e-07   
ref|XP_003629332.1|  Defensin                                         53.9    4e-07   
sp|P20346.1|DF322_SOLTU  RecName: Full=Defensin-like protein P322...  53.5    4e-07   Solanum tuberosum [potatoes]
gb|ADQ43196.1|  unknown                                               53.5    5e-07   
gb|AAS65426.1|  Kunitz-type trypsin inhibitor                         53.5    5e-07   Ipomoea batatas [batate]
gb|AIT42152.1|  defensin-like protein                                 53.5    5e-07   
ref|XP_004509603.1|  PREDICTED: defensin-like protein-like            53.5    5e-07   
gb|AIT42149.1|  defensin-like protein                                 53.5    5e-07   
sp|P82659.1|DFSD2_HELAN  RecName: Full=Defensin SD2; AltName: Ful...  53.5    5e-07   Helianthus annuus
ref|NP_001031460.1|  low-molecular-weight cysteine-rich 76            53.5    6e-07   Arabidopsis thaliana [mouse-ear cress]
gb|ACN93800.1|  defensin precursor                                    53.5    6e-07   Vigna unguiculata
ref|XP_003628979.1|  Defensin                                         53.1    6e-07   
ref|XP_004509604.1|  PREDICTED: defensin-like protein P322-like       53.1    8e-07   
ref|XP_008349481.1|  PREDICTED: defensin Ec-AMP-D2-like               52.8    9e-07   
ref|XP_003628978.1|  Defensin                                         52.4    1e-06   
ref|XP_007045354.1|  Defensin-like protein isoform 2                  52.4    1e-06   
gb|AIT42147.1|  defensin-like protein                                 52.4    1e-06   
ref|NP_001234987.1|  protease inhibitor precursor                     52.4    1e-06   
gb|KFK26328.1|  hypothetical protein AALP_AA8G233400                  52.4    2e-06   
gb|ADB02899.1|  gamma-thionin PPT precursor defensin 1-like protein   52.4    2e-06   
ref|XP_006647552.1|  PREDICTED: defensin-like protein P322-like       52.0    2e-06   
ref|XP_007204040.1|  hypothetical protein PRUPE_ppa021088mg           52.0    2e-06   
ref|XP_007202863.1|  hypothetical protein PRUPE_ppa015550mg           52.0    2e-06   
ref|XP_007156391.1|  hypothetical protein PHAVU_003G282500g           52.0    2e-06   
gb|AIA67014.1|  defensin                                              52.0    2e-06   
gb|KDP32807.1|  hypothetical protein JCGZ_12099                       51.6    2e-06   
ref|XP_007203287.1|  hypothetical protein PRUPE_ppa025677mg           52.0    2e-06   
gb|KHN23780.1|  Defensin SD2                                          51.6    3e-06   
gb|AHA50470.1|  defensin-like protein 1                               51.2    3e-06   
ref|XP_007226630.1|  hypothetical protein PRUPE_ppa022845mg           51.2    4e-06   
ref|XP_009370221.1|  PREDICTED: defensin-like protein 2               51.2    4e-06   
ref|XP_008437687.1|  PREDICTED: defensin J1-2-like                    50.8    4e-06   
ref|XP_009792224.1|  PREDICTED: defensin-like protein P322            50.8    5e-06   
ref|XP_010270777.1|  PREDICTED: defensin-like protein                 50.8    5e-06   
sp|P82781.2|DEF03_ARATH  RecName: Full=Putative defensin-like pro...  50.4    5e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002513261.1|  8.4 kDa sulfur-rich protein precursor, putative  50.4    7e-06   Ricinus communis
gb|AFK44299.1|  unknown                                               50.1    8e-06   
ref|XP_006394251.1|  hypothetical protein EUTSA_v10005235mg           50.1    8e-06   
ref|XP_002875116.1|  hypothetical protein ARALYDRAFT_904442           50.1    8e-06   
gb|AAL15885.1|AF417297_1  putative gamma-thionin                      50.1    1e-05   Castanea sativa
ref|XP_009769843.1|  PREDICTED: defensin-like protein P322            49.7    1e-05   
ref|XP_006410329.1|  hypothetical protein EUTSA_v10017942mg           49.7    1e-05   
ref|XP_009590912.1|  PREDICTED: defensin-like protein 1               49.7    1e-05   
ref|XP_003628977.1|  Defensin                                         49.7    1e-05   
ref|XP_003630422.1|  Defensin                                         49.7    1e-05   
gb|KFK33427.1|  hypothetical protein AALP_AA5G011600                  49.7    1e-05   
dbj|BAK06284.1|  predicted protein                                    49.7    2e-05   
ref|XP_007033367.1|  Scorpion toxin-like knottin superfamily protein  49.3    2e-05   
gb|EAY86781.1|  hypothetical protein OsI_08161                        52.4    2e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_006295860.1|  hypothetical protein CARUB_v10024990mg           49.3    2e-05   
gb|KHG09995.1|  Defensin-like protein 1                               48.9    2e-05   
ref|NP_178322.1|  defensin-like protein 10                            48.9    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007033927.1|  Scorpion toxin-like knottin superfamily protein  49.7    2e-05   
ref|XP_010675153.1|  PREDICTED: defensin-like protein 1 isoform X2    48.9    2e-05   
ref|XP_003562142.1|  PREDICTED: defensin Ec-AMP-D1-like               48.9    2e-05   
ref|XP_007033370.1|  Scorpion toxin-like knottin superfamily protein  48.9    2e-05   
gb|KGN49760.1|  hypothetical protein Csa_5G114570                     48.9    2e-05   
ref|XP_008466730.1|  PREDICTED: defensin J1-2-like                    48.9    2e-05   
ref|XP_009101271.1|  PREDICTED: defensin-like protein 10              48.9    2e-05   
ref|NP_001047493.1|  Os02g0629800                                     48.9    2e-05   Oryza sativa Japonica Group [Japonica rice]
gb|ACM90159.1|  low-molecular-weight cysteine-rich 69                 48.9    3e-05   Jatropha curcas
ref|XP_003599384.1|  Defensin                                         48.5    3e-05   
ref|XP_010319372.1|  PREDICTED: defensin Ec-AMP-D2-like               48.5    3e-05   
ref|NP_201171.1|  defensin-like protein 6                             48.5    3e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010675152.1|  PREDICTED: defensin-like protein 1 isoform X1    48.5    3e-05   
ref|XP_010260874.1|  PREDICTED: defensin D2-like                      48.5    3e-05   
ref|XP_006422269.1|  hypothetical protein CICLE_v10005867mg           50.4    3e-05   
ref|XP_002513755.1|  Low-molecular-weight cysteine-rich protein L...  48.5    3e-05   Ricinus communis
ref|XP_004509606.1|  PREDICTED: defensin J1-2-like                    48.5    3e-05   
emb|CDY39856.1|  BnaC02g42620D                                        48.1    4e-05   
ref|XP_002886566.1|  protease inhibitor II                            48.1    5e-05   
ref|XP_007045353.1|  Defensin-like protein isoform 1                  48.1    5e-05   
dbj|BAD25504.1|  hypothetical protein                                 48.1    5e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008240820.1|  PREDICTED: defensin Ec-AMP-D1-like               48.1    5e-05   
ref|XP_010671291.1|  PREDICTED: defensin Ec-AMP-D2-like               47.8    5e-05   
ref|XP_010908980.1|  PREDICTED: defensin Ec-AMP-D1-like               47.8    5e-05   
gb|ACS96442.1|  defensin                                              47.8    5e-05   Jatropha curcas
dbj|BAK07823.1|  predicted protein                                    48.1    6e-05   
ref|XP_009114204.1|  PREDICTED: defensin-like protein 2               47.4    7e-05   
ref|XP_008360020.1|  PREDICTED: defensin-like protein 2               47.4    8e-05   
ref|XP_006586320.1|  PREDICTED: defensin-like protein-like            47.4    8e-05   
ref|XP_004509602.1|  PREDICTED: defensin-1-like                       47.4    9e-05   
gb|ABA86589.1|  putative defensin 1                                   47.0    9e-05   Aquilegia pyrenaica
gb|AHA50471.1|  defensin-like protein 4                               47.0    9e-05   
ref|XP_009383785.1|  PREDICTED: defensin-like protein 1               47.0    1e-04   
ref|NP_001031462.1|  low-molecular-weight cysteine-rich 75            47.0    1e-04   Arabidopsis thaliana [mouse-ear cress]
gb|ABA81896.1|  putative defensin                                     47.0    1e-04   Aquilegia formosa
ref|NP_176302.2|  defensin-like protein                               47.0    1e-04   Arabidopsis thaliana [mouse-ear cress]
gb|AFD01290.1|  defensin 3                                            47.0    1e-04   
gb|EMT03363.1|  hypothetical protein F775_43918                       47.0    1e-04   
gb|KDO61571.1|  hypothetical protein CISIN_1g029977mg                 48.1    1e-04   
ref|XP_006292846.1|  hypothetical protein CARUB_v10019106mg           46.6    1e-04   
ref|XP_004953175.1|  PREDICTED: defensin-like protein 2-like          46.6    1e-04   
gb|AFW58880.1|  low-molecular-weight cysteine-rich protein LCR70      46.6    1e-04   
gb|AIA67012.1|  defensin                                              46.6    1e-04   
gb|ACV84379.1|  defensin precursor                                    46.6    1e-04   Triticum aestivum [Canadian hard winter wheat]
gb|ABK28445.1|  unknown                                               46.6    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001149230.1|  LOC100282852 precursor                           46.6    1e-04   Zea mays [maize]
gb|KFK33428.1|  hypothetical protein AALP_AA5G011900                  46.6    1e-04   
ref|XP_010497013.1|  PREDICTED: putative defensin-like protein 9      46.6    2e-04   
ref|XP_007137817.1|  hypothetical protein PHAVU_009G158100g           47.4    2e-04   
gb|ABK93231.1|  unknown                                               46.2    2e-04   Populus trichocarpa [western balsam poplar]
gb|EMS65298.1|  Defensin-like protein 1                               46.2    2e-04   
ref|XP_008240819.1|  PREDICTED: defensin Ec-AMP-D1-like               46.2    2e-04   
gb|KEH35658.1|  low-molecular-weight cysteine-rich protein            45.8    2e-04   
gb|KHN16909.1|  Defensin J1-2                                         46.2    2e-04   
emb|CEJ09690.1|  Defensin protein                                     46.2    2e-04   
gb|ACV84383.1|  defensin precursor                                    46.2    2e-04   Triticum turgidum subsp. durum
gb|EYU35335.1|  hypothetical protein MIMGU_mgv11b017254mg             46.2    2e-04   
ref|XP_004503912.1|  PREDICTED: defensin-like protein-like            45.8    2e-04   
ref|XP_007156390.1|  hypothetical protein PHAVU_003G282400g           45.8    3e-04   
ref|XP_009780051.1|  PREDICTED: defensin-like protein 1               45.8    3e-04   
gb|KEH35661.1|  Defensin                                              45.4    3e-04   
gb|ABA86587.1|  putative defensin 1                                   45.4    3e-04   Aquilegia chrysantha
gb|ABK23404.1|  unknown                                               45.4    3e-04   Picea sitchensis
gb|EYU27577.1|  hypothetical protein MIMGU_mgv1a024490mg              45.4    3e-04   
sp|Q43413.1|DEF1_CAPAN  RecName: Full=Defensin J1-1; Flags: Precu...  45.4    3e-04   Capsicum annuum
ref|XP_010088525.1|  Defensin-like protein 2                          45.4    4e-04   
ref|XP_002864860.1|  predicted protein                                45.4    4e-04   
ref|XP_008389117.1|  PREDICTED: defensin Tk-AMP-D1.1-like             45.4    4e-04   
gb|ABA86586.1|  putative defensin 1                                   45.1    4e-04   Aquilegia formosa
gb|AHA50473.1|  defensin-like protein 6                               45.1    4e-04   
emb|CAA62761.1|  putative gamma-thionin protein                       45.4    4e-04   Picea abies
emb|CAH65875.1|  OSIGBa0160I04.1                                      45.1    4e-04   Oryza sativa [red rice]
ref|XP_011001251.1|  PREDICTED: defensin-like protein 1               45.1    4e-04   
gb|AAM62652.1|  protease inhibitor II                                 45.1    5e-04   Arabidopsis thaliana [mouse-ear cress]
gb|AHA50472.1|  defensin-like protein 5                               45.1    5e-04   
ref|XP_011084089.1|  PREDICTED: defensin Ec-AMP-D2-like               45.1    5e-04   
ref|XP_008340512.1|  PREDICTED: defensin-like protein 1               45.1    5e-04   
ref|XP_002325734.2|  defensin-like family protein                     45.1    5e-04   Populus trichocarpa [western balsam poplar]
ref|XP_008389118.1|  PREDICTED: defensin-like protein 1               45.1    6e-04   
ref|XP_007202809.1|  hypothetical protein PRUPE_ppa014119mg           45.1    6e-04   
gb|KHG06821.1|  Defensin-like protein                                 44.7    6e-04   
gb|ABK25062.1|  unknown                                               44.7    6e-04   Picea sitchensis
emb|CAH58740.1|  defensin                                             44.7    6e-04   Plantago major [cart-track plant]
ref|XP_004509637.1|  PREDICTED: defensin J1-2-like                    44.3    7e-04   
ref|XP_003526900.1|  PREDICTED: defensin-like protein 6-like          44.3    8e-04   
gb|KHG15212.1|  Defensin-like protein 1                               44.3    0.001   
ref|XP_002468581.1|  hypothetical protein SORBIDRAFT_01g048380        44.3    0.001   Sorghum bicolor [broomcorn]
gb|EYU32771.1|  hypothetical protein MIMGU_mgv11b019564mg             44.3    0.001   
ref|XP_009342667.1|  PREDICTED: defensin-like protein 2               44.3    0.001   



>ref|XP_009593292.1| PREDICTED: defensin-like protein P322 [Nicotiana tomentosiformis]
Length=78

 Score = 67.0 bits (162),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 45/67 (67%), Gaps = 2/67 (3%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMGIMA-AGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGF  248
            + S+R FATV LL +LFMA+ MG M  A  R C S+SQ F+G+C+    NC  VC++EGF
Sbjct  2    AKSMRFFATVLLLAILFMATEMGPMTIAEARHCESQSQRFRGLCV-REKNCAAVCETEGF  60

Query  249  SNGSCTG  269
            S G C G
Sbjct  61   SGGDCRG  67



>ref|XP_009768915.1| PREDICTED: defensin-like protein isoform X2 [Nicotiana sylvestris]
Length=79

 Score = 65.5 bits (158),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 46/65 (71%), Gaps = 2/65 (3%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMG-IMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSN  254
            S+RL +TV LL+M+  A+ MG IM A  R C S+SQ FKGVC+ +N NC +VC +EGF +
Sbjct  5    SMRLLSTVFLLLMVVFATEMGPIMVAEARNCESQSQRFKGVCV-SNRNCASVCNTEGFPD  63

Query  255  GSCTG  269
            G C G
Sbjct  64   GKCKG  68



>ref|XP_009769844.1| PREDICTED: defensin-like protein P322 [Nicotiana sylvestris]
Length=78

 Score = 65.1 bits (157),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 43/67 (64%), Gaps = 2/67 (3%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMGIMA-AGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGF  248
            + S+R FATV LL ML MA+ MG M  A  R C S+SQ F+G C+    NC  VC++EGF
Sbjct  2    AKSMRFFATVLLLAMLVMATEMGPMTIAEARRCESKSQRFRGPCV-REKNCAAVCETEGF  60

Query  249  SNGSCTG  269
            S G C G
Sbjct  61   SGGDCRG  67



>ref|XP_002274353.1| PREDICTED: defensin Ec-AMP-D2 [Vitis vinifera]
 emb|CBI27507.3| unnamed protein product [Vitis vinifera]
Length=77

 Score = 63.9 bits (154),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 41/64 (64%), Gaps = 1/64 (2%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNG  257
            S RLF+   L+++LFMA+ MG M A  R C S+S  FKG C+    NC  VC++EGF  G
Sbjct  4    SQRLFSAFLLVILLFMATEMGPMVAEARTCESQSHRFKGTCV-RQSNCAAVCQTEGFHGG  62

Query  258  SCTG  269
            +C G
Sbjct  63   NCRG  66



>ref|NP_178320.1| defensin-like protein 4 [Arabidopsis thaliana]
 sp|Q41914.2|DEF04_ARATH RecName: Full=Defensin-like protein 4; AltName: Full=Low-molecular-weight 
cysteine-rich protein 70; Short=Protein LCR70; 
AltName: Full=Plant defensin 2.1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC97222.1| protease inhibitor II [Arabidopsis thaliana]
 dbj|BAC42603.1| putative protease inhibitor II [Arabidopsis thaliana]
 gb|AAO42893.1| At2g02120 [Arabidopsis thaliana]
 gb|AEC05548.1| defensin-like protein 4 [Arabidopsis thaliana]
Length=77

 Score = 63.9 bits (154),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 43/64 (67%), Gaps = 1/64 (2%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNG  257
            S+RL + V  LVM+F+A+GMG +    R C+S+SQ FKG C+ ++ NC  VC +EGF  G
Sbjct  4    SMRLISAVLFLVMIFVATGMGPVTVEARTCASQSQRFKGKCV-SDTNCENVCHNEGFPGG  62

Query  258  SCTG  269
             C G
Sbjct  63   DCRG  66



>ref|XP_010513972.1| PREDICTED: defensin-like protein 2 [Camelina sativa]
 ref|XP_010495963.1| PREDICTED: defensin-like protein 2 [Camelina sativa]
Length=77

 Score = 63.5 bits (153),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 42/64 (66%), Gaps = 1/64 (2%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNG  257
            S+RL + V +L M+F+A+GMG +    R C S+S  FKG C F+  NC  VC +EGFS G
Sbjct  4    SIRLISAVLVLFMIFVATGMGPVTVEARTCESKSHRFKGKC-FSETNCRNVCHNEGFSGG  62

Query  258  SCTG  269
            +C G
Sbjct  63   NCRG  66



>ref|XP_009604566.1| PREDICTED: defensin J1-2-like [Nicotiana tomentosiformis]
Length=77

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = +3

Query  84   RLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSC  263
            +LFATV L++ML  A+ MG M A  R C S+S  FKG C+    NC  VC++EGF  G C
Sbjct  6    KLFATVFLMLMLIFATEMGTMVAEARTCESQSHRFKGPCV-RKSNCAAVCQTEGFHGGHC  64

Query  264  TG  269
             G
Sbjct  65   RG  66



>ref|XP_010502227.1| PREDICTED: defensin-like protein 2 [Camelina sativa]
Length=77

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 42/64 (66%), Gaps = 1/64 (2%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNG  257
            S+RL + V +L M+F+A+GMG +    R C S+S  FKG C F+  NC  VC +EGFS G
Sbjct  4    SIRLISAVLVLFMIFVATGMGPVTVEARTCESQSHRFKGKC-FSETNCRNVCHNEGFSGG  62

Query  258  SCTG  269
            +C G
Sbjct  63   NCRG  66



>ref|XP_009800136.1| PREDICTED: defensin J1-2-like [Nicotiana sylvestris]
Length=77

 Score = 62.8 bits (151),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = +3

Query  84   RLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSC  263
            +LFATV L++ML  A+ MG M A  R C S+S  FKG C+    NC  VC++EGF  G C
Sbjct  6    KLFATVFLVLMLVFATEMGTMVADARTCESQSHRFKGPCV-RKSNCAAVCQTEGFHAGHC  64

Query  264  TG  269
             G
Sbjct  65   RG  66



>ref|XP_006292781.1| hypothetical protein CARUB_v10019030mg [Capsella rubella]
 gb|EOA25679.1| hypothetical protein CARUB_v10019030mg [Capsella rubella]
Length=77

 Score = 62.8 bits (151),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 42/64 (66%), Gaps = 1/64 (2%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNG  257
            S+RL + V +L M+F+A+GMG +    R C S+S  FKG C F+  NC  VC +EGF+ G
Sbjct  4    SIRLISAVLVLFMIFVATGMGPVTVEARTCESKSHRFKGKC-FSETNCKNVCHNEGFTGG  62

Query  258  SCTG  269
            +C G
Sbjct  63   NCRG  66



>ref|XP_009614488.1| PREDICTED: defensin J1-2-like [Nicotiana tomentosiformis]
Length=77

 Score = 62.8 bits (151),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = +3

Query  84   RLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSC  263
            +LFATV L++ML  A+ MG M A  R C S+S  FKG C+    NC  VC++EGF  G C
Sbjct  6    KLFATVFLMLMLVFATEMGTMVAEARTCESQSHRFKGPCV-RKSNCAAVCQTEGFHGGHC  64

Query  264  TG  269
             G
Sbjct  65   RG  66



>ref|XP_009614667.1| PREDICTED: defensin-like protein [Nicotiana tomentosiformis]
Length=75

 Score = 62.4 bits (150),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 45/64 (70%), Gaps = 2/64 (3%)
 Frame = +3

Query  81   VRLFATVSLLVMLFMASGMG-IMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNG  257
            +RL +TV LL+M+  A+ MG +M A  R C S+S+ FKGVC+ +N NC +VC +EGF +G
Sbjct  2    MRLLSTVFLLLMVVFATEMGPVMVAEARNCESQSERFKGVCV-SNRNCASVCNTEGFPDG  60

Query  258  SCTG  269
             C G
Sbjct  61   KCKG  64



>ref|XP_006395809.1| hypothetical protein EUTSA_v10005228mg [Eutrema salsugineum]
 gb|ACQ90606.1| defensin-like protein [Eutrema halophilum]
 gb|ESQ33095.1| hypothetical protein EUTSA_v10005228mg [Eutrema salsugineum]
Length=77

 Score = 62.0 bits (149),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 42/64 (66%), Gaps = 1/64 (2%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNG  257
            S+RL +TV L+ M+F+A+GMG +    R C S+S  FKG C+ +  NC  VC +EGF  G
Sbjct  4    SMRLISTVILVFMIFVATGMGPVTVEARTCESKSHRFKGACL-SETNCKNVCHNEGFRGG  62

Query  258  SCTG  269
            +C G
Sbjct  63   NCRG  66



>ref|XP_009768914.1| PREDICTED: defensin-like protein isoform X1 [Nicotiana sylvestris]
Length=80

 Score = 61.6 bits (148),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 45/66 (68%), Gaps = 3/66 (5%)
 Frame = +3

Query  78   SVRLFATVSLLVML-FMASGMG-IMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFS  251
            S+RL +TV LL+M+ F    MG IM A  R C S+SQ FKGVC+ +N NC +VC +EGF 
Sbjct  5    SMRLLSTVFLLLMVVFATEEMGPIMVAEARNCESQSQRFKGVCV-SNRNCASVCNTEGFP  63

Query  252  NGSCTG  269
            +G C G
Sbjct  64   DGKCKG  69



>emb|CDY48618.1| BnaC09g20670D [Brassica napus]
Length=77

 Score = 61.6 bits (148),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 1/64 (2%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNG  257
            S+RL + V L+ M+F+ASGMG +    R C S+S  F+G+C+ +  NC  VC +EGF  G
Sbjct  4    SLRLISAVLLMFMIFVASGMGPVTVEARTCESKSHKFRGLCV-SRHNCANVCHNEGFHGG  62

Query  258  SCTG  269
             C G
Sbjct  63   KCRG  66



>gb|ABO36641.1| defensin protein [Solanum pimpinellifolium]
Length=76

 Score = 61.2 bits (147),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 47/67 (70%), Gaps = 4/67 (6%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASG-MGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGF  248
            ++S+RLFAT+ LL ML MA+G M I+ A  R C S+S  FKG C+ +  NC +VC++EGF
Sbjct  2    ANSMRLFATMLLLAMLVMATGPMKIVEA--RTCESQSHRFKGPCV-SEKNCASVCETEGF  58

Query  249  SNGSCTG  269
            S G C G
Sbjct  59   SGGDCRG  65



>ref|XP_009129168.1| PREDICTED: defensin-like protein 1 [Brassica rapa]
 emb|CDY09389.1| BnaA02g26210D [Brassica napus]
Length=77

 Score = 61.2 bits (147),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 41/64 (64%), Gaps = 1/64 (2%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNG  257
            S+RL + V LL M+F+A+GMG ++   R C S+S  FKG C+  N NC  VC +EGF  G
Sbjct  4    SMRLISAVLLLFMIFVATGMGPVSVEARTCESQSHRFKGPCVSEN-NCANVCHNEGFGGG  62

Query  258  SCTG  269
             C G
Sbjct  63   KCRG  66



>gb|AGT51229.1| defensin [Brassica napus]
 emb|CDY51475.1| BnaC02g47680D [Brassica napus]
Length=77

 Score = 61.2 bits (147),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 42/64 (66%), Gaps = 1/64 (2%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNG  257
            S+RL + V LL M+F+A+GMG ++   R C S+S  FKG C+ ++ NC  VC +EGF  G
Sbjct  4    SMRLISAVLLLFMIFVATGMGPVSVEARTCESQSHRFKGPCV-SDNNCANVCHNEGFGGG  62

Query  258  SCTG  269
             C G
Sbjct  63   KCRG  66



>ref|XP_010513973.1| PREDICTED: defensin-like protein 1 [Camelina sativa]
Length=77

 Score = 61.2 bits (147),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 41/64 (64%), Gaps = 1/64 (2%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNG  257
            S+RL + V L+ MLF+A+GMG +    R C S+S  F+G C+ +  NC  VC +EGFS G
Sbjct  4    SMRLISAVLLMFMLFVATGMGPVTVEARTCESKSHRFRGPCV-SRHNCGNVCHNEGFSGG  62

Query  258  SCTG  269
             C G
Sbjct  63   KCRG  66



>gb|ABO36637.1| defensin protein [Solanum lycopersicum]
Length=76

 Score = 61.2 bits (147),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 47/67 (70%), Gaps = 4/67 (6%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASG-MGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGF  248
            ++S+RLFAT+ LL ML MA+G M I+ A  R C S+S  FKG C+ +  NC +VC++EGF
Sbjct  2    ANSMRLFATMLLLAMLVMATGPMRIVEA--RTCESQSHRFKGPCV-SEKNCASVCETEGF  58

Query  249  SNGSCTG  269
            S G C G
Sbjct  59   SGGDCRG  65



>ref|XP_009101273.1| PREDICTED: defensin-like protein 2 [Brassica rapa]
 emb|CDY17613.1| BnaA06g34320D [Brassica napus]
Length=77

 Score = 60.8 bits (146),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 41/64 (64%), Gaps = 1/64 (2%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNG  257
            S+RL + V LL M+F+A+GMG +    R C S+S  FKG C+ ++ NC  VC +EGF  G
Sbjct  4    SMRLISAVLLLFMIFVATGMGPVTVEARTCESKSHRFKGTCV-SSTNCGNVCHNEGFGGG  62

Query  258  SCTG  269
             C G
Sbjct  63   KCRG  66



>gb|AAL35366.1|AF442388_1 defensin protein precursor [Capsicum annuum]
 gb|AAR90845.1| defensin precursor [Capsicum annuum]
Length=78

 Score = 60.8 bits (146),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 42/67 (63%), Gaps = 2/67 (3%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMGIMA-AGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGF  248
            + S+R FA V LL ML MA+ MG M     R C S+S  FKGVC  +  NC +VC++EGF
Sbjct  2    AHSMRFFAIVLLLAMLVMATEMGPMRIVEARTCESQSHRFKGVCA-SETNCASVCQTEGF  60

Query  249  SNGSCTG  269
            S G C G
Sbjct  61   SGGDCRG  67



>gb|AAA91049.1| protease inhibitor II [Brassica rapa]
Length=77

 Score = 60.8 bits (146),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 41/64 (64%), Gaps = 1/64 (2%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNG  257
            S+RL + V LL M+F+A+GMG +    R C S+S  FKG C+ ++ NC  VC +EGF  G
Sbjct  4    SMRLISAVLLLFMIFVATGMGPVTVEARTCESKSHRFKGTCV-SSTNCGNVCHNEGFGGG  62

Query  258  SCTG  269
             C G
Sbjct  63   KCRG  66



>ref|XP_009114206.1| PREDICTED: defensin-like protein 1 [Brassica rapa]
 emb|CDY04121.1| BnaA09g18990D [Brassica napus]
Length=77

 Score = 60.5 bits (145),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 40/64 (63%), Gaps = 1/64 (2%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNG  257
            S+RL + V L+ M+F+ASGMG +    R C S+S  F+G C+ +  NC  VC +EGF  G
Sbjct  4    SLRLISAVLLMFMIFVASGMGPVTVEARTCESKSHKFRGPCV-SRHNCANVCHNEGFHGG  62

Query  258  SCTG  269
             C G
Sbjct  63   KCRG  66



>ref|XP_010495961.1| PREDICTED: defensin-like protein 1 [Camelina sativa]
Length=77

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 1/64 (2%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNG  257
            S+RL + V L+ M+F+A+GMG +    R C S+S  F+G C+ +  NC  VC +EGFS G
Sbjct  4    SMRLISAVLLMFMIFVATGMGPVTVEARTCESKSHRFRGPCV-SRHNCGNVCHNEGFSGG  62

Query  258  SCTG  269
             C G
Sbjct  63   KCRG  66



>gb|ADK87340.1| defensin [Pyrus pyrifolia]
 gb|AGC00408.1| defensin 1 [Pyrus pyrifolia]
Length=78

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 44/67 (66%), Gaps = 2/67 (3%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGM-GIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGF  248
              SVRLF+T  + V+L +A+GM G M A  R C S+S+ FKG C+ +  NC +VC++EGF
Sbjct  2    ERSVRLFSTAFVFVLLLVATGMMGPMLAEGRTCESQSRKFKGACL-SRSNCASVCQTEGF  60

Query  249  SNGSCTG  269
              G C G
Sbjct  61   PGGHCRG  67



>ref|XP_009610211.1| PREDICTED: defensin J1-2 [Nicotiana tomentosiformis]
Length=77

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = +3

Query  84   RLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSC  263
            ++ ATV L++ML  A+ MG M A  R C S+S  FKG+C F+  NC +VC +EGF  G C
Sbjct  6    KVVATVFLMLMLVFATEMGPMVAEARTCESQSHRFKGLC-FSKSNCASVCHTEGFYGGHC  64

Query  264  TG  269
             G
Sbjct  65   RG  66



>ref|XP_006292136.1| hypothetical protein CARUB_v10018340mg [Capsella rubella]
 gb|EOA25034.1| hypothetical protein CARUB_v10018340mg [Capsella rubella]
Length=77

 Score = 59.7 bits (143),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 41/64 (64%), Gaps = 1/64 (2%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNG  257
            S+RL + V ++ M+F+A+GMG +    R C S+S  FKG C+ +  NC  VC +EGF  G
Sbjct  4    SMRLISAVLVMFMIFVATGMGPVTVEARTCESKSHRFKGTCL-SESNCKNVCHNEGFQGG  62

Query  258  SCTG  269
            +C G
Sbjct  63   NCRG  66



>ref|XP_009593293.1| PREDICTED: defensin-like protein P322 [Nicotiana tomentosiformis]
Length=78

 Score = 59.7 bits (143),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 43/67 (64%), Gaps = 2/67 (3%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMGIMA-AGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGF  248
            ++S+R FATV L+ +L MA+ MG M  A  R C S+S  FKG C   + NC TVC +EGF
Sbjct  2    ANSMRFFATVLLIALLVMATEMGPMTIAEARTCESQSHRFKGPCS-RDSNCATVCLTEGF  60

Query  249  SNGSCTG  269
            S G C G
Sbjct  61   SGGDCRG  67



>ref|XP_009351645.1| PREDICTED: defensin Ec-AMP-D2-like [Pyrus x bretschneideri]
Length=78

 Score = 59.7 bits (143),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 42/67 (63%), Gaps = 2/67 (3%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGM-GIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGF  248
              SVRLF+T  + V+L +A+GM G M A  R C + S+ FKG C  +  NC TVC++EGF
Sbjct  2    ERSVRLFSTAFVFVLLLVATGMMGPMLAEGRTCEAHSRKFKGHC-HSKSNCATVCQTEGF  60

Query  249  SNGSCTG  269
              G C G
Sbjct  61   QGGHCHG  67



>ref|XP_006367978.1| PREDICTED: defensin-like protein P322-like [Solanum tuberosum]
Length=79

 Score = 59.7 bits (143),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 42/67 (63%), Gaps = 2/67 (3%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMGIMAA-GPRMCSSRSQTFKGVCIFANGNCNTVCKSEGF  248
            + S+R FATV  L ML M + MG M     R+C S SQ FKG C+  + NC +VC++EGF
Sbjct  2    AHSMRFFATVLFLAMLVMDTKMGPMRIIEARICESPSQRFKGPCL-TDRNCASVCETEGF  60

Query  249  SNGSCTG  269
            + G C G
Sbjct  61   TGGDCRG  67



>emb|CDP10468.1| unnamed protein product [Coffea canephora]
Length=78

 Score = 59.7 bits (143),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 41/65 (63%), Gaps = 2/65 (3%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMG-IMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSN  254
            S+RLFAT  LL+MLFM++ M  +  A  R C S S  FKG C+    NC  VC++EGF  
Sbjct  4    SMRLFATAFLLLMLFMSTEMDPVRVAEARTCESLSHRFKGTCV-RGSNCAAVCQTEGFPG  62

Query  255  GSCTG  269
            G C+G
Sbjct  63   GQCSG  67



>gb|ACB32234.1| gamma-thionin/defensin [Solanum chacoense]
Length=76

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 44/66 (67%), Gaps = 2/66 (3%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFS  251
            ++S+RLFAT+ LL ML MA+G   +    R C S+S  FKG C+ +  NC +VC++EGFS
Sbjct  2    ANSMRLFATMLLLAMLVMATGPTRIVEA-RTCESQSHRFKGPCV-SEKNCASVCETEGFS  59

Query  252  NGSCTG  269
             G C G
Sbjct  60   GGDCRG  65



>ref|XP_006392063.1| hypothetical protein EUTSA_v10023787mg [Eutrema salsugineum]
 gb|ESQ29349.1| hypothetical protein EUTSA_v10023787mg [Eutrema salsugineum]
Length=79

 Score = 59.7 bits (143),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Frame = +3

Query  63   MAASSSVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSE  242
            M    S+ L + +++++ML +A+GMG +    RMC S SQ F G C+ +  NC  +C +E
Sbjct  1    MKMKISLPLISAIAIMLMLLLATGMGPVTVEARMCESSSQLFNGPCL-STTNCANICHNE  59

Query  243  GFSNGSCTG  269
            GF++G C G
Sbjct  60   GFTDGDCQG  68



>ref|XP_010250779.1| PREDICTED: defensin Ec-AMP-D2-like [Nelumbo nucifera]
Length=78

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFS  251
            + S+RLF+ + +++ L  A+GMG   A  R C S+S  FKG+C+    NC  VC++EGF 
Sbjct  2    ARSMRLFSILFVVLFLLTATGMGPKVAEARTCESQSHRFKGICV-RKSNCAAVCQTEGFH  60

Query  252  NGSCTG  269
             G C G
Sbjct  61   GGHCRG  66



>ref|NP_001234872.1| gamma-thionin precursor [Solanum lycopersicum]
 emb|CAB42006.1| gamma-thionin [Solanum lycopersicum]
Length=72

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 44/64 (69%), Gaps = 4/64 (6%)
 Frame = +3

Query  81   VRLFATVSLLVMLFMASG-MGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNG  257
            +RLFAT+ LL ML MA+G M I+ A  R C S+S  FKG C+ +  NC +VC++EGFS G
Sbjct  1    MRLFATMLLLAMLVMATGPMRIVEA--RTCESQSHRFKGPCV-SEKNCASVCETEGFSGG  57

Query  258  SCTG  269
             C G
Sbjct  58   DCRG  61



>ref|XP_006359485.1| PREDICTED: defensin-like protein-like [Solanum tuberosum]
Length=79

 Score = 59.3 bits (142),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 44/66 (67%), Gaps = 3/66 (5%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAGP--RMCSSRSQTFKGVCIFANGNCNTVCKSEGFS  251
            S+RLFAT  L+ ML +++ MG M+ G   R C S+S +FKG C+  + NC +VC++EGF 
Sbjct  4    SMRLFATFFLVAMLLLSTEMGPMSGGAEARTCESQSHSFKGPCV-GDTNCASVCQTEGFI  62

Query  252  NGSCTG  269
             G C G
Sbjct  63   GGDCRG  68



>ref|XP_006359486.1| PREDICTED: defensin-like protein-like [Solanum tuberosum]
Length=78

 Score = 58.9 bits (141),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 42/63 (67%), Gaps = 2/63 (3%)
 Frame = +3

Query  84   RLFATVSLLVMLFMASGMGIMA-AGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGS  260
            RLFAT  L+ ML ++S MG M+ A  R C S+S  FKG C+  + NC TVC++EGF  G+
Sbjct  6    RLFATFFLVAMLLLSSEMGTMSSAEARTCESQSNRFKGTCV-RDSNCATVCQTEGFIGGN  64

Query  261  CTG  269
            C G
Sbjct  65   CRG  67



>ref|XP_006395808.1| hypothetical protein EUTSA_v10005229mg [Eutrema salsugineum]
 gb|ACQ90607.1| defensin-like protein [Eutrema halophilum]
 gb|ESQ33094.1| hypothetical protein EUTSA_v10005229mg [Eutrema salsugineum]
Length=77

 Score = 58.9 bits (141),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 42/64 (66%), Gaps = 1/64 (2%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNG  257
            S+RL + + L+ M+F+A+GMG +    R C S+S  FKG C+ +  NC  VC +EGF+ G
Sbjct  4    SMRLISALLLVFMIFVATGMGPVTVEARKCESKSHRFKGKCL-SETNCKNVCHNEGFTGG  62

Query  258  SCTG  269
            +C G
Sbjct  63   NCRG  66



>ref|XP_009351646.1| PREDICTED: defensin Ec-AMP-D2-like [Pyrus x bretschneideri]
Length=78

 Score = 58.5 bits (140),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 44/67 (66%), Gaps = 2/67 (3%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGM-GIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGF  248
              S+RLF+T  + V+L +A+GM G M A  R C S+S+ FKG C+ +  NC +VC++EGF
Sbjct  2    ERSMRLFSTAFVFVLLLVATGMMGPMLAEGRTCESQSRKFKGACL-SRSNCASVCQTEGF  60

Query  249  SNGSCTG  269
              G C G
Sbjct  61   PGGHCRG  67



>ref|NP_178321.1| defensin-like protein 1 [Arabidopsis thaliana]
 sp|Q9ZUL7.1|DEF01_ARATH RecName: Full=Defensin-like protein 1; AltName: Full=Low-molecular-weight 
cysteine-rich protein 68; Short=Protein LCR68; 
AltName: Full=Plant defensin 2.3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC97221.1| protease inhibitor II [Arabidopsis thaliana]
 gb|AAK93656.1| putative protease inhibitor II [Arabidopsis thaliana]
 gb|AAL85136.1| putative protease inhibitor II [Arabidopsis thaliana]
 gb|AEC05549.1| defensin-like protein 1 [Arabidopsis thaliana]
Length=77

 Score = 58.5 bits (140),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 38/64 (59%), Gaps = 1/64 (2%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNG  257
            SVR  +   LL M+F+A+GMG +    R C S+S  FKG C+ +  NC  VC +EGF  G
Sbjct  4    SVRFISAALLLFMVFIATGMGPVTVEARTCESKSHRFKGPCV-STHNCANVCHNEGFGGG  62

Query  258  SCTG  269
             C G
Sbjct  63   KCRG  66



>gb|AGT51227.1| defensin [Brassica napus]
Length=77

 Score = 58.5 bits (140),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 40/64 (63%), Gaps = 1/64 (2%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNG  257
            S+RL + V L++M+F+ASGMG +    R   S+S  F+G C+ +  NC  VC +EGF  G
Sbjct  4    SLRLISAVLLMIMIFVASGMGPVTVEARTSESKSHKFRGPCV-SRHNCANVCHNEGFHGG  62

Query  258  SCTG  269
             C G
Sbjct  63   KCRG  66



>ref|NP_178319.1| defensin-like protein 2 [Arabidopsis thaliana]
 sp|Q39182.1|DEF02_ARATH RecName: Full=Defensin-like protein 2; AltName: Full=Low-molecular-weight 
cysteine-rich protein 69; Short=Protein LCR69; 
AltName: Full=Plant defensin 2.2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK44170.1|AF370355_1 putative protease inhibitor II [Arabidopsis thaliana]
 emb|CAA48892.1| protease inhibitor II [Arabidopsis thaliana]
 gb|AAC97223.1| protease inhibitor II [Arabidopsis thaliana]
 gb|AAX39303.1| defensin-like protein [Arabidopsis thaliana]
 gb|AEC05546.1| defensin-like protein 2 [Arabidopsis thaliana]
Length=77

 Score = 58.5 bits (140),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 42/64 (66%), Gaps = 1/64 (2%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNG  257
            S+RL + V ++ M+F+A+GMG +    R C S+S  FKG C+ A+ NC  VC +EGF  G
Sbjct  4    SMRLISAVLIMFMIFVATGMGPVTVEARTCESQSHRFKGTCVSAS-NCANVCHNEGFVGG  62

Query  258  SCTG  269
            +C G
Sbjct  63   NCRG  66



>ref|XP_004151187.1| PREDICTED: defensin J1-2-like [Cucumis sativus]
 ref|XP_004171498.1| PREDICTED: defensin J1-2-like [Cucumis sativus]
Length=74

 Score = 58.2 bits (139),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 39/63 (62%), Gaps = 1/63 (2%)
 Frame = +3

Query  81   VRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGS  260
            ++ F+    L++L   SGM  M A  R+C S S  FKG+C F++ NC  +CK+EGFS G 
Sbjct  1    MKFFSAPIFLLLLIFGSGMAPMVAEARVCESPSHNFKGLC-FSDTNCGNICKTEGFSGGV  59

Query  261  CTG  269
            C G
Sbjct  60   CRG  62



>ref|XP_009784025.1| PREDICTED: defensin J1-2 [Nicotiana sylvestris]
Length=77

 Score = 58.2 bits (139),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = +3

Query  84   RLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSC  263
            ++ A V L++ML  A+ MG M A  R C S+S  FKG+CI +  NC +VC +EGF+ G C
Sbjct  6    KVLAIVFLMLMLVFANEMGPMVAEARTCESQSHRFKGLCI-SKSNCASVCHTEGFNGGHC  64

Query  264  TG  269
             G
Sbjct  65   RG  66



>ref|XP_002875115.1| hypothetical protein ARALYDRAFT_484136 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51374.1| hypothetical protein ARALYDRAFT_484136 [Arabidopsis lyrata subsp. 
lyrata]
Length=77

 Score = 58.2 bits (139),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 40/64 (63%), Gaps = 1/64 (2%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNG  257
            S+RL + V ++ M+F+A+GMG +    R C S+S  FKG C+ +  NC  VC +EGF  G
Sbjct  4    SMRLISAVLIMFMVFVATGMGPVTVEARTCESKSHRFKGPCV-STHNCANVCHNEGFGGG  62

Query  258  SCTG  269
             C G
Sbjct  63   KCRG  66



>ref|XP_002865329.1| hypothetical protein ARALYDRAFT_917107 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41588.1| hypothetical protein ARALYDRAFT_917107 [Arabidopsis lyrata subsp. 
lyrata]
Length=81

 Score = 58.2 bits (139),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFS  251
             SS++L +T+  LV+L +A GM  M  G +MC ++S  F+G+C     NC  VC SEGF 
Sbjct  2    KSSIQLISTLFFLVILVLAPGMMKMVEGQQMCETQSINFRGMCTKWR-NCQRVCMSEGFP  60

Query  252  NGSCTG  269
            +G C G
Sbjct  61   DGRCKG  66



>sp|Q40901.1|DEF_PETIN RecName: Full=Defensin-like protein; AltName: Full=Gamma-thionin 
homolog PPT; Flags: Precursor [Petunia integrifolia]
 gb|AAA64740.1| gamma-thionin homolog [Petunia integrifolia subsp. inflata]
Length=78

 Score = 58.2 bits (139),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 42/63 (67%), Gaps = 2/63 (3%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIM-AAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSN  254
            S+RLFAT  L+ MLF+++ MG M +A  R C S+S  F G C+    NC +VC++EGF  
Sbjct  4    SIRLFATFFLIAMLFLSTEMGPMTSAEARTCESQSHRFHGTCV-RESNCASVCQTEGFIG  62

Query  255  GSC  263
            G+C
Sbjct  63   GNC  65



>ref|XP_008389119.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
Length=77

 Score = 57.8 bits (138),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 39/66 (59%), Gaps = 1/66 (2%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFS  251
              S+RLF+T  L ++L     MG M A  R C S+S  FKG C+ +  NC TVC++EGF 
Sbjct  2    ERSMRLFSTAFLFLLLVATGMMGPMVAEGRTCDSQSHRFKGSCV-SKSNCATVCQTEGFR  60

Query  252  NGSCTG  269
             G C G
Sbjct  61   GGHCRG  66



>ref|XP_009354384.1| PREDICTED: defensin Ec-AMP-D2-like [Pyrus x bretschneideri]
Length=78

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 42/67 (63%), Gaps = 2/67 (3%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGM-GIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGF  248
              S+RLF+T  + V+L +A+GM G M A  R C + S+ FKG C+    NC +VC++EGF
Sbjct  2    ERSMRLFSTAFVFVLLLVATGMMGPMLAEGRTCEAHSRKFKGTCL-GKSNCASVCQTEGF  60

Query  249  SNGSCTG  269
              G C G
Sbjct  61   HGGHCRG  67



>ref|XP_010910081.1| PREDICTED: defensin Ec-AMP-D2-like [Elaeis guineensis]
Length=77

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 38/66 (58%), Gaps = 1/66 (2%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFS  251
              S R+   + LLV++ +AS M  M    R C S+S  FKG C+ A+ NC  VCK+EGF 
Sbjct  2    ERSRRMLPAILLLVLIVVASEMATMMVEARTCESQSHKFKGPCLRAS-NCANVCKTEGFH  60

Query  252  NGSCTG  269
             G C G
Sbjct  61   GGKCRG  66



>dbj|BAA95697.1| thionin like protein [Nicotiana tabacum]
Length=78

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 42/67 (63%), Gaps = 2/67 (3%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMGIMA-AGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGF  248
            ++S+R FATV L+ +L  A+ MG M  A  R C S+S  FKG C   + NC TVC +EGF
Sbjct  2    ANSMRFFATVLLIALLVTATEMGPMTIAEARTCESQSHRFKGPCS-RDSNCATVCLTEGF  60

Query  249  SNGSCTG  269
            S G C G
Sbjct  61   SGGDCRG  67



>ref|XP_004297787.1| PREDICTED: defensin-like protein 2-like [Fragaria vesca subsp. 
vesca]
Length=79

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 43/68 (63%), Gaps = 3/68 (4%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMG--IMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEG  245
             S +R+F+ V + ++L +A+GMG   M A  R C S S  FKG C+ +  NC +VCK+EG
Sbjct  2    ESFMRMFSAVFVALLLLVATGMGPNTMVAEARTCESLSHKFKGTCL-SETNCASVCKTEG  60

Query  246  FSNGSCTG  269
            FS G C G
Sbjct  61   FSGGDCRG  68



>ref|XP_008340514.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
Length=78

 Score = 57.0 bits (136),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 45/67 (67%), Gaps = 2/67 (3%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGM-GIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGF  248
              S+RLF+T  + V+L +A+GM G + A  R C S+S+ FKG C+ +  NC +VC++EGF
Sbjct  2    ERSMRLFSTAFVFVLLLVATGMMGPLLAEGRTCESQSRKFKGTCL-SKTNCASVCQTEGF  60

Query  249  SNGSCTG  269
              G+C G
Sbjct  61   PGGNCRG  67



>gb|AGT51228.1| defensin [Brassica napus]
 emb|CDY03076.1| BnaC07g21510D [Brassica napus]
Length=76

 Score = 57.0 bits (136),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 41/64 (64%), Gaps = 2/64 (3%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNG  257
            S+RL + V LL M+F+A+GMG +    R C S+S  FKG C+ ++ NC  VC +EGF  G
Sbjct  4    SMRLISAV-LLFMIFVATGMGPVTVEARTCESKSHRFKGTCV-SSTNCGNVCHNEGFGGG  61

Query  258  SCTG  269
             C G
Sbjct  62   KCRG  65



>ref|XP_004242750.1| PREDICTED: defensin-like protein P322 [Solanum lycopersicum]
 gb|ABO36643.1| defensin protein [Solanum pimpinellifolium]
Length=78

 Score = 57.0 bits (136),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 45/69 (65%), Gaps = 6/69 (9%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMG---IMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSE  242
            + S+R FAT+ LL ML MA+ MG   I+ A  R C S S  FKG C+ ++ NC +VC++E
Sbjct  2    AQSIRFFATLFLLAMLVMATEMGPTRIVEA--RHCESLSHRFKGPCV-SDKNCASVCETE  58

Query  243  GFSNGSCTG  269
             FS G+C G
Sbjct  59   RFSGGNCRG  67



>gb|EYU30124.1| hypothetical protein MIMGU_mgv1a017438mg [Erythranthe guttata]
Length=75

 Score = 57.0 bits (136),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 40/66 (61%), Gaps = 3/66 (5%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFS  251
            +S +RLFAT   +VML  ++GM  +A   R C ++S  FKG+C     NC  VC++EGF 
Sbjct  2    ASFLRLFATALFMVMLVFSTGM--VAEATRTCEAKSHRFKGICA-RKANCAAVCQTEGFH  58

Query  252  NGSCTG  269
             G C G
Sbjct  59   GGHCRG  64



>ref|XP_009413079.1| PREDICTED: defensin Ec-AMP-D2 {ECO:0000303|PubMed:18625284}-like 
[Musa acuminata subsp. malaccensis]
Length=81

 Score = 57.0 bits (136),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 36/66 (55%), Gaps = 1/66 (2%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFS  251
              S R+   + LL +L + S MG+ +   R C S S  FKG+C F   NC  VCK+EGF 
Sbjct  2    EDSRRMLPAIVLLFLLLITSDMGMTSVEARKCESASHKFKGLC-FRASNCANVCKTEGFH  60

Query  252  NGSCTG  269
             G C G
Sbjct  61   GGHCRG  66



>gb|ACJ26760.1| protease inhibitor-related protein [Solanum tuberosum]
Length=78

 Score = 56.6 bits (135),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 40/65 (62%), Gaps = 2/65 (3%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMA-AGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSN  254
            S+R FAT  LL ML MA+ MG M  A  R C S S  FKG C   + NC +VC++E FS 
Sbjct  4    SMRFFATFFLLAMLVMATEMGPMRIAEARHCESLSHRFKGPCT-RDSNCASVCETERFSG  62

Query  255  GSCTG  269
            G+C G
Sbjct  63   GNCHG  67



>ref|XP_006585876.1| PREDICTED: defensin-like protein-like [Glycine max]
Length=127

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 44/65 (68%), Gaps = 2/65 (3%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMG-IMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSN  254
            SV L +T+ +L++L +A+ MG  M A  R C S+S  FKG C+ ++ NC +VC++EGFS 
Sbjct  4    SVPLVSTIFVLLLLLIATEMGPTMVAEARTCESQSHRFKGPCL-SDTNCGSVCRTEGFSG  62

Query  255  GSCTG  269
            G C G
Sbjct  63   GHCRG  67



>gb|KHN06998.1| Defensin-like protein [Glycine soja]
Length=84

 Score = 56.6 bits (135),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 44/65 (68%), Gaps = 2/65 (3%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMG-IMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSN  254
            SV L +T+ +L++L +A+ MG  M A  R C S+S  FKG C+ ++ NC +VC++EGFS 
Sbjct  4    SVPLVSTIFVLLLLLIATEMGPTMVAEARTCESQSHRFKGPCL-SDTNCGSVCRTEGFSG  62

Query  255  GSCTG  269
            G C G
Sbjct  63   GHCRG  67



>ref|XP_007223891.1| hypothetical protein PRUPE_ppa014246mg [Prunus persica]
 ref|XP_008220985.1| PREDICTED: defensin Ec-AMP-D2-like [Prunus mume]
 gb|EMJ25090.1| hypothetical protein PRUPE_ppa014246mg [Prunus persica]
Length=78

 Score = 56.6 bits (135),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 2/65 (3%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGM-GIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSN  254
            S+RLF+T  +  +L  A+GM G M A  R C S+S  FKG C+ +  NC +VC++EGF  
Sbjct  4    SMRLFSTAFVFFLLLAAAGMMGPMVAEARTCESQSNRFKGTCV-STSNCASVCQTEGFPG  62

Query  255  GSCTG  269
            G C G
Sbjct  63   GHCRG  67



>ref|XP_004242748.1| PREDICTED: defensin-like protein [Solanum lycopersicum]
 gb|ABO36638.1| defensin protein [Solanum lycopersicum]
 gb|ABO36642.1| defensin protein [Solanum pimpinellifolium]
Length=79

 Score = 56.2 bits (134),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 45/68 (66%), Gaps = 3/68 (4%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMAS-GMG-IMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEG  245
            + S+RLFAT  L+ ML + S  MG I +A  R C S+S +FKG C+  + NC TVC++EG
Sbjct  2    AHSIRLFATFFLVAMLLLLSTEMGPISSAEARTCESQSNSFKGTCV-RDSNCATVCQTEG  60

Query  246  FSNGSCTG  269
            F  G+C G
Sbjct  61   FIGGNCRG  68



>ref|XP_006292097.1| hypothetical protein CARUB_v10018292mg, partial [Capsella rubella]
 gb|EOA24995.1| hypothetical protein CARUB_v10018292mg, partial [Capsella rubella]
Length=103

 Score = 56.6 bits (135),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFS  251
            S+RL + V L+ M+F+A+GMG +    R C S+S  FKG C+  N NC  VC +EGF 
Sbjct  30   SMRLISAVLLVFMIFVATGMGPVTVEARTCESKSHRFKGPCVSGN-NCKNVCHNEGFP  86



>ref|XP_009599356.1| PREDICTED: defensin-like protein [Nicotiana tomentosiformis]
Length=75

 Score = 55.8 bits (133),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 41/63 (65%), Gaps = 2/63 (3%)
 Frame = +3

Query  84   RLFATVSLLVMLFMASGMGIMA-AGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGS  260
            RLFAT  L+ ML +A+ MG M+ A  R C S+S  F G C+  + NC ++C++EGF  G+
Sbjct  3    RLFATFFLVAMLLLATEMGQMSSAEARTCESQSHRFHGTCV-RDSNCASICQTEGFIGGN  61

Query  261  CTG  269
            C G
Sbjct  62   CRG  64



>ref|XP_007159919.1| hypothetical protein PHAVU_002G278700g [Phaseolus vulgaris]
 gb|ESW31913.1| hypothetical protein PHAVU_002G278700g [Phaseolus vulgaris]
Length=74

 Score = 55.8 bits (133),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +3

Query  105  LLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCTG  269
             L+ L +A+ + +  A  R+C S SQ FKG+C F+N NC TVC +EGF+ G C G
Sbjct  10   FLLFLVLAADVAVKRAEARLCWSESQAFKGLC-FSNDNCATVCLTEGFTGGKCEG  63



>gb|AAL85480.1| defensin protein 1 [Prunus persica]
Length=79

 Score = 55.8 bits (133),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 3/66 (5%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGM--GIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFS  251
            S+RLF+T  +  +L  A+GM  G M A  R C S+S  FKG C+ +  NC +VC++EGF 
Sbjct  4    SMRLFSTAFVFFLLLAAAGMMMGPMVAEARTCESQSNRFKGTCV-STSNCASVCQTEGFP  62

Query  252  NGSCTG  269
             G C G
Sbjct  63   GGHCRG  68



>gb|AFW90621.1| protease inhibitor-related protein [Solanum tuberosum]
 gb|AIT42151.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 55.8 bits (133),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 40/65 (62%), Gaps = 2/65 (3%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMA-AGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSN  254
            S+R FAT  LL ML MA+ MG M  A  R C S S  FKG C   + NC +VC++E FS 
Sbjct  4    SMRFFATFFLLAMLVMATEMGPMRIAEARNCESLSHRFKGPCT-RDSNCASVCETERFSG  62

Query  255  GSCTG  269
            G+C G
Sbjct  63   GNCHG  67



>gb|AIT42148.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 55.5 bits (132),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 41/67 (61%), Gaps = 2/67 (3%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMGIMA-AGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGF  248
            + S+R F TV LL M+ MA+ MG M  A  R C S S  FKG C   + NC +VC++E F
Sbjct  2    AHSMRFFTTVFLLAMIVMATEMGPMRIAEARNCESLSHRFKGPCT-RDSNCASVCETERF  60

Query  249  SNGSCTG  269
            S G+C G
Sbjct  61   SGGNCHG  67



>ref|XP_006359487.1| PREDICTED: defensin-like protein-like [Solanum tuberosum]
Length=76

 Score = 55.5 bits (132),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 42/65 (65%), Gaps = 2/65 (3%)
 Frame = +3

Query  75   SSVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSN  254
            +S+RLFAT  L+ ML +A+G        R C S+S  FKG C+ ++ NC +VC +EGF+ 
Sbjct  3    NSLRLFATFFLVTMLLLATGPTTRVEA-RTCESKSHHFKGKCL-SDTNCGSVCHTEGFTG  60

Query  255  GSCTG  269
            G+C G
Sbjct  61   GNCRG  65



>ref|XP_004242747.1| PREDICTED: defensin-like protein [Solanum lycopersicum]
 gb|ABO36635.1| defensin protein [Solanum lycopersicum]
 gb|ABO36640.1| defensin protein [Solanum pimpinellifolium]
Length=76

 Score = 55.5 bits (132),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 44/65 (68%), Gaps = 2/65 (3%)
 Frame = +3

Query  75   SSVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSN  254
            +S+RLFAT  L+ ML +A+G    +   R C S+S  FKG C+ ++ NC +VC++EGF+ 
Sbjct  3    NSLRLFATFFLVAMLLLATGP-TTSVEARTCESQSHHFKGNCL-SDTNCGSVCRTEGFTG  60

Query  255  GSCTG  269
            G+C G
Sbjct  61   GNCRG  65



>ref|XP_002862935.1| low-molecular-weight cysteine-rich 76 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002879354.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39194.1| low-molecular-weight cysteine-rich 76 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55613.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=83

 Score = 55.5 bits (132),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 45/69 (65%), Gaps = 2/69 (3%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMGIMAAG-PRMCSSRSQTFKGVCIFANGNCNTVCKSEGF  248
             SS++L +T+  LV+L +A GM ++  G P++C ++S  ++G+C+    NC  VC SEGF
Sbjct  2    KSSMQLISTLFFLVILVVAPGMKMVVEGQPQLCETKSLNYRGLCMKWR-NCKRVCISEGF  60

Query  249  SNGSCTGSY  275
             +G C G +
Sbjct  61   PDGRCKGFF  69



>ref|XP_007159918.1| hypothetical protein PHAVU_002G278600g [Phaseolus vulgaris]
 gb|ESW31912.1| hypothetical protein PHAVU_002G278600g [Phaseolus vulgaris]
Length=75

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = +3

Query  102  SLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCTGS  272
            +L++++  AS MG+M +  R+C S S +FKG+C F + NC  VC +EGF+ G C G+
Sbjct  10   ALVLLVIFASDMGVMKSEARLCESPSHSFKGLC-FNDRNCANVCLTEGFTGGKCEGA  65



>ref|XP_011070574.1| PREDICTED: defensin J1-2-like [Sesamum indicum]
Length=74

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 40/63 (63%), Gaps = 4/63 (6%)
 Frame = +3

Query  81   VRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGS  260
            +R+FAT  +++ML  ++GM    A  R C S+S  FKG+C+    NC  VC++EGF +G 
Sbjct  5    LRMFATAFVMLMLVFSTGM---VAEARKCESQSHRFKGICL-RKANCAAVCQTEGFHSGH  60

Query  261  CTG  269
            C G
Sbjct  61   CRG  63



>ref|XP_006420697.1| hypothetical protein CICLE_v10006362mg [Citrus clementina]
 ref|XP_006470884.1| PREDICTED: defensin-like protein-like [Citrus sinensis]
 gb|ESR33937.1| hypothetical protein CICLE_v10006362mg [Citrus clementina]
 gb|KDO53542.1| hypothetical protein CISIN_1g034999mg [Citrus sinensis]
Length=76

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 45/64 (70%), Gaps = 2/64 (3%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNG  257
            SVRLF+TV L+++L +AS MG+ AA  R+C S+S  FKG C+ +  NC  VC++EGF  G
Sbjct  4    SVRLFSTVLLVLLL-LASEMGLRAAEARICESQSHRFKGPCV-SKSNCAAVCQTEGFHGG  61

Query  258  SCTG  269
             C G
Sbjct  62   HCRG  65



>ref|XP_006367121.1| PREDICTED: defensin J1-2-like [Solanum tuberosum]
Length=74

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 41/62 (66%), Gaps = 4/62 (6%)
 Frame = +3

Query  84   RLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSC  263
            +L AT+ L++ML  ++GM    A  R C S+S+ FKG+C F+  NC +VC +EGFS G C
Sbjct  6    KLVATILLMLMLVFSTGM---IAEARTCESQSRRFKGLC-FSKSNCGSVCHTEGFSGGHC  61

Query  264  TG  269
             G
Sbjct  62   RG  63



>ref|XP_009802655.1| PREDICTED: defensin-like protein [Nicotiana sylvestris]
Length=75

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 41/63 (65%), Gaps = 2/63 (3%)
 Frame = +3

Query  84   RLFATVSLLVMLFMASGMGIMA-AGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGS  260
            RLFAT  L+ ML +A+ MG M+ A  R C S+S  F G C+  + NC +VC++EGF  G+
Sbjct  3    RLFATFFLVAMLLLATEMGPMSSAEARTCESQSHRFHGTCVRGS-NCASVCQTEGFIGGN  61

Query  261  CTG  269
            C G
Sbjct  62   CRG  64



>emb|CDP16306.1| unnamed protein product [Coffea canephora]
Length=78

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 40/60 (67%), Gaps = 2/60 (3%)
 Frame = +3

Query  75   SSVRLFATVSLLVMLFMASGMG-IMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFS  251
            S +RL ATV LL+ LFMAS MG I  A  R+C S+S  FKG CI  + NC  VC++EGF 
Sbjct  3    SFMRLSATVLLLLALFMASVMGPIGVAEARICESQSHRFKGPCIRKD-NCAAVCQTEGFH  61



>gb|AFE88173.1| g-thionin [Panax ginseng]
Length=75

 Score = 54.3 bits (129),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 39/63 (62%), Gaps = 3/63 (5%)
 Frame = +3

Query  81   VRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGS  260
            +RLF T+ +++ML MA+G  +  A  R C S+S  FKG C  +  NC  VCK+EGF  G 
Sbjct  5    MRLFTTIFMVLMLLMATG--LEPAEGRTCESQSHKFKGTCA-SGTNCANVCKTEGFPGGK  61

Query  261  CTG  269
            C G
Sbjct  62   CRG  64



>sp|O65740.1|DEF2_CAPAN RecName: Full=Defensin J1-2; Flags: Precursor [Capsicum annuum]
 emb|CAA65046.1| unnamed protein product [Capsicum annuum]
Length=74

 Score = 53.9 bits (128),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 40/62 (65%), Gaps = 4/62 (6%)
 Frame = +3

Query  84   RLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSC  263
            ++ AT+ L++ML  A+GM    A  R C S+S  FKG+C F+  NC +VC +EGF+ G C
Sbjct  6    KVIATIFLMMMLVFATGM---VAEARTCESQSHRFKGLC-FSKSNCGSVCHTEGFNGGHC  61

Query  264  TG  269
             G
Sbjct  62   RG  63



>ref|XP_010043884.1| PREDICTED: defensin Ec-AMP-D2-like [Eucalyptus grandis]
 gb|KCW85903.1| hypothetical protein EUGRSUZ_B02620 [Eucalyptus grandis]
Length=77

 Score = 53.9 bits (128),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 38/64 (59%), Gaps = 1/64 (2%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNG  257
            S RL     ++++L +A+ M  M    R C S+SQ FKG C+ +  NC +VC++EGF  G
Sbjct  4    SKRLIPAALIVMLLLVATEMEPMVVEARTCESQSQRFKGACV-SKTNCASVCQTEGFHGG  62

Query  258  SCTG  269
             C G
Sbjct  63   HCRG  66



>ref|XP_007202934.1| hypothetical protein PRUPE_ppa016748mg [Prunus persica]
 ref|XP_007202943.1| hypothetical protein PRUPE_ppa016379mg [Prunus persica]
 ref|XP_007203068.1| hypothetical protein PRUPE_ppa023476mg [Prunus persica]
 gb|EMJ04133.1| hypothetical protein PRUPE_ppa016748mg [Prunus persica]
 gb|EMJ04142.1| hypothetical protein PRUPE_ppa016379mg [Prunus persica]
 gb|EMJ04267.1| hypothetical protein PRUPE_ppa023476mg [Prunus persica]
Length=85

 Score = 53.9 bits (128),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 41/72 (57%), Gaps = 9/72 (13%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAG--------PRMCSSRSQTFKGVCIFANGNCNTVC  233
            S R+F+TV +LV+LF+A G G M A          R C S S  FKG CI ++ NC  +C
Sbjct  4    SKRMFSTVFILVLLFVAIGTGPMVAEGKVETKETSRTCESLSTKFKGPCIRSS-NCANIC  62

Query  234  KSEGFSNGSCTG  269
            + EGF  G C G
Sbjct  63   EEEGFKGGKCVG  74



>ref|XP_004297786.1| PREDICTED: defensin-like protein 2-like [Fragaria vesca subsp. 
vesca]
Length=79

 Score = 53.9 bits (128),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 42/68 (62%), Gaps = 3/68 (4%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMG--IMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEG  245
             S +R+F+ V + ++L +A+GMG   M A  R C + S  FKG C+    NC +VC++EG
Sbjct  2    ESFMRMFSAVFVALLLLVATGMGPNAMVAEARTCETLSHKFKGTCL-RESNCASVCQTEG  60

Query  246  FSNGSCTG  269
            F+ G C G
Sbjct  61   FTGGDCRG  68



>gb|AIT42153.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 53.9 bits (128),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 40/65 (62%), Gaps = 2/65 (3%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMA-AGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSN  254
            S+R FAT  LL ML M++ MG M     R C S S  FKG C  ++ NC +VC++E FS 
Sbjct  4    SMRFFATFFLLAMLVMSTEMGPMRIVEARHCESLSHRFKGPCA-SDKNCASVCETERFSG  62

Query  255  GSCTG  269
            G+C G
Sbjct  63   GNCRG  67



>ref|XP_011070572.1| PREDICTED: defensin J1-2-like [Sesamum indicum]
Length=74

 Score = 53.5 bits (127),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 39/60 (65%), Gaps = 4/60 (7%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFS  251
            +S +RLFA V L++ML  +SGM    A  R+C S+S  F+G+C+    NC  VC++EGF 
Sbjct  2    ASFLRLFAAVFLMLMLVFSSGM---VAEARICESKSHRFRGICV-RKANCAAVCQTEGFH  57



>ref|XP_003629332.1| Defensin [Medicago truncatula]
 gb|AET03808.1| Defensin MtDef4.5 [Medicago truncatula]
Length=81

 Score = 53.9 bits (128),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 41/59 (69%), Gaps = 2/59 (3%)
 Frame = +3

Query  96   TVSLLVMLFMASGMG-IMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCTG  269
            T+ L +++ +A+ MG IM    R C S+S +FKG+C+ ++ NC TVC +EGF++G C G
Sbjct  10   TIFLFLLVLVATEMGSIMVVEARKCLSQSHSFKGLCL-SDQNCATVCLTEGFTDGRCRG  67



>sp|P20346.1|DF322_SOLTU RecName: Full=Defensin-like protein P322; AltName: Full=Probable 
protease inhibitor P322; Flags: Precursor [Solanum tuberosum]
 emb|CAA31577.1| unnamed protein product [Solanum tuberosum]
Length=74

 Score = 53.5 bits (127),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 39/64 (61%), Gaps = 2/64 (3%)
 Frame = +3

Query  81   VRLFATVSLLVMLFMASGMGIMA-AGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNG  257
            +R FAT  LL ML +A+ MG M  A  R C S S  FKG C   + NC +VC++E FS G
Sbjct  1    MRFFATFFLLAMLVVATKMGPMRIAEARHCESLSHRFKGPCT-RDSNCASVCETERFSGG  59

Query  258  SCTG  269
            +C G
Sbjct  60   NCHG  63



>gb|ADQ43196.1| unknown [Eutrema parvulum]
Length=76

 Score = 53.5 bits (127),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 40/64 (63%), Gaps = 2/64 (3%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNG  257
            S+RL +   L+ M+F+A+ MG +    R C S+S  FKG C+ ++GNC  VC +EGF  G
Sbjct  4    SMRLISAALLMFMIFVAA-MGPVTVEARTCESQSHRFKGKCL-SDGNCGNVCHNEGFGGG  61

Query  258  SCTG  269
             C G
Sbjct  62   KCRG  65



>gb|AAS65426.1| Kunitz-type trypsin inhibitor [Ipomoea batatas]
Length=80

 Score = 53.5 bits (127),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 35/57 (61%), Gaps = 4/57 (7%)
 Frame = +3

Query  108  LVMLFMASGMG---IMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCTG  269
             VMLFMA+ +G   IM A  RMC S S  FKG C   + NC TVC +EGF+ G C G
Sbjct  14   FVMLFMATELGTNRIMVAEARMCESASSKFKGPCS-RDSNCATVCHTEGFTGGDCKG  69



>gb|AIT42152.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 53.5 bits (127),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 40/65 (62%), Gaps = 2/65 (3%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMA-AGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSN  254
            S+R F+T  LL ML MA+ MG M     R C S S  FKG C  ++ NC +VC++E FS 
Sbjct  4    SMRFFSTFFLLAMLVMATEMGPMRIVEARHCESLSHRFKGPCA-SDRNCASVCETERFSG  62

Query  255  GSCTG  269
            G+C G
Sbjct  63   GNCRG  67



>ref|XP_004509603.1| PREDICTED: defensin-like protein-like [Cicer arietinum]
Length=78

 Score = 53.5 bits (127),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 43/67 (64%), Gaps = 2/67 (3%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGM-GIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGF  248
            + SV L +T+ ++ +L +A+ M  IM A  R C S S +FKG+C+  + NC  VC++EGF
Sbjct  2    ARSVPLVSTIIVIFLLLVATEMRPIMVAEARTCESLSYSFKGLCV-RDHNCAVVCQTEGF  60

Query  249  SNGSCTG  269
            + G C G
Sbjct  61   TGGQCKG  67



>gb|AIT42149.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 53.5 bits (127),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 40/65 (62%), Gaps = 2/65 (3%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMA-AGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSN  254
            S+R F+T  LL ML MA+ MG M     R C S S  FKG C  ++ NC +VC++E FS 
Sbjct  4    SMRFFSTFFLLAMLVMATEMGPMRIVEARHCESLSHRFKGPCA-SDRNCASVCETERFSG  62

Query  255  GSCTG  269
            G+C G
Sbjct  63   GNCRG  67



>sp|P82659.1|DFSD2_HELAN RecName: Full=Defensin SD2; AltName: Full=Flower-specific gamma-thionin; 
Flags: Precursor [Helianthus annuus]
 gb|AAF66591.1|AF141131_1 defensin [Helianthus annuus]
 gb|AAF72042.1|AF178634_1 defensin SD2 [Helianthus annuus]
Length=78

 Score = 53.5 bits (127),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 41/67 (61%), Gaps = 2/67 (3%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMG-IMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGF  248
             SS+++FA + L+VM  +A+ MG  +    R C S+S  FKG C+ ++ NC  VC SE F
Sbjct  2    KSSMKMFAALLLVVMCLLANEMGGPLVVEARTCESQSHKFKGTCL-SDTNCANVCHSERF  60

Query  249  SNGSCTG  269
            S G C G
Sbjct  61   SGGKCRG  67



>ref|NP_001031460.1| low-molecular-weight cysteine-rich 76 [Arabidopsis thaliana]
 sp|P82785.1|DEF09_ARATH RecName: Full=Putative defensin-like protein 9; AltName: Full=Putative 
low-molecular-weight cysteine-rich protein 76; Short=Protein 
LCR76; Flags: Precursor [Arabidopsis thaliana]
 gb|AEC08607.1| low-molecular-weight cysteine-rich 76 [Arabidopsis thaliana]
Length=86

 Score = 53.5 bits (127),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 45/69 (65%), Gaps = 2/69 (3%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMGIMAAG-PRMCSSRSQTFKGVCIFANGNCNTVCKSEGF  248
             SS++L +T+  LV+L +A GM ++  G P++C ++S  ++G+C+    +C  VC SEGF
Sbjct  2    KSSMQLISTLFFLVILVVAPGMKMVVEGQPQLCETKSLNYRGLCLKWR-SCKRVCISEGF  60

Query  249  SNGSCTGSY  275
             +G C G +
Sbjct  61   PDGRCKGFF  69



>gb|ACN93800.1| defensin precursor [Vigna unguiculata]
Length=78

 Score = 53.5 bits (127),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 43/67 (64%), Gaps = 2/67 (3%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMG-IMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGF  248
            + SV L +T+ + ++L +A+ MG  M A  R C S+S  FKG C+ ++ NC +VC++E F
Sbjct  2    ARSVPLVSTIFVFLLLLVATEMGPTMVAEARTCESQSHRFKGPCV-SDTNCASVCRTERF  60

Query  249  SNGSCTG  269
            S G C G
Sbjct  61   SGGHCRG  67



>ref|XP_003628979.1| Defensin [Medicago truncatula]
 ref|XP_003636616.1| Defensin [Medicago truncatula]
 gb|AET03455.1| Defensin MtDef4.4 [Medicago truncatula]
Length=78

 Score = 53.1 bits (126),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 43/67 (64%), Gaps = 2/67 (3%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMG-IMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGF  248
            + S+ L +T+ +  +L +A+ MG IM A  R C + S  FKG+C+ ++ NC +VC++EGF
Sbjct  2    ARSLPLVSTIFVFFLLLVATEMGPIMVAEARTCETPSNNFKGLCV-SDTNCASVCQTEGF  60

Query  249  SNGSCTG  269
              G C G
Sbjct  61   PGGHCEG  67



>ref|XP_004509604.1| PREDICTED: defensin-like protein P322-like [Cicer arietinum]
Length=78

 Score = 53.1 bits (126),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 43/67 (64%), Gaps = 2/67 (3%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMG-IMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGF  248
            + S+   +T+ ++ +L +A+ MG I  A  R+C S+S TFKG C+  + +C  VC++EGF
Sbjct  2    ARSIPFISTIFVMFLLLVATEMGPIKVAEARICDSQSNTFKGPCVI-DHSCAIVCQTEGF  60

Query  249  SNGSCTG  269
            + G C G
Sbjct  61   TGGQCEG  67



>ref|XP_008349481.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
 ref|XP_008344620.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
 ref|XP_008363304.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
 gb|AFH74424.1| defensin [Malus domestica]
Length=75

 Score = 52.8 bits (125),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 40/66 (61%), Gaps = 3/66 (5%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFS  251
              S+RLF T  + ++L +A+G   M A  R C S+S  FKG C+ +  NC  VC++EGF 
Sbjct  2    ERSMRLFPTAFVFLLLLVATG--TMVAEGRTCESQSNRFKGTCV-SKSNCAAVCQTEGFP  58

Query  252  NGSCTG  269
             G+C G
Sbjct  59   GGNCRG  64



>ref|XP_003628978.1| Defensin [Medicago truncatula]
 ref|XP_003636615.1| Defensin [Medicago truncatula]
 gb|AET03454.1| Defensin MtDef4.3 [Medicago truncatula]
Length=77

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 39/64 (61%), Gaps = 1/64 (2%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNG  257
            SV L +T+ +  +L +A+ MG      R C + S +FKG C F++ NC +VC++EGF  G
Sbjct  4    SVSLVSTIFVFFLLIVATEMGPSMVAARTCETPSNSFKGAC-FSDTNCASVCQTEGFPGG  62

Query  258  SCTG  269
             C G
Sbjct  63   HCKG  66



>ref|XP_007045354.1| Defensin-like protein isoform 2 [Theobroma cacao]
 gb|EOY01186.1| Defensin-like protein isoform 2 [Theobroma cacao]
Length=77

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 42/66 (64%), Gaps = 1/66 (2%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNG  257
            S RLF+   +L++L +A+ MG  AA  R C S+S  FKG+C+    NC  VC++EGF +G
Sbjct  4    STRLFSAAFVLLLLLLATEMGPKAAEARTCQSQSHRFKGMCM-RKSNCAAVCQTEGFHSG  62

Query  258  SCTGSY  275
             C G +
Sbjct  63   HCRGFH  68



>gb|AIT42147.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 39/65 (60%), Gaps = 2/65 (3%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMA-AGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSN  254
            S+R F  V LL M+ MA+ MG M     R C S S  FKG C  ++ NC +VC++E FS 
Sbjct  4    SMRFFTIVFLLAMIVMATEMGPMRIVEARHCESLSHRFKGPCA-SDKNCASVCETERFSG  62

Query  255  GSCTG  269
            G+C G
Sbjct  63   GNCRG  67



>ref|NP_001234987.1| protease inhibitor precursor [Glycine max]
 gb|AAC97524.1| protease inhibitor [Glycine max]
Length=79

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 43/68 (63%), Gaps = 3/68 (4%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGM--GIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEG  245
            S SV L +T+ +L++L +A+ M    M A  R C S+S  FKG C+ ++ NC +VC++E 
Sbjct  2    SRSVPLVSTICVLLLLLVATEMMGPTMVAEARTCESQSHRFKGPCL-SDTNCGSVCRTER  60

Query  246  FSNGSCTG  269
            F+ G C G
Sbjct  61   FTGGHCRG  68



>gb|KFK26328.1| hypothetical protein AALP_AA8G233400 [Arabis alpina]
Length=78

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 39/65 (60%), Gaps = 2/65 (3%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMAS-GMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSN  254
            S RL +T+ +L ML +A+ G+G +    R C + SQ F G C+ +  NC  VC +EGF +
Sbjct  4    SPRLISTIPVLFMLLVATTGIGPVTVEARTCETSSQLFNGPCL-STTNCANVCHNEGFPD  62

Query  255  GSCTG  269
            G C G
Sbjct  63   GDCRG  67



>gb|ADB02899.1| gamma-thionin PPT precursor defensin 1-like protein [Jatropha 
curcas]
Length=92

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 1/64 (2%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNG  257
             +RLF+T+ LL++L +A+  G M A  R C S S  FKG+C+  N NC  +C++EGF  G
Sbjct  4    PMRLFSTLLLLLLLLLATETGPMVAEARTCESLSHRFKGICV-RNSNCAAICQTEGFQGG  62

Query  258  SCTG  269
             C G
Sbjct  63   HCRG  66



>ref|XP_006647552.1| PREDICTED: defensin-like protein P322-like [Oryza brachyantha]
Length=80

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 2/65 (3%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMGI-MAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGF  248
            + S R+ A+V LL+ + +A+ MG    A  R C S+S  FKG+C+ +N NC  VCK+E F
Sbjct  2    APSRRMVASVFLLLAILVATEMGTTQVAEARHCLSQSHRFKGMCVSSN-NCANVCKTENF  60

Query  249  SNGSC  263
             +G C
Sbjct  61   PDGEC  65



>ref|XP_007204040.1| hypothetical protein PRUPE_ppa021088mg [Prunus persica]
 gb|EMJ05239.1| hypothetical protein PRUPE_ppa021088mg [Prunus persica]
Length=73

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 37/62 (60%), Gaps = 5/62 (8%)
 Frame = +3

Query  84   RLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSC  263
            R+F+TV +LV+LF+A+         R C S S  FKG+C F + NC  +CK EGF  G C
Sbjct  6    RMFSTVFILVLLFVAA----TKENSRTCESLSTKFKGLC-FRSSNCADICKKEGFLEGKC  60

Query  264  TG  269
             G
Sbjct  61   AG  62



>ref|XP_007202863.1| hypothetical protein PRUPE_ppa015550mg [Prunus persica]
 gb|EMJ04062.1| hypothetical protein PRUPE_ppa015550mg [Prunus persica]
Length=85

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 40/72 (56%), Gaps = 9/72 (13%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAG--------PRMCSSRSQTFKGVCIFANGNCNTVC  233
            S R+F+ V +LV+LF+A G G M A          R C S S  FKG CI ++ NC  +C
Sbjct  4    SKRMFSIVFILVLLFVAIGTGPMVAEGKVETKETSRTCESLSTKFKGPCIRSS-NCANIC  62

Query  234  KSEGFSNGSCTG  269
            + EGF  G C G
Sbjct  63   EEEGFKGGKCVG  74



>ref|XP_007156391.1| hypothetical protein PHAVU_003G282500g [Phaseolus vulgaris]
 gb|ADR30067.1| defensin D2 [Phaseolus vulgaris]
 gb|ESW28385.1| hypothetical protein PHAVU_003G282500g [Phaseolus vulgaris]
Length=78

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 42/67 (63%), Gaps = 2/67 (3%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMGI-MAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGF  248
            + SV   +T+ + ++L +A+ MG  M A  R C S+S  FKG C+ ++ NC +VC++E F
Sbjct  2    ARSVSFVSTIFVFLLLLLATEMGPRMVAEARTCESQSHRFKGPCV-SDTNCASVCRTERF  60

Query  249  SNGSCTG  269
            S G C G
Sbjct  61   SGGHCRG  67



>gb|AIA67014.1| defensin [Triticum aestivum]
Length=75

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 42/66 (64%), Gaps = 3/66 (5%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFS  251
             SS +LF  V++L++L +A+   ++ A  R C + S+ F G+C F + NC  VC +EGF+
Sbjct  2    ESSHKLFPAVAILLLLVVATE--VVPAQARECETESERFNGLC-FVSANCAGVCNAEGFT  58

Query  252  NGSCTG  269
             G C+G
Sbjct  59   GGKCSG  64



>gb|KDP32807.1| hypothetical protein JCGZ_12099 [Jatropha curcas]
Length=77

 Score = 51.6 bits (122),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 41/63 (65%), Gaps = 1/63 (2%)
 Frame = +3

Query  81   VRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGS  260
            +RLF+T+ LL++L +A+  G M A  R C S S  FKG+C+  N NC  +C++EGF  G 
Sbjct  5    MRLFSTLLLLLLLLLATETGPMVAEARTCESLSHRFKGICV-RNSNCAAICQTEGFQGGH  63

Query  261  CTG  269
            C G
Sbjct  64   CRG  66



>ref|XP_007203287.1| hypothetical protein PRUPE_ppa025677mg [Prunus persica]
 gb|EMJ04486.1| hypothetical protein PRUPE_ppa025677mg [Prunus persica]
Length=85

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 39/72 (54%), Gaps = 9/72 (13%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAG--------PRMCSSRSQTFKGVCIFANGNCNTVC  233
            S R+F+TV +LV+L +A G G M A          R C S S  FKG C F + NC  +C
Sbjct  4    SRRMFSTVFILVLLLVAIGTGPMVAEGKVETKETSRTCESLSTKFKGPC-FRSSNCANIC  62

Query  234  KSEGFSNGSCTG  269
            + EGF  G C G
Sbjct  63   EKEGFKGGKCVG  74



>gb|KHN23780.1| Defensin SD2 [Glycine soja]
Length=79

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 43/68 (63%), Gaps = 3/68 (4%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGM--GIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEG  245
            S SV L +T+ +L++L +A+ M    M A  R C S+S  FKG C+ ++ NC +VC++E 
Sbjct  2    SRSVPLVSTIFVLLLLLVATEMMGPTMVAEARTCESQSHRFKGPCL-SDTNCGSVCRTER  60

Query  246  FSNGSCTG  269
            F+ G C G
Sbjct  61   FTGGHCRG  68



>gb|AHA50470.1| defensin-like protein 1 [Citrullus lanatus]
Length=74

 Score = 51.2 bits (121),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 40/63 (63%), Gaps = 1/63 (2%)
 Frame = +3

Query  81   VRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGS  260
            ++ F+   LL++L +A+GMG M    R C S S+ FKG+C F+  NC  VCK+EGF  G 
Sbjct  1    MKFFSAAILLLLLLLATGMGPMVTDARTCESPSRHFKGLC-FSKNNCGHVCKTEGFHGGH  59

Query  261  CTG  269
            C G
Sbjct  60   CRG  62



>ref|XP_007226630.1| hypothetical protein PRUPE_ppa022845mg [Prunus persica]
 gb|EMJ27829.1| hypothetical protein PRUPE_ppa022845mg [Prunus persica]
Length=87

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 41/76 (54%), Gaps = 11/76 (14%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMGIMAAGPR----------MCSSRSQTFKGVCIFANGNC  221
              S+RL +   +LV+L +A+ MG MA   R           C S+SQ FKG+C F   +C
Sbjct  2    DRSIRLVSAAFVLVLLLVAAEMGPMAVEGRDAKKVEPKKKTCDSQSQKFKGMC-FLTSSC  60

Query  222  NTVCKSEGFSNGSCTG  269
               CKSEGF+ G C G
Sbjct  61   VQSCKSEGFTGGQCRG  76



>ref|XP_009370221.1| PREDICTED: defensin-like protein 2 [Pyrus x bretschneideri]
Length=86

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 40/79 (51%), Gaps = 14/79 (18%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMGIMAAGPRM-------------CSSRSQTFKGVCIFAN  212
              S RLF+T+ +LV+L +A G G M A  +              C S S  F+G+C F +
Sbjct  2    ERSGRLFSTIFILVLLLVAIGTGPMVAEGKTKEKSSKNEKSSKTCESPSHKFRGIC-FRS  60

Query  213  GNCNTVCKSEGFSNGSCTG  269
             NC T CK EGF  G C G
Sbjct  61   SNCATTCKKEGFMGGKCAG  79



>ref|XP_008437687.1| PREDICTED: defensin J1-2-like [Cucumis melo]
Length=77

 Score = 50.8 bits (120),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 35/62 (56%), Gaps = 1/62 (2%)
 Frame = +3

Query  84   RLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSC  263
            R  +      M  + SGM  M A  R+C S S  FKG+C F++ NC  +CK+EGFS G C
Sbjct  5    RWASDDGQATMAGVGSGMAPMVAEARVCESPSHNFKGLC-FSDTNCGNICKTEGFSGGLC  63

Query  264  TG  269
             G
Sbjct  64   RG  65



>ref|XP_009792224.1| PREDICTED: defensin-like protein P322 [Nicotiana sylvestris]
Length=78

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 43/67 (64%), Gaps = 2/67 (3%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMGIMA-AGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGF  248
            ++S+R FATV LL +L MA+ MG M  A  R C S+   FKG C   +GNC TVC +EGF
Sbjct  2    ANSMRFFATVLLLTLLVMATEMGPMTIAEARTCESQRHRFKGPCS-RDGNCATVCLTEGF  60

Query  249  SNGSCTG  269
            S G C G
Sbjct  61   SGGDCRG  67



>ref|XP_010270777.1| PREDICTED: defensin-like protein [Nelumbo nucifera]
 sp|A3FPF2.1|DEF_NELNU RecName: Full=Defensin-like protein; AltName: Full=Gamma-thionin 
homolog; Flags: Precursor [Nelumbo nucifera]
 gb|ABN46979.1| defensin [Nelumbo nucifera]
Length=77

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 43/64 (67%), Gaps = 1/64 (2%)
 Frame = +3

Query  81   VRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGS  260
            +RLF+++ L+++L  A+ MG   A  R C S+S  FKG C+ ++ NC +VC++EGF  G 
Sbjct  5    MRLFSSLVLVLLLVTATEMGPKVAEARTCESQSHRFKGACL-SDTNCASVCQTEGFPAGD  63

Query  261  CTGS  272
            C G+
Sbjct  64   CKGA  67



>sp|P82781.2|DEF03_ARATH RecName: Full=Putative defensin-like protein 3; AltName: Full=Putative 
low-molecular-weight cysteine-rich protein 71; Short=Protein 
LCR71; Flags: Precursor [Arabidopsis thaliana]
Length=62

 Score = 50.4 bits (119),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 31/52 (60%), Gaps = 1/52 (2%)
 Frame = +3

Query  114  MLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCTG  269
            M+ + +  G +    R+C SRSQ FKG C+ +  NC  VC +EGF +G C G
Sbjct  1    MMILVNAWGSVTVEARICKSRSQKFKGPCV-SEDNCANVCHTEGFPDGDCDG  51



>ref|XP_002513261.1| 8.4 kDa sulfur-rich protein precursor, putative [Ricinus communis]
 gb|EEF49129.1| 8.4 kDa sulfur-rich protein precursor, putative [Ricinus communis]
Length=74

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 36/60 (60%), Gaps = 1/60 (2%)
 Frame = +3

Query  90   FATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCTG  269
            F  V LL+++ +AS   I+    R+C S+S  FKG C+  + NC  VC++E FS G C G
Sbjct  5    FFGVFLLLLIVLASQEAIVPTEARVCESQSHYFKGPCL-RDHNCAMVCRNEAFSGGRCKG  63



>gb|AFK44299.1| unknown [Lotus japonicus]
Length=78

 Score = 50.1 bits (118),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 41/67 (61%), Gaps = 2/67 (3%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMG-IMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGF  248
            + S+ L +T+ + ++L +A+ MG  M A  R C S+S  FKG C+ ++ NC +VC  E F
Sbjct  2    ARSLPLVSTIFVFLLLLVATEMGPTMVAEARDCESQSHRFKGPCV-SDTNCASVCHGEKF  60

Query  249  SNGSCTG  269
            S G C G
Sbjct  61   SGGHCRG  67



>ref|XP_006394251.1| hypothetical protein EUTSA_v10005235mg [Eutrema salsugineum]
 gb|ESQ31537.1| hypothetical protein EUTSA_v10005235mg [Eutrema salsugineum]
Length=73

 Score = 50.1 bits (118),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 39/64 (61%), Gaps = 3/64 (5%)
 Frame = +3

Query  84   RLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSC  263
            + FA + L ++LF  S   I+    RMC S+S  FK +C +++ NC  +C++EGFS G C
Sbjct  4    KTFAAIFLFLVLF--SSQKIIGIEGRMCQSKSHHFKHMC-WSDHNCAIICRNEGFSGGRC  60

Query  264  TGSY  275
             G +
Sbjct  61   RGFH  64



>ref|XP_002875116.1| hypothetical protein ARALYDRAFT_904442 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51375.1| hypothetical protein ARALYDRAFT_904442 [Arabidopsis lyrata subsp. 
lyrata]
Length=73

 Score = 50.1 bits (118),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 39/63 (62%), Gaps = 3/63 (5%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNG  257
            S+RL + + L VML  A+GMG + A  R C S S  F+GVC+ +  +C   C SEGFS G
Sbjct  4    SLRLISALLLSVMLLFATGMGPVEA--RTCESPSNKFQGVCLNSQ-SCAKACPSEGFSGG  60

Query  258  SCT  266
             C+
Sbjct  61   RCS  63



>gb|AAL15885.1|AF417297_1 putative gamma-thionin [Castanea sativa]
Length=78

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 44/67 (66%), Gaps = 2/67 (3%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASG-MGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGF  248
            S S+R+F+TV ++++L +A+  MG M A  R C S+S  FKG C+    NC +VC++EGF
Sbjct  2    SRSMRVFSTVFVVLLLLVATQYMGPMVAEARTCESQSHRFKGPCV-RKSNCASVCQTEGF  60

Query  249  SNGSCTG  269
              G C G
Sbjct  61   HGGQCRG  67



>ref|XP_009769843.1| PREDICTED: defensin-like protein P322 [Nicotiana sylvestris]
Length=78

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 43/67 (64%), Gaps = 2/67 (3%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMGIMA-AGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGF  248
            ++S+R FATV LL +L MA+ MG M  A  R C S+S  FKG C   + NC TVC +EGF
Sbjct  2    ANSMRFFATVLLLTLLVMATEMGPMTIAEARTCESQSHRFKGPCS-RDSNCATVCLTEGF  60

Query  249  SNGSCTG  269
            S G C G
Sbjct  61   SGGDCRG  67



>ref|XP_006410329.1| hypothetical protein EUTSA_v10017942mg [Eutrema salsugineum]
 gb|ESQ51782.1| hypothetical protein EUTSA_v10017942mg [Eutrema salsugineum]
Length=80

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 39/63 (62%), Gaps = 2/63 (3%)
 Frame = +3

Query  81   VRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGS  260
            ++L +++  LV+L  A GM  M  G ++C +RS  F+G+C+    NC  VC SEGF +G 
Sbjct  5    MQLISSLFFLVILLAAPGMK-MVQGQQICEARSINFRGMCM-KWRNCQRVCMSEGFPDGR  62

Query  261  CTG  269
            C G
Sbjct  63   CAG  65



>ref|XP_009590912.1| PREDICTED: defensin-like protein 1 [Nicotiana tomentosiformis]
Length=74

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 39/62 (63%), Gaps = 2/62 (3%)
 Frame = +3

Query  84   RLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSC  263
            + F  + LL+++F AS M I  A  R+C S+S  ++G C+  + NC  VC++EGFS G C
Sbjct  4    KTFGLIFLLLIVF-ASQMAIQRAEGRVCISQSHGYRGPCV-HDHNCALVCRNEGFSGGDC  61

Query  264  TG  269
             G
Sbjct  62   IG  63



>ref|XP_003628977.1| Defensin [Medicago truncatula]
 ref|XP_003636614.1| Defensin [Medicago truncatula]
 gb|AET03453.1| Defensin MtDef4.2 [Medicago truncatula]
 gb|AFK35827.1| unknown [Medicago truncatula]
Length=76

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 40/64 (63%), Gaps = 2/64 (3%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNG  257
            SV L +T+ + ++L +A+G   M A  R C S+S  FKG C  ++ NC +VC++E FS G
Sbjct  4    SVPLVSTIFVFLLLLVATGPS-MVAEARTCESQSHKFKGPCA-SDHNCASVCQTERFSGG  61

Query  258  SCTG  269
             C G
Sbjct  62   HCRG  65



>ref|XP_003630422.1| Defensin [Medicago truncatula]
 gb|AET04898.1| Defensin MtDef4.7 [Medicago truncatula]
Length=74

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 37/60 (62%), Gaps = 3/60 (5%)
 Frame = +3

Query  96   TVSLLVMLFM--ASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCTG  269
            T+ +L MLF+  A+ + +  A  R C S+S  FKG C+ ++ NC +VC+ EGF  G C G
Sbjct  5    TLGILFMLFLVLAADVAVKTAEGRRCESQSHKFKGPCV-SDSNCGSVCRGEGFIGGDCRG  63



>gb|KFK33427.1| hypothetical protein AALP_AA5G011600 [Arabis alpina]
Length=77

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSE  242
            S+RL + V ++ M+F+A+GMG +    R C S+S  FKG C+ ++ NC  VC +E
Sbjct  4    SMRLISAVLIMFMIFVATGMGPVTVEARTCESQSHRFKGTCV-SDTNCANVCHNE  57



>dbj|BAK06284.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=100

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 41/66 (62%), Gaps = 3/66 (5%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFS  251
             SS +LF+ V++L++L +A+   +  A  R C   S+ F G+C F + NC  VC +EGF+
Sbjct  27   ESSHKLFSAVAILLLLVVATE--VAPAQARECEVESERFNGLC-FVSANCAGVCGAEGFT  83

Query  252  NGSCTG  269
             G C+G
Sbjct  84   GGKCSG  89



>ref|XP_007033367.1| Scorpion toxin-like knottin superfamily protein [Theobroma cacao]
 gb|EOY04293.1| Scorpion toxin-like knottin superfamily protein [Theobroma cacao]
Length=76

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 38/63 (60%), Gaps = 1/63 (2%)
 Frame = +3

Query  81   VRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGS  260
            +R    + LL+++ +A    ++ +  R C S+S  FKG C+ ++ NC  VC++EGF +G 
Sbjct  4    IRKLFGMFLLLLIVLAPQEMVVPSEARTCESKSHAFKGPCL-SDHNCGLVCRNEGFPDGW  62

Query  261  CTG  269
            C G
Sbjct  63   CRG  65



>gb|EAY86781.1| hypothetical protein OsI_08161 [Oryza sativa Indica Group]
Length=487

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/65 (40%), Positives = 40/65 (62%), Gaps = 2/65 (3%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMGIM-AAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGF  248
            + S R+ A+  LL+ + +A+ MG    A  R C S+S  FKG+C+ +N NC  VC++E F
Sbjct  2    APSRRMVASAFLLLAILVATEMGTTKVAEARHCLSQSHRFKGMCVSSN-NCANVCRTESF  60

Query  249  SNGSC  263
             +G C
Sbjct  61   PDGEC  65



>ref|XP_006295860.1| hypothetical protein CARUB_v10024990mg [Capsella rubella]
 gb|EOA28758.1| hypothetical protein CARUB_v10024990mg [Capsella rubella]
Length=83

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 40/68 (59%), Gaps = 3/68 (4%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMGIMAAG--PRMCSSRSQTFKGVCIFANGNCNTVCKSEG  245
             S+++L +T+  +++LF+   M     G  P++C ++S  F+G+C     NC  VC SEG
Sbjct  2    KSNMQLISTLIFVILLFLGPSMMKTVEGQDPQLCETKSLYFRGMCT-KWANCKRVCISEG  60

Query  246  FSNGSCTG  269
            F +G C G
Sbjct  61   FPDGRCKG  68



>gb|KHG09995.1| Defensin-like protein 1 [Gossypium arboreum]
Length=75

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 40/62 (65%), Gaps = 2/62 (3%)
 Frame = +3

Query  84   RLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSC  263
            +LF  + +L++L   +  G +  G R+C S+S  FKGVC+ ++ NC  VC++EGF +G C
Sbjct  5    KLFGMMFMLLLLVALASHGGVVEG-RICESKSHRFKGVCL-SDHNCGLVCRNEGFLDGWC  62

Query  264  TG  269
             G
Sbjct  63   RG  64



>ref|NP_178322.1| defensin-like protein 10 [Arabidopsis thaliana]
 sp|Q9ZUL8.1|DEF10_ARATH RecName: Full=Defensin-like protein 10; AltName: Full=Low-molecular-weight 
cysteine-rich protein 72; Short=Protein LCR72; 
AltName: Full=Plant defensin 2.6; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC97220.1| protease inhibitor II [Arabidopsis thaliana]
 gb|AAM64623.1| protease inhibitor II [Arabidopsis thaliana]
 gb|ABI49429.1| At2g02140 [Arabidopsis thaliana]
 gb|AEC05550.1| defensin-like protein 10 [Arabidopsis thaliana]
Length=73

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 39/63 (62%), Gaps = 3/63 (5%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNG  257
            S+RL + + + VML  A+GMG + A  R C S S  F+GVC+ +  +C   C SEGFS G
Sbjct  4    SLRLISALLMSVMLLFATGMGPVEA--RTCESPSNKFQGVCLNSQ-SCAKACPSEGFSGG  60

Query  258  SCT  266
             C+
Sbjct  61   RCS  63



>ref|XP_007033927.1| Scorpion toxin-like knottin superfamily protein [Theobroma cacao]
 gb|EOY04853.1| Scorpion toxin-like knottin superfamily protein [Theobroma cacao]
Length=141

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 44/86 (51%), Gaps = 11/86 (13%)
 Frame = +3

Query  42   VLNYIYTMAASSSVRLFAT----------VSLLVMLFMASGMGIMAAGPRMCSSRSQTFK  191
            VL + +++  +   RLF            +  L+++ +AS      A  R+C S+S  FK
Sbjct  46   VLFFPHSVTKAKVSRLFIEGIEMEKRSLGIFFLLLIVLASQWVAQPAEGRVCESKSHKFK  105

Query  192  GVCIFANGNCNTVCKSEGFSNGSCTG  269
            G C+  + NC  VC++EGFS G C G
Sbjct  106  GPCL-GDHNCALVCRNEGFSGGRCRG  130



>ref|XP_010675153.1| PREDICTED: defensin-like protein 1 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=72

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 36/64 (56%), Gaps = 4/64 (6%)
 Frame = +3

Query  84   RLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSC  263
            RLF    L ++LF +    +  A  R+C SRS  FKG C   + NC  VC++EGFS G C
Sbjct  4    RLFGLCILFLVLFASQ---VKQAEGRVCQSRSHYFKGPCA-RDHNCAYVCRNEGFSGGRC  59

Query  264  TGSY  275
             G +
Sbjct  60   HGFF  63



>ref|XP_003562142.1| PREDICTED: defensin Ec-AMP-D1-like [Brachypodium distachyon]
Length=81

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 29/47 (62%), Gaps = 1/47 (2%)
 Frame = +3

Query  129  SGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCTG  269
             G  +M A  R C SRS  F+G C+ A+ NC  VCK+EGF +G C G
Sbjct  23   DGDQMMVAEARTCESRSHRFRGPCMRAS-NCRNVCKTEGFQDGKCRG  68



>ref|XP_007033370.1| Scorpion toxin-like knottin superfamily protein [Theobroma cacao]
 gb|EOY04296.1| Scorpion toxin-like knottin superfamily protein [Theobroma cacao]
Length=76

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +3

Query  105  LLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCTG  269
            LL+++ +AS   ++ +  R+C S+S  FKG C+ ++ NC  VC +EGFS G C G
Sbjct  12   LLLLIVLASQEMVVPSKARLCESKSHGFKGACL-SDHNCGMVCSNEGFSGGRCRG  65



>gb|KGN49760.1| hypothetical protein Csa_5G114570 [Cucumis sativus]
Length=74

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 35/61 (57%), Gaps = 1/61 (2%)
 Frame = +3

Query  87   LFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCT  266
             F+    L++L + +GMG M    R C S S  FKG+C F+  NC  VCK+EGF  G C 
Sbjct  3    FFSAAIFLLLLLLGTGMGPMVTEARTCESPSHRFKGLC-FSKNNCGHVCKTEGFHGGHCR  61

Query  267  G  269
            G
Sbjct  62   G  62



>ref|XP_008466730.1| PREDICTED: defensin J1-2-like [Cucumis melo]
Length=74

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 28/48 (58%), Gaps = 1/48 (2%)
 Frame = +3

Query  126  ASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCTG  269
             +GMG M    R C S S  FKG+C F+  NC  VCK+EGF  G C G
Sbjct  16   GTGMGPMVTEARTCESPSHRFKGLC-FSKNNCGHVCKTEGFHGGHCRG  62



>ref|XP_009101271.1| PREDICTED: defensin-like protein 10 [Brassica rapa]
 emb|CDY17612.1| BnaA06g34310D [Brassica napus]
 emb|CDY03075.1| BnaC07g21520D [Brassica napus]
Length=73

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 39/63 (62%), Gaps = 3/63 (5%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNG  257
            S+RL +T+ L  ML +A+GM  + A  R C S S  F+GVC+ A  NC  VC  EGF+ G
Sbjct  4    SLRLVSTILLSFMLLLAAGMIPVEA--RTCESPSTKFQGVCLNAK-NCAGVCTGEGFTGG  60

Query  258  SCT  266
             C+
Sbjct  61   QCS  63



>ref|NP_001047493.1| Os02g0629800 [Oryza sativa Japonica Group]
 dbj|BAD23741.1| putative defensin [Oryza sativa Japonica Group]
 dbj|BAF09407.1| Os02g0629800 [Oryza sativa Japonica Group]
 gb|EEE57415.1| hypothetical protein OsJ_07607 [Oryza sativa Japonica Group]
Length=80

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 40/65 (62%), Gaps = 2/65 (3%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMGIMA-AGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGF  248
            + S R+ A+  LL+ + +A+ MG    A  R C S+S  FKG+C+ +N NC  VC++E F
Sbjct  2    APSRRMVASAFLLLAILVATEMGTTKVAEARHCLSQSHRFKGMCVSSN-NCANVCRTESF  60

Query  249  SNGSC  263
             +G C
Sbjct  61   PDGEC  65



>gb|ACM90159.1| low-molecular-weight cysteine-rich 69 [Jatropha curcas]
 gb|KDP32806.1| hypothetical protein JCGZ_12098 [Jatropha curcas]
Length=77

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 40/66 (61%), Gaps = 1/66 (2%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFS  251
             + +R F+ V  L++L +A+ +G   A  R C S+S  FKG C+ +  NC  VCK+EGF+
Sbjct  2    KNPMRPFSAVLFLLLLLVATEIGSKMAEARTCESQSHKFKGTCL-SETNCANVCKTEGFT  60

Query  252  NGSCTG  269
             G C G
Sbjct  61   GGDCRG  66



>ref|XP_003599384.1| Defensin [Medicago truncatula]
 gb|AES69635.1| gamma-thionin/defensin [Medicago truncatula]
Length=80

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 38/69 (55%), Gaps = 4/69 (6%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGM---GIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSE  242
            + S+ L  T+   + L +++ M    +     R C S+S +FKGVC +   NC  VCK+E
Sbjct  2    ARSITLVCTIFFFLFLLVSTEMQPTHVEEPEARTCDSQSHSFKGVC-WIKHNCANVCKTE  60

Query  243  GFSNGSCTG  269
            GF+ G C G
Sbjct  61   GFTGGHCHG  69



>ref|XP_010319372.1| PREDICTED: defensin Ec-AMP-D2-like [Solanum lycopersicum]
Length=73

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 36/62 (58%), Gaps = 5/62 (8%)
 Frame = +3

Query  84   RLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSC  263
            +L AT  L++ML  A+ +       R C S+S  +KG C+  N NC  VCK+EGFS G C
Sbjct  6    KLLATFFLVLMLVFAAEL----TEARTCESQSHRYKGPCVRKN-NCANVCKTEGFSGGHC  60

Query  264  TG  269
             G
Sbjct  61   RG  62



>ref|NP_201171.1| defensin-like protein 6 [Arabidopsis thaliana]
 sp|Q9FFP8.1|DEF06_ARATH RecName: Full=Defensin-like protein 6; AltName: Full=Low-molecular-weight 
cysteine-rich protein 74; Short=Protein LCR74; 
AltName: Full=Plant defensin 2.5; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB10459.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED97782.1| defensin-like protein 6 [Arabidopsis thaliana]
Length=73

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 37/64 (58%), Gaps = 3/64 (5%)
 Frame = +3

Query  84   RLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSC  263
            + FA   LL++LF  S   I+    R C S+S  FK +C  +N NC  VC++EGFS G C
Sbjct  4    KFFAAFFLLLVLF--SSQEIIGGEGRTCQSKSHHFKYMCT-SNHNCAIVCRNEGFSGGRC  60

Query  264  TGSY  275
             G +
Sbjct  61   HGFH  64



>ref|XP_010675152.1| PREDICTED: defensin-like protein 1 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=73

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 36/64 (56%), Gaps = 3/64 (5%)
 Frame = +3

Query  84   RLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSC  263
            RLF    L ++LF +    +  A  R+C SRS  FKG C   + NC  VC++EGFS G C
Sbjct  4    RLFGLCILFLVLFASPE--VKQAEGRVCQSRSHYFKGPCA-RDHNCAYVCRNEGFSGGRC  60

Query  264  TGSY  275
             G +
Sbjct  61   HGFF  64



>ref|XP_010260874.1| PREDICTED: defensin D2-like [Nelumbo nucifera]
Length=72

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +3

Query  99   VSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCTG  269
            +++ V+L+  +   ++    RMC + S+ F+G+C+  N NC+  C+ EGF +G C G
Sbjct  4    LTVYVLLWFVAEEMVVHVDARMCDTPSRLFRGLCLI-NRNCDNTCRVEGFPDGHCKG  59



>ref|XP_006422269.1| hypothetical protein CICLE_v10005867mg [Citrus clementina]
 gb|ESR35509.1| hypothetical protein CICLE_v10005867mg [Citrus clementina]
Length=216

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 43/78 (55%), Gaps = 4/78 (5%)
 Frame = +3

Query  39   FVLNYIYTMAASS-SVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANG  215
            F+++  Y     S   + FA+  LL ++F+++ M  + A  RMC + S+ F G+C + N 
Sbjct  15   FLVDRNYPQQYPSMETKDFASAFLLFIVFISAEMVEIHA--RMCRTHSRAFTGLC-YRND  71

Query  216  NCNTVCKSEGFSNGSCTG  269
            NC   C SEGF  G CT 
Sbjct  72   NCAMACMSEGFDYGYCTA  89



>ref|XP_002513755.1| Low-molecular-weight cysteine-rich protein LCR69 precursor, putative 
[Ricinus communis]
 gb|EEF48338.1| Low-molecular-weight cysteine-rich protein LCR69 precursor, putative 
[Ricinus communis]
Length=77

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +3

Query  81   VRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFS  251
            +RLF+TV LL++L +A+ MG   A  R C S+S  FKG C+ +  NC  +CK+EGF 
Sbjct  5    MRLFSTVFLLLLLLVATEMGAKVAEARTCESQSHKFKGTCL-STTNCANICKTEGFH  60



>ref|XP_004509606.1| PREDICTED: defensin J1-2-like [Cicer arietinum]
Length=74

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 41/66 (62%), Gaps = 4/66 (6%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFS  251
            + S+ + +T+ + ++L +A+ M    A  R C S+SQ FKG C+ ++ NC +VC++E F 
Sbjct  2    ARSIPMVSTIFVFLLLLVATEM---VAEARTCESKSQKFKGACV-SDRNCASVCQTERFP  57

Query  252  NGSCTG  269
             G C G
Sbjct  58   GGHCRG  63



>emb|CDY39856.1| BnaC02g42620D [Brassica napus]
 emb|CDY31356.1| BnaA02g33850D [Brassica napus]
Length=73

 Score = 48.1 bits (113),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 37/64 (58%), Gaps = 3/64 (5%)
 Frame = +3

Query  84   RLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSC  263
            ++FA   L ++LF  S   ++    RMC SRS  F+ +C+ +N NC  +C+ E FS G C
Sbjct  4    KVFAAFFLFLVLF--SSQEVIGIEGRMCQSRSHHFRSICL-SNHNCANICRGERFSGGRC  60

Query  264  TGSY  275
             G +
Sbjct  61   HGLH  64



>ref|XP_002886566.1| protease inhibitor II [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62825.1| protease inhibitor II [Arabidopsis lyrata subsp. lyrata]
Length=76

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 37/59 (63%), Gaps = 3/59 (5%)
 Frame = +3

Query  99   VSLLVMLFM--ASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCTG  269
            +S L++LFM  A+G+G +    R C + S  F G C+ ++ NC  VC +EGFS+G C G
Sbjct  8    ISALLLLFMILATGIGPVTVEARTCETSSNLFNGPCL-SSSNCANVCHNEGFSDGDCRG  65



>ref|XP_007045353.1| Defensin-like protein isoform 1 [Theobroma cacao]
 gb|EOY01185.1| Defensin-like protein isoform 1 [Theobroma cacao]
Length=78

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 42/67 (63%), Gaps = 2/67 (3%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASG-MGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSN  254
            S RLF+   +L++L +A+  MG  AA  R C S+S  FKG+C+    NC  VC++EGF +
Sbjct  4    STRLFSAAFVLLLLLLATEEMGPKAAEARTCQSQSHRFKGMCM-RKSNCAAVCQTEGFHS  62

Query  255  GSCTGSY  275
            G C G +
Sbjct  63   GHCRGFH  69



>dbj|BAD25504.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EAZ21909.1| hypothetical protein OsJ_05562 [Oryza sativa Japonica Group]
Length=85

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +3

Query  87   LFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCT  266
            + A V+  V++ +   +G   A  +MC  RSQTFKG+C F   NCNT C +EG++ G CT
Sbjct  1    MEAKVATTVLVLLLLTLGGEVAAAKMCHDRSQTFKGMC-FRTSNCNTSCTNEGYTGGHCT  59



>ref|XP_008240820.1| PREDICTED: defensin Ec-AMP-D1-like [Prunus mume]
Length=85

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 39/72 (54%), Gaps = 9/72 (13%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAGPRM--------CSSRSQTFKGVCIFANGNCNTVC  233
            S R+F+TV +LV+L +A G G M A  R+        C S S  FKG C F + +C   C
Sbjct  4    SKRMFSTVFILVLLLVALGTGPMVAEGRVATKETSRTCESLSTKFKGFC-FRSSSCADAC  62

Query  234  KSEGFSNGSCTG  269
            + EGF  G C G
Sbjct  63   QKEGFMGGKCPG  74



>ref|XP_010671291.1| PREDICTED: defensin Ec-AMP-D2-like [Beta vulgaris subsp. vulgaris]
Length=78

 Score = 47.8 bits (112),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 38/64 (59%), Gaps = 2/64 (3%)
 Frame = +3

Query  81   VRLFATVSLLVMLFMASG-MGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNG  257
            +RL + + L+++LF ++  +G   A  R C +RS  FKG+C     NC  VC++EGF  G
Sbjct  5    MRLISALLLVMLLFSSTAEVGPKVAEARTCETRSHRFKGICG-RKANCAAVCQAEGFQGG  63

Query  258  SCTG  269
             C G
Sbjct  64   HCRG  67



>ref|XP_010908980.1| PREDICTED: defensin Ec-AMP-D1-like [Elaeis guineensis]
 gb|AAN52490.1|AF322914_1 defensin EGAD1 [Elaeis guineensis]
Length=77

 Score = 47.8 bits (112),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 35/66 (53%), Gaps = 1/66 (2%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFS  251
              S R+   + LL+ L M S MG   A  R C S+S  F+G C+    NC  VC++EGF 
Sbjct  2    EHSRRMLPAILLLLFLLMPSEMGTKVAEARTCESQSHKFQGTCL-RESNCANVCQTEGFQ  60

Query  252  NGSCTG  269
             G C G
Sbjct  61   GGVCRG  66



>gb|ACS96442.1| defensin [Jatropha curcas]
Length=77

 Score = 47.8 bits (112),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 40/66 (61%), Gaps = 1/66 (2%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFS  251
             + +R F+ V  L++L +A+ +G   A  R C S++  FKG C+ +  NC  VCK+EGF+
Sbjct  2    KNPMRPFSAVLFLLLLLVATEIGSKMAEARTCESQTHKFKGTCL-SETNCANVCKTEGFT  60

Query  252  NGSCTG  269
             G C G
Sbjct  61   GGDCRG  66



>dbj|BAK07823.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=105

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 27/46 (59%), Gaps = 1/46 (2%)
 Frame = +3

Query  132  GMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCTG  269
            G  +M A  R C SRS  F+G C+    NC  VCK+EGF +G C G
Sbjct  48   GGPVMVAEARTCESRSHRFRGPCV-RRSNCANVCKTEGFPDGKCRG  92



>ref|XP_009114204.1| PREDICTED: defensin-like protein 2 [Brassica rapa]
Length=77

 Score = 47.4 bits (111),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = +3

Query  87   LFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFS  251
            L + V  + M+F+ASG G +    R C S+S  F+G+C+ +  NC  VC ++GFS
Sbjct  7    LISVVLFMFMIFVASGAGPVTVEARTCESKSHKFRGLCV-STHNCANVCHTQGFS  60



>ref|XP_008360020.1| PREDICTED: defensin-like protein 2 [Malus domestica]
Length=87

 Score = 47.4 bits (111),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 39/74 (53%), Gaps = 11/74 (15%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAGPR----------MCSSRSQTFKGVCIFANGNCNT  227
            S+RL +   +LVM F A+ MG M+   R          +C   S  FKG+C F++ NC  
Sbjct  4    SMRLVSAAFILVMFFAATXMGPMSVEARTESSKAIEGKICEVPSTLFKGLC-FSSNNCKH  62

Query  228  VCKSEGFSNGSCTG  269
             C+ E F+ G C+G
Sbjct  63   TCRKEQFTRGKCSG  76



>ref|XP_006586320.1| PREDICTED: defensin-like protein-like [Glycine max]
Length=74

 Score = 47.4 bits (111),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 34/54 (63%), Gaps = 1/54 (2%)
 Frame = +3

Query  108  LVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCTG  269
            L +L +   + +  A  R CSS+S  FKG+C F++ NC  VC++EGF+ G C G
Sbjct  11   LELLVICVDVAVKRAEGRDCSSKSHGFKGLC-FSDTNCAHVCRTEGFTGGDCGG  63



>ref|XP_004509602.1| PREDICTED: defensin-1-like [Cicer arietinum]
Length=80

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 41/66 (62%), Gaps = 5/66 (8%)
 Frame = +3

Query  84   RLFATVSLLVMLFM---ASGMGI-MAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFS  251
            RL ++VS + ++F+    + MG  M A  R C S+S T+KG+C+  + NC  VC++EGF 
Sbjct  3    RLLSSVSTIFVMFLLLVVTEMGANMVAEARSCISKSFTYKGLCV-HDRNCANVCRTEGFV  61

Query  252  NGSCTG  269
             G C G
Sbjct  62   EGHCRG  67



>gb|ABA86589.1| putative defensin 1 [Aquilegia pyrenaica]
 gb|ABA86590.1| putative defensin 1 [Aquilegia olympica]
Length=70

 Score = 47.0 bits (110),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 29/45 (64%), Gaps = 1/45 (2%)
 Frame = +3

Query  135  MGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCTG  269
            MG  AA  R C S+S  FKG CI  + NC +VC+SEGF+ G C G
Sbjct  14   MGPKAAEARDCESQSHKFKGTCIRKS-NCASVCQSEGFNGGHCRG  57



>gb|AHA50471.1| defensin-like protein 4 [Citrullus lanatus]
Length=75

 Score = 47.0 bits (110),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 1/50 (2%)
 Frame = +3

Query  120  FMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCTG  269
            F  +GM  +    R+C S S +FKG+C F++ NC  +CK+EGF+ G C G
Sbjct  15   FFGTGMEPIVVEARVCESLSHSFKGLC-FSSTNCGNICKTEGFTGGHCRG  63



>ref|XP_009383785.1| PREDICTED: defensin-like protein 1 [Musa acuminata subsp. malaccensis]
Length=76

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 39/64 (61%), Gaps = 1/64 (2%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNG  257
             V+  A   L+ +LF AS + +     R+C   S++F+G+C F++ NC  VC++EGF+ G
Sbjct  2    EVKATACALLMFLLFSASQLMMPGVEARVCRYASRSFRGLC-FSDTNCAHVCQTEGFNGG  60

Query  258  SCTG  269
             C G
Sbjct  61   HCHG  64



>ref|NP_001031462.1| low-molecular-weight cysteine-rich 75 [Arabidopsis thaliana]
 sp|P82784.3|DEF07_ARATH RecName: Full=Defensin-like protein 7; AltName: Full=Low-molecular-weight 
cysteine-rich protein 75; Short=Protein LCR75; 
AltName: Full=Low-molecular-weight cysteine-rich protein 79; 
Short=Protein LCR79; Flags: Precursor [Arabidopsis thaliana]
 gb|AEC08611.1| low-molecular-weight cysteine-rich 75 [Arabidopsis thaliana]
Length=82

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 41/68 (60%), Gaps = 4/68 (6%)
 Frame = +3

Query  66   AASSSVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEG  245
            ++++S++L  T+  L +L  +  M     G +MC ++S  +KG+C+    NC  VC SEG
Sbjct  3    SSTTSMQLIPTLFFLTILLASPEM---VEGQQMCEAKSLDWKGMCL-KWRNCRQVCISEG  58

Query  246  FSNGSCTG  269
            F++G C G
Sbjct  59   FTDGRCKG  66



>gb|ABA81896.1| putative defensin [Aquilegia formosa]
 gb|ABA86588.1| putative defensin 1 [Aquilegia brevistyla]
Length=70

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 29/45 (64%), Gaps = 1/45 (2%)
 Frame = +3

Query  135  MGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCTG  269
            MG+  A  R C S+S  FKG CI  + NC +VC+SEGF+ G C G
Sbjct  14   MGLKVAEARDCESQSHKFKGTCIRKS-NCASVCQSEGFNGGHCRG  57



>ref|NP_176302.2| defensin-like protein [Arabidopsis thaliana]
 sp|Q9C947.2|DEF05_ARATH RecName: Full=Defensin-like protein 5; AltName: Full=Low-molecular-weight 
cysteine-rich protein 66; Short=Protein LCR66; 
AltName: Full=Plant defensin 2.4; Flags: Precursor [Arabidopsis 
thaliana]
 gb|ABE65729.1| plant defensin-fusion protein [Arabidopsis thaliana]
 gb|AEE33774.1| defensin-like protein [Arabidopsis thaliana]
Length=76

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = +3

Query  105  LLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCTG  269
            LL+ + +A+ MG++    R C + S  F G C+ ++ NC  VC +EGFS+G C G
Sbjct  12   LLLFMILATVMGLVTVEARTCETSSNLFNGPCL-SSSNCANVCHNEGFSDGDCRG  65



>gb|AFD01290.1| defensin 3 [Pinus sylvestris]
Length=83

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = +3

Query  105  LLVMLFMASGM-GIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSC  263
            LLV+L +  GM  +  A  RMC + S  FKG C+ ++ NC  VC++EGF +GSC
Sbjct  15   LLVLLVITIGMMAVQVAEGRMCKTPSGKFKGYCV-SSTNCKNVCRTEGFPSGSC  67



>gb|EMT03363.1| hypothetical protein F775_43918 [Aegilops tauschii]
Length=82

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 28/46 (61%), Gaps = 1/46 (2%)
 Frame = +3

Query  132  GMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCTG  269
            G  +M A  R C SRS  F+G C+    NC  VC++EGFS+G C G
Sbjct  25   GGPVMVAEARTCESRSHRFRGPCV-RRSNCANVCRTEGFSDGECRG  69



>gb|KDO61571.1| hypothetical protein CISIN_1g029977mg [Citrus sinensis]
Length=184

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 38/64 (59%), Gaps = 3/64 (5%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNG  257
              + FA+  LL ++F+++ M  + A  RMC + S+ F G+C + N NC   C SEGF+ G
Sbjct  2    ETKDFASAFLLFIVFISAEMVEIHA--RMCRTHSRAFTGLC-YRNDNCAMACMSEGFNYG  58

Query  258  SCTG  269
             CT 
Sbjct  59   YCTA  62



>ref|XP_006292846.1| hypothetical protein CARUB_v10019106mg [Capsella rubella]
 gb|EOA25744.1| hypothetical protein CARUB_v10019106mg [Capsella rubella]
Length=73

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 36/62 (58%), Gaps = 3/62 (5%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNG  257
            S+RL + + L +ML  A+GMG + A  R C S S  F GVC+ +   C   C SEGF+ G
Sbjct  4    SLRLVSALLLSIMLLFATGMGPVEA--RTCESPSSKFSGVCLNSQ-TCAKACPSEGFTGG  60

Query  258  SC  263
             C
Sbjct  61   RC  62



>ref|XP_004953175.1| PREDICTED: defensin-like protein 2-like [Setaria italica]
Length=80

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 2/63 (3%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMG-IMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSN  254
            S R+ A V + ++L +AS MG    A  R C S+S  FKG+C+ ++ NC  VC+ E F +
Sbjct  4    SRRMAAPVLVFLLLLIASEMGPATVAEARHCLSQSHHFKGLCL-SSSNCANVCRVERFPD  62

Query  255  GSC  263
            G C
Sbjct  63   GEC  65



>gb|AFW58880.1| low-molecular-weight cysteine-rich protein LCR70 [Zea mays]
Length=82

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 38/68 (56%), Gaps = 2/68 (3%)
 Frame = +3

Query  63   MAASSSVRLFATVSLLVMLFMASGMGI-MAAGPRMCSSRSQTFKGVCIFANGNCNTVCKS  239
            MA +S   + + +  L+ML  AS MG    A  R C+S+S  F G C+ +  NC  VC++
Sbjct  1    MAWTSRRMVASALVFLLMLLAASEMGTTRVAEARHCTSQSHRFVGACM-SKSNCENVCRT  59

Query  240  EGFSNGSC  263
            EGF  G C
Sbjct  60   EGFPWGEC  67



>gb|AIA67012.1| defensin [Triticum aestivum]
Length=82

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 28/46 (61%), Gaps = 1/46 (2%)
 Frame = +3

Query  132  GMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCTG  269
            G  +M A  R C SRS  F+G C+    NC  VC++EGFS+G C G
Sbjct  25   GGPVMVAEARTCESRSHRFRGPCV-RRSNCANVCRTEGFSDGKCRG  69



>gb|ACV84379.1| defensin precursor [Triticum aestivum]
 gb|EMT06280.1| Defensin-like protein 5 [Aegilops tauschii]
 gb|AIA66986.1| defensin [Triticum aestivum]
Length=81

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 37/67 (55%), Gaps = 4/67 (6%)
 Frame = +3

Query  84   RLFATVSLLVMLFMASGMG---IMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSN  254
            R     +LL+ L +A+ MG   +  A  R C S+S  FKG C+ ++ NC  VC++E F +
Sbjct  5    RRMTASALLLFLLVATEMGTTTVKVAEARNCLSQSHNFKGACL-SSSNCAAVCRTENFPD  63

Query  255  GSCTGSY  275
            G C   +
Sbjct  64   GECHAPH  70



>gb|ABK28445.1| unknown [Arabidopsis thaliana]
Length=77

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = +3

Query  105  LLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCTG  269
            LL+ + +A+ MG++    R C + S  F G C+ ++ NC  VC +EGFS+G C G
Sbjct  12   LLLFMILATVMGLVTVEARTCETSSNLFNGPCL-SSSNCANVCHNEGFSDGDCRG  65



>ref|NP_001149230.1| LOC100282852 precursor [Zea mays]
 gb|ACG34648.1| low-molecular-weight cysteine-rich protein LCR70 precursor [Zea 
mays]
Length=82

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 38/68 (56%), Gaps = 2/68 (3%)
 Frame = +3

Query  63   MAASSSVRLFATVSLLVMLFMASGMGI-MAAGPRMCSSRSQTFKGVCIFANGNCNTVCKS  239
            MA +S   + + +  L+ML  AS MG    A  R C+S+S  F G C+ +  NC  VC++
Sbjct  1    MAWTSRRMVASALVFLLMLLAASEMGTTRXAEARHCTSQSHRFVGACM-SKSNCENVCRT  59

Query  240  EGFSNGSC  263
            EGF  G C
Sbjct  60   EGFPWGEC  67



>gb|KFK33428.1| hypothetical protein AALP_AA5G011900 [Arabis alpina]
Length=73

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 38/63 (60%), Gaps = 3/63 (5%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNG  257
            S+RL +   L  ML +ASG G + A  R C S S  F GVC+  + NC  +C +EGFS+G
Sbjct  4    SLRLVSVFLLSFMLLLASGKGPVEA--RTCESVSGKFSGVCL-NSANCAKICPTEGFSSG  60

Query  258  SCT  266
             C+
Sbjct  61   RCS  63



>ref|XP_010497013.1| PREDICTED: putative defensin-like protein 9 [Camelina sativa]
Length=82

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 37/69 (54%), Gaps = 2/69 (3%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMGIMAAG-PRMCSSRSQTFKGVCIFANGNCNTVCKSEGF  248
             SS++  +T+  L++L +  G+  M  G P+MC + S  F G C      C  VC SEGF
Sbjct  2    KSSMQFISTLFFLILLVVGPGVMKMVEGQPQMCETESINFTGFCS-KWRTCKRVCMSEGF  60

Query  249  SNGSCTGSY  275
             +G C G +
Sbjct  61   PDGKCNGDF  69



>ref|XP_007137817.1| hypothetical protein PHAVU_009G158100g [Phaseolus vulgaris]
 gb|ESW09811.1| hypothetical protein PHAVU_009G158100g [Phaseolus vulgaris]
Length=145

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 36/55 (65%), Gaps = 2/55 (4%)
 Frame = +3

Query  105  LLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCTG  269
             ++++ +AS M +   G R C S+S  FKG+C+ ++ NC +VC  EGF+ G+C G
Sbjct  82   FMLLILLASQMMVQTEG-RHCESKSHRFKGMCL-SDRNCASVCHLEGFTGGNCRG  134



>gb|ABK93231.1| unknown [Populus trichocarpa]
Length=75

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 1/55 (2%)
 Frame = +3

Query  105  LLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCTG  269
             L+++ +AS   ++    R+C S+S  FKG C   + NC  VC++EGFS G C G
Sbjct  11   FLLLIVLASQEVVVPTEARVCQSQSHYFKGPCA-RDHNCAWVCRNEGFSGGRCKG  64



>gb|EMS65298.1| Defensin-like protein 1 [Triticum urartu]
Length=82

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 27/46 (59%), Gaps = 1/46 (2%)
 Frame = +3

Query  132  GMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCTG  269
            G  +M A  R C SRS  F+G C+    NC  VCK+EGF +G C G
Sbjct  25   GGPVMVAEARTCESRSHRFRGPCV-RRSNCANVCKTEGFPDGKCRG  69



>ref|XP_008240819.1| PREDICTED: defensin Ec-AMP-D1-like [Prunus mume]
Length=85

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 39/72 (54%), Gaps = 9/72 (13%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAGPRM--------CSSRSQTFKGVCIFANGNCNTVC  233
            S R+F+TV +LV+L +A G G M A  ++        C S S  FKG C F + +C   C
Sbjct  4    SRRVFSTVFILVLLLVAIGTGPMVAEGKVATKEKSGTCESLSTKFKGFC-FRSSSCADAC  62

Query  234  KSEGFSNGSCTG  269
            + EGF  G C G
Sbjct  63   QKEGFMGGKCPG  74



>gb|KEH35658.1| low-molecular-weight cysteine-rich protein [Medicago truncatula]
Length=52

 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 27/42 (64%), Gaps = 1/42 (2%)
 Frame = +3

Query  144  MAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCTG  269
            M A  RMC S+S  FKG C+  + NC  VC++EGFS G C G
Sbjct  1    MHAEARMCESQSHGFKGACV-GDHNCALVCRNEGFSGGRCQG  41



>gb|KHN16909.1| Defensin J1-2 [Glycine soja]
Length=84

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (65%), Gaps = 1/51 (2%)
 Frame = +3

Query  117  LFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCTG  269
            +++   + +  A  R CSS+S  FKG+C F++ NC  VC++EGF+ G C G
Sbjct  24   IYIIPYVAVKRAEGRDCSSKSHGFKGLC-FSDTNCAHVCRTEGFTGGDCGG  73



>emb|CEJ09690.1| Defensin protein [Zea mays]
Length=80

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 40/68 (59%), Gaps = 2/68 (3%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMGIMA-AGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGF  248
            + S R+ A V +L++L +A+ +G    A  R C S+S  FKG+C+ +N NC  VC++E F
Sbjct  2    APSRRMAAPVLVLMLLPVATELGTTKVAEARHCLSQSHRFKGLCMSSN-NCANVCQTENF  60

Query  249  SNGSCTGS  272
              G C   
Sbjct  61   PGGECKAE  68



>gb|ACV84383.1| defensin precursor [Triticum turgidum subsp. durum]
Length=85

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 6/70 (9%)
 Frame = +3

Query  69   ASSSVRLFATVSLLVMLFMASGMGIMA-----AGPRMCSSRSQTFKGVCIFANGNCNTVC  233
            AS+S R+ A+V L+++L +A+ MG M       G R C S+S  ++G C + + NC  VC
Sbjct  2    ASTSRRMVASVLLVLLLLVATEMGTMRVAEARHGHRHCESQSHRYRGAC-WRDDNCEHVC  60

Query  234  KSEGFSNGSC  263
             +EGF  G C
Sbjct  61   NTEGFPWGKC  70



>gb|EYU35335.1| hypothetical protein MIMGU_mgv11b017254mg [Erythranthe guttata]
Length=99

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 32/55 (58%), Gaps = 1/55 (2%)
 Frame = +3

Query  105  LLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANG-NCNTVCKSEGFSNGSCT  266
            L+V+ F+      + A  R+C SRS+ F G C+  N  NCN VCK EGF  GSC 
Sbjct  6    LVVVFFVILSTHEIGAVTRICQSRSREFAGRCLRLNQRNCNIVCKHEGFLYGSCN  60



>ref|XP_004503912.1| PREDICTED: defensin-like protein-like [Cicer arietinum]
Length=76

 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 34/62 (55%), Gaps = 5/62 (8%)
 Frame = +3

Query  96   TVSLLVMLFM----ASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSC  263
            T+ +L M F+     + + +  A  R C SRS  FKG C+ ++  C   C++EGFS G C
Sbjct  5    TLGVLFMFFLLLTAVTDVAVKTAEARTCESRSHRFKGTCL-SDTTCAHACRNEGFSGGDC  63

Query  264  TG  269
             G
Sbjct  64   RG  65



>ref|XP_007156390.1| hypothetical protein PHAVU_003G282400g [Phaseolus vulgaris]
 gb|ESW28384.1| hypothetical protein PHAVU_003G282400g [Phaseolus vulgaris]
Length=78

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 40/67 (60%), Gaps = 2/67 (3%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMGI-MAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGF  248
            + SV   +T+ + ++L +A+ MG  M A  R C SRS+  +G C  ++ NC + C++E F
Sbjct  2    ARSVSFVSTIFVFLLLLLATEMGPRMVAEARGCESRSRHLRGKCE-SDENCASACRTERF  60

Query  249  SNGSCTG  269
            S G C G
Sbjct  61   SGGHCRG  67



>ref|XP_009780051.1| PREDICTED: defensin-like protein 1 [Nicotiana sylvestris]
Length=74

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 1/55 (2%)
 Frame = +3

Query  105  LLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCTG  269
             L+++  AS M I     R+C S+S  + G C+  + NC  VC++EGFS G C G
Sbjct  10   FLLLIVFASQMAISRVEGRVCISQSHGYHGTCV-HDHNCALVCRNEGFSGGDCIG  63



>gb|KEH35661.1| Defensin [Medicago truncatula]
Length=73

 Score = 45.4 bits (106),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 35/55 (64%), Gaps = 2/55 (4%)
 Frame = +3

Query  105  LLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCTG  269
             ++++ +AS M +   G R C S+S  FKG+C+ ++ NC +VC  EGF  G+C G
Sbjct  10   FILLILLASQMMVQTEG-RHCESKSHRFKGMCM-SDHNCASVCHVEGFPGGNCRG  62



>gb|ABA86587.1| putative defensin 1 [Aquilegia chrysantha]
Length=70

 Score = 45.4 bits (106),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 28/45 (62%), Gaps = 1/45 (2%)
 Frame = +3

Query  135  MGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCTG  269
            MG+  A  R C S+S  FKG CI  + NC +VC SEGF+ G C G
Sbjct  14   MGLKVAXARDCESQSHKFKGTCIRXS-NCASVCXSEGFNGGHCRG  57



>gb|ABK23404.1| unknown [Picea sitchensis]
 gb|ABK23503.1| unknown [Picea sitchensis]
 gb|ABR17883.1| unknown [Picea sitchensis]
 gb|ACN40306.1| unknown [Picea sitchensis]
Length=83

 Score = 45.4 bits (106),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 35/55 (64%), Gaps = 2/55 (4%)
 Frame = +3

Query  105  LLVMLFMASGM-GIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCT  266
            LLV+L ++ GM  +  A  R C + S  FKGVC  +N NC  VC++EGF +GSC 
Sbjct  15   LLVLLVISIGMIQLELAEARTCKTPSGKFKGVCASSN-NCKNVCQTEGFPSGSCD  68



>gb|EYU27577.1| hypothetical protein MIMGU_mgv1a024490mg [Erythranthe guttata]
Length=71

 Score = 45.4 bits (106),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 33/60 (55%), Gaps = 6/60 (10%)
 Frame = +3

Query  90   FATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCTG  269
            FA V  LV +F         A  R C S+S  F+G C+  + NC  VC+SEGF++G C G
Sbjct  7    FALVLFLVFVFACE-----EAKGRTCESQSFNFRGPCVI-DHNCKAVCESEGFTDGDCQG  60



>sp|Q43413.1|DEF1_CAPAN RecName: Full=Defensin J1-1; Flags: Precursor [Capsicum annuum]
 gb|AAM09502.1|AF488780_1 gamma thionin [Capsicum annuum]
 emb|CAA64653.1| gamma-thionin [Capsicum annuum]
 gb|ACB30365.1| defensin [Capsicum annuum]
Length=75

 Score = 45.4 bits (106),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 41/62 (66%), Gaps = 4/62 (6%)
 Frame = +3

Query  84   RLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSC  263
            ++ AT+ L+++L  A+ M    A  ++C + S  FKG+C+ ++ +C  VC+ EGF++GSC
Sbjct  6    KVVATIFLMMLLVFATDM---MAEAKICEALSGNFKGLCL-SSRDCGNVCRREGFTDGSC  61

Query  264  TG  269
             G
Sbjct  62   IG  63



>ref|XP_010088525.1| Defensin-like protein 2 [Morus notabilis]
 gb|EXB36442.1| Defensin-like protein 2 [Morus notabilis]
Length=76

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 29/49 (59%), Gaps = 1/49 (2%)
 Frame = +3

Query  123  MASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCTG  269
            +A+ MG   A  R C S S  FKG C+  N NC  +C++EGF  G+C G
Sbjct  18   VAAEMGPKVADARTCQSASHRFKGTCV-RNSNCANICRTEGFQGGNCQG  65



>ref|XP_002864860.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41119.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=73

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 35/59 (59%), Gaps = 1/59 (2%)
 Frame = +3

Query  99   VSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCTGSY  275
             +  ++L + S  GI+ +  R C S+S  FK +C  ++ NC  VC++EGFS G C G +
Sbjct  7    TAFFLLLVLISCQGIIGSDGRTCQSKSHHFKYMCT-SSHNCAIVCRNEGFSGGRCHGFH  64



>ref|XP_008389117.1| PREDICTED: defensin Tk-AMP-D1.1-like [Malus domestica]
Length=87

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIM----------AAGPRMCSSRSQTFKGVCIFANGNCNT  227
            S+RL + V +LV+L  A+ MG +          A   ++C   S  FKG+C F++ NC  
Sbjct  4    SMRLVSAVCVLVLLLAATEMGPISVEAMTESNKAVEGKICEVPSTLFKGLC-FSSNNCKH  62

Query  228  VCKSEGFSNGSCTG  269
             C+ E F+ G C+G
Sbjct  63   TCRKEQFTRGKCSG  76



>gb|ABA86586.1| putative defensin 1 [Aquilegia formosa]
Length=70

 Score = 45.1 bits (105),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 28/45 (62%), Gaps = 1/45 (2%)
 Frame = +3

Query  135  MGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCTG  269
            MG   A  R C S+S  FKG CI  + NC +VC+SEGF+ G C G
Sbjct  14   MGPKVAEARDCESQSHKFKGTCIRKS-NCASVCQSEGFNGGHCRG  57



>gb|AHA50473.1| defensin-like protein 6 [Citrullus lanatus]
Length=74

 Score = 45.1 bits (105),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 40/63 (63%), Gaps = 1/63 (2%)
 Frame = +3

Query  81   VRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGS  260
            ++ F+   LL++L   +GM  +    R+C S S +FKG+C F++ NC  +CK+EGF+ G 
Sbjct  1    MKFFSAAILLLLLIFGTGMEPIVVEARVCESLSHSFKGLC-FSSTNCGNICKTEGFTGGV  59

Query  261  CTG  269
            C G
Sbjct  60   CRG  62



>emb|CAA62761.1| putative gamma-thionin protein [Picea abies]
Length=83

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 37/60 (62%), Gaps = 2/60 (3%)
 Frame = +3

Query  90   FATVSLLVMLFMASGM-GIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCT  266
             + + LLV+L ++ GM  +  A  R C + S  FKGVC  +N NC  VC++EGF +GSC 
Sbjct  10   LSAIFLLVLLVISIGMMQLELAEGRTCKTPSGKFKGVCASSN-NCKNVCQTEGFPSGSCD  68



>emb|CAH65875.1| OSIGBa0160I04.1 [Oryza sativa Indica Group]
Length=78

 Score = 45.1 bits (105),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/62 (34%), Positives = 36/62 (58%), Gaps = 3/62 (5%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFS  251
             SS + F  +++L++L + + M    A  R C + S  F G+C+    NC+ +CK+EGF 
Sbjct  2    ESSRKFFPAIAVLLLLVINTEMA--PAQARECETESSKFSGMCMI-QANCDHICKTEGFM  58

Query  252  NG  257
            +G
Sbjct  59   HG  60



>ref|XP_011001251.1| PREDICTED: defensin-like protein 1 [Populus euphratica]
Length=75

 Score = 45.1 bits (105),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 1/55 (2%)
 Frame = +3

Query  105  LLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCTG  269
             L+++ +AS   ++    R+C S+S  FKG C   + NC  VC++EGFS G C G
Sbjct  11   FLLLIVLASQEVVVPTEARVCLSQSHYFKGPCA-RDHNCAWVCRNEGFSGGRCKG  64



>gb|AAM62652.1| protease inhibitor II [Arabidopsis thaliana]
Length=76

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 1/55 (2%)
 Frame = +3

Query  105  LLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCTG  269
            LL+ + +A+ MG +    R C + S  F G C+ ++ NC  VC +EGFS+G C G
Sbjct  12   LLLFMILATVMGPVRVEARTCETSSNLFNGPCL-SSSNCANVCHNEGFSDGDCRG  65



>gb|AHA50472.1| defensin-like protein 5 [Citrullus lanatus]
Length=74

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 40/63 (63%), Gaps = 1/63 (2%)
 Frame = +3

Query  81   VRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGS  260
            ++ F+   LL++L   +GM  +    R+C S S +FKG+C F++ NC  +CK+EGF+ G 
Sbjct  1    MKFFSAAILLLLLIFGTGMEPIVVEARVCESLSHSFKGLC-FSSTNCGNICKTEGFTGGV  59

Query  261  CTG  269
            C G
Sbjct  60   CRG  62



>ref|XP_011084089.1| PREDICTED: defensin Ec-AMP-D2-like [Sesamum indicum]
Length=74

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 36/62 (58%), Gaps = 1/62 (2%)
 Frame = +3

Query  84   RLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSC  263
            RL     +L+++ +++  G M    R C S S  FKG C+ ++ NC +VC +EGF  G+C
Sbjct  3    RLATVFFVLMLVVISTERGPMVGEARTCESLSHRFKGACV-SSTNCASVCHTEGFPGGNC  61

Query  264  TG  269
             G
Sbjct  62   RG  63



>ref|XP_008340512.1| PREDICTED: defensin-like protein 1 [Malus domestica]
Length=90

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 38/79 (48%), Gaps = 14/79 (18%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMGIMAAGPR------------MCSSR-SQTFKGVCIFAN  212
              S+R  +   +L++L + +GMG MAA  R             C S  S  FKGVC F N
Sbjct  2    EPSMRFVSAAFVLILLLVTTGMGPMAAEGRSGMTSKGAAEKKKCDSHPSSKFKGVCFFTN  61

Query  213  GNCNTVCKSEGFSNGSCTG  269
             NC   CK EG S G C G
Sbjct  62   -NCVDTCKLEGSSGGQCRG  79



>ref|XP_002325734.2| defensin-like family protein [Populus trichocarpa]
 gb|EEF00116.2| defensin-like family protein [Populus trichocarpa]
Length=76

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 34/62 (55%), Gaps = 1/62 (2%)
 Frame = +3

Query  84   RLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSC  263
            R F    LL+++  +    ++    R+C S+S  FKG C   + NC  VC++EGFS G C
Sbjct  5    RSFGLFFLLLIVLASPEEVVVPTEARVCQSQSHYFKGPCA-RDHNCAWVCRNEGFSGGRC  63

Query  264  TG  269
             G
Sbjct  64   KG  65



>ref|XP_008389118.1| PREDICTED: defensin-like protein 1 [Malus domestica]
Length=87

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 38/76 (50%), Gaps = 11/76 (14%)
 Frame = +3

Query  72   SSSVRLFATVSLLVMLFMASGMGIM----------AAGPRMCSSRSQTFKGVCIFANGNC  221
              S+RL +   +LV+L +A+ MG M              R C + S  FKG+C F++ NC
Sbjct  2    ERSMRLVSASFVLVLLLVATEMGTMGVEARSKSSKVVEERTCEAASGKFKGLC-FSSNNC  60

Query  222  NTVCKSEGFSNGSCTG  269
               CK E F+ G C G
Sbjct  61   KHTCKREQFTGGKCRG  76



>ref|XP_007202809.1| hypothetical protein PRUPE_ppa014119mg [Prunus persica]
 gb|EMJ04008.1| hypothetical protein PRUPE_ppa014119mg [Prunus persica]
Length=85

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 37/72 (51%), Gaps = 9/72 (13%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMAAG--------PRMCSSRSQTFKGVCIFANGNCNTVC  233
            S R+F+TV +LV+L  A G G M A          R C S S  FKG C+ ++  C   C
Sbjct  4    SRRMFSTVFILVLLLGAIGTGPMVAEGKVATKEESRTCESLSTKFKGFCLRSS-RCAEAC  62

Query  234  KSEGFSNGSCTG  269
            + EGF  G C G
Sbjct  63   QKEGFMGGKCPG  74



>gb|KHG06821.1| Defensin-like protein [Gossypium arboreum]
Length=78

 Score = 44.7 bits (104),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 32/49 (65%), Gaps = 2/49 (4%)
 Frame = +3

Query  126  ASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSE-GFSNGSCTG  269
            A+ +G MA   R C ++S  +KG+C+F + NC+++CK E GF  G C G
Sbjct  20   ATEVGPMAVEGRTCETKSSEYKGICLF-DANCDSICKVEPGFDGGHCHG  67



>gb|ABK25062.1| unknown [Picea sitchensis]
Length=83

 Score = 44.7 bits (104),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 35/55 (64%), Gaps = 2/55 (4%)
 Frame = +3

Query  105  LLVMLFMASGM-GIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCT  266
            LLV+L ++ GM  +  A  R C + S  FKGVC  +N NC  VC++EGF +GSC 
Sbjct  15   LLVLLVISIGMMQLELAEGRTCKTPSGKFKGVCASSN-NCKNVCQTEGFPSGSCD  68



>emb|CAH58740.1| defensin [Plantago major]
Length=72

 Score = 44.7 bits (104),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 33/61 (54%), Gaps = 7/61 (11%)
 Frame = +3

Query  87   LFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCT  266
            LFA   +LV+       G M    R C S S  FKG C+ ++ NC +VCK+EGF  G C 
Sbjct  8    LFALFLVLVI------TGPMVGEARKCRSASHRFKGTCL-SDTNCASVCKTEGFPGGDCK  60

Query  267  G  269
            G
Sbjct  61   G  61



>ref|XP_004509637.1| PREDICTED: defensin J1-2-like [Cicer arietinum]
Length=58

 Score = 44.3 bits (103),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
 Frame = +3

Query  144  MAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCTG  269
            M A  R+C S+S ++KG+C+F + NC  VC++EGF  G C G
Sbjct  5    MVAEARICESKSLSYKGLCVF-DRNCALVCRTEGFVGGHCKG  45



>ref|XP_003526900.1| PREDICTED: defensin-like protein 6-like [Glycine max]
 gb|ACU20671.1| unknown [Glycine max]
 gb|KHN09676.1| Defensin-like protein 6 [Glycine soja]
Length=73

 Score = 44.3 bits (103),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 34/55 (62%), Gaps = 2/55 (4%)
 Frame = +3

Query  105  LLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSNGSCTG  269
             ++++ ++S M +   G R C S+S  FKG+C+ +  NC +VC  EGF+ G C G
Sbjct  10   FMLLILLSSQMVVQTEG-RHCESKSHRFKGMCL-SKHNCASVCHLEGFTGGKCRG  62



>gb|KHG15212.1| Defensin-like protein 1 [Gossypium arboreum]
Length=74

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 31/49 (63%), Gaps = 1/49 (2%)
 Frame = +3

Query  105  LLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFS  251
             L+++ +AS  G+     R+C S+S  F G C+ ++ NC  VC++EGFS
Sbjct  10   FLLLIVLASQWGVQPTEARVCQSQSHKFHGACV-SSHNCAMVCRNEGFS  57



>ref|XP_002468581.1| hypothetical protein SORBIDRAFT_01g048380 [Sorghum bicolor]
 gb|EER95579.1| hypothetical protein SORBIDRAFT_01g048380 [Sorghum bicolor]
Length=80

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 41/65 (63%), Gaps = 2/65 (3%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIMA-AGPRMCSSRSQTFKGVCIFANGNCNTVCKSEGFSN  254
            S +LF  V L+++L +A+ +G +A A  R C S+S  F+G C+    NC  VC++EGF +
Sbjct  4    SRKLFTAVVLVMLLLVATEIGAVAVAEARTCQSQSHRFRGPCV-RRENCANVCRTEGFPD  62

Query  255  GSCTG  269
            G C G
Sbjct  63   GKCRG  67



>gb|EYU32771.1| hypothetical protein MIMGU_mgv11b019564mg [Erythranthe guttata]
Length=82

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 42/72 (58%), Gaps = 2/72 (3%)
 Frame = +3

Query  63   MAASSSVRLFATVSLLVMLFMASGMGIMAAGPRMCSSRSQTFKGVCIFANGNCNTVCKS-  239
            MAAS   RL + + ++++LF+     +M    R+C  RS+T+ G C  +N NCN  C++ 
Sbjct  1    MAASLVYRLSSVILIVLLLFIMLNNEVMVVESRLCERRSKTWTGFCGSSN-NCNNQCRNW  59

Query  240  EGFSNGSCTGSY  275
            E  S+G+C   +
Sbjct  60   ERASHGACHAQF  71



>ref|XP_009342667.1| PREDICTED: defensin-like protein 2 [Pyrus x bretschneideri]
Length=89

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 38/75 (51%), Gaps = 11/75 (15%)
 Frame = +3

Query  78   SVRLFATVSLLVMLFMASGMGIM----------AAGPRMCSSRSQTFKGVCIFANGNCNT  227
            S+RL +   +LV+L  A+ MG M          A   ++C   S  FKG+C+ +N NC  
Sbjct  4    SMRLVSAAFVLVLLLAATEMGPMGIEAKTESSKAVEGKICEVPSTLFKGLCVSSN-NCKH  62

Query  228  VCKSEGFSNGSCTGS  272
             C+ E F+ G C G 
Sbjct  63   TCRKEQFTRGKCIGD  77



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 508176617088