BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24075_g1_i1 len=603 path=[25:0-83 1681:84-91 129:92-122 160:123-163
200:164-340 377:341-354 391:355-356 393:357-397 434:398-399
436:400-449 486:450-554 591:555-602]

Length=603
                                                                      Score     E

ref|XP_006392063.1|  hypothetical protein EUTSA_v10023787mg           58.2    4e-08   
ref|XP_009593292.1|  PREDICTED: defensin-like protein P322            57.8    5e-08   
ref|NP_178320.1|  defensin-like protein 4                             57.0    7e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009769844.1|  PREDICTED: defensin-like protein P322            55.8    2e-07   
ref|XP_010513973.1|  PREDICTED: defensin-like protein 1               55.8    2e-07   
ref|XP_009114206.1|  PREDICTED: defensin-like protein 1               55.5    3e-07   
ref|XP_009129168.1|  PREDICTED: defensin-like protein 1               55.1    4e-07   
ref|XP_006292781.1|  hypothetical protein CARUB_v10019030mg           55.1    5e-07   
ref|XP_010495961.1|  PREDICTED: defensin-like protein 1               54.7    5e-07   
emb|CDY48618.1|  BnaC09g20670D                                        54.7    6e-07   
ref|XP_004242747.1|  PREDICTED: defensin-like protein                 54.7    6e-07   
ref|XP_010502227.1|  PREDICTED: defensin-like protein 2               54.3    8e-07   
gb|AGT51229.1|  defensin                                              54.3    8e-07   
ref|XP_006395808.1|  hypothetical protein EUTSA_v10005229mg           54.3    8e-07   
gb|AAL35366.1|AF442388_1  defensin protein precursor                  53.9    1e-06   Capsicum annuum
gb|AGT51227.1|  defensin                                              53.5    1e-06   
gb|ADK87340.1|  defensin                                              53.5    2e-06   
ref|XP_002865329.1|  hypothetical protein ARALYDRAFT_917107           53.5    2e-06   
gb|ACB32234.1|  gamma-thionin/defensin                                53.1    2e-06   Solanum chacoense
ref|XP_010513972.1|  PREDICTED: defensin-like protein 2               53.1    2e-06   
gb|AFW58880.1|  low-molecular-weight cysteine-rich protein LCR70      53.1    3e-06   
ref|NP_178321.1|  defensin-like protein 1                             52.8    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001149230.1|  LOC100282852 precursor                           52.8    3e-06   Zea mays [maize]
ref|XP_002274353.1|  PREDICTED: defensin Ec-AMP-D2                    52.4    4e-06   Vitis vinifera
gb|ACV84383.1|  defensin precursor                                    52.4    5e-06   Triticum turgidum subsp. durum
ref|XP_006395809.1|  hypothetical protein EUTSA_v10005228mg           52.0    5e-06   
gb|ABO36641.1|  defensin protein                                      52.0    5e-06   Solanum pimpinellifolium [currant tomato]
ref|XP_006292136.1|  hypothetical protein CARUB_v10018340mg           52.0    6e-06   
ref|XP_009351646.1|  PREDICTED: defensin Ec-AMP-D2-like               52.0    6e-06   
gb|ABO36637.1|  defensin protein                                      51.6    9e-06   Solanum lycopersicum
ref|XP_009101273.1|  PREDICTED: defensin-like protein 2               51.2    9e-06   
ref|XP_009800136.1|  PREDICTED: defensin J1-2-like                    51.2    1e-05   
ref|NP_178319.1|  defensin-like protein 2                             51.2    1e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006585876.1|  PREDICTED: defensin-like protein-like            52.0    1e-05   
gb|AAS65426.1|  Kunitz-type trypsin inhibitor                         50.8    1e-05   Ipomoea batatas [batate]
ref|XP_009784025.1|  PREDICTED: defensin J1-2                         50.8    2e-05   
gb|AAA91049.1|  protease inhibitor II                                 50.8    2e-05   Brassica rapa
gb|KHN06998.1|  Defensin-like protein                                 50.8    2e-05   
ref|XP_008340514.1|  PREDICTED: defensin Ec-AMP-D2-like               50.4    2e-05   
ref|XP_009604566.1|  PREDICTED: defensin J1-2-like                    50.4    2e-05   
ref|XP_009351645.1|  PREDICTED: defensin Ec-AMP-D2-like               50.4    2e-05   
gb|AFD01290.1|  defensin 3                                            50.4    2e-05   
ref|XP_009614488.1|  PREDICTED: defensin J1-2-like                    50.4    2e-05   
ref|XP_009610211.1|  PREDICTED: defensin J1-2                         50.1    3e-05   
gb|EAY86781.1|  hypothetical protein OsI_08161                        53.5    3e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_009593293.1|  PREDICTED: defensin-like protein P322            49.7    4e-05   
ref|NP_001234872.1|  gamma-thionin precursor                          49.7    4e-05   
gb|ACG41256.1|  low-molecular-weight cysteine-rich protein LCR70 ...  49.7    5e-05   Zea mays [maize]
ref|XP_010270777.1|  PREDICTED: defensin-like protein                 49.3    5e-05   
ref|XP_006367978.1|  PREDICTED: defensin-like protein P322-like       49.3    7e-05   
emb|CDP10468.1|  unnamed protein product                              48.9    7e-05   
gb|AGT51228.1|  defensin                                              48.9    7e-05   
ref|XP_002875115.1|  hypothetical protein ARALYDRAFT_484136           48.9    8e-05   
ref|XP_009768915.1|  PREDICTED: defensin-like protein isoform X2      48.9    9e-05   
ref|XP_006292097.1|  hypothetical protein CARUB_v10018292mg           49.3    9e-05   
ref|XP_004297787.1|  PREDICTED: defensin-like protein 2-like          48.5    1e-04   
ref|NP_001047493.1|  Os02g0629800                                     48.5    1e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006359487.1|  PREDICTED: defensin-like protein-like            48.5    1e-04   
ref|XP_004953175.1|  PREDICTED: defensin-like protein 2-like          48.5    1e-04   
ref|XP_010250779.1|  PREDICTED: defensin Ec-AMP-D2-like               48.1    1e-04   
ref|XP_004509604.1|  PREDICTED: defensin-like protein P322-like       48.1    2e-04   
ref|XP_008389119.1|  PREDICTED: defensin Ec-AMP-D2-like               48.1    2e-04   
sp|Q40901.1|DEF_PETIN  RecName: Full=Defensin-like protein; AltNa...  47.8    2e-04   Petunia integrifolia [violet-flowered petunia]
ref|XP_009614667.1|  PREDICTED: defensin-like protein                 47.8    2e-04   
ref|XP_006359485.1|  PREDICTED: defensin-like protein-like            47.8    2e-04   
ref|XP_010043884.1|  PREDICTED: defensin Ec-AMP-D2-like               47.8    2e-04   
gb|ACV84379.1|  defensin precursor                                    47.4    3e-04   Triticum aestivum [Canadian hard winter wheat]
dbj|BAA95697.1|  thionin like protein                                 47.4    3e-04   Nicotiana tabacum [American tobacco]
gb|ADQ43196.1|  unknown                                               47.4    3e-04   
gb|KFK26328.1|  hypothetical protein AALP_AA8G233400                  47.0    4e-04   
gb|KHN23780.1|  Defensin SD2                                          47.0    4e-04   
ref|XP_009354384.1|  PREDICTED: defensin Ec-AMP-D2-like               47.0    5e-04   
ref|NP_001234987.1|  protease inhibitor precursor                     47.0    5e-04   
ref|XP_007223891.1|  hypothetical protein PRUPE_ppa014246mg           47.0    5e-04   
ref|XP_010910081.1|  PREDICTED: defensin Ec-AMP-D2-like               46.6    5e-04   
ref|XP_008349481.1|  PREDICTED: defensin Ec-AMP-D2-like               46.6    5e-04   
ref|XP_002886566.1|  protease inhibitor II                            46.6    6e-04   
ref|XP_006647552.1|  PREDICTED: defensin-like protein P322-like       46.6    7e-04   
gb|AAL85480.1|  defensin protein 1                                    46.6    7e-04   Prunus persica



>ref|XP_006392063.1| hypothetical protein EUTSA_v10023787mg [Eutrema salsugineum]
 gb|ESQ29349.1| hypothetical protein EUTSA_v10023787mg [Eutrema salsugineum]
Length=79

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 47/83 (57%), Gaps = 9/83 (11%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDTE  280
            S+ L++  ++++ML +A+GMG +    RMC S S+ + G CL     S  NC  IC + E
Sbjct  6    SLPLISAIAIMLMLLLATGMGPVTVEARMCESSSQLFNGPCL-----STTNCANICHN-E  59

Query  281  GFTSGDCTITAQARRICSCFMPC  349
            GFT GDC      RR C C  PC
Sbjct  60   GFTDGDC---QGFRRRCICTRPC  79



>ref|XP_009593292.1| PREDICTED: defensin-like protein P322 [Nicotiana tomentosiformis]
Length=78

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 47/86 (55%), Gaps = 10/86 (12%)
 Frame = +2

Query  95   SSSVRLVAIASLLVMLFMASGMGTMA-AGTRMCTSQSEHYRGNCLLINQNSRNNCNRICR  271
            + S+R  A   LL +LFMA+ MG M  A  R C SQS+ +RG C+        NC  +C 
Sbjct  2    AKSMRFFATVLLLAILFMATEMGPMTIAEARHCESQSQRFRGLCV-----REKNCAAVC-  55

Query  272  DTEGFTSGDCTITAQARRICSCFMPC  349
            +TEGF+ GDC      RR C C  PC
Sbjct  56   ETEGFSGGDCR---GLRRRCFCTRPC  78



>ref|NP_178320.1| defensin-like protein 4 [Arabidopsis thaliana]
 sp|Q41914.2|DEF04_ARATH RecName: Full=Defensin-like protein 4; AltName: Full=Low-molecular-weight 
cysteine-rich protein 70; Short=Protein LCR70; 
AltName: Full=Plant defensin 2.1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC97222.1| protease inhibitor II [Arabidopsis thaliana]
 dbj|BAC42603.1| putative protease inhibitor II [Arabidopsis thaliana]
 gb|AAO42893.1| At2g02120 [Arabidopsis thaliana]
 gb|AEC05548.1| defensin-like protein 4 [Arabidopsis thaliana]
Length=77

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 41/67 (61%), Gaps = 6/67 (9%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDTE  280
            S+RL++    LVM+F+A+GMG +    R C SQS+ ++G C+     S  NC  +C + E
Sbjct  4    SMRLISAVLFLVMIFVATGMGPVTVEARTCASQSQRFKGKCV-----SDTNCENVCHN-E  57

Query  281  GFTSGDC  301
            GF  GDC
Sbjct  58   GFPGGDC  64



>ref|XP_009769844.1| PREDICTED: defensin-like protein P322 [Nicotiana sylvestris]
Length=78

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 46/86 (53%), Gaps = 10/86 (12%)
 Frame = +2

Query  95   SSSVRLVAIASLLVMLFMASGMGTMA-AGTRMCTSQSEHYRGNCLLINQNSRNNCNRICR  271
            + S+R  A   LL ML MA+ MG M  A  R C S+S+ +RG C+        NC  +C 
Sbjct  2    AKSMRFFATVLLLAMLVMATEMGPMTIAEARRCESKSQRFRGPCV-----REKNCAAVC-  55

Query  272  DTEGFTSGDCTITAQARRICSCFMPC  349
            +TEGF+ GDC      RR C C  PC
Sbjct  56   ETEGFSGGDCR---GLRRRCFCTRPC  78



>ref|XP_010513973.1| PREDICTED: defensin-like protein 1 [Camelina sativa]
Length=77

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 47/83 (57%), Gaps = 9/83 (11%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDTE  280
            S+RL++   L+ MLF+A+GMG +    R C S+S  +RG C+     SR+NC  +C + E
Sbjct  4    SMRLISAVLLMFMLFVATGMGPVTVEARTCESKSHRFRGPCV-----SRHNCGNVCHN-E  57

Query  281  GFTSGDCTITAQARRICSCFMPC  349
            GF+ G C      RR C C   C
Sbjct  58   GFSGGKCR---GFRRRCFCTRHC  77



>ref|XP_009114206.1| PREDICTED: defensin-like protein 1 [Brassica rapa]
 emb|CDY04121.1| BnaA09g18990D [Brassica napus]
Length=77

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 46/83 (55%), Gaps = 9/83 (11%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDTE  280
            S+RL++   L+ M+F+ASGMG +    R C S+S  +RG C+     SR+NC  +C + E
Sbjct  4    SLRLISAVLLMFMIFVASGMGPVTVEARTCESKSHKFRGPCV-----SRHNCANVCHN-E  57

Query  281  GFTSGDCTITAQARRICSCFMPC  349
            GF  G C      RR C C   C
Sbjct  58   GFHGGKCR---GFRRRCYCTRHC  77



>ref|XP_009129168.1| PREDICTED: defensin-like protein 1 [Brassica rapa]
 emb|CDY09389.1| BnaA02g26210D [Brassica napus]
Length=77

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 46/83 (55%), Gaps = 9/83 (11%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDTE  280
            S+RL++   LL M+F+A+GMG ++   R C SQS  ++G C+     S NNC  +C + E
Sbjct  4    SMRLISAVLLLFMIFVATGMGPVSVEARTCESQSHRFKGPCV-----SENNCANVCHN-E  57

Query  281  GFTSGDCTITAQARRICSCFMPC  349
            GF  G C      RR C C   C
Sbjct  58   GFGGGKCR---GLRRRCFCTRHC  77



>ref|XP_006292781.1| hypothetical protein CARUB_v10019030mg [Capsella rubella]
 gb|EOA25679.1| hypothetical protein CARUB_v10019030mg [Capsella rubella]
Length=77

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 45/83 (54%), Gaps = 9/83 (11%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDTE  280
            S+RL++   +L M+F+A+GMG +    R C S+S  ++G C      S  NC  +C + E
Sbjct  4    SIRLISAVLVLFMIFVATGMGPVTVEARTCESKSHRFKGKCF-----SETNCKNVCHN-E  57

Query  281  GFTSGDCTITAQARRICSCFMPC  349
            GFT G+C      RR C C   C
Sbjct  58   GFTGGNC---RGFRRRCFCTRHC  77



>ref|XP_010495961.1| PREDICTED: defensin-like protein 1 [Camelina sativa]
Length=77

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 47/83 (57%), Gaps = 9/83 (11%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDTE  280
            S+RL++   L+ M+F+A+GMG +    R C S+S  +RG C+     SR+NC  +C + E
Sbjct  4    SMRLISAVLLMFMIFVATGMGPVTVEARTCESKSHRFRGPCV-----SRHNCGNVCHN-E  57

Query  281  GFTSGDCTITAQARRICSCFMPC  349
            GF+ G C      RR C C   C
Sbjct  58   GFSGGKCR---GFRRRCFCTRHC  77



>emb|CDY48618.1| BnaC09g20670D [Brassica napus]
Length=77

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 46/83 (55%), Gaps = 9/83 (11%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDTE  280
            S+RL++   L+ M+F+ASGMG +    R C S+S  +RG C+     SR+NC  +C + E
Sbjct  4    SLRLISAVLLMFMIFVASGMGPVTVEARTCESKSHKFRGLCV-----SRHNCANVCHN-E  57

Query  281  GFTSGDCTITAQARRICSCFMPC  349
            GF  G C      RR C C   C
Sbjct  58   GFHGGKCR---GFRRRCYCTRHC  77



>ref|XP_004242747.1| PREDICTED: defensin-like protein [Solanum lycopersicum]
 gb|ABO36635.1| defensin protein [Solanum lycopersicum]
 gb|ABO36640.1| defensin protein [Solanum pimpinellifolium]
Length=76

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 47/84 (56%), Gaps = 10/84 (12%)
 Frame = +2

Query  98   SSVRLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDT  277
            +S+RL A   L+ ML +A+G  T +   R C SQS H++GNCL     S  NC  +CR T
Sbjct  3    NSLRLFATFFLVAMLLLATGP-TTSVEARTCESQSHHFKGNCL-----SDTNCGSVCR-T  55

Query  278  EGFTSGDCTITAQARRICSCFMPC  349
            EGFT G+C      RR C C   C
Sbjct  56   EGFTGGNC---RGFRRRCFCTRNC  76



>ref|XP_010502227.1| PREDICTED: defensin-like protein 2 [Camelina sativa]
Length=77

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 45/83 (54%), Gaps = 9/83 (11%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDTE  280
            S+RL++   +L M+F+A+GMG +    R C SQS  ++G C      S  NC  +C + E
Sbjct  4    SIRLISAVLVLFMIFVATGMGPVTVEARTCESQSHRFKGKCF-----SETNCRNVCHN-E  57

Query  281  GFTSGDCTITAQARRICSCFMPC  349
            GF+ G+C      RR C C   C
Sbjct  58   GFSGGNCR---GFRRRCFCTRYC  77



>gb|AGT51229.1| defensin [Brassica napus]
 emb|CDY51475.1| BnaC02g47680D [Brassica napus]
Length=77

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 46/83 (55%), Gaps = 9/83 (11%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDTE  280
            S+RL++   LL M+F+A+GMG ++   R C SQS  ++G C+     S NNC  +C + E
Sbjct  4    SMRLISAVLLLFMIFVATGMGPVSVEARTCESQSHRFKGPCV-----SDNNCANVCHN-E  57

Query  281  GFTSGDCTITAQARRICSCFMPC  349
            GF  G C      RR C C   C
Sbjct  58   GFGGGKCR---GLRRRCFCTRHC  77



>ref|XP_006395808.1| hypothetical protein EUTSA_v10005229mg [Eutrema salsugineum]
 gb|ACQ90607.1| defensin-like protein [Eutrema halophilum]
 gb|ESQ33094.1| hypothetical protein EUTSA_v10005229mg [Eutrema salsugineum]
Length=77

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 46/83 (55%), Gaps = 9/83 (11%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDTE  280
            S+RL++   L+ M+F+A+GMG +    R C S+S  ++G CL     S  NC  +C + E
Sbjct  4    SMRLISALLLVFMIFVATGMGPVTVEARKCESKSHRFKGKCL-----SETNCKNVCHN-E  57

Query  281  GFTSGDCTITAQARRICSCFMPC  349
            GFT G+C      RR C C   C
Sbjct  58   GFTGGNCR---GFRRRCFCTRNC  77



>gb|AAL35366.1|AF442388_1 defensin protein precursor [Capsicum annuum]
 gb|AAR90845.1| defensin precursor [Capsicum annuum]
Length=78

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 45/86 (52%), Gaps = 10/86 (12%)
 Frame = +2

Query  95   SSSVRLVAIASLLVMLFMASGMGTM-AAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICR  271
            + S+R  AI  LL ML MA+ MG M     R C SQS  ++G C      S  NC  +C+
Sbjct  2    AHSMRFFAIVLLLAMLVMATEMGPMRIVEARTCESQSHRFKGVC-----ASETNCASVCQ  56

Query  272  DTEGFTSGDCTITAQARRICSCFMPC  349
             TEGF+ GDC      RR C C  PC
Sbjct  57   -TEGFSGGDCR---GFRRRCFCTRPC  78



>gb|AGT51227.1| defensin [Brassica napus]
Length=77

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 46/83 (55%), Gaps = 9/83 (11%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDTE  280
            S+RL++   L++M+F+ASGMG +    R   S+S  +RG C+     SR+NC  +C + E
Sbjct  4    SLRLISAVLLMIMIFVASGMGPVTVEARTSESKSHKFRGPCV-----SRHNCANVCHN-E  57

Query  281  GFTSGDCTITAQARRICSCFMPC  349
            GF  G C      RR C C   C
Sbjct  58   GFHGGKCR---GFRRRCYCTRHC  77



>gb|ADK87340.1| defensin [Pyrus pyrifolia]
 gb|AGC00408.1| defensin 1 [Pyrus pyrifolia]
Length=78

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 46/84 (55%), Gaps = 10/84 (12%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMASGM-GTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDT  277
            SVRL + A + V+L +A+GM G M A  R C SQS  ++G CL     SR+NC  +C  T
Sbjct  4    SVRLFSTAFVFVLLLVATGMMGPMLAEGRTCESQSRKFKGACL-----SRSNCASVC-QT  57

Query  278  EGFTSGDCTITAQARRICSCFMPC  349
            EGF  G C      RR C C   C
Sbjct  58   EGFPGGHCR---GFRRRCFCTKHC  78



>ref|XP_002865329.1| hypothetical protein ARALYDRAFT_917107 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41588.1| hypothetical protein ARALYDRAFT_917107 [Arabidopsis lyrata subsp. 
lyrata]
Length=81

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 44/85 (52%), Gaps = 9/85 (11%)
 Frame = +2

Query  95   SSSVRLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRD  274
             SS++L++    LV+L +A GM  M  G +MC +QS ++RG C         NC R+C  
Sbjct  2    KSSIQLISTLFFLVILVLAPGMMKMVEGQQMCETQSINFRGMC-----TKWRNCQRVCM-  55

Query  275  TEGFTSGDCTITAQARRICSCFMPC  349
            +EGF  G C       R C C  PC
Sbjct  56   SEGFPDGRC---KGFIRKCICTKPC  77



>gb|ACB32234.1| gamma-thionin/defensin [Solanum chacoense]
Length=76

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 46/85 (54%), Gaps = 10/85 (12%)
 Frame = +2

Query  95   SSSVRLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRD  274
            ++S+RL A   LL ML MA+G  T     R C SQS  ++G C+     S  NC  +C +
Sbjct  2    ANSMRLFATMLLLAMLVMATG-PTRIVEARTCESQSHRFKGPCV-----SEKNCASVC-E  54

Query  275  TEGFTSGDCTITAQARRICSCFMPC  349
            TEGF+ GDC      RR C C  PC
Sbjct  55   TEGFSGGDCR---GLRRRCFCTRPC  76



>ref|XP_010513972.1| PREDICTED: defensin-like protein 2 [Camelina sativa]
 ref|XP_010495963.1| PREDICTED: defensin-like protein 2 [Camelina sativa]
Length=77

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 45/83 (54%), Gaps = 9/83 (11%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDTE  280
            S+RL++   +L M+F+A+GMG +    R C S+S  ++G C      S  NC  +C + E
Sbjct  4    SIRLISAVLVLFMIFVATGMGPVTVEARTCESKSHRFKGKCF-----SETNCRNVCHN-E  57

Query  281  GFTSGDCTITAQARRICSCFMPC  349
            GF+ G+C      RR C C   C
Sbjct  58   GFSGGNCR---GFRRRCFCTRHC  77



>gb|AFW58880.1| low-molecular-weight cysteine-rich protein LCR70 [Zea mays]
Length=82

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 49/91 (54%), Gaps = 15/91 (16%)
 Frame = +2

Query  89   MASSSVRLVAIA-SLLVMLFMASGMGTM-AAGTRMCTSQSEHYRGNCLLINQNSRNNCNR  262
            MA +S R+VA A   L+ML  AS MGT   A  R CTSQS  + G C+     S++NC  
Sbjct  1    MAWTSRRMVASALVFLLMLLAASEMGTTRVAEARHCTSQSHRFVGACM-----SKSNCEN  55

Query  263  ICRDTEGFTSGDCTITAQARRICSCFMPCHC  355
            +CR TEGF  G+C      R+       CHC
Sbjct  56   VCR-TEGFPWGECRWHGIERK-------CHC  78



>ref|NP_178321.1| defensin-like protein 1 [Arabidopsis thaliana]
 sp|Q9ZUL7.1|DEF01_ARATH RecName: Full=Defensin-like protein 1; AltName: Full=Low-molecular-weight 
cysteine-rich protein 68; Short=Protein LCR68; 
AltName: Full=Plant defensin 2.3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC97221.1| protease inhibitor II [Arabidopsis thaliana]
 gb|AAK93656.1| putative protease inhibitor II [Arabidopsis thaliana]
 gb|AAL85136.1| putative protease inhibitor II [Arabidopsis thaliana]
 gb|AEC05549.1| defensin-like protein 1 [Arabidopsis thaliana]
Length=77

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 45/83 (54%), Gaps = 9/83 (11%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDTE  280
            SVR ++ A LL M+F+A+GMG +    R C S+S  ++G C+     S +NC  +C + E
Sbjct  4    SVRFISAALLLFMVFIATGMGPVTVEARTCESKSHRFKGPCV-----STHNCANVCHN-E  57

Query  281  GFTSGDCTITAQARRICSCFMPC  349
            GF  G C      RR C C   C
Sbjct  58   GFGGGKCR---GFRRRCYCTRHC  77



>ref|NP_001149230.1| LOC100282852 precursor [Zea mays]
 gb|ACG34648.1| low-molecular-weight cysteine-rich protein LCR70 precursor [Zea 
mays]
Length=82

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 49/91 (54%), Gaps = 15/91 (16%)
 Frame = +2

Query  89   MASSSVRLVAIA-SLLVMLFMASGMGTM-AAGTRMCTSQSEHYRGNCLLINQNSRNNCNR  262
            MA +S R+VA A   L+ML  AS MGT   A  R CTSQS  + G C+     S++NC  
Sbjct  1    MAWTSRRMVASALVFLLMLLAASEMGTTRXAEARHCTSQSHRFVGACM-----SKSNCEN  55

Query  263  ICRDTEGFTSGDCTITAQARRICSCFMPCHC  355
            +CR TEGF  G+C      R+       CHC
Sbjct  56   VCR-TEGFPWGECRWHGIERK-------CHC  78



>ref|XP_002274353.1| PREDICTED: defensin Ec-AMP-D2 [Vitis vinifera]
 emb|CBI27507.3| unnamed protein product [Vitis vinifera]
Length=77

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 45/85 (53%), Gaps = 9/85 (11%)
 Frame = +2

Query  95   SSSVRLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRD  274
              S RL +   L+++LFMA+ MG M A  R C SQS  ++G C+      ++NC  +C  
Sbjct  2    KGSQRLFSAFLLVILLFMATEMGPMVAEARTCESQSHRFKGTCV-----RQSNCAAVC-Q  55

Query  275  TEGFTSGDCTITAQARRICSCFMPC  349
            TEGF  G+C      RR C C   C
Sbjct  56   TEGFHGGNCR---GFRRRCFCTKHC  77



>gb|ACV84383.1| defensin precursor [Triticum turgidum subsp. durum]
Length=85

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 49/92 (53%), Gaps = 12/92 (13%)
 Frame = +2

Query  89   MASSSVRLVAIASLLVMLFMASGMGTMAA-----GTRMCTSQSEHYRGNCLLINQNSRNN  253
            MAS+S R+VA   L+++L +A+ MGTM       G R C SQS  YRG C        +N
Sbjct  1    MASTSRRMVASVLLVLLLLVATEMGTMRVAEARHGHRHCESQSHRYRGACWRD-----DN  55

Query  254  CNRICRDTEGFTSGDCTITAQARRICSCFMPC  349
            C  +C +TEGF  G C      R+ C C  PC
Sbjct  56   CEHVC-NTEGFPWGKCKFHDFERK-CFCKRPC  85



>ref|XP_006395809.1| hypothetical protein EUTSA_v10005228mg [Eutrema salsugineum]
 gb|ACQ90606.1| defensin-like protein [Eutrema halophilum]
 gb|ESQ33095.1| hypothetical protein EUTSA_v10005228mg [Eutrema salsugineum]
Length=77

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 45/83 (54%), Gaps = 9/83 (11%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDTE  280
            S+RL++   L+ M+F+A+GMG +    R C S+S  ++G CL     S  NC  +C + E
Sbjct  4    SMRLISTVILVFMIFVATGMGPVTVEARTCESKSHRFKGACL-----SETNCKNVCHN-E  57

Query  281  GFTSGDCTITAQARRICSCFMPC  349
            GF  G+C      RR C C   C
Sbjct  58   GFRGGNC---RGLRRRCFCTRNC  77



>gb|ABO36641.1| defensin protein [Solanum pimpinellifolium]
Length=76

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 46/85 (54%), Gaps = 10/85 (12%)
 Frame = +2

Query  95   SSSVRLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRD  274
            ++S+RL A   LL ML MA+G   +    R C SQS  ++G C+     S  NC  +C +
Sbjct  2    ANSMRLFATMLLLAMLVMATGPMKIVEA-RTCESQSHRFKGPCV-----SEKNCASVC-E  54

Query  275  TEGFTSGDCTITAQARRICSCFMPC  349
            TEGF+ GDC      RR C C  PC
Sbjct  55   TEGFSGGDCR---GFRRRCFCTRPC  76



>ref|XP_006292136.1| hypothetical protein CARUB_v10018340mg [Capsella rubella]
 gb|EOA25034.1| hypothetical protein CARUB_v10018340mg [Capsella rubella]
Length=77

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 46/83 (55%), Gaps = 9/83 (11%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDTE  280
            S+RL++   ++ M+F+A+GMG +    R C S+S  ++G CL     S +NC  +C + E
Sbjct  4    SMRLISAVLVMFMIFVATGMGPVTVEARTCESKSHRFKGTCL-----SESNCKNVCHN-E  57

Query  281  GFTSGDCTITAQARRICSCFMPC  349
            GF  G+C      RR C C   C
Sbjct  58   GFQGGNCR---GFRRRCFCTRHC  77



>ref|XP_009351646.1| PREDICTED: defensin Ec-AMP-D2-like [Pyrus x bretschneideri]
Length=78

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 46/84 (55%), Gaps = 10/84 (12%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMASGM-GTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDT  277
            S+RL + A + V+L +A+GM G M A  R C SQS  ++G CL     SR+NC  +C  T
Sbjct  4    SMRLFSTAFVFVLLLVATGMMGPMLAEGRTCESQSRKFKGACL-----SRSNCASVC-QT  57

Query  278  EGFTSGDCTITAQARRICSCFMPC  349
            EGF  G C      RR C C   C
Sbjct  58   EGFPGGHCR---GFRRRCFCTKHC  78



>gb|ABO36637.1| defensin protein [Solanum lycopersicum]
Length=76

 Score = 51.6 bits (122),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 46/85 (54%), Gaps = 10/85 (12%)
 Frame = +2

Query  95   SSSVRLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRD  274
            ++S+RL A   LL ML MA+G   +    R C SQS  ++G C+     S  NC  +C +
Sbjct  2    ANSMRLFATMLLLAMLVMATGPMRIVEA-RTCESQSHRFKGPCV-----SEKNCASVC-E  54

Query  275  TEGFTSGDCTITAQARRICSCFMPC  349
            TEGF+ GDC      RR C C  PC
Sbjct  55   TEGFSGGDCR---GFRRRCFCTRPC  76



>ref|XP_009101273.1| PREDICTED: defensin-like protein 2 [Brassica rapa]
 emb|CDY17613.1| BnaA06g34320D [Brassica napus]
Length=77

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 44/83 (53%), Gaps = 9/83 (11%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDTE  280
            S+RL++   LL M+F+A+GMG +    R C S+S  ++G C+     S  NC  +C + E
Sbjct  4    SMRLISAVLLLFMIFVATGMGPVTVEARTCESKSHRFKGTCV-----SSTNCGNVCHN-E  57

Query  281  GFTSGDCTITAQARRICSCFMPC  349
            GF  G C      RR C C   C
Sbjct  58   GFGGGKC---RGFRRRCYCTRHC  77



>ref|XP_009800136.1| PREDICTED: defensin J1-2-like [Nicotiana sylvestris]
Length=77

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 44/81 (54%), Gaps = 9/81 (11%)
 Frame = +2

Query  107  RLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDTEGF  286
            +L A   L++ML  A+ MGTM A  R C SQS  ++G C+      ++NC  +C+ TEGF
Sbjct  6    KLFATVFLVLMLVFATEMGTMVADARTCESQSHRFKGPCV-----RKSNCAAVCQ-TEGF  59

Query  287  TSGDCTITAQARRICSCFMPC  349
             +G C      RR C C   C
Sbjct  60   HAGHCR---GIRRRCFCTKHC  77



>ref|NP_178319.1| defensin-like protein 2 [Arabidopsis thaliana]
 sp|Q39182.1|DEF02_ARATH RecName: Full=Defensin-like protein 2; AltName: Full=Low-molecular-weight 
cysteine-rich protein 69; Short=Protein LCR69; 
AltName: Full=Plant defensin 2.2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK44170.1|AF370355_1 putative protease inhibitor II [Arabidopsis thaliana]
 emb|CAA48892.1| protease inhibitor II [Arabidopsis thaliana]
 gb|AAC97223.1| protease inhibitor II [Arabidopsis thaliana]
 gb|AAX39303.1| defensin-like protein [Arabidopsis thaliana]
 gb|AEC05546.1| defensin-like protein 2 [Arabidopsis thaliana]
Length=77

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 46/83 (55%), Gaps = 9/83 (11%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDTE  280
            S+RL++   ++ M+F+A+GMG +    R C SQS  ++G C+     S +NC  +C + E
Sbjct  4    SMRLISAVLIMFMIFVATGMGPVTVEARTCESQSHRFKGTCV-----SASNCANVCHN-E  57

Query  281  GFTSGDCTITAQARRICSCFMPC  349
            GF  G+C      RR C C   C
Sbjct  58   GFVGGNCR---GFRRRCFCTRHC  77



>ref|XP_006585876.1| PREDICTED: defensin-like protein-like [Glycine max]
Length=127

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 41/68 (60%), Gaps = 7/68 (10%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMASGMG-TMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDT  277
            SV LV+   +L++L +A+ MG TM A  R C SQS  ++G CL     S  NC  +CR T
Sbjct  4    SVPLVSTIFVLLLLLIATEMGPTMVAEARTCESQSHRFKGPCL-----SDTNCGSVCR-T  57

Query  278  EGFTSGDC  301
            EGF+ G C
Sbjct  58   EGFSGGHC  65



>gb|AAS65426.1| Kunitz-type trypsin inhibitor [Ipomoea batatas]
Length=80

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 41/76 (54%), Gaps = 12/76 (16%)
 Frame = +2

Query  131  LVMLFMASGMGT---MAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDTEGFTSGDC  301
             VMLFMA+ +GT   M A  RMC S S  ++G C     +  +NC  +C  TEGFT GDC
Sbjct  14   FVMLFMATELGTNRIMVAEARMCESASSKFKGPC-----SRDSNCATVCH-TEGFTGGDC  67

Query  302  TITAQARRICSCFMPC  349
                  RR C C  PC
Sbjct  68   ---KGFRRRCFCTKPC  80



>ref|XP_009784025.1| PREDICTED: defensin J1-2 [Nicotiana sylvestris]
Length=77

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 39/65 (60%), Gaps = 6/65 (9%)
 Frame = +2

Query  107  RLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDTEGF  286
            +++AI  L++ML  A+ MG M A  R C SQS  ++G C+     S++NC  +C  TEGF
Sbjct  6    KVLAIVFLMLMLVFANEMGPMVAEARTCESQSHRFKGLCI-----SKSNCASVC-HTEGF  59

Query  287  TSGDC  301
              G C
Sbjct  60   NGGHC  64



>gb|AAA91049.1| protease inhibitor II [Brassica rapa]
Length=77

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 39/67 (58%), Gaps = 6/67 (9%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDTE  280
            S+RL++   LL M+F+A+GMG +    R C S+S  ++G C+     S  NC  +C + E
Sbjct  4    SMRLISAVLLLFMIFVATGMGPVTVEARTCESKSHRFKGTCV-----SSTNCGNVCHN-E  57

Query  281  GFTSGDC  301
            GF  G C
Sbjct  58   GFGGGKC  64



>gb|KHN06998.1| Defensin-like protein [Glycine soja]
Length=84

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 41/68 (60%), Gaps = 7/68 (10%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMASGMG-TMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDT  277
            SV LV+   +L++L +A+ MG TM A  R C SQS  ++G CL     S  NC  +CR T
Sbjct  4    SVPLVSTIFVLLLLLIATEMGPTMVAEARTCESQSHRFKGPCL-----SDTNCGSVCR-T  57

Query  278  EGFTSGDC  301
            EGF+ G C
Sbjct  58   EGFSGGHC  65



>ref|XP_008340514.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
Length=78

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 46/84 (55%), Gaps = 10/84 (12%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMASGM-GTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDT  277
            S+RL + A + V+L +A+GM G + A  R C SQS  ++G CL     S+ NC  +C  T
Sbjct  4    SMRLFSTAFVFVLLLVATGMMGPLLAEGRTCESQSRKFKGTCL-----SKTNCASVC-QT  57

Query  278  EGFTSGDCTITAQARRICSCFMPC  349
            EGF  G+C      RR C C   C
Sbjct  58   EGFPGGNC---RGFRRRCFCTKHC  78



>ref|XP_009604566.1| PREDICTED: defensin J1-2-like [Nicotiana tomentosiformis]
Length=77

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 42/81 (52%), Gaps = 9/81 (11%)
 Frame = +2

Query  107  RLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDTEGF  286
            +L A   L++ML  A+ MGTM A  R C SQS  ++G C+      ++NC  +C  TEGF
Sbjct  6    KLFATVFLMLMLIFATEMGTMVAEARTCESQSHRFKGPCV-----RKSNCAAVC-QTEGF  59

Query  287  TSGDCTITAQARRICSCFMPC  349
              G C      RR C C   C
Sbjct  60   HGGHCR---GFRRRCFCTKHC  77



>ref|XP_009351645.1| PREDICTED: defensin Ec-AMP-D2-like [Pyrus x bretschneideri]
Length=78

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 46/84 (55%), Gaps = 10/84 (12%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMASGM-GTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDT  277
            SVRL + A + V+L +A+GM G M A  R C + S  ++G+C     +S++NC  +C  T
Sbjct  4    SVRLFSTAFVFVLLLVATGMMGPMLAEGRTCEAHSRKFKGHC-----HSKSNCATVC-QT  57

Query  278  EGFTSGDCTITAQARRICSCFMPC  349
            EGF  G C      RR C C   C
Sbjct  58   EGFQGGHC---HGIRRRCFCTKHC  78



>gb|AFD01290.1| defensin 3 [Pinus sylvestris]
Length=83

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 40/75 (53%), Gaps = 8/75 (11%)
 Frame = +2

Query  128  LLVMLFMASGM-GTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDTEGFTSGDCT  304
            LLV+L +  GM     A  RMC + S  ++G C+     S  NC  +CR TEGF SG C 
Sbjct  15   LLVLLVITIGMMAVQVAEGRMCKTPSGKFKGYCV-----SSTNCKNVCR-TEGFPSGSCD  68

Query  305  ITAQARRICSCFMPC  349
                +R+ C C+ PC
Sbjct  69   FHVTSRK-CYCYKPC  82



>ref|XP_009614488.1| PREDICTED: defensin J1-2-like [Nicotiana tomentosiformis]
Length=77

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 42/81 (52%), Gaps = 9/81 (11%)
 Frame = +2

Query  107  RLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDTEGF  286
            +L A   L++ML  A+ MGTM A  R C SQS  ++G C+      ++NC  +C  TEGF
Sbjct  6    KLFATVFLMLMLVFATEMGTMVAEARTCESQSHRFKGPCV-----RKSNCAAVC-QTEGF  59

Query  287  TSGDCTITAQARRICSCFMPC  349
              G C      RR C C   C
Sbjct  60   HGGHCR---GFRRRCFCTKHC  77



>ref|XP_009610211.1| PREDICTED: defensin J1-2 [Nicotiana tomentosiformis]
Length=77

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 37/65 (57%), Gaps = 6/65 (9%)
 Frame = +2

Query  107  RLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDTEGF  286
            ++VA   L++ML  A+ MG M A  R C SQS  ++G C      S++NC  +C  TEGF
Sbjct  6    KVVATVFLMLMLVFATEMGPMVAEARTCESQSHRFKGLCF-----SKSNCASVC-HTEGF  59

Query  287  TSGDC  301
              G C
Sbjct  60   YGGHC  64



>gb|EAY86781.1| hypothetical protein OsI_08161 [Oryza sativa Indica Group]
Length=487

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 47/86 (55%), Gaps = 8/86 (9%)
 Frame = +2

Query  95   SSSVRLVAIASLLVMLFMASGMGT-MAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICR  271
            + S R+VA A LL+ + +A+ MGT   A  R C SQS  ++G C+     S NNC  +CR
Sbjct  2    APSRRMVASAFLLLAILVATEMGTTKVAEARHCLSQSHRFKGMCV-----SSNNCANVCR  56

Query  272  DTEGFTSGDCTITAQARRICSCFMPC  349
             TE F  G+C      R+ C C  PC
Sbjct  57   -TESFPDGECKSHGLERK-CFCKKPC  80



>ref|XP_009593293.1| PREDICTED: defensin-like protein P322 [Nicotiana tomentosiformis]
Length=78

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 46/86 (53%), Gaps = 10/86 (12%)
 Frame = +2

Query  95   SSSVRLVAIASLLVMLFMASGMGTMA-AGTRMCTSQSEHYRGNCLLINQNSRNNCNRICR  271
            ++S+R  A   L+ +L MA+ MG M  A  R C SQS  ++G C     +  +NC  +C 
Sbjct  2    ANSMRFFATVLLIALLVMATEMGPMTIAEARTCESQSHRFKGPC-----SRDSNCATVCL  56

Query  272  DTEGFTSGDCTITAQARRICSCFMPC  349
             TEGF+ GDC      RR C C  PC
Sbjct  57   -TEGFSGGDCR---GFRRRCFCTRPC  78



>ref|NP_001234872.1| gamma-thionin precursor [Solanum lycopersicum]
 emb|CAB42006.1| gamma-thionin [Solanum lycopersicum]
Length=72

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 43/82 (52%), Gaps = 10/82 (12%)
 Frame = +2

Query  104  VRLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDTEG  283
            +RL A   LL ML MA+G   +    R C SQS  ++G C+     S  NC  +C +TEG
Sbjct  1    MRLFATMLLLAMLVMATGPMRIVEA-RTCESQSHRFKGPCV-----SEKNCASVC-ETEG  53

Query  284  FTSGDCTITAQARRICSCFMPC  349
            F+ GDC      RR C C  PC
Sbjct  54   FSGGDCR---GFRRRCFCTRPC  72



>gb|ACG41256.1| low-molecular-weight cysteine-rich protein LCR70 precursor [Zea 
mays]
Length=82

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 48/89 (54%), Gaps = 9/89 (10%)
 Frame = +2

Query  89   MASSSVRLVAIA-SLLVMLFMASGMGTM-AAGTRMCTSQSEHYRGNCLLINQNSRNNCNR  262
            MA +S R+VA A   L+ML  AS MGT   A  R CTSQS  + G C+     S++NC  
Sbjct  1    MAWTSRRMVASALVFLLMLLAASEMGTTRVAEARHCTSQSHRFVGACM-----SKSNCEN  55

Query  263  ICRDTEGFTSGDCTITAQARRICSCFMPC  349
            +CR TEGF   +C      R+ C C   C
Sbjct  56   VCR-TEGFPWXECRWHGIERK-CXCKRIC  82



>ref|XP_010270777.1| PREDICTED: defensin-like protein [Nelumbo nucifera]
 sp|A3FPF2.1|DEF_NELNU RecName: Full=Defensin-like protein; AltName: Full=Gamma-thionin 
homolog; Flags: Precursor [Nelumbo nucifera]
 gb|ABN46979.1| defensin [Nelumbo nucifera]
Length=77

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 45/82 (55%), Gaps = 9/82 (11%)
 Frame = +2

Query  104  VRLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDTEG  283
            +RL +   L+++L  A+ MG   A  R C SQS  ++G CL     S  NC  +C+ TEG
Sbjct  5    MRLFSSLVLVLLLVTATEMGPKVAEARTCESQSHRFKGACL-----SDTNCASVCQ-TEG  58

Query  284  FTSGDCTITAQARRICSCFMPC  349
            F +GDC     ARR C C  PC
Sbjct  59   FPAGDCK---GARRRCFCVKPC  77



>ref|XP_006367978.1| PREDICTED: defensin-like protein P322-like [Solanum tuberosum]
Length=79

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 44/87 (51%), Gaps = 10/87 (11%)
 Frame = +2

Query  95   SSSVRLVAIASLLVMLFMASGMGTM-AAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICR  271
            + S+R  A    L ML M + MG M     R+C S S+ ++G CL     +  NC  +C 
Sbjct  2    AHSMRFFATVLFLAMLVMDTKMGPMRIIEARICESPSQRFKGPCL-----TDRNCASVC-  55

Query  272  DTEGFTSGDCTITAQARRICSCFMPCH  352
            +TEGFT GDC      RR C C   C+
Sbjct  56   ETEGFTGGDCR---GLRRRCFCTKECY  79



>emb|CDP10468.1| unnamed protein product [Coffea canephora]
Length=78

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 46/84 (55%), Gaps = 10/84 (12%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMASGMGTM-AAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDT  277
            S+RL A A LL+MLFM++ M  +  A  R C S S  ++G C+       +NC  +C+ T
Sbjct  4    SMRLFATAFLLLMLFMSTEMDPVRVAEARTCESLSHRFKGTCV-----RGSNCAAVCQ-T  57

Query  278  EGFTSGDCTITAQARRICSCFMPC  349
            EGF  G C+     RR C C  PC
Sbjct  58   EGFPGGQCS---GLRRRCFCSKPC  78



>gb|AGT51228.1| defensin [Brassica napus]
 emb|CDY03076.1| BnaC07g21510D [Brassica napus]
Length=76

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 45/83 (54%), Gaps = 10/83 (12%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDTE  280
            S+RL++ A LL M+F+A+GMG +    R C S+S  ++G C+     S  NC  +C + E
Sbjct  4    SMRLIS-AVLLFMIFVATGMGPVTVEARTCESKSHRFKGTCV-----SSTNCGNVCHN-E  56

Query  281  GFTSGDCTITAQARRICSCFMPC  349
            GF  G C      RR C C   C
Sbjct  57   GFGGGKC---RGFRRRCYCTRHC  76



>ref|XP_002875115.1| hypothetical protein ARALYDRAFT_484136 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51374.1| hypothetical protein ARALYDRAFT_484136 [Arabidopsis lyrata subsp. 
lyrata]
Length=77

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 45/83 (54%), Gaps = 9/83 (11%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDTE  280
            S+RL++   ++ M+F+A+GMG +    R C S+S  ++G C+     S +NC  +C + E
Sbjct  4    SMRLISAVLIMFMVFVATGMGPVTVEARTCESKSHRFKGPCV-----STHNCANVCHN-E  57

Query  281  GFTSGDCTITAQARRICSCFMPC  349
            GF  G C      RR C C   C
Sbjct  58   GFGGGKCR---GFRRRCYCTRHC  77



>ref|XP_009768915.1| PREDICTED: defensin-like protein isoform X2 [Nicotiana sylvestris]
Length=79

 Score = 48.9 bits (115),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 46/88 (52%), Gaps = 10/88 (11%)
 Frame = +2

Query  89   MASSSVRLVAIASLLVMLFMASGMGT-MAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRI  265
            M   S+RL++   LL+M+  A+ MG  M A  R C SQS+ ++G C+     S  NC  +
Sbjct  1    MMRRSMRLLSTVFLLLMVVFATEMGPIMVAEARNCESQSQRFKGVCV-----SNRNCASV  55

Query  266  CRDTEGFTSGDCTITAQARRICSCFMPC  349
            C +TEGF  G C      RR C C   C
Sbjct  56   C-NTEGFPDGKCK---GLRRRCFCLRNC  79



>ref|XP_006292097.1| hypothetical protein CARUB_v10018292mg, partial [Capsella rubella]
 gb|EOA24995.1| hypothetical protein CARUB_v10018292mg, partial [Capsella rubella]
Length=103

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 38/62 (61%), Gaps = 6/62 (10%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDTE  280
            S+RL++   L+ M+F+A+GMG +    R C S+S  ++G C+     S NNC  +C + E
Sbjct  30   SMRLISAVLLVFMIFVATGMGPVTVEARTCESKSHRFKGPCV-----SGNNCKNVCHN-E  83

Query  281  GF  286
            GF
Sbjct  84   GF  85



>ref|XP_004297787.1| PREDICTED: defensin-like protein 2-like [Fragaria vesca subsp. 
vesca]
Length=79

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 46/87 (53%), Gaps = 11/87 (13%)
 Frame = +2

Query  95   SSSVRLVAIASLLVMLFMASGMG--TMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRIC  268
             S +R+ +   + ++L +A+GMG  TM A  R C S S  ++G CL     S  NC  +C
Sbjct  2    ESFMRMFSAVFVALLLLVATGMGPNTMVAEARTCESLSHKFKGTCL-----SETNCASVC  56

Query  269  RDTEGFTSGDCTITAQARRICSCFMPC  349
            + TEGF+ GDC      RR C C   C
Sbjct  57   K-TEGFSGGDCR---GLRRRCFCTKHC  79



>ref|NP_001047493.1| Os02g0629800 [Oryza sativa Japonica Group]
 dbj|BAD23741.1| putative defensin [Oryza sativa Japonica Group]
 dbj|BAF09407.1| Os02g0629800 [Oryza sativa Japonica Group]
 gb|EEE57415.1| hypothetical protein OsJ_07607 [Oryza sativa Japonica Group]
Length=80

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 43/78 (55%), Gaps = 7/78 (9%)
 Frame = +2

Query  95   SSSVRLVAIASLLVMLFMASGMGT-MAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICR  271
            + S R+VA A LL+ + +A+ MGT   A  R C SQS  ++G C+     S NNC  +CR
Sbjct  2    APSRRMVASAFLLLAILVATEMGTTKVAEARHCLSQSHRFKGMCV-----SSNNCANVCR  56

Query  272  DTEGFTSGDCTITAQARR  325
             TE F  G+C      R+
Sbjct  57   -TESFPDGECKSHGLERK  73



>ref|XP_006359487.1| PREDICTED: defensin-like protein-like [Solanum tuberosum]
Length=76

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 39/68 (57%), Gaps = 7/68 (10%)
 Frame = +2

Query  98   SSVRLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDT  277
            +S+RL A   L+ ML +A+G  T     R C S+S H++G CL     S  NC  +C  T
Sbjct  3    NSLRLFATFFLVTMLLLATGPTTRVEA-RTCESKSHHFKGKCL-----SDTNCGSVC-HT  55

Query  278  EGFTSGDC  301
            EGFT G+C
Sbjct  56   EGFTGGNC  63



>ref|XP_004953175.1| PREDICTED: defensin-like protein 2-like [Setaria italica]
Length=80

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 41/76 (54%), Gaps = 7/76 (9%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMASGMGTM-AAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDT  277
            S R+ A   + ++L +AS MG    A  R C SQS H++G CL     S +NC  +CR  
Sbjct  4    SRRMAAPVLVFLLLLIASEMGPATVAEARHCLSQSHHFKGLCL-----SSSNCANVCR-V  57

Query  278  EGFTSGDCTITAQARR  325
            E F  G+C  TA  R+
Sbjct  58   ERFPDGECQTTAGTRK  73



>ref|XP_010250779.1| PREDICTED: defensin Ec-AMP-D2-like [Nelumbo nucifera]
Length=78

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 44/85 (52%), Gaps = 9/85 (11%)
 Frame = +2

Query  95   SSSVRLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRD  274
            + S+RL +I  +++ L  A+GMG   A  R C SQS  ++G C+      ++NC  +C  
Sbjct  2    ARSMRLFSILFVVLFLLTATGMGPKVAEARTCESQSHRFKGICV-----RKSNCAAVC-Q  55

Query  275  TEGFTSGDCTITAQARRICSCFMPC  349
            TEGF  G C      RR C C   C
Sbjct  56   TEGFHGGHCR---GFRRRCFCTKHC  77



>ref|XP_004509604.1| PREDICTED: defensin-like protein P322-like [Cicer arietinum]
Length=78

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 47/84 (56%), Gaps = 10/84 (12%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMASGMGTM-AAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDT  277
            S+  ++   ++ +L +A+ MG +  A  R+C SQS  ++G C++      ++C  +C+ T
Sbjct  4    SIPFISTIFVMFLLLVATEMGPIKVAEARICDSQSNTFKGPCVI-----DHSCAIVCQ-T  57

Query  278  EGFTSGDCTITAQARRICSCFMPC  349
            EGFT G C      RRIC C  PC
Sbjct  58   EGFTGGQC---EGLRRICFCTKPC  78



>ref|XP_008389119.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
Length=77

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 43/83 (52%), Gaps = 9/83 (11%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDTE  280
            S+RL + A L ++L     MG M A  R C SQS  ++G+C+     S++NC  +C  TE
Sbjct  4    SMRLFSTAFLFLLLVATGMMGPMVAEGRTCDSQSHRFKGSCV-----SKSNCATVC-QTE  57

Query  281  GFTSGDCTITAQARRICSCFMPC  349
            GF  G C      RR C C   C
Sbjct  58   GFRGGHCR---GFRRRCFCTKHC  77



>sp|Q40901.1|DEF_PETIN RecName: Full=Defensin-like protein; AltName: Full=Gamma-thionin 
homolog PPT; Flags: Precursor [Petunia integrifolia]
 gb|AAA64740.1| gamma-thionin homolog [Petunia integrifolia subsp. inflata]
Length=78

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 43/80 (54%), Gaps = 10/80 (13%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMASGMGTM-AAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDT  277
            S+RL A   L+ MLF+++ MG M +A  R C SQS  + G C+       +NC  +C  T
Sbjct  4    SIRLFATFFLIAMLFLSTEMGPMTSAEARTCESQSHRFHGTCV-----RESNCASVC-QT  57

Query  278  EGFTSGDCTITAQARRICSC  337
            EGF  G+C      RR C C
Sbjct  58   EGFIGGNCR---AFRRRCFC  74



>ref|XP_009614667.1| PREDICTED: defensin-like protein [Nicotiana tomentosiformis]
Length=75

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 44/83 (53%), Gaps = 10/83 (12%)
 Frame = +2

Query  104  VRLVAIASLLVMLFMASGMG-TMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDTE  280
            +RL++   LL+M+  A+ MG  M A  R C SQSE ++G C+     S  NC  +C +TE
Sbjct  2    MRLLSTVFLLLMVVFATEMGPVMVAEARNCESQSERFKGVCV-----SNRNCASVC-NTE  55

Query  281  GFTSGDCTITAQARRICSCFMPC  349
            GF  G C      RR C C   C
Sbjct  56   GFPDGKCK---GLRRRCFCLRNC  75



>ref|XP_006359485.1| PREDICTED: defensin-like protein-like [Solanum tuberosum]
Length=79

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 43/81 (53%), Gaps = 11/81 (14%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMASGMGTMAAGT--RMCTSQSEHYRGNCLLINQNSRNNCNRICRD  274
            S+RL A   L+ ML +++ MG M+ G   R C SQS  ++G C+        NC  +C+ 
Sbjct  4    SMRLFATFFLVAMLLLSTEMGPMSGGAEARTCESQSHSFKGPCV-----GDTNCASVCQ-  57

Query  275  TEGFTSGDCTITAQARRICSC  337
            TEGF  GDC      RR C C
Sbjct  58   TEGFIGGDCR---GLRRQCFC  75



>ref|XP_010043884.1| PREDICTED: defensin Ec-AMP-D2-like [Eucalyptus grandis]
 gb|KCW85903.1| hypothetical protein EUGRSUZ_B02620 [Eucalyptus grandis]
Length=77

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 39/67 (58%), Gaps = 6/67 (9%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDTE  280
            S RL+  A ++++L +A+ M  M    R C SQS+ ++G C+     S+ NC  +C+ TE
Sbjct  4    SKRLIPAALIVMLLLVATEMEPMVVEARTCESQSQRFKGACV-----SKTNCASVCQ-TE  57

Query  281  GFTSGDC  301
            GF  G C
Sbjct  58   GFHGGHC  64



>gb|ACV84379.1| defensin precursor [Triticum aestivum]
 gb|EMT06280.1| Defensin-like protein 5 [Aegilops tauschii]
 gb|AIA66986.1| defensin [Triticum aestivum]
Length=81

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 45/84 (54%), Gaps = 10/84 (12%)
 Frame = +2

Query  107  RLVAIASLLVMLFMASGMGT---MAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDT  277
            R +  ++LL+ L +A+ MGT     A  R C SQS +++G CL     S +NC  +CR T
Sbjct  5    RRMTASALLLFLLVATEMGTTTVKVAEARNCLSQSHNFKGACL-----SSSNCAAVCR-T  58

Query  278  EGFTSGDCTITAQARRICSCFMPC  349
            E F  G+C      R+ C C  PC
Sbjct  59   ENFPDGECHAPHYERK-CFCKRPC  81



>dbj|BAA95697.1| thionin like protein [Nicotiana tabacum]
Length=78

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 45/86 (52%), Gaps = 10/86 (12%)
 Frame = +2

Query  95   SSSVRLVAIASLLVMLFMASGMGTMA-AGTRMCTSQSEHYRGNCLLINQNSRNNCNRICR  271
            ++S+R  A   L+ +L  A+ MG M  A  R C SQS  ++G C     +  +NC  +C 
Sbjct  2    ANSMRFFATVLLIALLVTATEMGPMTIAEARTCESQSHRFKGPC-----SRDSNCATVCL  56

Query  272  DTEGFTSGDCTITAQARRICSCFMPC  349
             TEGF+ GDC      RR C C  PC
Sbjct  57   -TEGFSGGDCR---GFRRRCFCTRPC  78



>gb|ADQ43196.1| unknown [Eutrema parvulum]
Length=76

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 43/79 (54%), Gaps = 10/79 (13%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDTE  280
            S+RL++ A L+ M+F+A+ MG +    R C SQS  ++G CL     S  NC  +C + E
Sbjct  4    SMRLISAALLMFMIFVAA-MGPVTVEARTCESQSHRFKGKCL-----SDGNCGNVCHN-E  56

Query  281  GFTSGDCTITAQARRICSC  337
            GF  G C      RR C C
Sbjct  57   GFGGGKCR---GFRRRCFC  72



>gb|KFK26328.1| hypothetical protein AALP_AA8G233400 [Arabis alpina]
Length=78

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 43/84 (51%), Gaps = 10/84 (12%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMAS-GMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDT  277
            S RL++   +L ML +A+ G+G +    R C + S+ + G CL     S  NC  +C + 
Sbjct  4    SPRLISTIPVLFMLLVATTGIGPVTVEARTCETSSQLFNGPCL-----STTNCANVCHN-  57

Query  278  EGFTSGDCTITAQARRICSCFMPC  349
            EGF  GDC      RR C C  PC
Sbjct  58   EGFPDGDC---RGFRRRCLCSRPC  78



>gb|KHN23780.1| Defensin SD2 [Glycine soja]
Length=79

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 45/87 (52%), Gaps = 11/87 (13%)
 Frame = +2

Query  95   SSSVRLVAIASLLVMLFMASGM--GTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRIC  268
            S SV LV+   +L++L +A+ M   TM A  R C SQS  ++G CL     S  NC  +C
Sbjct  2    SRSVPLVSTIFVLLLLLVATEMMGPTMVAEARTCESQSHRFKGPCL-----SDTNCGSVC  56

Query  269  RDTEGFTSGDCTITAQARRICSCFMPC  349
            R TE FT G C      RR C C   C
Sbjct  57   R-TERFTGGHC---RGFRRRCFCTKHC  79



>ref|XP_009354384.1| PREDICTED: defensin Ec-AMP-D2-like [Pyrus x bretschneideri]
Length=78

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 44/84 (52%), Gaps = 10/84 (12%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMASGM-GTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDT  277
            S+RL + A + V+L +A+GM G M A  R C + S  ++G CL      ++NC  +C  T
Sbjct  4    SMRLFSTAFVFVLLLVATGMMGPMLAEGRTCEAHSRKFKGTCL-----GKSNCASVC-QT  57

Query  278  EGFTSGDCTITAQARRICSCFMPC  349
            EGF  G C      RR C C   C
Sbjct  58   EGFHGGHCR---GFRRRCFCTKHC  78



>ref|NP_001234987.1| protease inhibitor precursor [Glycine max]
 gb|AAC97524.1| protease inhibitor [Glycine max]
Length=79

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 40/71 (56%), Gaps = 8/71 (11%)
 Frame = +2

Query  95   SSSVRLVAIASLLVMLFMASGM--GTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRIC  268
            S SV LV+   +L++L +A+ M   TM A  R C SQS  ++G CL     S  NC  +C
Sbjct  2    SRSVPLVSTICVLLLLLVATEMMGPTMVAEARTCESQSHRFKGPCL-----SDTNCGSVC  56

Query  269  RDTEGFTSGDC  301
            R TE FT G C
Sbjct  57   R-TERFTGGHC  66



>ref|XP_007223891.1| hypothetical protein PRUPE_ppa014246mg [Prunus persica]
 ref|XP_008220985.1| PREDICTED: defensin Ec-AMP-D2-like [Prunus mume]
 gb|EMJ25090.1| hypothetical protein PRUPE_ppa014246mg [Prunus persica]
Length=78

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 43/84 (51%), Gaps = 10/84 (12%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMASGM-GTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDT  277
            S+RL + A +  +L  A+GM G M A  R C SQS  ++G C+     S +NC  +C  T
Sbjct  4    SMRLFSTAFVFFLLLAAAGMMGPMVAEARTCESQSNRFKGTCV-----STSNCASVC-QT  57

Query  278  EGFTSGDCTITAQARRICSCFMPC  349
            EGF  G C      RR C C   C
Sbjct  58   EGFPGGHCR---GFRRRCFCTKHC  78



>ref|XP_010910081.1| PREDICTED: defensin Ec-AMP-D2-like [Elaeis guineensis]
Length=77

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 37/67 (55%), Gaps = 6/67 (9%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDTE  280
            S R++    LLV++ +AS M TM    R C SQS  ++G CL       +NC  +C+ TE
Sbjct  4    SRRMLPAILLLVLIVVASEMATMMVEARTCESQSHKFKGPCL-----RASNCANVCK-TE  57

Query  281  GFTSGDC  301
            GF  G C
Sbjct  58   GFHGGKC  64



>ref|XP_008349481.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
 ref|XP_008344620.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
 ref|XP_008363304.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
 gb|AFH74424.1| defensin [Malus domestica]
Length=75

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 45/83 (54%), Gaps = 11/83 (13%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDTE  280
            S+RL   A + ++L +A+G  TM A  R C SQS  ++G C+     S++NC  +C  TE
Sbjct  4    SMRLFPTAFVFLLLLVATG--TMVAEGRTCESQSNRFKGTCV-----SKSNCAAVC-QTE  55

Query  281  GFTSGDCTITAQARRICSCFMPC  349
            GF  G+C      RR C C   C
Sbjct  56   GFPGGNCR---GLRRRCFCTKHC  75



>ref|XP_002886566.1| protease inhibitor II [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62825.1| protease inhibitor II [Arabidopsis lyrata subsp. lyrata]
Length=76

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 45/83 (54%), Gaps = 10/83 (12%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMASGMGTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRDTE  280
            S RL++ A LL+ + +A+G+G +    R C + S  + G CL     S +NC  +C + E
Sbjct  4    SSRLIS-ALLLLFMILATGIGPVTVEARTCETSSNLFNGPCL-----SSSNCANVCHN-E  56

Query  281  GFTSGDCTITAQARRICSCFMPC  349
            GF+ GDC      RR C C  PC
Sbjct  57   GFSDGDCR---GFRRRCLCTRPC  76



>ref|XP_006647552.1| PREDICTED: defensin-like protein P322-like [Oryza brachyantha]
Length=80

 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 42/78 (54%), Gaps = 7/78 (9%)
 Frame = +2

Query  95   SSSVRLVAIASLLVMLFMASGMGT-MAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICR  271
            + S R+VA   LL+ + +A+ MGT   A  R C SQS  ++G C+     S NNC  +C+
Sbjct  2    APSRRMVASVFLLLAILVATEMGTTQVAEARHCLSQSHRFKGMCV-----SSNNCANVCK  56

Query  272  DTEGFTSGDCTITAQARR  325
             TE F  G+C      R+
Sbjct  57   -TENFPDGECKSHGLERK  73



>gb|AAL85480.1| defensin protein 1 [Prunus persica]
Length=79

 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 38/69 (55%), Gaps = 8/69 (12%)
 Frame = +2

Query  101  SVRLVAIASLLVMLFMASGM--GTMAAGTRMCTSQSEHYRGNCLLINQNSRNNCNRICRD  274
            S+RL + A +  +L  A+GM  G M A  R C SQS  ++G C+     S +NC  +C  
Sbjct  4    SMRLFSTAFVFFLLLAAAGMMMGPMVAEARTCESQSNRFKGTCV-----STSNCASVC-Q  57

Query  275  TEGFTSGDC  301
            TEGF  G C
Sbjct  58   TEGFPGGHC  66



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 754980566040