BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24064_g2_i3 len=1963 path=[1231:0-94 @1326@!:95-465 6160:466-467
5583:468-602 5358:603-708 415:709-831 538:832-832 539:833-849
556:850-850 1699:851-1962]

Length=1963
                                                                      Score     E

ref|XP_011082380.1|  PREDICTED: serine/arginine-rich splicing fac...    161   3e-40   
ref|XP_009624179.1|  PREDICTED: serine/arginine-rich splicing fac...    156   2e-38   
ref|XP_006586189.1|  PREDICTED: uncharacterized RNA-binding prote...    149   2e-38   
ref|XP_009778762.1|  PREDICTED: serine/arginine-rich splicing fac...    155   6e-38   
ref|XP_009778763.1|  PREDICTED: serine/arginine-rich splicing fac...    155   6e-38   
ref|XP_010685629.1|  PREDICTED: serine/arginine-rich splicing fac...    154   1e-37   
ref|XP_007016195.1|  RNA-binding family protein isoform 2               146   2e-37   
ref|XP_010033040.1|  PREDICTED: serine/arginine-rich splicing fac...    144   7e-37   
ref|XP_002520437.1|  FUS-interacting serine-arginine-rich protein...    151   9e-37   Ricinus communis
emb|CBI16010.3|  unnamed protein product                                146   1e-36   
ref|XP_003530834.1|  PREDICTED: uncharacterized RNA-binding prote...    150   1e-36   
emb|CDP09143.1|  unnamed protein product                                150   1e-36   
ref|XP_006350816.1|  PREDICTED: serine/arginine repetitive matrix...    149   5e-36   
emb|CAN63579.1|  hypothetical protein VITISV_029585                     145   6e-36   Vitis vinifera
gb|AFK47423.1|  unknown                                                 148   6e-36   
ref|XP_003551321.1|  PREDICTED: pre-mRNA-splicing factor cwc22-like     148   7e-36   
gb|AFK40884.1|  unknown                                                 147   9e-36   
gb|KHN06265.1|  Putative RNA-binding protein C25G10.01                  147   1e-35   
ref|XP_007146720.1|  hypothetical protein PHAVU_006G064000g             147   2e-35   
ref|XP_002280779.2|  PREDICTED: serine/arginine-rich splicing fac...    146   2e-35   Vitis vinifera
ref|XP_004984684.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-35   
gb|KDP46559.1|  hypothetical protein JCGZ_08531                         147   2e-35   
ref|XP_011032165.1|  PREDICTED: serine/arginine-rich splicing fac...    147   3e-35   
ref|XP_011032164.1|  PREDICTED: serine/arginine-rich splicing fac...    147   3e-35   
ref|XP_011032161.1|  PREDICTED: serine/arginine-rich splicing fac...    147   3e-35   
ref|XP_008785439.1|  PREDICTED: serine/arginine-rich splicing fac...    146   4e-35   
ref|XP_010521922.1|  PREDICTED: serine/arginine-rich splicing fac...    139   4e-35   
gb|EYU45746.1|  hypothetical protein MIMGU_mgv1a008547mg                146   4e-35   
gb|KCW52572.1|  hypothetical protein EUGRSUZ_J01947                     145   5e-35   
ref|XP_004241182.1|  PREDICTED: serine/arginine-rich splicing fac...    146   6e-35   
ref|XP_002314126.1|  transformer serine/arginine-rich ribonucleop...    144   6e-35   Populus trichocarpa [western balsam poplar]
ref|XP_009380617.1|  PREDICTED: serine/arginine-rich splicing fac...    144   9e-35   
ref|XP_009380616.1|  PREDICTED: serine/arginine-rich splicing fac...    145   9e-35   
ref|XP_006425006.1|  hypothetical protein CICLE_v10028652mg             145   1e-34   
gb|KDO66764.1|  hypothetical protein CISIN_1g016540mg                   145   2e-34   
emb|CBI34365.3|  unnamed protein product                                137   2e-34   
ref|XP_011035209.1|  PREDICTED: serine/arginine-rich splicing fac...    138   2e-34   
ref|XP_004500218.1|  PREDICTED: pre-mRNA-splicing factor cwc22-like     144   2e-34   
ref|XP_010256685.1|  PREDICTED: serine/arginine-rich splicing fac...    142   3e-34   
gb|ABW81106.1|  putRNAbp29                                              143   4e-34   Tarenaya spinosa
ref|XP_002304510.1|  hypothetical protein POPTR_0003s13030g             139   4e-34   Populus trichocarpa [western balsam poplar]
ref|XP_010521921.1|  PREDICTED: serine/arginine-rich splicing fac...    143   4e-34   
gb|ACN26118.1|  unknown                                                 142   5e-34   Zea mays [maize]
ref|XP_008787412.1|  PREDICTED: serine/arginine-rich splicing fac...    138   5e-34   
ref|XP_006649804.1|  PREDICTED: scaffold attachment factor B2-lik...    136   5e-34   
ref|XP_010262758.1|  PREDICTED: serine/arginine-rich splicing fac...    142   6e-34   
ref|XP_010262757.1|  PREDICTED: serine/arginine-rich splicing fac...    142   6e-34   
ref|XP_007016197.1|  RNA-binding family protein isoform 4               143   6e-34   
ref|XP_010521920.1|  PREDICTED: serine/arginine-rich splicing fac...    142   7e-34   
ref|XP_006827527.1|  hypothetical protein AMTR_s00009p00202570          141   8e-34   
ref|XP_011022643.1|  PREDICTED: serine/arginine-rich splicing fac...    138   9e-34   
ref|XP_008220282.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-33   
ref|XP_007016194.1|  RNA-binding family protein isoform 1               142   1e-33   
ref|XP_006476526.1|  PREDICTED: uncharacterized RNA-binding prote...    135   2e-33   
ref|NP_001049650.1|  Os03g0265600                                       135   2e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008779363.1|  PREDICTED: serine/arginine-rich splicing fac...    137   2e-33   
ref|XP_004984683.1|  PREDICTED: serine/arginine repetitive matrix...    140   2e-33   
ref|XP_010923140.1|  PREDICTED: serine/arginine-rich splicing fac...    140   3e-33   
ref|XP_004294256.1|  PREDICTED: uncharacterized protein LOC101294250    140   4e-33   
ref|XP_010940583.1|  PREDICTED: serine/arginine-rich splicing fac...    136   5e-33   
ref|XP_004984682.1|  PREDICTED: serine/arginine repetitive matrix...    140   6e-33   
ref|XP_002279684.1|  PREDICTED: serine/arginine-rich splicing fac...    136   6e-33   Vitis vinifera
dbj|BAJ89187.1|  predicted protein                                      133   8e-33   
ref|XP_001757377.1|  predicted protein                                  132   8e-33   
ref|XP_009337333.1|  PREDICTED: serine/arginine-rich splicing fac...    140   1e-32   
ref|XP_009337331.1|  PREDICTED: serine/arginine-rich splicing fac...    140   1e-32   
ref|XP_001756218.1|  predicted protein                                  134   1e-32   
ref|XP_002299830.2|  hypothetical protein POPTR_0001s25520g             139   1e-32   Populus trichocarpa [western balsam poplar]
ref|XP_006476524.1|  PREDICTED: uncharacterized RNA-binding prote...    135   1e-32   
ref|XP_006476525.1|  PREDICTED: uncharacterized RNA-binding prote...    135   1e-32   
ref|XP_002509834.1|  Arginine/serine-rich-splicing factor, putative     135   1e-32   Ricinus communis
ref|XP_010255285.1|  PREDICTED: serine/arginine-rich splicing fac...    134   2e-32   
ref|XP_009337332.1|  PREDICTED: serine/arginine-rich splicing fac...    139   2e-32   
ref|XP_009337328.1|  PREDICTED: serine/arginine-rich splicing fac...    139   2e-32   
ref|XP_001778182.1|  predicted protein                                  133   2e-32   
ref|XP_008384864.1|  PREDICTED: pre-mRNA-splicing factor cwc22 is...    139   2e-32   
gb|KDP25408.1|  hypothetical protein JCGZ_20564                         134   3e-32   
ref|XP_011035207.1|  PREDICTED: serine/arginine-rich splicing fac...    138   3e-32   
ref|XP_006439504.1|  hypothetical protein CICLE_v10021507mg             134   3e-32   
gb|AAP06839.1|  putative transformer serine/arginine-rich ribonuc...    137   3e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008384865.1|  PREDICTED: pre-mRNA-splicing factor cwc22 is...    138   3e-32   
ref|XP_008384862.1|  PREDICTED: pre-mRNA-splicing factor cwc22 is...    138   4e-32   
ref|XP_009375026.1|  PREDICTED: serine/arginine-rich splicing fac...    132   4e-32   
ref|NP_849605.1|  serine/arginine rich-like protein SR45a               131   4e-32   Arabidopsis thaliana [mouse-ear cress]
gb|EAY89362.1|  hypothetical protein OsI_10866                          137   4e-32   Oryza sativa Indica Group [Indian rice]
ref|XP_011035206.1|  PREDICTED: serine/arginine-rich splicing fac...    137   4e-32   
ref|XP_006649803.1|  PREDICTED: scaffold attachment factor B2-lik...    137   4e-32   
ref|XP_006439505.1|  hypothetical protein CICLE_v10021507mg             134   4e-32   
ref|XP_006848090.1|  hypothetical protein AMTR_s00029p00209460          138   4e-32   
ref|XP_011035205.1|  PREDICTED: serine/arginine-rich splicing fac...    137   4e-32   
ref|XP_007040292.1|  RNA-binding family protein                         133   6e-32   
ref|XP_010104693.1|  Uncharacterized RNA-binding protein                139   9e-32   
gb|KHG02619.1|  Scaffold attachment factor B2                           133   1e-31   
gb|EMT18238.1|  Scaffold attachment factor B2                           135   1e-31   
ref|XP_004298819.1|  PREDICTED: uncharacterized RNA-binding prote...    132   1e-31   
ref|XP_006439508.1|  hypothetical protein CICLE_v10021507mg             132   1e-31   
ref|XP_006417810.1|  hypothetical protein EUTSA_v10008061mg             135   2e-31   
ref|XP_010228830.1|  PREDICTED: serine/arginine-rich splicing fac...    135   2e-31   
ref|XP_006439510.1|  hypothetical protein CICLE_v10021507mg             132   2e-31   
ref|XP_009375024.1|  PREDICTED: serine/arginine-rich splicing fac...    132   2e-31   
ref|XP_009392818.1|  PREDICTED: serine/arginine-rich splicing fac...    131   2e-31   
ref|XP_009375022.1|  PREDICTED: serine/arginine-rich splicing fac...    132   2e-31   
gb|ABF95135.1|  RNA recognition motif family protein, expressed         135   3e-31   Oryza sativa Japonica Group [Japonica rice]
gb|ABF95136.1|  RNA recognition motif family protein, expressed         135   3e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008238932.1|  PREDICTED: uncharacterized RNA-binding prote...    131   3e-31   
gb|KDO76279.1|  hypothetical protein CISIN_1g028130mg                   131   3e-31   
gb|KDO76280.1|  hypothetical protein CISIN_1g028130mg                   131   3e-31   
ref|XP_009375025.1|  PREDICTED: serine/arginine-rich splicing fac...    130   4e-31   
ref|XP_007209603.1|  hypothetical protein PRUPE_ppa011480mg             131   4e-31   
ref|XP_006439507.1|  hypothetical protein CICLE_v10021507mg             132   5e-31   
ref|XP_002892395.1|  hypothetical protein ARALYDRAFT_470756             135   5e-31   
gb|AAK92735.1|  putative transformer-SR ribonucleoprotein               134   7e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006439511.1|  hypothetical protein CICLE_v10021507mg             132   7e-31   
ref|XP_006305290.1|  hypothetical protein CARUB_v10009665mg             133   8e-31   
gb|ADE76245.1|  unknown                                                 130   9e-31   
ref|NP_563787.2|  serine/arginine rich-like protein SR45a               133   1e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004145262.1|  PREDICTED: uncharacterized protein LOC101211183    133   2e-30   
gb|AFW62088.1|  hypothetical protein ZEAMMB73_489339                    127   2e-30   
ref|XP_010239167.1|  PREDICTED: serine/arginine-rich splicing fac...    128   2e-30   
gb|EMS64978.1|  Scaffold attachment factor B2                           126   3e-30   
ref|XP_002444277.1|  hypothetical protein SORBIDRAFT_07g019390          128   3e-30   Sorghum bicolor [broomcorn]
ref|XP_009118966.1|  PREDICTED: serine/arginine-rich splicing fac...    132   3e-30   
ref|XP_006425349.1|  hypothetical protein CICLE_v10026375mg             126   4e-30   
ref|XP_008457405.1|  PREDICTED: serine/arginine-rich splicing fac...    132   4e-30   
emb|CDY06701.1|  BnaA10g04800D                                          131   5e-30   
ref|XP_001752273.1|  predicted protein                                  124   5e-30   
ref|XP_010475492.1|  PREDICTED: serine/arginine-rich splicing fac...    131   5e-30   
ref|XP_010475491.1|  PREDICTED: serine/arginine-rich splicing fac...    130   6e-30   
ref|XP_010457907.1|  PREDICTED: serine/arginine-rich splicing fac...    131   8e-30   
ref|XP_010457908.1|  PREDICTED: serine/arginine-rich splicing fac...    131   8e-30   
ref|XP_004163746.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    131   9e-30   
emb|CDP12048.1|  unnamed protein product                                129   1e-29   
gb|EMS59082.1|  Uncharacterized RNA-binding protein C25G10.01           134   1e-29   
gb|EYU38329.1|  hypothetical protein MIMGU_mgv1a013947mg                127   1e-29   
ref|XP_006828824.1|  hypothetical protein AMTR_s00001p00140760          127   1e-29   
gb|ADE75667.1|  unknown                                                 126   2e-29   
gb|EEE68615.1|  hypothetical protein OsJ_27155                          127   3e-29   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001061706.1|  Os08g0385900                                       127   3e-29   Oryza sativa Japonica Group [Japonica rice]
gb|KFK30200.1|  hypothetical protein AALP_AA7G231300                    124   3e-29   
ref|XP_006659363.1|  PREDICTED: serine/arginine-rich splicing fac...    127   3e-29   
ref|XP_006425346.1|  hypothetical protein CICLE_v10026375mg             124   4e-29   
ref|XP_002972807.1|  hypothetical protein SELMODRAFT_59634              121   4e-29   
gb|EMT21403.1|  Putative RNA-binding protein                            126   4e-29   
gb|KHF98970.1|  putative RNA-binding C25G10.01                          130   5e-29   
ref|XP_010487375.1|  PREDICTED: serine/arginine-rich splicing fac...    129   5e-29   
ref|NP_001154288.1|  RNA-binding (RRM/RBD/RNP motifs) family protein    125   5e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010487367.1|  PREDICTED: serine/arginine-rich splicing fac...    129   5e-29   
ref|XP_003536651.1|  PREDICTED: uncharacterized RNA-binding prote...    124   6e-29   
ref|XP_003563207.1|  PREDICTED: serine/arginine-rich splicing fac...    125   6e-29   
emb|CDX75526.1|  BnaA01g01760D                                          127   7e-29   
gb|KHG21989.1|  Scaffold attachment factor B2                           124   7e-29   
gb|AFW62092.1|  hypothetical protein ZEAMMB73_489339                    124   7e-29   
ref|XP_009150254.1|  PREDICTED: serine/arginine-rich splicing fac...    125   7e-29   
ref|XP_004973345.1|  PREDICTED: serine/arginine-rich splicing fac...    126   8e-29   
ref|XP_010089074.1|  Uncharacterized RNA-binding protein                127   9e-29   
ref|XP_006282702.1|  hypothetical protein CARUB_v10005648mg             124   9e-29   
ref|NP_001190929.1|  RNA-binding (RRM/RBD/RNP motifs) family protein    124   1e-28   
gb|EPS65363.1|  hypothetical protein M569_09415                         124   1e-28   
gb|KDO71363.1|  hypothetical protein CISIN_1g026421mg                   123   1e-28   
ref|XP_010935769.1|  PREDICTED: serine/arginine-rich splicing fac...    123   2e-28   
ref|NP_001190930.1|  RNA-binding (RRM/RBD/RNP motifs) family protein    124   2e-28   
ref|XP_009408202.1|  PREDICTED: serine/arginine-rich splicing fac...    124   2e-28   
ref|XP_009400377.1|  PREDICTED: serine/arginine-rich splicing fac...    124   2e-28   
ref|XP_006425348.1|  hypothetical protein CICLE_v10026375mg             124   3e-28   
ref|XP_006467033.1|  PREDICTED: transformer-2 protein homolog bet...    124   3e-28   
emb|CAA70700.1|  transformer-SR ribonucleoprotein                       124   3e-28   Nicotiana tabacum [American tobacco]
ref|XP_010526825.1|  PREDICTED: serine/arginine-rich splicing fac...    123   3e-28   
emb|CDX69165.1|  BnaC01g02880D                                          124   3e-28   
gb|KDO71362.1|  hypothetical protein CISIN_1g026421mg                   124   3e-28   
ref|XP_006409259.1|  hypothetical protein EUTSA_v10022831mg             123   4e-28   
emb|CDY10270.1|  BnaC05g05130D                                          126   4e-28   
gb|AAF79558.1|AC022464_16  F22G5.31                                     127   4e-28   Arabidopsis thaliana [mouse-ear cress]
gb|AAY84876.1|  alternative splicing regulator                          124   4e-28   Triticum aestivum [Canadian hard winter wheat]
ref|NP_680768.5|  RNA-binding (RRM/RBD/RNP motifs) family protein       123   5e-28   Arabidopsis thaliana [mouse-ear cress]
ref|NP_974690.4|  RNA-binding (RRM/RBD/RNP motifs) family protein       123   5e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867054.1|  hypothetical protein ARALYDRAFT_912788             120   5e-28   
ref|XP_010235085.1|  PREDICTED: serine/arginine-rich splicing fac...    125   6e-28   
ref|XP_006425350.1|  hypothetical protein CICLE_v10026375mg             122   7e-28   
ref|XP_010918157.1|  PREDICTED: serine/arginine-rich splicing fac...    122   7e-28   
ref|XP_010918156.1|  PREDICTED: serine/arginine-rich splicing fac...    123   8e-28   
ref|XP_006343342.1|  PREDICTED: transformer-2 protein homolog alp...    122   8e-28   
ref|XP_011079075.1|  PREDICTED: serine/arginine-rich splicing fac...    122   8e-28   
ref|XP_010437422.1|  PREDICTED: serine/arginine-rich splicing fac...    122   9e-28   
ref|XP_004232529.1|  PREDICTED: serine/arginine-rich splicing fac...    122   1e-27   
gb|EYU30367.1|  hypothetical protein MIMGU_mgv1a012795mg                120   1e-27   
ref|XP_006282703.1|  hypothetical protein CARUB_v10005648mg             122   1e-27   
ref|NP_001238379.1|  uncharacterized protein LOC100499944               120   1e-27   
gb|ACF82503.1|  unknown                                                 123   1e-27   Zea mays [maize]
ref|XP_010033540.1|  PREDICTED: serine/arginine-rich splicing fac...    122   1e-27   
ref|NP_001148693.1|  LOC100282309                                       123   1e-27   Zea mays [maize]
ref|NP_001238605.1|  uncharacterized protein LOC100527350               120   1e-27   
ref|XP_008791954.1|  PREDICTED: serine/arginine-rich splicing fac...    121   1e-27   
ref|XP_008806158.1|  PREDICTED: serine/arginine-rich splicing fac...    121   2e-27   
ref|XP_009788034.1|  PREDICTED: serine/arginine-rich splicing fac...    121   2e-27   
ref|XP_009387324.1|  PREDICTED: serine/arginine-rich splicing fac...    121   2e-27   
ref|XP_010935190.1|  PREDICTED: serine/arginine-rich splicing fac...    120   2e-27   
ref|XP_009788035.1|  PREDICTED: serine/arginine-rich splicing fac...    121   2e-27   
ref|XP_010055674.1|  PREDICTED: serine/arginine-rich splicing fac...    121   3e-27   
ref|XP_006412060.1|  hypothetical protein EUTSA_v10026015mg             121   3e-27   
ref|XP_007202500.1|  hypothetical protein PRUPE_ppa010685mg             121   3e-27   
ref|XP_002992560.1|  hypothetical protein SELMODRAFT_49595              115   4e-27   
gb|KDP43705.1|  hypothetical protein JCGZ_22332                         120   5e-27   
ref|XP_011022229.1|  PREDICTED: serine/arginine-rich splicing fac...    120   5e-27   
ref|XP_010935189.1|  PREDICTED: serine/arginine-rich splicing fac...    120   5e-27   
ref|XP_010676454.1|  PREDICTED: serine/arginine-rich splicing fac...    119   6e-27   
ref|XP_008393698.1|  PREDICTED: transformer-2 protein homolog bet...    120   6e-27   
ref|XP_008393706.1|  PREDICTED: transformer-2 protein homolog bet...    120   6e-27   
ref|XP_010935188.1|  PREDICTED: serine/arginine-rich splicing fac...    120   6e-27   
ref|XP_009344818.1|  PREDICTED: serine/arginine-rich splicing fac...    120   7e-27   
ref|XP_009344819.1|  PREDICTED: serine/arginine-rich splicing fac...    120   7e-27   
gb|KEH27603.1|  RNA-binding (RRM/RBD/RNP motif) family protein          119   7e-27   
ref|XP_002972503.1|  hypothetical protein SELMODRAFT_26372              116   7e-27   
ref|XP_004509406.1|  PREDICTED: transformer-2 protein homolog alp...    120   8e-27   
gb|ABR46234.1|  At4g35785                                               117   9e-27   Arabidopsis thaliana [mouse-ear cress]
gb|EYU30368.1|  hypothetical protein MIMGU_mgv1a012795mg                119   1e-26   
ref|XP_009109272.1|  PREDICTED: serine/arginine-rich splicing fac...    119   1e-26   
ref|XP_002530643.1|  Arginine/serine-rich-splicing factor, putative     119   1e-26   Ricinus communis
gb|EYU29909.1|  hypothetical protein MIMGU_mgv1a025336mg                119   1e-26   
ref|XP_010696606.1|  PREDICTED: serine/arginine-rich splicing fac...    118   1e-26   
ref|XP_004135013.1|  PREDICTED: uncharacterized RNA-binding prote...    119   1e-26   
emb|CDY20808.1|  BnaC07g06570D                                          119   2e-26   
ref|XP_004158852.1|  PREDICTED: uncharacterized LOC101219220            119   2e-26   
emb|CBI24453.3|  unnamed protein product                                119   2e-26   
ref|XP_006383019.1|  hypothetical protein POPTR_0005s10780g             118   2e-26   
dbj|BAJ99477.1|  predicted protein                                      118   3e-26   
gb|KHN35554.1|  Putative RNA-binding protein C25G10.01                  118   3e-26   
ref|XP_006383020.1|  hypothetical protein POPTR_0005s10780g             118   3e-26   
gb|KHN00439.1|  Putative RNA-binding protein C25G10.01                  119   3e-26   
ref|XP_009109965.1|  PREDICTED: serine/arginine-rich splicing fac...    119   4e-26   
ref|XP_009623497.1|  PREDICTED: ankyrin repeat domain-containing ...    124   4e-26   
ref|NP_001058614.1|  Os06g0724600                                       115   4e-26   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001237888.1|  uncharacterized protein LOC100500170               117   4e-26   
emb|CDP01837.1|  unnamed protein product                                117   5e-26   
ref|XP_004512185.1|  PREDICTED: serine/arginine-rich splicing fac...    117   7e-26   
ref|XP_002984383.1|  hypothetical protein SELMODRAFT_49471              111   1e-25   
ref|XP_010266988.1|  PREDICTED: ankyrin repeat domain-containing ...    122   1e-25   
gb|KEH27602.1|  RNA-binding (RRM/RBD/RNP motif) family protein          116   1e-25   
emb|CDY42653.1|  BnaC01g00650D                                          121   2e-25   
gb|AFK45871.1|  unknown                                                 117   2e-25   
ref|XP_003629227.1|  ELAV-like protein                                  117   2e-25   
ref|XP_007157858.1|  hypothetical protein PHAVU_002G104100g             117   2e-25   
ref|XP_006572837.1|  PREDICTED: uncharacterized protein LOC100527...    115   2e-25   
ref|XP_002963380.1|  hypothetical protein SELMODRAFT_80254              113   3e-25   
gb|KHN35992.1|  Putative RNA-binding protein C25G10.01                  116   3e-25   
ref|XP_008242002.1|  PREDICTED: ankyrin repeat domain-containing ...    120   4e-25   
ref|XP_008440881.1|  PREDICTED: LOW QUALITY PROTEIN: ankyrin repe...    120   5e-25   
gb|AIX10950.1|  transformer-2 protein-like alpha-like protein           114   6e-25   
ref|XP_004287763.1|  PREDICTED: transformer-2 protein homolog bet...    114   6e-25   
gb|AFK46395.1|  unknown                                                 114   9e-25   
ref|XP_002974665.1|  hypothetical protein SELMODRAFT_102224             114   9e-25   
ref|XP_008676182.1|  PREDICTED: LOW QUALITY PROTEIN: RNA binding ...    115   1e-24   
ref|XP_004512184.1|  PREDICTED: serine/arginine-rich splicing fac...    115   1e-24   
ref|XP_002298021.2|  hypothetical protein POPTR_0001s09650g             109   1e-24   Populus trichocarpa [western balsam poplar]
ref|XP_008361349.1|  PREDICTED: uncharacterized protein LOC103425049    119   1e-24   
gb|EEE66378.1|  hypothetical protein OsJ_22698                          114   2e-24   Oryza sativa Japonica Group [Japonica rice]
gb|EEC81329.1|  hypothetical protein OsI_24503                          114   2e-24   Oryza sativa Indica Group [Indian rice]
dbj|BAD61690.1|  putative transformer-SR ribonucleoprotein              114   2e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007046578.1|  Ankyrin repeat protein                             118   2e-24   
ref|XP_002270437.3|  PREDICTED: uncharacterized protein LOC100241946    119   2e-24   Vitis vinifera
ref|XP_009337079.1|  PREDICTED: ankyrin repeat domain-containing ...    118   3e-24   
ref|XP_009363438.1|  PREDICTED: ankyrin repeat domain-containing ...    118   3e-24   
ref|XP_006657354.1|  PREDICTED: transformer-2 protein homolog bet...    114   3e-24   
ref|XP_003612260.1|  Scaffold attachment factor B1                      114   3e-24   
gb|AFW69545.1|  hypothetical protein ZEAMMB73_512754                    109   4e-24   
ref|XP_002437609.1|  hypothetical protein SORBIDRAFT_10g030460          111   4e-24   Sorghum bicolor [broomcorn]
ref|XP_010113281.1|  Ankyrin repeat domain-containing protein           117   6e-24   
gb|AFW69542.1|  hypothetical protein ZEAMMB73_512754                    108   4e-23   
dbj|BAK07261.1|  predicted protein                                      107   4e-23   
gb|KHN06831.1|  RNA-binding motif protein, X chromosome                 106   7e-23   
ref|XP_003563264.1|  PREDICTED: serine/arginine-rich splicing fac...    107   2e-22   
gb|EMT02480.1|  Putative RNA-binding protein                            107   2e-22   
ref|XP_004966485.1|  PREDICTED: RNA-binding motif protein, X chro...    107   5e-22   
ref|NP_001149397.1|  transformer-2 protein                              106   7e-22   Zea mays [maize]
gb|AFW69546.1|  hypothetical protein ZEAMMB73_512754                    106   7e-22   
ref|XP_007850789.1|  hypothetical protein Moror_796                   99.8    4e-20   
ref|XP_006586014.1|  PREDICTED: transformer-2 protein homolog bet...  97.1    9e-20   
ref|XP_009540671.1|  hypothetical protein HETIRDRAFT_308332           92.8    1e-18   
ref|XP_007298101.1|  RNA-binding domain-containing protein            90.1    2e-17   
ref|XP_002912240.1|  hypothetical protein CC1G_13772                  90.9    8e-17   
emb|CDS05949.1|  hypothetical protein LRAMOSA08477                    90.9    9e-17   
ref|XP_004336466.1|  RNA recognition motif domain containing protein  90.9    1e-16   
emb|CDY41631.1|  BnaC03g62530D                                        92.4    1e-16   
ref|XP_007762605.1|  RNA-binding domain-containing protein            88.2    1e-16   
gb|EMD32604.1|  hypothetical protein CERSUDRAFT_77305                 90.5    1e-16   
gb|EPS97798.1|  hypothetical protein FOMPIDRAFT_1127661               90.1    2e-16   
gb|KDN43545.1|  RNA-binding domain-containing protein                 86.7    2e-16   
gb|ESA17395.1|  hypothetical protein GLOINDRAFT_149806                87.8    2e-16   
emb|CCA73260.1|  related to Transformer-2 protein homolog             89.4    3e-16   
ref|XP_007843149.1|  hypothetical protein Moror_17576                 89.0    4e-16   
gb|KDQ31587.1|  hypothetical protein PLEOSDRAFT_173268                89.0    5e-16   
ref|XP_002997732.1|  conserved hypothetical protein                   87.8    8e-16   
gb|EMS20097.1|  transformer-SR ribonucleoprotein                      87.8    1e-15   
gb|KFH65433.1|  hypothetical protein MVEG_08911                       87.4    1e-15   
gb|KFH71731.1|  hypothetical protein MVEG_02026                       87.4    1e-15   
emb|CEI93424.1|  Putative RNA-binding domain-containing protein       87.0    1e-15   
dbj|GAC74764.1|  hsp27-ere-tata-binding protein/Scaffold attachme...  87.4    2e-15   
ref|XP_007856967.1|  hypothetical protein Moror_2102                  87.4    2e-15   
emb|CCO29814.1|  putative RNA-binding protein C25G10,01               86.3    2e-15   
ref|XP_007402728.1|  hypothetical protein PHACADRAFT_266187           86.7    2e-15   
gb|ETS62642.1|  hypothetical protein PaG_03286                        87.4    3e-15   
gb|KDQ15586.1|  hypothetical protein BOTBODRAFT_108308                83.2    3e-15   
gb|KDN49090.1|  hypothetical protein RSAG8_02443                      85.9    3e-15   
ref|XP_003026365.1|  hypothetical protein SCHCODRAFT_30182            82.4    3e-15   
gb|KDQ62974.1|  hypothetical protein JAAARDRAFT_188608                86.3    4e-15   
ref|XP_007872140.1|  hypothetical protein PNEG_00267                  85.5    5e-15   
gb|EXX80020.1|  Pub1p                                                 85.5    5e-15   
gb|ELU39394.1|  RNA recognition motif domain-containing protein       86.7    6e-15   
emb|CCJ29365.1|  unnamed protein product                              85.1    8e-15   
ref|XP_009514980.1|  hypothetical protein PHYSODRAFT_472294           83.2    8e-15   
ref|XP_007313119.1|  hypothetical protein SERLADRAFT_412645           85.1    9e-15   
gb|EPB85733.1|  hypothetical protein HMPREF1544_07484                 84.7    9e-15   
gb|KDE02910.1|  hypothetical protein MVLG_06570                       84.7    9e-15   
gb|EPY51974.1|  RNA-binding protein                                   85.5    1e-14   
gb|EIE80732.1|  hypothetical protein RO3G_05437                       84.3    1e-14   
emb|CCF48487.1|  related to Transformer-2 protein homolog             85.1    2e-14   
emb|CBQ71214.1|  related to Transformer-2 protein homolog             84.7    2e-14   
gb|KDR85886.1|  hypothetical protein GALMADRAFT_51853                 80.5    2e-14   
ref|XP_007854065.1|  hypothetical protein Moror_9723                  83.2    2e-14   
gb|EUC56720.1|  RNA recognition motif, putative                       82.4    4e-14   
ref|XP_008032928.1|  hypothetical protein TRAVEDRAFT_108807           80.5    5e-14   
gb|EST05979.1|  hypothetical protein PSEUBRA_SCAF4g05113              83.6    5e-14   
dbj|GAA98830.1|  hypothetical protein E5Q_05518                       83.6    8e-14   
dbj|GAA98831.1|  hypothetical protein E5Q_05519                       83.6    9e-14   
ref|XP_003889826.1|  hypothetical protein, variant                    80.5    2e-13   
ref|XP_007325962.1|  hypothetical protein AGABI1DRAFT_110889          80.9    2e-13   
ref|XP_006453853.1|  hypothetical protein AGABI2DRAFT_189205          80.9    2e-13   
ref|XP_003327294.2|  hypothetical protein PGTG_09843                  80.1    3e-13   
ref|XP_008907232.1|  hypothetical protein, variant 2                  79.7    4e-13   
ref|XP_008907230.1|  hypothetical protein PPTG_13366                  79.7    5e-13   
ref|XP_002841000.1|  hypothetical protein                             80.1    6e-13   
ref|XP_008907233.1|  hypothetical protein, variant 3                  79.0    6e-13   
ref|XP_008907231.1|  hypothetical protein, variant 1                  79.0    7e-13   
gb|KEP52585.1|  putative RNA recognition motif                        78.6    9e-13   
ref|XP_007877230.1|  hypothetical protein PFL1_01529                  79.7    9e-13   
emb|CDO73389.1|  hypothetical protein BN946_scf185013.g23             78.2    1e-12   
ref|XP_007359859.1|  hypothetical protein DICSQDRAFT_46822            75.5    1e-12   
ref|XP_007379242.1|  RNA-binding domain-containing protein            77.8    1e-12   
ref|XP_001273363.1|  transformer-SR ribonucleoprotein, putative       78.6    2e-12   
emb|CCA16044.1|  conserved hypothetical protein                       77.0    3e-12   
ref|XP_001261469.1|  transformer-SR ribonucleoprotein, putative       77.8    3e-12   
dbj|BAJ92808.1|  predicted protein                                    77.0    4e-12   
dbj|GAD99687.1|  transformer-SR ribonucleoprotein, putative           77.8    4e-12   
ref|XP_748983.1|  transformer-SR ribonucleoprotein                    77.0    4e-12   
gb|EMF16729.1|  RRM_1-domain-containing protein                       75.5    5e-12   
ref|XP_003321679.1|  hypothetical protein PGTG_03216                  75.9    6e-12   
ref|XP_007410602.1|  hypothetical protein MELLADRAFT_31155            72.8    7e-12   
emb|CCA16496.1|  conserved hypothetical protein                       75.1    8e-12   
gb|KHJ35597.1|  putative rna recognition domain-containing protein    75.9    1e-11   
emb|CCG83105.2|  Predicted protein                                    75.1    1e-11   
ref|XP_007288071.1|  RNA recognition domain-containing protein        76.3    1e-11   
ref|XP_002173239.2|  RNA-binding protein                              76.6    1e-11   
gb|KFY43057.1|  hypothetical protein V495_04193                       74.7    1e-11   
ref|XP_007784864.1|  hypothetical protein W97_08807                   75.1    1e-11   
gb|KDQ08825.1|  hypothetical protein BOTBODRAFT_555164                75.5    1e-11   
ref|XP_010278696.1|  PREDICTED: serine/arginine repetitive matrix...  75.5    1e-11   
ref|XP_007265112.1|  hypothetical protein FOMMEDRAFT_82331            73.6    1e-11   
gb|ABR16511.1|  unknown                                               77.8    1e-11   
gb|EPS34207.1|  hypothetical protein PDE_09171                        75.9    2e-11   
emb|CCX10691.1|  Similar to Uncharacterized RNA-binding protein C...  75.9    2e-11   
ref|XP_006677310.1|  hypothetical protein BATDEDRAFT_23541            74.3    2e-11   
ref|XP_006967664.1|  predicted protein                                73.9    2e-11   
ref|XP_007214333.1|  hypothetical protein PRUPE_ppb022899mg           74.3    2e-11   
gb|KGB74799.1|  hypothetical protein CNBG_0637                        74.3    2e-11   
gb|KFY25758.1|  hypothetical protein V493_04478                       74.7    2e-11   
dbj|GAC98552.1|  hypothetical protein PHSY_006146                     74.7    3e-11   
ref|XP_008078096.1|  RNA-binding, RBD                                 74.7    3e-11   
gb|KFY03195.1|  hypothetical protein O988_01652                       74.7    3e-11   
gb|KFY34823.1|  hypothetical protein V494_06442                       73.6    3e-11   
ref|XP_007364416.1|  RNA-binding domain-containing protein            74.3    3e-11   
ref|XP_002845973.1|  TRA2B                                            74.7    3e-11   
ref|XP_001215629.1|  conserved hypothetical protein                   74.3    4e-11   
ref|XP_570425.1|  hypothetical protein                                73.6    4e-11   
ref|XP_007862612.1|  RNA-binding domain-containing protein            73.9    4e-11   
emb|CCU81883.1|  transformer-SR ribonucleoprotein/RNA recognition...  74.3    4e-11   
gb|EPQ66356.1|  hypothetical protein BGT96224_3321                    74.3    4e-11   
gb|KDP39131.1|  hypothetical protein JCGZ_00888                       75.9    4e-11   
ref|XP_003193552.1|  hypothetical protein CGB_D4310W                  73.6    4e-11   
gb|EPX70810.1|  RNA-binding protein                                   74.3    5e-11   
ref|XP_003025833.1|  transformer-SR ribonucleoprotein, putative       71.2    5e-11   
gb|AGV14344.1|  hypothetical protein, variant                         73.2    6e-11   
ref|XP_010276089.1|  PREDICTED: pre-mRNA-splicing factor CWC21-li...  74.7    6e-11   
gb|KFZ02816.1|  hypothetical protein V502_11471                       73.6    6e-11   
emb|CCI48968.1|  unnamed protein product                              75.9    6e-11   
ref|XP_009218715.1|  hypothetical protein GGTG_02676                  73.9    6e-11   
gb|EMD40972.1|  hypothetical protein CERSUDRAFT_111545                73.6    6e-11   
ref|XP_002557435.1|  Pc12g05910                                       73.9    7e-11   
gb|KFY85329.1|  hypothetical protein V500_08518                       73.6    7e-11   
gb|KFY75458.1|  hypothetical protein V499_04583                       73.6    7e-11   
gb|EYE98633.1|  RNA-binding domain-containing protein                 73.6    7e-11   
gb|AFR95086.1|  hypothetical protein CNAG_01060                       72.8    7e-11   
ref|XP_007315263.1|  hypothetical protein SERLADRAFT_434943           73.2    8e-11   
gb|KFY50090.1|  hypothetical protein V496_09596                       73.6    8e-11   
gb|ELR06000.1|  hypothetical protein GMDG_01961                       73.6    8e-11   
gb|KEQ82209.1|  RNA-binding domain-containing protein                 73.2    8e-11   
gb|AFW58564.1|  hypothetical protein ZEAMMB73_261167                  72.4    9e-11   
emb|CDO74157.1|  hypothetical protein BN946_scf185043.g208            72.4    9e-11   
ref|XP_007392122.1|  hypothetical protein PHACADRAFT_250155           72.8    9e-11   
gb|KEQ77088.1|  RNA-binding domain-containing protein                 73.2    1e-10   
ref|XP_010763107.1|  hypothetical protein PADG_07689                  73.2    1e-10   
dbj|GAA86148.1|  transformer-SR ribonucleoprotein                     73.2    1e-10   
ref|XP_001540824.1|  predicted protein                                73.2    1e-10   
ref|XP_002792416.1|  conserved hypothetical protein                   73.2    1e-10   
dbj|GAK65123.1|  RNA-binding domain-containing protein                73.6    1e-10   
gb|EER43165.1|  transformer-SR ribonucleoprotein                      73.2    1e-10   
ref|XP_001391382.1|  transformer-SR ribonucleoprotein                 73.2    1e-10   
ref|XP_664280.1|  hypothetical protein AN6676.2                       72.8    1e-10   
gb|EEH11125.1|  conserved hypothetical protein                        73.2    1e-10   
gb|EPT03124.1|  hypothetical protein FOMPIDRAFT_1022487               72.4    1e-10   
gb|EKG13991.1|  hypothetical protein MPH_08865                        72.4    1e-10   
ref|XP_007000902.1|  hypothetical protein TREMEDRAFT_37437            72.0    1e-10   
dbj|BAE55352.1|  unnamed protein product                              72.8    1e-10   
ref|XP_010923906.1|  PREDICTED: serine/arginine repetitive matrix...  73.9    2e-10   
emb|CCI41219.1|  unnamed protein product                              73.9    2e-10   
ref|XP_002372423.1|  transformer-SR ribonucleoprotein, putative       72.4    2e-10   
gb|EKV11840.1|  hypothetical protein PDIP_54740                       72.8    2e-10   
ref|XP_008812624.1|  PREDICTED: serine/arginine repetitive matrix...  73.9    2e-10   
ref|XP_010923908.1|  PREDICTED: serine/arginine repetitive matrix...  73.9    2e-10   
gb|KFH43274.1|  putative RNA-binding protein-like protein             70.9    2e-10   
gb|KFX42364.1|  putative RNA-binding protein C25G10.01                73.2    2e-10   
dbj|GAM37945.1|  hypothetical protein TCE0_033r08296                  72.8    2e-10   
ref|XP_007874723.1|  hypothetical protein PNEG_02699                  71.2    2e-10   
gb|EJT46854.1|  hypothetical protein A1Q1_04405                       73.2    2e-10   
ref|XP_002473663.1|  predicted protein                                73.9    2e-10   
gb|EEQ86499.1|  transformer-SR ribonucleoprotein                      72.4    2e-10   
gb|KGQ05847.1|  putative RNA-binding protein C25G10.01                72.8    2e-10   
ref|XP_007847123.1|  transformer-2-beta isoform 3                     71.6    2e-10   
ref|XP_002624692.1|  transformer-SR ribonucleoprotein                 72.0    2e-10   
gb|AFR92532.2|  transformer-2-beta isoform 3                          72.0    2e-10   
ref|XP_003662172.1|  hypothetical protein MYCTH_2314855               72.4    2e-10   
gb|EFX01090.1|  transformer-SR ribonucleoprotein                      71.2    2e-10   
ref|XP_008806407.1|  PREDICTED: serine/arginine repetitive matrix...  73.6    2e-10   
gb|ETR99440.1|  RNA-binding domain-containing protein                 72.4    2e-10   
ref|XP_629578.1|  RNA-binding region RNP-1 domain-containing protein  72.0    2e-10   
gb|EZF76089.1|  hypothetical protein H105_02525                       72.0    3e-10   
gb|EHK49735.1|  hypothetical protein TRIATDRAFT_297628                72.4    3e-10   
gb|EHK15146.1|  hypothetical protein TRIVIDRAFT_185271                72.4    3e-10   
ref|XP_002150032.1|  transformer-SR ribonucleoprotein, putative       72.4    3e-10   
ref|XP_003233279.1|  hypothetical protein TERG_06272                  71.6    3e-10   
ref|XP_003711424.1|  hypothetical protein MGG_07511                   72.0    3e-10   
gb|EKD03814.1|  RRM protein                                           73.2    3e-10   
emb|CDM35678.1|  Nucleotide-binding, alpha-beta plait                 72.4    3e-10   
ref|XP_001224802.1|  hypothetical protein CHGG_07146                  72.4    3e-10   
gb|KEQ98986.1|  hypothetical protein AUEXF2481DRAFT_26221             72.0    3e-10   
ref|XP_003852851.1|  hypothetical protein MYCGRDRAFT_70735            70.5    3e-10   
gb|EGD99624.1|  hypothetical protein TESG_06970                       71.6    3e-10   
ref|XP_007579790.1|  putative rna recognition domain-containing p...  71.2    4e-10   
gb|KGO75787.1|  Nucleotide-binding, alpha-beta plait                  72.0    4e-10   
emb|CCD49551.1|  hypothetical protein BofuT4_P099280.1                71.6    4e-10   
gb|ESZ90606.1|  putative Uncharacterized RNA-binding protein C25G...  71.6    4e-10   
gb|EZF35371.1|  hypothetical protein H101_01107                       71.2    4e-10   
gb|KDE04808.1|  hypothetical protein MVLG_04772                       71.2    4e-10   
ref|XP_007678523.1|  hypothetical protein BAUCODRAFT_149939           73.9    4e-10   
ref|XP_007741101.1|  hypothetical protein A1O5_02295                  71.2    4e-10   
ref|XP_001592047.1|  hypothetical protein SS1G_07495                  71.6    4e-10   
ref|XP_009406507.1|  PREDICTED: SAFB-like transcription modulator...  73.2    4e-10   
gb|KGO58813.1|  Zinc finger, PHD-type                                 73.6    4e-10   
gb|KGO39811.1|  Zinc finger, PHD-type                                 73.6    4e-10   
gb|KGO61254.1|  Zinc finger, PHD-type                                 73.6    4e-10   
ref|XP_003649775.1|  hypothetical protein THITE_2108702               71.6    4e-10   
ref|XP_001555758.1|  hypothetical protein BC1G_05132                  71.2    4e-10   
ref|XP_008600574.1|  RNA recognition domain-containing protein        71.6    4e-10   
ref|XP_008365101.1|  PREDICTED: serine/arginine repetitive matrix...  72.4    4e-10   
gb|ADE10071.1|  RRM                                                   71.6    4e-10   
ref|XP_003293810.1|  hypothetical protein DICPUDRAFT_84328            70.9    5e-10   
ref|WP_014217949.1|  RNA-binding protein                              67.4    5e-10   
gb|ELQ38069.1|  hypothetical protein OOU_Y34scaffold00552g23          72.0    5e-10   
ref|XP_008365088.1|  PREDICTED: serine/arginine repetitive matrix...  72.4    5e-10   
gb|KDQ28892.1|  hypothetical protein PLEOSDRAFT_1075764               69.3    6e-10   
ref|XP_009360988.1|  PREDICTED: serine/arginine-rich splicing fac...  72.0    7e-10   
ref|XP_002484236.1|  transformer-SR ribonucleoprotein, putative       70.9    7e-10   
gb|EME48408.1|  hypothetical protein DOTSEDRAFT_39776                 68.9    7e-10   
ref|XP_004294384.1|  PREDICTED: uncharacterized protein LOC101309621  72.0    8e-10   
ref|XP_008035847.1|  RNA-binding domain-containing protein            69.3    8e-10   
ref|XP_006669166.1|  transformer-SR ribonucleoprotein, putative       71.2    9e-10   
gb|EFX72513.1|  hypothetical protein DAPPUDRAFT_326177                72.4    9e-10   
gb|ELU13574.1|  hypothetical protein CAPTEDRAFT_6610                  70.1    9e-10   
ref|XP_007737664.1|  hypothetical protein A1O3_09380                  70.1    1e-09   
ref|XP_001884298.1|  predicted protein                                68.9    1e-09   
ref|XP_007759310.1|  hypothetical protein A1O7_07120                  69.3    1e-09   
gb|EGO01519.1|  hypothetical protein SERLA73DRAFT_120183              68.9    1e-09   
ref|WP_037385289.1|  RNA-binding protein                              67.8    1e-09   
ref|XP_003171589.1|  RNA recognition domain-containing protein fa...  70.1    1e-09   
ref|XP_011095397.1|  PREDICTED: serine/arginine repetitive matrix...  72.0    1e-09   
ref|XP_007793484.1|  putative transformer-sr ribonucleo protein       70.5    1e-09   
ref|XP_011056190.1|  PREDICTED: SAFB-like transcription modulator...  72.0    1e-09   
gb|EGI64471.1|  Scaffold attachment factor B2                         72.0    1e-09   
ref|XP_011056189.1|  PREDICTED: SAFB-like transcription modulator...  72.0    1e-09   
ref|XP_008204416.1|  PREDICTED: scaffold attachment factor B2-like    72.0    1e-09   
ref|XP_007305599.1|  RNA-binding domain-containing protein            69.3    1e-09   
ref|XP_006696535.1|  hypothetical protein CTHT_0062190                70.5    1e-09   
gb|KIH94268.1|  hypothetical protein SPBR_05918                       70.5    1e-09   
dbj|BAP58003.1|  RNA-binding protein                                  66.6    1e-09   
ref|XP_001911920.1|  hypothetical protein                             70.1    1e-09   
ref|XP_008226903.1|  PREDICTED: uncharacterized protein C2orf16-l...  70.9    1e-09   
ref|XP_003324121.2|  hypothetical protein PGTG_06023                  69.7    1e-09   
ref|XP_007407078.1|  hypothetical protein MELLADRAFT_42536            69.7    1e-09   
ref|XP_011056191.1|  PREDICTED: SAFB-like transcription modulator...  71.6    1e-09   
gb|ERS99204.1|  hypothetical protein HMPREF1624_04402                 70.5    1e-09   
ref|XP_007724437.1|  hypothetical protein A1O1_05361                  68.6    2e-09   
gb|EFN71758.1|  Scaffold attachment factor B2                         71.2    2e-09   



>ref|XP_011082380.1| PREDICTED: serine/arginine-rich splicing factor SR45a [Sesamum 
indicum]
Length=374

 Score =   161 bits (407),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/83 (88%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DAENPGNNLYVTGLSTRV ++DLEKHFS+EGKVEDVHLV+DPWTRESRGF FVTMS LE+
Sbjct  39   DAENPGNNLYVTGLSTRVTKRDLEKHFSTEGKVEDVHLVVDPWTRESRGFGFVTMSTLEE  98

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            ADRCIKYL+RSVLEGRVITVEK 
Sbjct  99   ADRCIKYLDRSVLEGRVITVEKA  121



>ref|XP_009624179.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Nicotiana 
tomentosiformis]
Length=391

 Score =   156 bits (395),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/83 (86%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D ENPGNNLYVTGLSTRV+++D+EKHFS+EGKVEDVHLV+DPWTRESRGF FVTMS +E+
Sbjct  40   DIENPGNNLYVTGLSTRVKERDVEKHFSAEGKVEDVHLVVDPWTRESRGFGFVTMSSVEE  99

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            ADRCIKYLNRSVLEGRVITVEK 
Sbjct  100  ADRCIKYLNRSVLEGRVITVEKA  122



>ref|XP_006586189.1| PREDICTED: uncharacterized RNA-binding protein C25G10.01-like 
isoform X2 [Glycine max]
 ref|XP_006586190.1| PREDICTED: uncharacterized RNA-binding protein C25G10.01-like 
isoform X3 [Glycine max]
Length=143

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DAENPGNNLYVTGLS R+ +++LEKHFS+EGKV DVHLV+DPWTRESRGF FVTM  LE+
Sbjct  42   DAENPGNNLYVTGLSPRITKRELEKHFSAEGKVIDVHLVVDPWTRESRGFGFVTMETLEE  101

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            ADRC+KYLNRSVLEGRVITVEK
Sbjct  102  ADRCVKYLNRSVLEGRVITVEK  123



>ref|XP_009778762.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X1 [Nicotiana sylvestris]
Length=399

 Score =   155 bits (391),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D ENPGNNLYVTGLSTRV+++D+EKHFS+EGKVEDVHLV+DPWT+ESRGF FVTMS +E+
Sbjct  41   DVENPGNNLYVTGLSTRVKERDVEKHFSAEGKVEDVHLVVDPWTQESRGFGFVTMSSVEE  100

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            ADRCIKYLNRSVLEGRVITVEK 
Sbjct  101  ADRCIKYLNRSVLEGRVITVEKA  123



>ref|XP_009778763.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X2 [Nicotiana sylvestris]
Length=398

 Score =   155 bits (391),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D ENPGNNLYVTGLSTRV+++D+EKHFS+EGKVEDVHLV+DPWT+ESRGF FVTMS +E+
Sbjct  40   DVENPGNNLYVTGLSTRVKERDVEKHFSAEGKVEDVHLVVDPWTQESRGFGFVTMSSVEE  99

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            ADRCIKYLNRSVLEGRVITVEK 
Sbjct  100  ADRCIKYLNRSVLEGRVITVEKA  122



>ref|XP_010685629.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Beta 
vulgaris subsp. vulgaris]
Length=375

 Score =   154 bits (388),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  231  ENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDAD  410
            ENPGNNLYVTGLSTRV +++LEKHFSSEGKVEDVHLV DPWT+ESRGF FVTMS L++AD
Sbjct  44   ENPGNNLYVTGLSTRVTKRELEKHFSSEGKVEDVHLVTDPWTKESRGFGFVTMSSLQEAD  103

Query  411  RCIKYLNRSVLEGRVITVEKV  473
            RCIKYL+RSVLEGRVITVEK 
Sbjct  104  RCIKYLDRSVLEGRVITVEKA  124



>ref|XP_007016195.1| RNA-binding family protein isoform 2 [Theobroma cacao]
 ref|XP_007016196.1| RNA-binding family protein isoform 2 [Theobroma cacao]
 gb|EOY33814.1| RNA-binding family protein isoform 2 [Theobroma cacao]
 gb|EOY33815.1| RNA-binding family protein isoform 2 [Theobroma cacao]
Length=131

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D ENPGNNLYVTGLS R+ +++LEKHF+SEG V DVHLV+DPWTRESRGF FVTM+  E+
Sbjct  40   DVENPGNNLYVTGLSPRITKRELEKHFASEGNVIDVHLVVDPWTRESRGFGFVTMATNEE  99

Query  405  ADRCIKYLNRSVLEGRVITVEKVN  476
            A+RCIKYLNRSVLEGRVITVEKVN
Sbjct  100  AERCIKYLNRSVLEGRVITVEKVN  123



>ref|XP_010033040.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Eucalyptus 
grandis]
Length=130

 Score =   144 bits (363),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D ENPGNNLYVTGLS R+ +++LEKHF+SEGKV DVHLV+DPWTRESRGF FVTMS +E+
Sbjct  40   DVENPGNNLYVTGLSPRITKRELEKHFASEGKVVDVHLVVDPWTRESRGFGFVTMSTVEE  99

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            A+RCIKYL+RSVLEGRVITVEK
Sbjct  100  AERCIKYLDRSVLEGRVITVEK  121



>ref|XP_002520437.1| FUS-interacting serine-arginine-rich protein 1, putative [Ricinus 
communis]
 gb|EEF41850.1| FUS-interacting serine-arginine-rich protein 1, putative [Ricinus 
communis]
Length=399

 Score =   151 bits (382),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D ENPGNNLYVTGLS R+ ++DLEKHF+SEGKV DVHLV+DPWTRESRGF FVTMS L +
Sbjct  41   DVENPGNNLYVTGLSPRITKRDLEKHFASEGKVIDVHLVVDPWTRESRGFGFVTMSTLVE  100

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            ADRCIKYLNRSVLEGRVITVEK 
Sbjct  101  ADRCIKYLNRSVLEGRVITVEKA  123



>emb|CBI16010.3| unnamed protein product [Vitis vinifera]
Length=198

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            + ENPGNNLYVTGLSTRV +++LEKHF+SEG V DVHLV DPWTRESRGF FVTMS +E+
Sbjct  43   EVENPGNNLYVTGLSTRVTKRELEKHFASEGSVADVHLVTDPWTRESRGFGFVTMSTVEE  102

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+RCIKYL+RSVLEGRVITVEKV
Sbjct  103  ANRCIKYLDRSVLEGRVITVEKV  125



>ref|XP_003530834.1| PREDICTED: uncharacterized RNA-binding protein C25G10.01-like 
isoform X1 [Glycine max]
 gb|KHN01785.1| Putative RNA-binding protein C25G10.01 [Glycine soja]
Length=362

 Score =   150 bits (380),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DAENPGNNLYVTGLS R+ +++LEKHFS+EGKV DVHLV+DPWTRESRGF FVTM  LE+
Sbjct  42   DAENPGNNLYVTGLSPRITKRELEKHFSAEGKVIDVHLVVDPWTRESRGFGFVTMETLEE  101

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            ADRC+KYLNRSVLEGRVITVEK 
Sbjct  102  ADRCVKYLNRSVLEGRVITVEKA  124



>emb|CDP09143.1| unnamed protein product [Coffea canephora]
Length=363

 Score =   150 bits (379),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +3

Query  228  AENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDA  407
            AENPGNNLYVTGLSTRV ++DLEKHFS+EG VEDVHLVIDPW+RESRGF FVTM+ +++A
Sbjct  40   AENPGNNLYVTGLSTRVTKRDLEKHFSTEGAVEDVHLVIDPWSRESRGFGFVTMASVKEA  99

Query  408  DRCIKYLNRSVLEGRVITVEKVNC  479
            DRCIKYLN SVLEGRVIT+EK  C
Sbjct  100  DRCIKYLNHSVLEGRVITIEKFLC  123



>ref|XP_006350816.1| PREDICTED: serine/arginine repetitive matrix protein 2-like [Solanum 
tuberosum]
Length=385

 Score =   149 bits (376),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = +3

Query  231  ENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDAD  410
            ENPGNNLYVTGLSTRV+++D+EKHFS+EGKVEDV LV DPWTRESRGF FVTMS +E+AD
Sbjct  42   ENPGNNLYVTGLSTRVKERDVEKHFSAEGKVEDVRLVFDPWTRESRGFGFVTMSSVEEAD  101

Query  411  RCIKYLNRSVLEGRVITVEKV  473
            RCIK LNRSVLEGRVITVEK 
Sbjct  102  RCIKSLNRSVLEGRVITVEKA  122



>emb|CAN63579.1| hypothetical protein VITISV_029585 [Vitis vinifera]
Length=241

 Score =   145 bits (366),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            + ENPGNNLYVTGLSTRV +++LEKHF+SEG V DVHLV DPWTRESRGF FVTMS +E+
Sbjct  43   EVENPGNNLYVTGLSTRVTKRELEKHFASEGSVADVHLVTDPWTRESRGFGFVTMSTVEE  102

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+RCIKYL+RSVLEGRVITVEK 
Sbjct  103  ANRCIKYLDRSVLEGRVITVEKA  125



>gb|AFK47423.1| unknown [Medicago truncatula]
 gb|KEH34153.1| RNA-binding (RRM/RBD/RNP motif) family protein [Medicago truncatula]
Length=340

 Score =   148 bits (373),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D ENPGNNLYVTGLS R+ +++LEKHFS++GKV DVHLV+DPWTRESRGF FVTM  LE+
Sbjct  39   DVENPGNNLYVTGLSPRITKRELEKHFSAKGKVVDVHLVVDPWTRESRGFGFVTMDTLEE  98

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            ADRC+KYLNRSVLEGRVITVEK 
Sbjct  99   ADRCVKYLNRSVLEGRVITVEKA  121



>ref|XP_003551321.1| PREDICTED: pre-mRNA-splicing factor cwc22-like [Glycine max]
Length=364

 Score =   148 bits (374),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DAENPGNNLYVTGLS R+ +++LEKHF++EGKV DVHLV+DPWTRESRGF FVTM  LE+
Sbjct  44   DAENPGNNLYVTGLSPRITKRELEKHFAAEGKVIDVHLVVDPWTRESRGFGFVTMETLEE  103

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+RC+KYLNRSVLEGRVITVEK 
Sbjct  104  AERCVKYLNRSVLEGRVITVEKA  126



>gb|AFK40884.1| unknown [Lotus japonicus]
Length=344

 Score =   147 bits (372),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D ENPGNNLYVTGLS R+ +++LEKHF++EGKV DVHLV+DPWTRESRGF FVTM  LED
Sbjct  42   DVENPGNNLYVTGLSPRITKRELEKHFATEGKVIDVHLVVDPWTRESRGFGFVTMDTLED  101

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+RC+KYLNRSVLEGRVITVEK 
Sbjct  102  ANRCVKYLNRSVLEGRVITVEKA  124



>gb|KHN06265.1| Putative RNA-binding protein C25G10.01 [Glycine soja]
Length=366

 Score =   147 bits (372),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DAENPGNNLYVTGLS R+ +++LEKHF++EGKV DVHLV+DPWTRESRGF FVTM  LE+
Sbjct  46   DAENPGNNLYVTGLSPRITKRELEKHFAAEGKVIDVHLVVDPWTRESRGFGFVTMETLEE  105

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+RC+KYLNRSVLEGRVITVEK 
Sbjct  106  AERCVKYLNRSVLEGRVITVEKA  128



>ref|XP_007146720.1| hypothetical protein PHAVU_006G064000g [Phaseolus vulgaris]
 gb|ESW18714.1| hypothetical protein PHAVU_006G064000g [Phaseolus vulgaris]
Length=369

 Score =   147 bits (372),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DAENPGNNLYVTGLS R+ +++LEKHF++EGKV DVHLV+DPWTRESRGF FVTM  +E 
Sbjct  46   DAENPGNNLYVTGLSPRITKRELEKHFAAEGKVRDVHLVVDPWTRESRGFGFVTMETVEV  105

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            ADRC+KYLNRSVLEGRVITVEK 
Sbjct  106  ADRCVKYLNRSVLEGRVITVEKA  128



>ref|XP_002280779.2| PREDICTED: serine/arginine-rich splicing factor SR45a [Vitis 
vinifera]
Length=330

 Score =   146 bits (369),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            + ENPGNNLYVTGLSTRV +++LEKHF+SEG V DVHLV DPWTRESRGF FVTMS +E+
Sbjct  43   EVENPGNNLYVTGLSTRVTKRELEKHFASEGSVADVHLVTDPWTRESRGFGFVTMSTVEE  102

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+RCIKYL+RSVLEGRVITVEK 
Sbjct  103  ANRCIKYLDRSVLEGRVITVEKA  125



>ref|XP_004984684.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X3 [Setaria italica]
Length=122

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DAENPGNNLYVTGLS RV  +DLEKHFS+EG+V D  +V DPWTRESRGF FVTM+ +++
Sbjct  34   DAENPGNNLYVTGLSARVTDQDLEKHFSTEGEVIDASIVHDPWTRESRGFGFVTMATVKE  93

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            ADRCIKYL+RSVLEGRVITVEK+
Sbjct  94   ADRCIKYLDRSVLEGRVITVEKI  116



>gb|KDP46559.1| hypothetical protein JCGZ_08531 [Jatropha curcas]
Length=372

 Score =   147 bits (370),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D +NPGNNLYVTGLS R+ ++DLEKHF+SEG V DVHLV+DPWTRESRGF FVTMS + +
Sbjct  46   DVDNPGNNLYVTGLSPRITKRDLEKHFASEGTVVDVHLVVDPWTRESRGFGFVTMSSVGE  105

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            ADRCIKYLNRSVLEGRVITVEK 
Sbjct  106  ADRCIKYLNRSVLEGRVITVEKA  128



>ref|XP_011032165.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X3 [Populus euphratica]
Length=389

 Score =   147 bits (371),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D ENPGNNLYVTGLS R+ +K+LEKHFS+EG V DVHLVIDPWTRESRGF FVTMS +E+
Sbjct  42   DVENPGNNLYVTGLSPRITKKELEKHFSAEGTVIDVHLVIDPWTRESRGFGFVTMSTVEE  101

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            AD CIKYL+RSVLEGRVITVEK 
Sbjct  102  ADHCIKYLDRSVLEGRVITVEKA  124



>ref|XP_011032164.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X2 [Populus euphratica]
Length=391

 Score =   147 bits (371),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D ENPGNNLYVTGLS R+ +K+LEKHFS+EG V DVHLVIDPWTRESRGF FVTMS +E+
Sbjct  44   DVENPGNNLYVTGLSPRITKKELEKHFSAEGTVIDVHLVIDPWTRESRGFGFVTMSTVEE  103

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            AD CIKYL+RSVLEGRVITVEK 
Sbjct  104  ADHCIKYLDRSVLEGRVITVEKA  126



>ref|XP_011032161.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X1 [Populus euphratica]
 ref|XP_011032162.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X1 [Populus euphratica]
 ref|XP_011032163.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X1 [Populus euphratica]
Length=393

 Score =   147 bits (371),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D ENPGNNLYVTGLS R+ +K+LEKHFS+EG V DVHLVIDPWTRESRGF FVTMS +E+
Sbjct  46   DVENPGNNLYVTGLSPRITKKELEKHFSAEGTVIDVHLVIDPWTRESRGFGFVTMSTVEE  105

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            AD CIKYL+RSVLEGRVITVEK 
Sbjct  106  ADHCIKYLDRSVLEGRVITVEKA  128



>ref|XP_008785439.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Phoenix 
dactylifera]
Length=365

 Score =   146 bits (369),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D ENPGNNLYVTGLS+R+ + DLEKHF+SEGKV DVHLV+DPWTRESRGF FVTM  +E+
Sbjct  43   DVENPGNNLYVTGLSSRLTKNDLEKHFASEGKVIDVHLVVDPWTRESRGFGFVTMDTVEE  102

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+RCIKYL+RSVLEGRVITVEK 
Sbjct  103  ANRCIKYLDRSVLEGRVITVEKA  125



>ref|XP_010521922.1| PREDICTED: serine/arginine-rich splicing factor SR45a isoform 
X3 [Tarenaya hassleriana]
Length=128

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DAENPGN+LYVTGLS RV ++DLE HFS EGKV DV+LV+DPWTRESRGF FVTM  +ED
Sbjct  38   DAENPGNSLYVTGLSHRVTKRDLEDHFSKEGKVVDVNLVLDPWTRESRGFGFVTMENMED  97

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            A+RCIKYL+RSVLEGR+ITVEK
Sbjct  98   ANRCIKYLDRSVLEGRIITVEK  119



>gb|EYU45746.1| hypothetical protein MIMGU_mgv1a008547mg [Erythranthe guttata]
Length=370

 Score =   146 bits (369),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DAENPGNNLYVTGL +RV ++D+EKHFS+EGKVE+VHLVIDP TRESRGF FVTMS LE+
Sbjct  39   DAENPGNNLYVTGLPSRVTKRDIEKHFSTEGKVENVHLVIDPRTRESRGFGFVTMSTLEE  98

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            ADRCIKYL+R+V EGRVITVEK 
Sbjct  99   ADRCIKYLDRTVFEGRVITVEKA  121



>gb|KCW52572.1| hypothetical protein EUGRSUZ_J01947 [Eucalyptus grandis]
Length=338

 Score =   145 bits (366),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D ENPGNNLYVTGLS R+ +++LEKHF+SEGKV DVHLV+DPWTRESRGF FVTMS +E+
Sbjct  40   DVENPGNNLYVTGLSPRITKRELEKHFASEGKVVDVHLVVDPWTRESRGFGFVTMSTVEE  99

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+RCIKYL+RSVLEGRVITVEK 
Sbjct  100  AERCIKYLDRSVLEGRVITVEKA  122



>ref|XP_004241182.1| PREDICTED: serine/arginine-rich splicing factor SR45a [Solanum 
lycopersicum]
Length=386

 Score =   146 bits (368),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = +3

Query  231  ENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDAD  410
            ENPGNNLYVTGLSTRV+++D+EKHFS+EGKVEDV LV+DPWT ESRGF FVTMS +E+AD
Sbjct  42   ENPGNNLYVTGLSTRVKERDIEKHFSAEGKVEDVRLVLDPWTHESRGFGFVTMSSVEEAD  101

Query  411  RCIKYLNRSVLEGRVITVEKV  473
            RCIK LNRS+LEGRVITVEK 
Sbjct  102  RCIKSLNRSILEGRVITVEKA  122



>ref|XP_002314126.1| transformer serine/arginine-rich ribonucleoprotein [Populus trichocarpa]
 gb|EEE88081.1| transformer serine/arginine-rich ribonucleoprotein [Populus trichocarpa]
Length=316

 Score =   144 bits (364),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D ENPGNNLYVTGLS R+ +K+LEKHFS+EG V DVHLV+DPWTRESRGF FVTMS +E+
Sbjct  46   DVENPGNNLYVTGLSPRITKKELEKHFSAEGTVIDVHLVVDPWTRESRGFGFVTMSTVEE  105

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            AD CIKYL+RSVLEGRVITVEK 
Sbjct  106  ADHCIKYLDRSVLEGRVITVEKA  128



>ref|XP_009380617.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=342

 Score =   144 bits (364),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +3

Query  228  AENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDA  407
            A+NPGNNLYVTG+S+RV + +LEKHF+SEGKV DVHLV+DPWTRESRGF FVTMS +E+A
Sbjct  48   AKNPGNNLYVTGISSRVTKDELEKHFASEGKVVDVHLVVDPWTRESRGFGFVTMSTIEEA  107

Query  408  DRCIKYLNRSVLEGRVITVEKV  473
            D CI+YLNRSVLEGRVITVEK 
Sbjct  108  DSCIQYLNRSVLEGRVITVEKA  129



>ref|XP_009380616.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=357

 Score =   145 bits (365),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +3

Query  228  AENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDA  407
            A+NPGNNLYVTG+S+RV + +LEKHF+SEGKV DVHLV+DPWTRESRGF FVTMS +E+A
Sbjct  48   AKNPGNNLYVTGISSRVTKDELEKHFASEGKVVDVHLVVDPWTRESRGFGFVTMSTIEEA  107

Query  408  DRCIKYLNRSVLEGRVITVEKV  473
            D CI+YLNRSVLEGRVITVEK 
Sbjct  108  DSCIQYLNRSVLEGRVITVEKA  129



>ref|XP_006425006.1| hypothetical protein CICLE_v10028652mg [Citrus clementina]
 ref|XP_006488466.1| PREDICTED: uncharacterized RNA-binding protein C25G10.01-like 
isoform X1 [Citrus sinensis]
 gb|ESR38246.1| hypothetical protein CICLE_v10028652mg [Citrus clementina]
Length=381

 Score =   145 bits (366),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DAENPGNNLYVTGLS R+ +++LEKHF++EGKV DVHLV+DPWTRESRGF FVTM+ +E+
Sbjct  38   DAENPGNNLYVTGLSPRITKRELEKHFAAEGKVIDVHLVVDPWTRESRGFGFVTMATVEE  97

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            ADRCIKYL+RSVLEGR+ITVE+ 
Sbjct  98   ADRCIKYLDRSVLEGRIITVERA  120



>gb|KDO66764.1| hypothetical protein CISIN_1g016540mg [Citrus sinensis]
Length=387

 Score =   145 bits (365),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DAENPGNNLYVTGLS R+ +++LEKHF++EGKV DVHLV+DPWTRESRGF FVTM+ +E+
Sbjct  38   DAENPGNNLYVTGLSPRITKRELEKHFAAEGKVIDVHLVVDPWTRESRGFGFVTMATVEE  97

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            ADRCIKYL+RSVLEGR+ITVE+ 
Sbjct  98   ADRCIKYLDRSVLEGRIITVERA  120



>emb|CBI34365.3| unnamed protein product [Vitis vinifera]
Length=133

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DA NPGNNLYVTGLSTRV   DLEK+F+SEGKV + HLV DP TRESRGF FVTM  +ED
Sbjct  48   DAVNPGNNLYVTGLSTRVNASDLEKYFNSEGKVVECHLVTDPRTRESRGFGFVTMETVED  107

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            ADRCIKYLNRSVLEGR+ITVEKV
Sbjct  108  ADRCIKYLNRSVLEGRLITVEKV  130



>ref|XP_011035209.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X4 [Populus euphratica]
Length=155

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D ENPGNNLYVTGLS R+ +K+LEKHF++EG V DVHLV+DP TRESRGF FVTMS +E+
Sbjct  38   DVENPGNNLYVTGLSPRITKKELEKHFAAEGTVIDVHLVVDPLTRESRGFGFVTMSAVEE  97

Query  405  ADRCIKYLNRSVLEGRVITVEKVN  476
            ADRCIKYL+RSVL GRVITVEK  
Sbjct  98   ADRCIKYLDRSVLGGRVITVEKAK  121



>ref|XP_004500218.1| PREDICTED: pre-mRNA-splicing factor cwc22-like [Cicer arietinum]
Length=359

 Score =   144 bits (363),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DAENPGNNLYVTGLS R+ +++LEKHF++EGKV DVHLV+DPWTR SRGF FVTM  LE+
Sbjct  44   DAENPGNNLYVTGLSPRITKRELEKHFAAEGKVIDVHLVVDPWTRASRGFGFVTMETLEE  103

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            ADRC+KYL+RSVLEGRVI VEK 
Sbjct  104  ADRCVKYLDRSVLEGRVIMVEKA  126



>ref|XP_010256685.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Nelumbo 
nucifera]
Length=319

 Score =   142 bits (359),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +3

Query  231  ENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDAD  410
            ENPGNNLYVTG+S R+ +K+LEKHFSSEG V DVHL++DPWTRESRGF FVTMS +++AD
Sbjct  44   ENPGNNLYVTGISPRITKKELEKHFSSEGTVIDVHLIVDPWTRESRGFGFVTMSTVQEAD  103

Query  411  RCIKYLNRSVLEGRVITVEKV  473
            RCIKYL+RSVLEGRVITVEK 
Sbjct  104  RCIKYLDRSVLEGRVITVEKA  124



>gb|ABW81106.1| putRNAbp29 [Cleome spinosa]
Length=338

 Score =   143 bits (360),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DAENPGN+LYVTGLS RV ++DLE HFS EGKV DV+LV+DPWTRESRGF FVTM  +ED
Sbjct  38   DAENPGNSLYVTGLSHRVTKRDLEDHFSKEGKVVDVNLVLDPWTRESRGFGFVTMENMED  97

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+RCIKYL+RSVLEGR+ITVEK 
Sbjct  98   ANRCIKYLDRSVLEGRIITVEKA  120



>ref|XP_002304510.1| hypothetical protein POPTR_0003s13030g [Populus trichocarpa]
 gb|EEE79489.1| hypothetical protein POPTR_0003s13030g [Populus trichocarpa]
Length=208

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DA NPGNNLYVTGLSTRV   DLEK+FSSEGKV + HLV DP TRESRGFAFVTM  +ED
Sbjct  42   DASNPGNNLYVTGLSTRVTSSDLEKYFSSEGKVLECHLVTDPRTRESRGFAFVTMETVED  101

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+RC+KYLNRSVLEGRVITVEK 
Sbjct  102  ANRCVKYLNRSVLEGRVITVEKA  124



>ref|XP_010521921.1| PREDICTED: serine/arginine-rich splicing factor SR45a isoform 
X2 [Tarenaya hassleriana]
Length=367

 Score =   143 bits (361),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DAENPGN+LYVTGLS RV ++DLE HFS EGKV DV+LV+DPWTRESRGF FVTM  +ED
Sbjct  38   DAENPGNSLYVTGLSHRVTKRDLEDHFSKEGKVVDVNLVLDPWTRESRGFGFVTMENMED  97

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+RCIKYL+RSVLEGR+ITVEK 
Sbjct  98   ANRCIKYLDRSVLEGRIITVEKA  120



>gb|ACN26118.1| unknown [Zea mays]
 gb|AFW88868.1| hypothetical protein ZEAMMB73_204329 [Zea mays]
Length=315

 Score =   142 bits (357),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DAENPGNNLYVTGLS RV  +DLEKHFS+EG+V D  +V DPWTRESRGF FVTM+ ++D
Sbjct  34   DAENPGNNLYVTGLSARVTDRDLEKHFSTEGEVIDASVVYDPWTRESRGFGFVTMAAVKD  93

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            ADRCIKYL+RSVL+GRVITVEK 
Sbjct  94   ADRCIKYLDRSVLQGRVITVEKA  116



>ref|XP_008787412.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Phoenix 
dactylifera]
 ref|XP_008787413.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Phoenix 
dactylifera]
Length=196

 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DA NPGNNLYVTGLSTRV   DLEK+FS+EG+V++ H+V+DP T+ESRGF FVTM  LED
Sbjct  43   DARNPGNNLYVTGLSTRVTSSDLEKYFSNEGRVQECHVVMDPRTKESRGFGFVTMETLED  102

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            ADRC+KYLNRSVLEGR+ITVEK 
Sbjct  103  ADRCVKYLNRSVLEGRLITVEKA  125



>ref|XP_006649804.1| PREDICTED: scaffold attachment factor B2-like isoform X2 [Oryza 
brachyantha]
Length=126

 Score =   136 bits (342),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D ENPGNNLYVTGLS RV  +DLEKHFS+EG+V D  +V+DPWTRESRGF FVTM+ +E+
Sbjct  38   DVENPGNNLYVTGLSARVTDRDLEKHFSTEGEVIDASIVLDPWTRESRGFGFVTMATVEE  97

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A RCIKYL+ SVLEGRVITVEK+
Sbjct  98   AGRCIKYLDHSVLEGRVITVEKL  120



>ref|XP_010262758.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X2 [Nelumbo nucifera]
Length=340

 Score =   142 bits (358),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 75/85 (88%), Gaps = 1/85 (1%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEG-KVEDVHLVIDPWTRESRGFAFVTMSKLE  401
            + ENPGNNLYVTGLS R+ +K+LEKHF+SEG  V DVHLV+DPWTRESRGF FVTMS +E
Sbjct  43   EVENPGNNLYVTGLSPRITKKELEKHFTSEGGTVIDVHLVVDPWTRESRGFGFVTMSTVE  102

Query  402  DADRCIKYLNRSVLEGRVITVEKVN  476
            +ADRCIKYLNRSVLEGRVITVEK  
Sbjct  103  EADRCIKYLNRSVLEGRVITVEKAK  127



>ref|XP_010262757.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X1 [Nelumbo nucifera]
Length=341

 Score =   142 bits (358),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 75/85 (88%), Gaps = 1/85 (1%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEG-KVEDVHLVIDPWTRESRGFAFVTMSKLE  401
            + ENPGNNLYVTGLS R+ +K+LEKHF+SEG  V DVHLV+DPWTRESRGF FVTMS +E
Sbjct  44   EVENPGNNLYVTGLSPRITKKELEKHFTSEGGTVIDVHLVVDPWTRESRGFGFVTMSTVE  103

Query  402  DADRCIKYLNRSVLEGRVITVEKVN  476
            +ADRCIKYLNRSVLEGRVITVEK  
Sbjct  104  EADRCIKYLNRSVLEGRVITVEKAK  128



>ref|XP_007016197.1| RNA-binding family protein isoform 4 [Theobroma cacao]
 gb|EOY33816.1| RNA-binding family protein isoform 4 [Theobroma cacao]
Length=385

 Score =   143 bits (360),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D ENPGNNLYVTGLS R+ +++LEKHF+SEG V DVHLV+DPWTRESRGF FVTM+  E+
Sbjct  40   DVENPGNNLYVTGLSPRITKRELEKHFASEGNVIDVHLVVDPWTRESRGFGFVTMATNEE  99

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+RCIKYLNRSVLEGRVITVEK 
Sbjct  100  AERCIKYLNRSVLEGRVITVEKA  122



>ref|XP_010521920.1| PREDICTED: serine/arginine-rich splicing factor SR45a isoform 
X1 [Tarenaya hassleriana]
Length=370

 Score =   142 bits (359),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DAENPGN+LYVTGLS RV ++DLE HFS EGKV DV+LV+DPWTRESRGF FVTM  +ED
Sbjct  38   DAENPGNSLYVTGLSHRVTKRDLEDHFSKEGKVVDVNLVLDPWTRESRGFGFVTMENMED  97

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+RCIKYL+RSVLEGR+ITVEK 
Sbjct  98   ANRCIKYLDRSVLEGRIITVEKA  120



>ref|XP_006827527.1| hypothetical protein AMTR_s00009p00202570 [Amborella trichopoda]
 gb|ERM94943.1| hypothetical protein AMTR_s00009p00202570 [Amborella trichopoda]
Length=300

 Score =   141 bits (355),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DA+NPGNNLY+TGLSTRV  ++LE+HF SEGKV + HLV+DP TRESRGF FVTM  +ED
Sbjct  33   DAQNPGNNLYITGLSTRVTTRELERHFQSEGKVLECHLVVDPRTRESRGFGFVTMETIED  92

Query  405  ADRCIKYLNRSVLEGRVITVEKVN  476
            ADRCIKYLNRSVLEGRVI VEKV+
Sbjct  93   ADRCIKYLNRSVLEGRVIAVEKVD  116



>ref|XP_011022643.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Populus 
euphratica]
Length=209

 Score =   138 bits (348),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DA NPGNNLYVTGLSTRV   DLEK+FSSEGKV + HLV DP TRESRGFAFVTM  +ED
Sbjct  42   DASNPGNNLYVTGLSTRVTSSDLEKYFSSEGKVLECHLVTDPRTRESRGFAFVTMETVED  101

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+RC+KYLNRSVLEGRV+TVEK 
Sbjct  102  ANRCVKYLNRSVLEGRVVTVEKA  124



>ref|XP_008220282.1| PREDICTED: serine/arginine repetitive matrix protein 2-like [Prunus 
mume]
Length=391

 Score =   142 bits (359),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +3

Query  231  ENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDAD  410
            ENPGNNLYVTGLS R+ +++LEKHF+SEGKV DVHLV+DPWTRESRGF FVTM  +++AD
Sbjct  39   ENPGNNLYVTGLSPRITKRELEKHFASEGKVIDVHLVVDPWTRESRGFGFVTMENVDEAD  98

Query  411  RCIKYLNRSVLEGRVITVEKV  473
            RCIKYL+RSVLEGRVITVE+ 
Sbjct  99   RCIKYLDRSVLEGRVITVERA  119



>ref|XP_007016194.1| RNA-binding family protein isoform 1 [Theobroma cacao]
 gb|EOY33813.1| RNA-binding family protein isoform 1 [Theobroma cacao]
Length=390

 Score =   142 bits (359),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D ENPGNNLYVTGLS R+ +++LEKHF+SEG V DVHLV+DPWTRESRGF FVTM+  E+
Sbjct  40   DVENPGNNLYVTGLSPRITKRELEKHFASEGNVIDVHLVVDPWTRESRGFGFVTMATNEE  99

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+RCIKYLNRSVLEGRVITVEK 
Sbjct  100  AERCIKYLNRSVLEGRVITVEKF  122



>ref|XP_006476526.1| PREDICTED: uncharacterized RNA-binding protein C25G10.01-like 
isoform X3 [Citrus sinensis]
Length=156

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DA NPGNNLYVTGLSTRV   DLEK F  EGKV + HLV DP TRESRGFAFVTM  +E 
Sbjct  44   DAANPGNNLYVTGLSTRVTNADLEKFFGGEGKVTECHLVTDPRTRESRGFAFVTMETVEG  103

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            ADRCIKYLNRSVLEGR+ITVEK 
Sbjct  104  ADRCIKYLNRSVLEGRLITVEKA  126



>ref|NP_001049650.1| Os03g0265600 [Oryza sativa Japonica Group]
 dbj|BAF11564.1| Os03g0265600 [Oryza sativa Japonica Group]
Length=125

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +3

Query  231  ENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDAD  410
            ENPGNNLYVTGLS RV  +DLEKHFS+EG+V D  +V+DPWTRESRGF FVTM+ +++AD
Sbjct  39   ENPGNNLYVTGLSARVTDRDLEKHFSAEGEVIDASIVLDPWTRESRGFGFVTMATVKEAD  98

Query  411  RCIKYLNRSVLEGRVITVEKV  473
             CIKYL+RSVLEGRVITVEK+
Sbjct  99   LCIKYLDRSVLEGRVITVEKL  119



>ref|XP_008779363.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Phoenix 
dactylifera]
 ref|XP_008779371.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Phoenix 
dactylifera]
 ref|XP_008779376.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Phoenix 
dactylifera]
Length=203

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +3

Query  228  AENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDA  407
            A+NPGNNLYVTGLSTRV   DLEK+FS EG+V++ H+V+DP TRESRGF FVTM  LEDA
Sbjct  44   AKNPGNNLYVTGLSTRVTSSDLEKYFSKEGRVQECHVVMDPRTRESRGFGFVTMETLEDA  103

Query  408  DRCIKYLNRSVLEGRVITVEKV  473
            DRC+KYLNRSVLEGR+ITVEK 
Sbjct  104  DRCVKYLNRSVLEGRLITVEKA  125



>ref|XP_004984683.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X2 [Setaria italica]
Length=331

 Score =   140 bits (354),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DAENPGNNLYVTGLS RV  +DLEKHFS+EG+V D  +V DPWTRESRGF FVTM+ +++
Sbjct  34   DAENPGNNLYVTGLSARVTDQDLEKHFSTEGEVIDASIVHDPWTRESRGFGFVTMATVKE  93

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            ADRCIKYL+RSVLEGRVITVEK 
Sbjct  94   ADRCIKYLDRSVLEGRVITVEKA  116



>ref|XP_010923140.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Elaeis 
guineensis]
Length=363

 Score =   140 bits (354),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DAENPGNNLYVTGLS+R+ + DLEKHF+SEGKV DVHLV+DPWTRESRGF FVTM  +++
Sbjct  43   DAENPGNNLYVTGLSSRLTKDDLEKHFASEGKVIDVHLVVDPWTRESRGFGFVTMDTVKE  102

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+RCIK L+RSVLEGRVITVEK 
Sbjct  103  ANRCIKCLDRSVLEGRVITVEKA  125



>ref|XP_004294256.1| PREDICTED: uncharacterized protein LOC101294250 [Fragaria vesca 
subsp. vesca]
Length=363

 Score =   140 bits (354),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +3

Query  231  ENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDAD  410
            ENPGNNLYVTGLS R+ +++LEKHF+SEGKV DVHLV+DPWTRESRGF FVTM  +  AD
Sbjct  48   ENPGNNLYVTGLSPRITRRELEKHFASEGKVIDVHLVVDPWTRESRGFGFVTMENVNVAD  107

Query  411  RCIKYLNRSVLEGRVITVEKV  473
            RCIKYL+RSVLEGRVITVEK 
Sbjct  108  RCIKYLDRSVLEGRVITVEKA  128



>ref|XP_010940583.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Elaeis 
guineensis]
 ref|XP_010940585.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Elaeis 
guineensis]
Length=203

 Score =   136 bits (342),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DA+NPGNNLYVTGLSTRV   +LEK+FS EG+V++ H+V+DP TRESRGF FVTM  LE 
Sbjct  43   DAKNPGNNLYVTGLSTRVTSSELEKYFSKEGRVQECHVVMDPRTRESRGFGFVTMETLEG  102

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            ADRCIKYLNRSVLEGR+ITVEK 
Sbjct  103  ADRCIKYLNRSVLEGRLITVEKA  125



>ref|XP_004984682.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X1 [Setaria italica]
Length=373

 Score =   140 bits (353),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DAENPGNNLYVTGLS RV  +DLEKHFS+EG+V D  +V DPWTRESRGF FVTM+ +++
Sbjct  76   DAENPGNNLYVTGLSARVTDQDLEKHFSTEGEVIDASIVHDPWTRESRGFGFVTMATVKE  135

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            ADRCIKYL+RSVLEGRVITVEK 
Sbjct  136  ADRCIKYLDRSVLEGRVITVEKA  158



>ref|XP_002279684.1| PREDICTED: serine/arginine-rich splicing factor SR45a [Vitis 
vinifera]
Length=211

 Score =   136 bits (342),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DA NPGNNLYVTGLSTRV   DLEK+F+SEGKV + HLV DP TRESRGF FVTM  +ED
Sbjct  48   DAVNPGNNLYVTGLSTRVNASDLEKYFNSEGKVVECHLVTDPRTRESRGFGFVTMETVED  107

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            ADRCIKYLNRSVLEGR+ITVEK 
Sbjct  108  ADRCIKYLNRSVLEGRLITVEKA  130



>dbj|BAJ89187.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=126

 Score =   133 bits (334),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +3

Query  231  ENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDAD  410
            ENPGNNL+VTGLS+R+  +DLEKHFS+EG+V D  +V+DPWTRESRGF FVTM+ L++A+
Sbjct  40   ENPGNNLFVTGLSSRLTDRDLEKHFSTEGEVIDASIVLDPWTRESRGFGFVTMANLKEAE  99

Query  411  RCIKYLNRSVLEGRVITVEKV  473
            RCIKYL+ SVLEGRVITVEK+
Sbjct  100  RCIKYLDSSVLEGRVITVEKI  120



>ref|XP_001757377.1| predicted protein [Physcomitrella patens]
 gb|EDQ77862.1| predicted protein [Physcomitrella patens]
Length=113

 Score =   132 bits (333),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DA NPGNNLYVTGLSTRV +KDL +HFS EGKV +  LV+DP TRESRGF FVTM  LED
Sbjct  32   DALNPGNNLYVTGLSTRVNEKDLLEHFSQEGKVLECRLVLDPRTRESRGFGFVTMEHLED  91

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            A+RCIKYLNRS LEGR+ITVEK
Sbjct  92   AERCIKYLNRSTLEGRIITVEK  113



>ref|XP_009337333.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X4 [Pyrus x bretschneideri]
Length=394

 Score =   140 bits (352),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +3

Query  231  ENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDAD  410
            ENPGNNLYVTGLS RV +++LEKHF++EGKV DVHLV+DPWTRESRGF FVTM  +++A+
Sbjct  35   ENPGNNLYVTGLSPRVTKRELEKHFAAEGKVTDVHLVVDPWTRESRGFGFVTMENVDEAE  94

Query  411  RCIKYLNRSVLEGRVITVEKV  473
            RCIKYL+ SVLEGRVITVEK 
Sbjct  95   RCIKYLDGSVLEGRVITVEKA  115



>ref|XP_009337331.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X2 [Pyrus x bretschneideri]
Length=396

 Score =   140 bits (352),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +3

Query  231  ENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDAD  410
            ENPGNNLYVTGLS RV +++LEKHF++EGKV DVHLV+DPWTRESRGF FVTM  +++A+
Sbjct  37   ENPGNNLYVTGLSPRVTKRELEKHFAAEGKVTDVHLVVDPWTRESRGFGFVTMENVDEAE  96

Query  411  RCIKYLNRSVLEGRVITVEKV  473
            RCIKYL+ SVLEGRVITVEK 
Sbjct  97   RCIKYLDGSVLEGRVITVEKA  117



>ref|XP_001756218.1| predicted protein [Physcomitrella patens]
 gb|EDQ79084.1| predicted protein [Physcomitrella patens]
Length=158

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DA NPGNNLYVTGLSTRV +KDL++HFS EGKV +  LV+DP TRESRGF FVTM   +D
Sbjct  11   DATNPGNNLYVTGLSTRVTEKDLDEHFSREGKVVECRLVVDPRTRESRGFGFVTMDNADD  70

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            ADRC+KYLNRS LEGR+ITVEK 
Sbjct  71   ADRCVKYLNRSTLEGRIITVEKA  93



>ref|XP_002299830.2| hypothetical protein POPTR_0001s25520g [Populus trichocarpa]
 gb|EEE84635.2| hypothetical protein POPTR_0001s25520g [Populus trichocarpa]
Length=344

 Score =   139 bits (349),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D ENPGNNLYVTGLS R+ +K+LEKHF++EG V DVHLV+DP TRESRGF FVTMS +E+
Sbjct  38   DVENPGNNLYVTGLSPRITKKELEKHFAAEGTVIDVHLVVDPLTRESRGFGFVTMSAVEE  97

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            ADRCIKYL+RSVL GRVITVEK 
Sbjct  98   ADRCIKYLDRSVLGGRVITVEKA  120



>ref|XP_006476524.1| PREDICTED: uncharacterized RNA-binding protein C25G10.01-like 
isoform X1 [Citrus sinensis]
Length=213

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DA NPGNNLYVTGLSTRV   DLEK F  EGKV + HLV DP TRESRGFAFVTM  +E 
Sbjct  44   DAANPGNNLYVTGLSTRVTNADLEKFFGGEGKVTECHLVTDPRTRESRGFAFVTMETVEG  103

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            ADRCIKYLNRSVLEGR+ITVEK 
Sbjct  104  ADRCIKYLNRSVLEGRLITVEKA  126



>ref|XP_006476525.1| PREDICTED: uncharacterized RNA-binding protein C25G10.01-like 
isoform X2 [Citrus sinensis]
Length=201

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DA NPGNNLYVTGLSTRV   DLEK F  EGKV + HLV DP TRESRGFAFVTM  +E 
Sbjct  32   DAANPGNNLYVTGLSTRVTNADLEKFFGGEGKVTECHLVTDPRTRESRGFAFVTMETVEG  91

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            ADRCIKYLNRSVLEGR+ITVEK 
Sbjct  92   ADRCIKYLNRSVLEGRLITVEKA  114



>ref|XP_002509834.1| Arginine/serine-rich-splicing factor, putative [Ricinus communis]
 gb|EEF51221.1| Arginine/serine-rich-splicing factor, putative [Ricinus communis]
Length=204

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DA NPGNNLYVTGLSTRV   DLEK+F  EGKV + HLV DP TRESRGFAFVTM  LED
Sbjct  41   DAANPGNNLYVTGLSTRVTTGDLEKYFGKEGKVLECHLVTDPRTRESRGFAFVTMETLED  100

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+RC+KYLNRSVLEGR+ITVEK 
Sbjct  101  AERCVKYLNRSVLEGRLITVEKA  123



>ref|XP_010255285.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Nelumbo 
nucifera]
Length=206

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DA NPGNNLYVTGLSTRV   DLEK+FS EGKV + HLV DP TRESRGF FVTM  LED
Sbjct  43   DAANPGNNLYVTGLSTRVTTNDLEKYFSREGKVVECHLVTDPRTRESRGFGFVTMETLED  102

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            ADRCIKYL+RSVLEGR+ITV+K 
Sbjct  103  ADRCIKYLDRSVLEGRLITVQKA  125



>ref|XP_009337332.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X3 [Pyrus x bretschneideri]
Length=396

 Score =   139 bits (350),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +3

Query  231  ENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDAD  410
            ENPGNNLYVTGLS RV +++LEKHF++EGKV DVHLV+DPWTRESRGF FVTM  +++A+
Sbjct  37   ENPGNNLYVTGLSPRVTKRELEKHFAAEGKVTDVHLVVDPWTRESRGFGFVTMENVDEAE  96

Query  411  RCIKYLNRSVLEGRVITVEKV  473
            RCIKYL+ SVLEGRVITVEK 
Sbjct  97   RCIKYLDGSVLEGRVITVEKA  117



>ref|XP_009337328.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009337329.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X1 [Pyrus x bretschneideri]
Length=398

 Score =   139 bits (350),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +3

Query  231  ENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDAD  410
            ENPGNNLYVTGLS RV +++LEKHF++EGKV DVHLV+DPWTRESRGF FVTM  +++A+
Sbjct  39   ENPGNNLYVTGLSPRVTKRELEKHFAAEGKVTDVHLVVDPWTRESRGFGFVTMENVDEAE  98

Query  411  RCIKYLNRSVLEGRVITVEKV  473
            RCIKYL+ SVLEGRVITVEK 
Sbjct  99   RCIKYLDGSVLEGRVITVEKA  119



>ref|XP_001778182.1| predicted protein [Physcomitrella patens]
 gb|EDQ56964.1| predicted protein [Physcomitrella patens]
Length=172

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D  NPGNNLYVTGLSTRV +KDL++HFS EGKV +  LV+DP TRESRGF FVTM  LED
Sbjct  7    DINNPGNNLYVTGLSTRVNEKDLQEHFSREGKVLECRLVLDPRTRESRGFGFVTMEHLED  66

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+RCIKYLNRS LEGR+ITVEK 
Sbjct  67   AERCIKYLNRSTLEGRMITVEKA  89



>ref|XP_008384864.1| PREDICTED: pre-mRNA-splicing factor cwc22 isoform X2 [Malus domestica]
Length=400

 Score =   139 bits (350),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +3

Query  231  ENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDAD  410
            ENPGNNLYVTGLS RV +++LEKHF++EGKV DVHLV+DPWTRESRGF FVTM  +++A+
Sbjct  37   ENPGNNLYVTGLSPRVTKRELEKHFAAEGKVTDVHLVVDPWTRESRGFGFVTMENVDEAE  96

Query  411  RCIKYLNRSVLEGRVITVEKV  473
            RCIKYL+ SVLEGRVITVEK 
Sbjct  97   RCIKYLDGSVLEGRVITVEKA  117



>gb|KDP25408.1| hypothetical protein JCGZ_20564 [Jatropha curcas]
Length=205

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            +A NPGNNLYVTGLSTRV   DLEK+F  EGKV + HLV DP TRESRGFAFVTM  +ED
Sbjct  42   EAANPGNNLYVTGLSTRVTTSDLEKYFGKEGKVLECHLVTDPRTRESRGFAFVTMETVED  101

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+RCIKYLNRSVLEGR+ITVEK 
Sbjct  102  AERCIKYLNRSVLEGRLITVEKA  124



>ref|XP_011035207.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X3 [Populus euphratica]
Length=348

 Score =   138 bits (347),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D ENPGNNLYVTGLS R+ +K+LEKHF++EG V DVHLV+DP TRESRGF FVTMS +E+
Sbjct  38   DVENPGNNLYVTGLSPRITKKELEKHFAAEGTVIDVHLVVDPLTRESRGFGFVTMSAVEE  97

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            ADRCIKYL+RSVL GRVITVEK 
Sbjct  98   ADRCIKYLDRSVLGGRVITVEKA  120



>ref|XP_006439504.1| hypothetical protein CICLE_v10021507mg [Citrus clementina]
 ref|XP_006439509.1| hypothetical protein CICLE_v10021507mg [Citrus clementina]
 gb|ESR52744.1| hypothetical protein CICLE_v10021507mg [Citrus clementina]
 gb|ESR52749.1| hypothetical protein CICLE_v10021507mg [Citrus clementina]
Length=202

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DA NPGNNLYVTGLSTRV   DLEK F  EGKV + HLV DP TRES GFAFVTM  +E 
Sbjct  32   DAANPGNNLYVTGLSTRVTNADLEKFFGGEGKVTECHLVTDPRTRESCGFAFVTMETVEG  91

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            ADRCIKYLNRSVLEGR+ITVEKV
Sbjct  92   ADRCIKYLNRSVLEGRLITVEKV  114



>gb|AAP06839.1| putative transformer serine/arginine-rich ribonucleoprotein [Oryza 
sativa Japonica Group]
 gb|EAZ26366.1| hypothetical protein OsJ_10248 [Oryza sativa Japonica Group]
Length=324

 Score =   137 bits (344),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D ENPGNNLYVTGLS RV  +DLEKHFS+EG+V D  +V+DPWTRESRGF FVTM+ +++
Sbjct  14   DVENPGNNLYVTGLSARVTDRDLEKHFSAEGEVIDASIVLDPWTRESRGFGFVTMATVKE  73

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            AD CIKYL+RSVLEGRVITVEK 
Sbjct  74   ADLCIKYLDRSVLEGRVITVEKA  96



>ref|XP_008384865.1| PREDICTED: pre-mRNA-splicing factor cwc22 isoform X3 [Malus domestica]
Length=400

 Score =   138 bits (348),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +3

Query  231  ENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDAD  410
            ENPGNNLYVTGLS RV +++LEKHF++EGKV DVHLV+DPWTRESRGF FVTM  +++A+
Sbjct  37   ENPGNNLYVTGLSPRVTKRELEKHFAAEGKVTDVHLVVDPWTRESRGFGFVTMENVDEAE  96

Query  411  RCIKYLNRSVLEGRVITVEKV  473
            RCIKYL+ SVLEGRVITVEK 
Sbjct  97   RCIKYLDGSVLEGRVITVEKA  117



>ref|XP_008384862.1| PREDICTED: pre-mRNA-splicing factor cwc22 isoform X1 [Malus domestica]
Length=402

 Score =   138 bits (348),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +3

Query  231  ENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDAD  410
            ENPGNNLYVTGLS RV +++LEKHF++EGKV DVHLV+DPWTRESRGF FVTM  +++A+
Sbjct  39   ENPGNNLYVTGLSPRVTKRELEKHFAAEGKVTDVHLVVDPWTRESRGFGFVTMENVDEAE  98

Query  411  RCIKYLNRSVLEGRVITVEKV  473
            RCIKYL+ SVLEGRVITVEK 
Sbjct  99   RCIKYLDGSVLEGRVITVEKA  119



>ref|XP_009375026.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X4 [Pyrus x bretschneideri]
 ref|XP_009375036.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X4 [Pyrus x bretschneideri]
Length=147

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DA NPGNNLYVTGLSTRV   DLEK F+ +GKV D HLV DP TRESRGF FVTM  +ED
Sbjct  42   DASNPGNNLYVTGLSTRVTSTDLEKFFNKQGKVLDCHLVTDPRTRESRGFGFVTMETVED  101

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+RCIKYL+RSVLEGR+ITVEK 
Sbjct  102  AERCIKYLDRSVLEGRLITVEKA  124



>ref|NP_849605.1| serine/arginine rich-like protein SR45a [Arabidopsis thaliana]
 gb|AAK96648.1| At1g07350/F22G5_25 [Arabidopsis thaliana]
 gb|AEE28113.1| serine/arginine rich-like protein SR45a [Arabidopsis thaliana]
Length=129

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DAENPGN+LYVTGLS RV ++DLE HF+ EGKV DVHLV+DPWTRESRGF F++M  + D
Sbjct  39   DAENPGNSLYVTGLSHRVTERDLEDHFAKEGKVTDVHLVLDPWTRESRGFGFISMKSVGD  98

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            A+RCI+ L+ SVL+GRVITVEK
Sbjct  99   ANRCIRSLDHSVLQGRVITVEK  120



>gb|EAY89362.1| hypothetical protein OsI_10866 [Oryza sativa Indica Group]
Length=324

 Score =   137 bits (344),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D ENPGNNLYVTGLS RV  +DLEKHFS+EG+V D  +V+DPWTRESRGF FVTM+ +++
Sbjct  14   DVENPGNNLYVTGLSARVTDRDLEKHFSAEGEVIDASIVLDPWTRESRGFGFVTMATVKE  73

Query  405  ADRCIKYLNRSVLEGRVITVEKVN  476
            AD CIKYL+RSVLEGRVITVEK  
Sbjct  74   ADLCIKYLDRSVLEGRVITVEKAK  97



>ref|XP_011035206.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X2 [Populus euphratica]
Length=357

 Score =   137 bits (346),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D ENPGNNLYVTGLS R+ +K+LEKHF++EG V DVHLV+DP TRESRGF FVTMS +E+
Sbjct  38   DVENPGNNLYVTGLSPRITKKELEKHFAAEGTVIDVHLVVDPLTRESRGFGFVTMSAVEE  97

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            ADRCIKYL+RSVL GRVITVEK 
Sbjct  98   ADRCIKYLDRSVLGGRVITVEKA  120



>ref|XP_006649803.1| PREDICTED: scaffold attachment factor B2-like isoform X1 [Oryza 
brachyantha]
Length=340

 Score =   137 bits (345),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D ENPGNNLYVTGLS RV  +DLEKHFS+EG+V D  +V+DPWTRESRGF FVTM+ +E+
Sbjct  38   DVENPGNNLYVTGLSARVTDRDLEKHFSTEGEVIDASIVLDPWTRESRGFGFVTMATVEE  97

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A RCIKYL+ SVLEGRVITVEK 
Sbjct  98   AGRCIKYLDHSVLEGRVITVEKA  120



>ref|XP_006439505.1| hypothetical protein CICLE_v10021507mg [Citrus clementina]
 ref|XP_006439506.1| hypothetical protein CICLE_v10021507mg [Citrus clementina]
 gb|ESR52745.1| hypothetical protein CICLE_v10021507mg [Citrus clementina]
 gb|ESR52746.1| hypothetical protein CICLE_v10021507mg [Citrus clementina]
Length=214

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DA NPGNNLYVTGLSTRV   DLEK F  EGKV + HLV DP TRES GFAFVTM  +E 
Sbjct  44   DAANPGNNLYVTGLSTRVTNADLEKFFGGEGKVTECHLVTDPRTRESCGFAFVTMETVEG  103

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            ADRCIKYLNRSVLEGR+ITVEKV
Sbjct  104  ADRCIKYLNRSVLEGRLITVEKV  126



>ref|XP_006848090.1| hypothetical protein AMTR_s00029p00209460 [Amborella trichopoda]
 gb|ERN09671.1| hypothetical protein AMTR_s00029p00209460 [Amborella trichopoda]
Length=382

 Score =   138 bits (347),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +3

Query  231  ENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDAD  410
            ENPGNNLYVTGLS+R   +DLEKHF+SEG V D HLV+DP TRESRGF FVTMS +E+AD
Sbjct  40   ENPGNNLYVTGLSSRATSRDLEKHFASEGTVTDCHLVVDPRTRESRGFGFVTMSTVEEAD  99

Query  411  RCIKYLNRSVLEGRVITVEKV  473
            RC+KYL+RSVLEGRVITVEK 
Sbjct  100  RCLKYLDRSVLEGRVITVEKA  120



>ref|XP_011035205.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X1 [Populus euphratica]
Length=358

 Score =   137 bits (345),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D ENPGNNLYVTGLS R+ +K+LEKHF++EG V DVHLV+DP TRESRGF FVTMS +E+
Sbjct  38   DVENPGNNLYVTGLSPRITKKELEKHFAAEGTVIDVHLVVDPLTRESRGFGFVTMSAVEE  97

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            ADRCIKYL+RSVL GRVITVEK 
Sbjct  98   ADRCIKYLDRSVLGGRVITVEKA  120



>ref|XP_007040292.1| RNA-binding family protein [Theobroma cacao]
 gb|EOY24793.1| RNA-binding family protein [Theobroma cacao]
Length=200

 Score =   133 bits (334),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DA NPGNNLYVTGLSTRV   DLEK+F +EGKV + HLV DP TRESRGFAFVTM  +E 
Sbjct  37   DASNPGNNLYVTGLSTRVTTADLEKYFGNEGKVVECHLVTDPRTRESRGFAFVTMETVEG  96

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+RCIKYLNRSVLEGR+ITVEK 
Sbjct  97   AERCIKYLNRSVLEGRLITVEKA  119



>ref|XP_010104693.1| Uncharacterized RNA-binding protein [Morus notabilis]
 gb|EXC01499.1| Uncharacterized RNA-binding protein [Morus notabilis]
Length=492

 Score =   139 bits (349),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D +NPGNNLYVTGLS R+ +++LEKHF +EGKV DVHLV+DP TRESRGF FV+MS +E+
Sbjct  141  DVDNPGNNLYVTGLSPRITKRELEKHFVTEGKVVDVHLVVDPCTRESRGFGFVSMSSVEE  200

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            ADRCIKYL+RSVLEGRVITVEK
Sbjct  201  ADRCIKYLDRSVLEGRVITVEK  222



>gb|KHG02619.1| Scaffold attachment factor B2 [Gossypium arboreum]
Length=234

 Score =   133 bits (335),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DA NPGNNLYVTGLSTRV   DLEK+F +EGKV + HLV DP T+ESRGFAFVTM  +E 
Sbjct  34   DASNPGNNLYVTGLSTRVTAGDLEKYFGNEGKVLECHLVTDPHTKESRGFAFVTMETVEG  93

Query  405  ADRCIKYLNRSVLEGRVITVEKVN  476
            A+RCIKYLNRSVLEGR+ITVEK N
Sbjct  94   AERCIKYLNRSVLEGRLITVEKGN  117



>gb|EMT18238.1| Scaffold attachment factor B2 [Aegilops tauschii]
Length=329

 Score =   135 bits (341),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  231  ENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDAD  410
            ENPGNNL+VTGLS+R+  +DLEKHFS+EG+V D  +V+DPWTRESRGF FVTM+ L++A+
Sbjct  96   ENPGNNLFVTGLSSRLTDRDLEKHFSTEGEVIDASIVLDPWTRESRGFGFVTMATLKEAE  155

Query  411  RCIKYLNRSVLEGRVITVEK  470
            RCIKYL+RSVLEGRVITVEK
Sbjct  156  RCIKYLDRSVLEGRVITVEK  175



>ref|XP_004298819.1| PREDICTED: uncharacterized RNA-binding protein C25G10.01-like 
[Fragaria vesca subsp. vesca]
Length=222

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DA NPGNNLYVTGLSTRV   D+EK F+ EGKV D HLV DP +RESRGFAFVTM  +ED
Sbjct  41   DASNPGNNLYVTGLSTRVTSADVEKFFNKEGKVLDCHLVTDPRSRESRGFAFVTMETVED  100

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+RCIKYLNRSVLEGR++TVEK 
Sbjct  101  AERCIKYLNRSVLEGRLVTVEKA  123



>ref|XP_006439508.1| hypothetical protein CICLE_v10021507mg [Citrus clementina]
 gb|ESR52748.1| hypothetical protein CICLE_v10021507mg [Citrus clementina]
Length=218

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DA NPGNNLYVTGLSTRV   DLEK F  EGKV + HLV DP TRES GFAFVTM  +E 
Sbjct  32   DAANPGNNLYVTGLSTRVTNADLEKFFGGEGKVTECHLVTDPRTRESCGFAFVTMETVEG  91

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            ADRCIKYLNRSVLEGR+ITVEKV
Sbjct  92   ADRCIKYLNRSVLEGRLITVEKV  114



>ref|XP_006417810.1| hypothetical protein EUTSA_v10008061mg [Eutrema salsugineum]
 gb|ESQ36163.1| hypothetical protein EUTSA_v10008061mg [Eutrema salsugineum]
Length=352

 Score =   135 bits (341),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DAENPGN+LYVTGLS RV ++DLE HFS EGKV DVHLV+DPWTRE RGF F++M  + D
Sbjct  39   DAENPGNSLYVTGLSHRVTERDLEDHFSKEGKVTDVHLVLDPWTREPRGFGFISMETVGD  98

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+RCI+YL+ SVL+GRVITVEK 
Sbjct  99   ANRCIRYLDHSVLQGRVITVEKA  121



>ref|XP_010228830.1| PREDICTED: serine/arginine-rich splicing factor SR45a [Brachypodium 
distachyon]
Length=338

 Score =   135 bits (340),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +3

Query  231  ENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDAD  410
            +NPGNNL+VTGLS+R+  +DLEKHFS+EG+V D  +V+DPWTRESRGF FVTM+ L++AD
Sbjct  28   DNPGNNLFVTGLSSRLTDRDLEKHFSTEGEVIDASIVLDPWTRESRGFGFVTMATLKEAD  87

Query  411  RCIKYLNRSVLEGRVITVEKV  473
            RCIKYL+RSVLEGRVITVEK 
Sbjct  88   RCIKYLDRSVLEGRVITVEKA  108



>ref|XP_006439510.1| hypothetical protein CICLE_v10021507mg [Citrus clementina]
 gb|ESR52750.1| hypothetical protein CICLE_v10021507mg [Citrus clementina]
Length=230

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DA NPGNNLYVTGLSTRV   DLEK F  EGKV + HLV DP TRES GFAFVTM  +E 
Sbjct  44   DAANPGNNLYVTGLSTRVTNADLEKFFGGEGKVTECHLVTDPRTRESCGFAFVTMETVEG  103

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            ADRCIKYLNRSVLEGR+ITVEKV
Sbjct  104  ADRCIKYLNRSVLEGRLITVEKV  126



>ref|XP_009375024.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009375034.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X2 [Pyrus x bretschneideri]
Length=215

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DA NPGNNLYVTGLSTRV   DLEK F+ +GKV D HLV DP TRESRGF FVTM  +ED
Sbjct  42   DASNPGNNLYVTGLSTRVTSTDLEKFFNKQGKVLDCHLVTDPRTRESRGFGFVTMETVED  101

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+RCIKYL+RSVLEGR+ITVEK 
Sbjct  102  AERCIKYLDRSVLEGRLITVEKA  124



>ref|XP_009392818.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Musa 
acuminata subsp. malaccensis]
Length=208

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D+ NPGNNLYVTGLSTRV   DLEK+FS EGKV + H+++DP TRESRGF FVTM  +E 
Sbjct  42   DSSNPGNNLYVTGLSTRVSSSDLEKYFSKEGKVSECHVIVDPRTRESRGFGFVTMETVEG  101

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+RC+KYLNRSVLEGR+ITV+K 
Sbjct  102  AERCVKYLNRSVLEGRLITVQKA  124



>ref|XP_009375022.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009375023.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009375031.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009375032.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X1 [Pyrus x bretschneideri]
Length=217

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DA NPGNNLYVTGLSTRV   DLEK F+ +GKV D HLV DP TRESRGF FVTM  +ED
Sbjct  42   DASNPGNNLYVTGLSTRVTSTDLEKFFNKQGKVLDCHLVTDPRTRESRGFGFVTMETVED  101

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+RCIKYL+RSVLEGR+ITVEK 
Sbjct  102  AERCIKYLDRSVLEGRLITVEKA  124



>gb|ABF95135.1| RNA recognition motif family protein, expressed [Oryza sativa 
Japonica Group]
Length=346

 Score =   135 bits (339),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +3

Query  231  ENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDAD  410
            ENPGNNLYVTGLS RV  +DLEKHFS+EG+V D  +V+DPWTRESRGF FVTM+ +++AD
Sbjct  38   ENPGNNLYVTGLSARVTDRDLEKHFSAEGEVIDASIVLDPWTRESRGFGFVTMATVKEAD  97

Query  411  RCIKYLNRSVLEGRVITVEKVN  476
             CIKYL+RSVLEGRVITVEK  
Sbjct  98   LCIKYLDRSVLEGRVITVEKAK  119



>gb|ABF95136.1| RNA recognition motif family protein, expressed [Oryza sativa 
Japonica Group]
Length=347

 Score =   135 bits (339),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +3

Query  231  ENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDAD  410
            ENPGNNLYVTGLS RV  +DLEKHFS+EG+V D  +V+DPWTRESRGF FVTM+ +++AD
Sbjct  39   ENPGNNLYVTGLSARVTDRDLEKHFSAEGEVIDASIVLDPWTRESRGFGFVTMATVKEAD  98

Query  411  RCIKYLNRSVLEGRVITVEKVN  476
             CIKYL+RSVLEGRVITVEK  
Sbjct  99   LCIKYLDRSVLEGRVITVEKAK  120



>ref|XP_008238932.1| PREDICTED: uncharacterized RNA-binding protein C25G10.01-like 
isoform X2 [Prunus mume]
Length=206

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DA NPGNNLYVTGLSTRV   DLEK F+ EGKV + HLV DP TRESRGF FVTM  +ED
Sbjct  41   DASNPGNNLYVTGLSTRVTSSDLEKFFNKEGKVLECHLVTDPRTRESRGFGFVTMETVED  100

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+RC+KYLNRSVLEGR++TVEK 
Sbjct  101  AERCVKYLNRSVLEGRLVTVEKA  123



>gb|KDO76279.1| hypothetical protein CISIN_1g028130mg [Citrus sinensis]
Length=201

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DA NPGNNLYVTGLSTRV   DLEK F  EGKV + HLV DP TRES GFAFVTM  +E 
Sbjct  32   DAANPGNNLYVTGLSTRVTNADLEKFFGGEGKVTECHLVTDPRTRESCGFAFVTMETVEG  91

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            ADRCIKYLNRSVLEGR+ITVEK 
Sbjct  92   ADRCIKYLNRSVLEGRLITVEKA  114



>gb|KDO76280.1| hypothetical protein CISIN_1g028130mg [Citrus sinensis]
Length=213

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DA NPGNNLYVTGLSTRV   DLEK F  EGKV + HLV DP TRES GFAFVTM  +E 
Sbjct  44   DAANPGNNLYVTGLSTRVTNADLEKFFGGEGKVTECHLVTDPRTRESCGFAFVTMETVEG  103

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            ADRCIKYLNRSVLEGR+ITVEK 
Sbjct  104  ADRCIKYLNRSVLEGRLITVEKA  126



>ref|XP_009375025.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X3 [Pyrus x bretschneideri]
 ref|XP_009375035.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X3 [Pyrus x bretschneideri]
Length=178

 Score =   130 bits (327),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DA NPGNNLYVTGLSTRV   DLEK F+ +GKV D HLV DP TRESRGF FVTM  +ED
Sbjct  42   DASNPGNNLYVTGLSTRVTSTDLEKFFNKQGKVLDCHLVTDPRTRESRGFGFVTMETVED  101

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+RCIKYL+RSVLEGR+ITVEK 
Sbjct  102  AERCIKYLDRSVLEGRLITVEKA  124



>ref|XP_007209603.1| hypothetical protein PRUPE_ppa011480mg [Prunus persica]
 ref|XP_008238931.1| PREDICTED: uncharacterized RNA-binding protein C25G10.01-like 
isoform X1 [Prunus mume]
 gb|EMJ10802.1| hypothetical protein PRUPE_ppa011480mg [Prunus persica]
Length=208

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DA NPGNNLYVTGLSTRV   DLEK F+ EGKV + HLV DP TRESRGF FVTM  +ED
Sbjct  41   DASNPGNNLYVTGLSTRVTSSDLEKFFNKEGKVLECHLVTDPRTRESRGFGFVTMETVED  100

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+RC+KYLNRSVLEGR++TVEK 
Sbjct  101  AERCVKYLNRSVLEGRLVTVEKA  123



>ref|XP_006439507.1| hypothetical protein CICLE_v10021507mg [Citrus clementina]
 gb|ESR52747.1| hypothetical protein CICLE_v10021507mg [Citrus clementina]
Length=274

 Score =   132 bits (333),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DA NPGNNLYVTGLSTRV   DLEK F  EGKV + HLV DP TRES GFAFVTM  +E 
Sbjct  32   DAANPGNNLYVTGLSTRVTNADLEKFFGGEGKVTECHLVTDPRTRESCGFAFVTMETVEG  91

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            ADRCIKYLNRSVLEGR+ITVEKV
Sbjct  92   ADRCIKYLNRSVLEGRLITVEKV  114



>ref|XP_002892395.1| hypothetical protein ARALYDRAFT_470756 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68654.1| hypothetical protein ARALYDRAFT_470756 [Arabidopsis lyrata subsp. 
lyrata]
Length=381

 Score =   135 bits (339),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DAENPGN+LYVTGLS RV ++DLE HF+ EGKV DVHLV+DPWTRESRGF F++M  + D
Sbjct  68   DAENPGNSLYVTGLSHRVTERDLEDHFAKEGKVTDVHLVLDPWTRESRGFGFISMESVGD  127

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+RCI+YL+ SVL+GRVITVEK 
Sbjct  128  ANRCIRYLDHSVLQGRVITVEKA  150



>gb|AAK92735.1| putative transformer-SR ribonucleoprotein [Arabidopsis thaliana]
Length=352

 Score =   134 bits (336),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DAENPGN+LYVTGLS RV ++DLE HF+ EGKV DVHLV+DPWTRESRGF F++M  + D
Sbjct  39   DAENPGNSLYVTGLSHRVTERDLEDHFAKEGKVTDVHLVLDPWTRESRGFGFISMKSVGD  98

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+RCI+ L+ SVL+GRVITVEK 
Sbjct  99   ANRCIRSLDHSVLQGRVITVEKA  121



>ref|XP_006439511.1| hypothetical protein CICLE_v10021507mg [Citrus clementina]
 gb|ESR52751.1| hypothetical protein CICLE_v10021507mg [Citrus clementina]
Length=286

 Score =   132 bits (333),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DA NPGNNLYVTGLSTRV   DLEK F  EGKV + HLV DP TRES GFAFVTM  +E 
Sbjct  44   DAANPGNNLYVTGLSTRVTNADLEKFFGGEGKVTECHLVTDPRTRESCGFAFVTMETVEG  103

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            ADRCIKYLNRSVLEGR+ITVEKV
Sbjct  104  ADRCIKYLNRSVLEGRLITVEKV  126



>ref|XP_006305290.1| hypothetical protein CARUB_v10009665mg [Capsella rubella]
 gb|EOA38188.1| hypothetical protein CARUB_v10009665mg [Capsella rubella]
Length=337

 Score =   133 bits (335),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DAENPGN+LYVTGLS RV ++DLE HFS EGKV DVHLV+DPWTRESRGF F++M  + D
Sbjct  39   DAENPGNSLYVTGLSHRVTERDLEDHFSKEGKVTDVHLVLDPWTRESRGFGFISMETVGD  98

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+RCI+YL+ SVL GRVI VEK 
Sbjct  99   ANRCIRYLDHSVLLGRVIKVEKA  121



>gb|ADE76245.1| unknown [Picea sitchensis]
 gb|ADE77346.1| unknown [Picea sitchensis]
Length=220

 Score =   130 bits (327),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            +AENPGN LYVTGLSTRV +KDLE+HFS EGKV D  LV++P TR SRGF FVTM  LED
Sbjct  36   EAENPGNTLYVTGLSTRVTEKDLEEHFSGEGKVIDCRLVVEPRTRISRGFGFVTMGSLED  95

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            A+RCIKYLN+S+LEGR ITVEK
Sbjct  96   AERCIKYLNQSILEGRFITVEK  117



>ref|NP_563787.2| serine/arginine rich-like protein SR45a [Arabidopsis thaliana]
 sp|Q84TH4.1|SR45A_ARATH RecName: Full=Serine/arginine-rich splicing factor SR45a; Short=At-SR45A; 
Short=AtSR45a; AltName: Full=Protein TRANSFORMER2-like; 
Short=atTra2 [Arabidopsis thaliana]
 gb|AAO64199.1| putative transformer-SR ribonucleoprotein [Arabidopsis thaliana]
 gb|AEE28112.1| serine/arginine rich-like protein SR45a [Arabidopsis thaliana]
Length=382

 Score =   133 bits (335),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DAENPGN+LYVTGLS RV ++DLE HF+ EGKV DVHLV+DPWTRESRGF F++M  + D
Sbjct  69   DAENPGNSLYVTGLSHRVTERDLEDHFAKEGKVTDVHLVLDPWTRESRGFGFISMKSVGD  128

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+RCI+ L+ SVL+GRVITVEK 
Sbjct  129  ANRCIRSLDHSVLQGRVITVEKA  151



>ref|XP_004145262.1| PREDICTED: uncharacterized protein LOC101211183 [Cucumis sativus]
 ref|XP_004153030.1| PREDICTED: uncharacterized protein LOC101208036 [Cucumis sativus]
 ref|XP_004154325.1| PREDICTED: uncharacterized protein LOC101221508 [Cucumis sativus]
 gb|KGN65784.1| hypothetical protein Csa_1G528490 [Cucumis sativus]
Length=367

 Score =   133 bits (334),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D ENPGNNLYVTGLS R+ +++LEKHFS+EG V DVHLV DP TRESRGF F+TMS  ++
Sbjct  36   DVENPGNNLYVTGLSPRITRRELEKHFSAEGTVLDVHLVADPLTRESRGFGFITMSSNDE  95

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+ CIKYLNRSVLEGR+ITVEK 
Sbjct  96   AENCIKYLNRSVLEGRIITVEKA  118



>gb|AFW62088.1| hypothetical protein ZEAMMB73_489339 [Zea mays]
Length=159

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +3

Query  234  NPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDADR  413
            NPGNNLYVTGLSTRV + DLEK FS EGKV++ H+V+DP T+ESRGFAFVTM  LE A R
Sbjct  78   NPGNNLYVTGLSTRVTEDDLEKFFSKEGKVKNCHVVLDPRTKESRGFAFVTMDTLEGARR  137

Query  414  CIKYLNRSVLEGRVITVEKVNC  479
             IKYL+R+VLEGR++TVEKV C
Sbjct  138  SIKYLHRTVLEGRLVTVEKVRC  159



>ref|XP_010239167.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X2 [Brachypodium distachyon]
Length=196

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 71/89 (80%), Gaps = 2/89 (2%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            +  NPGNNLYVTGLSTR    DLEK FS EGKV+D H+V+DP T+ESRGFAFVTM  +ED
Sbjct  104  EVRNPGNNLYVTGLSTRTSGDDLEKFFSKEGKVKDCHVVMDPRTKESRGFAFVTMDNIED  163

Query  405  ADRCIKYLNRSVLEGRVITVEKV--NCHY  485
            A RCIKYL+R+VLEGR+I+V KV   C Y
Sbjct  164  ARRCIKYLHRTVLEGRLISVAKVVEQCMY  192



>gb|EMS64978.1| Scaffold attachment factor B2 [Triticum urartu]
Length=142

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D  NPGNNLYVTGLSTR ++ DLEK FS EGKV+D  +VIDP T+ESRGFAFVTM  +ED
Sbjct  14   DVRNPGNNLYVTGLSTRTQETDLEKFFSKEGKVKDCRVVIDPRTKESRGFAFVTMENVED  73

Query  405  ADRCIKYLNRSVLEGRVITVEKVN  476
            A RCIKYL+R+VLEGR+I+V K++
Sbjct  74   ARRCIKYLHRTVLEGRLISVAKLS  97



>ref|XP_002444277.1| hypothetical protein SORBIDRAFT_07g019390 [Sorghum bicolor]
 gb|EES13772.1| hypothetical protein SORBIDRAFT_07g019390 [Sorghum bicolor]
Length=191

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +3

Query  234  NPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDADR  413
            NPG NLYVTGLSTRV ++DL+K FS EGKV++ H+V+DP T+ESRGFAFVTM  LEDA R
Sbjct  83   NPGTNLYVTGLSTRVTEEDLQKFFSKEGKVKNCHVVLDPRTKESRGFAFVTMDTLEDARR  142

Query  414  CIKYLNRSVLEGRVITVEKVN  476
            CIKYL+R+VLEGR++TVEK N
Sbjct  143  CIKYLHRTVLEGRLVTVEKFN  163



>ref|XP_009118966.1| PREDICTED: serine/arginine-rich splicing factor SR45a [Brassica 
rapa]
 ref|XP_009118967.1| PREDICTED: serine/arginine-rich splicing factor SR45a [Brassica 
rapa]
Length=349

 Score =   132 bits (331),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DAENPGN+LYVTGLS RV ++DLE HFS EGKV DVHLV+DPWTRE RGF F++M  + D
Sbjct  36   DAENPGNSLYVTGLSHRVTERDLEDHFSKEGKVTDVHLVLDPWTREPRGFGFISMETVGD  95

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+RCI++L+ SVL GRVITVEK 
Sbjct  96   ANRCIRHLDHSVLLGRVITVEKA  118



>ref|XP_006425349.1| hypothetical protein CICLE_v10026375mg [Citrus clementina]
 gb|ESR38589.1| hypothetical protein CICLE_v10026375mg [Citrus clementina]
Length=148

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  234  NPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDADR  413
            NPGN LYVTGLSTRV ++DLEKHFS EGKV    LV++P TR SRGFAFVTM  +EDA+R
Sbjct  68   NPGNTLYVTGLSTRVTERDLEKHFSKEGKVASCFLVVEPRTRISRGFAFVTMDSVEDAER  127

Query  414  CIKYLNRSVLEGRVITVEKV  473
            CIKYLN+SVLEGR ITVE+V
Sbjct  128  CIKYLNQSVLEGRYITVERV  147



>ref|XP_008457405.1| PREDICTED: serine/arginine-rich splicing factor 2-like [Cucumis 
melo]
Length=369

 Score =   132 bits (331),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D ENPGNNLYVTGLS R+ +++LEKHFS+EG V DVHL+ DP TRESRGF F+TMS  ++
Sbjct  36   DVENPGNNLYVTGLSPRITRRELEKHFSAEGTVLDVHLLADPLTRESRGFGFITMSSNDE  95

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+ CIKYLNRSVLEGR+ITVEK 
Sbjct  96   AENCIKYLNRSVLEGRIITVEKA  118



>emb|CDY06701.1| BnaA10g04800D [Brassica napus]
Length=349

 Score =   131 bits (330),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DAENPGN+LYVTGLS RV ++DLE HFS EGKV DVHLV+DPWTRE RGF F++M  + D
Sbjct  36   DAENPGNSLYVTGLSHRVTERDLEDHFSKEGKVTDVHLVLDPWTREPRGFGFISMETVGD  95

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A RCI++L+ SVL GRVITVEK 
Sbjct  96   ASRCIRHLDHSVLLGRVITVEKA  118



>ref|XP_001752273.1| predicted protein [Physcomitrella patens]
 gb|EDQ83006.1| predicted protein [Physcomitrella patens]
Length=80

 Score =   124 bits (310),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DA NPGNNLYVTGLSTRV +KDL++HFS EGKV +  LV+DP TRESRGF FVTM  LED
Sbjct  5    DALNPGNNLYVTGLSTRVNEKDLQEHFSREGKVLECRLVLDPRTRESRGFGFVTMEHLED  64

Query  405  ADRCIKYLNRSVLEGR  452
            A+RCIKYLNRS LEGR
Sbjct  65   AERCIKYLNRSTLEGR  80



>ref|XP_010475492.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X2 [Camelina sativa]
Length=330

 Score =   131 bits (329),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DAENPGN+LYVTGLS RV ++DLE HFS EGKV DVHLV+DPWTRESRGF F+++  + D
Sbjct  39   DAENPGNSLYVTGLSHRVTERDLEDHFSKEGKVTDVHLVLDPWTRESRGFGFISLETVGD  98

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+RCI+YL+ SVL GRVI VEK 
Sbjct  99   ANRCIRYLDHSVLLGRVIKVEKA  121



>ref|XP_010475491.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X1 [Camelina sativa]
Length=332

 Score =   130 bits (328),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DAENPGN+LYVTGLS RV ++DLE HFS EGKV DVHLV+DPWTRESRGF F+++  + D
Sbjct  39   DAENPGNSLYVTGLSHRVTERDLEDHFSKEGKVTDVHLVLDPWTRESRGFGFISLETVGD  98

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+RCI+YL+ SVL GRVI VEK 
Sbjct  99   ANRCIRYLDHSVLLGRVIKVEKA  121



>ref|XP_010457907.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X1 [Camelina sativa]
Length=354

 Score =   131 bits (329),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DAENPGN+LYVTGLS RV ++DLE HFS EGKV DVHLV+DPWTRESRGF F+++  + D
Sbjct  39   DAENPGNSLYVTGLSHRVTERDLEDHFSKEGKVTDVHLVLDPWTRESRGFGFISLETVGD  98

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+RCI+YL+ SVL GRVI VEK 
Sbjct  99   ANRCIRYLDHSVLLGRVIKVEKA  121



>ref|XP_010457908.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X2 [Camelina sativa]
Length=352

 Score =   131 bits (329),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DAENPGN+LYVTGLS RV ++DLE HFS EGKV DVHLV+DPWTRESRGF F+++  + D
Sbjct  39   DAENPGNSLYVTGLSHRVTERDLEDHFSKEGKVTDVHLVLDPWTRESRGFGFISLETVGD  98

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+RCI+YL+ SVL GRVI VEK 
Sbjct  99   ANRCIRYLDHSVLLGRVIKVEKA  121



>ref|XP_004163746.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101230062 
[Cucumis sativus]
Length=369

 Score =   131 bits (329),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D ENPGNNLYVTGLS R+ +++LEKHFS+EG V DVHLV DP TRESRGF F+TMS  ++
Sbjct  36   DVENPGNNLYVTGLSPRITRRELEKHFSAEGTVLDVHLVADPLTRESRGFGFITMSSNDE  95

Query  405  ADRCIKYLNRSVLEGRVITVE  467
            A+ CIKYLNRSVLEGR+ITVE
Sbjct  96   AENCIKYLNRSVLEGRIITVE  116



>emb|CDP12048.1| unnamed protein product [Coffea canephora]
Length=289

 Score =   129 bits (324),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +3

Query  228  AENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDA  407
            A NPGNNLYVTGLSTRV   DLEK F+ EGKV + HLV DP T+ESRGFAFVTM   EDA
Sbjct  126  AVNPGNNLYVTGLSTRVTSSDLEKFFNREGKVTECHLVTDPRTKESRGFAFVTMETNEDA  185

Query  408  DRCIKYLNRSVLEGRVITVEKV  473
            DRCIKYLNRSV+EGR+ITVEK 
Sbjct  186  DRCIKYLNRSVMEGRLITVEKA  207



>gb|EMS59082.1| Uncharacterized RNA-binding protein C25G10.01 [Triticum urartu]
Length=685

 Score =   134 bits (338),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  231  ENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDAD  410
            ENPGNNL+VTGLS+R+  +DLEKHFS+EG+V D  +V+DPWTRESRGF FVTM+ L++A+
Sbjct  339  ENPGNNLFVTGLSSRLTDQDLEKHFSTEGEVIDASIVLDPWTRESRGFGFVTMATLKEAE  398

Query  411  RCIKYLNRSVLEGRVITVEK  470
            RCIKYL+RSVLEGRVITVEK
Sbjct  399  RCIKYLDRSVLEGRVITVEK  418



>gb|EYU38329.1| hypothetical protein MIMGU_mgv1a013947mg [Erythranthe guttata]
Length=205

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +3

Query  228  AENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDA  407
            A NPGNNLYVTGLSTRV + DL+K+FS EGKV D HLV DP +RESRGF FVTM   ED 
Sbjct  51   ASNPGNNLYVTGLSTRVTESDLKKYFSREGKVVDCHLVTDPHSRESRGFGFVTMETNEDG  110

Query  408  DRCIKYLNRSVLEGRVITVEKV  473
            +RCIK+LNRSVLEGR+ITV++ 
Sbjct  111  ERCIKHLNRSVLEGRLITVQQA  132



>ref|XP_006828824.1| hypothetical protein AMTR_s00001p00140760 [Amborella trichopoda]
 gb|ERM96240.1| hypothetical protein AMTR_s00001p00140760 [Amborella trichopoda]
Length=228

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DA NPGN LYVTGLSTRV ++D+E+HFS EGKV    LV++P TR SRGFAFVTM  LED
Sbjct  48   DAVNPGNTLYVTGLSTRVTERDVEEHFSREGKVASCRLVVEPRTRISRGFAFVTMDTLED  107

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            ADRCIKYLN+S+LEGR ITVEK
Sbjct  108  ADRCIKYLNQSILEGRYITVEK  129



>gb|ADE75667.1| unknown [Picea sitchensis]
Length=216

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D  NPGNNLYVTGLS RV + DLE+ FS EGKV D  +V+DP +RESRGF FVTM  LE+
Sbjct  57   DVSNPGNNLYVTGLSARVVEADLEELFSQEGKVVDCRIVVDPRSRESRGFGFVTMDTLEN  116

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            ADRC+KYLNRS LEGR+ITVEK 
Sbjct  117  ADRCVKYLNRSTLEGRIITVEKA  139



>gb|EEE68615.1| hypothetical protein OsJ_27155 [Oryza sativa Japonica Group]
Length=271

 Score =   127 bits (320),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  234  NPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDADR  413
            NPGNNLYVTGLSTRV ++DLEK FS EGKV+  H+V+DP T+ESRGFAFVTM  ++DA R
Sbjct  80   NPGNNLYVTGLSTRVTEEDLEKFFSKEGKVQSCHVVLDPRTKESRGFAFVTMDSVDDARR  139

Query  414  CIKYLNRSVLEGRVITVEKV  473
            CIKYL+R+VLEGR++TVEK 
Sbjct  140  CIKYLHRTVLEGRLVTVEKA  159



>ref|NP_001061706.1| Os08g0385900 [Oryza sativa Japonica Group]
 dbj|BAD05420.1| putative transformer-SR ribonucleoprotein [Oryza sativa Japonica 
Group]
 dbj|BAD05836.1| putative transformer-SR ribonucleoprotein [Oryza sativa Japonica 
Group]
 dbj|BAF23620.1| Os08g0385900 [Oryza sativa Japonica Group]
 dbj|BAG92152.1| unnamed protein product [Oryza sativa Japonica Group]
Length=279

 Score =   127 bits (320),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  234  NPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDADR  413
            NPGNNLYVTGLSTRV ++DLEK FS EGKV+  H+V+DP T+ESRGFAFVTM  ++DA R
Sbjct  88   NPGNNLYVTGLSTRVTEEDLEKFFSKEGKVQSCHVVLDPRTKESRGFAFVTMDSVDDARR  147

Query  414  CIKYLNRSVLEGRVITVEKV  473
            CIKYL+R+VLEGR++TVEK 
Sbjct  148  CIKYLHRTVLEGRLVTVEKA  167



>gb|KFK30200.1| hypothetical protein AALP_AA7G231300 [Arabis alpina]
Length=157

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D ENPG  LYVTGLSTRV  +DLE HFS EGKV    LV++P TR SRGF FVTM  L+D
Sbjct  62   DIENPGTTLYVTGLSTRVTDEDLEAHFSKEGKVASCFLVMEPRTRVSRGFGFVTMDSLKD  121

Query  405  ADRCIKYLNRSVLEGRVITVEKVN  476
            ADRCIKYLN+SVLEGR ITVE+ N
Sbjct  122  ADRCIKYLNQSVLEGRYITVERKN  145



>ref|XP_006659363.1| PREDICTED: serine/arginine-rich splicing factor 2-like isoform 
X1 [Oryza brachyantha]
Length=277

 Score =   127 bits (320),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  234  NPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDADR  413
            NPGNNLYVTGLSTRV ++DLEK FS EGKV+  H+V+DP T+ESRGFAFVTM  ++DA R
Sbjct  86   NPGNNLYVTGLSTRVTEEDLEKFFSKEGKVQSCHVVLDPRTKESRGFAFVTMDTVDDARR  145

Query  414  CIKYLNRSVLEGRVITVEKV  473
            CIKYL+R+VLEGR++TVEK 
Sbjct  146  CIKYLHRTVLEGRLVTVEKA  165



>ref|XP_006425346.1| hypothetical protein CICLE_v10026375mg [Citrus clementina]
 ref|XP_006425347.1| hypothetical protein CICLE_v10026375mg [Citrus clementina]
 gb|ESR38586.1| hypothetical protein CICLE_v10026375mg [Citrus clementina]
 gb|ESR38587.1| hypothetical protein CICLE_v10026375mg [Citrus clementina]
Length=166

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  234  NPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDADR  413
            NPGN LYVTGLSTRV ++DLEKHFS EGKV    LV++P TR SRGFAFVTM  +EDA+R
Sbjct  68   NPGNTLYVTGLSTRVTERDLEKHFSKEGKVASCFLVVEPRTRISRGFAFVTMDSVEDAER  127

Query  414  CIKYLNRSVLEGRVITVEK  470
            CIKYLN+SVLEGR ITVE+
Sbjct  128  CIKYLNQSVLEGRYITVER  146



>ref|XP_002972807.1| hypothetical protein SELMODRAFT_59634, partial [Selaginella moellendorffii]
 gb|EFJ26028.1| hypothetical protein SELMODRAFT_59634, partial [Selaginella moellendorffii]
Length=82

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D +NPGNNLYVTGLSTRV +K L +H S EGKV +  +V+DP T+ESRGF FVTM+  ED
Sbjct  1    DPDNPGNNLYVTGLSTRVAEKQLLEHLSREGKVLECRIVVDPRTKESRGFGFVTMASTED  60

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            A+RCI Y+NRS LEGR+IT+EK
Sbjct  61   AERCINYMNRSTLEGRIITIEK  82



>gb|EMT21403.1| Putative RNA-binding protein [Aegilops tauschii]
Length=247

 Score =   126 bits (317),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D  NPGNNLYVTGLSTR ++ DLEK FS EGKV+D  +VIDP T+ESRGFAFVTM  +ED
Sbjct  85   DVRNPGNNLYVTGLSTRTQETDLEKFFSKEGKVKDCRVVIDPRTKESRGFAFVTMENVED  144

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A RCIKYL+R+VLEGR+I+V K 
Sbjct  145  ARRCIKYLHRTVLEGRLISVAKA  167



>gb|KHF98970.1| putative RNA-binding C25G10.01 [Gossypium arboreum]
Length=428

 Score =   130 bits (326),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D ENPGN+LYVTGLS R+ +++LEKHF+SEG V DVHLV+DP TR+SRGF FVTM+  ++
Sbjct  44   DVENPGNSLYVTGLSPRITKRELEKHFASEGNVIDVHLVVDPRTRDSRGFGFVTMATNKE  103

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            ADRCIKYL+ SVLEGRVITVEK 
Sbjct  104  ADRCIKYLDGSVLEGRVITVEKA  126



>ref|XP_010487375.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X2 [Camelina sativa]
Length=356

 Score =   129 bits (323),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DAENPGN+LYVTGLS RV ++DLE HFS EGKV DVHLV+DPWTRESRGF F+++  + D
Sbjct  39   DAENPGNSLYVTGLSHRVTERDLEDHFSKEGKVTDVHLVLDPWTRESRGFGFISLETVGD  98

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
             +RCI+YL+ SVL GRVI VEK 
Sbjct  99   VNRCIRYLDHSVLLGRVIKVEKA  121



>ref|NP_001154288.1| RNA-binding (RRM/RBD/RNP motifs) family protein [Arabidopsis 
thaliana]
 gb|AEE86567.1| RNA-binding (RRM/RBD/RNP motifs) family protein [Arabidopsis 
thaliana]
Length=207

 Score =   125 bits (314),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            + ENPG  LYVTGLSTRV  KDLE HF+ EGKV    LV++P TR SRGFAFVTMS L+D
Sbjct  66   EVENPGTTLYVTGLSTRVTDKDLEAHFAKEGKVASCFLVMEPRTRVSRGFAFVTMSSLKD  125

Query  405  ADRCIKYLNRSVLEGRVITVEKVNCH  482
            A+RCIKYLN+SVLEGR ITVE+   H
Sbjct  126  AERCIKYLNQSVLEGRYITVERKILH  151



>ref|XP_010487367.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X1 [Camelina sativa]
Length=358

 Score =   129 bits (323),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DAENPGN+LYVTGLS RV ++DLE HFS EGKV DVHLV+DPWTRESRGF F+++  + D
Sbjct  39   DAENPGNSLYVTGLSHRVTERDLEDHFSKEGKVTDVHLVLDPWTRESRGFGFISLETVGD  98

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
             +RCI+YL+ SVL GRVI VEK 
Sbjct  99   VNRCIRYLDHSVLLGRVIKVEKA  121



>ref|XP_003536651.1| PREDICTED: uncharacterized RNA-binding protein C25G10.01-like 
isoform X1 [Glycine max]
 gb|KHN06726.1| Putative RNA-binding protein C25G10.01 [Glycine soja]
Length=191

 Score =   124 bits (312),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D ENPGNNLYVTGLSTR+   DL K+FS EGKV D HLV DP T+ESRGF FVTM   +D
Sbjct  40   DVENPGNNLYVTGLSTRITDSDLHKYFSKEGKVVDCHLVKDPHTKESRGFGFVTMETNDD  99

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+ CIKYLNRSV EGR+ITVEK 
Sbjct  100  AECCIKYLNRSVFEGRLITVEKA  122



>ref|XP_003563207.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X1 [Brachypodium distachyon]
Length=241

 Score =   125 bits (315),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  234  NPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDADR  413
            NPGNNLYVTGLSTR    DLEK FS EGKV+D H+V+DP T+ESRGFAFVTM  +EDA R
Sbjct  107  NPGNNLYVTGLSTRTSGDDLEKFFSKEGKVKDCHVVMDPRTKESRGFAFVTMDNIEDARR  166

Query  414  CIKYLNRSVLEGRVITVEKV  473
            CIKYL+R+VLEGR+I+V K 
Sbjct  167  CIKYLHRTVLEGRLISVAKA  186



>emb|CDX75526.1| BnaA01g01760D [Brassica napus]
Length=285

 Score =   127 bits (318),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            + ENPG  LYVTGLSTRV  KDLE HFS EGKV    LV++P TRESRGFAFVTM  ++D
Sbjct  70   EVENPGTTLYVTGLSTRVTDKDLEAHFSKEGKVASCFLVMEPRTRESRGFAFVTMDTVKD  129

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            ADRCIKYLN+SVLEGR ITVE++
Sbjct  130  ADRCIKYLNQSVLEGRYITVERL  152



>gb|KHG21989.1| Scaffold attachment factor B2 [Gossypium arboreum]
Length=175

 Score =   124 bits (310),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DA NPGN LYVTGLS RV ++DLE+HFS EGKV    LV++P TR SRGFAFVTM  +ED
Sbjct  63   DAGNPGNTLYVTGLSQRVTERDLEEHFSKEGKVASCFLVVEPRTRISRGFAFVTMDSVED  122

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            A RCIKYLN+S+LEGR ITVE+
Sbjct  123  ASRCIKYLNQSILEGRFITVER  144



>gb|AFW62092.1| hypothetical protein ZEAMMB73_489339 [Zea mays]
Length=191

 Score =   124 bits (311),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +3

Query  234  NPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDADR  413
            NPGNNLYVTGLSTRV + DLEK FS EGKV++ H+V+DP T+ESRGFAFVTM  LE A R
Sbjct  83   NPGNNLYVTGLSTRVTEDDLEKFFSKEGKVKNCHVVLDPRTKESRGFAFVTMDTLEGARR  142

Query  414  CIKYLNRSVLEGRVITVEKVN  476
             IKYL+R+VLEGR++TVEK N
Sbjct  143  SIKYLHRTVLEGRLVTVEKFN  163



>ref|XP_009150254.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Brassica 
rapa]
Length=221

 Score =   125 bits (313),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  231  ENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDAD  410
            ENPG  LYVTGLSTRV  KDLE HFS EGKV    LV++P TRESRGFAFVTM  ++DAD
Sbjct  63   ENPGTTLYVTGLSTRVTDKDLESHFSKEGKVASCFLVMEPRTRESRGFAFVTMDTVKDAD  122

Query  411  RCIKYLNRSVLEGRVITVEK  470
            RCIKYLN+SVLEGR ITVE+
Sbjct  123  RCIKYLNQSVLEGRYITVER  142



>ref|XP_004973345.1| PREDICTED: serine/arginine-rich splicing factor 2-like isoform 
X1 [Setaria italica]
 ref|XP_004973346.1| PREDICTED: serine/arginine-rich splicing factor 2-like isoform 
X2 [Setaria italica]
 ref|XP_004973347.1| PREDICTED: serine/arginine-rich splicing factor 2-like isoform 
X3 [Setaria italica]
Length=283

 Score =   126 bits (317),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  234  NPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDADR  413
            NPGNNLYVTGLSTRV + DLEK FS EGKV++ H+V+DP ++ESRGFAFVTM  +EDA R
Sbjct  86   NPGNNLYVTGLSTRVTEDDLEKFFSKEGKVKNCHVVLDPRSKESRGFAFVTMDTVEDARR  145

Query  414  CIKYLNRSVLEGRVITVEKV  473
            CIKYL+R+VLEGR++TVEK 
Sbjct  146  CIKYLHRTVLEGRLVTVEKA  165



>ref|XP_010089074.1| Uncharacterized RNA-binding protein [Morus notabilis]
 gb|EXB37321.1| Uncharacterized RNA-binding protein [Morus notabilis]
Length=314

 Score =   127 bits (319),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +3

Query  228  AENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDA  407
            A+NPGNNLYVTGLSTRV   DLEK F  EGKV   HLV DP T+ESRGF FVTM  +EDA
Sbjct  152  ADNPGNNLYVTGLSTRVTTSDLEKFFGKEGKVVACHLVTDPHTKESRGFGFVTMETVEDA  211

Query  408  DRCIKYLNRSVLEGRVITVEKV  473
            DRCIK LNRSVLEGR++TVEK 
Sbjct  212  DRCIKQLNRSVLEGRLVTVEKA  233



>ref|XP_006282702.1| hypothetical protein CARUB_v10005648mg [Capsella rubella]
 gb|EOA15600.1| hypothetical protein CARUB_v10005648mg [Capsella rubella]
Length=185

 Score =   124 bits (310),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            + ENPG  LYVTGLSTRV  KDLE HFS EGKV    LV++P TR SRGFAFVTM  L+D
Sbjct  64   EVENPGTTLYVTGLSTRVTDKDLEAHFSKEGKVASCFLVMEPRTRVSRGFAFVTMDSLKD  123

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            A+RCIKYLN+SVLEGR ITVE+
Sbjct  124  AERCIKYLNQSVLEGRYITVER  145



>ref|NP_001190929.1| RNA-binding (RRM/RBD/RNP motifs) family protein [Arabidopsis 
thaliana]
 gb|AEE86568.1| RNA-binding (RRM/RBD/RNP motifs) family protein [Arabidopsis 
thaliana]
Length=201

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            + ENPG  LYVTGLSTRV  KDLE HF+ EGKV    LV++P TR SRGFAFVTMS L+D
Sbjct  80   EVENPGTTLYVTGLSTRVTDKDLEAHFAKEGKVASCFLVMEPRTRVSRGFAFVTMSSLKD  139

Query  405  ADRCIKYLNRSVLEGRVITVEKVNCH  482
            A+RCIKYLN+SVLEGR ITVE+   H
Sbjct  140  AERCIKYLNQSVLEGRYITVERKILH  165



>gb|EPS65363.1| hypothetical protein M569_09415 [Genlisea aurea]
Length=198

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            +A NPGN LYVTGLSTRV ++DLE HFS EGKV+ V LV++P +R SRGFAF+TM  +ED
Sbjct  96   EAINPGNGLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRISRGFAFITMESVED  155

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+RCIK+LN+SVLEGR ITVE+V
Sbjct  156  ANRCIKHLNQSVLEGRYITVERV  178



>gb|KDO71363.1| hypothetical protein CISIN_1g026421mg [Citrus sinensis]
Length=187

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  234  NPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDADR  413
            NPGN LYVTGLSTRV ++DLEKHFS EGKV    LV++P TR SRGFAFVTM  +EDA+R
Sbjct  17   NPGNTLYVTGLSTRVTERDLEKHFSKEGKVASCFLVVEPRTRISRGFAFVTMDGVEDAER  76

Query  414  CIKYLNRSVLEGRVITVEK  470
            CIKYLN+SVLEGR ITVE+
Sbjct  77   CIKYLNQSVLEGRYITVER  95



>ref|XP_010935769.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Elaeis 
guineensis]
Length=203

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D  NPGNNLYVTGLS RV   DLEK+FS EG+V++ H+V DP T+ESRGF FVTM  + D
Sbjct  43   DTRNPGNNLYVTGLSARVTSSDLEKYFSKEGRVQECHVVKDPRTKESRGFGFVTMETVGD  102

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            AD CIKYLN SVLEGR+ITVEK 
Sbjct  103  ADCCIKYLNHSVLEGRLITVEKA  125



>ref|NP_001190930.1| RNA-binding (RRM/RBD/RNP motifs) family protein [Arabidopsis 
thaliana]
 gb|AEE86569.1| RNA-binding (RRM/RBD/RNP motifs) family protein [Arabidopsis 
thaliana]
Length=244

 Score =   124 bits (312),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            + ENPG  LYVTGLSTRV  KDLE HF+ EGKV    LV++P TR SRGFAFVTMS L+D
Sbjct  80   EVENPGTTLYVTGLSTRVTDKDLEAHFAKEGKVASCFLVMEPRTRVSRGFAFVTMSSLKD  139

Query  405  ADRCIKYLNRSVLEGRVITVEKVNCH  482
            A+RCIKYLN+SVLEGR ITVE+   H
Sbjct  140  AERCIKYLNQSVLEGRYITVERKILH  165



>ref|XP_009408202.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Musa 
acuminata subsp. malaccensis]
Length=232

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            +A NPGN LYVTGLS+RV +++LE HFS EGKV   HLV++P TR SRGFAFVTM   ED
Sbjct  54   EAVNPGNTLYVTGLSSRVTERELEDHFSREGKVVGCHLVVEPRTRVSRGFAFVTMDAAED  113

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            ADRCIKYLN+S+LEGR ITVEK
Sbjct  114  ADRCIKYLNQSILEGRYITVEK  135



>ref|XP_009400377.1| PREDICTED: serine/arginine-rich splicing factor SR45a [Musa acuminata 
subsp. malaccensis]
Length=223

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            +A NPGN LYVTGLS+RV ++DLE HFS EGKV + +L+++P TR SRGFAFVTM  +E 
Sbjct  47   NATNPGNTLYVTGLSSRVTERDLESHFSREGKVSECYLIVEPRTRVSRGFAFVTMDTVEG  106

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            ADRCIKYLN+SVLEGR ITVEK
Sbjct  107  ADRCIKYLNQSVLEGRYITVEK  128



>ref|XP_006425348.1| hypothetical protein CICLE_v10026375mg [Citrus clementina]
 gb|ESR38588.1| hypothetical protein CICLE_v10026375mg [Citrus clementina]
Length=238

 Score =   124 bits (311),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  234  NPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDADR  413
            NPGN LYVTGLSTRV ++DLEKHFS EGKV    LV++P TR SRGFAFVTM  +EDA+R
Sbjct  68   NPGNTLYVTGLSTRVTERDLEKHFSKEGKVASCFLVVEPRTRISRGFAFVTMDSVEDAER  127

Query  414  CIKYLNRSVLEGRVITVEK  470
            CIKYLN+SVLEGR ITVE+
Sbjct  128  CIKYLNQSVLEGRYITVER  146



>ref|XP_006467033.1| PREDICTED: transformer-2 protein homolog beta-like [Citrus sinensis]
Length=238

 Score =   124 bits (310),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  234  NPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDADR  413
            NPGN LYVTGLSTRV ++DLEKHFS EGKV    LV++P TR SRGFAFVTM  +EDA+R
Sbjct  68   NPGNTLYVTGLSTRVTERDLEKHFSKEGKVASCFLVVEPRTRISRGFAFVTMDSVEDAER  127

Query  414  CIKYLNRSVLEGRVITVEK  470
            CIKYLN+SVLEGR ITVE+
Sbjct  128  CIKYLNQSVLEGRYITVER  146



>emb|CAA70700.1| transformer-SR ribonucleoprotein [Nicotiana tabacum]
Length=235

 Score =   124 bits (310),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            +  NPGN LYVTGLSTRV ++DLE+HFS EGKV+ V LV++P +R SRGFAF+TM  LED
Sbjct  60   EVSNPGNTLYVTGLSTRVTERDLEEHFSKEGKVKSVFLVVEPRSRISRGFAFITMDSLED  119

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            A+RCIK+LN+SVLEGR ITVEK
Sbjct  120  ANRCIKHLNQSVLEGRYITVEK  141



>ref|XP_010526825.1| PREDICTED: serine/arginine-rich splicing factor SR45a [Tarenaya 
hassleriana]
Length=226

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            + ENPGN LYVTGLSTRV ++DLE+HFS EGKV    LV++P TR SRGFAFVTM   ED
Sbjct  63   EVENPGNTLYVTGLSTRVTERDLEEHFSKEGKVSSCFLVVEPRTRVSRGFAFVTMETYED  122

Query  405  ADRCIKYLNRSVLEGRVITVE  467
            ADRCIKYLN+SVLEGR ITVE
Sbjct  123  ADRCIKYLNQSVLEGRYITVE  143



>emb|CDX69165.1| BnaC01g02880D [Brassica napus]
Length=268

 Score =   124 bits (312),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            + ENPG  LYVTGLSTRV  KDLE HFS EGKV    LV++P TRESRGFAFVTM  ++D
Sbjct  92   EVENPGTTLYVTGLSTRVTDKDLEAHFSKEGKVASCFLVMEPRTRESRGFAFVTMDSVKD  151

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            ADRCIKYLN+SVLEGR ITVE+
Sbjct  152  ADRCIKYLNQSVLEGRYITVER  173



>gb|KDO71362.1| hypothetical protein CISIN_1g026421mg [Citrus sinensis]
Length=238

 Score =   124 bits (310),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  234  NPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDADR  413
            NPGN LYVTGLSTRV ++DLEKHFS EGKV    LV++P TR SRGFAFVTM  +EDA+R
Sbjct  68   NPGNTLYVTGLSTRVTERDLEKHFSKEGKVASCFLVVEPRTRISRGFAFVTMDGVEDAER  127

Query  414  CIKYLNRSVLEGRVITVEK  470
            CIKYLN+SVLEGR ITVE+
Sbjct  128  CIKYLNQSVLEGRYITVER  146



>ref|XP_006409259.1| hypothetical protein EUTSA_v10022831mg [Eutrema salsugineum]
 gb|ESQ50712.1| hypothetical protein EUTSA_v10022831mg [Eutrema salsugineum]
Length=235

 Score =   123 bits (309),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            + ENPGN LYVTGLSTRV +++LE HFS EGKV    LV++P TR SRGFAFVTM   ED
Sbjct  65   ETENPGNTLYVTGLSTRVTERELETHFSKEGKVASCFLVVEPRTRVSRGFAFVTMDSYED  124

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            ADRCIKYLN+SVLEGR ITVE+
Sbjct  125  ADRCIKYLNQSVLEGRYITVER  146



>emb|CDY10270.1| BnaC05g05130D [Brassica napus]
Length=356

 Score =   126 bits (316),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DAENPGN+LYVTGLS RV ++DLE HFS EGKV DVHLV+DP TRE RGF F++M  + D
Sbjct  39   DAENPGNSLYVTGLSHRVTERDLEDHFSEEGKVTDVHLVLDPRTREPRGFGFISMETVGD  98

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+RCI++L+ SVL GRVITVEK 
Sbjct  99   ANRCIRHLDHSVLMGRVITVEKA  121



>gb|AAF79558.1|AC022464_16 F22G5.31 [Arabidopsis thaliana]
Length=415

 Score =   127 bits (318),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 71/86 (83%), Gaps = 3/86 (3%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKV---EDVHLVIDPWTRESRGFAFVTMSK  395
            DAENPGN+LYVTGLS RV ++DLE HF+ EGKV    DVHLV+DPWTRESRGF F++M  
Sbjct  101  DAENPGNSLYVTGLSHRVTERDLEDHFAKEGKVVDVTDVHLVLDPWTRESRGFGFISMKS  160

Query  396  LEDADRCIKYLNRSVLEGRVITVEKV  473
            + DA+RCI+ L+ SVL+GRVITVEK 
Sbjct  161  VGDANRCIRSLDHSVLQGRVITVEKA  186



>gb|AAY84876.1| alternative splicing regulator [Triticum aestivum]
Length=250

 Score =   124 bits (310),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D  NPGNNLYVTGLSTR ++ DLEK FS EGKV+D  +VIDP T+ESR FAFVTM  +ED
Sbjct  109  DVRNPGNNLYVTGLSTRTQETDLEKFFSKEGKVKDCRVVIDPRTKESRDFAFVTMENVED  168

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A RCIKYL+R+VLEGR+I+V K 
Sbjct  169  ARRCIKYLHRTVLEGRLISVAKA  191



>ref|NP_680768.5| RNA-binding (RRM/RBD/RNP motifs) family protein [Arabidopsis 
thaliana]
 gb|AEE86565.1| RNA-binding (RRM/RBD/RNP motifs) family protein [Arabidopsis 
thaliana]
Length=238

 Score =   123 bits (309),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            + ENPG  LYVTGLSTRV  KDLE HF+ EGKV    LV++P TR SRGFAFVTMS L+D
Sbjct  65   EVENPGTTLYVTGLSTRVTDKDLEAHFAKEGKVASCFLVMEPRTRVSRGFAFVTMSSLKD  124

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            A+RCIKYLN+SVLEGR ITVE+
Sbjct  125  AERCIKYLNQSVLEGRYITVER  146



>ref|NP_974690.4| RNA-binding (RRM/RBD/RNP motifs) family protein [Arabidopsis 
thaliana]
 gb|AAZ23933.1| At4g35785 [Arabidopsis thaliana]
 gb|AEE86566.1| RNA-binding (RRM/RBD/RNP motifs) family protein [Arabidopsis 
thaliana]
Length=239

 Score =   123 bits (308),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            + ENPG  LYVTGLSTRV  KDLE HF+ EGKV    LV++P TR SRGFAFVTMS L+D
Sbjct  66   EVENPGTTLYVTGLSTRVTDKDLEAHFAKEGKVASCFLVMEPRTRVSRGFAFVTMSSLKD  125

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            A+RCIKYLN+SVLEGR ITVE+
Sbjct  126  AERCIKYLNQSVLEGRYITVER  147



>ref|XP_002867054.1| hypothetical protein ARALYDRAFT_912788 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43313.1| hypothetical protein ARALYDRAFT_912788 [Arabidopsis lyrata subsp. 
lyrata]
Length=160

 Score =   120 bits (302),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            + ENPG  LYVTGLSTRV  KDLE HF+ EGKV    LV++P TR SRGFAFVTM  ++D
Sbjct  47   EVENPGTTLYVTGLSTRVTDKDLEAHFAKEGKVASCFLVMEPRTRVSRGFAFVTMDSVKD  106

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            A+RCIKYLN+SVLEGR ITVE+
Sbjct  107  AERCIKYLNQSVLEGRYITVER  128



>ref|XP_010235085.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Brachypodium 
distachyon]
 ref|XP_010235086.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Brachypodium 
distachyon]
Length=314

 Score =   125 bits (313),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D  NPGNNLYVTGLSTRV + +LEK FS+EGKV++ H+V+DP T+ESRGFAFV+M  +ED
Sbjct  82   DLRNPGNNLYVTGLSTRVTEAELEKFFSTEGKVKNCHVVLDPRTKESRGFAFVSMDTVED  141

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A RCIK L+R+VLEGR++TVEK 
Sbjct  142  ARRCIKRLHRTVLEGRLVTVEKA  164



>ref|XP_006425350.1| hypothetical protein CICLE_v10026375mg [Citrus clementina]
 gb|ESR38590.1| hypothetical protein CICLE_v10026375mg [Citrus clementina]
Length=236

 Score =   122 bits (307),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  234  NPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDADR  413
            NPGN LYVTGLSTRV ++DLEKHFS EGKV    LV++P TR SRGFAFVTM  +EDA+R
Sbjct  68   NPGNTLYVTGLSTRVTERDLEKHFSKEGKVASCFLVVEPRTRISRGFAFVTMDSVEDAER  127

Query  414  CIKYLNRSVLEGRVITVEK  470
            CIKYLN+SVLEGR ITVE+
Sbjct  128  CIKYLNQSVLEGRYITVER  146



>ref|XP_010918157.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X2 [Elaeis guineensis]
Length=237

 Score =   122 bits (307),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  234  NPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDADR  413
            NPGN LYVTGLS+RV ++DLE HFS EGKV+   LV++P TR SRGFAFVTM  +EDADR
Sbjct  44   NPGNTLYVTGLSSRVTERDLEYHFSKEGKVKGCFLVVEPRTRVSRGFAFVTMDTVEDADR  103

Query  414  CIKYLNRSVLEGRVITVEK  470
            C+KYLN+SVLEGR ITVEK
Sbjct  104  CVKYLNQSVLEGRYITVEK  122



>ref|XP_010918156.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X1 [Elaeis guineensis]
Length=246

 Score =   123 bits (308),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  234  NPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDADR  413
            NPGN LYVTGLS+RV ++DLE HFS EGKV+   LV++P TR SRGFAFVTM  +EDADR
Sbjct  53   NPGNTLYVTGLSSRVTERDLEYHFSKEGKVKGCFLVVEPRTRVSRGFAFVTMDTVEDADR  112

Query  414  CIKYLNRSVLEGRVITVEK  470
            C+KYLN+SVLEGR ITVEK
Sbjct  113  CVKYLNQSVLEGRYITVEK  131



>ref|XP_006343342.1| PREDICTED: transformer-2 protein homolog alpha-like [Solanum 
tuberosum]
Length=241

 Score =   122 bits (307),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  234  NPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDADR  413
            NPG  LYVTGLSTRV Q+DLE+HFS EGKV+   LV++P +R SRGFAF+TM  LEDADR
Sbjct  59   NPGATLYVTGLSTRVTQRDLEEHFSKEGKVKSAFLVVEPRSRISRGFAFITMDSLEDADR  118

Query  414  CIKYLNRSVLEGRVITVEK  470
            CIK+LN+SVLEGR ITVEK
Sbjct  119  CIKHLNQSVLEGRYITVEK  137



>ref|XP_011079075.1| PREDICTED: serine/arginine-rich splicing factor SR45a [Sesamum 
indicum]
Length=232

 Score =   122 bits (307),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DA NPGN LYVTGLSTRV ++DLE HFS EGKV+ V LV++P +R SRGFAF+TM  LED
Sbjct  59   DAVNPGNTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRISRGFAFITMDCLED  118

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            A+RCIK+LN+SVLEGR ITVE+
Sbjct  119  ANRCIKHLNQSVLEGRYITVER  140



>ref|XP_010437422.1| PREDICTED: serine/arginine-rich splicing factor SR45a [Camelina 
sativa]
Length=235

 Score =   122 bits (306),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            + ENPG  LYVTGLSTRV  KDLE HFS EGKV    LV++P TR SRGFAFVTM  L+D
Sbjct  66   EVENPGTTLYVTGLSTRVTDKDLESHFSKEGKVASCFLVMEPRTRVSRGFAFVTMDSLKD  125

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            A+RCIKYLN+SVLEGR ITVE+
Sbjct  126  AERCIKYLNQSVLEGRYITVER  147



>ref|XP_004232529.1| PREDICTED: serine/arginine-rich splicing factor SR45a [Solanum 
lycopersicum]
Length=228

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  234  NPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDADR  413
            NPGN LYVTGLS+RV Q+DLE+HFS EGKV+   LV++P +R SRGFAF+TM  LEDA+R
Sbjct  50   NPGNTLYVTGLSSRVTQRDLEEHFSKEGKVKSAFLVVEPRSRISRGFAFITMDSLEDANR  109

Query  414  CIKYLNRSVLEGRVITVEK  470
            CIK+LN+SVLEGR ITVEK
Sbjct  110  CIKHLNQSVLEGRSITVEK  128



>gb|EYU30367.1| hypothetical protein MIMGU_mgv1a012795mg [Erythranthe guttata]
Length=172

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DA NPG  LYVTGLSTR  ++DLE HFS EGKV+ V LV++P TR SRGFAFVTM  +ED
Sbjct  59   DAVNPGITLYVTGLSTRATERDLEDHFSKEGKVKSVFLVVEPRTRISRGFAFVTMETVED  118

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            A+RCIK+LN+SVLEGR ITVE+
Sbjct  119  ANRCIKHLNQSVLEGRYITVER  140



>ref|XP_006282703.1| hypothetical protein CARUB_v10005648mg [Capsella rubella]
 gb|EOA15601.1| hypothetical protein CARUB_v10005648mg [Capsella rubella]
Length=232

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            + ENPG  LYVTGLSTRV  KDLE HFS EGKV    LV++P TR SRGFAFVTM  L+D
Sbjct  64   EVENPGTTLYVTGLSTRVTDKDLEAHFSKEGKVASCFLVMEPRTRVSRGFAFVTMDSLKD  123

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            A+RCIKYLN+SVLEGR ITVE+
Sbjct  124  AERCIKYLNQSVLEGRYITVER  145



>ref|NP_001238379.1| uncharacterized protein LOC100499944 [Glycine max]
 gb|ACU14296.1| unknown [Glycine max]
Length=164

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            +  NPG+ LYVTGLS+RV ++DLE+HFS EGKV    LV++P TR SRGFAFVTM   ED
Sbjct  65   EPSNPGDTLYVTGLSSRVTERDLEEHFSKEGKVSSCFLVVEPRTRISRGFAFVTMESAED  124

Query  405  ADRCIKYLNRSVLEGRVITVEKVNCH  482
            A+RCIKYLN+SVLEGR IT+E+   H
Sbjct  125  AERCIKYLNQSVLEGRYITIERNALH  150



>gb|ACF82503.1| unknown [Zea mays]
 gb|ACL54810.1| unknown [Zea mays]
 gb|AFW62089.1| arginine/serine-rich splicing factor 10 isoform 1 [Zea mays]
 gb|AFW62090.1| arginine/serine-rich splicing factor 10 isoform 2 [Zea mays]
 gb|AFW62091.1| arginine/serine-rich splicing factor 10 isoform 3 [Zea mays]
Length=295

 Score =   123 bits (309),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  234  NPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDADR  413
            NPGNNLYVTGLSTRV + DLEK FS EGKV++ H+V+DP T+ESRGFAFVTM  LE A R
Sbjct  83   NPGNNLYVTGLSTRVTEDDLEKFFSKEGKVKNCHVVLDPRTKESRGFAFVTMDTLEGARR  142

Query  414  CIKYLNRSVLEGRVITVEKV  473
             IKYL+R+VLEGR++TVEK 
Sbjct  143  SIKYLHRTVLEGRLVTVEKA  162



>ref|XP_010033540.1| PREDICTED: serine/arginine-rich splicing factor SR45a [Eucalyptus 
grandis]
 gb|KCW53228.1| hypothetical protein EUGRSUZ_J02495 [Eucalyptus grandis]
Length=236

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D  NPGN LYVTGLSTRV ++DLE HFS EGKV    LV++P TR SRGFAF+TM  +ED
Sbjct  58   DENNPGNALYVTGLSTRVTERDLEDHFSKEGKVASCFLVVEPRTRISRGFAFITMETVED  117

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            A+RC+KYLN+SVLEGR ITVEK
Sbjct  118  ANRCVKYLNQSVLEGRYITVEK  139



>ref|NP_001148693.1| LOC100282309 [Zea mays]
 gb|ACG32556.1| arginine/serine-rich splicing factor 10 [Zea mays]
Length=295

 Score =   123 bits (309),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  234  NPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDADR  413
            NPGNNLYVTGLSTRV + DLEK FS EGKV++ H+V+DP T+ESRGFAFVTM  LE A R
Sbjct  83   NPGNNLYVTGLSTRVTEDDLEKFFSKEGKVKNCHVVLDPRTKESRGFAFVTMDTLEGARR  142

Query  414  CIKYLNRSVLEGRVITVEKV  473
             IKYL+R+VLEGR++TVEK 
Sbjct  143  SIKYLHRTVLEGRLVTVEKA  162



>ref|NP_001238605.1| uncharacterized protein LOC100527350 [Glycine max]
 gb|ACU16425.1| unknown [Glycine max]
Length=174

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            +A+N G  LYVTGLS+RV ++DLE+HFS EGKV    LV++P TR SRGFAF+TM  +ED
Sbjct  63   EAKNAGTTLYVTGLSSRVTERDLEEHFSKEGKVASCFLVVEPRTRISRGFAFITMDTVED  122

Query  405  ADRCIKYLNRSVLEGRVITVEKVNCH  482
            A+RCIKYLN+SVLEGR ITVE+   H
Sbjct  123  ANRCIKYLNQSVLEGRYITVERNTLH  148



>ref|XP_008791954.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Phoenix 
dactylifera]
Length=227

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  234  NPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDADR  413
            NPGN LYVTGLS+RV ++DLE HFS EGKV+   LV++P TR SRGFAFVTM+ +E ADR
Sbjct  49   NPGNTLYVTGLSSRVTERDLEYHFSKEGKVKGCFLVVEPRTRVSRGFAFVTMNTVEGADR  108

Query  414  CIKYLNRSVLEGRVITVEK  470
            C+KYLN+SVLEGR ITVEK
Sbjct  109  CVKYLNQSVLEGRYITVEK  127



>ref|XP_008806158.1| PREDICTED: serine/arginine-rich splicing factor SR45a [Phoenix 
dactylifera]
Length=237

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DA NPGN LYVTGLS+RV  +DLE HFS EGKV    LV++P TR SRGFAFVTM   ED
Sbjct  54   DARNPGNTLYVTGLSSRVTDRDLEDHFSREGKVVGCRLVVEPRTRISRGFAFVTMDTTED  113

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            A+RC+KYLN+SVLEGR ITVEK
Sbjct  114  AERCVKYLNQSVLEGRYITVEK  135



>ref|XP_009788034.1| PREDICTED: serine/arginine-rich splicing factor SR45a isoform 
X1 [Nicotiana sylvestris]
Length=231

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            +  NPGN LYVTGLSTRV ++DLE+HFS EGKV+ V LV++P +R SRGFAF+TM  LED
Sbjct  51   EVSNPGNTLYVTGLSTRVTERDLEEHFSKEGKVKSVFLVVEPRSRISRGFAFITMDSLED  110

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            A+RCIK LN+SVLEGR ITVEK
Sbjct  111  ANRCIKNLNQSVLEGRYITVEK  132



>ref|XP_009387324.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Musa 
acuminata subsp. malaccensis]
Length=238

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            +  N GN LYVTGLS+RV ++DLE HFS EGKV   HLV++P TR SRGFAFVTM   ED
Sbjct  54   ETANHGNTLYVTGLSSRVTERDLEDHFSREGKVVGCHLVVEPRTRASRGFAFVTMDTTED  113

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            ADRCIKYLN+S+LEGR ITVEK
Sbjct  114  ADRCIKYLNQSILEGRCITVEK  135



>ref|XP_010935190.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X3 [Elaeis guineensis]
Length=192

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            +A NPGN LYVTGLS+RV ++DLE HFS EGKV    LV++P TR SRGFAFVTM   ED
Sbjct  10   EARNPGNTLYVTGLSSRVTERDLEDHFSREGKVVGCRLVVEPRTRISRGFAFVTMDTNED  69

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            A+RCIKYLN+SVLEGR ITVEK
Sbjct  70   AERCIKYLNQSVLEGRYITVEK  91



>ref|XP_009788035.1| PREDICTED: serine/arginine-rich splicing factor SR45a isoform 
X2 [Nicotiana sylvestris]
Length=218

 Score =   121 bits (303),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            +  NPGN LYVTGLSTRV ++DLE+HFS EGKV+ V LV++P +R SRGFAF+TM  LED
Sbjct  51   EVSNPGNTLYVTGLSTRVTERDLEEHFSKEGKVKSVFLVVEPRSRISRGFAFITMDSLED  110

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            A+RCIK LN+SVLEGR ITVEK
Sbjct  111  ANRCIKNLNQSVLEGRYITVEK  132



>ref|XP_010055674.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Eucalyptus 
grandis]
 gb|KCW72183.1| hypothetical protein EUGRSUZ_E00636 [Eucalyptus grandis]
Length=249

 Score =   121 bits (304),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  234  NPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDADR  413
            NPGNNLYVTGLSTRV  +DLEK+FS EGKV +  LV DP T++SRGF FVTM   +DA+R
Sbjct  87   NPGNNLYVTGLSTRVTSRDLEKYFSKEGKVLECQLVTDPRTKDSRGFGFVTMETNKDAER  146

Query  414  CIKYLNRSVLEGRVITVEKV  473
            CIKYLN+SV EGR+ITVEK 
Sbjct  147  CIKYLNQSVFEGRLITVEKA  166



>ref|XP_006412060.1| hypothetical protein EUTSA_v10026015mg [Eutrema salsugineum]
 gb|ESQ53513.1| hypothetical protein EUTSA_v10026015mg [Eutrema salsugineum]
Length=260

 Score =   121 bits (304),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  231  ENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDAD  410
            ENPG  LYVTGLSTRV  KDLE HFS EGKV    LV++P TR SRGFAFVTM  L+DA+
Sbjct  69   ENPGTTLYVTGLSTRVTDKDLETHFSKEGKVASCFLVMEPRTRVSRGFAFVTMDSLKDAE  128

Query  411  RCIKYLNRSVLEGRVITVEK  470
            RCIKYLN+SVLEGR ITVE+
Sbjct  129  RCIKYLNQSVLEGRYITVER  148



>ref|XP_007202500.1| hypothetical protein PRUPE_ppa010685mg [Prunus persica]
 gb|EMJ03699.1| hypothetical protein PRUPE_ppa010685mg [Prunus persica]
Length=240

 Score =   121 bits (303),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +3

Query  228  AENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDA  407
            A NPGN LYVTGLSTRV +KD+E+HFS EGKV    LV++P TR SRGFAFVTM  +EDA
Sbjct  62   AINPGNTLYVTGLSTRVSEKDVERHFSKEGKVASCFLVVEPRTRISRGFAFVTMDSVEDA  121

Query  408  DRCIKYLNRSVLEGRVITVEK  470
            +RCIK+LN+SVLEGR ITVE+
Sbjct  122  ERCIKHLNQSVLEGRYITVER  142



>ref|XP_002992560.1| hypothetical protein SELMODRAFT_49595, partial [Selaginella moellendorffii]
 gb|EFJ06366.1| hypothetical protein SELMODRAFT_49595, partial [Selaginella moellendorffii]
Length=79

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +3

Query  234  NPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDADR  413
            NPGNNLYVTGLSTRV +  LE++F+ EGKV +  LV DP TRESRGF FVTM  +EDADR
Sbjct  1    NPGNNLYVTGLSTRVTESWLEEYFAKEGKVIECCLVTDPLTRESRGFGFVTMDTVEDADR  60

Query  414  CIKYLNRSVLEGRVITVEK  470
            CIKYL+RS L+GR ITVEK
Sbjct  61   CIKYLHRSNLDGRSITVEK  79



>gb|KDP43705.1| hypothetical protein JCGZ_22332 [Jatropha curcas]
Length=227

 Score =   120 bits (301),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DA NPGN LYVTGLSTRV ++DLE+HFS EGKV    LV++P TR SRGFAFVTM  +E 
Sbjct  63   DAINPGNTLYVTGLSTRVTERDLEEHFSKEGKVASCFLVVEPRTRISRGFAFVTMDNVEA  122

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            A+RC+K+LN+SVLEGR ITVEK
Sbjct  123  ANRCVKHLNQSVLEGRYITVEK  144



>ref|XP_011022229.1| PREDICTED: serine/arginine-rich splicing factor SR45a [Populus 
euphratica]
Length=236

 Score =   120 bits (301),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  234  NPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDADR  413
            NPGN LYVTGLSTRV ++DLE+HFS EGKV    LV++P TR SRGFAFVTM  ++DA+R
Sbjct  68   NPGNTLYVTGLSTRVTERDLEEHFSKEGKVASCFLVVEPRTRISRGFAFVTMDNVDDANR  127

Query  414  CIKYLNRSVLEGRVITVEK  470
            C+KYLN+SVLEGR ITVEK
Sbjct  128  CVKYLNQSVLEGRYITVEK  146



>ref|XP_010935189.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X2 [Elaeis guineensis]
Length=236

 Score =   120 bits (301),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            +A NPGN LYVTGLS+RV ++DLE HFS EGKV    LV++P TR SRGFAFVTM   ED
Sbjct  54   EARNPGNTLYVTGLSSRVTERDLEDHFSREGKVVGCRLVVEPRTRISRGFAFVTMDTNED  113

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            A+RCIKYLN+SVLEGR ITVEK
Sbjct  114  AERCIKYLNQSVLEGRYITVEK  135



>ref|XP_010676454.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Beta 
vulgaris subsp. vulgaris]
Length=214

 Score =   119 bits (299),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 65/83 (78%), Gaps = 0/83 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DA NPGNNLYVTGLSTRV   DLEK    EGKV +  LV DP T+ESRGFAFVTM   E 
Sbjct  43   DASNPGNNLYVTGLSTRVTNSDLEKFCGKEGKVLECCLVTDPRTKESRGFAFVTMETREG  102

Query  405  ADRCIKYLNRSVLEGRVITVEKV  473
            A+RCIKYLNR+VLEGR++TVEK 
Sbjct  103  AERCIKYLNRTVLEGRLVTVEKA  125



>ref|XP_008393698.1| PREDICTED: transformer-2 protein homolog beta isoform X1 [Malus 
domestica]
Length=244

 Score =   120 bits (301),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +3

Query  228  AENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDA  407
            A NPGN LYVTGLSTRV +KD+E+HFS EGKV    LV++P TR SRGFAFVTM  +EDA
Sbjct  65   AINPGNTLYVTGLSTRVSEKDVERHFSKEGKVASCFLVMEPRTRISRGFAFVTMDSVEDA  124

Query  408  DRCIKYLNRSVLEGRVITVEK  470
            +RCIK+LN+SVLEGR ITVE+
Sbjct  125  ERCIKHLNQSVLEGRYITVER  145



>ref|XP_008393706.1| PREDICTED: transformer-2 protein homolog beta isoform X2 [Malus 
domestica]
Length=242

 Score =   120 bits (301),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +3

Query  228  AENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDA  407
            A NPGN LYVTGLSTRV +KD+E+HFS EGKV    LV++P TR SRGFAFVTM  +EDA
Sbjct  63   AINPGNTLYVTGLSTRVSEKDVERHFSKEGKVASCFLVMEPRTRISRGFAFVTMDSVEDA  122

Query  408  DRCIKYLNRSVLEGRVITVEK  470
            +RCIK+LN+SVLEGR ITVE+
Sbjct  123  ERCIKHLNQSVLEGRYITVER  143



>ref|XP_010935188.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X1 [Elaeis guineensis]
Length=239

 Score =   120 bits (300),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            +A NPGN LYVTGLS+RV ++DLE HFS EGKV    LV++P TR SRGFAFVTM   ED
Sbjct  57   EARNPGNTLYVTGLSSRVTERDLEDHFSREGKVVGCRLVVEPRTRISRGFAFVTMDTNED  116

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            A+RCIKYLN+SVLEGR ITVEK
Sbjct  117  AERCIKYLNQSVLEGRYITVEK  138



>ref|XP_009344818.1| PREDICTED: serine/arginine-rich splicing factor SR45a isoform 
X1 [Pyrus x bretschneideri]
Length=248

 Score =   120 bits (301),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +3

Query  228  AENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDA  407
            A NPGN LYVTGLSTRV +KD+E+HFS EGKV    LV++P TR SRGFAFVTM  +EDA
Sbjct  67   AINPGNTLYVTGLSTRVSEKDVERHFSKEGKVASCFLVMEPRTRISRGFAFVTMDSVEDA  126

Query  408  DRCIKYLNRSVLEGRVITVEK  470
            +RCIK+LN+SVLEGR ITVE+
Sbjct  127  ERCIKHLNQSVLEGRYITVER  147



>ref|XP_009344819.1| PREDICTED: serine/arginine-rich splicing factor SR45a isoform 
X2 [Pyrus x bretschneideri]
Length=246

 Score =   120 bits (301),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +3

Query  228  AENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDA  407
            A NPGN LYVTGLSTRV +KD+E+HFS EGKV    LV++P TR SRGFAFVTM  +EDA
Sbjct  65   AINPGNTLYVTGLSTRVSEKDVERHFSKEGKVASCFLVMEPRTRISRGFAFVTMDSVEDA  124

Query  408  DRCIKYLNRSVLEGRVITVEK  470
            +RCIK+LN+SVLEGR ITVE+
Sbjct  125  ERCIKHLNQSVLEGRYITVER  145



>gb|KEH27603.1| RNA-binding (RRM/RBD/RNP motif) family protein [Medicago truncatula]
Length=213

 Score =   119 bits (298),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  240  GNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDADRCI  419
            G+ LYVTGLS+RV ++DLE+HFS EGKV    LV++P TR SRGFAFVTM   EDA+RCI
Sbjct  130  GDTLYVTGLSSRVTERDLEEHFSKEGKVASCFLVVEPRTRISRGFAFVTMDTAEDANRCI  189

Query  420  KYLNRSVLEGRVITVEKVNC  479
            KYLN+S+LEGR ITVE+V C
Sbjct  190  KYLNQSILEGRYITVERVMC  209



>ref|XP_002972503.1| hypothetical protein SELMODRAFT_26372, partial [Selaginella moellendorffii]
 gb|EFJ26589.1| hypothetical protein SELMODRAFT_26372, partial [Selaginella moellendorffii]
Length=107

 Score =   116 bits (290),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  234  NPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDADR  413
            NPGNNLYVTGLSTRV +  LE++F+ EGKV +  LV DP TRESRGF FVTM  +EDADR
Sbjct  8    NPGNNLYVTGLSTRVTESWLEEYFAKEGKVIECCLVTDPLTRESRGFGFVTMDTVEDADR  67

Query  414  CIKYLNRSVLEGRVITVEKV  473
            CIKYL+RS L+GR ITVEK 
Sbjct  68   CIKYLHRSNLDGRSITVEKA  87



>ref|XP_004509406.1| PREDICTED: transformer-2 protein homolog alpha-like [Cicer arietinum]
Length=260

 Score =   120 bits (301),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            +A NPGN LYVTGLS+RV  +DLE+HFS EGKV    LV++P TR SRGFAFVTM   ED
Sbjct  55   NATNPGNTLYVTGLSSRVTDRDLEEHFSKEGKVASCFLVVEPRTRISRGFAFVTMDSPED  114

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            A+RCIKYLN+SVLEGR ITVE+
Sbjct  115  AERCIKYLNQSVLEGRYITVER  136



>gb|ABR46234.1| At4g35785 [Arabidopsis thaliana]
Length=141

 Score =   117 bits (292),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            + ENPG  LYVTGLSTRV  KDLE HF+ EGKV    LV++P TR SRGFAFVTMS L+D
Sbjct  66   EVENPGTTLYVTGLSTRVTDKDLEAHFAKEGKVASCFLVMEPRTRVSRGFAFVTMSSLKD  125

Query  405  ADRCIKYLNRSVLEGR  452
            A+RCIKYLN+SVLEGR
Sbjct  126  AERCIKYLNQSVLEGR  141



>gb|EYU30368.1| hypothetical protein MIMGU_mgv1a012795mg [Erythranthe guttata]
Length=239

 Score =   119 bits (299),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DA NPG  LYVTGLSTR  ++DLE HFS EGKV+ V LV++P TR SRGFAFVTM  +ED
Sbjct  59   DAVNPGITLYVTGLSTRATERDLEDHFSKEGKVKSVFLVVEPRTRISRGFAFVTMETVED  118

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            A+RCIK+LN+SVLEGR ITVE+
Sbjct  119  ANRCIKHLNQSVLEGRYITVER  140



>ref|XP_009109272.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Brassica 
rapa]
Length=243

 Score =   119 bits (299),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  231  ENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDAD  410
            ENPG  LYVTGLSTRV +KDLE +FS EGKV    LV++P TRESRGFAFVTM  ++DA+
Sbjct  69   ENPGTTLYVTGLSTRVTEKDLEAYFSKEGKVASCVLVLEPRTRESRGFAFVTMDSVKDAE  128

Query  411  RCIKYLNRSVLEGRVITVEK  470
            RCIKYLN SVLEGR ITVE+
Sbjct  129  RCIKYLNHSVLEGRYITVER  148



>ref|XP_002530643.1| Arginine/serine-rich-splicing factor, putative [Ricinus communis]
 gb|EEF31751.1| Arginine/serine-rich-splicing factor, putative [Ricinus communis]
Length=248

 Score =   119 bits (299),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            +A NPGN LYVTGLSTRV ++ LE+HF+ EGKV    LV++P TR SRGFAFVTM  +ED
Sbjct  68   EAVNPGNTLYVTGLSTRVTERGLEEHFAKEGKVASCFLVVEPRTRISRGFAFVTMDNVED  127

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            A+RC+KYLN+SVLEGR ITVEK
Sbjct  128  ANRCVKYLNQSVLEGRYITVEK  149



>gb|EYU29909.1| hypothetical protein MIMGU_mgv1a025336mg [Erythranthe guttata]
Length=244

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DA NPG  LYVTGLSTR  ++DLE HFS EGKV+ V LV++P TR SRGFAFVTM  +ED
Sbjct  59   DAVNPGITLYVTGLSTRATERDLEDHFSKEGKVKSVFLVVEPRTRISRGFAFVTMETVED  118

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            A+RCIK+LN+SVLEGR ITVE+
Sbjct  119  ANRCIKHLNQSVLEGRYITVER  140



>ref|XP_010696606.1| PREDICTED: serine/arginine-rich splicing factor SR45a [Beta vulgaris 
subsp. vulgaris]
Length=220

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +3

Query  234  NPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDADR  413
            NPGN L+VTGLS+RV +++LE  F+ EGKV  V LV++P TR SRGFAFVTM  LEDADR
Sbjct  47   NPGNTLFVTGLSSRVTERELEDFFNKEGKVSSVFLVVEPRTRISRGFAFVTMDTLEDADR  106

Query  414  CIKYLNRSVLEGRVITVEK  470
            CIKYLN+SVLEGR ITVEK
Sbjct  107  CIKYLNQSVLEGRYITVEK  125



>ref|XP_004135013.1| PREDICTED: uncharacterized RNA-binding protein C25G10.01-like, 
partial [Cucumis sativus]
Length=238

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +3

Query  228  AENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDA  407
            A NPGN LYVTGLSTRV ++DLE+HFS EGKV    LV++P TR SRGFAFVTM  ++DA
Sbjct  54   ANNPGNTLYVTGLSTRVTERDLEEHFSKEGKVASCFLVVEPRTRISRGFAFVTMDNVDDA  113

Query  408  DRCIKYLNRSVLEGRVITVEK  470
            +RC+K+LN+S+LEGR ITVEK
Sbjct  114  NRCVKHLNQSILEGRYITVEK  134



>emb|CDY20808.1| BnaC07g06570D [Brassica napus]
Length=262

 Score =   119 bits (299),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            +  NPG+ LYVTGLSTRV ++++E HFS EGKV    LV++P TR SRGFAFVTM   ED
Sbjct  94   ETANPGSTLYVTGLSTRVTEREIETHFSKEGKVASCFLVVEPRTRASRGFAFVTMDSYED  153

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            ADRCIKYLN+SVLEGR ITVE+
Sbjct  154  ADRCIKYLNQSVLEGRYITVER  175



>ref|XP_004158852.1| PREDICTED: uncharacterized LOC101219220 [Cucumis sativus]
 gb|KGN48961.1| hypothetical protein Csa_6G507340 [Cucumis sativus]
Length=244

 Score =   119 bits (298),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +3

Query  228  AENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDA  407
            A NPGN LYVTGLSTRV ++DLE+HFS EGKV    LV++P TR SRGFAFVTM  ++DA
Sbjct  60   ANNPGNTLYVTGLSTRVTERDLEEHFSKEGKVASCFLVVEPRTRISRGFAFVTMDNVDDA  119

Query  408  DRCIKYLNRSVLEGRVITVEK  470
            +RC+K+LN+S+LEGR ITVEK
Sbjct  120  NRCVKHLNQSILEGRYITVEK  140



>emb|CBI24453.3| unnamed protein product [Vitis vinifera]
Length=260

 Score =   119 bits (298),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D  NPGN LYVTGLSTRV ++ LE HFS EGKV    LV++P TR SRGFAFVTM  +ED
Sbjct  85   DTSNPGNTLYVTGLSTRVTERALEDHFSREGKVASCFLVMEPRTRISRGFAFVTMETVED  144

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            A+RCIK+LN+SVLEGR ITVEK
Sbjct  145  ANRCIKHLNQSVLEGRYITVEK  166



>ref|XP_006383019.1| hypothetical protein POPTR_0005s10780g [Populus trichocarpa]
 gb|ERP60816.1| hypothetical protein POPTR_0005s10780g [Populus trichocarpa]
Length=223

 Score =   118 bits (296),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +3

Query  234  NPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDADR  413
            NPGN LYVTGLSTRV ++DLE+HFS EGKV    LV++P TR SRGFAFVTM  ++ A+R
Sbjct  55   NPGNTLYVTGLSTRVTERDLEEHFSKEGKVASCFLVVEPRTRISRGFAFVTMDNVDGANR  114

Query  414  CIKYLNRSVLEGRVITVEK  470
            C+KYLN+SVLEGR ITVEK
Sbjct  115  CVKYLNQSVLEGRYITVEK  133



>dbj|BAJ99477.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86812.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93566.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=247

 Score =   118 bits (296),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  234  NPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDADR  413
            NPGNNLYVTGLS R ++ DLEK FS EGKV+D  +V DP T+ESRGFAFVTM  +EDA R
Sbjct  105  NPGNNLYVTGLSIRTQETDLEKFFSKEGKVKDCRVVTDPRTKESRGFAFVTMENVEDARR  164

Query  414  CIKYLNRSVLEGRVITVEKV  473
            CIKYL+ +VLEGR+I+V K 
Sbjct  165  CIKYLHHTVLEGRLISVAKA  184



>gb|KHN35554.1| Putative RNA-binding protein C25G10.01 [Glycine soja]
Length=240

 Score =   118 bits (296),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            +  NPG+ LYVTGLS+RV ++DLE+HFS EGKV    LV++P TR SRGFAFVTM   ED
Sbjct  65   EPSNPGDTLYVTGLSSRVTERDLEEHFSKEGKVSSCFLVVEPRTRISRGFAFVTMESAED  124

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            A+RCIKYLN+SVLEGR IT+E+
Sbjct  125  AERCIKYLNQSVLEGRYITIER  146



>ref|XP_006383020.1| hypothetical protein POPTR_0005s10780g [Populus trichocarpa]
 gb|ERP60817.1| hypothetical protein POPTR_0005s10780g [Populus trichocarpa]
Length=236

 Score =   118 bits (295),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +3

Query  234  NPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDADR  413
            NPGN LYVTGLSTRV ++DLE+HFS EGKV    LV++P TR SRGFAFVTM  ++ A+R
Sbjct  68   NPGNTLYVTGLSTRVTERDLEEHFSKEGKVASCFLVVEPRTRISRGFAFVTMDNVDGANR  127

Query  414  CIKYLNRSVLEGRVITVEK  470
            C+KYLN+SVLEGR ITVEK
Sbjct  128  CVKYLNQSVLEGRYITVEK  146



>gb|KHN00439.1| Putative RNA-binding protein C25G10.01 [Glycine soja]
Length=310

 Score =   119 bits (299),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +3

Query  234  NPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDADR  413
            NPG+ LYVTGLS+RV ++DLE+HFS EGKV    LV++P TR SRGFAFVTM   EDA+R
Sbjct  117  NPGDTLYVTGLSSRVTERDLEEHFSKEGKVSSCFLVVEPRTRISRGFAFVTMESAEDAER  176

Query  414  CIKYLNRSVLEGRVITVEKVNCH  482
            CIKYLN+SVLEGR ITVE+   H
Sbjct  177  CIKYLNQSVLEGRYITVERNELH  199



>ref|XP_009109965.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Brassica 
rapa]
Length=269

 Score =   119 bits (297),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  231  ENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDAD  410
            ENPGN LYVTGLST+V +KDLE HFS +GKV    L++DP TRESRG+AFVTM  L DA+
Sbjct  98   ENPGNTLYVTGLSTKVTEKDLEAHFSKQGKVASCVLMLDPHTRESRGYAFVTMDSLRDAE  157

Query  411  RCIKYLNRSVLEGRVITVEK  470
            RCIKYLN+++L+GR I VEK
Sbjct  158  RCIKYLNKTLLDGRYIKVEK  177



>ref|XP_009623497.1| PREDICTED: ankyrin repeat domain-containing protein, chloroplastic 
[Nicotiana tomentosiformis]
Length=702

 Score =   124 bits (310),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            +  NPGN LYVTGLSTRV ++DLE+HFS EGKV+ + LV++P +R SRGFAF+TM  LED
Sbjct  49   EVSNPGNTLYVTGLSTRVTERDLEEHFSKEGKVKSIFLVVEPRSRISRGFAFITMDSLED  108

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            A+RCIK+LN+SVLEGR ITVEK
Sbjct  109  ANRCIKHLNQSVLEGRYITVEK  130



>ref|NP_001058614.1| Os06g0724600 [Oryza sativa Japonica Group]
 dbj|BAF20528.1| Os06g0724600 [Oryza sativa Japonica Group]
 dbj|BAG93673.1| unnamed protein product [Oryza sativa Japonica Group]
Length=164

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            DA N GN LYVTGLS+RV +++L+ +FS EG+V   H+V++P TR SRGFAFVTM  +ED
Sbjct  59   DAVNHGNTLYVTGLSSRVTERELKDYFSKEGRVTSCHVVLEPHTRVSRGFAFVTMDTVED  118

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            A+RCIKYLN+SV+EGR ITVEK
Sbjct  119  AERCIKYLNQSVMEGRNITVEK  140



>ref|NP_001237888.1| uncharacterized protein LOC100500170 [Glycine max]
 gb|ACU15118.1| unknown [Glycine max]
Length=238

 Score =   117 bits (294),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            +  NPG+ LYVTGLS+RV ++DLE+HFS EGKV    LV++P TR SRGFAFVTM   ED
Sbjct  65   EPSNPGDTLYVTGLSSRVTERDLEEHFSKEGKVSSCFLVVEPRTRISRGFAFVTMESAED  124

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            A+RCIKYLN+SVLEGR IT+E+
Sbjct  125  AERCIKYLNQSVLEGRYITIER  146



>emb|CDP01837.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   117 bits (293),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            +A N GN LYVTGLSTRV ++DLE HFS EGKV+ V LV++P +R SRGFAF+TM   ED
Sbjct  122  NAINSGNTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFITMDSAED  181

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            A+RCIK+LN+S+LEGR ITVE+
Sbjct  182  ANRCIKHLNQSILEGRYITVER  203



>ref|XP_004512185.1| PREDICTED: serine/arginine-rich splicing factor 4-like isoform 
X2 [Cicer arietinum]
Length=246

 Score =   117 bits (293),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +3

Query  234  NPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDADR  413
            N G+ LYVTGLS+RV +KDLE+HFS+EGKV    LV++P TR SRGF FVTM  +EDA R
Sbjct  136  NAGDTLYVTGLSSRVTEKDLEEHFSTEGKVASCFLVVEPRTRISRGFGFVTMESVEDASR  195

Query  414  CIKYLNRSVLEGRVITVEKVNCH  482
            C+KYLN+SVLEGR ITVE+   H
Sbjct  196  CVKYLNQSVLEGRYITVERNALH  218



>ref|XP_002984383.1| hypothetical protein SELMODRAFT_49471, partial [Selaginella moellendorffii]
 gb|EFJ14433.1| hypothetical protein SELMODRAFT_49471, partial [Selaginella moellendorffii]
Length=78

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            D +NPGNNLYVTGLSTRV +K L +H S EGKV +  +V+DP T+ESRGF FVTM+  ED
Sbjct  3    DPDNPGNNLYVTGLSTRVAEKQLLEHLSREGKVLECRIVVDPRTKESRGFGFVTMASTED  62

Query  405  ADRCIKYLNRSVLEGR  452
            A+RCI Y+NRS LEGR
Sbjct  63   AERCINYMNRSTLEGR  78



>ref|XP_010266988.1| PREDICTED: ankyrin repeat domain-containing protein, chloroplastic 
[Nelumbo nucifera]
Length=679

 Score =   122 bits (306),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            +A NPGN LYVTGLSTRV +++LE HFS EGKV    LV++P +R SRGFAFVTM  +ED
Sbjct  48   NASNPGNTLYVTGLSTRVTERELEDHFSKEGKVISCRLVVEPRSRASRGFAFVTMDTIED  107

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            ADRCIK+LN+SVLEGR ITVEK
Sbjct  108  ADRCIKHLNQSVLEGRYITVEK  129



>gb|KEH27602.1| RNA-binding (RRM/RBD/RNP motif) family protein [Medicago truncatula]
Length=236

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = +3

Query  240  GNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDADRCI  419
            G+ LYVTGLS+RV ++DLE+HFS EGKV    LV++P TR SRGFAFVTM   EDA+RCI
Sbjct  130  GDTLYVTGLSSRVTERDLEEHFSKEGKVASCFLVVEPRTRISRGFAFVTMDTAEDANRCI  189

Query  420  KYLNRSVLEGRVITVEKVNCH  482
            KYLN+S+LEGR ITVE+   H
Sbjct  190  KYLNQSILEGRYITVERNALH  210



>emb|CDY42653.1| BnaC01g00650D [Brassica napus]
Length=595

 Score =   121 bits (304),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 75/111 (68%), Gaps = 5/111 (5%)
 Frame = +3

Query  231  ENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDAD  410
            ENPG  LYVTGLSTRV +KDLE +FS EGKV    LV++P TRESRGFAFVTM  ++DA+
Sbjct  86   ENPGTTLYVTGLSTRVTEKDLEAYFSKEGKVASCVLVLEPRTRESRGFAFVTMDSVKDAE  145

Query  411  RCIKYLNRSVLEGRVITVEK-----VNCHYlfvtllftpplfSHHSSINTS  548
            RCIKYLN SVLEGR ITVE+     +  HY         P   H+  + +S
Sbjct  146  RCIKYLNHSVLEGRYITVERKKILLIKGHYQSRRKRPRTPTPGHYLGLKSS  196


 Score =   116 bits (290),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  231  ENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDAD  410
            ENPGN LYVTGLST+V  KDLE HFS +G V    L++DP TRESRG+AFVTM  L DA+
Sbjct  332  ENPGNTLYVTGLSTKVTDKDLEAHFSKQGNVASCVLMLDPHTRESRGYAFVTMDSLRDAE  391

Query  411  RCIKYLNRSVLEGRVITVEK  470
            RCIKYLN+++L+GR I VEK
Sbjct  392  RCIKYLNKTLLDGRYIKVEK  411



>gb|AFK45871.1| unknown [Medicago truncatula]
Length=270

 Score =   117 bits (292),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            +A NPGN LYVTGLS+RV  +DLE HFS EGKV    LV++P TR SRGFAFVTM   ED
Sbjct  56   NATNPGNTLYVTGLSSRVTDRDLEDHFSKEGKVASCFLVVEPRTRISRGFAFVTMDSHED  115

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            A+RCIK+LN+SVLEGR ITVE+
Sbjct  116  AERCIKHLNQSVLEGRYITVER  137



>ref|XP_003629227.1| ELAV-like protein [Medicago truncatula]
 gb|AET03703.1| RNA recognition motif [Medicago truncatula]
Length=270

 Score =   117 bits (292),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            +A NPGN LYVTGLS+RV  +DLE HFS EGKV    LV++P TR SRGFAFVTM   ED
Sbjct  56   NATNPGNTLYVTGLSSRVTDRDLEDHFSKEGKVASCFLVVEPRTRISRGFAFVTMDSHED  115

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            A+RCIK+LN+SVLEGR ITVE+
Sbjct  116  AERCIKHLNQSVLEGRYITVER  137



>ref|XP_007157858.1| hypothetical protein PHAVU_002G104100g [Phaseolus vulgaris]
 gb|ESW29852.1| hypothetical protein PHAVU_002G104100g [Phaseolus vulgaris]
Length=285

 Score =   117 bits (292),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            +A+N G  LYVTGLS+RV ++DLE+HFS EGKV    LV++P TR SRGFAF+TM  +ED
Sbjct  102  EAKNSGTTLYVTGLSSRVTERDLEEHFSKEGKVSSCFLVVEPRTRISRGFAFITMDNVED  161

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            A+RCIKYLN+SVLEGR ITVE+
Sbjct  162  ANRCIKYLNQSVLEGRYITVER  183



>ref|XP_006572837.1| PREDICTED: uncharacterized protein LOC100527350 isoform X1 [Glycine 
max]
 gb|ACU18771.1| unknown [Glycine max]
Length=246

 Score =   115 bits (289),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            +A+N G  LYVTGLS+RV ++DLE+HFS EGKV    LV++P TR SRGFAF+TM  +ED
Sbjct  63   EAKNAGTTLYVTGLSSRVTERDLEEHFSKEGKVASCFLVVEPRTRISRGFAFITMDTVED  122

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            A+RCIKYLN+SVLEGR ITVE+
Sbjct  123  ANRCIKYLNQSVLEGRYITVER  144



>ref|XP_002963380.1| hypothetical protein SELMODRAFT_80254 [Selaginella moellendorffii]
 gb|EFJ35251.1| hypothetical protein SELMODRAFT_80254 [Selaginella moellendorffii]
Length=161

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  234  NPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDADR  413
            NPGNNLYVTGLSTRV +KDLE +FS EGKV +  LV+DP + ESRGF FV +  L+DA+R
Sbjct  19   NPGNNLYVTGLSTRVTEKDLEDYFSKEGKVVECRLVVDPRSHESRGFGFVALESLDDAER  78

Query  414  CIKYLNRSVLEGRVITVEKV  473
            CIK L+ S LEGR+ITVEK 
Sbjct  79   CIKRLHHSNLEGRIITVEKA  98



>gb|KHN35992.1| Putative RNA-binding protein C25G10.01 [Glycine soja]
Length=273

 Score =   116 bits (290),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +3

Query  225  DAENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLED  404
            +A+N G  LYVTGLS+RV ++DLE+HFS EGKV    LV++P TR SRGFAF+TM  +ED
Sbjct  90   EAKNAGTTLYVTGLSSRVTERDLEEHFSKEGKVASCFLVVEPRTRISRGFAFITMDTVED  149

Query  405  ADRCIKYLNRSVLEGRVITVEK  470
            A+RCIKYLN+SVLEGR ITVE+
Sbjct  150  ANRCIKYLNQSVLEGRYITVER  171



>ref|XP_008242002.1| PREDICTED: ankyrin repeat domain-containing protein, chloroplastic 
[Prunus mume]
Length=677

 Score =   120 bits (302),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +3

Query  228  AENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDA  407
            A NPGN LYVTGLSTRV +KD+E+HFS EGKV    LV++P TR SRGFAFVTM  +EDA
Sbjct  62   AINPGNTLYVTGLSTRVSEKDVERHFSKEGKVASCFLVVEPRTRISRGFAFVTMDSVEDA  121

Query  408  DRCIKYLNRSVLEGRVITVEK  470
            +RCIK+LN+SVLEGR ITVE+
Sbjct  122  ERCIKHLNQSVLEGRYITVER  142



>ref|XP_008440881.1| PREDICTED: LOW QUALITY PROTEIN: ankyrin repeat domain-containing 
protein, chloroplastic [Cucumis melo]
Length=663

 Score =   120 bits (301),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +3

Query  228  AENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDA  407
            A NPGN LYVTGLSTRV ++DLE HFS EGKV    LV++P TR SRGFAFVTM  ++DA
Sbjct  60   ANNPGNTLYVTGLSTRVTERDLEDHFSKEGKVASCFLVVEPRTRISRGFAFVTMDNVDDA  119

Query  408  DRCIKYLNRSVLEGRVITVEK  470
            +RC+K+LN+SVLEGR ITVEK
Sbjct  120  NRCVKHLNQSVLEGRYITVEK  140



>gb|AIX10950.1| transformer-2 protein-like alpha-like protein [Gardenia jasminoides]
Length=237

 Score =   114 bits (286),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +3

Query  228  AENPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDA  407
            A N G+ LYVTGLSTRV ++DLE HFS EGKV+ V LV++P +R SRGFAF+TM  +EDA
Sbjct  65   AINSGSTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFITMDNVEDA  124

Query  408  DRCIKYLNRSVLEGRVITVEK  470
            +RCIK+LN+S+LEGR ITVE+
Sbjct  125  NRCIKHLNQSILEGRYITVER  145



>ref|XP_004287763.1| PREDICTED: transformer-2 protein homolog beta-like [Fragaria 
vesca subsp. vesca]
Length=241

 Score =   114 bits (286),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +3

Query  234  NPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDADR  413
            NPGN LYVTGLS R  +KD+E+HFS EGKV    LV++P +R SRGFAFVTM   EDA+R
Sbjct  68   NPGNTLYVTGLSQRASEKDVERHFSKEGKVASCFLVVEPRSRISRGFAFVTMDSNEDAER  127

Query  414  CIKYLNRSVLEGRVITVEK  470
            CIK+LN+SVLEGR ITVE+
Sbjct  128  CIKHLNQSVLEGRYITVER  146



>gb|AFK46395.1| unknown [Lotus japonicus]
Length=268

 Score =   114 bits (286),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +3

Query  234  NPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDADR  413
            N GN LYVTGLS+RV ++DLE+HF+ EGKV    LV++P TR SRGFAF+TM  +EDA+R
Sbjct  88   NGGNTLYVTGLSSRVTERDLEEHFAKEGKVASCFLVVEPRTRISRGFAFITMDTVEDANR  147

Query  414  CIKYLNRSVLEGRVITVEK  470
            C+KYLN+SVLEGR ITVE+
Sbjct  148  CVKYLNQSVLEGRYITVER  166



>ref|XP_002974665.1| hypothetical protein SELMODRAFT_102224, partial [Selaginella 
moellendorffii]
 gb|EFJ24185.1| hypothetical protein SELMODRAFT_102224, partial [Selaginella 
moellendorffii]
Length=232

 Score =   114 bits (284),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  234  NPGNNLYVTGLSTRVRQKDLEKHFSSEGKVEDVHLVIDPWTRESRGFAFVTMSKLEDADR  413
            NPGNNLYVTGLSTRV +KDLE +FS EGKV +  LV+DP + ESRGF FV +  L+DA+R
Sbjct  48   NPGNNLYVTGLSTRVTEKDLEDYFSKEGKVVECRLVVDPRSHESRGFGFVALESLDDAER  107

Query  414  CIKYLNRSVLEGRVITVEKV  473
            CIK L+ S LEGR+ITVEK 
Sbjct  108  CIKRLHHSNLEGRIITVEKA  127



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5834191354632