BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24058_g1_i4 len=732 path=[681:0-391 1072:392-450 596:451-515
1195:516-520 1200:521-546 307:547-551 312:552-575 336:576-605
25:606-643 5248:644-680 105:681-684 5591:685-731]

Length=732
                                                                      Score     E

ref|NP_192992.1|  auxin-Induced in Root cultures 1                    74.3    2e-13   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63191.1|  putative cell wall-plasma membrane disconnecting ...  73.2    5e-13   Arabidopsis thaliana [mouse-ear cress]
gb|AAC62610.1|  similar to the C-terminus of putative plasma memb...  72.4    8e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009134277.1|  PREDICTED: putative lipid-binding protein AIR1   72.4    9e-13   
emb|CDY21277.1|  BnaC03g29610D                                        72.0    1e-12   
ref|XP_010041843.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.0    1e-12   
ref|XP_011070106.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.0    1e-12   
ref|XP_003572782.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  72.0    2e-12   
gb|AIX10944.1|  PRP2-like protein                                     72.0    2e-12   
ref|XP_006647641.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  71.6    2e-12   
gb|EYU30301.1|  hypothetical protein MIMGU_mgv1a018370mg              71.2    2e-12   
gb|EYU30296.1|  hypothetical protein MIMGU_mgv1a015783mg              71.6    3e-12   
ref|XP_002454523.1|  hypothetical protein SORBIDRAFT_04g032640        71.2    3e-12   Sorghum bicolor [broomcorn]
ref|XP_010053449.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    70.9    4e-12   
dbj|BAA11854.1|  extensin like protein                                71.2    4e-12   Populus nigra [black poplar]
gb|KCW77747.1|  hypothetical protein EUGRSUZ_D02041                   70.5    4e-12   
ref|XP_010539605.1|  PREDICTED: putative lipid-binding protein AIR1   70.9    5e-12   
ref|XP_002271593.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    70.5    6e-12   Vitis vinifera
ref|XP_006369032.1|  HyPRP family protein                             70.5    6e-12   
dbj|BAF46299.1|  extensin like protein                                70.5    6e-12   Ipomoea nil [qian niu]
gb|KHG02760.1|  14 kDa proline-rich DC2                               70.5    6e-12   
emb|CDP09932.1|  unnamed protein product                              70.5    7e-12   
gb|ABP35529.1|  proline-rich protein                                  70.1    8e-12   Ipomoea batatas [batate]
dbj|BAA05471.1|  tumor-related protein                                68.9    8e-12   Nicotiana glauca x Nicotiana langsdorffii
ref|XP_009796139.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.5    8e-12   
ref|XP_002533293.1|  14 kDa proline-rich protein DC2.15 precursor...  70.1    9e-12   Ricinus communis
ref|XP_009114615.1|  PREDICTED: putative lipid-binding protein AIR1   69.7    9e-12   
ref|NP_001238293.1|  uncharacterized protein LOC100527330 precursor   70.1    9e-12   
ref|XP_010041938.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  69.7    9e-12   
ref|XP_010433325.1|  PREDICTED: putative lipid-binding protein AIR1B  69.3    1e-11   
ref|XP_002533292.1|  14 kDa proline-rich protein DC2.15 precursor...  69.7    1e-11   Ricinus communis
ref|XP_007039886.1|  14 kDa proline-rich protein DC2.15, putative     69.7    1e-11   
ref|XP_003603362.1|  Proline-rich protein                             69.7    1e-11   
ref|XP_002270769.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    69.7    1e-11   Vitis vinifera
ref|XP_010455703.1|  PREDICTED: putative lipid-binding protein AIR1B  69.3    1e-11   
gb|KHN04346.1|  14 kDa proline-rich protein DC2.15                    69.7    1e-11   
ref|XP_010053450.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    69.3    1e-11   
ref|XP_010433312.1|  PREDICTED: putative lipid-binding protein AIR1   69.3    1e-11   
ref|XP_009782706.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.1    1e-11   
gb|EMS62564.1|  14 kDa proline-rich protein DC2.15                    69.3    2e-11   
ref|XP_009796138.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  69.7    2e-11   
ref|XP_002454525.1|  hypothetical protein SORBIDRAFT_04g032660        68.9    2e-11   Sorghum bicolor [broomcorn]
ref|XP_006289270.1|  hypothetical protein CARUB_v10002736mg           69.3    2e-11   
ref|XP_002454524.1|  hypothetical protein SORBIDRAFT_04g032650        69.3    2e-11   Sorghum bicolor [broomcorn]
ref|XP_009783445.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  69.7    2e-11   
ref|XP_010433300.1|  PREDICTED: putative lipid-binding protein AIR1   68.6    2e-11   
gb|ABG91752.1|  HyPRP2                                                69.3    2e-11   Gossypium hirsutum [American cotton]
ref|NP_001047651.1|  Os02g0662100                                     68.9    2e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010529481.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  69.3    2e-11   
ref|XP_006289359.1|  hypothetical protein CARUB_v10002845mg           68.6    2e-11   
ref|XP_002533294.1|  14 kDa proline-rich protein DC2.15 precursor...  68.9    2e-11   Ricinus communis
ref|XP_009619251.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  69.3    2e-11   
ref|XP_010431835.1|  PREDICTED: putative lipid-binding protein AIR1   68.6    2e-11   
ref|XP_002454521.1|  hypothetical protein SORBIDRAFT_04g032620        68.9    2e-11   Sorghum bicolor [broomcorn]
ref|XP_010455705.1|  PREDICTED: pEARLI1-like lipid transfer prote...  69.3    2e-11   
ref|XP_006600137.1|  PREDICTED: uncharacterized protein LOC100500...  68.9    2e-11   
ref|XP_009619252.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  69.3    2e-11   
ref|XP_006368194.1|  HyPRP family protein                             68.9    2e-11   
ref|XP_010422227.1|  PREDICTED: putative lipid-binding protein AIR1B  68.2    2e-11   
ref|XP_009795761.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.9    3e-11   
ref|XP_011018292.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    68.9    3e-11   
ref|XP_011001498.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.6    3e-11   
ref|XP_010433333.1|  PREDICTED: putative lipid-binding protein AIR1   68.2    3e-11   
ref|XP_011033953.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.6    3e-11   
ref|XP_010431811.1|  PREDICTED: putative lipid-binding protein AIR1   67.8    3e-11   
ref|XP_010422226.1|  PREDICTED: putative lipid-binding protein AIR1   68.2    3e-11   
ref|XP_004501349.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.6    3e-11   
ref|NP_001233824.1|  arachidonic acid-induced DEA1 precursor          68.2    4e-11   
ref|XP_006355479.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.2    4e-11   
ref|XP_006355477.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.2    4e-11   
ref|NP_001148300.1|  cortical cell-delineating protein precursor      67.8    5e-11   Zea mays [maize]
gb|ACN26094.1|  unknown                                               67.8    5e-11   Zea mays [maize]
emb|CBI31906.3|  unnamed protein product                              67.4    5e-11   
ref|XP_008362163.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.2    5e-11   
ref|XP_009600481.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.6    5e-11   
dbj|BAA13150.1|  NT16 polypeptide                                     68.6    5e-11   Nicotiana tabacum [American tobacco]
ref|NP_001151721.1|  LOC100285357 precursor                           67.8    5e-11   Zea mays [maize]
ref|XP_010455702.1|  PREDICTED: putative lipid-binding protein AIR1   67.8    5e-11   
ref|XP_004152413.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  67.8    5e-11   
ref|XP_011076346.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.2    6e-11   
ref|NP_001235642.1|  uncharacterized protein LOC100500016 precursor   67.8    6e-11   
ref|XP_004291444.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  67.8    6e-11   
ref|XP_003549906.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  67.8    6e-11   
ref|XP_002529775.1|  14 kDa proline-rich protein DC2.15 precursor...  67.8    6e-11   Ricinus communis
ref|XP_010431799.1|  PREDICTED: putative lipid-binding protein AIR1   67.0    6e-11   
ref|XP_009795760.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.2    7e-11   
ref|XP_010264239.1|  PREDICTED: putative lipid-binding protein At...  67.4    7e-11   
ref|XP_006396747.1|  hypothetical protein EUTSA_v10029313mg           67.4    7e-11   
gb|ACV74341.1|  proline-rich protein                                  67.4    7e-11   Jatropha curcas
ref|XP_009111571.1|  PREDICTED: putative lipid-binding protein AIR1B  67.0    7e-11   
ref|XP_003526352.1|  PREDICTED: extensin-like                         68.9    8e-11   
ref|XP_008378389.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  67.4    8e-11   
ref|NP_001237154.1|  uncharacterized protein LOC100500124 precursor   67.4    8e-11   
emb|CDP05328.1|  unnamed protein product                              67.0    8e-11   
ref|XP_004245748.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  67.4    9e-11   
emb|CAA59472.1|  hybrid proline-rich protein                          67.4    9e-11   Catharanthus roseus [chatas]
ref|XP_006306558.1|  hypothetical protein CARUB_v10012658mg           67.0    9e-11   
ref|XP_002446915.1|  hypothetical protein SORBIDRAFT_06g024790        67.0    9e-11   Sorghum bicolor [broomcorn]
ref|XP_009626056.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  67.0    9e-11   
ref|XP_010422228.1|  PREDICTED: putative lipid-binding protein AIR1   67.0    1e-10   
gb|KGN50238.1|  hypothetical protein Csa_5G161870                     67.0    1e-10   
ref|XP_007039884.1|  Bifunctional inhibitor/lipid-transfer protei...  67.0    1e-10   
gb|ACE82175.1|  extensin-like protein                                 67.0    1e-10   
ref|XP_009601879.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  66.6    1e-10   
ref|XP_002446914.1|  hypothetical protein SORBIDRAFT_06g024780        66.6    1e-10   Sorghum bicolor [broomcorn]
ref|XP_006290090.1|  hypothetical protein CARUB_v10003735mg           66.2    1e-10   
ref|XP_002533291.1|  lipid binding protein, putative                  66.2    1e-10   Ricinus communis
ref|XP_004964283.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  66.6    1e-10   
ref|XP_004976455.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  66.6    1e-10   
dbj|BAJ96792.1|  predicted protein                                    66.6    1e-10   
gb|EMS59022.1|  14 kDa proline-rich protein DC2.15                    66.6    1e-10   
gb|ABX84384.1|  protease inhibitor-like protein                       66.6    1e-10   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006289141.1|  hypothetical protein CARUB_v10002564mg           66.6    1e-10   
ref|XP_008437101.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  66.6    1e-10   
ref|XP_009801825.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  66.6    1e-10   
ref|XP_004171279.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  66.6    1e-10   
ref|XP_004501348.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  66.6    1e-10   
ref|XP_004152411.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  66.6    1e-10   
ref|XP_004955126.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.2    1e-10   
ref|XP_009375766.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  66.6    1e-10   
gb|KDP25647.1|  hypothetical protein JCGZ_20803                       66.6    1e-10   
ref|XP_008786991.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  66.2    2e-10   
gb|KDP25645.1|  hypothetical protein JCGZ_20801                       66.6    2e-10   
gb|EYU30303.1|  hypothetical protein MIMGU_mgv1a016181mg              66.2    2e-10   
ref|XP_002271461.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    66.2    2e-10   Vitis vinifera
ref|XP_004251936.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  66.2    2e-10   
ref|XP_009617786.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  66.6    2e-10   
ref|XP_010456924.1|  PREDICTED: putative lipid-binding protein AIR1   65.9    2e-10   
ref|XP_010099842.1|  hypothetical protein L484_008499                 65.9    2e-10   
gb|ADD11814.1|  hybrid proline-rich protein                           66.2    2e-10   Cajanus cajan
ref|XP_009598876.1|  PREDICTED: lipid transfer protein EARLI 1-like   65.1    2e-10   
gb|ABQ88334.1|  lipid transfer protein                                66.2    2e-10   Capsicum annuum
emb|CAI51313.1|  arachidonic acid-induced DEA1                        66.2    2e-10   Capsicum chinense [bonnet pepper]
ref|XP_004976454.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.9    2e-10   
ref|XP_009134276.1|  PREDICTED: putative lipid-binding protein AIR1   65.9    2e-10   
ref|XP_004498751.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.9    2e-10   
emb|CAA81526.1|  14 kDa polypeptide                                   65.9    2e-10   Catharanthus roseus [chatas]
emb|CBI38878.3|  unnamed protein product                              65.9    2e-10   
ref|XP_010433288.1|  PREDICTED: putative lipid-binding protein AIR1   65.1    3e-10   
ref|XP_009783170.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.5    3e-10   
ref|XP_004291443.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.5    3e-10   
gb|KDP25650.1|  hypothetical protein JCGZ_20806                       65.5    3e-10   
ref|XP_010093705.1|  hypothetical protein L484_019046                 65.1    3e-10   
ref|XP_006289733.1|  hypothetical protein CARUB_v10003301mg           65.5    3e-10   
emb|CDP18670.1|  unnamed protein product                              65.9    3e-10   
ref|XP_010919518.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.5    3e-10   
ref|XP_007226236.1|  hypothetical protein PRUPE_ppa017473mg           65.5    3e-10   
ref|XP_010258987.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    65.5    3e-10   
ref|XP_009623719.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.5    3e-10   
ref|XP_006290087.1|  hypothetical protein CARUB_v10003726mg           65.1    4e-10   
ref|XP_002511665.1|  14 kDa proline-rich protein DC2.15 precursor...  65.5    4e-10   Ricinus communis
ref|XP_004165754.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.5    4e-10   
ref|XP_004291441.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.9    4e-10   
ref|XP_010458632.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.5    4e-10   
gb|KDP25648.1|  hypothetical protein JCGZ_20804                       67.4    4e-10   
gb|ABU63756.1|  root specific protein                                 65.1    4e-10   
emb|CDY20048.1|  BnaA09g02030D                                        64.7    4e-10   
ref|XP_008437102.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.5    4e-10   
ref|XP_006366173.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.1    4e-10   
gb|KGN50240.1|  hypothetical protein Csa_5G161890                     65.1    5e-10   
ref|XP_004152412.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.1    5e-10   
ref|XP_003633921.2|  PREDICTED: putative lipid-binding protein At...  65.5    5e-10   
ref|XP_009346182.1|  PREDICTED: putative lipid-binding protein AIR1   64.7    5e-10   
ref|XP_004165755.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.1    5e-10   
ref|XP_004152410.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.1    6e-10   
gb|EMS47202.1|  Cortical cell-delineating protein                     64.7    6e-10   
ref|XP_010258988.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  64.7    6e-10   
ref|XP_010422379.1|  PREDICTED: putative lipid-binding protein AIR1   64.3    6e-10   
ref|XP_011018291.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    64.7    6e-10   
ref|XP_004152415.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  64.7    6e-10   
ref|XP_010493734.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  64.7    6e-10   
ref|XP_010424613.1|  PREDICTED: putative lipid-binding protein AIR1   64.3    7e-10   
ref|XP_009795762.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.1    7e-10   
ref|XP_004976453.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  64.7    7e-10   
gb|KDP25651.1|  hypothetical protein JCGZ_20807                       66.6    7e-10   
ref|XP_008394102.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  64.3    7e-10   
ref|XP_006368193.1|  hypothetical protein POPTR_0001s00400g           64.7    7e-10   
ref|XP_006289684.1|  hypothetical protein CARUB_v10003241mg           64.7    7e-10   
ref|XP_007039887.1|  Bifunctional inhibitor/lipid-transfer protei...  64.7    7e-10   
gb|EMT19257.1|  Cortical cell-delineating protein                     64.3    7e-10   
ref|XP_006286641.1|  hypothetical protein CARUB_v10002511mg           63.9    7e-10   
ref|XP_010493743.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  64.7    7e-10   
ref|XP_004976456.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  64.3    8e-10   
ref|XP_002436327.1|  hypothetical protein SORBIDRAFT_10g000510        64.7    8e-10   Sorghum bicolor [broomcorn]
ref|XP_007161198.1|  hypothetical protein PHAVU_001G050300g           64.3    8e-10   
ref|XP_010456925.1|  PREDICTED: putative lipid-binding protein AIR1   63.9    8e-10   
ref|XP_002271619.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    64.3    9e-10   Vitis vinifera
ref|NP_001053512.1|  Os04g0554600                                     64.3    9e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006396746.1|  hypothetical protein EUTSA_v10029045mg           64.7    9e-10   
gb|AAC02087.1|  hairy root 4                                          65.5    9e-10   Nicotiana tabacum [American tobacco]
ref|XP_010539616.1|  PREDICTED: lipid transfer protein EARLI 1-like   64.3    9e-10   
emb|CDY21034.1|  BnaA08g24910D                                        64.3    1e-09   
ref|XP_010676151.1|  PREDICTED: putative lipid-binding protein AIR1B  64.3    1e-09   
ref|XP_009611018.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  64.3    1e-09   
ref|XP_009110670.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    64.3    1e-09   
gb|AAX20042.1|  proline-rich protein                                  64.3    1e-09   Capsicum annuum
ref|XP_010055514.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  64.3    1e-09   
ref|XP_010493717.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  64.3    1e-09   
ref|XP_010433379.1|  PREDICTED: lipid transfer protein EARLI 1-like   63.9    1e-09   
ref|XP_003574313.1|  PREDICTED: acanthoscurrin-1-like                 65.5    1e-09   
ref|NP_001152584.1|  cortical cell-delineating protein precursor      63.9    1e-09   Zea mays [maize]
gb|EYU30297.1|  hypothetical protein MIMGU_mgv1a015941mg              64.3    1e-09   
ref|XP_007052128.1|  Bifunctional inhibitor/lipid-transfer protei...  63.9    1e-09   
gb|KHN08148.1|  Putative lipid-binding protein                        64.7    1e-09   
ref|XP_003546415.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.9    1e-09   
ref|NP_849366.1|  Bifunctional inhibitor/lipid-transfer protein/s...  63.5    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006355478.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.9    1e-09   
ref|XP_008448870.1|  PREDICTED: lipid transfer protein EARLI 1-like   65.1    1e-09   
ref|XP_006417265.1|  hypothetical protein EUTSA_v10009083mg           63.9    1e-09   
ref|XP_002464967.1|  hypothetical protein SORBIDRAFT_01g029610        63.5    1e-09   Sorghum bicolor [broomcorn]
ref|XP_008392579.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.9    1e-09   
emb|CDX79156.1|  BnaA01g12230D                                        63.9    1e-09   
gb|AFW63295.1|  cortical cell-delineating protein                     63.9    1e-09   
dbj|BAJ97873.1|  predicted protein                                    65.5    1e-09   
ref|XP_008219516.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.5    1e-09   
ref|XP_006440347.1|  hypothetical protein CICLE_v10022825mg           63.9    1e-09   
ref|XP_009798259.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.9    1e-09   
gb|EYU24741.1|  hypothetical protein MIMGU_mgv1a016172mg              63.5    1e-09   
ref|XP_004169260.1|  PREDICTED: putative lipid-binding protein At...  64.7    2e-09   
ref|XP_004245750.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.5    2e-09   
ref|XP_006440346.1|  hypothetical protein CICLE_v10022839mg           63.5    2e-09   
gb|KDO61485.1|  hypothetical protein CISIN_1g047179mg                 63.5    2e-09   
ref|XP_008646032.1|  PREDICTED: cortical cell-delineating protein...  63.5    2e-09   
ref|XP_010906608.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.5    2e-09   
ref|XP_010093706.1|  hypothetical protein L484_019047                 63.5    2e-09   
ref|XP_002867769.1|  hypothetical protein ARALYDRAFT_914370           63.5    2e-09   
ref|XP_002533299.1|  14 kDa proline-rich protein DC2.15 precursor...  63.5    2e-09   Ricinus communis
ref|XP_007155641.1|  hypothetical protein PHAVU_003G218900g           63.5    2e-09   
ref|XP_009589966.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.2    2e-09   
gb|AEX33654.1|  lipid transfer protein                                63.5    2e-09   
emb|CDY20047.1|  BnaA09g02040D                                        62.8    2e-09   
ref|NP_001047650.1|  Os02g0662000                                     63.2    2e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004516837.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.2    2e-09   
emb|CDY31241.1|  BnaC08g15360D                                        63.2    2e-09   
gb|KDP25644.1|  hypothetical protein JCGZ_20800                       63.2    2e-09   
ref|XP_008437105.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.2    2e-09   
ref|NP_001152585.1|  LOC100286225 precursor                           62.8    3e-09   Zea mays [maize]
gb|AAC49369.1|  proline-rich 14 kDa protein                           63.2    3e-09   Phaseolus vulgaris [French bean]
ref|XP_006477231.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.2    3e-09   
ref|NP_193977.1|  bifunctional inhibitor/lipid-transfer protein/s...  63.2    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009376589.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.2    3e-09   
ref|XP_009355765.1|  PREDICTED: putative lipid-binding protein AIR1   62.8    3e-09   
ref|XP_008381149.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.2    3e-09   
gb|EAY95110.1|  hypothetical protein OsI_16927                        62.8    3e-09   Oryza sativa Indica Group [Indian rice]
ref|NP_001053511.1|  Os04g0554500                                     62.8    3e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010539640.1|  PREDICTED: lipid transfer protein EARLI 1-like   62.8    3e-09   
ref|XP_002874778.1|  hypothetical protein ARALYDRAFT_911651           62.8    3e-09   
ref|XP_010264240.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.8    3e-09   
ref|XP_008648736.1|  PREDICTED: pEARLI1-like lipid transfer prote...  62.8    3e-09   
ref|XP_009782252.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.8    3e-09   
ref|XP_009333674.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.8    3e-09   
ref|XP_009333632.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.8    3e-09   
ref|XP_004151035.1|  PREDICTED: uncharacterized protein LOC101220...  64.7    3e-09   
ref|XP_011081223.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.8    4e-09   
ref|XP_007155643.1|  hypothetical protein PHAVU_003G219100g           62.4    4e-09   
ref|XP_009333598.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.8    4e-09   
ref|XP_011070108.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.8    4e-09   
ref|NP_001152587.1|  cortical cell-delineating protein precursor      62.4    4e-09   Zea mays [maize]
ref|XP_008437111.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.8    4e-09   
ref|XP_002446913.1|  hypothetical protein SORBIDRAFT_06g024770        62.4    4e-09   Sorghum bicolor [broomcorn]
ref|XP_010448889.1|  PREDICTED: putative lipid-binding protein AIR1   62.4    4e-09   
ref|NP_001152564.1|  cortical cell-delineating protein precursor      62.4    4e-09   Zea mays [maize]
ref|XP_004151036.1|  PREDICTED: uncharacterized protein LOC101220...  63.9    4e-09   
ref|XP_008437107.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.4    4e-09   
ref|NP_001148290.1|  gibberellin responsive2 precursor                62.4    4e-09   Zea mays [maize]
ref|XP_008663526.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.4    4e-09   
emb|CAN80712.1|  hypothetical protein VITISV_033379                   62.8    5e-09   Vitis vinifera
ref|XP_003608743.1|  14 kDa proline-rich protein DC2.15               62.4    5e-09   
ref|XP_003608746.1|  14 kDa proline-rich protein DC2.15               62.4    5e-09   
ref|XP_002874779.1|  hypothetical protein ARALYDRAFT_911652           62.4    5e-09   
ref|XP_010553464.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    62.4    5e-09   
ref|XP_002454527.1|  hypothetical protein SORBIDRAFT_04g032680        62.0    5e-09   Sorghum bicolor [broomcorn]
gb|AFK43955.1|  unknown                                               62.0    5e-09   
ref|XP_011090306.1|  PREDICTED: putative lipid-binding protein At...  62.0    5e-09   
ref|XP_010455699.1|  PREDICTED: lipid transfer protein EARLI 1-like   62.4    5e-09   
ref|XP_010455698.1|  PREDICTED: lipid transfer protein EARLI 1-like   62.4    5e-09   
ref|XP_011081227.1|  PREDICTED: pEARLI1-like lipid transfer prote...  62.4    5e-09   
ref|XP_010456905.1|  PREDICTED: putative lipid-binding protein AIR1   61.6    5e-09   
emb|CDX94516.1|  BnaC09g23200D                                        61.6    6e-09   
emb|CDY21276.1|  BnaC03g29600D                                        61.6    6e-09   
ref|XP_010422224.1|  PREDICTED: lipid transfer protein EARLI 1-like   62.0    6e-09   
ref|XP_007137003.1|  hypothetical protein PHAVU_009G092000g           62.8    6e-09   
ref|XP_010422222.1|  PREDICTED: lipid transfer protein EARLI 1-li...  62.0    6e-09   
ref|XP_006286053.1|  hypothetical protein CARUB_v10007585mg           62.0    6e-09   
ref|XP_009375767.1|  PREDICTED: putative lipid-binding protein At...  62.0    6e-09   
gb|KFK31985.1|  hypothetical protein AALP_AA6G185200                  62.0    6e-09   
ref|XP_004147199.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.0    6e-09   
ref|XP_009384469.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.0    6e-09   
gb|ADA67933.1|  putative 14 kDa proline-rich protein DC2.15           62.0    6e-09   
ref|XP_008232588.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.0    6e-09   
emb|CDY64848.1|  BnaC05g49400D                                        62.0    6e-09   
gb|AFK47889.1|  unknown                                               61.6    6e-09   
ref|XP_009148613.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.0    7e-09   
ref|XP_008344389.1|  PREDICTED: lipid transfer protein EARLI 1-like   62.0    7e-09   
ref|XP_006661670.1|  PREDICTED: cortical cell-delineating protein...  62.0    7e-09   
ref|XP_009333597.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.0    7e-09   
ref|XP_009607067.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  61.6    7e-09   
ref|XP_004516834.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  61.6    7e-09   
ref|NP_001104845.1|  GR1a protein precursor                           61.6    7e-09   
ref|XP_010433369.1|  PREDICTED: lipid transfer protein EARLI 1-like   62.0    7e-09   
ref|XP_010422223.1|  PREDICTED: lipid transfer protein EARLI 1-li...  61.6    8e-09   
gb|EAY95111.1|  hypothetical protein OsI_16928                        62.0    8e-09   
ref|NP_001053513.2|  Os04g0554800                                     62.0    8e-09   
gb|EYU18564.1|  hypothetical protein MIMGU_mgv1a016162mg              61.6    8e-09   
ref|XP_003588785.1|  14 kDa proline-rich protein DC2.15               62.0    8e-09   
emb|CDY16710.1|  BnaA09g20880D                                        61.2    8e-09   
sp|P14009.1|14KD_DAUCA  RecName: Full=14 kDa proline-rich protein...  61.6    8e-09   
gb|AAA32650.1|  bimodular protein                                     62.4    8e-09   
ref|NP_001235511.1|  uncharacterized protein LOC100500518 precursor   61.6    8e-09   
gb|ACG24992.1|  cortical cell-delineating protein precursor           61.6    8e-09   
ref|XP_009333675.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.0    8e-09   
ref|XP_006652622.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  61.6    9e-09   
gb|KGN55880.1|  hypothetical protein Csa_3G026160                     64.7    9e-09   
ref|XP_006366172.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  61.2    9e-09   
ref|XP_008356291.1|  PREDICTED: putative lipid-binding protein At...  61.6    9e-09   
ref|XP_006579357.1|  PREDICTED: uncharacterized protein LOC100499...  61.6    9e-09   
ref|XP_004241782.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  61.2    9e-09   
gb|ABQ01426.1|  bimodular protein                                     62.0    9e-09   
ref|XP_009591583.1|  PREDICTED: pEARLI1-like lipid transfer prote...  61.6    9e-09   
ref|XP_008437103.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  61.6    9e-09   
ref|XP_009135928.1|  PREDICTED: putative lipid-binding protein AIR1   61.6    1e-08   
ref|XP_008392581.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  61.6    1e-08   
ref|XP_004165505.1|  PREDICTED: LOW QUALITY PROTEIN: 14 kDa proli...  61.6    1e-08   
ref|XP_003588783.1|  14 kDa proline-rich protein DC2.15               61.6    1e-08   
ref|XP_009801239.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  61.2    1e-08   
gb|KHN41445.1|  14 kDa proline-rich protein DC2.15                    60.5    1e-08   
gb|ACU23575.1|  unknown                                               61.2    1e-08   
ref|XP_009612116.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  61.2    1e-08   
gb|AFK37038.1|  unknown                                               61.2    1e-08   
ref|XP_003533833.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  61.2    1e-08   
ref|XP_009795308.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  61.2    1e-08   
ref|XP_008448867.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  61.2    1e-08   
gb|ABX84383.1|  protease inhibitor-like protein                       61.2    1e-08   
ref|XP_002515493.1|  14 kDa proline-rich protein DC2.15 precursor...  61.2    1e-08   
ref|NP_001236284.1|  uncharacterized protein LOC100526941 precursor   62.0    1e-08   
emb|CDY31240.1|  BnaC08g15350D                                        61.2    1e-08   
ref|XP_010518131.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  61.2    1e-08   
ref|XP_010258985.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  61.2    1e-08   
emb|CDP09930.1|  unnamed protein product                              60.8    1e-08   
ref|XP_010053452.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  61.2    1e-08   
gb|AAM47507.1|  extensin-like protein                                 61.2    1e-08   
ref|XP_006289908.1|  hypothetical protein CARUB_v10003523mg           60.5    1e-08   
gb|KCW78307.1|  hypothetical protein EUGRSUZ_D02487                   60.8    2e-08   
ref|NP_567391.1|  bifunctional inhibitor/lipid-transfer protein/s...  60.8    2e-08   
ref|XP_011081229.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  60.8    2e-08   
ref|XP_009110671.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    60.8    2e-08   
ref|XP_002309638.1|  hypothetical protein POPTR_0006s27220g           60.5    2e-08   
ref|NP_001238461.1|  uncharacterized protein LOC100499693 precursor   60.8    2e-08   
ref|NP_001266108.1|  14 kDa proline-rich protein DC2.15-like prec...  60.8    2e-08   
gb|AES59035.2|  Lipid transfer protein                                61.2    2e-08   
ref|XP_003549907.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  60.8    2e-08   
gb|EPS73889.1|  hypothetical protein M569_00868                       60.8    2e-08   
emb|CDP19512.1|  unnamed protein product                              60.5    2e-08   
ref|XP_002466039.1|  hypothetical protein SORBIDRAFT_01g050420        60.5    2e-08   
ref|XP_010506455.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  60.5    2e-08   
ref|XP_006477234.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  60.5    2e-08   
gb|KHN04345.1|  14 kDa proline-rich protein DC2.15                    60.8    2e-08   
dbj|BAA74804.1|  ZmGR1b                                               60.5    2e-08   
gb|AFK37174.1|  unknown                                               60.1    2e-08   
gb|KHN09805.1|  14 kDa proline-rich protein DC2.15                    60.5    2e-08   
ref|XP_003525810.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  60.8    2e-08   
gb|ACU21436.1|  unknown                                               60.8    2e-08   
gb|KFK43474.1|  hypothetical protein AALP_AA1G129700                  60.5    2e-08   
gb|AAM75351.1|AF520576_1  extensin-like protein                       61.2    3e-08   
emb|CDY21275.1|  BnaC03g29590D                                        60.5    3e-08   
ref|XP_004291442.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  60.1    3e-08   
ref|XP_011081224.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  60.1    3e-08   
ref|XP_010053928.1|  PREDICTED: putative lipid-binding protein At...  60.1    3e-08   
ref|XP_007218576.1|  hypothetical protein PRUPE_ppa013120mg           60.5    3e-08   
ref|XP_003594279.1|  14 kDa proline-rich protein DC2.15               60.1    3e-08   
ref|XP_010696470.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  60.1    3e-08   
ref|XP_006304906.1|  hypothetical protein CARUB_v10011959mg           60.1    3e-08   
ref|NP_001235888.1|  uncharacterized protein LOC100500033 precursor   60.1    3e-08   
ref|NP_001235027.1|  uncharacterized protein LOC100500229 precursor   60.1    3e-08   
gb|EPS71802.1|  hypothetical protein M569_02964                       60.5    3e-08   
ref|XP_004516838.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  60.5    3e-08   
ref|XP_006440349.1|  hypothetical protein CICLE_v10022832mg           60.1    3e-08   
gb|KFK30593.1|  hypothetical protein AALP_AA6G001800                  60.1    3e-08   
ref|XP_008232632.1|  PREDICTED: lipid transfer protein EARLI 1-like   60.8    3e-08   
ref|XP_010468268.1|  PREDICTED: uncharacterized protein LOC104748299  63.2    3e-08   
gb|ACN54400.1|  hybrid proline-rich protein                           60.1    3e-08   
ref|XP_010906607.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  60.1    3e-08   
ref|XP_006353678.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  60.1    3e-08   
ref|XP_010258990.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  60.1    3e-08   
ref|XP_010055513.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  60.1    3e-08   
ref|XP_011039660.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  59.7    3e-08   
emb|CAI48077.1|  extensin-like protein                                60.1    3e-08   
ref|XP_004140487.1|  PREDICTED: putative lipid-binding protein At...  60.1    4e-08   
ref|XP_006396752.1|  hypothetical protein EUTSA_v10029040mg           60.1    4e-08   
ref|XP_008458132.1|  PREDICTED: putative lipid-binding protein At...  59.7    4e-08   
ref|XP_003588784.1|  14 kDa proline-rich protein DC2.15               60.5    4e-08   
ref|XP_003525817.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  59.7    4e-08   
ref|XP_008786988.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  59.7    4e-08   
ref|XP_006396750.1|  hypothetical protein EUTSA_v10029060mg           59.7    4e-08   
ref|XP_006295216.1|  hypothetical protein CARUB_v10024298mg           59.7    4e-08   
ref|XP_004291440.1|  PREDICTED: putative lipid-binding protein At...  60.5    4e-08   
ref|XP_006289038.1|  hypothetical protein CARUB_v10002422mg           60.1    4e-08   
ref|XP_007011824.1|  Bimodular protein                                59.7    4e-08   
ref|NP_176440.1|  bifunctional inhibitor/lipid-transfer protein/s...  59.7    5e-08   
ref|XP_008232586.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  59.7    5e-08   
emb|CDX90837.1|  BnaA03g25170D                                        58.9    5e-08   
ref|XP_010430305.1|  PREDICTED: lipid transfer protein EARLI 1        59.7    5e-08   
ref|XP_009338026.1|  PREDICTED: vegetative cell wall protein gp1-...  62.4    5e-08   
emb|CDY61290.1|  BnaCnng37610D                                        59.3    5e-08   
ref|XP_009113072.1|  PREDICTED: lipid transfer protein EARLI 1        59.7    5e-08   
ref|XP_002304421.2|  hypothetical protein POPTR_0003s11070g           59.3    5e-08   
ref|XP_006357014.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  59.7    5e-08   
ref|XP_004298650.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  59.3    5e-08   
ref|XP_010473467.1|  PREDICTED: lipid transfer protein EARLI 1-like   59.7    5e-08   
ref|XP_010418243.1|  PREDICTED: lipid transfer protein EARLI 1-like   59.7    5e-08   
ref|XP_003559026.1|  PREDICTED: putative lipid-binding protein AIR1   59.7    6e-08   
gb|AAC60566.1|  proline-rich SAC51                                    59.7    6e-08   
ref|XP_010264242.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  59.3    6e-08   
ref|NP_001275620.1|  uncharacterized protein LOC102590907 precursor   59.3    6e-08   
ref|XP_008808739.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  59.3    6e-08   
ref|XP_004976457.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  59.3    6e-08   
ref|XP_011081228.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  59.3    6e-08   
ref|XP_008338137.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  59.3    6e-08   
ref|XP_006662037.1|  PREDICTED: cortical cell-delineating protein...  59.3    6e-08   
ref|NP_001152193.1|  cortical cell-delineating protein precursor      59.3    6e-08   
ref|XP_006652623.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  60.5    6e-08   
ref|XP_011036580.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  58.9    6e-08   
ref|XP_004298648.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  59.3    6e-08   
gb|KFK28807.1|  hypothetical protein AALP_AA7G051200                  59.3    7e-08   
ref|XP_008238566.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  59.3    7e-08   
dbj|BAP16240.1|  Os10g0554800                                         59.7    7e-08   
gb|EAY79472.1|  hypothetical protein OsI_34600                        59.7    7e-08   
gb|EMT33298.1|  14 kDa proline-rich protein                           58.9    7e-08   
ref|XP_006302912.1|  hypothetical protein CARUB_v10021046mg           59.7    7e-08   
ref|XP_010088891.1|  hypothetical protein L484_020879                 59.3    7e-08   
ref|XP_009134275.1|  PREDICTED: lipid transfer protein EARLI 1-like   58.9    7e-08   
ref|XP_002874775.1|  hypothetical protein ARALYDRAFT_490053           59.7    7e-08   
ref|XP_002446916.1|  hypothetical protein SORBIDRAFT_06g024800        58.9    7e-08   
ref|NP_001065343.2|  Os10g0554800                                     59.7    7e-08   
ref|XP_007209690.1|  hypothetical protein PRUPE_ppa012402mg           59.7    7e-08   
ref|XP_009798258.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  58.9    8e-08   
ref|NP_566036.1|  protease inhibitor/seed storage/lipid transfer ...  58.9    8e-08   
ref|XP_006417266.1|  hypothetical protein EUTSA_v10009061mg           59.3    8e-08   
ref|XP_008238562.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  59.3    8e-08   
ref|XP_010508203.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  58.9    8e-08   
ref|NP_192985.1|  putative lipid transfer protein                     59.7    8e-08   
gb|EMT19253.1|  14 kDa proline-rich protein                           58.9    8e-08   
ref|XP_009333630.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  58.9    8e-08   
ref|XP_010088890.1|  hypothetical protein L484_020878                 58.9    8e-08   
ref|XP_008238564.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  59.3    8e-08   
ref|XP_009787417.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  58.9    9e-08   
ref|XP_008669243.1|  PREDICTED: uncharacterized protein LOC103646289  60.1    9e-08   
gb|KHN04344.1|  14 kDa proline-rich protein DC2.15                    58.5    9e-08   
ref|XP_007155640.1|  hypothetical protein PHAVU_003G218800g           60.1    9e-08   
ref|XP_007209745.1|  hypothetical protein PRUPE_ppa013010mg           58.9    9e-08   
gb|AFK36980.1|  unknown                                               58.5    9e-08   
ref|XP_007155639.1|  hypothetical protein PHAVU_003G218800g           60.1    1e-07   
ref|XP_008658410.1|  PREDICTED: ctenidin-1-like                       60.1    1e-07   
gb|AFK47547.1|  unknown                                               58.9    1e-07   
ref|XP_004244453.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  58.5    1e-07   
ref|NP_001237995.1|  uncharacterized protein LOC100305616 precursor   58.5    1e-07   
ref|NP_001237899.1|  uncharacterized protein LOC100527818 precursor   58.5    1e-07   
gb|ACG33201.1|  cortical cell-delineating protein precursor           58.9    1e-07   
ref|XP_010093708.1|  hypothetical protein L484_019049                 58.5    1e-07   
gb|KFK37310.1|  hypothetical protein AALP_AA4G240600                  58.5    1e-07   
ref|XP_002511666.1|  14 kDa proline-rich protein DC2.15 precursor...  58.5    1e-07   
gb|AAK30571.1|AF346659_1  extensin-like protein                       58.5    1e-07   
ref|XP_008808738.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  58.5    1e-07   
ref|XP_003588779.1|  14 kDa proline-rich protein DC2.15               59.7    1e-07   
ref|XP_003608741.1|  Cortical cell-delineating protein                58.5    1e-07   
ref|XP_010553463.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  58.5    1e-07   
ref|XP_008232589.1|  PREDICTED: putative lipid-binding protein At...  58.5    1e-07   
gb|KFK25909.1|  hypothetical protein AALP_AA8G178400                  58.9    1e-07   
emb|CDP09931.1|  unnamed protein product                              58.2    1e-07   
ref|XP_006367623.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  58.2    1e-07   
ref|XP_009388037.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  58.2    2e-07   
ref|NP_001235008.1|  uncharacterized protein LOC100499716 precursor   58.9    2e-07   
ref|XP_007218590.1|  hypothetical protein PRUPE_ppa013286mg           58.2    2e-07   
ref|XP_009388030.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  58.2    2e-07   
ref|XP_002324869.2|  hypothetical protein POPTR_0018s01890g           57.8    2e-07   
ref|XP_006397698.1|  hypothetical protein EUTSA_v10001680mg           58.2    2e-07   
ref|XP_010676152.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  58.2    2e-07   
gb|AFK41425.1|  unknown                                               58.2    2e-07   
ref|XP_010476166.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  58.2    2e-07   
ref|XP_004306948.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  57.8    2e-07   
tpg|DAA42812.1|  TPA: hypothetical protein ZEAMMB73_664289            58.9    2e-07   
ref|XP_003609035.1|  Proline-rich protein                             57.8    2e-07   
ref|XP_009411010.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  57.8    2e-07   
ref|XP_010053929.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    57.8    2e-07   
ref|XP_009123402.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  57.8    2e-07   
emb|CDY32208.1|  BnaA03g54590D                                        57.8    2e-07   
ref|XP_007052129.1|  Bifunctional inhibitor/lipid-transfer protei...  57.8    2e-07   
ref|NP_001241194.1|  uncharacterized protein LOC100777903 precursor   57.8    2e-07   
ref|XP_010264241.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  57.8    2e-07   
ref|NP_001237088.1|  uncharacterized protein LOC100527767 precursor   57.4    2e-07   
emb|CDY08680.1|  BnaC04g19890D                                        57.8    3e-07   
gb|KDP28789.1|  hypothetical protein JCGZ_14560                       57.4    3e-07   
ref|XP_008786992.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  57.8    3e-07   
gb|ADW80126.1|  hybrid proline-rich protein                           57.4    3e-07   
ref|XP_006391856.1|  hypothetical protein EUTSA_v10023747mg           57.8    3e-07   
ref|XP_010919517.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  57.8    3e-07   
ref|XP_002880164.1|  hypothetical protein ARALYDRAFT_483654           57.4    3e-07   
tpg|DAA37198.1|  TPA: hypothetical protein ZEAMMB73_187029            57.4    3e-07   
ref|XP_004235149.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  56.6    3e-07   
ref|XP_004235416.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  56.6    3e-07   



>ref|NP_192992.1| auxin-Induced in Root cultures 1 [Arabidopsis thaliana]
 sp|Q9S7I2.1|AIR1_ARATH RecName: Full=Putative lipid-binding protein AIR1; AltName: Full=Auxin-induced 
in root cultures protein 1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK95273.1|AF410287_1 AT4g12550/T1P17_140 [Arabidopsis thaliana]
 gb|AAD12258.1| putative cell wall-plasma membrane disconnecting CLCT protein 
[Arabidopsis thaliana]
 emb|CAB41725.1| putative cell wall-plasma membrane disconnecting CLCT protein 
(AIR1A) [Arabidopsis thaliana]
 emb|CAB78298.1| putative cell wall-plasma membrane disconnecting CLCT protein 
(AIR1A) [Arabidopsis thaliana]
 gb|AAM10352.1| AT4g12550/T1P17_140 [Arabidopsis thaliana]
 gb|AEE83146.1| auxin-Induced in Root cultures 1 [Arabidopsis thaliana]
Length=111

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 57/84 (68%), Gaps = 6/84 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CPKN +++  CV +L  V  T+G PP+    +PCCSLI  L DLEA +CLC  VKA++
Sbjct  26   GTCPKNSIEIGTCVTVLNLVDLTLGNPPV----KPCCSLIQGLADLEAAVCLCTAVKASI  81

Query  450  PQIVDVNLTVSLA--LKVCNRNIP  515
              IV++NL ++L+  L VC+RN P
Sbjct  82   LGIVNINLPINLSVLLNVCSRNAP  105



>gb|AAM63191.1| putative cell wall-plasma membrane disconnecting CLCT protein 
(AIR1A) [Arabidopsis thaliana]
Length=111

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 6/84 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CPKN +++  CV +L  V  T+G PP+    +PCCSLI  L DLEA +CLC  +KA++
Sbjct  26   GTCPKNSIEIGTCVTVLNLVDLTLGNPPV----KPCCSLIQGLADLEAAVCLCTALKASI  81

Query  450  PQIVDVNLTVSLA--LKVCNRNIP  515
              IV++NL ++L+  L VC+RN P
Sbjct  82   LGIVNINLPINLSVLLNVCSRNAP  105



>gb|AAC62610.1| similar to the C-terminus of putative plasma membrane-cell wall 
linker proteins [Arabidopsis thaliana]
Length=108

 Score = 72.4 bits (176),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 56/84 (67%), Gaps = 6/84 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CPKN +++  CV +L  V  T+G PP+    +PCCSLI  L DLEA  CLC  +KA++
Sbjct  23   GTCPKNSIEIGTCVTVLNLVDLTLGNPPV----KPCCSLIQGLADLEAAACLCTALKASI  78

Query  450  PQIVDVNLTVSLA--LKVCNRNIP  515
              IV++NL ++L+  L VC+RN P
Sbjct  79   LGIVNINLPINLSVLLNVCSRNAP  102



>ref|XP_009134277.1| PREDICTED: putative lipid-binding protein AIR1 [Brassica rapa]
 emb|CDX90838.1| BnaA03g25180D [Brassica napus]
Length=113

 Score = 72.4 bits (176),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 59/85 (69%), Gaps = 5/85 (6%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CP++ LQL VC ++L+ V  T+G PP+    +PCCSLIA L DLEA +CLC ++KAN+
Sbjct  29   GSCPRDSLQLGVCANVLKLVDLTLGNPPV----KPCCSLIAGLADLEAAVCLCTVLKANI  84

Query  450  PQI-VDVNLTVSLALKVCNRNIPLN  521
              I +++ + +S+ L VC+R  P N
Sbjct  85   LGIKLNLPINLSVLLNVCSRKAPKN  109



>emb|CDY21277.1| BnaC03g29610D [Brassica napus]
Length=113

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 59/85 (69%), Gaps = 5/85 (6%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CP++ LQL VC ++L+ V  T+G PP+    +PCCSLIA L DLEA +CLC ++KAN+
Sbjct  29   GSCPRDSLQLGVCANVLKLVDLTLGNPPV----KPCCSLIAGLADLEAAVCLCTVLKANI  84

Query  450  PQI-VDVNLTVSLALKVCNRNIPLN  521
              I +++ + +S+ L VC+R  P N
Sbjct  85   LGIKLNLPINLSVLLNVCSRKAPKN  109



>ref|XP_010041843.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
 ref|XP_010042382.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
Length=121

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 57/82 (70%), Gaps = 6/82 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CP+N L+L VC+DLL + V  TVG PP      PCCSLI  LVDLEA +CLC  ++AN+ 
Sbjct  38   CPENALKLGVCLDLLGSLVNVTVGTPP----KEPCCSLIQGLVDLEAAVCLCTAIRANVL  93

Query  453  QI-VDVNLTVSLALKVCNRNIP  515
             + +DV L++SL L VC++ +P
Sbjct  94   GLHLDVPLSLSLLLNVCSKKVP  115



>ref|XP_011070106.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum]
Length=127

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 56/84 (67%), Gaps = 6/84 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CPK+ L+L VC DLL  + G T+G PP      PCC+LI  L DLEA +CLC  +KAN
Sbjct  42   GYCPKDTLKLGVCADLLGGLLGITIGTPP----KTPCCTLIEGLADLEAAVCLCTAIKAN  97

Query  447  LPQI-VDVNLTVSLALKVCNRNIP  515
            +  I ++V L++SL L VC++ +P
Sbjct  98   ILGINLNVPLSLSLLLNVCSKKVP  121



>ref|XP_003572782.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Brachypodium 
distachyon]
Length=123

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 54/88 (61%), Gaps = 5/88 (6%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            +G CPKN L+L  C D+L  V A VG PP      PCCS++  L DLEA +CLC  +KAN
Sbjct  38   DGKCPKNALKLAACADVLGLVSAEVGHPP----AEPCCSILGGLADLEAAVCLCTAIKAN  93

Query  447  LPQI-VDVNLTVSLALKVCNRNIPLNAI  527
            +  I +D+ + +SL +  C +++P   I
Sbjct  94   VLGISLDIPVKLSLLVNYCGKSLPSGFI  121



>gb|AIX10944.1| PRP2-like protein [Gardenia jasminoides]
Length=147

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 55/81 (68%), Gaps = 5/81 (6%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            CP + L+L VC DLL  +G ++G PP    T+PCCSL+  L DLEA +CLC  +KAN+  
Sbjct  65   CPGDALKLGVCADLLGLIGISIGSPP----TKPCCSLLEGLADLEAAVCLCTAIKANILG  120

Query  456  I-VDVNLTVSLALKVCNRNIP  515
            I ++V +++SL L  C +++P
Sbjct  121  INLNVPISLSLILNNCGKSVP  141



>ref|XP_006647641.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Oryza brachyantha]
Length=128

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 52/85 (61%), Gaps = 5/85 (6%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            CPKN L+L  C D+L  V A VG PP      PCCS++  L DLEA +CLC  +KAN+  
Sbjct  46   CPKNALKLAACADVLGLVSAEVGQPPY----EPCCSVLGGLADLEAAVCLCTAIKANVLG  101

Query  456  I-VDVNLTVSLALKVCNRNIPLNAI  527
            I +D+ + +SL +  C +N+P   I
Sbjct  102  ITLDIPVKLSLLVNYCGKNVPSGFI  126



>gb|EYU30301.1| hypothetical protein MIMGU_mgv1a018370mg [Erythranthe guttata]
Length=119

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 58/89 (65%), Gaps = 6/89 (7%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKA  443
            N  CPK+ L+L VC DLL  +   TVG PP      PCCSLI  LVDLEA +CLC  +KA
Sbjct  33   NYACPKDTLKLGVCADLLNGLLNVTVGTPP----KTPCCSLIEGLVDLEAAVCLCTAIKA  88

Query  444  NLPQI-VDVNLTVSLALKVCNRNIPLNAI  527
            N+  I +DV ++++L L VC +++P + +
Sbjct  89   NVLGINIDVPISLTLLLNVCTKSVPKDFV  117



>gb|EYU30296.1| hypothetical protein MIMGU_mgv1a015783mg [Erythranthe guttata]
Length=146

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 56/82 (68%), Gaps = 6/82 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CP++ L+L VC DLL   +G T+G PP      PCCSLI  L DLEA +CLC  +KAN+ 
Sbjct  63   CPRDALKLGVCADLLGGLIGLTIGSPP----KTPCCSLIEGLADLEAAVCLCTAIKANVL  118

Query  453  QI-VDVNLTVSLALKVCNRNIP  515
             I ++V +++SL L VC++NIP
Sbjct  119  GINLNVPISLSLLLNVCSKNIP  140



>ref|XP_002454523.1| hypothetical protein SORBIDRAFT_04g032640 [Sorghum bicolor]
 ref|XP_002454526.1| hypothetical protein SORBIDRAFT_04g032670 [Sorghum bicolor]
 gb|EES07499.1| hypothetical protein SORBIDRAFT_04g032640 [Sorghum bicolor]
 gb|EES07502.1| hypothetical protein SORBIDRAFT_04g032670 [Sorghum bicolor]
Length=122

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 55/84 (65%), Gaps = 5/84 (6%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            NG CP++ L+L VC ++L  + A VG+PP      PCC L+A LVDLEA +CLC  +KAN
Sbjct  38   NGSCPRDALKLGVCANVLGLIKAQVGVPP----AEPCCPLLAGLVDLEAAVCLCTAIKAN  93

Query  447  LPQI-VDVNLTVSLALKVCNRNIP  515
            +  I ++V L +SL L  C + +P
Sbjct  94   VLGINLNVPLDLSLILNYCGKTVP  117



>ref|XP_010053449.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Eucalyptus grandis]
 gb|KCW77745.1| hypothetical protein EUGRSUZ_D02039 [Eucalyptus grandis]
Length=121

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 58/89 (65%), Gaps = 7/89 (8%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CP+N L+L VC+DLL ++   TVG PP      PCCSLI  L DLEA  CLC+++ A++ 
Sbjct  38   CPENALKLGVCLDLLGSLLNVTVGTPP----KEPCCSLIGGLADLEAAACLCIVIDADVL  93

Query  453  QI-VDVNLTVSLALKVCNRNIPLNAIKCP  536
             + +DV L++SL L  C++ +P    +CP
Sbjct  94   GLQIDVPLSLSLLLDACSKKVP-PGFQCP  121



>dbj|BAA11854.1| extensin like protein [Populus nigra]
 dbj|BAA11855.1| extensin like protein [Populus nigra]
Length=141

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 58/85 (68%), Gaps = 6/85 (7%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKA  443
             G CPK+ L+L VC DLL ++   TVG PP+    +PCCS+I  L+DLEA +CLC  +KA
Sbjct  55   GGKCPKDALKLGVCADLLGSLLNVTVGTPPV----KPCCSVIQGLLDLEAAVCLCTAIKA  110

Query  444  NLPQI-VDVNLTVSLALKVCNRNIP  515
            N+  I +++ L++SL L VC + +P
Sbjct  111  NILGINLNIPLSLSLLLNVCGKKVP  135



>gb|KCW77747.1| hypothetical protein EUGRSUZ_D02041 [Eucalyptus grandis]
Length=121

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 58/89 (65%), Gaps = 7/89 (8%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CP+N L+L VC+DLL ++   TVG PP      PCCSLI  L DLEA  CLC+++ A++ 
Sbjct  38   CPENALKLGVCLDLLGSLLNVTVGTPP----KEPCCSLIGGLADLEAAACLCIVIDADVL  93

Query  453  QI-VDVNLTVSLALKVCNRNIPLNAIKCP  536
             + +DV L++SL L  C++ +P    +CP
Sbjct  94   GLQIDVPLSLSLLLDACSKKVP-PGFQCP  121



>ref|XP_010539605.1| PREDICTED: putative lipid-binding protein AIR1 [Tarenaya hassleriana]
Length=140

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 60/90 (67%), Gaps = 6/90 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CP++ L+L +CVD L  +  T+G PP+    +PCCSLI  LVDLEA LCLC +++A++
Sbjct  56   GSCPRDALKLGICVDALNLLNVTLGSPPV----QPCCSLIQGLVDLEAALCLCTVLRASI  111

Query  450  PQI-VDVNLTVSLALKVCNRNIPLNAIKCP  536
              I V++ + +SL L VC+R  P    +CP
Sbjct  112  LGINVNLPINLSLLLNVCSRQAP-RGFQCP  140



>ref|XP_002271593.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Vitis vinifera]
 emb|CAN80709.1| hypothetical protein VITISV_033376 [Vitis vinifera]
 emb|CBI31903.3| unnamed protein product [Vitis vinifera]
Length=132

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 56/85 (66%), Gaps = 6/85 (7%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLR-TVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKA  443
            NG CP++ L+L VC  LL  TVGA VG PP+     PCCSL+  L+DLE   CLC  +KA
Sbjct  46   NGSCPRDALKLGVCAKLLNGTVGAVVGTPPVT----PCCSLLEGLLDLEVAACLCTAIKA  101

Query  444  NLPQI-VDVNLTVSLALKVCNRNIP  515
            N+  I +D+ +++SL + +C + +P
Sbjct  102  NILGIHLDIPVSLSLLVNICGKKLP  126



>ref|XP_006369032.1| HyPRP family protein [Populus trichocarpa]
 gb|ERP65601.1| HyPRP family protein [Populus trichocarpa]
Length=132

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 57/85 (67%), Gaps = 6/85 (7%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKA  443
             G CPK+ L+L VC DLL ++   TVG PP+     PCCSLI  L+DLEA +CLC  +KA
Sbjct  46   GGKCPKDALKLGVCADLLGSLLNVTVGTPPV----EPCCSLIQGLLDLEAAVCLCTAIKA  101

Query  444  NLPQI-VDVNLTVSLALKVCNRNIP  515
            N+  I +++ +++SL L VC + +P
Sbjct  102  NILGINLNIPVSLSLLLNVCGKKVP  126



>dbj|BAF46299.1| extensin like protein [Ipomoea nil]
Length=133

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 60/91 (66%), Gaps = 7/91 (8%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CPK+ L+L VC ++L  + G  VG PP     +PCCSLI  LVDLEA +CLC  +KAN
Sbjct  48   GKCPKDALKLGVCANVLGNLLGLVVGNPP----KKPCCSLIEGLVDLEAAVCLCTAIKAN  103

Query  447  LPQI-VDVNLTVSLALKVCNRNIPLNAIKCP  536
            +  I ++V L++SL L VC + +P +  +CP
Sbjct  104  ILGINLNVPLSLSLLLNVCGKKVP-SGFQCP  133



>gb|KHG02760.1| 14 kDa proline-rich DC2 [Gossypium arboreum]
Length=132

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 57/83 (69%), Gaps = 5/83 (6%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CP++ L+L VC ++L  V  TVG PP+     PCCSL+  LVDLEA  CLC  ++AN+
Sbjct  49   GRCPRDALKLGVCANVLNLVNVTVGSPPV----MPCCSLLNGLVDLEAAACLCTAIRANI  104

Query  450  PQI-VDVNLTVSLALKVCNRNIP  515
              I +++ +++SL L VC+RN+P
Sbjct  105  LGINLNIPVSLSLLLNVCSRNVP  127



>emb|CDP09932.1| unnamed protein product [Coffea canephora]
Length=147

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 56/90 (62%), Gaps = 12/90 (13%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            CP++ L+L VC +LL  +G ++G PP    T PCCSL+  L DLEA LCLC  +KAN   
Sbjct  65   CPRDALKLGVCANLLNIIGISIGSPP----TEPCCSLLQGLADLEAALCLCTAIKAN---  117

Query  456  IVDVNLTVSLALKV----CNRNIPLNAIKC  533
            I+ +NL V ++L V    C + +P N  +C
Sbjct  118  ILGINLNVPVSLSVILNDCGKKVP-NGFQC  146



>gb|ABP35529.1| proline-rich protein [Ipomoea batatas]
Length=132

 Score = 70.1 bits (170),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 58/91 (64%), Gaps = 7/91 (8%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CPK+ L+L VC ++L  + G  VG PP     +PCCS I  LVDLEA +CLC  +KAN
Sbjct  47   GKCPKDALKLGVCANVLGNLLGLVVGNPP----KKPCCSFIEGLVDLEAAVCLCTAIKAN  102

Query  447  LPQI-VDVNLTVSLALKVCNRNIPLNAIKCP  536
            +  I ++V L++SL L VC + +P    +CP
Sbjct  103  VLGINLNVPLSLSLFLNVCGKKVPF-GFQCP  132



>dbj|BAA05471.1| tumor-related protein [Nicotiana glauca x Nicotiana langsdorffii]
Length=87

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 56/84 (67%), Gaps = 6/84 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CP++ L+L VC +L+   VGA VG PP    T PCCSLIA L DLEA +CLC  ++AN
Sbjct  3    GRCPRDALKLGVCANLVGGLVGAIVGSPP----TLPCCSLIAGLADLEAAVCLCTAIRAN  58

Query  447  LPQI-VDVNLTVSLALKVCNRNIP  515
            +  I ++V L++SL L  C RN P
Sbjct  59   VLGINLNVPLSLSLVLNNCGRNPP  82



>ref|XP_009796139.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=158

 Score = 70.5 bits (171),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 55/82 (67%), Gaps = 6/82 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CP++ L+L VC +LL   VGA +G PP    T PCCSLIA L DLEA +CLC  ++AN+ 
Sbjct  76   CPRDALKLGVCANLLGGLVGAVIGTPP----TMPCCSLIAGLADLEAAVCLCTAIRANVL  131

Query  453  QI-VDVNLTVSLALKVCNRNIP  515
             I ++V L++SL L  C RN P
Sbjct  132  GINLNVPLSLSLVLNNCGRNPP  153



>ref|XP_002533293.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
 gb|EEF29087.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
Length=136

 Score = 70.1 bits (170),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 56/88 (64%), Gaps = 7/88 (8%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CPK+ L+L VCVDLL+ +   T+G PP      PCCSLI  LVDLEA +CLC  +KA+L 
Sbjct  53   CPKDTLKLGVCVDLLKDLLSVTIGKPP----KSPCCSLIGDLVDLEAAVCLCTTIKASLL  108

Query  453  QI-VDVNLTVSLALKVCNRNIPLNAIKC  533
             I ++V + +SL L  C + +P    KC
Sbjct  109  GINLNVPVDLSLLLNYCGKKVP-EGFKC  135



>ref|XP_009114615.1| PREDICTED: putative lipid-binding protein AIR1 [Brassica rapa]
Length=129

 Score = 69.7 bits (169),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 59/88 (67%), Gaps = 6/88 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            CPK+ ++L VCV+ L  + AT+G PP+    +PCCSLI  LVDLEA +CLC  +KA++  
Sbjct  47   CPKDTVKLGVCVNALNLLNATLGAPPV----KPCCSLIDGLVDLEAAVCLCTALKASILG  102

Query  456  I-VDVNLTVSLALKVCNRNIPLNAIKCP  536
            I +++ + +SL L VCNR  P    +CP
Sbjct  103  ININLPINLSLLLNVCNRKAP-RGFQCP  129



>ref|NP_001238293.1| uncharacterized protein LOC100527330 precursor [Glycine max]
 gb|ACU16403.1| unknown [Glycine max]
Length=136

 Score = 70.1 bits (170),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 60/86 (70%), Gaps = 5/86 (6%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            +G CP++ L+L VC ++L  V AT+G PP+     PCC+L+  LVDLEA +CLC  +KAN
Sbjct  51   SGSCPRDALKLGVCANVLNLVNATLGQPPVT----PCCTLLDGLVDLEAAVCLCTALKAN  106

Query  447  LPQI-VDVNLTVSLALKVCNRNIPLN  521
            +  I +++ +++SL L VC+R +P N
Sbjct  107  ILGINLNLPISLSLLLNVCSRKVPRN  132



>ref|XP_010041938.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
Length=121

 Score = 69.7 bits (169),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 58/89 (65%), Gaps = 7/89 (8%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CP+N L+L VC+DLL ++   TVG PP      PCCSLI  L+D+EA  CLC+ + A++ 
Sbjct  38   CPENALKLGVCLDLLGSLLNVTVGTPP----KEPCCSLIGGLLDVEAAACLCIAIDADIL  93

Query  453  QI-VDVNLTVSLALKVCNRNIPLNAIKCP  536
             + +DV L++SL L  C++ +P    +CP
Sbjct  94   GLQIDVELSLSLLLDACSKKVP-PGFQCP  121



>ref|XP_010433325.1| PREDICTED: putative lipid-binding protein AIR1B [Camelina sativa]
Length=113

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 56/86 (65%), Gaps = 7/86 (8%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CPK+ LQL VC ++L+ V  T+G PP+    +PCCSLI  L DLEA  CLC ++K N+
Sbjct  29   GSCPKDSLQLGVCANVLKLVDLTLGNPPV----KPCCSLIQGLADLEAAACLCTLLKVNI  84

Query  450  PQIVDVNLTVSLA--LKVCNRNIPLN  521
              I ++NL V+L+  L VC R  P N
Sbjct  85   LGI-NINLPVNLSVLLNVCGRKAPTN  109



>ref|XP_002533292.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
 gb|EEF29086.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
Length=137

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 56/88 (64%), Gaps = 7/88 (8%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CP++ L+L VCVDLL+ +   TVG PP      PCCSLIA LVDLEA +CLC  +KA+L 
Sbjct  54   CPRDTLKLGVCVDLLKDLLSVTVGTPP----KTPCCSLIADLVDLEAAVCLCTTIKASLL  109

Query  453  QI-VDVNLTVSLALKVCNRNIPLNAIKC  533
             I + V + +SL L  C + +P    KC
Sbjct  110  GINLSVPVDLSLLLNYCGKKVP-EGFKC  136



>ref|XP_007039886.1| 14 kDa proline-rich protein DC2.15, putative [Theobroma cacao]
 gb|EOY24387.1| 14 kDa proline-rich protein DC2.15, putative [Theobroma cacao]
Length=140

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 58/85 (68%), Gaps = 6/85 (7%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKA  443
             G CP++ L+L +C DLL  +   TVG PP+    +PCCSLI  L DLEA +CLC  +KA
Sbjct  54   GGKCPRDALKLGICADLLGGLLNVTVGKPPV----QPCCSLIQGLADLEAAVCLCTAIKA  109

Query  444  NLPQI-VDVNLTVSLALKVCNRNIP  515
            N+  I +++ +++SL L VC++N+P
Sbjct  110  NILGINLNIPVSLSLLLNVCSKNVP  134



>ref|XP_003603362.1| Proline-rich protein [Medicago truncatula]
 gb|ACJ86111.1| unknown [Medicago truncatula]
 gb|AES73613.1| Lipid transfer protein [Medicago truncatula]
 gb|AFK47287.1| unknown [Medicago truncatula]
Length=130

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 55/90 (61%), Gaps = 5/90 (6%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CPK+ L+L VC DLL  V   +G PP   S   CC+LI  L DLEA LCLC  +KAN+
Sbjct  45   GQCPKDTLKLGVCADLLGLVNVVIGNPP---SGSKCCALIKGLADLEAALCLCTALKANV  101

Query  450  PQI-VDVNLTVSLALKVCNRNIPLNAIKCP  536
              I ++V +T+SL L  C + +P    +CP
Sbjct  102  LGINLNVPITLSLLLSACQKTVP-PGFQCP  130



>ref|XP_002270769.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Vitis vinifera]
 emb|CAN65287.1| hypothetical protein VITISV_042739 [Vitis vinifera]
Length=135

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 55/82 (67%), Gaps = 6/82 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CPK+ L+L VC +LL   +GA VG PP      PCCSLI  L DLEA +CLC  +KAN+ 
Sbjct  52   CPKDTLKLGVCANLLGGLIGAVVGTPP----KTPCCSLIQGLADLEAAVCLCTAIKANVL  107

Query  453  QI-VDVNLTVSLALKVCNRNIP  515
             I +++ L++SL L VC++ +P
Sbjct  108  GINLNIPLSLSLLLNVCSKKVP  129



>ref|XP_010455703.1| PREDICTED: putative lipid-binding protein AIR1B [Camelina sativa]
Length=113

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 55/85 (65%), Gaps = 5/85 (6%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CPK+ LQL VC ++L+ V  T+G PP+    +PCCSLI  L DLEA  CLC ++K NL
Sbjct  29   GSCPKDSLQLGVCANVLKLVDLTLGNPPV----KPCCSLIQGLADLEAAACLCTLLKVNL  84

Query  450  PQI-VDVNLTVSLALKVCNRNIPLN  521
              I +++ + +S+ L VC R  P N
Sbjct  85   LGINLNLPINLSVLLNVCGRKAPTN  109



>gb|KHN04346.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=136

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 60/86 (70%), Gaps = 5/86 (6%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            +G CP++ L+L VC ++L  V AT+G PP+     PCC+L+  LVDLEA +CLC  +KAN
Sbjct  51   SGSCPRDALKLGVCANVLNLVNATLGQPPVT----PCCTLLDGLVDLEAAVCLCTALKAN  106

Query  447  LPQI-VDVNLTVSLALKVCNRNIPLN  521
            +  I +++ +++SL L VC+R +P N
Sbjct  107  ILGINLNLPISLSLLLNVCSRKVPRN  132



>ref|XP_010053450.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Eucalyptus grandis]
 gb|KCW77748.1| hypothetical protein EUGRSUZ_D02042 [Eucalyptus grandis]
Length=121

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 56/82 (68%), Gaps = 6/82 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CP+N L+L VC+DLL + V  TVG PP      PCCSLI  L DLEA +CLC  ++A++ 
Sbjct  38   CPENALKLGVCLDLLGSLVNVTVGTPP----KEPCCSLIQGLADLEAAVCLCTAIRADVL  93

Query  453  QI-VDVNLTVSLALKVCNRNIP  515
             + +DV L++SL L VC++ +P
Sbjct  94   GLHLDVPLSLSLLLNVCSKKVP  115



>ref|XP_010433312.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=131

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 57/86 (66%), Gaps = 5/86 (6%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            +G CP++ LQL VC ++L+ V  T+G PP+    +PCCSLI  L DLEA +CLC ++K N
Sbjct  46   SGTCPRDSLQLGVCANVLKLVDLTLGNPPV----KPCCSLIQGLADLEAAVCLCTLLKVN  101

Query  447  LPQI-VDVNLTVSLALKVCNRNIPLN  521
            +  I +++ + +S+ L VC R  P N
Sbjct  102  ILGININLPIDLSILLNVCGRKAPTN  127



>ref|XP_009782706.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=158

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 56/84 (67%), Gaps = 6/84 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CP++ L+L VC +L+   VGA +G PP    T PCCSLIA L DLEA +CLC  ++AN
Sbjct  74   GRCPRDALKLGVCANLVGGLVGAVIGTPP----TMPCCSLIAGLADLEAAVCLCTAIRAN  129

Query  447  LPQI-VDVNLTVSLALKVCNRNIP  515
            +  I ++V L++SL L  C RN P
Sbjct  130  VLGINLNVPLSLSLVLNNCGRNPP  153



>gb|EMS62564.1| 14 kDa proline-rich protein DC2.15 [Triticum urartu]
Length=126

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 52/85 (61%), Gaps = 5/85 (6%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            CPKN L+L  C D+L  V A VG PP      PCCS++  L DLEA +CLC  +KAN+  
Sbjct  44   CPKNALKLAACADVLGLVLAQVGQPP----AEPCCSILGGLADLEAAVCLCTAIKANVLG  99

Query  456  I-VDVNLTVSLALKVCNRNIPLNAI  527
            I +D+ + +SL +  C +N+P   I
Sbjct  100  ISLDIPVKLSLLVNYCGKNLPSGFI  124



>ref|XP_009796138.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
 ref|XP_009796140.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=152

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 56/84 (67%), Gaps = 6/84 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CP++ L+L VC +L+   VGA +G PP    T PCCSLIA L DLEA +CLC  ++AN
Sbjct  68   GRCPRDALKLGVCANLVGGLVGAVIGSPP----TMPCCSLIAGLADLEAAVCLCTAIRAN  123

Query  447  LPQI-VDVNLTVSLALKVCNRNIP  515
            +  I ++V L++SL L  C RN P
Sbjct  124  VLGINLNVPLSLSLVLNNCGRNPP  147



>ref|XP_002454525.1| hypothetical protein SORBIDRAFT_04g032660 [Sorghum bicolor]
 gb|EES07501.1| hypothetical protein SORBIDRAFT_04g032660 [Sorghum bicolor]
Length=122

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 54/83 (65%), Gaps = 5/83 (6%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CP++ L+L VC ++L  + A VG+PP      PCC L+A LVDLEA +CLC  +KAN+
Sbjct  39   GSCPRDALKLGVCANVLGLIKAQVGVPP----AEPCCPLLAGLVDLEAAVCLCTAIKANV  94

Query  450  PQI-VDVNLTVSLALKVCNRNIP  515
              I ++V L +SL L  C + +P
Sbjct  95   LGINLNVPLDLSLILNYCGKTVP  117



>ref|XP_006289270.1| hypothetical protein CARUB_v10002736mg [Capsella rubella]
 gb|EOA22168.1| hypothetical protein CARUB_v10002736mg [Capsella rubella]
Length=131

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 57/88 (65%), Gaps = 6/88 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            CPK+ L+L VCV  L  V  T+G PP+    +PCCSLI  LVDLEA +CLC  +KA++  
Sbjct  49   CPKDALKLGVCVQALNLVNVTLGAPPV----KPCCSLIDGLVDLEAAVCLCTAIKASILG  104

Query  456  I-VDVNLTVSLALKVCNRNIPLNAIKCP  536
            I +++ + +SL L VC+R  P    +CP
Sbjct  105  ININLPINLSLLLNVCSRKAP-RGFQCP  131



>ref|XP_002454524.1| hypothetical protein SORBIDRAFT_04g032650 [Sorghum bicolor]
 gb|EES07500.1| hypothetical protein SORBIDRAFT_04g032650 [Sorghum bicolor]
Length=131

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 54/83 (65%), Gaps = 5/83 (6%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CP++ L+L VC ++L  + A VG+PP      PCC L+A LVDLEA +CLC  +KAN+
Sbjct  48   GSCPRDALKLGVCANVLGLIKAQVGVPP----AEPCCPLLAGLVDLEAAVCLCTAIKANV  103

Query  450  PQI-VDVNLTVSLALKVCNRNIP  515
              I ++V L +SL L  C + +P
Sbjct  104  LGINLNVPLDLSLILNYCGKTVP  126



>ref|XP_009783445.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=158

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 56/84 (67%), Gaps = 6/84 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CP++ L+L VC +L+   VGA +G PP    T PCCSLIA L DLEA +CLC  ++AN
Sbjct  74   GRCPRDALKLGVCANLVGGLVGAVIGSPP----TMPCCSLIAGLADLEAAVCLCTAIRAN  129

Query  447  LPQI-VDVNLTVSLALKVCNRNIP  515
            +  I ++V L++SL L  C RN P
Sbjct  130  VLGINLNVPLSLSLVLNNCGRNPP  153



>ref|XP_010433300.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=113

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 56/85 (66%), Gaps = 5/85 (6%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CP++ LQL VC ++L+ V  T+G PP     +PCCSLI  L DLEA +CLC ++K N+
Sbjct  29   GSCPRDSLQLGVCANVLKLVDLTLGNPP----VKPCCSLIQGLADLEAAVCLCTLLKVNI  84

Query  450  PQI-VDVNLTVSLALKVCNRNIPLN  521
             +I +++ + +S+ L +C R  P N
Sbjct  85   LEININLPIDLSVLLNICGRKAPTN  109



>gb|ABG91752.1| HyPRP2 [Gossypium hirsutum]
Length=137

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 6/84 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CP++ L+L VC DLL  +   T+G PP+    +PCCSLI  L DLEA +CLC  +KAN
Sbjct  52   GKCPRDALKLGVCADLLGGLLNVTIGTPPV----QPCCSLIQGLADLEAAVCLCTAIKAN  107

Query  447  LPQI-VDVNLTVSLALKVCNRNIP  515
            +  I ++V L++SL L VC++ +P
Sbjct  108  ILGINLNVPLSLSLLLNVCSKKVP  131



>ref|NP_001047651.1| Os02g0662100 [Oryza sativa Japonica Group]
 dbj|BAD25631.1| putative ZmGR1a [Oryza sativa Japonica Group]
 dbj|BAD27674.1| putative ZmGR1a [Oryza sativa Japonica Group]
 dbj|BAF09565.1| Os02g0662100 [Oryza sativa Japonica Group]
 gb|EAY86973.1| hypothetical protein OsI_08367 [Oryza sativa Indica Group]
 gb|EAZ24090.1| hypothetical protein OsJ_07828 [Oryza sativa Japonica Group]
 dbj|BAG86633.1| unnamed protein product [Oryza sativa Japonica Group]
Length=128

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 50/85 (59%), Gaps = 5/85 (6%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            CPKN L+   C D+L  V A VG PP      PCC ++  L DLEA +CLC  +KAN+  
Sbjct  46   CPKNALKFAACADVLGLVSAEVGQPPY----EPCCGVLGGLADLEAAVCLCTAIKANVLG  101

Query  456  I-VDVNLTVSLALKVCNRNIPLNAI  527
            I +D+ + +SL +  C +N+P   I
Sbjct  102  ITLDIPVKLSLLVNYCGKNVPSGFI  126



>ref|XP_010529481.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Tarenaya 
hassleriana]
Length=152

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 57/91 (63%), Gaps = 6/91 (7%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
             G CP++ L++ VCVD L  +  T+G PP+    +PCCSLI  LVDLEA LCLC  ++A 
Sbjct  67   GGTCPRDALKIGVCVDALNLINVTIGSPPV----QPCCSLIQGLVDLEAALCLCTALRAT  122

Query  447  -LPQIVDVNLTVSLALKVCNRNIPLNAIKCP  536
             L   +++ + +SL L VC+R  P    +CP
Sbjct  123  ILGLTINLPINLSLLLNVCSRQTP-RGFQCP  152



>ref|XP_006289359.1| hypothetical protein CARUB_v10002845mg [Capsella rubella]
 gb|EOA22257.1| hypothetical protein CARUB_v10002845mg [Capsella rubella]
Length=113

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 57/83 (69%), Gaps = 5/83 (6%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            CPK+ LQL VC ++L+ V  T+G PP+    +PCCSLI  L DLEA +CLC ++KAN+  
Sbjct  31   CPKDSLQLGVCANVLKLVDLTLGNPPV----KPCCSLIQGLADLEAAVCLCTVLKANVLG  86

Query  456  I-VDVNLTVSLALKVCNRNIPLN  521
            I +++ + +S+ L VC+R  P N
Sbjct  87   INLNLPIDLSVLLNVCSRKAPKN  109



>ref|XP_002533294.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
 gb|EEF29088.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
Length=140

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 57/89 (64%), Gaps = 7/89 (8%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CPK+ L+L VCVDLL+ +   T+G PP      PCCSLI  LVDLEA +CLC  +KA+L 
Sbjct  57   CPKDTLKLGVCVDLLKDLLSVTIGKPP----KTPCCSLIGDLVDLEAAVCLCTSIKASLL  112

Query  453  QI-VDVNLTVSLALKVCNRNIPLNAIKCP  536
             I +++ + +SL L  C + +P    +CP
Sbjct  113  GINLNLPVDLSLVLNYCGKKVP-EGFQCP  140



>ref|XP_009619251.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
Length=158

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 56/84 (67%), Gaps = 6/84 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CP++ L+L VC +L+   VGA VG PP    T PCCSLIA L DLEA +CLC  ++AN
Sbjct  74   GRCPRDALKLGVCANLVGGLVGAIVGSPP----TLPCCSLIAGLADLEAAVCLCTAIRAN  129

Query  447  LPQI-VDVNLTVSLALKVCNRNIP  515
            +  I ++V L++SL L  C RN P
Sbjct  130  VLGINLNVPLSLSLVLNNCGRNPP  153



>ref|XP_010431835.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=107

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 56/86 (65%), Gaps = 5/86 (6%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            +  CPK+ LQL VC ++L+ V  T+G PP+    +PCCSLI  LVDLEA  CLC ++K N
Sbjct  22   SAACPKDSLQLGVCANVLKLVDLTLGNPPV----KPCCSLIQGLVDLEAAACLCTLLKVN  77

Query  447  LPQI-VDVNLTVSLALKVCNRNIPLN  521
            +  I V++ + +S+ L +C R  P N
Sbjct  78   ILGINVNLPIDLSVLLNICGRKAPTN  103



>ref|XP_002454521.1| hypothetical protein SORBIDRAFT_04g032620 [Sorghum bicolor]
 gb|EES07497.1| hypothetical protein SORBIDRAFT_04g032620 [Sorghum bicolor]
Length=131

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 52/85 (61%), Gaps = 5/85 (6%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            CPK+ L+L  C ++L  V A VG PP      PCCS++  L DLEA +CLC  +KAN+  
Sbjct  49   CPKHALKLAACANVLGFVSAEVGHPP----AEPCCSILGGLADLEAAVCLCTAIKANVLG  104

Query  456  I-VDVNLTVSLALKVCNRNIPLNAI  527
            I VD+ + +SL +  C +N+P   I
Sbjct  105  ITVDIPVKLSLIVNYCGKNLPSGFI  129



>ref|XP_010455705.1| PREDICTED: pEARLI1-like lipid transfer protein 3 [Camelina sativa]
Length=161

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 59/89 (66%), Gaps = 6/89 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CP++ LQL VC ++L+ V  T+G PP+    +PCCSLI  LVDLEA +CLC ++K N+
Sbjct  77   GACPRDSLQLGVCANVLKLVDLTLGNPPV----KPCCSLIQGLVDLEAAVCLCTLLKVNI  132

Query  450  PQI-VDVNLTVSLALKVCNRNIPLNAIKC  533
              I +++ + +S+ L VC R  P N  KC
Sbjct  133  LGINLNLPIDLSVLLNVCGRKAPTN-FKC  160



>ref|XP_006600137.1| PREDICTED: uncharacterized protein LOC100500016 isoform X1 [Glycine 
max]
 gb|KHN09802.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=137

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 58/84 (69%), Gaps = 5/84 (6%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            +G CP++ L+L VC ++L  V AT+G PP+     PCCSL+  LVDLEA +CLC  +KAN
Sbjct  51   SGSCPRDALKLGVCANVLNLVNATLGQPPVT----PCCSLLDGLVDLEAAVCLCTALKAN  106

Query  447  LPQI-VDVNLTVSLALKVCNRNIP  515
            +  I +++ +++SL L VC+R  P
Sbjct  107  ILGINLNLPISLSLLLNVCSRKAP  130



>ref|XP_009619252.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
 dbj|BAA95941.1| glycine-rich protein [Nicotiana tabacum]
Length=158

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 56/84 (67%), Gaps = 6/84 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CP++ L+L VC +L+   VGA VG PP    T PCCSLIA L DLEA +CLC  ++AN
Sbjct  74   GRCPRDALKLGVCANLVGGLVGAIVGSPP----TLPCCSLIAGLADLEAAVCLCTAIRAN  129

Query  447  LPQI-VDVNLTVSLALKVCNRNIP  515
            +  I ++V L++SL L  C RN P
Sbjct  130  VLGINLNVPLSLSLVLNNCGRNPP  153



>ref|XP_006368194.1| HyPRP family protein [Populus trichocarpa]
 gb|ABK92650.1| unknown [Populus trichocarpa]
 gb|ERP64763.1| HyPRP family protein [Populus trichocarpa]
Length=140

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 62/91 (68%), Gaps = 7/91 (8%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CPK+ L+L VC DLL ++   T+G PP+    +PCCS+I  L+DLEA +CLC  +KAN
Sbjct  55   GKCPKDALKLGVCADLLGSLLNVTIGSPPV----KPCCSVIQGLLDLEAAICLCTAIKAN  110

Query  447  LPQI-VDVNLTVSLALKVCNRNIPLNAIKCP  536
            +  I +++ +++SL + VC + +P +  +CP
Sbjct  111  ILGINLNIPISLSLLINVCGKKVPKD-FQCP  140



>ref|XP_010422227.1| PREDICTED: putative lipid-binding protein AIR1B [Camelina sativa]
Length=113

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 55/85 (65%), Gaps = 5/85 (6%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CPK+ LQL VC ++L+ V  T+G PP+    +PCCSLI  L DLEA  CLC ++K N+
Sbjct  29   GSCPKDSLQLGVCANVLKLVDLTLGNPPV----KPCCSLIQGLADLEAAACLCTLLKVNI  84

Query  450  PQI-VDVNLTVSLALKVCNRNIPLN  521
              I +++ + +S+ L VC R  P N
Sbjct  85   LGINLNLPINLSVLLNVCGRKAPTN  109



>ref|XP_009795761.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X2 
[Nicotiana sylvestris]
Length=146

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 56/90 (62%), Gaps = 7/90 (8%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CP++ L+L VC  L+   VGA +G PP    T PCCSLI  L DLEA +CLC  ++AN
Sbjct  62   GRCPRDALKLGVCASLVGGLVGAVIGTPP----TMPCCSLITGLADLEAAVCLCTAIRAN  117

Query  447  LPQI-VDVNLTVSLALKVCNRNIPLNAIKC  533
            +  I ++V L++SL L  C RN P N   C
Sbjct  118  VLGINLNVPLSLSLVLNNCGRNPP-NGFTC  146



>ref|XP_011018292.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Populus euphratica]
Length=140

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 62/91 (68%), Gaps = 7/91 (8%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CPK+ L+L VC DLL ++   T+G PP+    +PCCS+I  L+DLEA +CLC  +KAN
Sbjct  55   GRCPKDALKLGVCADLLGSLLNVTIGSPPV----KPCCSVIQGLLDLEAAVCLCTAIKAN  110

Query  447  LPQI-VDVNLTVSLALKVCNRNIPLNAIKCP  536
            +  I +++ L++SL + VC + +P +  +CP
Sbjct  111  ILGINLNIPLSLSLLVNVCGKKVPKD-FQCP  140



>ref|XP_011001498.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Populus euphratica]
Length=132

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 60/92 (65%), Gaps = 7/92 (8%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKA  443
             G CPK+ L+L VC  LL ++   TVG PP+    +PCCS+I  L+DLEA +CLC  +KA
Sbjct  46   GGKCPKDALKLGVCAGLLGSLLNVTVGTPPV----QPCCSVIQGLLDLEAAVCLCTAIKA  101

Query  444  NLPQI-VDVNLTVSLALKVCNRNIPLNAIKCP  536
            N+  I +++ +++SL L VC + +P    +CP
Sbjct  102  NILGINLNIPVSLSLLLNVCGKKVP-KGFQCP  132



>ref|XP_010433333.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=131

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 57/88 (65%), Gaps = 6/88 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            CPK+ L+L VCV  L  V  T+G PP+    +PCCSLI  LVDLEA +CLC  +KA++  
Sbjct  49   CPKDALKLGVCVQALNLVNVTLGAPPV----KPCCSLIDGLVDLEAAVCLCTALKASILG  104

Query  456  I-VDVNLTVSLALKVCNRNIPLNAIKCP  536
            I +++ + +SL L VC+R  P    +CP
Sbjct  105  ININLPINLSLLLNVCSRKAP-RGFQCP  131



>ref|XP_011033953.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Populus euphratica]
Length=137

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 58/84 (69%), Gaps = 6/84 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CPK+ L+L VC DLL ++   TVG PP+    +PCCS+I  L+DLE+ +CLC  +KAN
Sbjct  52   GKCPKDALKLGVCADLLGSLLNVTVGNPPV----KPCCSVIQGLLDLESAVCLCTAIKAN  107

Query  447  LPQI-VDVNLTVSLALKVCNRNIP  515
            +  I +++ L++SL L VC + +P
Sbjct  108  ILGINLNIPLSLSLLLNVCGKKVP  131



>ref|XP_010431811.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=107

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 56/86 (65%), Gaps = 5/86 (6%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            +  CPK+ LQL VC ++L+ V  T+G PP+    +PCCSLI  LVDLEA  CLC ++K N
Sbjct  22   SAACPKDSLQLGVCSNVLKLVDLTLGNPPV----KPCCSLIQGLVDLEAAACLCTLLKVN  77

Query  447  LPQI-VDVNLTVSLALKVCNRNIPLN  521
            +  I V++ + +S+ L +C R  P N
Sbjct  78   ILGINVNLPIDLSVLLNICGRKAPTN  103



>ref|XP_010422226.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=131

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 57/88 (65%), Gaps = 6/88 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            CPK+ L+L VCV  L  V  T+G PP+    +PCCSLI  LVDLEA +CLC  +KA++  
Sbjct  49   CPKDALKLGVCVQALNLVNVTLGAPPV----KPCCSLIDGLVDLEAAVCLCTALKASILG  104

Query  456  I-VDVNLTVSLALKVCNRNIPLNAIKCP  536
            I +++ + +SL L VC+R  P    +CP
Sbjct  105  ININLPINLSLLLNVCSRKAP-RGFQCP  131



>ref|XP_004501349.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cicer arietinum]
Length=145

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 52/83 (63%), Gaps = 4/83 (5%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CPK+ L+L VC D+L  V   +G PP   S   CC+LI  L DLEA LCLC  +KAN+
Sbjct  60   GSCPKDALKLGVCADVLGLVNVIIGNPP---SGSKCCALIKGLTDLEAALCLCTALKANV  116

Query  450  PQI-VDVNLTVSLALKVCNRNIP  515
              I ++V +T+SL L  C + +P
Sbjct  117  LGINLNVPITLSLVLSACQKTVP  139



>ref|NP_001233824.1| arachidonic acid-induced DEA1 precursor [Solanum lycopersicum]
 gb|AAS80139.1| arachidonic acid-induced DEA1 [Solanum lycopersicum]
Length=138

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 59/92 (64%), Gaps = 7/92 (8%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CP + L+L VC ++L  + G  +G PP     +PCCSLI  LVDLEA LCLC  +KAN
Sbjct  52   GKCPIDTLKLGVCANVLGNLLGVVLGNPP----KKPCCSLIEGLVDLEAALCLCTAIKAN  107

Query  447  LPQI-VDVNLTVSLALKVCNRNIPLNAIKCPK  539
            +  I ++V L++SL L VC +  P +  +CPK
Sbjct  108  ILGINLNVPLSLSLLLNVCGKKAP-SGFQCPK  138



>ref|XP_006355479.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum tuberosum]
Length=131

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 60/88 (68%), Gaps = 6/88 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CPK+ L+L VC ++L  +   T+G PP+    +PCCSLI  LVDLEA +CLC  +KAN
Sbjct  46   GKCPKDALKLGVCANVLSGLLNVTLGTPPV----KPCCSLIGNLVDLEAAVCLCTALKAN  101

Query  447  LPQI-VDVNLTVSLALKVCNRNIPLNAI  527
            +  I +++ +++SL L VC++++P   I
Sbjct  102  ILGINLNIPISLSLLLNVCSKDVPKGFI  129



>ref|XP_006355477.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum tuberosum]
Length=138

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 58/92 (63%), Gaps = 7/92 (8%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CP + L+L VC ++L  V G  +G PP     +PCCSLI  LVDLEA LCLC  +KAN
Sbjct  52   GKCPIDTLKLGVCANVLGNVLGVVLGNPP----KKPCCSLIEGLVDLEAALCLCTAIKAN  107

Query  447  LPQI-VDVNLTVSLALKVCNRNIPLNAIKCPK  539
            +  I ++V L++SL L  C +  P +  +CPK
Sbjct  108  ILGINLNVPLSLSLLLNACGKKAP-SGFQCPK  138



>ref|NP_001148300.1| cortical cell-delineating protein precursor [Zea mays]
 gb|ACG30459.1| cortical cell-delineating protein precursor [Zea mays]
 gb|AFW72687.1| cortical cell-delineating protein [Zea mays]
Length=128

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 51/85 (60%), Gaps = 5/85 (6%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            CPK+ L+   C ++L  V A VG PP      PCCS++  L DLEA +CLC  +KAN+  
Sbjct  46   CPKHALKFAACANVLGLVSAEVGHPP----AEPCCSILGGLADLEAAVCLCTAIKANVLG  101

Query  456  I-VDVNLTVSLALKVCNRNIPLNAI  527
            I VD+ + +SL +  C +N+P   I
Sbjct  102  ITVDIPVKLSLIINYCGKNLPSGFI  126



>gb|ACN26094.1| unknown [Zea mays]
 tpg|DAA46218.1| TPA: cortical cell-delineating protein [Zea mays]
Length=133

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 54/84 (64%), Gaps = 5/84 (6%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            +G CP+N L+L VC ++L  V A VG PP      PCCSL+  LVDLEA +CLC  VKAN
Sbjct  48   HGSCPRNALKLGVCANVLGLVKAKVGSPPY----EPCCSLLDGLVDLEAAVCLCTAVKAN  103

Query  447  LPQI-VDVNLTVSLALKVCNRNIP  515
            +  I +++ + +SL L  C +N P
Sbjct  104  ILGINLNLPIDLSLILNNCGKNCP  127



>emb|CBI31906.3| unnamed protein product [Vitis vinifera]
Length=113

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 54/85 (64%), Gaps = 6/85 (7%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKA  443
            + +CPK+ L+L VC DLL  +  A VG PP      PCCSLI  L DLEA +CLC  +KA
Sbjct  27   SAVCPKDTLKLGVCADLLNDLLHAVVGTPP----KSPCCSLIGGLADLEAAVCLCTAIKA  82

Query  444  NLPQI-VDVNLTVSLALKVCNRNIP  515
            N+  I ++V +++SL L  C + +P
Sbjct  83   NVLGIKLNVPVSLSLLLNYCGKKVP  107



>ref|XP_008362163.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
Length=145

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 55/88 (63%), Gaps = 7/88 (8%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CPK+ L+L VC DLL   V   VG PP      PCCSLI  L DLEA +CLC  +KAN+ 
Sbjct  62   CPKDTLKLGVCGDLLNDLVTIVVGTPP----KTPCCSLIGGLADLEAAVCLCTAIKANVL  117

Query  453  QI-VDVNLTVSLALKVCNRNIPLNAIKC  533
             I +DV +++SL L  C +++P N  +C
Sbjct  118  GINLDVPVSLSLLLNYCGKSVP-NGFQC  144



>ref|XP_009600481.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
Length=170

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 55/84 (65%), Gaps = 6/84 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CP++ L+L VC +LL   VG  VG PP    T PCCSLIA L DLEA +CLC  ++AN
Sbjct  86   GRCPRDALKLGVCANLLGGLVGVIVGSPP----TLPCCSLIAGLADLEAAVCLCTAIRAN  141

Query  447  LPQI-VDVNLTVSLALKVCNRNIP  515
            +  I ++V L++SL L  C RN P
Sbjct  142  VLGINLNVPLSLSLVLNNCGRNPP  165



>dbj|BAA13150.1| NT16 polypeptide [Nicotiana tabacum]
Length=170

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 55/84 (65%), Gaps = 6/84 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CP++ L+L VC +LL   VG  VG PP    T PCCSLIA L DLEA +CLC  ++AN
Sbjct  86   GRCPRDALKLGVCANLLGGLVGVIVGSPP----TLPCCSLIAGLADLEAAVCLCTAIRAN  141

Query  447  LPQI-VDVNLTVSLALKVCNRNIP  515
            +  I ++V L++SL L  C RN P
Sbjct  142  VLGINLNVPLSLSLVLNNCGRNPP  165



>ref|NP_001151721.1| LOC100285357 precursor [Zea mays]
 gb|ACG44119.1| cortical cell-delineating protein precursor [Zea mays]
Length=133

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 54/84 (64%), Gaps = 5/84 (6%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            +G CP+N L+L VC ++L  V A VG PP      PCCSL+  LVDLEA +CLC  VKAN
Sbjct  48   HGSCPRNALKLGVCANVLGLVKAKVGSPPY----EPCCSLLDGLVDLEAAVCLCTAVKAN  103

Query  447  LPQI-VDVNLTVSLALKVCNRNIP  515
            +  I +++ + +SL L  C +N P
Sbjct  104  ILGINLNLPIDLSLILNNCGKNCP  127



>ref|XP_010455702.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=131

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 57/88 (65%), Gaps = 6/88 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            CPK+ L+L VCV  L  V  T+G PP+    +PCCSLI  LVDLEA +CLC  +KA++  
Sbjct  49   CPKDALKLGVCVQALNLVNVTLGAPPV----KPCCSLIDGLVDLEAAVCLCTALKASILG  104

Query  456  I-VDVNLTVSLALKVCNRNIPLNAIKCP  536
            I +++ + +SL L VC+R  P    +CP
Sbjct  105  ININLPINLSLLLNVCSRKPP-RGFQCP  131



>ref|XP_004152413.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis sativus]
 ref|XP_004171280.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis sativus]
Length=130

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 58/90 (64%), Gaps = 7/90 (8%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CPK+ L++ VC  LL   V  T+G PP+     PCC+L+  L DLEA +CLC  +KA+
Sbjct  46   GKCPKDALKIGVCAKLLGGLVDLTIGKPPVT----PCCTLVEGLADLEAAVCLCTAIKAS  101

Query  447  -LPQIVDVNLTVSLALKVCNRNIPLNAIKC  533
             L +++ + L +SL L VCN+N+P N  +C
Sbjct  102  VLGKMIKIPLHLSLLLNVCNKNLP-NGFQC  130



>ref|XP_011076346.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum]
Length=152

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 54/82 (66%), Gaps = 6/82 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLL-RTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CP++ L+L VC +LL R  G  VG PP    T PCCSL+A LVDLEA +CLC  +KAN+ 
Sbjct  69   CPRDALKLGVCANLLGRAAGVVVGNPP----TTPCCSLLAGLVDLEAAVCLCTAIKANVL  124

Query  453  QI-VDVNLTVSLALKVCNRNIP  515
             I +++ +++SL L  C R  P
Sbjct  125  GINLNIPVSLSLLLNACGRTPP  146



>ref|NP_001235642.1| uncharacterized protein LOC100500016 precursor [Glycine max]
 gb|ACU14605.1| unknown [Glycine max]
Length=137

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 57/84 (68%), Gaps = 5/84 (6%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            +G CP++ L+L VC ++L  V AT+G PP+     PCCSL+  L DLEA +CLC  +KAN
Sbjct  51   SGSCPRDALKLGVCANVLNLVNATLGQPPVT----PCCSLLDGLADLEAAVCLCTALKAN  106

Query  447  LPQI-VDVNLTVSLALKVCNRNIP  515
            +  I +++ +++SL L VC+R  P
Sbjct  107  ILGINLNLPISLSLLLNVCSRKAP  130



>ref|XP_004291444.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Fragaria 
vesca subsp. vesca]
Length=133

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 53/81 (65%), Gaps = 5/81 (6%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            CPK+ L+L VC DLL  V   +G PP    T PCCSL+  L DLEA LCLC  +KAN+  
Sbjct  51   CPKDTLKLGVCADLLGLVNLQIGSPP----TTPCCSLLKGLTDLEAALCLCTALKANVLG  106

Query  456  I-VDVNLTVSLALKVCNRNIP  515
            I ++V +++S+ +  C +++P
Sbjct  107  INLNVPISLSVLVSACQKSVP  127



>ref|XP_003549906.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Glycine max]
 gb|KHN09800.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=136

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 58/84 (69%), Gaps = 5/84 (6%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            +G CP++ L+L VC ++L  V AT+G PP+     PCC+L+  LVDLEA +CLC  +KAN
Sbjct  51   SGSCPRDALKLGVCANVLNLVNATLGQPPVT----PCCTLLDGLVDLEAAVCLCTALKAN  106

Query  447  LPQI-VDVNLTVSLALKVCNRNIP  515
            +  I +++ +++SL L VC+R  P
Sbjct  107  ILGINLNLPISLSLLLNVCSRKAP  130



>ref|XP_002529775.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
 gb|EEF32589.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
Length=139

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 57/84 (68%), Gaps = 6/84 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CP++ L+L VC D+L ++   T+G PP+     PCCSLI  LVDLEA +CLC  +KAN
Sbjct  54   GKCPRDALKLGVCADVLGSLLNITIGKPPV----EPCCSLIQGLVDLEAAVCLCTAIKAN  109

Query  447  LPQI-VDVNLTVSLALKVCNRNIP  515
            +  I +++ L++SL L VC++  P
Sbjct  110  ILGINLNIPLSLSLLLNVCSKKTP  133



>ref|XP_010431799.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
 ref|XP_010431824.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=107

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 56/86 (65%), Gaps = 5/86 (6%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            +  CPK+ LQL VC ++L+ V  T+G PP+    +PCCSLI  LVDLEA  CLC ++K N
Sbjct  22   SAACPKDSLQLGVCANVLKLVDLTLGNPPV----KPCCSLIQGLVDLEAAACLCTLLKVN  77

Query  447  LPQI-VDVNLTVSLALKVCNRNIPLN  521
            +  I +++ + +S+ L +C R  P N
Sbjct  78   ILGINLNLPIDLSVLLNICGRKAPTN  103



>ref|XP_009795760.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X1 
[Nicotiana sylvestris]
Length=158

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 55/88 (63%), Gaps = 7/88 (8%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CP++ L+L VC  L+   VGA +G PP    T PCCSLI  L DLEA +CLC  ++AN+ 
Sbjct  76   CPRDALKLGVCASLVGGLVGAVIGTPP----TMPCCSLITGLADLEAAVCLCTAIRANVL  131

Query  453  QI-VDVNLTVSLALKVCNRNIPLNAIKC  533
             I ++V L++SL L  C RN P N   C
Sbjct  132  GINLNVPLSLSLVLNNCGRNPP-NGFTC  158



>ref|XP_010264239.1| PREDICTED: putative lipid-binding protein At4g00165 [Nelumbo 
nucifera]
Length=126

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 52/82 (63%), Gaps = 6/82 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            CPK+ L+L +C ++L  V   VG PP     +PCC+L+  L DLEA LCLC  +KAN+  
Sbjct  43   CPKDTLKLGICANVLGLVNVLVGTPP----YKPCCALLTELTDLEAALCLCTAIKANVLG  98

Query  456  IVDVNLTVSLALKV--CNRNIP  515
            +V + L ++L+L V  C + +P
Sbjct  99   VVKLELPIALSLVVNTCGKKVP  120



>ref|XP_006396747.1| hypothetical protein EUTSA_v10029313mg [Eutrema salsugineum]
 gb|ESQ38200.1| hypothetical protein EUTSA_v10029313mg [Eutrema salsugineum]
Length=129

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 58/88 (66%), Gaps = 6/88 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            CPK+ L+L VCV+ L  +  T+G PP+    +PCCSLI  LVDLEA +CLC  +KA++  
Sbjct  47   CPKDALKLGVCVNALNLLNVTLGAPPV----QPCCSLIDGLVDLEAAVCLCTALKASILG  102

Query  456  I-VDVNLTVSLALKVCNRNIPLNAIKCP  536
            I +++ + +SL L VC+R  P    +CP
Sbjct  103  ININLPINLSLLLNVCSRKAP-RGFQCP  129



>gb|ACV74341.1| proline-rich protein [Jatropha curcas]
Length=138

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 59/87 (68%), Gaps = 6/87 (7%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKA  443
             G CP++ L+L VC  +L ++   T+G PP+    +PCCSL+  LVDLEA +CLC  +KA
Sbjct  52   GGKCPRDALKLGVCAKVLGSLLNITIGDPPV----KPCCSLLEGLVDLEAAVCLCTAIKA  107

Query  444  NLPQI-VDVNLTVSLALKVCNRNIPLN  521
            N+  I ++V L++SL L VC++ +P +
Sbjct  108  NILGITLNVPLSLSLLLNVCSKKVPFD  134



>ref|XP_009111571.1| PREDICTED: putative lipid-binding protein AIR1B [Brassica rapa]
Length=111

 Score = 67.0 bits (162),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 50/84 (60%), Gaps = 6/84 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CPK+ LQ+ +C ++L  V  T+G    N S  PCCSLI  LVDLEA  CLC  +K ++
Sbjct  25   GSCPKDSLQISLCANVLNVVELTLG----NPSVPPCCSLIHGLVDLEAAACLCSALKVDI  80

Query  450  PQIVDVNLTVSL--ALKVCNRNIP  515
            P I  +NL + L   L VC R  P
Sbjct  81   PGITSINLPIFLNVLLNVCGRPTP  104



>ref|XP_003526352.1| PREDICTED: extensin-like [Glycine max]
Length=221

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 55/89 (62%), Gaps = 6/89 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            CPK+ L+L VC D+L  V  TVG PP    +  CC+L+  L DLEA LCLC  +KAN+  
Sbjct  138  CPKDTLKLGVCADILGLVNVTVGTPP----SSECCALVKGLADLEAALCLCTAIKANVLG  193

Query  456  I-VDVNLTVSLALKVCNRNIPLNAIKCPK  539
            I ++V +T+S+ L  C + +P    +CP 
Sbjct  194  INLNVPVTLSVILSACQKTVP-PGFQCPS  221



>ref|XP_008378389.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
Length=133

 Score = 67.4 bits (163),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 52/82 (63%), Gaps = 6/82 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            CPK+ L+L  CVDLL  V   +G PP +G    CC+L+  L DLEA +CLC + KAN   
Sbjct  50   CPKDTLKLGACVDLLGLVNLKIGTPPTSG----CCALLEGLADLEAAICLCTVTKANAQG  105

Query  456  IVDVNLTVSLALKV--CNRNIP  515
            +V++ + V+L+L V  C + +P
Sbjct  106  LVNLEVPVALSLLVSACQKTVP  127



>ref|NP_001237154.1| uncharacterized protein LOC100500124 precursor [Glycine max]
 gb|ACU15034.1| unknown [Glycine max]
Length=136

 Score = 67.4 bits (163),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 58/84 (69%), Gaps = 5/84 (6%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            +G CP++ L+L VC ++L  V  T+G PP+     PCC+L+  LVDLEA +CLC  +KAN
Sbjct  51   SGSCPRDALKLGVCANVLNLVNVTLGQPPVT----PCCTLLDGLVDLEAAVCLCTALKAN  106

Query  447  LPQI-VDVNLTVSLALKVCNRNIP  515
            +  I +++ +++SL L VC+R +P
Sbjct  107  ILGINLNLPISLSLLLDVCSRKVP  130



>emb|CDP05328.1| unnamed protein product [Coffea canephora]
Length=129

 Score = 67.0 bits (162),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 56/88 (64%), Gaps = 6/88 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            CP++ L+L VC ++L  +  ++G PP    T PCCSL+  L DLEA LCLC  ++AN+  
Sbjct  47   CPRDALKLGVCANVLGLIRVSIGAPP----TLPCCSLLQGLADLEAALCLCTAIRANILG  102

Query  456  I-VDVNLTVSLALKVCNRNIPLNAIKCP  536
            I +++ +T+SL L  C RN P N   CP
Sbjct  103  INLNLPVTLSLVLNNCGRNPP-NGFICP  129



>ref|XP_004245748.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum lycopersicum]
Length=135

 Score = 67.4 bits (163),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 59/88 (67%), Gaps = 6/88 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CPK+ L+L VC ++L  +   T+G PP+    +PCCSLI  LVDLEA  CLC  +KAN
Sbjct  50   GKCPKDTLKLGVCANVLSGLLNVTLGTPPV----KPCCSLIGNLVDLEAAACLCTALKAN  105

Query  447  LPQI-VDVNLTVSLALKVCNRNIPLNAI  527
            +  I +++ +++SL L VC++++P   I
Sbjct  106  VLGINLNIPISLSLLLNVCSKDVPKGFI  133



>emb|CAA59472.1| hybrid proline-rich protein [Catharanthus roseus]
Length=138

 Score = 67.4 bits (163),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 55/86 (64%), Gaps = 6/86 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CP++ L+L VC DLL   + A +G PP      PCCSLI  L DLEA +CLC  +KAN+ 
Sbjct  55   CPRDALKLGVCADLLGGLISAVIGAPP----KTPCCSLIEGLADLEAAVCLCTAIKANVL  110

Query  453  QI-VDVNLTVSLALKVCNRNIPLNAI  527
             I ++V +++SL L VC++ +P   I
Sbjct  111  GINLNVPVSLSLLLNVCSKKVPEGFI  136



>ref|XP_006306558.1| hypothetical protein CARUB_v10012658mg [Capsella rubella]
 gb|EOA39456.1| hypothetical protein CARUB_v10012658mg [Capsella rubella]
Length=132

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 54/86 (63%), Gaps = 6/86 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLR-TVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CPK+ LQL VC  +L   VG  +G PP      PCCS++  LVDLEA +CLC  +KAN+ 
Sbjct  49   CPKDALQLGVCAKILDGAVGTVIGNPP----DTPCCSVLKGLVDLEAAVCLCTAIKANVL  104

Query  453  QI-VDVNLTVSLALKVCNRNIPLNAI  527
             I +D+ +++SL +  C + +P N I
Sbjct  105  GINIDIPISLSLLINTCGKTLPSNFI  130



>ref|XP_002446915.1| hypothetical protein SORBIDRAFT_06g024790 [Sorghum bicolor]
 gb|EES11243.1| hypothetical protein SORBIDRAFT_06g024790 [Sorghum bicolor]
Length=132

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 56/89 (63%), Gaps = 6/89 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CP++ L+L VC ++L  + A VG+PP    T PCC L+  LVDLEA LCLC  +K N+
Sbjct  48   GKCPRDALKLGVCANVLGLIKAKVGVPP----TEPCCPLLEGLVDLEAALCLCTAIKGNI  103

Query  450  PQI-VDVNLTVSLALKVCNRNIPLNAIKC  533
              I +++ + +SL L  C +++P    KC
Sbjct  104  LGINLNLPIDLSLILNHCGKSVP-TGFKC  131



>ref|XP_009626056.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
Length=128

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 58/88 (66%), Gaps = 6/88 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            CP + L+L VC D+L  V A +G PP+     PCCSL++ L ++EA LCLC  +KAN+  
Sbjct  46   CPIDTLKLGVCADVLGLVNAVIGSPPVT----PCCSLLSGLANVEAALCLCTAIKANILG  101

Query  456  I-VDVNLTVSLALKVCNRNIPLNAIKCP  536
            I ++V +++SL L VC++  P +  +CP
Sbjct  102  INLNVPISLSLLLNVCSKEAP-SGFQCP  128



>ref|XP_010422228.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
 ref|XP_010422229.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=131

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 57/86 (66%), Gaps = 5/86 (6%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            +G CP++ LQL VC ++L+ V  T+G PP+    +PCC+LI  L DLEA +CLC ++K N
Sbjct  46   SGTCPRDSLQLGVCANVLKLVDLTLGNPPV----KPCCTLIQGLADLEAAVCLCTLLKVN  101

Query  447  LPQI-VDVNLTVSLALKVCNRNIPLN  521
            +  I +++ + +S+ L VC R  P N
Sbjct  102  ILGINLNLPIDLSVLLNVCGRKAPTN  127



>gb|KGN50238.1| hypothetical protein Csa_5G161870 [Cucumis sativus]
Length=130

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 58/90 (64%), Gaps = 7/90 (8%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CPK+ L++ VC  LL   V  T+G PP+     PCC+L+  L DLEA +CLC  +KA+
Sbjct  46   GKCPKDALKIGVCAKLLGGLVDLTIGKPPVT----PCCTLVEGLADLEAAVCLCTAIKAS  101

Query  447  -LPQIVDVNLTVSLALKVCNRNIPLNAIKC  533
             L +++ + L +SL + VCN+N+P N  +C
Sbjct  102  VLGKMIKIPLHLSLLINVCNKNLP-NGFQC  130



>ref|XP_007039884.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
 gb|EOY24385.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
Length=134

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 53/81 (65%), Gaps = 5/81 (6%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN-LP  452
            CPK+ L+L VC DLL  + A VG    N +  PCCSL+A L D EAT+CLC  +KA+ L 
Sbjct  52   CPKDTLKLGVCADLLNLMHAVVG----NPAKTPCCSLLAGLADAEATVCLCTTIKASVLG  107

Query  453  QIVDVNLTVSLALKVCNRNIP  515
              +++ +++SL L  C +NIP
Sbjct  108  ANLNIPVSLSLLLNYCGKNIP  128



>gb|ACE82175.1| extensin-like protein [Glycine max]
 gb|KHN04348.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=136

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 58/84 (69%), Gaps = 5/84 (6%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            +G CP++ L+L VC ++L  V  T+G PP+     PCC+L+  LVDLEA +CLC  +KAN
Sbjct  51   SGSCPRDALKLGVCANVLNLVNVTLGQPPVT----PCCTLLDGLVDLEAAVCLCTALKAN  106

Query  447  LPQI-VDVNLTVSLALKVCNRNIP  515
            +  I +++ +++SL L VC+R +P
Sbjct  107  ILGINLNLPISLSLLLNVCSRKVP  130



>ref|XP_009601879.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
Length=128

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 60/91 (66%), Gaps = 7/91 (8%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CP + L+L VC ++L  +   T+G PP+    +PCCSLI  LVDLEA +CLC  +KAN
Sbjct  43   GKCPTDALKLGVCANVLNGLLNVTLGTPPV----KPCCSLIGNLVDLEAAVCLCTALKAN  98

Query  447  LPQI-VDVNLTVSLALKVCNRNIPLNAIKCP  536
            +  I +++ +++SL L VC+++IP     CP
Sbjct  99   ILGINLNIPISLSLLLNVCSKDIP-KGFACP  128



>ref|XP_002446914.1| hypothetical protein SORBIDRAFT_06g024780 [Sorghum bicolor]
 gb|EES11242.1| hypothetical protein SORBIDRAFT_06g024780 [Sorghum bicolor]
Length=129

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 56/89 (63%), Gaps = 6/89 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CP++ L+L VC ++L  + A VG+PP    T PCC L+  LVDLEA LCLC  +K N+
Sbjct  45   GKCPRDALKLGVCANVLGLIKAKVGVPP----TEPCCPLLEGLVDLEAALCLCTAIKGNI  100

Query  450  PQI-VDVNLTVSLALKVCNRNIPLNAIKC  533
              I +++ + +SL L  C +++P    KC
Sbjct  101  LGINLNLPIDLSLILNHCGKSVP-TGFKC  128



>ref|XP_006290090.1| hypothetical protein CARUB_v10003735mg [Capsella rubella]
 gb|EOA22988.1| hypothetical protein CARUB_v10003735mg [Capsella rubella]
Length=113

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 56/83 (67%), Gaps = 5/83 (6%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            CP++ LQL VC ++L+ V  T+G PP+    +PCCSLI  L DLEA +CLC ++K NL  
Sbjct  31   CPRDSLQLGVCANVLKLVDLTLGNPPV----KPCCSLIQGLADLEAAVCLCTMLKVNLLG  86

Query  456  I-VDVNLTVSLALKVCNRNIPLN  521
            I +++ + +S+ L VC+R  P N
Sbjct  87   INLNLPIDLSVLLNVCSRKAPKN  109



>ref|XP_002533291.1| lipid binding protein, putative [Ricinus communis]
 gb|EEF29085.1| lipid binding protein, putative [Ricinus communis]
Length=114

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 56/88 (64%), Gaps = 7/88 (8%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CPK+ ++L VCV+LL+ +   TVG PP      PCCSLIA LVDLEA  CLC  +KA++ 
Sbjct  30   CPKDTVKLGVCVNLLKDLLSVTVGTPP----KTPCCSLIAGLVDLEAAACLCTTIKADVA  85

Query  453  QI-VDVNLTVSLALKVCNRNIPLNAIKC  533
             I +++ + +SL L  C + +P    KC
Sbjct  86   GIKLNLPIHLSLLLNYCGKKVP-QGFKC  112



>ref|XP_004964283.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Setaria italica]
Length=127

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 52/84 (62%), Gaps = 2/84 (2%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CP N ++L VC  +L   + A VG PP N    PCCSLI+ L DLEA +C+CL + AN
Sbjct  38   GKCPVNAVKLGVCAHVLDGLIHAVVGKPPPNNKKEPCCSLISGLADLEAAVCVCLAINAN  97

Query  447  LPQI-VDVNLTVSLALKVCNRNIP  515
            +  + +DV + +SL +  C R +P
Sbjct  98   VLGVNLDVAVDLSLLVNYCGRTVP  121



>ref|XP_004976455.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Setaria italica]
Length=123

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 56/91 (62%), Gaps = 8/91 (9%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CP++ L+L VC ++L  + A VG+PP    T PCC L+  LVDLEA +CLC  +K N+
Sbjct  37   GKCPRDALKLGVCANVLGLIKAKVGVPP----TEPCCPLLEGLVDLEAAVCLCTAIKGNI  92

Query  450  PQI---VDVNLTVSLALKVCNRNIPLNAIKC  533
              I   + +++++SL L  C + +P    KC
Sbjct  93   LGINLNLPIDVSLSLILNHCGKTVP-TGFKC  122



>dbj|BAJ96792.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=120

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 55/83 (66%), Gaps = 5/83 (6%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CP+N L+LHVC ++L  V A +G+PP    T PCCSL+  LV+L+A +CLC  +KAN+
Sbjct  35   GSCPQNALKLHVCANVLNLVKAKIGVPP----TEPCCSLLEGLVNLDAAVCLCTAIKANV  90

Query  450  PQI-VDVNLTVSLALKVCNRNIP  515
              I +++ + +SL L  C +  P
Sbjct  91   LGIHLNIPIDLSLILNNCGKICP  113



>gb|EMS59022.1| 14 kDa proline-rich protein DC2.15 [Triticum urartu]
Length=126

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 54/84 (64%), Gaps = 6/84 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CP++ +++ +CV+ L  V A +G PP    T PCC L+  LVDLEA LCLC ++KAN+
Sbjct  42   GRCPRDAVKIGLCVNALNLVKAELGAPP----TLPCCPLVKGLVDLEAALCLCTVLKANV  97

Query  450  PQIVDVNLTVSLA--LKVCNRNIP  515
              IV +NL + L+  L  C + +P
Sbjct  98   LNIVKLNLPIDLSVILNDCGKKVP  121



>gb|ABX84384.1| protease inhibitor-like protein [Triticum aestivum]
Length=126

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 54/84 (64%), Gaps = 6/84 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CP++ +++ +CV+ L  V A +G PP    T PCC L+  LVDLEA LCLC ++KAN+
Sbjct  42   GRCPRDAVKIGLCVNALNLVKAELGAPP----TLPCCPLVKGLVDLEAALCLCTVLKANV  97

Query  450  PQIVDVNLTVSLA--LKVCNRNIP  515
              IV +NL + L+  L  C + +P
Sbjct  98   LNIVKLNLPIDLSVILNDCGKKVP  121



>ref|XP_006289141.1| hypothetical protein CARUB_v10002564mg [Capsella rubella]
 gb|EOA22039.1| hypothetical protein CARUB_v10002564mg [Capsella rubella]
Length=135

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 59/91 (65%), Gaps = 7/91 (8%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKA  443
             G CPK+ L+L VC ++L+ +    +G PP+    +PCCSLI  LVDLEA  CLC  +KA
Sbjct  49   TGSCPKDTLKLGVCANVLKDLLKIELGTPPV----KPCCSLIKGLVDLEAAACLCTAIKA  104

Query  444  NLPQI-VDVNLTVSLALKVCNRNIPLNAIKC  533
            N+  I ++V +++SL L VC + +P +  KC
Sbjct  105  NVLGINLNVPVSLSLLLNVCGKKVP-SGFKC  134



>ref|XP_008437101.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis melo]
Length=140

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 55/84 (65%), Gaps = 6/84 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CP++ L+L VC  LL   V  T+G PP+     PCCSLI  L DLEA +CLC  +KAN
Sbjct  56   GKCPRDTLKLGVCAKLLGGLVDVTIGKPPVT----PCCSLIEGLADLEAAVCLCTAIKAN  111

Query  447  LPQI-VDVNLTVSLALKVCNRNIP  515
            L  + +++ +++SL L VC +N+P
Sbjct  112  LLGLNLNIPVSLSLLLNVCQKNVP  135



>ref|XP_009801825.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=133

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 55/83 (66%), Gaps = 5/83 (6%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
             ICP + L+L VC D+L  V A +G PP+     PCCSL++ L ++EA LCLC  +KAN+
Sbjct  49   AICPIDTLKLGVCADVLGLVNAVIGSPPV----APCCSLLSGLANVEAALCLCSAIKANI  104

Query  450  PQI-VDVNLTVSLALKVCNRNIP  515
              I ++V +++SL L VC++  P
Sbjct  105  LGINLNVPISLSLLLNVCSKEAP  127



>ref|XP_004171279.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis sativus]
 gb|KGN50237.1| hypothetical protein Csa_5G161860 [Cucumis sativus]
Length=136

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 57/90 (63%), Gaps = 7/90 (8%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CPK+ L++ VC  LL   V  T+G PP+     PCC+L+  L DLEA +CLC  +KA+
Sbjct  52   GKCPKDALKIGVCAKLLGGLVDLTIGKPPVT----PCCTLVQGLADLEAAVCLCTAIKAS  107

Query  447  -LPQIVDVNLTVSLALKVCNRNIPLNAIKC  533
             L + + + L +SL L VCN+N+P N  +C
Sbjct  108  VLGKTIKIPLHLSLLLNVCNKNLP-NGFQC  136



>ref|XP_004501348.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cicer arietinum]
Length=142

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 53/83 (64%), Gaps = 4/83 (5%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN-  446
            G CPK+ L+L VC DLLR V   VG PP +GS+  CC+LI  L DLEA LCLC  +K N 
Sbjct  57   GSCPKDTLKLGVCADLLRLVKVPVGNPP-SGSS--CCALIKGLADLEAALCLCTAIKTNV  113

Query  447  LPQIVDVNLTVSLALKVCNRNIP  515
            L   ++V +T++  L  C + +P
Sbjct  114  LGNNLNVPVTLTWILSACQKTLP  136



>ref|XP_004152411.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis sativus]
Length=136

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 57/90 (63%), Gaps = 7/90 (8%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CPK+ L++ VC  LL   V  T+G PP+     PCC+L+  L DLEA +CLC  +KA+
Sbjct  52   GKCPKDTLKIGVCAKLLGGLVDLTIGKPPVT----PCCTLVQGLADLEAAVCLCTAIKAS  107

Query  447  -LPQIVDVNLTVSLALKVCNRNIPLNAIKC  533
             L + + + L +SL L VCN+N+P N  +C
Sbjct  108  VLGKTIKIPLHLSLLLNVCNKNLP-NGFQC  136



>ref|XP_004955126.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Setaria italica]
Length=241

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 51/88 (58%), Gaps = 5/88 (6%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
             G CPKN L+L  C ++   V A VG PP      PCCS++  L DLEA  CLC  +KAN
Sbjct  156  KGKCPKNALKLAACANVAGLVSAEVGQPP----AEPCCSILGGLADLEAAACLCTAIKAN  211

Query  447  LPQI-VDVNLTVSLALKVCNRNIPLNAI  527
            +  I +D+ + +SL +  C +N+P   I
Sbjct  212  VLGISLDIPVKLSLIVNYCGKNLPSGFI  239



>ref|XP_009375766.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=142

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 52/82 (63%), Gaps = 6/82 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CPK+ L+L VC DLL   V   VG PP      PCCSLI  L DLEA +CLC  +KAN+ 
Sbjct  59   CPKDTLKLGVCGDLLNDLVTIVVGTPP----KTPCCSLIGGLTDLEAAVCLCTAIKANVL  114

Query  453  QI-VDVNLTVSLALKVCNRNIP  515
             I +DV +++SL L  C +++P
Sbjct  115  GINLDVPVSLSLLLNYCGKSVP  136



>gb|KDP25647.1| hypothetical protein JCGZ_20803 [Jatropha curcas]
Length=130

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 57/91 (63%), Gaps = 7/91 (8%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKA  443
             G CP++ L+L VCVD+L+ +   TVG PP      PCCSL+  LVDLEA +CLC  +KA
Sbjct  44   TGACPRDTLKLGVCVDVLKGLLNVTVGKPP----KTPCCSLLGDLVDLEAAVCLCTTIKA  99

Query  444  NLPQI-VDVNLTVSLALKVCNRNIPLNAIKC  533
            +L  I +++ + +SL L  C + +P    KC
Sbjct  100  SLLGINLNLPIDLSLLLNYCGKKVP-EGFKC  129



>ref|XP_008786991.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera]
Length=126

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 56/91 (62%), Gaps = 6/91 (7%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
             G CP N L+L VC D+L+ +   +G PP     +PCC+L+  LVDLEA +CLC  +KAN
Sbjct  41   KGRCPMNTLKLGVCADVLKALIVNIGKPP----KKPCCTLLEGLVDLEAAVCLCTALKAN  96

Query  447  LPQI-VDVNLTVSLALKVCNRNIPLNAIKCP  536
            +  I +++ + +SL L  C + +P    +CP
Sbjct  97   ILGIKLNIPVDLSLLLNYCGKKVP-KGFQCP  126



>gb|KDP25645.1| hypothetical protein JCGZ_20801 [Jatropha curcas]
Length=138

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 58/85 (68%), Gaps = 6/85 (7%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKA  443
             G CP++ L+L VC  +L ++   T+G PP+    +PCCSL+  LVDLEA +CLC  +KA
Sbjct  52   GGKCPRDALKLGVCAKVLGSLLNITIGDPPV----KPCCSLLEGLVDLEAAVCLCTAIKA  107

Query  444  NLPQI-VDVNLTVSLALKVCNRNIP  515
            N+  I ++V L++SL L VC++ +P
Sbjct  108  NILGINLNVPLSLSLLLNVCSKKVP  132



>gb|EYU30303.1| hypothetical protein MIMGU_mgv1a016181mg [Erythranthe guttata]
Length=131

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 55/85 (65%), Gaps = 6/85 (7%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLR-TVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKA  443
             G CP++ L+L +C  LL  +VGA +G PP      PCCS++  L+DLEA +CLC  +KA
Sbjct  45   KGSCPRDALKLGICAKLLNGSVGAELGSPP----DHPCCSVLGGLLDLEAAVCLCTALKA  100

Query  444  NLPQI-VDVNLTVSLALKVCNRNIP  515
            N+  I +D+ +++SL +  C + +P
Sbjct  101  NILGINIDIPISLSLLINTCGKTLP  125



>ref|XP_002271461.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Vitis vinifera]
Length=132

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKA  443
              +CPK+ L+L VC DLL  +  A VG PP      PCCSLI  L DLEA +CLC  +KA
Sbjct  46   KAVCPKDTLKLGVCADLLNDLLHAVVGTPP----KSPCCSLIGGLADLEAAVCLCTAIKA  101

Query  444  NLPQI-VDVNLTVSLALKVCNRNIP  515
            N+  I ++V +++SL L  C + +P
Sbjct  102  NVLGIKLNVPVSLSLLLNYCGKKVP  126



>ref|XP_004251936.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum lycopersicum]
Length=123

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 52/81 (64%), Gaps = 5/81 (6%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            CPK+ L+L VC ++L  V  TVG PP      PCCSLI  L DLEA +CLC  ++AN+  
Sbjct  42   CPKDALKLGVCANVLNLVNVTVGSPP----PLPCCSLIQGLTDLEAAVCLCTAIRANVLG  97

Query  456  I-VDVNLTVSLALKVCNRNIP  515
            I +++ L++SL L  C RN P
Sbjct  98   INLNIPLSLSLVLNNCGRNPP  118



>ref|XP_009617786.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
Length=146

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 55/84 (65%), Gaps = 6/84 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G  P++ L+L VC +L+   VGA +G PP    T PCCSLIA L DLEA +CLC  ++AN
Sbjct  62   GRWPRDALKLGVCANLVGGLVGAVIGSPP----TLPCCSLIAGLADLEAAVCLCTAIRAN  117

Query  447  LPQI-VDVNLTVSLALKVCNRNIP  515
            +  I ++V L++SL L  C RN P
Sbjct  118  VLGINLNVPLSLSLVLNNCGRNPP  141



>ref|XP_010456924.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=107

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 56/86 (65%), Gaps = 5/86 (6%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            +  CPK+ LQL VC ++L+ V  T+G PP+    +PCCSLI  L DLEA +CLC ++K N
Sbjct  22   SAACPKDSLQLGVCANVLKLVDLTLGNPPV----KPCCSLIQGLADLEAAVCLCTLLKVN  77

Query  447  LPQI-VDVNLTVSLALKVCNRNIPLN  521
            +  I +++ + +S+ L +C +  P N
Sbjct  78   ILGINLNLPIDLSVLLNICGKKAPTN  103



>ref|XP_010099842.1| hypothetical protein L484_008499 [Morus notabilis]
 gb|EXB80719.1| hypothetical protein L484_008499 [Morus notabilis]
Length=124

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 54/87 (62%), Gaps = 6/87 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            CPK+ L+  VC DLL  V   VG PP    +  CC+L++ L DLEA +CLC  +KAN+  
Sbjct  42   CPKDTLKFGVCADLLGLVNLVVGSPP----SSKCCALLSGLADLEAAVCLCTAIKANVLG  97

Query  456  I-VDVNLTVSLALKVCNRNIPLNAIKC  533
            I ++V LT+S+ +  C + +P +  KC
Sbjct  98   INLNVPLTLSVLISACQKTVP-SGFKC  123



>gb|ADD11814.1| hybrid proline-rich protein [Cajanus cajan]
Length=131

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 53/88 (60%), Gaps = 5/88 (6%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            +G CPK+ L+  VC +LL  V   +G PP      PCCSLI  L DLEA +CLC  +KAN
Sbjct  46   SGTCPKDTLKFGVCANLLGLVNVNLGKPP----KTPCCSLIEGLADLEAAVCLCTALKAN  101

Query  447  LPQI-VDVNLTVSLALKVCNRNIPLNAI  527
            +  I ++V + +SL L VC +  P + I
Sbjct  102  VLGINLNVPVKLSLLLNVCGKKTPKDFI  129



>ref|XP_009598876.1| PREDICTED: lipid transfer protein EARLI 1-like, partial [Nicotiana 
tomentosiformis]
Length=93

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 57/90 (63%), Gaps = 5/90 (6%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CPKN L+L VC ++L   G  +GL   N   +PCC+LI  L D+EA LCLC  +KAN+
Sbjct  8    GKCPKNTLKLGVCANVL---GNLLGLKIGNIPKKPCCTLIKGLADVEAALCLCTAIKANV  64

Query  450  PQI-VDVNLTVSLALKVCNRNIPLNAIKCP  536
              I ++V L++SL L VC + +P   I CP
Sbjct  65   LGINLNVPLSLSLLLNVCGKKVPSGFI-CP  93



>gb|ABQ88334.1| lipid transfer protein [Capsicum annuum]
Length=142

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 59/91 (65%), Gaps = 7/91 (8%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CP + L+L +C ++L  + G  +G PP     +PCCSLI  LVDLEA LCLC  +KAN
Sbjct  56   GKCPVDALKLGICANVLGNLLGVVLGNPP----KKPCCSLIQGLVDLEAALCLCTALKAN  111

Query  447  LPQI-VDVNLTVSLALKVCNRNIPLNAIKCP  536
            +  I ++V +++SL L VC + +P +  +CP
Sbjct  112  ILGINLNVPISLSLLLNVCGKKVP-SGFQCP  141



>emb|CAI51313.1| arachidonic acid-induced DEA1 [Capsicum chinense]
Length=142

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 59/91 (65%), Gaps = 7/91 (8%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CP + L+L +C ++L  + G  +G PP     +PCCSLI  LVDLEA LCLC  +KAN
Sbjct  56   GKCPIDALKLGICANVLGNLLGVVLGNPP----KKPCCSLIQGLVDLEAALCLCTALKAN  111

Query  447  LPQI-VDVNLTVSLALKVCNRNIPLNAIKCP  536
            +  I ++V +++SL L VC + +P +  +CP
Sbjct  112  ILGINLNVPISLSLLLNVCGKKVP-SGFQCP  141



>ref|XP_004976454.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Setaria italica]
Length=127

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 55/89 (62%), Gaps = 6/89 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CP++ L+L VC ++L  + A VG+PP    T PCC L+  LVDLEA +CLC  +K N+
Sbjct  43   GRCPRDALKLGVCANVLGLIKAKVGVPP----TEPCCPLLEGLVDLEAAVCLCTAIKGNI  98

Query  450  PQI-VDVNLTVSLALKVCNRNIPLNAIKC  533
              I +++ + VSL L  C + +P    KC
Sbjct  99   LGINLNLPIDVSLILNHCGKTVP-TGFKC  126



>ref|XP_009134276.1| PREDICTED: putative lipid-binding protein AIR1 [Brassica rapa]
Length=127

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 58/88 (66%), Gaps = 6/88 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            CPK+ ++L VCV+ L  +  T+G PP+    +PCCSLI  LVDLEA +CLC  +KA++  
Sbjct  45   CPKDTVKLGVCVNALNLLNVTLGAPPV----KPCCSLIDGLVDLEAAVCLCTALKASILG  100

Query  456  I-VDVNLTVSLALKVCNRNIPLNAIKCP  536
            I +++ + +SL L VC+R  P    +CP
Sbjct  101  ININLPINLSLLLNVCSRKAP-RGFQCP  127



>ref|XP_004498751.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cicer arietinum]
Length=126

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 55/90 (61%), Gaps = 6/90 (7%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
             G CP + L+L VC D+L  V   VG P    S+  CC+L+  L DLEA +CLC  +KAN
Sbjct  41   KGKCPSDTLKLGVCADVLGLVNIIVGTP----SSSKCCALLQGLADLEAAICLCTAIKAN  96

Query  447  LPQI-VDVNLTVSLALKVCNRNIPLNAIKC  533
            +  I ++V +T+SL L  C ++IP +  KC
Sbjct  97   VLGINLNVPITLSLLLSACQKSIP-SGFKC  125



>emb|CAA81526.1| 14 kDa polypeptide [Catharanthus roseus]
Length=138

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 55/86 (64%), Gaps = 6/86 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CP++ L+L VC DLL   + A +G PP      PCCSLI  L DLEA +CLC  +KAN+ 
Sbjct  55   CPRDALKLGVCADLLGGLISAVIGAPP----KTPCCSLIEGLADLEAAVCLCTAIKANVL  110

Query  453  QI-VDVNLTVSLALKVCNRNIPLNAI  527
             I ++V ++++L L VC++ +P   I
Sbjct  111  GINLNVPVSLTLLLNVCSKKVPEGFI  136



>emb|CBI38878.3| unnamed protein product [Vitis vinifera]
Length=127

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 6/82 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            CPK+ L+   C + L  VG  VG PP    +  CC+L+A L DLEA LC C  +KAN+  
Sbjct  44   CPKDTLKFGACANWLGLVGEVVGTPP----SSKCCALVAGLADLEAALCFCTAIKANVLG  99

Query  456  IVDVNLTVSLALKV--CNRNIP  515
             + V + V+L L V  C + +P
Sbjct  100  AIKVEVPVALTLLVNACGKKVP  121



>ref|XP_010433288.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=107

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 55/87 (63%), Gaps = 7/87 (8%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            +  CP++ LQL VC ++L+ V  T+G PP+     PCCSLI  + DLEA  CLC +VKAN
Sbjct  22   SAACPRDSLQLGVCANVLKLVDLTLGNPPVT----PCCSLIQGVADLEAAACLCTLVKAN  77

Query  447  LPQIVDVNLTVSLA--LKVCNRNIPLN  521
            +  I ++NL + L   L VC+R  P N
Sbjct  78   VLGI-NLNLPIDLTVLLNVCSRTAPTN  103



>ref|XP_009783170.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=126

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 60/92 (65%), Gaps = 7/92 (8%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKA  443
             G CP + L+L VC ++L  +   T+G PP+    +PCCSL+  LVDLEA +CLC  +KA
Sbjct  40   EGKCPTDALKLGVCANVLNGLLNVTLGTPPV----KPCCSLLGNLVDLEAAVCLCTALKA  95

Query  444  NLPQI-VDVNLTVSLALKVCNRNIPLNAIKCP  536
            N+  I +++ +++SL L VC+++IP     CP
Sbjct  96   NILGINLNIPISLSLLLNVCSKDIP-KGFTCP  126



>ref|XP_004291443.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform 3 
[Fragaria vesca subsp. vesca]
Length=118

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 55/87 (63%), Gaps = 6/87 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            CP++ L+L VC DLL  V   +G P    ++ PCC+L+  LVD EA LCLC  +KAN+  
Sbjct  36   CPRDTLKLGVCADLLGLVNVQIGSP----ASSPCCALLQGLVDAEAALCLCTALKANILG  91

Query  456  I-VDVNLTVSLALKVCNRNIPLNAIKC  533
            I ++V +++SL L  C + +P N  KC
Sbjct  92   INLNVPISLSLLLSACQKEVPPN-FKC  117



>gb|KDP25650.1| hypothetical protein JCGZ_20806 [Jatropha curcas]
Length=130

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 56/91 (62%), Gaps = 7/91 (8%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKA  443
             G CP++ L+L VC D+L+ +   TVG PP      PCCSL+  LVDLEA +CLC  +KA
Sbjct  44   TGACPRDTLKLGVCADVLKGLLNVTVGTPP----KTPCCSLLGDLVDLEAAVCLCTTIKA  99

Query  444  NLPQI-VDVNLTVSLALKVCNRNIPLNAIKC  533
            +L  I +++ + +SL L  C + +P    KC
Sbjct  100  SLLGINLNLPIDLSLLLNYCGKKVP-EGFKC  129



>ref|XP_010093705.1| hypothetical protein L484_019046 [Morus notabilis]
 gb|EXB54485.1| hypothetical protein L484_019046 [Morus notabilis]
Length=114

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 55/82 (67%), Gaps = 6/82 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLR-TVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CP++ L+L VC D+L+  VG  VG PP      PCCSL+  L+DLEA +CLC  +KAN+ 
Sbjct  31   CPRDALKLGVCADVLKGPVGVVVGSPP----DVPCCSLLEGLIDLEAAVCLCTAIKANIL  86

Query  453  QI-VDVNLTVSLALKVCNRNIP  515
             I +++ +++SL +  C ++IP
Sbjct  87   GINLNIPISLSLLISTCRKDIP  108



>ref|XP_006289733.1| hypothetical protein CARUB_v10003301mg [Capsella rubella]
 gb|EOA22631.1| hypothetical protein CARUB_v10003301mg [Capsella rubella]
Length=135

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 56/85 (66%), Gaps = 6/85 (7%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKA  443
             G CPK+ L+L VC ++L+ +    +G PP+    +PCCSLI  LVDLEA  CLC  +KA
Sbjct  49   TGSCPKDTLKLGVCANVLKDLLKIELGTPPV----KPCCSLIKGLVDLEAAACLCTAIKA  104

Query  444  NLPQI-VDVNLTVSLALKVCNRNIP  515
            N+  I ++V +++SL L VC + +P
Sbjct  105  NVLGINLNVPISLSLLLNVCGKKVP  129



>emb|CDP18670.1| unnamed protein product [Coffea canephora]
Length=148

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 56/89 (63%), Gaps = 8/89 (9%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            CP+  L+L VC ++L  +G T+G PP    T PCCSL+  L DLEA +CLC  ++AN+  
Sbjct  66   CPRYALKLGVCANVLGLIGVTIGSPP----TLPCCSLLQGLADLEAAVCLCTAIRANVLG  121

Query  456  IVDVNLTVSLALKVCN--RNIPLNAIKCP  536
            I ++N  VSL+L + N  RN P N   CP
Sbjct  122  I-NLNFPVSLSLILNNYGRNTP-NGFICP  148



>ref|XP_010919518.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=128

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 55/91 (60%), Gaps = 6/91 (7%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
             G CP N L+L VC D+L+ +   +G PP     +PCC+L+  LVDLEA +CLC  +KAN
Sbjct  43   KGNCPMNTLKLGVCADVLKALVVKIGKPP----KKPCCTLLEGLVDLEAAVCLCTALKAN  98

Query  447  LPQI-VDVNLTVSLALKVCNRNIPLNAIKCP  536
            +  I +++ + +SL L  C +  P    +CP
Sbjct  99   ILGIKLNIPIDLSLLLNYCGKKAP-KGFQCP  128



>ref|XP_007226236.1| hypothetical protein PRUPE_ppa017473mg [Prunus persica]
 gb|EMJ27435.1| hypothetical protein PRUPE_ppa017473mg [Prunus persica]
Length=128

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 54/82 (66%), Gaps = 6/82 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            CPK+ L+L VC+DLL  V   VG PP    T  CC+L+  L D+EA LCLC ++K N+  
Sbjct  45   CPKDTLKLGVCMDLLGLVNLPVGTPP----TSKCCALLEGLADMEAALCLCTVIKNNVLG  100

Query  456  IVDVNLTVSLALKV--CNRNIP  515
            +V++ + V+L+L V  C +++P
Sbjct  101  LVNLEVPVALSLLVSACQKSVP  122



>ref|XP_010258987.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Nelumbo nucifera]
Length=135

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 54/90 (60%), Gaps = 6/90 (7%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
             G CP++ L+L VC ++L+ V  +VG PP      PCCSLI  L DLEA  CLC  +KA 
Sbjct  50   KGTCPRDALKLGVCANVLKLVSVSVGTPPY----LPCCSLIKDLADLEAAACLCTAIKAK  105

Query  447  LPQI-VDVNLTVSLALKVCNRNIPLNAIKC  533
            +  I ++V +++SL L  C + +P    KC
Sbjct  106  VLGINLNVPVSLSLILNNCGKKVP-TGFKC  134



>ref|XP_009623719.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
Length=135

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 57/90 (63%), Gaps = 5/90 (6%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CPKN L+L VC ++L   G  +GL   N   +PCC+LI  L D+EA LCLC  +KAN+
Sbjct  50   GKCPKNTLKLGVCANVL---GNLLGLKIGNIPKKPCCTLIKGLADVEAALCLCTAIKANV  106

Query  450  PQI-VDVNLTVSLALKVCNRNIPLNAIKCP  536
              I ++V L++SL L VC + +P   I CP
Sbjct  107  LGINLNVPLSLSLLLNVCGKKVPSGFI-CP  135



>ref|XP_006290087.1| hypothetical protein CARUB_v10003726mg [Capsella rubella]
 gb|EOA22985.1| hypothetical protein CARUB_v10003726mg [Capsella rubella]
Length=113

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 56/83 (67%), Gaps = 5/83 (6%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            CPK+ L+L VC ++L+ V   +G PP+    +PCCSLI  L DLEA +CLC ++KAN+  
Sbjct  31   CPKDSLKLGVCANVLKLVDLKLGNPPV----KPCCSLIQGLADLEAAVCLCTVLKANVLG  86

Query  456  I-VDVNLTVSLALKVCNRNIPLN  521
            I +++ + +S+ L VC+R  P N
Sbjct  87   INLNLPIDLSVLLNVCSRKAPKN  109



>ref|XP_002511665.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
 gb|EEF50334.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
Length=139

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 51/84 (61%), Gaps = 6/84 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CPKN L+L VC DLL   V   VG PP      PCC LI  L DLEA +CLC  +KAN
Sbjct  54   GSCPKNALKLGVCADLLNDLVHLVVGTPP----KEPCCPLIQGLADLEAAVCLCTALKAN  109

Query  447  LPQI-VDVNLTVSLALKVCNRNIP  515
            +  I ++V +++SL L  C + +P
Sbjct  110  ILGINLNVPVSLSLLLNYCGKGVP  133



>ref|XP_004165754.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis sativus]
 gb|KGN50241.1| HyPRP2 [Cucumis sativus]
Length=140

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 55/84 (65%), Gaps = 6/84 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CP++ L+L VC  LL  +   T+G PP+     PCCSLI  L DLEA +CLC  +KA+
Sbjct  56   GKCPRDTLKLGVCAKLLGGLLDITIGKPPVT----PCCSLIEGLADLEAAVCLCTAIKAD  111

Query  447  LPQI-VDVNLTVSLALKVCNRNIP  515
            +  I ++V L++SL L VC +N+P
Sbjct  112  ILGINLNVPLSLSLLLNVCQKNVP  135



>ref|XP_004291441.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform 1 
[Fragaria vesca subsp. vesca]
Length=157

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 55/87 (63%), Gaps = 6/87 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            CP++ L+L VC DLL  V   +G P    ++ PCC+L+  LVD EA LCLC  +KAN+  
Sbjct  75   CPRDTLKLGVCADLLGLVNVQIGSP----ASSPCCALLQGLVDAEAALCLCTALKANILG  130

Query  456  I-VDVNLTVSLALKVCNRNIPLNAIKC  533
            I ++V +++SL L  C + +P N  KC
Sbjct  131  INLNVPISLSLLLSACQKEVPPN-FKC  156



>ref|XP_010458632.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Camelina 
sativa]
Length=143

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 56/82 (68%), Gaps = 6/82 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVG-ATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CPK+ L+  VC ++L+TV   T+G PP+     PCCSLI  L +LEA +CLC  +KAN+ 
Sbjct  60   CPKDTLKFAVCDNVLKTVFHYTLGKPPV----EPCCSLIQGLANLEAAVCLCTALKANVL  115

Query  453  QI-VDVNLTVSLALKVCNRNIP  515
             I +DV +T+SL L VC++ +P
Sbjct  116  GINLDVPITLSLLLNVCSKELP  137



>gb|KDP25648.1| hypothetical protein JCGZ_20804 [Jatropha curcas]
Length=251

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 56/85 (66%), Gaps = 6/85 (7%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKA  443
            +G CP++ L+L VCVDLL+ +   T+G PP      PCCSL+  LVDLEA +CLC  +KA
Sbjct  165  HGACPRDTLKLGVCVDLLKDLLSVTIGTPP----KTPCCSLLGDLVDLEAAVCLCTTIKA  220

Query  444  NLPQI-VDVNLTVSLALKVCNRNIP  515
            +L  I +++ + +SL L  C + +P
Sbjct  221  SLLGINLNLPIDLSLLLNYCGKKVP  245



>gb|ABU63756.1| root specific protein [Triticum aestivum]
Length=126

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 54/84 (64%), Gaps = 6/84 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CP++ +++ +CV+ L  V A +G PP    T PCC L+  LVDLEA LCLC ++KAN+
Sbjct  42   GRCPRDAVKIGLCVNALNLVKAELGAPP----TLPCCPLVKGLVDLEAALCLCTVLKANV  97

Query  450  PQIVDVNLTVSLAL--KVCNRNIP  515
              IV +NL + L++    C + +P
Sbjct  98   LNIVKLNLPIDLSVIPNDCGKKVP  121



>emb|CDY20048.1| BnaA09g02030D [Brassica napus]
Length=111

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 49/84 (58%), Gaps = 6/84 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CPK+ LQ+ +C ++L  V  T+G    N S  PCCSLI  LVDLEA  CLC  +  ++
Sbjct  25   GSCPKDSLQISLCANVLNVVELTLG----NPSVPPCCSLIHGLVDLEAAACLCSALNVDI  80

Query  450  PQIVDVNLTVSL--ALKVCNRNIP  515
            P I  +NL + L   L VC R  P
Sbjct  81   PGITSINLPIFLNVLLNVCGRPTP  104



>ref|XP_008437102.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis melo]
Length=136

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 56/90 (62%), Gaps = 7/90 (8%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CPK+ L++ VC  LL   V  T+G PP+     PCC+L+  L DLEA +CLC  +KA+
Sbjct  52   GKCPKDTLKIGVCAKLLGGLVDLTIGKPPVT----PCCTLVEGLADLEAAVCLCTAIKAS  107

Query  447  -LPQIVDVNLTVSLALKVCNRNIPLNAIKC  533
             L   + + L +SL L VCN+N+P N  +C
Sbjct  108  VLGNKIKIPLHLSLLLNVCNKNLP-NGFQC  136



>ref|XP_006366173.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum tuberosum]
Length=121

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            C  + L+L VC ++L  V   VG PP    T PCCSLI  L+DLEA +CL L ++AN+  
Sbjct  39   CSIDTLKLGVCANILNLVNVVVGSPP----TMPCCSLIQGLLDLEAAVCLSLAIRANVLG  94

Query  456  IVD--VNLTVSLALKVCNRNIPLNA  524
            I++  V L + L L  C R+IP N+
Sbjct  95   IINLQVPLAIDLILSACGRSIPTNS  119



>gb|KGN50240.1| hypothetical protein Csa_5G161890 [Cucumis sativus]
Length=136

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 56/90 (62%), Gaps = 7/90 (8%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CPK+ L++ VC  LL   V  T+G PP+     PCC+L+  L DLEA +CLC  +KA+
Sbjct  52   GKCPKDTLKIGVCAKLLGGLVDLTIGKPPVT----PCCTLVKGLADLEAAVCLCTAIKAS  107

Query  447  -LPQIVDVNLTVSLALKVCNRNIPLNAIKC  533
             L   + + L +SL L VCN+N+P N  +C
Sbjct  108  VLGNKIKIPLHLSLLLNVCNKNLP-NGFQC  136



>ref|XP_004152412.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis sativus]
 gb|KGN50239.1| hypothetical protein Csa_5G161880 [Cucumis sativus]
Length=136

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 56/90 (62%), Gaps = 7/90 (8%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CPK+ L++ VC  LL   V  T+G PP+     PCC+L+  L DLEA +CLC  +KA+
Sbjct  52   GKCPKDTLKIGVCAKLLGGLVDLTIGKPPVT----PCCTLVQGLADLEAAVCLCTAIKAS  107

Query  447  -LPQIVDVNLTVSLALKVCNRNIPLNAIKC  533
             L   + + L +SL L VCN+N+P N  +C
Sbjct  108  VLGNKIKIPLHLSLLLNVCNKNLP-NGFQC  136



>ref|XP_003633921.2| PREDICTED: putative lipid-binding protein At4g00165 [Vitis vinifera]
Length=154

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 6/82 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            CPK+ L+   C + L  VG  VG PP    +  CC+L+A L DLEA LC C  +KAN+  
Sbjct  71   CPKDTLKFGACANWLGLVGEVVGTPP----SSKCCALVAGLADLEAALCFCTAIKANVLG  126

Query  456  IVDVNLTVSLALKV--CNRNIP  515
             + V + V+L L V  C + +P
Sbjct  127  AIKVEVPVALTLLVNACGKKVP  148



>ref|XP_009346182.1| PREDICTED: putative lipid-binding protein AIR1 [Pyrus x bretschneideri]
Length=128

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 52/82 (63%), Gaps = 6/82 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            CPK+ L+L  CVDLL  +    G PP +G    CC+L+  L DLEA +CLC ++KAN   
Sbjct  45   CPKDTLKLGACVDLLGLINLQNGSPPTSG----CCALLEGLTDLEAAICLCTVIKANAAG  100

Query  456  IVDVNLTVSLALKV--CNRNIP  515
            +V++ + V+L+L V  C + +P
Sbjct  101  LVNLEVPVALSLLVSACQKTVP  122



>ref|XP_004165755.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis sativus]
Length=136

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 56/90 (62%), Gaps = 7/90 (8%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CPK+ L++ VC  LL   V  T+G PP+     PCC+L+  L DLEA +CLC  +KA+
Sbjct  52   GKCPKDTLKIGVCAKLLGGLVDLTIGKPPVT----PCCTLVQGLADLEAAVCLCTAIKAS  107

Query  447  -LPQIVDVNLTVSLALKVCNRNIPLNAIKC  533
             L   + + L +SL L VCN+N+P N  +C
Sbjct  108  VLGNKIKIPLHLSLLLNVCNKNLP-NGFQC  136



>ref|XP_004152410.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis sativus]
Length=140

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 55/84 (65%), Gaps = 6/84 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CP++ L+L VC  LL  +   T+G PP+     PCCSLI  L DLEA +CLC  +KA+
Sbjct  56   GKCPRDTLKLGVCAKLLGGLLDITIGKPPVT----PCCSLIDGLADLEAAVCLCTAIKAD  111

Query  447  LPQI-VDVNLTVSLALKVCNRNIP  515
            +  I ++V L++SL L VC +N+P
Sbjct  112  ILGINLNVPLSLSLLLNVCQKNVP  135



>gb|EMS47202.1| Cortical cell-delineating protein [Triticum urartu]
Length=120

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 55/85 (65%), Gaps = 5/85 (6%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CP+N L+LHVC ++L  V A +G+PP      PCCSL+  LV+L+A +CLC  +KAN+
Sbjct  35   GSCPQNALKLHVCANVLNLVKAKIGVPP----AEPCCSLLDGLVNLDAAVCLCTAIKANV  90

Query  450  PQI-VDVNLTVSLALKVCNRNIPLN  521
              I ++V + +SL L  C +  P +
Sbjct  91   LGIHLNVPIDLSLILNNCGKICPAD  115



>ref|XP_010258988.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nelumbo nucifera]
Length=126

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 52/84 (62%), Gaps = 6/84 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLR-TVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CPK+ L+L VC  LL   +GA VG PP      PCC+L+  LVDLE   CLC  +KAN
Sbjct  41   GSCPKDALKLGVCAKLLNGAIGAEVGNPP----DHPCCALLEGLVDLEVAACLCTAIKAN  96

Query  447  LPQI-VDVNLTVSLALKVCNRNIP  515
            +  I +D+ +++SL +  C + +P
Sbjct  97   ILGINLDIPISLSLLVNTCGKKLP  120



>ref|XP_010422379.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=107

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 56/86 (65%), Gaps = 5/86 (6%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            +  CPK+ LQL VC ++L+ V  ++G PP+    +PCCSLI  L DLEA +CLC ++K N
Sbjct  22   SAACPKDSLQLGVCANVLKLVDLSLGNPPV----KPCCSLIQGLADLEAAVCLCTLLKVN  77

Query  447  LPQI-VDVNLTVSLALKVCNRNIPLN  521
            +  I +++ + +S+ L +C +  P N
Sbjct  78   ILGINLNLPIDLSVLLNICGKKAPTN  103



>ref|XP_011018291.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Populus euphratica]
Length=131

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 54/86 (63%), Gaps = 6/86 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLR-TVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CP++ L+L VC  LL   +G  VG PP      PCC+++  LVDLEA +CLC  +KAN+ 
Sbjct  48   CPRDALKLGVCAKLLNGAIGGVVGSPP----DTPCCTVLQGLVDLEAAVCLCTAIKANIL  103

Query  453  QI-VDVNLTVSLALKVCNRNIPLNAI  527
             I +D+ +++SL +  C + +P + I
Sbjct  104  GINIDIPISLSLLINTCGKKLPSDFI  129



>ref|XP_004152415.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis sativus]
Length=136

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 56/90 (62%), Gaps = 7/90 (8%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CPK+ L++ VC  LL   V  T+G PP+     PCC+L+  L DLEA +CLC  +KA+
Sbjct  52   GKCPKDALKIGVCAKLLGGLVDLTIGKPPVT----PCCTLVHGLADLEAAVCLCTAIKAS  107

Query  447  -LPQIVDVNLTVSLALKVCNRNIPLNAIKC  533
             L   + + L +SL L VCN+N+P N  +C
Sbjct  108  VLGNKIKIPLHLSLLLNVCNKNLP-NGFQC  136



>ref|XP_010493734.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Camelina 
sativa]
Length=132

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 54/86 (63%), Gaps = 6/86 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLR-TVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CPK+ L+L VC  +L   VG  +G PP      PCCS++  LVDLEA +CLC  +KAN+ 
Sbjct  49   CPKDALKLGVCAKILDGAVGTVIGNPP----DTPCCSVLQGLVDLEAAVCLCTAIKANIL  104

Query  453  QI-VDVNLTVSLALKVCNRNIPLNAI  527
             I +D+ +++SL +  C + +P + I
Sbjct  105  GINIDIPISLSLLISTCGKKLPSDFI  130



>ref|XP_010424613.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=107

 Score = 64.3 bits (155),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 54/86 (63%), Gaps = 5/86 (6%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            +  CP++ LQL VC ++L+ V  T+G PP+     PCCSLI  L DLEA +CLC +VK N
Sbjct  22   SAACPRDSLQLGVCANVLKLVDITLGNPPVT----PCCSLIQGLADLEAAVCLCTLVKVN  77

Query  447  LPQI-VDVNLTVSLALKVCNRNIPLN  521
            +  I + + + +S+ L VC R  P N
Sbjct  78   VLGINLKLPIDLSVLLNVCGRTPPTN  103



>ref|XP_009795762.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=149

 Score = 65.1 bits (157),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 53/82 (65%), Gaps = 6/82 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CP++ L   VC +L+   VGA +G PP    T PCCSLIA L DLEA +CLC  ++AN+ 
Sbjct  67   CPRDALMFGVCANLVGGLVGAVIGSPP----TMPCCSLIAGLADLEAAVCLCTAIRANVL  122

Query  453  QI-VDVNLTVSLALKVCNRNIP  515
             + ++V L++SL L  C R+ P
Sbjct  123  GLNLNVPLSLSLVLNNCGRSPP  144



>ref|XP_004976453.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Setaria italica]
Length=131

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 55/89 (62%), Gaps = 6/89 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CP++ L+L VC ++L  + A VG+PP    T PCC L+  LVDL+A +CLC  +K N+
Sbjct  47   GKCPRDALKLGVCTNVLGLIKAKVGVPP----TEPCCPLLEGLVDLQAAVCLCTAIKGNI  102

Query  450  PQI-VDVNLTVSLALKVCNRNIPLNAIKC  533
              I +++ + VSL L  C + +P    KC
Sbjct  103  LGINLNLPIDVSLILNHCGKTVP-TGFKC  130



>gb|KDP25651.1| hypothetical protein JCGZ_20807 [Jatropha curcas]
Length=244

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 55/84 (65%), Gaps = 6/84 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CP++ L+L VCVDLL+ +   T+G PP      PCCSL+  LVDLEA +CLC  +KA+
Sbjct  159  GACPRDTLKLGVCVDLLKDLLSVTIGTPP----KTPCCSLLGDLVDLEAAVCLCTTIKAS  214

Query  447  LPQI-VDVNLTVSLALKVCNRNIP  515
            L  I +++ + +SL L  C + +P
Sbjct  215  LLGINLNLPIDLSLLLNYCGKKVP  238



>ref|XP_008394102.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
Length=125

 Score = 64.3 bits (155),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 53/87 (61%), Gaps = 6/87 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            CPK+ L+L  CVDLL  V   +G PP +G    CC+L+  L DLEA +CLC ++KAN   
Sbjct  43   CPKDTLKLGACVDLLGLVNLQIGSPPTSG----CCALLEGLSDLEAAICLCTVIKANALG  98

Query  456  I-VDVNLTVSLALKVCNRNIPLNAIKC  533
            + ++V + +SL +  C + +P    KC
Sbjct  99   LNMEVPVALSLLVSACQKTVP-PGFKC  124



>ref|XP_006368193.1| hypothetical protein POPTR_0001s00400g [Populus trichocarpa]
 gb|ERP64762.1| hypothetical protein POPTR_0001s00400g [Populus trichocarpa]
Length=128

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 54/86 (63%), Gaps = 6/86 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLR-TVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CP++ L+L VC  LL   +G  VG PP      PCC+++  LVDLEA +CLC  +KAN+ 
Sbjct  45   CPRDALKLGVCAKLLNGAIGGVVGSPP----DTPCCTVLQGLVDLEAAVCLCTAIKANIL  100

Query  453  QI-VDVNLTVSLALKVCNRNIPLNAI  527
             I +D+ +++SL +  C + +P + I
Sbjct  101  GINIDIPISLSLLINTCGKKLPSDFI  126



>ref|XP_006289684.1| hypothetical protein CARUB_v10003241mg [Capsella rubella]
 ref|XP_006289723.1| hypothetical protein CARUB_v10003290mg [Capsella rubella]
 gb|EOA22582.1| hypothetical protein CARUB_v10003241mg [Capsella rubella]
 gb|EOA22621.1| hypothetical protein CARUB_v10003290mg [Capsella rubella]
Length=140

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 55/85 (65%), Gaps = 5/85 (6%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CP++ LQL VC ++L+ V   +G PP+    +PCCSLI  L DLEA +CLC  +K N+
Sbjct  56   GTCPRDALQLGVCANVLKLVDLKLGNPPV----KPCCSLIQGLADLEAAVCLCTALKVNI  111

Query  450  PQI-VDVNLTVSLALKVCNRNIPLN  521
              I +++ + +S+ L VC+R  P N
Sbjct  112  LGINLNLPIDLSVLLNVCSRKAPKN  136



>ref|XP_007039887.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
 gb|EOY24388.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
Length=132

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 56/86 (65%), Gaps = 6/86 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLR-TVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CP++ L+L VC  LL  T+G  VG PP      PCCS+++ LVDLEA +CLC  +KAN+ 
Sbjct  49   CPRDALKLGVCAKLLNGTIGGVVGNPP----DTPCCSVLSGLVDLEAAVCLCTAIKANVL  104

Query  453  QI-VDVNLTVSLALKVCNRNIPLNAI  527
             I +++ +++SL +  C + +P + I
Sbjct  105  GININIPISLSLLINTCGKQLPSDFI  130



>gb|EMT19257.1| Cortical cell-delineating protein [Aegilops tauschii]
Length=120

 Score = 64.3 bits (155),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 54/83 (65%), Gaps = 5/83 (6%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CP+N L+LHVC ++L  V A +G+PP      PCCSL+  LV+L+A +CLC  +KAN+
Sbjct  35   GSCPQNALKLHVCANVLNLVKAKIGVPP----AEPCCSLLDGLVNLDAAVCLCTAIKANV  90

Query  450  PQI-VDVNLTVSLALKVCNRNIP  515
              I ++V + +SL L  C +  P
Sbjct  91   LGIHLNVPIDLSLILNNCGKICP  113



>ref|XP_006286641.1| hypothetical protein CARUB_v10002511mg [Capsella rubella]
 gb|EOA19539.1| hypothetical protein CARUB_v10002511mg [Capsella rubella]
Length=110

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 55/85 (65%), Gaps = 5/85 (6%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CP++ L++ VCV +L  V  T+G PP+    +PCCSLI  L DLEA +CLC  +KA++
Sbjct  26   GTCPRDALKIGVCVSVLNIVDLTLGNPPV----QPCCSLIQGLADLEAAVCLCTALKASV  81

Query  450  PQI-VDVNLTVSLALKVCNRNIPLN  521
              I +++ + +S+ L VC R  P N
Sbjct  82   LGINLNLPINLSVLLNVCGRKAPTN  106



>ref|XP_010493743.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Camelina 
sativa]
Length=132

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 54/86 (63%), Gaps = 6/86 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLR-TVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CPK+ L+L VC  +L   VG  +G PP      PCCS++  LVDLEA +CLC  +KAN+ 
Sbjct  49   CPKDALKLGVCAKILDGAVGTVIGNPP----DAPCCSVLQGLVDLEAAVCLCTAIKANIL  104

Query  453  QI-VDVNLTVSLALKVCNRNIPLNAI  527
             I +D+ +++SL +  C + +P + I
Sbjct  105  GINIDIPISLSLLINTCGKKLPSDFI  130



>ref|XP_004976456.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Setaria italica]
Length=129

 Score = 64.3 bits (155),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 55/89 (62%), Gaps = 6/89 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CP++ L+L VC ++L  + A +G+PP    T PCC L+  LVDL+A +CLC  +K N+
Sbjct  45   GKCPRDALKLGVCANVLGLIKAKIGVPP----TEPCCPLLEGLVDLQAAVCLCTAIKGNI  100

Query  450  PQI-VDVNLTVSLALKVCNRNIPLNAIKC  533
              I +++ + VSL L  C + +P    KC
Sbjct  101  LGINLNLPIDVSLILNHCGKTVP-TGFKC  128



>ref|XP_002436327.1| hypothetical protein SORBIDRAFT_10g000510 [Sorghum bicolor]
 gb|EER87694.1| hypothetical protein SORBIDRAFT_10g000510 [Sorghum bicolor]
Length=133

 Score = 64.7 bits (156),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 56/91 (62%), Gaps = 7/91 (8%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKA  443
            +G CP N ++L VC D+L   + A VG PP      PCCSLI+ LVDL+A +C+CL + A
Sbjct  47   DGKCPVNAVKLGVCADVLDGLIHAVVGGPP----KEPCCSLISGLVDLDAAVCVCLAINA  102

Query  444  NLPQI-VDVNLTVSLALKVCNRNIPLNAIKC  533
            N+  I +DV + +SL +  C R +P    KC
Sbjct  103  NVLGINLDVAVDLSLLVNYCGRRVP-AGFKC  132



>ref|XP_007161198.1| hypothetical protein PHAVU_001G050300g [Phaseolus vulgaris]
 gb|ESW33192.1| hypothetical protein PHAVU_001G050300g [Phaseolus vulgaris]
Length=121

 Score = 64.3 bits (155),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 56/91 (62%), Gaps = 6/91 (7%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            +G CPK+ L+L  C D+L  V   VG P     +  CC+L++ L DLEA LCLC  +KAN
Sbjct  36   SGKCPKDTLKLGACADILGLVNIVVGSP----VSSKCCALLSGLADLEAALCLCTAIKAN  91

Query  447  LPQI-VDVNLTVSLALKVCNRNIPLNAIKCP  536
            +  I ++V +T+S+ L  C + +P +  +CP
Sbjct  92   VLGINLNVPITLSVLLSACQKTVP-SGFQCP  121



>ref|XP_010456925.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=107

 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 54/86 (63%), Gaps = 5/86 (6%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            +  CP++ LQL VC ++L+ V  T+G PP+     PCCSLI  L DLEA  CLC +VK N
Sbjct  22   SAACPRDSLQLGVCANVLKLVDITLGNPPVT----PCCSLIQGLADLEAAACLCTLVKVN  77

Query  447  LPQI-VDVNLTVSLALKVCNRNIPLN  521
            +  I +++ + +S+ L VC R  P N
Sbjct  78   VLGINLNLPIDLSVLLNVCGRTPPTN  103



>ref|XP_002271619.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Vitis vinifera]
Length=133

 Score = 64.3 bits (155),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 55/85 (65%), Gaps = 6/85 (7%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKA  443
            +G CP + L+L VC ++L   VG  +G PP      PCC+L+  L+DLEA +CLC  +KA
Sbjct  47   SGSCPIDALKLGVCANVLSGLVGVVIGTPP----DTPCCALLDGLLDLEAAICLCTAIKA  102

Query  444  NLPQI-VDVNLTVSLALKVCNRNIP  515
            N+  I +D++L++SL +  C + +P
Sbjct  103  NILGINLDIHLSLSLLINTCGKTLP  127



>ref|NP_001053512.1| Os04g0554600 [Oryza sativa Japonica Group]
 emb|CAD41235.2| OSJNBa0010H02.23 [Oryza sativa Japonica Group]
 dbj|BAF15426.1| Os04g0554600 [Oryza sativa Japonica Group]
 gb|EAZ31583.1| hypothetical protein OsJ_15725 [Oryza sativa Japonica Group]
Length=131

 Score = 64.3 bits (155),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 54/89 (61%), Gaps = 6/89 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CP++ L+L VC ++L  + A VG+PP      PCC L+  LVDLEA +CLC  +K N+
Sbjct  47   GKCPRDALKLGVCANVLGLIKAKVGVPP----AEPCCPLLEGLVDLEAAVCLCTAIKGNI  102

Query  450  PQI-VDVNLTVSLALKVCNRNIPLNAIKC  533
              I +++ + +SL L  C + +P    KC
Sbjct  103  LGINLNLPVDLSLILNYCGKRVP-TGFKC  130



>ref|XP_006396746.1| hypothetical protein EUTSA_v10029045mg [Eutrema salsugineum]
 gb|ESQ38199.1| hypothetical protein EUTSA_v10029045mg [Eutrema salsugineum]
Length=147

 Score = 64.7 bits (156),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 57/84 (68%), Gaps = 7/84 (8%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CP++ L++ +C ++L+ V  T+G PP+    +PCC+LI  L DLEA +CLC  +KAN+
Sbjct  63   GSCPRDALKIGLCANVLKLVDLTLGNPPV----KPCCTLIEGLADLEAAVCLCTALKANI  118

Query  450  PQIVDVNLTVSLA--LKVCNRNIP  515
              I ++NL +SL+  L VC+R  P
Sbjct  119  LGI-NLNLPISLSVLLNVCSREAP  141



>gb|AAC02087.1| hairy root 4 [Nicotiana tabacum]
Length=196

 Score = 65.5 bits (158),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 54/82 (66%), Gaps = 6/82 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CP++ L+L VC +L+   VGA +G PP    T PCCSLIA L DLEA +CLC  ++AN
Sbjct  74   GRCPRDALKLGVCANLVGGLVGAVIGSPP----TMPCCSLIAGLADLEAAVCLCTAIRAN  129

Query  447  LPQI-VDVNLTVSLALKVCNRN  509
            +  I ++V L++SL L  C + 
Sbjct  130  VLGINLNVPLSLSLVLNNCGKE  151



>ref|XP_010539616.1| PREDICTED: lipid transfer protein EARLI 1-like [Tarenaya hassleriana]
Length=142

 Score = 64.3 bits (155),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 57/88 (65%), Gaps = 6/88 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            CP++ L+L VCV+ L  +  T+G PP+    +PCCSLI  L DLEA +CLC  +KA++  
Sbjct  60   CPRDSLKLGVCVNALNLLNVTLGSPPV----KPCCSLIQGLADLEAAVCLCTALKASILG  115

Query  456  I-VDVNLTVSLALKVCNRNIPLNAIKCP  536
            I ++V + ++L L VC+R  P    +CP
Sbjct  116  INLNVPINLTLLLNVCSRKAP-RGFQCP  142



>emb|CDY21034.1| BnaA08g24910D [Brassica napus]
Length=134

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 53/86 (62%), Gaps = 6/86 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLR-TVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CP++ L+L VC  +L   VG  +G PP      PCCS +  LVDLEA +CLC  +KAN+ 
Sbjct  51   CPRDALKLGVCAKILDGAVGTVIGNPP----DTPCCSFLQGLVDLEAAVCLCTAIKANIL  106

Query  453  QI-VDVNLTVSLALKVCNRNIPLNAI  527
             I +D+ +++SL +  C + +P + I
Sbjct  107  GIDIDIPISLSLLINTCGKKLPSDFI  132



>ref|XP_010676151.1| PREDICTED: putative lipid-binding protein AIR1B [Beta vulgaris 
subsp. vulgaris]
Length=131

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 57/90 (63%), Gaps = 8/90 (9%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CP + L+L VC +LL  +    +G PP+    +PCCSLI  LVDLEA +CLC +++AN+ 
Sbjct  47   CPIDTLKLGVCANLLGNLLHLQIGTPPV----QPCCSLIQGLVDLEAAVCLCTVIRANVL  102

Query  453  QIVDVNLTV--SLALKVCNRNIPLNAIKCP  536
             ++++NL V  SL L VC R +P     CP
Sbjct  103  DLINLNLPVNLSLLLNVCGRQVP-RGFVCP  131



>ref|XP_009611018.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
Length=137

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 54/84 (64%), Gaps = 6/84 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CP++ L+L VC  +L   VGA +G PP      PCCS++  L+DLEA +CLC  +KAN
Sbjct  52   GHCPRDALKLGVCAKVLNGPVGAVIGTPP----DMPCCSVLGGLLDLEAAVCLCTALKAN  107

Query  447  LPQI-VDVNLTVSLALKVCNRNIP  515
            +  I +D+ + +SL +  C +++P
Sbjct  108  ILGINIDIPIALSLLINTCGKSLP  131



>ref|XP_009110670.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Brassica rapa]
Length=134

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 53/86 (62%), Gaps = 6/86 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLR-TVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CP++ L+L VC  +L   VG  +G PP      PCCS +  LVDLEA +CLC  +KAN+ 
Sbjct  51   CPRDALKLGVCAKILDGAVGTVIGNPP----DTPCCSFLQGLVDLEAAVCLCTAIKANIL  106

Query  453  QI-VDVNLTVSLALKVCNRNIPLNAI  527
             I +D+ +++SL +  C + +P + I
Sbjct  107  GIDIDIPISLSLLINTCGKKLPSDFI  132



>gb|AAX20042.1| proline-rich protein [Capsicum annuum]
Length=136

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 53/81 (65%), Gaps = 5/81 (6%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            CP + L+L VC D+L  V A +G PP+     PCCSL++ L + EA LCLC  +KAN+  
Sbjct  54   CPIDTLKLGVCADVLGLVNAVIGSPPV----TPCCSLLSGLANAEAALCLCTAIKANILG  109

Query  456  I-VDVNLTVSLALKVCNRNIP  515
            I ++V +++SL L VC++  P
Sbjct  110  INLNVPVSLSLLLNVCSKEAP  130



>ref|XP_010055514.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
 gb|KCW71995.1| hypothetical protein EUGRSUZ_E00448 [Eucalyptus grandis]
Length=135

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 56/82 (68%), Gaps = 6/82 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLL-RTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CP++ L+L VC D+L   +  TVG PP+     PCCSL+  LVDLEA +CLC  +KAN+ 
Sbjct  52   CPRDALKLGVCADVLGNLLNVTVGKPPVT----PCCSLLNGLVDLEAAVCLCTAIKANIL  107

Query  453  QI-VDVNLTVSLALKVCNRNIP  515
             I +++ +++SL L VC++ +P
Sbjct  108  GINLNIPISLSLLLNVCSKQVP  129



>ref|XP_010493717.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Camelina 
sativa]
 ref|XP_010476165.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Camelina 
sativa]
Length=143

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 56/82 (68%), Gaps = 6/82 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVG-ATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CPK+ L+  VC ++L+TV   T+G PP+     PCCSLI  L +LEA +CLC  +KAN+ 
Sbjct  60   CPKDTLKFAVCDNVLKTVFHYTLGKPPV----EPCCSLIQGLANLEAAVCLCTALKANVL  115

Query  453  QI-VDVNLTVSLALKVCNRNIP  515
             I +D+ +T+SL L VC++ +P
Sbjct  116  GINLDLPITLSLLLNVCSKELP  137



>ref|XP_010433379.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=135

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 56/84 (67%), Gaps = 6/84 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CP++ L+L VC +LL+ +    +G PP+    +PCCSL+  LVDLEA  CLC  +KAN
Sbjct  50   GSCPRDTLKLGVCANLLKDLLKIELGTPPV----KPCCSLLNGLVDLEAAACLCTALKAN  105

Query  447  LPQI-VDVNLTVSLALKVCNRNIP  515
            +  I ++V +++SL L VC R +P
Sbjct  106  VIGIKLNVPVSLSLLLNVCGRKVP  129



>ref|XP_003574313.1| PREDICTED: acanthoscurrin-1-like [Brachypodium distachyon]
Length=212

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 56/90 (62%), Gaps = 5/90 (6%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CP + L+LHVC ++L  + A VG+PPLN     CC L+  LVDL+A LCLC  +KA++
Sbjct  127  GKCPTDALKLHVCANVLDLIKAKVGVPPLNDR---CCPLLHGLVDLDAALCLCTAIKADV  183

Query  450  PQI-VDVNLTVSLALKVCNRNIPLNAIKCP  536
              I +++ + +SL L  C + +P     CP
Sbjct  184  LGIKLNLPVHLSLILNFCGKGVP-TGFMCP  212



>ref|NP_001152584.1| cortical cell-delineating protein precursor [Zea mays]
 gb|ACG48357.1| cortical cell-delineating protein precursor [Zea mays]
Length=131

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 53/92 (58%), Gaps = 12/92 (13%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CP++ L+L VC ++L  + A VG+PP      PCC L+  LVDLEA +CLC  +K   
Sbjct  48   GRCPRDALKLGVCANVLGLIKAKVGVPP----AEPCCPLLEGLVDLEAAVCLCTAIKG--  101

Query  450  PQIVDVNL----TVSLALKVCNRNIPLNAIKC  533
             QI+ +NL     +SL L  C R +P    KC
Sbjct  102  -QILGINLNLPIDLSLILNYCGRTVP-TGFKC  131



>gb|EYU30297.1| hypothetical protein MIMGU_mgv1a015941mg [Erythranthe guttata]
Length=140

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 53/83 (64%), Gaps = 6/83 (7%)
 Frame = +3

Query  273  ICPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN-  446
             CPK+ L+L VC +LL  + G T G+PP      PCCSLIA L D  A +CLC  VKAN 
Sbjct  55   YCPKDTLKLGVCANLLAGLLGRTNGIPP----KAPCCSLIADLDDYGAAVCLCNAVKANV  110

Query  447  LPQIVDVNLTVSLALKVCNRNIP  515
            L + ++V L++SL L VC + +P
Sbjct  111  LGKNLNVPLSISLLLNVCTKKVP  133



>ref|XP_007052128.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
 gb|EOX96285.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
Length=135

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 48/82 (59%), Gaps = 6/82 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            CPK+ L+  VC   L  V   VG PP    ++ CC+LIA L DLEA LCLC  +KAN+  
Sbjct  52   CPKDTLKFGVCGSWLGLVHEVVGTPP----SKECCTLIAGLADLEAALCLCTAIKANVLG  107

Query  456  IVDVNLTVSLALKV--CNRNIP  515
            ++ V   V+L L +  C + +P
Sbjct  108  VIKVKTPVALTLLINACGKKVP  129



>gb|KHN08148.1| Putative lipid-binding protein [Glycine soja]
Length=177

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 53/89 (60%), Gaps = 6/89 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            CPK+ L+L  C DLL  V   VG PP    +  CC+LI  L DLEA LCLC  +K+N+  
Sbjct  94   CPKDTLKLGACADLLGLVNIIVGTPP----SSQCCALIKGLADLEAALCLCTAIKSNVLG  149

Query  456  I-VDVNLTVSLALKVCNRNIPLNAIKCPK  539
            I ++V +T+S+ L  C + +P    +CP 
Sbjct  150  INLNVPVTLSVILSACQKTVP-PGFQCPS  177



>ref|XP_003546415.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Glycine max]
 gb|KHN15311.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=139

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 6/82 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLL-RTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CP++ L+L +C +LL RTV  T+G PP+     PCCSLIA LVD EA +CLC  ++ N+ 
Sbjct  57   CPRDELKLGICTNLLNRTVNITLGEPPV----IPCCSLIAGLVDFEAAVCLCTPLRQNIL  112

Query  453  QI-VDVNLTVSLALKVCNRNIP  515
             I +D+ +  +    +C+R +P
Sbjct  113  GIDLDIPVIFNFLFNICSREVP  134



>ref|NP_849366.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 sp|Q9ZSP6.1|AIR1L_ARATH RecName: Full=Putative lipid-binding protein AIR1B; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD12259.1| putative cell wall-plasma membrane disconnecting CLCT protein 
[Arabidopsis thaliana]
 dbj|BAC43314.1| putative cell wall-plasma membrane disconnecting CLCT protein 
[Arabidopsis thaliana]
 gb|ABD57494.1| At4g12545 [Arabidopsis thaliana]
 gb|AEE83145.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=108

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 54/84 (64%), Gaps = 9/84 (11%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CP   +Q+  C ++L  V  T+G PP+    +PCCSLI  L DLEA  CLC  +KA++
Sbjct  26   GTCP---IQISTCANVLNLVDLTLGNPPV----KPCCSLIQGLADLEAAACLCTALKASI  78

Query  450  PQIVDVNLTVSLA--LKVCNRNIP  515
              IV++NL ++L+  L VC+RN P
Sbjct  79   LGIVNINLPINLSVLLNVCSRNAP  102



>ref|XP_006355478.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum tuberosum]
Length=132

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 59/89 (66%), Gaps = 7/89 (8%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CPK+ L+L +C ++L  +   T+G PP+    +PCCSLI  LVDLEA +CLC  +KAN+ 
Sbjct  49   CPKDALKLGICANVLNGLLNVTLGTPPV----KPCCSLIGNLVDLEAAVCLCTALKANIL  104

Query  453  QI-VDVNLTVSLALKVCNRNIPLNAIKCP  536
             I +++ +++SL L VC++  P   I CP
Sbjct  105  GINLNIPISLSLLLNVCSKEAPKGFI-CP  132



>ref|XP_008448870.1| PREDICTED: lipid transfer protein EARLI 1-like [Cucumis melo]
Length=210

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 55/88 (63%), Gaps = 6/88 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            CP++ L++ VC  +L  V  T+G PP+     PCCSLI  L DLEA +CLC  ++AN+  
Sbjct  128  CPRDALKIGVCARVLSIVNVTLGTPPVT----PCCSLIQGLADLEAAICLCTAIRANILG  183

Query  456  I-VDVNLTVSLALKVCNRNIPLNAIKCP  536
            + + + + +SL L VC+RN P    +CP
Sbjct  184  LNISLPINLSLLLNVCSRNTP-REFQCP  210



>ref|XP_006417265.1| hypothetical protein EUTSA_v10009083mg [Eutrema salsugineum]
 gb|ESQ35618.1| hypothetical protein EUTSA_v10009083mg [Eutrema salsugineum]
Length=134

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 54/86 (63%), Gaps = 6/86 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLR-TVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CP++ L+L VC  +L   VG  +G PP      PCCS++  LVDLEA +CLC  +KAN+ 
Sbjct  51   CPRDALKLGVCAKILDGAVGTVIGNPP----DTPCCSVLQGLVDLEAAVCLCTAIKANIL  106

Query  453  QI-VDVNLTVSLALKVCNRNIPLNAI  527
             I +D+ +++SL +  C + +P + I
Sbjct  107  GINIDIPISLSLLINTCGKKLPSDFI  132



>ref|XP_002464967.1| hypothetical protein SORBIDRAFT_01g029610 [Sorghum bicolor]
 gb|EER91965.1| hypothetical protein SORBIDRAFT_01g029610 [Sorghum bicolor]
Length=124

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 53/81 (65%), Gaps = 5/81 (6%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            CP++ L+L VC ++L  V A +G PP     +PCCSL+  LVDLEA +CLC  +KAN+  
Sbjct  42   CPRDSLKLGVCANVLGLVKAKIGSPP----YQPCCSLLDGLVDLEAAVCLCTAIKANILG  97

Query  456  I-VDVNLTVSLALKVCNRNIP  515
            I +++ + +SL L  C +N P
Sbjct  98   INLNLPIDLSLILNNCGKNCP  118



>ref|XP_008392579.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
Length=136

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 56/91 (62%), Gaps = 13/91 (14%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLL-RTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CP++ L+L VC  LL R VGA VG PP      PCC+L+  LV+LE  +CLC  +KAN  
Sbjct  53   CPRDSLKLGVCAKLLNRAVGAVVGNPP----DHPCCALLEGLVELEVAVCLCTAIKAN--  106

Query  453  QIVDVNLTVSLALKV----CNRNIPLNAIKC  533
             I+ +NL + +AL +    C +N+P +  KC
Sbjct  107  -ILGINLNIPIALSLIIDGCAKNVP-SGFKC  135



>emb|CDX79156.1| BnaA01g12230D [Brassica napus]
Length=135

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 57/93 (61%), Gaps = 9/93 (10%)
 Frame = +3

Query  270  GICPKNRLQLHVCVD---LLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVK  440
            G CPK+ L+L VCV+   LL   G  +G PP+     PCCSLI  LVDLEA +CLC  +K
Sbjct  48   GTCPKDTLKLGVCVNALNLLNDDGPALGTPPVT----PCCSLIKGLVDLEAAVCLCTALK  103

Query  441  ANLPQI-VDVNLTVSLALKVCNRNIPLNAIKCP  536
            A++  I +++ + +SL L VC R  P    +CP
Sbjct  104  ASVLGININLPINLSLLLNVCKRKSP-PGFQCP  135



>gb|AFW63295.1| cortical cell-delineating protein [Zea mays]
Length=131

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 53/92 (58%), Gaps = 12/92 (13%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CP++ L+L VC ++L  + A VG+PP      PCC L+  LVDLEA +CLC  +K   
Sbjct  48   GRCPRDALKLGVCANVLGLIKAKVGVPP----AEPCCPLLEGLVDLEAAVCLCTAIKG--  101

Query  450  PQIVDVNL----TVSLALKVCNRNIPLNAIKC  533
             QI+ +NL     +SL L  C R +P    KC
Sbjct  102  -QILGINLNLPIDLSLILNYCGRTVP-TGFKC  131



>dbj|BAJ97873.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=232

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 56/90 (62%), Gaps = 5/90 (6%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CP + L+LHVC ++L  + A VG+PPLN     CC L+  LVDL+A +CLC  +KA++
Sbjct  146  GKCPTDALKLHVCANVLDLIKAKVGVPPLNDR---CCPLLNGLVDLDAAICLCTAIKADV  202

Query  450  PQI-VDVNLTVSLALKVCNRNIPLNAIKCP  536
              I +++ + +SL L  C + +P     CP
Sbjct  203  LGIHINLPIHLSLILNFCGKGVP-TGFMCP  231



>ref|XP_008219516.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Prunus mume]
Length=131

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 52/82 (63%), Gaps = 6/82 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            CPK+ L+L VC+DLL  V   VG PP    T  CC+L+  L D+EA +CLC  +KAN+  
Sbjct  48   CPKDTLKLGVCMDLLGLVNLPVGTPP----TSKCCALLEGLADMEAAICLCTAIKANVLG  103

Query  456  I--VDVNLTVSLALKVCNRNIP  515
            +  ++V + +SL +  C +++P
Sbjct  104  VGALEVPVALSLLVSACQKSVP  125



>ref|XP_006440347.1| hypothetical protein CICLE_v10022825mg [Citrus clementina]
 ref|XP_006477232.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Citrus sinensis]
 gb|ESR53587.1| hypothetical protein CICLE_v10022825mg [Citrus clementina]
 gb|KDO61486.1| hypothetical protein CISIN_1g044385mg [Citrus sinensis]
Length=132

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 57/82 (70%), Gaps = 6/82 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CP++ L+L VC ++L  +   T+G PP+    +PCC+LI  L DLEA +CLC  +KAN+ 
Sbjct  49   CPRDALKLGVCANVLNGLLNVTIGTPPV----QPCCTLIQGLADLEAAVCLCTAIKANIL  104

Query  453  QI-VDVNLTVSLALKVCNRNIP  515
             I +++ L++SL L VC++++P
Sbjct  105  GINLNIPLSLSLLLNVCSKSVP  126



>ref|XP_009798259.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=138

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 54/84 (64%), Gaps = 6/84 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CP++ L+L VC  +L   +GA +G PP      PCCS++  L+DLEA +CLC  +KAN
Sbjct  53   GHCPRDALKLGVCAKVLNGPIGAVIGTPP----DMPCCSVLGGLLDLEAAVCLCTALKAN  108

Query  447  LPQI-VDVNLTVSLALKVCNRNIP  515
            +  I +D+ + +SL +  C +++P
Sbjct  109  ILGINIDIPIALSLLINTCGKSLP  132



>gb|EYU24741.1| hypothetical protein MIMGU_mgv1a016172mg [Erythranthe guttata]
Length=132

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 52/82 (63%), Gaps = 6/82 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CPK+ L+L VC +LL   V   VG PP      PCCSLI  LVDLEA +CLC  VKAN+ 
Sbjct  49   CPKDTLKLGVCANLLNDLVHLVVGSPP----KTPCCSLIGGLVDLEAAVCLCTAVKANVL  104

Query  453  QI-VDVNLTVSLALKVCNRNIP  515
             I ++V +++SL L  C + +P
Sbjct  105  GINLNVPVSLSLLLNYCGKKVP  126



>ref|XP_004169260.1| PREDICTED: putative lipid-binding protein At4g00165-like [Cucumis 
sativus]
Length=199

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 57/88 (65%), Gaps = 6/88 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            CP++ L++ +C  +L  V AT+G PP+     PCC+LI  L DLEA +CLC  ++A++  
Sbjct  117  CPRDALKIGICARVLSLVNATIGSPPVT----PCCTLIQGLADLEAAICLCTAIRASILG  172

Query  456  I-VDVNLTVSLALKVCNRNIPLNAIKCP  536
            + +++ + +SL L VC+RN P    +CP
Sbjct  173  LNINLPINLSLLLNVCSRNTP-RGFQCP  199



>ref|XP_004245750.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum lycopersicum]
Length=131

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 56/86 (65%), Gaps = 6/86 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CP++ L+L VC ++L  +   T+G PP+    +PCCSL+  LVDLEA +CLC  +KAN+ 
Sbjct  48   CPRDALKLGVCANVLNGLLNVTLGTPPV----KPCCSLLGNLVDLEAAVCLCTALKANIL  103

Query  453  QI-VDVNLTVSLALKVCNRNIPLNAI  527
             I +D+ +++SL L VC +  P   I
Sbjct  104  GINLDIPISLSLLLNVCTKEAPKGFI  129



>ref|XP_006440346.1| hypothetical protein CICLE_v10022839mg [Citrus clementina]
 gb|ESR53586.1| hypothetical protein CICLE_v10022839mg [Citrus clementina]
Length=130

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 56/86 (65%), Gaps = 6/86 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLR-TVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CP++ L+L VC  +L  TVGA VG PP      PCCS++  L+DLEA +CLC  +KAN+ 
Sbjct  47   CPRDALKLGVCAKVLDGTVGAVVGNPP----DFPCCSVLQGLLDLEAAVCLCTAIKANIL  102

Query  453  QI-VDVNLTVSLALKVCNRNIPLNAI  527
             I +++ +++SL +  C + +P + I
Sbjct  103  GININIPISLSLLINTCGKKLPSDFI  128



>gb|KDO61485.1| hypothetical protein CISIN_1g047179mg [Citrus sinensis]
Length=130

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 56/86 (65%), Gaps = 6/86 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLR-TVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CP++ L+L VC  +L  TVGA VG PP      PCCS++  L+DLEA +CLC  +KAN+ 
Sbjct  47   CPRDALKLGVCAKVLDGTVGAVVGNPP----DFPCCSVLQGLLDLEAAVCLCTAIKANIL  102

Query  453  QI-VDVNLTVSLALKVCNRNIPLNAI  527
             I +++ +++SL +  C + +P + I
Sbjct  103  GININIPISLSLLINTCGKKLPSDFI  128



>ref|XP_008646032.1| PREDICTED: cortical cell-delineating protein-like [Zea mays]
 gb|AFW72681.1| cortical cell-delineating protein [Zea mays]
Length=126

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 52/89 (58%), Gaps = 6/89 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CP++ L+L VC ++L  + A VG PP      PCC L+  LVDLEA  CLC  +K N+
Sbjct  43   GRCPRDALKLGVCANVLGLIKAKVGAPP----AEPCCPLLEGLVDLEAAACLCTAIKGNI  98

Query  450  PQI-VDVNLTVSLALKVCNRNIPLNAIKC  533
              I +++ + +SL L  C R +P    KC
Sbjct  99   LGINLNLPVDLSLILNYCGRTVP-TGFKC  126



>ref|XP_010906608.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=129

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 53/84 (63%), Gaps = 6/84 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CP + L+L VC D+L  +   T+G PP      PCCSL++ LVDLEA +CLC  +KAN
Sbjct  44   GKCPIDALKLGVCADVLSGLLNVTIGTPP----KEPCCSLLSGLVDLEAAVCLCTAIKAN  99

Query  447  LPQI-VDVNLTVSLALKVCNRNIP  515
            +  I +++ + +SL L  C + +P
Sbjct  100  ILGINLNIPVDLSLLLNYCGKKVP  123



>ref|XP_010093706.1| hypothetical protein L484_019047 [Morus notabilis]
 gb|EXB54486.1| hypothetical protein L484_019047 [Morus notabilis]
Length=133

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 58/89 (65%), Gaps = 7/89 (8%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CP++ L++ VC ++L   V ATVG PP+     PCC+LI  L DLEA LCLC  ++A++ 
Sbjct  50   CPRDALKIGVCANVLGGLVNATVGNPPVT----PCCTLIQGLADLEAALCLCTAIRASIL  105

Query  453  QI-VDVNLTVSLALKVCNRNIPLNAIKCP  536
             I +++ + +SL L VC+RN P    +CP
Sbjct  106  GININIPVNLSLLLNVCSRNSP-PGFQCP  133



>ref|XP_002867769.1| hypothetical protein ARALYDRAFT_914370 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44028.1| hypothetical protein ARALYDRAFT_914370 [Arabidopsis lyrata subsp. 
lyrata]
Length=133

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 60/92 (65%), Gaps = 7/92 (8%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKA  443
            +G CPK+ L+L VCV+ L  +   T+G PP+     PCCSLI  LVDLEA +CLC  +KA
Sbjct  47   SGTCPKDALKLGVCVNALNLLNDVTLGTPPVT----PCCSLIKGLVDLEAAVCLCTALKA  102

Query  444  NLPQI-VDVNLTVSLALKVCNRNIPLNAIKCP  536
            ++  I +++ + +SL L VC+R  P +  +CP
Sbjct  103  SVLGINLNLPIDLSLLLNVCSRKAP-HGFQCP  133



>ref|XP_002533299.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
 gb|EEF29093.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
Length=133

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 55/84 (65%), Gaps = 6/84 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CP++ L+L VC ++L ++    +G PP+     PCCSLI  LVDLEA +CLC  +KAN
Sbjct  48   GKCPRDALKLGVCANVLGSLLNLNIGKPPV----EPCCSLIQGLVDLEAAVCLCTAIKAN  103

Query  447  LPQI-VDVNLTVSLALKVCNRNIP  515
            +  I +++ L++SL L VC +  P
Sbjct  104  ILGINLNIPLSLSLLLNVCGKKTP  127



>ref|XP_007155641.1| hypothetical protein PHAVU_003G218900g [Phaseolus vulgaris]
 gb|ESW27635.1| hypothetical protein PHAVU_003G218900g [Phaseolus vulgaris]
Length=133

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 58/85 (68%), Gaps = 6/85 (7%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKA  443
            +G CP++ L+L VC ++L   V AT+G PP+     PCC+L+  LVDLEA +CLC  +KA
Sbjct  47   SGSCPRDALKLGVCANVLNGLVNATLGQPPVT----PCCTLLDGLVDLEAAVCLCTALKA  102

Query  444  NLPQI-VDVNLTVSLALKVCNRNIP  515
            N+  I +++ +++SL L VC+R  P
Sbjct  103  NILGINLNLPISLSLLLNVCSRQAP  127



>ref|XP_009589966.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
 dbj|BAB16431.1| P-rich protein NtEIG-C29 [Nicotiana tabacum]
Length=130

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 58/91 (64%), Gaps = 7/91 (8%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CP + L+L VC ++L  + G  +G PP     +PCC+LI  + DLEA +CLC  +KAN
Sbjct  45   GKCPIDTLKLGVCANVLGNLLGLVIGNPP----KKPCCTLIQGVADLEAAICLCTAIKAN  100

Query  447  LPQI-VDVNLTVSLALKVCNRNIPLNAIKCP  536
            +  I ++V L++SL L VC + +P +  +CP
Sbjct  101  ILGINLNVPLSLSLLLNVCGKQVP-SGFQCP  130



>gb|AEX33654.1| lipid transfer protein [Uromyces hobsonii]
Length=137

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 55/91 (60%), Gaps = 7/91 (8%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CPK+ L+L VC +LL   V   VG PP      PCC+L+  L DLEA LCLC  +KAN
Sbjct  49   GKCPKDTLKLGVCANLLNDLVHLVVGAPP----KTPCCTLLKGLADLEAALCLCTAIKAN  104

Query  447  LPQI-VDVNLTVSLALKVCNRNIPLNAIKCP  536
            +  I ++V +++SL L  C + +P    +CP
Sbjct  105  VLGINLNVPVSLSLLLNYCGKKVP-TGFQCP  134



>emb|CDY20047.1| BnaA09g02040D [Brassica napus]
Length=111

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 49/84 (58%), Gaps = 6/84 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CPK+ LQ+ +C ++L  V  T+G    N S  PCCSLI  LVDLEA  CLC  +K ++
Sbjct  25   GSCPKDSLQISLCANVLNVVELTLG----NPSVPPCCSLIHGLVDLEAAACLCSALKVDI  80

Query  450  PQIVDVNLTVSL--ALKVCNRNIP  515
              I  VNL + L   L VC R  P
Sbjct  81   LGITSVNLPIFLNVLLNVCGRPTP  104



>ref|NP_001047650.1| Os02g0662000 [Oryza sativa Japonica Group]
 gb|AAA65513.1| RCc3 [Oryza sativa Japonica Group]
 dbj|BAD25630.1| root-specific protein RCc3 [Oryza sativa Japonica Group]
 dbj|BAD27673.1| root-specific protein RCc3 [Oryza sativa Japonica Group]
 dbj|BAF09564.1| Os02g0662000 [Oryza sativa Japonica Group]
 gb|EAY86972.1| hypothetical protein OsI_08366 [Oryza sativa Indica Group]
 gb|EAZ24089.1| hypothetical protein OsJ_07827 [Oryza sativa Japonica Group]
 dbj|BAG98613.1| unnamed protein product [Oryza sativa Japonica Group]
Length=133

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 54/89 (61%), Gaps = 6/89 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CP++ L+L VC ++L  + A VG+PP      PCC L+  LVDLEA +CLC  ++ N+
Sbjct  50   GRCPRDALKLGVCANVLGLIKAKVGVPP----AEPCCPLLEGLVDLEAAVCLCTAIRGNI  105

Query  450  PQI-VDVNLTVSLALKVCNRNIPLNAIKC  533
              I +++ + +SL L  C + +P    KC
Sbjct  106  LGINLNLPIDLSLILNYCGKTVP-TGFKC  133



>ref|XP_004516837.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cicer arietinum]
Length=135

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 53/84 (63%), Gaps = 6/84 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLR-TVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CP++ LQL VC +LL   +GA +G PP      PCCS++  L+DLE  +CLC  +KAN+ 
Sbjct  52   CPRDALQLGVCANLLNGPIGAVIGSPP----EHPCCSVLEGLLDLEVAVCLCTAIKANIL  107

Query  453  QI-VDVNLTVSLALKVCNRNIPLN  521
             I +++ +++SL L  C +  P N
Sbjct  108  GININIPISLSLILNACEKTPPSN  131



>emb|CDY31241.1| BnaC08g15360D [Brassica napus]
Length=132

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 54/87 (62%), Gaps = 8/87 (9%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLR-TVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CP++ L+L VC  +L   VG  +G PP      PCCS +  LVDLEA +CLC  +KAN+ 
Sbjct  49   CPRDALKLGVCAKILDGAVGTVIGNPP----DTPCCSFLQGLVDLEAAVCLCTAIKANIL  104

Query  453  QIVDVNLTVSLALKV--CNRNIPLNAI  527
             I D+N+ +SL+L +  C + +P + I
Sbjct  105  GI-DINIPISLSLLINTCGKKLPSDFI  130



>gb|KDP25644.1| hypothetical protein JCGZ_20800 [Jatropha curcas]
Length=128

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 54/86 (63%), Gaps = 6/86 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLR-TVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CP++ L+L VC  LL   VG  VG PP      PCCS++  LVDLEA +CLC  +KAN+ 
Sbjct  45   CPRDALKLGVCAKLLNGAVGGVVGNPP----DHPCCSVLQGLVDLEAAVCLCTAIKANIL  100

Query  453  QI-VDVNLTVSLALKVCNRNIPLNAI  527
             I +++ +++SL +  C + +P + I
Sbjct  101  GININIPISLSLLINTCGKQLPSDFI  126



>ref|XP_008437105.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis melo]
Length=136

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 55/88 (63%), Gaps = 7/88 (8%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN-L  449
            CPK+ L++ VC  LL   V  T+G PP+     PCC+L+  L DLEA +CLC  +KA+ L
Sbjct  54   CPKDALKIGVCAKLLGGLVDLTIGKPPVT----PCCTLVQGLADLEAAVCLCTAIKASVL  109

Query  450  PQIVDVNLTVSLALKVCNRNIPLNAIKC  533
               + + L +SL L VCN+N+P N  +C
Sbjct  110  GNKIKIPLHLSLLLNVCNKNLP-NGFQC  136



>ref|NP_001152585.1| LOC100286225 precursor [Zea mays]
 gb|ACG48364.1| cortical cell-delineating protein precursor [Zea mays]
Length=125

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 52/89 (58%), Gaps = 6/89 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CP++ L+L VC ++L  + A VG PP      PCC L+  LVDLEA  CLC  +K N+
Sbjct  42   GRCPRDALKLGVCANVLGLIKAKVGAPP----AEPCCPLLEGLVDLEAAACLCTAIKGNI  97

Query  450  PQI-VDVNLTVSLALKVCNRNIPLNAIKC  533
              I +++ + +SL L  C R +P    KC
Sbjct  98   LGINLNLPVDLSLILNYCGRTVPXG-FKC  125



>gb|AAC49369.1| proline-rich 14 kDa protein [Phaseolus vulgaris]
Length=127

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 53/88 (60%), Gaps = 5/88 (6%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            +G CP+N L+  VC D+L  +G  +G PP      PCC+LI  L DLEA +CLC  ++AN
Sbjct  42   SGSCPENTLKFGVCADVLGLIGVELGKPP----KTPCCNLIQGLADLEAAVCLCTALRAN  97

Query  447  LPQI-VDVNLTVSLALKVCNRNIPLNAI  527
            +  I ++V + ++L L  C +  P + +
Sbjct  98   VLGINLNVPIKLNLLLNYCGKKTPKDFV  125



>ref|XP_006477231.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Citrus sinensis]
Length=130

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 56/86 (65%), Gaps = 6/86 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLR-TVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CP++ L+L +C  +L  TVGA VG PP      PCCS++  L+DLEA +CLC  +KAN+ 
Sbjct  47   CPRDALKLGICAKVLDGTVGAVVGNPP----DFPCCSVLQGLLDLEAAVCLCTAIKANIL  102

Query  453  QI-VDVNLTVSLALKVCNRNIPLNAI  527
             I +++ +++SL +  C + +P + I
Sbjct  103  GININIPISLSLLINTCGKKLPSDFI  128



>ref|NP_193977.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin-like protein [Arabidopsis thaliana]
 emb|CAA22151.1| extensin like protein [Arabidopsis thaliana]
 emb|CAB79201.1| extensin like protein [Arabidopsis thaliana]
 gb|AEE84609.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin-like protein [Arabidopsis thaliana]
Length=133

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 54/84 (64%), Gaps = 12/84 (14%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CPK+ L++ VCV+ L  + G T G PP+     PCCSLI  LVDLEA +CLC  +KA+
Sbjct  48   GTCPKDALKVGVCVNALNLLNGLTPGTPPVT----PCCSLIEGLVDLEAAICLCTALKAS  103

Query  447  LPQIVDVNLT----VSLALKVCNR  506
               ++ +NLT    +SL L +CNR
Sbjct  104  ---VLGINLTLPINLSLLLNICNR  124



>ref|XP_009376589.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
 ref|XP_009376590.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=136

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 54/88 (61%), Gaps = 7/88 (8%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLR-TVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CP++ L+L VC  LL   VGA VG PP      PCC+L+  LVDLE  +CLC  +KAN+ 
Sbjct  53   CPRDSLKLGVCAKLLNGAVGAVVGNPP----DHPCCALLEGLVDLEVAVCLCTAIKANIL  108

Query  453  QI-VDVNLTVSLALKVCNRNIPLNAIKC  533
             I +++ + +SL +  C +N+P    KC
Sbjct  109  GINLNIPIALSLVIDGCAKNVP-EGFKC  135



>ref|XP_009355765.1| PREDICTED: putative lipid-binding protein AIR1 [Pyrus x bretschneideri]
Length=129

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 6/82 (7%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLPQ  455
            CPK+ L+L  CVDLL  +    G PP +G    CC+L+  L DLEA +CLC ++K N   
Sbjct  46   CPKDTLKLGACVDLLGLINLQNGSPPTSG----CCALLEGLTDLEAAICLCTVIKVNAAG  101

Query  456  IVDVNLTVSLALKV--CNRNIP  515
            +V++ + V+L+L V  C + +P
Sbjct  102  LVNLEVPVALSLLVSACQKTVP  123



>ref|XP_008381149.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
 ref|XP_008365739.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
Length=136

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 54/88 (61%), Gaps = 7/88 (8%)
 Frame = +3

Query  276  CPKNRLQLHVCVDLLR-TVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANLP  452
            CP++ L+L VC  LL   VGA VG PP      PCC+L+  LVDLE  +CLC  +KAN+ 
Sbjct  53   CPRDSLKLGVCAKLLNGAVGAVVGNPP----DHPCCALLEGLVDLEVAVCLCTAIKANIL  108

Query  453  QI-VDVNLTVSLALKVCNRNIPLNAIKC  533
             I +++ + +SL +  C +N+P    KC
Sbjct  109  GINLNIPIALSLVIDGCAKNVP-EGFKC  135



>gb|EAY95110.1| hypothetical protein OsI_16927 [Oryza sativa Indica Group]
Length=131

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 54/89 (61%), Gaps = 6/89 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CP++ L+L VC ++L  + A VG+PP      PCC L+  LVDLEA +CLC  ++ N+
Sbjct  47   GKCPRDALKLGVCANVLGLIKAKVGVPP----AEPCCPLLEGLVDLEAAVCLCTAIRGNI  102

Query  450  PQI-VDVNLTVSLALKVCNRNIPLNAIKC  533
              I +++ + +SL L  C + +P    KC
Sbjct  103  LGINLNLPVDLSLILNYCGKRVP-TGFKC  130



>ref|NP_001053511.1| Os04g0554500 [Oryza sativa Japonica Group]
 emb|CAE01698.2| OSJNBa0010H02.22 [Oryza sativa Japonica Group]
 gb|AAR30140.1| lipid transfer protein-like protein [Oryza sativa Japonica Group]
 dbj|BAF15425.1| Os04g0554500 [Oryza sativa Japonica Group]
 gb|EAY95109.1| hypothetical protein OsI_16926 [Oryza sativa Indica Group]
Length=130

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 54/89 (61%), Gaps = 6/89 (7%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRTVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKANL  449
            G CP++ L+L VC ++L  + A VG+PP      PCC L+  LVDLEA +CLC  ++ N+
Sbjct  47   GKCPRDALKLGVCANVLGLIKAKVGVPP----AEPCCPLLEGLVDLEAAVCLCTAIRGNI  102

Query  450  PQI-VDVNLTVSLALKVCNRNIPLNAIKC  533
              I +++ + +SL L  C + +P    KC
Sbjct  103  LGINLNLPVDLSLILNYCGKRVP-TGFKC  130



>ref|XP_010539640.1| PREDICTED: lipid transfer protein EARLI 1-like [Tarenaya hassleriana]
Length=133

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 59/90 (66%), Gaps = 7/90 (8%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CP++ L+L +C+++L+  V   +G PP+    +PCCSLI  L DLEA  CLC ++KAN
Sbjct  48   GKCPRDTLKLGICLNVLKGLVDLQLGQPPV----KPCCSLIEGLADLEAAACLCTVLKAN  103

Query  447  LPQI-VDVNLTVSLALKVCNRNIPLNAIKC  533
            +  + ++V +++SL L VC R  P +  KC
Sbjct  104  VLGLKLNVPVSLSLLLNVCKRKAP-SGFKC  132



>ref|XP_002874778.1| hypothetical protein ARALYDRAFT_911651 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51037.1| hypothetical protein ARALYDRAFT_911651 [Arabidopsis lyrata subsp. 
lyrata]
Length=129

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 55/85 (65%), Gaps = 6/85 (7%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKA  443
             G CP++ L+L VC ++L+ +    +G PP+    +PCCSL+  LVDLEA  CLC  +KA
Sbjct  43   TGSCPRDTLKLGVCANVLKDLLKIQLGTPPV----KPCCSLLKGLVDLEAAACLCTALKA  98

Query  444  N-LPQIVDVNLTVSLALKVCNRNIP  515
            N L   ++V +++SL L VC R +P
Sbjct  99   NVLGTKLNVPVSLSLLLNVCGRKVP  123



>ref|XP_010264240.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nelumbo nucifera]
Length=132

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 53/85 (62%), Gaps = 8/85 (9%)
 Frame = +3

Query  270  GICPKNRLQLHVCVDLLR-TVGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKAN  446
            G CP++ L+L VC  LL   VGA VG PP      PCC+L+  LVDLE   CLC  +KAN
Sbjct  47   GSCPRDALKLGVCAKLLNGAVGAEVGNPP----DHPCCTLLEGLVDLEVAACLCTAIKAN  102

Query  447  LPQIVDVNLTVSLALKV--CNRNIP  515
            +  I ++N+ VSL+L V  C + +P
Sbjct  103  ILGI-NLNIPVSLSLLVNTCGKKLP  126



>ref|XP_008648736.1| PREDICTED: pEARLI1-like lipid transfer protein 2 [Zea mays]
 gb|AFW75218.1| hypothetical protein ZEAMMB73_070531 [Zea mays]
Length=133

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 55/91 (60%), Gaps = 7/91 (8%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRT-VGATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKA  443
            +G CP N ++L VC D+L   + A VG PP      PCCSLI+ L DL+A +C+CL + A
Sbjct  47   DGKCPVNAVKLGVCADVLDGLIHAVVGGPP----KEPCCSLISGLADLDAAVCVCLAINA  102

Query  444  NLPQI-VDVNLTVSLALKVCNRNIPLNAIKC  533
            N+  + +DV + +SL +  C R +P    KC
Sbjct  103  NILGVNLDVAVDLSLLVNYCGRRVPAG-FKC  132



>ref|XP_009782252.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=133

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 58/92 (63%), Gaps = 7/92 (8%)
 Frame = +3

Query  267  NGICPKNRLQLHVCVDLLRTV-GATVGLPPLNGSTRPCCSLIARLVDLEATLCLCLIVKA  443
             G CP + L+L VC ++L  +   T+G PP+    +PCCSLI  LVDLEA +CLC  +KA
Sbjct  47   GGKCPTDALKLGVCANVLNGLLNVTLGTPPV----KPCCSLIGNLVDLEAAVCLCTALKA  102

Query  444  NLPQI-VDVNLTVSLALKVCNRNIPLNAIKCP  536
            N+  I +++ ++++L L VC++  P     CP
Sbjct  103  NILSINLNLPISLNLLLNVCSKKAP-KGFTCP  133



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1222808918166