BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24056_g4_i1 len=1263 path=[1:0-91 93:92-129 131:130-143 145:144-179
181:180-232 234:233-235 237:236-282 7722:283-291 293:292-430
432:431-455 457:456-461 463:462-507 509:508-659 661:660-684
686:685-862 864:863-901 903:902-1015 1017:1016-1044 1046:1045-1262]

Length=1263
                                                                      Score     E

ref|XP_009612081.1|  PREDICTED: trans-resveratrol di-O-methyltran...    404   2e-135   
ref|XP_002278211.1|  PREDICTED: trans-resveratrol di-O-methyltran...    403   7e-135   Vitis vinifera
ref|XP_002278294.1|  PREDICTED: trans-resveratrol di-O-methyltran...    402   3e-134   Vitis vinifera
emb|CAN61955.1|  hypothetical protein VITISV_020020                     401   4e-134   Vitis vinifera
emb|CAN78992.1|  hypothetical protein VITISV_005827                     399   4e-133   Vitis vinifera
ref|XP_002278190.1|  PREDICTED: trans-resveratrol di-O-methyltran...    398   1e-132   Vitis vinifera
ref|XP_009779391.1|  PREDICTED: trans-resveratrol di-O-methyltran...    397   3e-132   
ref|XP_003633245.1|  PREDICTED: trans-resveratrol di-O-methyltran...    396   6e-132   
ref|XP_003633248.1|  PREDICTED: trans-resveratrol di-O-methyltran...    394   2e-131   
ref|XP_003633249.1|  PREDICTED: trans-resveratrol di-O-methyltran...    393   6e-131   
ref|XP_002326036.2|  hypothetical protein POPTR_0019s12290g             393   6e-131   Populus trichocarpa [western balsam poplar]
ref|XP_009778350.1|  PREDICTED: trans-resveratrol di-O-methyltran...    393   7e-131   
ref|XP_009605623.1|  PREDICTED: myricetin O-methyltransferase-like      393   1e-130   
emb|CAQ76879.1|  resveratrol O-methyltransferase                        392   2e-130   Vitis vinifera
gb|AEF97347.1|  O-methyltransferase                                     392   2e-130   
ref|XP_002281368.2|  PREDICTED: trans-resveratrol di-O-methyltran...    391   5e-130   Vitis vinifera
ref|XP_011002662.1|  PREDICTED: trans-resveratrol di-O-methyltran...    390   1e-129   
ref|XP_002278316.1|  PREDICTED: trans-resveratrol di-O-methyltran...    389   3e-129   Vitis vinifera
ref|XP_011002663.1|  PREDICTED: trans-resveratrol di-O-methyltran...    389   4e-129   
ref|XP_002277927.2|  PREDICTED: trans-resveratrol di-O-methyltran...    387   2e-128   Vitis vinifera
ref|XP_011002666.1|  PREDICTED: trans-resveratrol di-O-methyltran...    387   2e-128   
ref|XP_002278517.1|  PREDICTED: trans-resveratrol di-O-methyltran...    386   3e-128   Vitis vinifera
ref|XP_002274019.2|  PREDICTED: trans-resveratrol di-O-methyltran...    385   6e-128   Vitis vinifera
sp|B6VJS4.2|ROMT_VITVI  RecName: Full=Trans-resveratrol di-O-meth...    385   1e-127   Vitis vinifera
gb|AEC13057.1|  orcinol O-methyltransferase-like protein                385   2e-127   
emb|CAN69333.1|  hypothetical protein VITISV_003273                     384   2e-127   Vitis vinifera
emb|CDP15886.1|  unnamed protein product                                384   2e-127   
emb|CAN79968.1|  hypothetical protein VITISV_043678                     384   3e-127   Vitis vinifera
ref|XP_004303127.1|  PREDICTED: trans-resveratrol di-O-methyltran...    384   4e-127   
gb|AFX68805.1|  O-metyltransferase                                      384   4e-127   
ref|XP_006357086.1|  PREDICTED: tabersonine 16-O-methyltransferas...    383   7e-127   
ref|XP_009625456.1|  PREDICTED: trans-resveratrol di-O-methyltran...    383   7e-127   
ref|XP_009780812.1|  PREDICTED: myricetin O-methyltransferase-like      382   9e-127   
emb|CDP19709.1|  unnamed protein product                                382   1e-126   
ref|XP_003527407.1|  PREDICTED: trans-resveratrol di-O-methyltran...    382   1e-126   
gb|ABQ02270.2|  O-methyltransferase                                     382   1e-126   Vitis vinifera
ref|XP_002278398.1|  PREDICTED: trans-resveratrol di-O-methyltran...    382   2e-126   Vitis vinifera
ref|NP_001267963.1|  O-methyltransferase                                381   3e-126   
ref|NP_001268044.1|  trans-resveratrol di-O-methyltransferase           381   3e-126   
ref|XP_006365444.1|  PREDICTED: trans-resveratrol di-O-methyltran...    380   5e-126   
ref|XP_002278149.1|  PREDICTED: trans-resveratrol di-O-methyltran...    380   1e-125   Vitis vinifera
ref|XP_008229109.1|  PREDICTED: trans-resveratrol di-O-methyltran...    380   1e-125   
ref|XP_002278057.1|  PREDICTED: trans-resveratrol di-O-methyltran...    379   2e-125   Vitis vinifera
ref|XP_003544912.1|  PREDICTED: trans-resveratrol di-O-methyltran...    379   3e-125   
gb|KDP24061.1|  hypothetical protein JCGZ_25718                         378   7e-125   
ref|XP_002262833.1|  PREDICTED: trans-resveratrol di-O-methyltran...    378   8e-125   Vitis vinifera
emb|CAN83014.1|  hypothetical protein VITISV_029725                     377   1e-124   Vitis vinifera
ref|XP_006469135.1|  PREDICTED: trans-resveratrol di-O-methyltran...    379   1e-124   
ref|XP_006368013.1|  PREDICTED: trans-resveratrol di-O-methyltran...    377   2e-124   
emb|CAN73269.1|  hypothetical protein VITISV_021917                     377   2e-124   Vitis vinifera
gb|AAM23004.1|AF502433_1  orcinol O-methyltransferase                   376   5e-124   Rosa hybrid cultivar
ref|XP_004490696.1|  PREDICTED: trans-resveratrol di-O-methyltran...    375   9e-124   
ref|XP_003544914.1|  PREDICTED: trans-resveratrol di-O-methyltran...    375   1e-123   
ref|XP_006446728.1|  hypothetical protein CICLE_v10015708mg             375   1e-123   
ref|XP_003557042.1|  PREDICTED: trans-resveratrol di-O-methyltran...    374   2e-123   
ref|XP_002517827.1|  o-methyltransferase, putative                      374   3e-123   Ricinus communis
gb|AAM23005.1|AF502434_1  orcinol O-methyltransferase                   374   3e-123   Rosa hybrid cultivar
ref|XP_007043718.1|  Flavonoid o-methyltransferase related              374   3e-123   
ref|XP_008245137.1|  PREDICTED: trans-resveratrol di-O-methyltran...    373   4e-123   
ref|XP_002525159.1|  o-methyltransferase, putative                      373   4e-123   Ricinus communis
ref|XP_006428632.1|  hypothetical protein CICLE_v10012033mg             374   4e-123   
ref|XP_004229155.1|  PREDICTED: myricetin O-methyltransferase-lik...    372   1e-122   
ref|XP_008229108.1|  PREDICTED: trans-resveratrol di-O-methyltran...    372   2e-122   
ref|XP_006480453.1|  PREDICTED: trans-resveratrol di-O-methyltran...    371   3e-122   
ref|XP_010088036.1|  8-hydroxyquercetin 8-O-methyltransferase           370   8e-122   
emb|CAJ65638.1|  putative orcinol O-methyltransferase                   369   9e-122   Rosa hugonis
emb|CAJ65632.1|  putative orcinol O-methyltransferase                   369   1e-121   Rosa odorata var. gigantea
ref|XP_006346268.1|  PREDICTED: trans-resveratrol di-O-methyltran...    369   1e-121   
emb|CAJ65607.1|  putative orcinol O-methyltransferase                   369   1e-121   Rosa beggeriana
emb|CAJ65602.1|  putative orcinol O-methyltransferase                   369   1e-121   Rosa banksiae
ref|XP_006351391.1|  PREDICTED: trans-resveratrol di-O-methyltran...    369   2e-121   
emb|CAJ65641.1|  putative orcinol O-methyltransferase                   369   2e-121   Rosa marretii
emb|CAJ65609.1|  putative orcinol O-methyltransferase                   369   2e-121   Rosa bracteata [Macartny rose]
emb|CAJ65663.1|  putative orcinol O-methyltransferase                   368   3e-121   Rosa odorata [tea rose]
emb|CAJ65628.1|  putative orcinol O-methyltransferase                   368   3e-121   Rosa odorata var. gigantea
emb|CAJ65601.1|  putative orcinol O-methyltransferase                   368   3e-121   Rosa chinensis [China rose]
emb|CAJ65624.1|  putative orcinol O-methyltransferase                   368   3e-121   Rosa gallica [apothecary rose]
emb|CAJ65630.1|  putative orcinol O-methyltransferase                   368   3e-121   Rosa odorata var. gigantea
emb|CAH05081.1|  putative orcinol O-methyltransferase                   368   4e-121   Rosa hybrid cultivar
emb|CAJ65621.1|  putative orcinol O-methyltransferase                   368   4e-121   Rosa gallica [apothecary rose]
emb|CAH05089.1|  putative orcinol O-methyltransferase                   368   4e-121   Rosa odorata var. gigantea
emb|CAJ65665.1|  putative orcinol O-methyltransferase                   368   5e-121   Rosa odorata [tea rose]
emb|CAJ65640.1|  putative orcinol O-methyltransferase                   367   5e-121   Rosa majalis [cinnamon rose]
emb|CAJ65626.1|  putative orcinol O-methyltransferase                   367   8e-121   Rosa gallica [apothecary rose]
ref|XP_006365443.1|  PREDICTED: trans-resveratrol di-O-methyltran...    367   8e-121   
emb|CAJ65623.1|  putative orcinol O-methyltransferase                   367   8e-121   Rosa gallica [apothecary rose]
gb|ABK96707.1|  unknown                                                 367   9e-121   Populus trichocarpa x Populus deltoides
gb|AFK40900.1|  unknown                                                 367   1e-120   
emb|CAH05084.1|  orcinol O-methyltransferase 3                          367   1e-120   Rosa hybrid cultivar
emb|CAJ65612.1|  putative orcinol O-methyltransferase                   367   1e-120   Rosa canina [dog briar]
ref|XP_007142076.1|  hypothetical protein PHAVU_008G250600g             367   1e-120   
ref|XP_009780941.1|  PREDICTED: trans-resveratrol di-O-methyltran...    367   1e-120   
emb|CAJ65622.1|  putative orcinol O-methyltransferase                   366   1e-120   Rosa gallica [apothecary rose]
emb|CAJ65642.1|  putative orcinol O-methyltransferase                   366   2e-120   Rosa marretii
emb|CAD29556.1|  orcinol O-methyltransferase                            366   2e-120   Rosa hybrid cultivar
emb|CAJ65625.1|  putative orcinol O-methyltransferase                   366   2e-120   Rosa gallica [apothecary rose]
emb|CAJ65598.1|  putative orcinol O-methyltransferase                   365   3e-120   Rosa chinensis [China rose]
emb|CAJ65648.1|  putative orcinol O-methyltransferase                   365   3e-120   Rosa woodsii var. ultramontana
emb|CAJ65603.1|  putative orcinol O-methyltransferase                   365   3e-120   Rosa banksiae
emb|CAH05082.1|  putative orcinol O-methyltransferase                   365   3e-120   Rosa hybrid cultivar
emb|CAH05087.1|  orcinol O-methyltransferase 4                          365   4e-120   Rosa hybrid cultivar
ref|XP_006376396.1|  hypothetical protein POPTR_0013s12670g             366   4e-120   
emb|CAJ65618.1|  putative orcinol O-methyltransferase                   365   4e-120   Rosa chinensis var. spontanea
emb|CAJ65613.1|  putative orcinol O-methyltransferase                   365   4e-120   Rosa chinensis var. spontanea
emb|CAJ65635.1|  putative orcinol O-methyltransferase                   365   4e-120   Rosa odorata var. gigantea
emb|CAJ65639.1|  putative orcinol O-methyltransferase                   365   4e-120   Rosa hugonis
ref|XP_004235335.1|  PREDICTED: trans-resveratrol di-O-methyltran...    369   5e-120   
emb|CAJ65604.1|  putative orcinol O-methyltransferase                   365   6e-120   Rosa beggeriana
ref|XP_006469069.1|  PREDICTED: trans-resveratrol di-O-methyltran...    365   6e-120   
emb|CAJ65645.1|  putative orcinol O-methyltransferase                   364   8e-120   Rosa roxburghii [chestnut rose]
emb|CAJ65647.1|  putative orcinol O-methyltransferase                   364   1e-119   Rosa rugosa [Japanese rose]
ref|XP_009764108.1|  PREDICTED: trans-resveratrol di-O-methyltran...    365   1e-119   
emb|CAJ65610.1|  putative orcinol O-methyltransferase                   364   1e-119   Rosa canina [dog briar]
emb|CAJ65664.1|  putative orcinol O-methyltransferase                   364   1e-119   Rosa odorata [tea rose]
emb|CAH05091.1|  putative orcinol O-methyltransferase                   364   1e-119   Rosa odorata var. gigantea
emb|CAJ65655.1|  putative orcinol O-methyltransferase                   364   1e-119   Rosa lucieae [memorial rose]
emb|CAJ65597.1|  putative orcinol O-methyltransferase                   364   1e-119   Rosa chinensis [China rose]
emb|CAJ65608.1|  putative orcinol O-methyltransferase                   364   1e-119   Rosa bracteata [Macartny rose]
emb|CAJ65620.1|  putative orcinol O-methyltransferase                   363   2e-119   Rosa chinensis var. spontanea
ref|XP_007142077.1|  hypothetical protein PHAVU_008G250700g             364   2e-119   
emb|CAJ65646.1|  putative orcinol O-methyltransferase                   363   2e-119   Rosa rugosa [Japanese rose]
emb|CAJ65606.1|  putative orcinol O-methyltransferase                   363   2e-119   Rosa beggeriana
emb|CAJ65633.1|  putative orcinol O-methyltransferase                   363   2e-119   Rosa odorata var. gigantea
emb|CAJ65656.1|  putative orcinol O-methyltransferase                   363   3e-119   Rosa odorata [tea rose]
ref|XP_006446726.1|  hypothetical protein CICLE_v10015705mg             363   3e-119   
emb|CAJ65661.1|  putative orcinol O-methyltransferase                   363   4e-119   Rosa odorata [tea rose]
emb|CAH05079.1|  putative orcinol O-methyltransferase                   363   4e-119   Rosa gallica [apothecary rose]
emb|CAH05080.1|  putative orcinol O-methyltransferase                   363   4e-119   Rosa gallica [apothecary rose]
emb|CAJ65634.1|  putative orcinol O-methyltransferase                   362   6e-119   Rosa odorata var. gigantea
ref|XP_002525160.1|  o-methyltransferase, putative                      362   6e-119   Ricinus communis
gb|ABZ89567.1|  O-methyltransferase 3                                   363   6e-119   Humulus lupulus [common hop]
ref|XP_006376386.1|  hypothetical protein POPTR_0013s12560g             362   7e-119   
emb|CAH05085.1|  orcinol O-methyltransferase 3                          362   8e-119   Rosa hybrid cultivar
emb|CAH05083.1|  putative orcinol O-methyltransferase                   362   8e-119   Rosa hybrid cultivar
emb|CAJ65615.1|  putative orcinol O-methyltransferase                   362   8e-119   Rosa chinensis var. spontanea
emb|CAH05086.1|  orcinol O-methyltransferase 4                          362   1e-118   Rosa hybrid cultivar
emb|CAD29555.1|  orcinol O-methyltransferase                            362   1e-118   Rosa hybrid cultivar
emb|CAJ65605.1|  putative orcinol O-methyltransferase                   362   1e-118   Rosa beggeriana
gb|AAB71213.1|  methyltransferase                                       362   1e-118   Prunus armeniaca
emb|CAJ65629.1|  putative orcinol O-methyltransferase                   361   2e-118   Rosa odorata var. gigantea
emb|CAH05090.1|  putative orcinol O-methyltransferase                   361   2e-118   Rosa odorata var. gigantea
gb|KHN07780.1|  Tabersonine 16-O-methyltransferase                      360   2e-118   
emb|CAJ65614.1|  putative orcinol O-methyltransferase                   361   2e-118   Rosa chinensis var. spontanea
emb|CAH05088.1|  putative orcinol O-methyltransferase                   360   3e-118   Rosa odorata var. gigantea
emb|CAJ65649.1|  putative orcinol O-methyltransferase                   360   3e-118   Rosa woodsii var. ultramontana
ref|XP_006376381.1|  6a-hydroxymaackiain methyltransferase family...    361   3e-118   
emb|CAJ65611.1|  putative orcinol O-methyltransferase                   360   4e-118   Rosa canina [dog briar]
ref|XP_009594948.1|  PREDICTED: trans-resveratrol di-O-methyltran...    360   4e-118   
ref|XP_009618299.1|  PREDICTED: trans-resveratrol di-O-methyltran...    360   5e-118   
emb|CAJ65599.1|  putative orcinol O-methyltransferase                   360   5e-118   Rosa chinensis [China rose]
emb|CAJ65659.1|  putative orcinol O-methyltransferase                   360   6e-118   Rosa odorata [tea rose]
emb|CDP19711.1|  unnamed protein product                                360   6e-118   
emb|CAJ65643.1|  putative orcinol O-methyltransferase                   359   8e-118   Rosa marretii
emb|CAJ65627.1|  putative orcinol O-methyltransferase                   359   8e-118   Rosa odorata var. gigantea
ref|XP_006376388.1|  6a-hydroxymaackiain methyltransferase family...    360   9e-118   
ref|XP_004241912.1|  PREDICTED: trans-resveratrol di-O-methyltran...    359   1e-117   
ref|XP_006469137.1|  PREDICTED: trans-resveratrol di-O-methyltran...    360   1e-117   
emb|CAJ65631.1|  putative orcinol O-methyltransferase                   359   1e-117   Rosa odorata var. gigantea
gb|AES89720.2|  orcinol O-methyltransferase                             359   1e-117   
emb|CDP15888.1|  unnamed protein product                                359   1e-117   
ref|XP_009602136.1|  PREDICTED: trans-resveratrol di-O-methyltran...    359   2e-117   
ref|XP_002522501.1|  o-methyltransferase, putative                      358   3e-117   Ricinus communis
emb|CAJ65636.1|  putative orcinol O-methyltransferase                   358   3e-117   Rosa odorata var. gigantea
emb|CAJ65616.1|  putative orcinol O-methyltransferase                   357   5e-117   Rosa chinensis var. spontanea
gb|ADZ76434.1|  myricetin O-methyltransferase 2                         357   6e-117   
ref|XP_004241914.1|  PREDICTED: myricetin O-methyltransferase-like      357   7e-117   
emb|CAA11131.1|  O-methyltransferase                                    357   7e-117   Prunus dulcis [sweet almond]
emb|CAJ65600.1|  putative orcinol O-methyltransferase                   357   1e-116   Rosa chinensis [China rose]
ref|XP_003615966.1|  O-methyltransferase                                357   1e-116   
ref|XP_003607523.1|  O-methyltransferase                                357   2e-116   
emb|CDP19713.1|  unnamed protein product                                356   2e-116   
emb|CAJ65617.1|  putative orcinol O-methyltransferase                   356   2e-116   Rosa chinensis var. spontanea
emb|CAJ65637.1|  putative orcinol O-methyltransferase                   355   3e-116   Rosa odorata var. gigantea
ref|XP_006356531.1|  PREDICTED: trans-resveratrol di-O-methyltran...    355   4e-116   
gb|KHN08844.1|  8-hydroxyquercetin 8-O-methyltransferase                354   5e-116   
ref|XP_004505627.1|  PREDICTED: trans-resveratrol di-O-methyltran...    356   5e-116   
emb|CAJ65657.1|  putative orcinol O-methyltransferase                   355   6e-116   Rosa odorata [tea rose]
ref|XP_011016237.1|  PREDICTED: trans-resveratrol di-O-methyltran...    355   7e-116   
emb|CAJ65660.1|  putative orcinol O-methyltransferase                   354   9e-116   Rosa odorata [tea rose]
ref|XP_007142043.1|  hypothetical protein PHAVU_008G247600g             354   1e-115   
ref|XP_010093978.1|  Tabersonine 16-O-methyltransferase                 355   1e-115   
sp|B0EXJ8.1|HTOMT_CATRO  RecName: Full=Tabersonine 16-O-methyltra...    354   1e-115   Catharanthus roseus [chatas]
ref|XP_006376392.1|  hypothetical protein POPTR_0013s12620g             353   2e-115   
ref|XP_011037437.1|  PREDICTED: trans-resveratrol di-O-methyltran...    353   3e-115   
ref|XP_006356529.1|  PREDICTED: trans-resveratrol di-O-methyltran...    353   4e-115   
emb|CAJ65596.1|  putative orcinol O-methyltransferase                   352   5e-115   Rosa chinensis [China rose]
emb|CDP21836.1|  unnamed protein product                                353   5e-115   
ref|XP_007132709.1|  hypothetical protein PHAVU_011G118100g             352   6e-115   
ref|XP_004490686.1|  PREDICTED: trans-resveratrol di-O-methyltran...    352   6e-115   
ref|XP_003615973.1|  O-methyltransferase                                352   7e-115   
ref|XP_006366298.1|  PREDICTED: trans-resveratrol di-O-methyltran...    352   1e-114   
emb|CAJ65662.1|  putative orcinol O-methyltransferase                   351   2e-114   Rosa odorata [tea rose]
emb|CDP21787.1|  unnamed protein product                                351   2e-114   
emb|CAN70493.1|  hypothetical protein VITISV_002330                     350   4e-114   Vitis vinifera
ref|XP_004490687.1|  PREDICTED: trans-resveratrol di-O-methyltran...    350   4e-114   
ref|XP_003615967.1|  O-methyltransferase                                350   4e-114   
emb|CAJ65666.1|  putative orcinol O-methyltransferase                   350   4e-114   Rosa odorata [tea rose]
dbj|BAI79244.1|  O-methyltransferase                                    350   6e-114   Carapichea ipecacuanha [ipecac]
ref|XP_006356530.1|  PREDICTED: trans-resveratrol di-O-methyltran...    350   6e-114   
ref|XP_002278092.1|  PREDICTED: trans-resveratrol di-O-methyltran...    350   7e-114   Vitis vinifera
dbj|BAJ05387.1|  O-methyltransferase                                    349   1e-113   
ref|XP_011037442.1|  PREDICTED: trans-resveratrol di-O-methyltran...    348   2e-113   
emb|CDP19840.1|  unnamed protein product                                348   3e-113   
ref|XP_006388573.1|  hypothetical protein POPTR_0151s00210g             348   3e-113   
dbj|BAJ72588.1|  7'-O-demethylcephaeline/cephaeline O-methyltrans...    348   4e-113   
dbj|BAJ05384.1|  O-methyltransferase                                    347   5e-113   
ref|XP_011100233.1|  PREDICTED: 8-hydroxyquercetin 8-O-methyltran...    347   5e-113   
ref|XP_002305103.1|  6a-hydroxymaackiain methyltransferase family...    347   5e-113   Populus trichocarpa [western balsam poplar]
ref|XP_006474725.1|  PREDICTED: trans-resveratrol di-O-methyltran...    347   7e-113   
ref|XP_006346269.1|  PREDICTED: trans-resveratrol di-O-methyltran...    347   8e-113   
emb|CAN69556.1|  hypothetical protein VITISV_027590                     346   8e-113   Vitis vinifera
ref|XP_006469138.1|  PREDICTED: trans-resveratrol di-O-methyltran...    353   8e-113   
gb|KDP21023.1|  hypothetical protein JCGZ_21494                         345   3e-112   
ref|XP_009593020.1|  PREDICTED: trans-resveratrol di-O-methyltran...    345   4e-112   
ref|XP_004248183.1|  PREDICTED: trans-resveratrol di-O-methyltran...    344   1e-111   
ref|XP_006377432.1|  6a-hydroxymaackiain methyltransferase family...    344   2e-111   
gb|KDO73905.1|  hypothetical protein CISIN_1g017835mg                   343   3e-111   
ref|XP_010320673.1|  PREDICTED: trans-resveratrol di-O-methyltran...    342   5e-111   
ref|XP_011001214.1|  PREDICTED: trans-resveratrol di-O-methyltran...    343   7e-111   
ref|XP_010110664.1|  8-hydroxyquercetin 8-O-methyltransferase           342   8e-111   
sp|Q8GSN1.1|MOMT_CATRO  RecName: Full=Myricetin O-methyltransfera...    341   1e-110   Catharanthus roseus [chatas]
ref|XP_011027757.1|  PREDICTED: trans-resveratrol di-O-methyltran...    341   1e-110   
gb|KDP35397.1|  hypothetical protein JCGZ_10381                         341   2e-110   
emb|CDP21661.1|  unnamed protein product                                341   2e-110   
ref|XP_011085377.1|  PREDICTED: chavicol O-methyltransferase-like       341   2e-110   
ref|XP_006452811.1|  hypothetical protein CICLE_v10008718mg             341   2e-110   
ref|XP_004151735.1|  PREDICTED: trans-resveratrol di-O-methyltran...    340   3e-110   
ref|XP_004169298.1|  PREDICTED: trans-resveratrol di-O-methyltran...    340   3e-110   
ref|XP_011100228.1|  PREDICTED: trans-resveratrol di-O-methyltran...    340   4e-110   
emb|CAN73270.1|  hypothetical protein VITISV_021918                     338   1e-109   Vitis vinifera
ref|XP_011091580.1|  PREDICTED: trans-resveratrol di-O-methyltran...    338   2e-109   
ref|XP_002517832.1|  o-methyltransferase, putative                      338   2e-109   Ricinus communis
gb|AAR02421.1|  putative O-methyltransferase                            338   2e-109   Catharanthus roseus [chatas]
ref|XP_002278208.2|  PREDICTED: trans-resveratrol di-O-methyltran...    338   5e-109   Vitis vinifera
ref|XP_008783119.1|  PREDICTED: trans-resveratrol di-O-methyltran...    337   5e-109   
ref|XP_010320677.1|  PREDICTED: trans-resveratrol di-O-methyltran...    336   6e-109   
ref|XP_010097399.1|  8-hydroxyquercetin 8-O-methyltransferase           338   8e-109   
ref|XP_003527405.1|  PREDICTED: trans-resveratrol di-O-methyltran...    337   9e-109   
gb|KGN43480.1|  hypothetical protein Csa_7G039280                       337   1e-108   
ref|XP_006446725.1|  hypothetical protein CICLE_v10015630mg             337   1e-108   
ref|XP_011037440.1|  PREDICTED: trans-resveratrol di-O-methyltran...    335   2e-108   
emb|CBI22005.3|  unnamed protein product                                334   2e-108   
ref|XP_006469063.1|  PREDICTED: trans-resveratrol di-O-methyltran...    336   3e-108   
ref|XP_011100227.1|  PREDICTED: 8-hydroxyquercetin 8-O-methyltran...    335   4e-108   
gb|KDP24062.1|  hypothetical protein JCGZ_25719                         335   5e-108   
ref|XP_010260367.1|  PREDICTED: trans-resveratrol di-O-methyltran...    335   7e-108   
ref|XP_010110665.1|  8-hydroxyquercetin 8-O-methyltransferase           335   8e-108   
ref|XP_004303135.1|  PREDICTED: trans-resveratrol di-O-methyltran...    334   1e-107   
ref|XP_010920172.1|  PREDICTED: trans-resveratrol di-O-methyltran...    333   2e-107   
ref|XP_008779514.1|  PREDICTED: trans-resveratrol di-O-methyltran...    333   2e-107   
ref|XP_011091583.1|  PREDICTED: trans-resveratrol di-O-methyltran...    333   3e-107   
ref|XP_006364318.1|  PREDICTED: trans-resveratrol di-O-methyltran...    332   4e-107   
emb|CDP17644.1|  unnamed protein product                                332   5e-107   
ref|XP_006388414.1|  6a-hydroxymaackiain methyltransferase family...    332   5e-107   
ref|XP_010916033.1|  PREDICTED: trans-resveratrol di-O-methyltran...    332   5e-107   
ref|XP_002522586.1|  o-methyltransferase, putative                      332   5e-107   Ricinus communis
ref|XP_004232928.1|  PREDICTED: trans-resveratrol di-O-methyltran...    331   1e-106   
ref|XP_010040912.1|  PREDICTED: trans-resveratrol di-O-methyltran...    331   2e-106   
emb|CBI21921.3|  unnamed protein product                                328   3e-106   
ref|XP_010920173.1|  PREDICTED: trans-resveratrol di-O-methyltran...    330   3e-106   
gb|AJD20223.1|  norcoclaurine 6-O-methyltransferase                     330   3e-106   
gb|KCW89599.1|  hypothetical protein EUGRSUZ_A01884                     329   7e-106   
ref|XP_010070255.1|  PREDICTED: trans-resveratrol di-O-methyltran...    329   7e-106   
gb|KHN07781.1|  Tabersonine 16-O-methyltransferase                      329   7e-106   
ref|XP_008229106.1|  PREDICTED: trans-resveratrol di-O-methyltran...    330   1e-105   
dbj|BAI79245.1|  O-methyltransferase                                    328   1e-105   Carapichea ipecacuanha [ipecac]
ref|XP_003615968.1|  O-methyltransferase                                327   2e-105   
ref|XP_010052409.1|  PREDICTED: trans-resveratrol di-O-methyltran...    328   2e-105   
ref|XP_011077108.1|  PREDICTED: chavicol O-methyltransferase-like       328   2e-105   
ref|XP_008364164.1|  PREDICTED: trans-resveratrol di-O-methyltran...    328   3e-105   
dbj|BAJ05383.1|  O-methyltransferase                                    327   3e-105   
gb|AIY62760.1|  N-acetylserotonin O-methyltransferase                   328   3e-105   
ref|XP_004232927.1|  PREDICTED: trans-resveratrol di-O-methyltran...    328   3e-105   
gb|AEN94899.1|  desoxyhemigossypol-6-O-methyltransferase                328   3e-105   
gb|AAM97498.1|  O-methyltransferase                                     327   3e-105   Catharanthus roseus [chatas]
ref|XP_010058047.1|  PREDICTED: trans-resveratrol di-O-methyltran...    327   4e-105   
gb|KCW75545.1|  hypothetical protein EUGRSUZ_E04305                     327   5e-105   
ref|XP_011085639.1|  PREDICTED: chavicol O-methyltransferase-like       327   5e-105   
gb|KHG15351.1|  8-hydroxyquercetin 8-O-methyltransferase                327   6e-105   
dbj|BAJ05388.1|  O-methyltransferase                                    327   7e-105   
ref|XP_010093977.1|  Tabersonine 16-O-methyltransferase                 327   7e-105   
ref|XP_011092041.1|  PREDICTED: trans-resveratrol di-O-methyltran...    326   8e-105   
ref|XP_011091579.1|  PREDICTED: trans-resveratrol di-O-methyltran...    326   1e-104   
ref|XP_010058046.1|  PREDICTED: trans-resveratrol di-O-methyltran...    326   1e-104   
dbj|BAI79243.1|  O-methyltransferase                                    326   1e-104   
ref|XP_011091578.1|  PREDICTED: trans-resveratrol di-O-methyltran...    326   2e-104   
ref|XP_011070200.1|  PREDICTED: trans-resveratrol di-O-methyltran...    329   2e-104   
ref|XP_004293905.1|  PREDICTED: trans-resveratrol di-O-methyltran...    325   2e-104   
ref|XP_006582298.1|  PREDICTED: trans-resveratrol di-O-methyltran...    325   2e-104   
ref|XP_008364163.1|  PREDICTED: trans-resveratrol di-O-methyltran...    325   3e-104   
ref|XP_009597680.1|  PREDICTED: trans-resveratrol di-O-methyltran...    325   3e-104   
ref|XP_008455944.1|  PREDICTED: trans-resveratrol di-O-methyltran...    325   3e-104   
ref|XP_006388574.1|  hypothetical protein POPTR_0151s00220g             323   4e-104   
ref|XP_009345025.1|  PREDICTED: trans-resveratrol di-O-methyltran...    325   5e-104   
ref|XP_002278127.1|  PREDICTED: trans-resveratrol di-O-methyltran...    324   5e-104   
gb|ACV65500.1|  deoxyhemigossypol-6-O-methyltransferase                 325   5e-104   
ref|XP_007025515.1|  Flavonoid o-methyltransferase related, putative    325   1e-103   
gb|AAR09603.1|  O-methyltransferase                                     323   1e-103   
ref|XP_009351009.1|  PREDICTED: trans-resveratrol di-O-methyltran...    324   1e-103   
gb|AAR02417.1|  putative O-methyltransferase                            322   2e-103   
emb|CAN75971.1|  hypothetical protein VITISV_009882                     321   3e-103   
ref|XP_008455485.1|  PREDICTED: trans-resveratrol di-O-methyltran...    323   3e-103   
ref|XP_010916034.1|  PREDICTED: trans-resveratrol di-O-methyltran...    323   3e-103   
ref|XP_006364328.1|  PREDICTED: trans-resveratrol di-O-methyltran...    322   5e-103   
ref|XP_008788394.1|  PREDICTED: trans-resveratrol di-O-methyltran...    322   6e-103   
emb|CDP21583.1|  unnamed protein product                                320   7e-103   
emb|CAN75970.1|  hypothetical protein VITISV_009881                     321   1e-102   
ref|XP_010111159.1|  6a-hydroxymaackiain methyltransferase 1            323   1e-102   
gb|KDO75191.1|  hypothetical protein CISIN_1g018205mg                   320   2e-102   
gb|EYU30782.1|  hypothetical protein MIMGU_mgv1a021078mg                320   2e-102   
ref|XP_002441380.1|  hypothetical protein SORBIDRAFT_09g025570          320   4e-102   
ref|NP_001267964.1|  O-methyltransferase                                320   4e-102   
emb|CDP19839.1|  unnamed protein product                                319   4e-102   
ref|XP_010057350.1|  PREDICTED: trans-resveratrol di-O-methyltran...    321   5e-102   
gb|KCW74501.1|  hypothetical protein EUGRSUZ_E03213                     319   8e-102   
ref|XP_003536186.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    318   9e-102   
gb|ACY41220.1|  O-methyltransferase-like protein                        319   9e-102   
ref|XP_002522500.1|  o-methyltransferase, putative                      318   1e-101   
ref|XP_010920171.1|  PREDICTED: trans-resveratrol di-O-methyltran...    318   1e-101   
gb|KDP24060.1|  hypothetical protein JCGZ_25717                         318   1e-101   
ref|XP_009344934.1|  PREDICTED: trans-resveratrol di-O-methyltran...    318   1e-101   
ref|XP_004151906.1|  PREDICTED: trans-resveratrol di-O-methyltran...    318   2e-101   
ref|XP_010920170.1|  PREDICTED: trans-resveratrol di-O-methyltran...    318   2e-101   
ref|XP_004163430.1|  PREDICTED: LOW QUALITY PROTEIN: trans-resver...    317   2e-101   
ref|XP_008788395.1|  PREDICTED: trans-resveratrol di-O-methyltran...    318   3e-101   
ref|XP_002517833.1|  o-methyltransferase, putative                      318   3e-101   
gb|AGQ21572.1|  flavone 8-O-methyltransferase                           317   4e-101   
ref|XP_010109381.1|  Tabersonine 16-O-methyltransferase                 316   9e-101   
ref|XP_004975403.1|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...    316   9e-101   
ref|XP_004158564.1|  PREDICTED: LOW QUALITY PROTEIN: trans-resver...    316   9e-101   
ref|XP_010057351.1|  PREDICTED: trans-resveratrol di-O-methyltran...    316   2e-100   
ref|XP_002517835.1|  o-methyltransferase, putative                      315   2e-100   
ref|XP_008343875.1|  PREDICTED: trans-resveratrol di-O-methyltran...    316   3e-100   
ref|XP_006489814.1|  PREDICTED: trans-resveratrol di-O-methyltran...    315   3e-100   
gb|AAX82431.1|  3,5-dimethoxyphenol O-methyltransferase                 315   3e-100   
ref|XP_006471149.1|  PREDICTED: trans-resveratrol di-O-methyltran...    315   4e-100   
gb|KDP35391.1|  hypothetical protein JCGZ_10375                         314   4e-100   
ref|XP_006469136.1|  PREDICTED: trans-resveratrol di-O-methyltran...    315   4e-100   
ref|XP_010111158.1|  Tabersonine 16-O-methyltransferase                 315   4e-100   
gb|KDP21022.1|  hypothetical protein JCGZ_21493                         314   5e-100   
gb|AAR02419.1|  flavonoid 4'-O-methyltransferase                        314   6e-100   
ref|XP_010916035.1|  PREDICTED: trans-resveratrol di-O-methyltran...    314   7e-100   
ref|XP_010023968.1|  PREDICTED: trans-resveratrol di-O-methyltran...    313   1e-99    
gb|KCW74500.1|  hypothetical protein EUGRSUZ_E03212                     313   2e-99    
ref|XP_006468348.1|  PREDICTED: trans-resveratrol di-O-methyltran...    313   2e-99    
ref|XP_006448856.1|  hypothetical protein CICLE_v10015723mg             313   2e-99    
ref|XP_003615962.1|  O-methyltransferase                                312   2e-99    
ref|XP_004170024.1|  PREDICTED: trans-resveratrol di-O-methyltran...    313   3e-99    
ref|XP_003536187.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    312   3e-99    
ref|XP_004139733.1|  PREDICTED: LOW QUALITY PROTEIN: trans-resver...    313   4e-99    
ref|XP_002517834.1|  o-methyltransferase, putative                      312   4e-99    
ref|XP_007025514.1|  Flavonoid o-methyltransferase related              311   7e-99    
ref|XP_002305104.2|  6a-hydroxymaackiain methyltransferase family...    311   8e-99    
ref|XP_011027758.1|  PREDICTED: trans-resveratrol di-O-methyltran...    311   8e-99    
ref|XP_004139732.1|  PREDICTED: trans-resveratrol di-O-methyltran...    311   9e-99    
ref|XP_003536188.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    311   1e-98    
ref|XP_006420642.1|  hypothetical protein CICLE_v10005275mg             311   1e-98    
ref|XP_006420638.1|  hypothetical protein CICLE_v10005279mg             311   1e-98    
ref|XP_006364329.1|  PREDICTED: uncharacterized protein LOC102587683    324   1e-98    
ref|XP_006420643.1|  hypothetical protein CICLE_v10005276mg             310   2e-98    
gb|KDO39394.1|  hypothetical protein CISIN_1g021867mg                   308   3e-98    
ref|XP_009398848.1|  PREDICTED: trans-resveratrol di-O-methyltran...    309   3e-98    
gb|KCW44789.1|  hypothetical protein EUGRSUZ_L01645                     309   5e-98    
ref|XP_004249745.2|  PREDICTED: trans-resveratrol di-O-methyltran...    307   6e-98    
ref|XP_008778546.1|  PREDICTED: trans-resveratrol di-O-methyltran...    309   7e-98    
ref|XP_008778275.1|  PREDICTED: trans-resveratrol di-O-methyltran...    308   1e-97    
ref|XP_008649874.1|  PREDICTED: O-methyltransferase ZRP4-like           308   1e-97    
ref|XP_010938927.1|  PREDICTED: trans-resveratrol di-O-methyltran...    307   2e-97    
ref|XP_008778001.1|  PREDICTED: trans-resveratrol di-O-methyltran...    307   3e-97    
ref|XP_009791021.1|  PREDICTED: trans-resveratrol di-O-methyltran...    308   3e-97    
ref|XP_004961502.1|  PREDICTED: O-methyltransferase ZRP4-like iso...    308   3e-97    
gb|KHN30531.1|  Isoflavone 7-O-methyltransferase                        306   3e-97    
ref|XP_008455943.1|  PREDICTED: trans-resveratrol di-O-methyltran...    308   5e-97    
ref|XP_011091734.1|  PREDICTED: trans-resveratrol di-O-methyltran...    305   6e-97    
gb|KCW74012.1|  hypothetical protein EUGRSUZ_E02637                     305   6e-97    
ref|XP_010093975.1|  Isoflavone-7-O-methyltransferase 8                 306   7e-97    
ref|XP_008354304.1|  PREDICTED: trans-resveratrol di-O-methyltran...    306   1e-96    
ref|XP_008343876.1|  PREDICTED: trans-resveratrol di-O-methyltran...    306   1e-96    
ref|XP_003556407.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    305   2e-96    
ref|XP_004252468.1|  PREDICTED: trans-resveratrol di-O-methyltran...    305   2e-96    
ref|XP_008807987.1|  PREDICTED: trans-resveratrol di-O-methyltran...    305   3e-96    
ref|XP_010052318.1|  PREDICTED: trans-resveratrol di-O-methyltran...    304   4e-96    
ref|XP_006371493.1|  hypothetical protein POPTR_0019s12280g             301   5e-96    
gb|ACU20151.1|  unknown                                                 303   7e-96    
ref|XP_003555535.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    303   1e-95    
dbj|BAA86059.1|  O-methyltransferase                                    304   1e-95    
ref|XP_008392935.1|  PREDICTED: trans-resveratrol di-O-methyltran...    304   1e-95    
ref|XP_010070166.1|  PREDICTED: trans-resveratrol di-O-methyltran...    303   1e-95    
ref|XP_006421002.1|  hypothetical protein CICLE_v10006550mg             303   2e-95    
ref|XP_008362623.1|  PREDICTED: trans-resveratrol di-O-methyltran...    303   2e-95    
gb|KDO40717.1|  hypothetical protein CISIN_1g037127mg                   301   2e-95    
ref|XP_009628719.1|  PREDICTED: trans-resveratrol di-O-methyltran...    302   2e-95    
ref|XP_004961504.1|  PREDICTED: O-methyltransferase ZRP4-like           302   3e-95    
ref|XP_002441376.1|  hypothetical protein SORBIDRAFT_09g025540          302   3e-95    
gb|KDP24057.1|  hypothetical protein JCGZ_25714                         300   3e-95    
ref|XP_010689977.1|  PREDICTED: trans-resveratrol di-O-methyltran...    302   3e-95    
ref|XP_010694747.1|  PREDICTED: trans-resveratrol di-O-methyltran...    302   4e-95    
gb|KHN30530.1|  Isoflavone 7-O-methyltransferase                        308   4e-95    
sp|Q6VMW0.1|Q8OMT_MENPI  RecName: Full=8-hydroxyquercetin 8-O-met...    302   4e-95    
ref|XP_004987341.1|  PREDICTED: O-methyltransferase ZRP4-like iso...    302   5e-95    
ref|XP_009597678.1|  PREDICTED: trans-resveratrol di-O-methyltran...    303   6e-95    
ref|XP_010023967.1|  PREDICTED: trans-resveratrol di-O-methyltran...    301   7e-95    
ref|XP_008359463.1|  PREDICTED: trans-resveratrol di-O-methyltran...    301   8e-95    
ref|XP_011091736.1|  PREDICTED: trans-resveratrol di-O-methyltran...    307   9e-95    
emb|CBI21929.3|  unnamed protein product                                298   1e-94    
gb|EYU30737.1|  hypothetical protein MIMGU_mgv1a009866mg                298   3e-94    
ref|XP_009396879.1|  PREDICTED: trans-resveratrol di-O-methyltran...    299   4e-94    
ref|XP_011001215.1|  PREDICTED: trans-resveratrol di-O-methyltran...    299   4e-94    
gb|KDO37374.1|  hypothetical protein CISIN_1g023625mg                   295   8e-94    
sp|Q93WU3.1|CVMT1_OCIBA  RecName: Full=Chavicol O-methyltransfera...    298   8e-94    
emb|CBI21931.3|  unnamed protein product                                295   8e-94    
ref|XP_008792251.1|  PREDICTED: trans-resveratrol di-O-methyltran...    298   9e-94    
gb|EMT10452.1|  O-methyltransferase ZRP4                                298   1e-93    
ref|NP_001175192.1|  Os07g0463600                                       297   3e-93    
gb|KDP35402.1|  hypothetical protein JCGZ_10386                         295   3e-93    
gb|ADO16249.1|  chavicol O-methyltransferase                            296   3e-93    
ref|XP_010057348.1|  PREDICTED: trans-resveratrol di-O-methyltran...    297   4e-93    
ref|XP_008649876.1|  PREDICTED: O-methyltransferase ZRP4-like           296   4e-93    
ref|XP_010093976.1|  Myricetin O-methyltransferase                      297   4e-93    
ref|XP_006377431.1|  6a-hydroxymaackiain methyltransferase family...    296   5e-93    
ref|NP_001168311.1|  uncharacterized protein LOC100382077               296   5e-93    
gb|AFW60893.1|  O-methyltransferase ZRP4                                296   6e-93    
ref|XP_007143925.1|  hypothetical protein PHAVU_007G114000g             295   9e-93    
ref|XP_008454865.1|  PREDICTED: trans-resveratrol di-O-methyltran...    297   1e-92    
ref|XP_009376908.1|  PREDICTED: trans-resveratrol di-O-methyltran...    296   1e-92    
ref|NP_001241010.1|  uncharacterized protein LOC100812688               295   1e-92    
gb|KCW74499.1|  hypothetical protein EUGRSUZ_E03211                     295   2e-92    
dbj|BAI77794.1|  chavicol O-methyltransferase                           295   2e-92    
emb|CBI21927.3|  unnamed protein product                                292   2e-92    
ref|XP_008455942.1|  PREDICTED: trans-resveratrol di-O-methyltran...    292   1e-91    
gb|KHN05026.1|  Isoflavone 7-O-methyltransferase                        291   2e-91    
ref|XP_003531866.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    292   2e-91    
ref|NP_001140810.1|  uncharacterized protein LOC100272885               292   2e-91    
ref|XP_010070153.1|  PREDICTED: trans-resveratrol di-O-methyltran...    292   3e-91    
gb|EMS45262.1|  O-methyltransferase ZRP4                                291   5e-91    
ref|XP_003569832.1|  PREDICTED: LOW QUALITY PROTEIN: O-methyltran...    291   5e-91    
ref|XP_009791022.1|  PREDICTED: trans-resveratrol di-O-methyltran...    292   6e-91    
ref|XP_004151088.1|  PREDICTED: trans-resveratrol di-O-methyltran...    289   8e-91    
ref|XP_003574581.2|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...    291   9e-91    
ref|XP_004169299.1|  PREDICTED: trans-resveratrol di-O-methyltran...    288   9e-91    
ref|XP_008392936.1|  PREDICTED: trans-resveratrol di-O-methyltran...    290   1e-90    
ref|XP_003533873.1|  PREDICTED: isoflavone-7-O-methyltransferase ...    290   1e-90    
ref|XP_010070184.1|  PREDICTED: trans-resveratrol di-O-methyltran...    290   1e-90    
ref|XP_003622357.1|  Isoflavone-7-O-methyltransferase                   290   2e-90    
ref|XP_004489528.1|  PREDICTED: isoflavone-7-O-methyltransferase ...    290   2e-90    
ref|XP_006489813.1|  PREDICTED: 8-hydroxyquercetin 8-O-methyltran...    290   2e-90    
ref|XP_003568107.1|  PREDICTED: O-methyltransferase ZRP4-like           289   3e-90    
gb|KCW89595.1|  hypothetical protein EUGRSUZ_A01877                     289   4e-90    
gb|KEH30963.1|  isoflavone-7-O-methyltransferase                        288   5e-90    
ref|XP_003608210.1|  Isoflavone-7-O-methyltransferase                   287   1e-89    
ref|XP_003622356.1|  Isoflavone-7-O-methyltransferase                   288   1e-89    
ref|XP_010683510.1|  PREDICTED: trans-resveratrol di-O-methyltran...    286   1e-89    
gb|AEF14418.1|  isoflavone O-methyltranferase                           288   1e-89    
ref|XP_008359464.1|  PREDICTED: trans-resveratrol di-O-methyltran...    288   1e-89    
ref|XP_006449423.1|  hypothetical protein CICLE_v10015724mg             287   1e-89    
ref|XP_010916032.1|  PREDICTED: trans-resveratrol di-O-methyltran...    287   2e-89    
ref|NP_001148593.1|  O-methyltransferase ZRP4                           287   2e-89    
gb|AFW78710.1|  O-methyltransferase ZRP4                                287   2e-89    
ref|XP_010680776.1|  PREDICTED: trans-resveratrol di-O-methyltran...    287   2e-89    
emb|CBI21932.3|  unnamed protein product                                289   2e-89    
ref|NP_001241162.1|  uncharacterized protein LOC100813225               286   4e-89    
ref|XP_010052330.1|  PREDICTED: trans-resveratrol di-O-methyltran...    286   4e-89    
gb|AFX68806.1|  O-metyltransferase                                      286   5e-89    
gb|EMS47465.1|  O-methyltransferase ZRP4                                286   5e-89    
gb|EAZ42961.1|  hypothetical protein OsJ_27551                          285   6e-89    
emb|CDP21212.1|  unnamed protein product                                284   7e-89    
sp|O24305.1|M3OM1_PEA  RecName: Full=(+)-6a-hydroxymaackiain 3-O-...    285   7e-89    
ref|XP_004983195.1|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...    286   8e-89    
ref|XP_006467714.1|  PREDICTED: isoflavone 4'-O-methyltransferase...    285   9e-89    
gb|ABD83944.1|  IOMT 4                                                  285   1e-88    
ref|XP_010070176.1|  PREDICTED: trans-resveratrol di-O-methyltran...    285   1e-88    
emb|CBI38115.3|  unnamed protein product                                281   2e-88    
ref|XP_010231163.1|  PREDICTED: O-methyltransferase ZRP4-like iso...    285   2e-88    
ref|XP_002447425.1|  hypothetical protein SORBIDRAFT_06g000820          285   2e-88    
ref|NP_001158962.1|  O-methyltransferase ZRP4                           285   2e-88    
ref|XP_010231162.1|  PREDICTED: O-methyltransferase ZRP4-like iso...    285   2e-88    
gb|AES78096.2|  isoflavone-7-O-methyltransferase                        284   3e-88    
gb|ACU19152.1|  unknown                                                 280   6e-88    
gb|EMT18419.1|  O-methyltransferase ZRP4                                286   7e-88    
ref|XP_008677433.1|  PREDICTED: O-methyltransferase ZRP4 isoform X1     283   7e-88    
sp|O22309.1|7OMT9_MEDSA  RecName: Full=Isoflavone-7-O-methyltrans...    282   1e-87    
gb|KGN44538.1|  hypothetical protein Csa_7G328260                       282   1e-87    
ref|XP_006467715.1|  PREDICTED: isoflavone 4'-O-methyltransferase...    282   1e-87    
sp|O22308.1|7OMT6_MEDSA  RecName: Full=Isoflavone-7-O-methyltrans...    281   2e-87    
gb|AFK38314.1|  unknown                                                 282   2e-87    
ref|XP_004505392.1|  PREDICTED: isoflavone-7-O-methyltransferase ...    281   2e-87    
gb|KHN08846.1|  8-hydroxyquercetin 8-O-methyltransferase                278   2e-87    
ref|XP_008679470.1|  PREDICTED: O-methyltransferase ZRP4-like           282   2e-87    
gb|AID51450.1|  isoflavone O-methyltransferase                          281   3e-87    
gb|EAZ07211.1|  hypothetical protein OsI_29456                          281   3e-87    
sp|O24529.1|7OMT8_MEDSA  RecName: Full=Isoflavone-7-O-methyltrans...    281   4e-87    
ref|NP_001140567.1|  hypothetical protein                               281   4e-87    
dbj|BAC99560.1|  putative flavonoid 7-O-methyltransferase               281   5e-87    
ref|XP_003556405.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    281   5e-87    
gb|KHN14021.1|  Isoflavone 7-O-methyltransferase                        280   5e-87    
emb|CDM84119.1|  unnamed protein product                                281   5e-87    
ref|XP_002441374.1|  hypothetical protein SORBIDRAFT_09g025530          281   5e-87    
sp|Q93WU2.1|EOMT1_OCIBA  RecName: Full=Eugenol O-methyltransferas...    280   7e-87    
gb|EMS45259.1|  O-methyltransferase ZRP4                                280   9e-87    
ref|XP_006492044.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    280   1e-86    



>ref|XP_009612081.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=350

 Score =   404 bits (1039),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 200/358 (56%), Positives = 261/358 (73%), Gaps = 11/358 (3%)
 Frame = +3

Query  54    MGENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAAL  233
             M ENG     ELLQA  Q WNHI N++ S+  KCAVQLGIPD+++ H K M L DL AAL
Sbjct  3     MNENGS---TELLQAHTQIWNHIYNFVSSSAAKCAVQLGIPDVLYKHGKSMCLSDLSAAL  59

Query  234   PIHPSKAPYIHRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNE  413
             P++PSK  ++  L R LVHSG L+      E+ YSLTPA RL +KD+P+++R++  I ++
Sbjct  60    PLNPSKISFLPILIRSLVHSGFLN----EHEDYYSLTPASRLFLKDDPLSMRSYFLIMHD  115

Query  414   YVFQKSCYSLGDWFQNNDPSPFCTAH-GEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVL  590
                QK  + L  WFQN+ P+ F  AH G+  WDY + EP  N++FN+  A DS L+  VL
Sbjct  116   PCVQKPWFELSSWFQNDFPTAFHAAHNGKSFWDYFADEPRVNNIFNDSMANDSSLIANVL  175

Query  591   LSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEF  770
             ++ E K VF+G++SLVDV GG G +A AIAK FPA+ CTVLDLPHVI  +  +   N+EF
Sbjct  176   IT-ECKHVFEGLTSLVDVGGGTGTLAIAIAKAFPAINCTVLDLPHVIGDLKGSG--NLEF  232

Query  771   VAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKK  950
             V G+MFE IP ANA+LLKWI+H+W DE+CVKILKKCKE+IPSRE+GGKVIIID+V+E+ K
Sbjct  233   VGGSMFEKIPNANAILLKWILHNWGDEDCVKILKKCKESIPSREKGGKVIIIDIVLENPK  292

Query  951   HDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
                   RA+  MDL++M L+G+KER KK+WEKL +EAGFS+Y+ITP LG RSLIE++P
Sbjct  293   QKDDSVRAQHNMDLVMMVLFGAKERTKKEWEKLFTEAGFSEYEITPTLGTRSLIEIYP  350



>ref|XP_002278211.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   403 bits (1036),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 191/354 (54%), Positives = 259/354 (73%), Gaps = 6/354 (2%)
 Frame = +3

Query  72    QSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSK  251
             ++  ELL A+A  WNHI N+I+S +LKCA+QLGIPDIIHNH KPM L +L+A LPIHP K
Sbjct  7     ETSSELLHAQAHVWNHIFNFINSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPIHPKK  66

Query  252   APYIHRLTRFLVHSGLLS---VTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVF  422
                ++RL R LV SG  +   V  S QEE Y LT A RL+++D+P+++R FL    + + 
Sbjct  67    VWCVYRLMRILVQSGFFARQKVEESEQEEGYVLTHASRLLLEDDPLSVRPFLLAMLDPIL  126

Query  423   QKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGE  602
              K  + +  WFQN+DP+PF TAHG   WDY  HEP  N+ FNE  A D++L+  VL+  +
Sbjct  127   TKPWHYVSAWFQNDDPTPFDTAHGRTFWDYGGHEPKINNFFNEAMASDARLVTSVLIK-D  185

Query  603   SKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGN  782
              K VF+G++SLVDV GG G VA AIA  FP + CTV DLPHV+A ++ +  +N+ ++ G+
Sbjct  186   CKGVFEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVFDLPHVVAGLEGS--KNLNYLGGD  243

Query  783   MFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPC  962
             MF+ IP A+A+LLKWI+HDW DEECVKIL++C++AIPS+E+GGKVIIIDM++E++K D  
Sbjct  244   MFKGIPPADAILLKWILHDWNDEECVKILQQCRQAIPSKEKGGKVIIIDMMMENQKGDDE  303

Query  963   YSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
                 +L+ D+L+M L   +ERN+K+WEKL  +AGFS YKITP LGLRSLIE++P
Sbjct  304   SMETQLFFDMLMMILVTGQERNEKEWEKLFLDAGFSGYKITPILGLRSLIEVYP  357



>ref|XP_002278294.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   402 bits (1032),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 195/357 (55%), Positives = 256/357 (72%), Gaps = 7/357 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S  ELL A+A  WNHI N+I+S +LKCA+QLGIPDIIHNH KPM   +L+A LP+H
Sbjct  5     NGEIS-AELLHAQAHVWNHIFNFINSMSLKCAIQLGIPDIIHNHGKPMTFPELVAKLPVH  63

Query  243   PSKAPYIHRLTRFLVHSGLLS---VTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNE  413
             P ++  ++RL R LVHSG L+   V    QEE Y LT A RL++ D+ +++R FL    +
Sbjct  64    PKRSQCVYRLMRILVHSGFLAAQRVQQGEQEEGYVLTDASRLLLMDDSLSIRPFLLAMLD  123

Query  414   YVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLL  593
              V  K  + L  WFQN+DP+PF TAH +  WDY  HEP  N+ FNE  A DS+L++ VLL
Sbjct  124   PVLTKPWHYLSAWFQNDDPTPFHTAHEQPFWDYAGHEPQLNNFFNEAMASDSRLVISVLL  183

Query  594   SGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFV  773
               E K +F+G++SLVDV GG G VA AIA  FP + CTVLDLPHV+A +  +  +N+ + 
Sbjct  184   K-EGKGLFEGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQES--KNLNYF  240

Query  774   AGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKH  953
             AG+MFE IP A+A+LLKWI+HDW DEECVKILK+C+EAIPS+E GGKVIIIDM++   + 
Sbjct  241   AGDMFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQG  300

Query  954   DPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             D      +LY D+++M L   +ER++ +WEKL  +AGFS YKITP LGLRSLIE++P
Sbjct  301   DYKSVETQLYFDMVMMILVTGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>emb|CAN61955.1| hypothetical protein VITISV_020020 [Vitis vinifera]
Length=357

 Score =   401 bits (1031),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 190/354 (54%), Positives = 258/354 (73%), Gaps = 6/354 (2%)
 Frame = +3

Query  72    QSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSK  251
             ++  ELL A+A  WNHI N+I+S +LKCA+QLGIPDIIHNH KPM L +L+A LPIHP K
Sbjct  7     ETSSELLHAQAHVWNHIFNFINSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPIHPKK  66

Query  252   APYIHRLTRFLVHSGLLS---VTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVF  422
                ++RL R LV SG  +   V  S QEE Y LT A RL+++D+P+++R FL    + + 
Sbjct  67    VWCVYRLMRILVQSGFFARQKVEESEQEEGYVLTHASRLLLEDDPLSVRPFLLAMLDPIL  126

Query  423   QKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGE  602
              K  + +  WFQN+DP+PF TAHG   WDY  HEP  N+ FNE  A D++L+   L+  +
Sbjct  127   TKPWHYVSAWFQNDDPTPFDTAHGXTFWDYGGHEPKJNNFFNEAMASDARLVTSXLIK-D  185

Query  603   SKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGN  782
              K VF+G++SLVDV GG G VA AIA  FP + CTV DLPHV+A ++ +  +N+ ++ G+
Sbjct  186   CKGVFEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVFDLPHVVAGLEGS--KNLNYLGGD  243

Query  783   MFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPC  962
             MF+ IP A+A+LLKWI+HDW DEECVKIL++C++AIPS+E+GGKVIIIDM++E++K D  
Sbjct  244   MFKGIPPADAILLKWILHDWNDEECVKILQQCRQAIPSKEKGGKVIIIDMMMENQKGDDE  303

Query  963   YSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
                 +L+ D+L+M L   +ERN+K+WEKL  +AGFS YKITP LGLRSLIE++P
Sbjct  304   SMETQLFFDMLMMILVTGQERNEKEWEKLFLDAGFSGYKITPILGLRSLIEVYP  357



>emb|CAN78992.1| hypothetical protein VITISV_005827 [Vitis vinifera]
Length=357

 Score =   399 bits (1024),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 194/357 (54%), Positives = 255/357 (71%), Gaps = 7/357 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S  ELL A+A  WNHI N+I+S +LKCA+QLGIPDIIHNH KPM   +L+A LP+H
Sbjct  5     NGEIS-AELLHAQAHVWNHIFNFINSMSLKCAIQLGIPDIIHNHGKPMTFPELVAKLPVH  63

Query  243   PSKAPYIHRLTRFLVHSGLLS---VTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNE  413
             P ++  ++RL R LVHSG L+   V    QEE Y LT A RL++ D+ +++R FL    +
Sbjct  64    PKRSQCVYRLMRILVHSGFLAAQRVQQGEQEEGYVLTDASRLLLMDDSLSIRPFLLAMLD  123

Query  414   YVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLL  593
              V  K  + L  WFQN+DP+PF TAH +  WDY  HEP  N+ FNE  A DS+L++ VLL
Sbjct  124   PVLTKPWHYLSAWFQNDDPTPFHTAHEQPFWDYAGHEPQLNNFFNEAMASDSRLVISVLL  183

Query  594   SGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFV  773
               E K +F+G++SLVDV GG G VA AIA  FP + CTVLD PHV+A +  +  +N+ + 
Sbjct  184   K-EGKGLFEGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDPPHVVAGLQES--KNLNYF  240

Query  774   AGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKH  953
             AG+MFE IP A+A+LLKWI+HDW DEECVKILK+C+EAIPS+E GGKVIIIDM++   + 
Sbjct  241   AGDMFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQG  300

Query  954   DPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             D      +LY D+++M L   +ER++ +WEKL  +AGFS YKITP LGLRSLIE++P
Sbjct  301   DYKSVETQLYFDMVMMILVTGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>ref|XP_002278190.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   398 bits (1022),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 190/354 (54%), Positives = 254/354 (72%), Gaps = 6/354 (2%)
 Frame = +3

Query  72    QSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSK  251
             ++  ELL A A  WNHI N+I+S +LKCA++LGIPDIIHNH KPM L +L+A LP++P K
Sbjct  7     ETSTELLHAHAHVWNHIFNFINSMSLKCAIELGIPDIIHNHGKPMTLSELVAELPVNPEK  66

Query  252   APYIHRLTRFLVHSGLLS---VTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVF  422
                ++RL R LV SG  +   V  SGQEE Y LT A RL++KD+P++ R FL    + V 
Sbjct  67    TKCVYRLMRLLVQSGFFTRKRVQESGQEEGYVLTHASRLLLKDDPLSARPFLLAMLDPVL  126

Query  423   QKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGE  602
                   +  WFQN+DP+PF TAHG   WDY  HEP  N+ FNE  A D++L+  VL+  +
Sbjct  127   ITPWQYVSAWFQNDDPTPFDTAHGRTFWDYAGHEPKLNNFFNEAMASDARLVTSVLIK-D  185

Query  603   SKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGN  782
              K +F G++SLVDV GG G VA AIA  FP + CTVLDLPHV+A ++ +  +N+ ++AG+
Sbjct  186   CKGIFVGLNSLVDVGGGTGTVARAIANAFPHLNCTVLDLPHVVAGLEGS--KNLNYLAGD  243

Query  783   MFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPC  962
             MFE IP A+A+LLKWI+HDW  +ECVKILK+C++AIPS+E+GGKVIIIDM++E++K D  
Sbjct  244   MFEAIPPADAILLKWILHDWNHDECVKILKRCRDAIPSKEKGGKVIIIDMMMENQKADDE  303

Query  963   YSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
                 +L+ D+L+M +   +ERN K WEKL  +AGFS YKITP LGLRSLIE++P
Sbjct  304   SIETQLFWDMLMMIVLTGQERNIKDWEKLFFDAGFSGYKITPMLGLRSLIEVYP  357



>ref|XP_009779391.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
sylvestris]
Length=351

 Score =   397 bits (1019),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 193/358 (54%), Positives = 256/358 (72%), Gaps = 10/358 (3%)
 Frame = +3

Query  54    MGENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAAL  233
             M ENG    ++LL A+ QTWNH+ N+I S+  KCA+QLGIPD+++ H KP+ L DL A L
Sbjct  3     MNENGS---IDLLLAQTQTWNHMFNFISSSAAKCAIQLGIPDVVYKHGKPISLSDLTAEL  59

Query  234   P-IHPSKAPYIHRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICN  410
               I  SK  ++  L RFLVHSG L   N  + E YSLTPA +L+VKD+P+++R++  I +
Sbjct  60    SLIDRSKVSFLPILMRFLVHSGFL---NQHENEHYSLTPASQLLVKDDPLSMRSYFLIIH  116

Query  411   EYVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVL  590
             + V  K+   L DW QN+  + F TAH + +WDY   EP   D FNE  A DS+L+  VL
Sbjct  117   DPVLLKAWSCLNDWLQNDSSTAFHTAHEKSLWDYYVQEPRVGDSFNESMASDSRLIANVL  176

Query  591   LSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEF  770
             ++ E K VF+G++SLVDV GG G VA AIAK FPA+KCTVLDLP V+ +       NVEF
Sbjct  177   IT-ECKHVFEGLTSLVDVGGGTGTVAIAIAKAFPAIKCTVLDLPRVVGNFKGNG--NVEF  233

Query  771   VAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKK  950
             V G+MFE IP ANA+L KWI+H+W DE+CVKILKKCK++IPSREEGGKVIIID+V+E+  
Sbjct  234   VGGSMFEKIPNANAILFKWILHNWSDEDCVKILKKCKDSIPSREEGGKVIIIDIVLENPN  293

Query  951   HDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
                 + RA+ YMD+L+M  Y +K+R K +WE+L ++AGF++YKITP LG RSLIE++P
Sbjct  294   TSNEFVRAQHYMDMLMMVFYAAKQRTKMEWERLFTDAGFNEYKITPTLGTRSLIEIYP  351



>ref|XP_003633245.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score =   396 bits (1017),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 190/356 (53%), Positives = 253/356 (71%), Gaps = 9/356 (3%)
 Frame = +3

Query  69    KQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPS  248
             ++   ELLQA+  TW H  N+++S  LKCA+QLGIPD+IH+H +PM L  LI AL + P+
Sbjct  7     RERATELLQAQVHTWKHTTNFVNSMVLKCAIQLGIPDVIHSHGQPMALSQLITALSLEPT  66

Query  249   KAPYIHRLTRFLVHSGLLS----VTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             KAP ++RL R LVHSG  +    + NS +EE YSLT A + ++KDEP++   FL +  + 
Sbjct  67    KAPCLYRLMRVLVHSGFFAQQKLLHNSEEEEGYSLTFASQFLLKDEPVSGVPFLLLQLDP  126

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             +     + LGDWFQN DP+PF TAH +  WDY  HEP  ND+FNE    DS+L+  +++ 
Sbjct  127   ILTAPWHFLGDWFQNEDPTPFHTAHRKSFWDYAVHEPKLNDIFNETMVSDSRLIANMIVR  186

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G++SLVDV GG G +  AIAK FP +KC V D PHV+A+++    EN+E V 
Sbjct  187   -QYKEVFEGLASLVDVGGGTGTMVKAIAKAFPQLKCIVFDQPHVVANLEVG--ENLEIVG  243

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             GN+FE IP A+A+LLKWI+HDW DEECVKILKKCK AIP++  GGKVIIIDMV+E  K D
Sbjct  244   GNIFEAIPPADAILLKWILHDWSDEECVKILKKCKGAIPNK--GGKVIIIDMVVESNKGD  301

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
                   +L++D+L+M +   KERN+K+WEKL   AGF+ YKITPALGLRSLIE++P
Sbjct  302   NKAVETQLFIDMLMMVVVAGKERNEKEWEKLFLAAGFTHYKITPALGLRSLIEVYP  357



>ref|XP_003633248.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score =   394 bits (1013),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 192/357 (54%), Positives = 252/357 (71%), Gaps = 7/357 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S  ELL A+A  WNHILN+I S +LKCA+QLGIPDIIHNH KPM L +L+A LP+H
Sbjct  5     NGEIS-AELLHAQAHVWNHILNFIKSVSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVH  63

Query  243   PSKAPYIHRLTRFLVHSGLL---SVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNE  413
             P ++  ++RL R LVHSG L   SV    +EE Y LT A RL++ D+ +++R  L    +
Sbjct  64    PKRSQCVYRLMRILVHSGFLAAQSVQQGEEEEGYVLTDASRLLLMDDSLSIRPLLLAMLD  123

Query  414   YVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLL  593
              +  K  + L  WFQN+DP+PF TAH    WDY  HEP  N+ FNE  A D++L+  VLL
Sbjct  124   PILTKPWHYLSAWFQNDDPTPFHTAHERPFWDYAGHEPQLNNFFNEAMASDARLVTSVLL  183

Query  594   SGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFV  773
               E K VF+G++SLVDV GG G VA AIA  FP + CTVLDLPHV+A +  +  +N+ + 
Sbjct  184   K-EGKGVFEGLNSLVDVGGGTGQVAKAIANAFPHLNCTVLDLPHVVAGLQGS--KNLNYF  240

Query  774   AGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKH  953
             AG++FE IP A+A+LLKWI+HDW DEECVKILK+C+EAIPS+E GGKVIIIDM++   + 
Sbjct  241   AGDIFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQG  300

Query  954   DPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             D      +L+ D+ +M     +ER++ +WEKL  +AGFS YKITP LGLRSLIE++P
Sbjct  301   DYKSIETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>ref|XP_003633249.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score =   393 bits (1010),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 191/357 (54%), Positives = 252/357 (71%), Gaps = 7/357 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S  ELL A+A  WNHILN+I S +LKCA+QLGIPDIIHNH KPM L +L+A LP+H
Sbjct  5     NGEIS-AELLHAQAHVWNHILNFIKSVSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVH  63

Query  243   PSKAPYIHRLTRFLVHSGLLS---VTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNE  413
             P ++  ++RL R LVHSG L+   V    +EE Y LT A RL++ D+ +++R  L    +
Sbjct  64    PKRSQCVYRLMRILVHSGFLAAQRVQQGEEEEGYVLTDASRLLLMDDSLSIRPLLLAMLD  123

Query  414   YVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLL  593
              +  K  + L  WFQN+DP+PF TAH    WDY  HEP  N+ FNE  A D++L+  VLL
Sbjct  124   PILTKPWHYLSAWFQNDDPTPFHTAHERPFWDYAGHEPQLNNFFNEAMASDARLVTSVLL  183

Query  594   SGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFV  773
               E K VF+G++SLVDV GG G VA AIA  FP + CTVLDLPHV+A +  +  +N+ + 
Sbjct  184   K-EGKGVFEGLNSLVDVGGGTGQVAKAIANAFPHLNCTVLDLPHVVAGLQGS--KNLNYF  240

Query  774   AGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKH  953
             AG++FE IP A+A+LLKWI+HDW DEECVKILK+C+EAIPS+E GGKVIIIDM++   + 
Sbjct  241   AGDIFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQG  300

Query  954   DPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             D      +L+ D+ +M     +ER++ +WEKL  +AGFS YKITP LGLRSLIE++P
Sbjct  301   DYKSIETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>ref|XP_002326036.2| hypothetical protein POPTR_0019s12290g [Populus trichocarpa]
 gb|EEF00418.2| hypothetical protein POPTR_0019s12290g [Populus trichocarpa]
Length=357

 Score =   393 bits (1010),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 191/356 (54%), Positives = 253/356 (71%), Gaps = 7/356 (2%)
 Frame = +3

Query  66    GKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHP  245
             G     ELLQA+A  WNHI N+++S +LKCA+QLGIPD+IHNH KPM L +L+A LPIHP
Sbjct  6     GNLHGAELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDVIHNHGKPMTLSELVAVLPIHP  65

Query  246   SKAPYIHRLTRFLVHSGLLSVTNSGQE---ECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             SKAP I+RL R LVHSG  +  N+  E   E Y LT A +L++KD P ++  FL    + 
Sbjct  66    SKAPGIYRLMRILVHSGFFATQNNSGETEGEGYVLTNASQLLIKDNPFSVTPFLLAMLDP  125

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             +  +  + +  WFQN+ PS F TAH    W+Y  HE   N  FNE  A D++L+  VL++
Sbjct  126   ILTQPWHYVSVWFQNDAPSSFYTAHQRTSWEYAGHETELNHFFNEAMASDARLVSSVLVN  185

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              E K VF+G++SLVDV GG G VA AIAK F  + CTV DLPHV+A ++ +  EN+++++
Sbjct  186   -ECKGVFEGLNSLVDVGGGTGTVAKAIAKEFQHLDCTVFDLPHVVAGLEGS--ENLKYLS  242

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE IP A+A+LLKWI+HDW DEECVKILK+CKEAI  R EGGK+IIIDMV+E+ K  
Sbjct  243   GDMFEAIPQADAILLKWILHDWNDEECVKILKQCKEAIKGR-EGGKLIIIDMVVENNKEV  301

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
                +  +L+ D+L+M L   KERN+K+W KL ++AGFS+YKI P LGLRSLIE++P
Sbjct  302   EGSTETQLFFDMLMMILVTGKERNEKEWAKLFTDAGFSNYKINPVLGLRSLIEVYP  357



>ref|XP_009778350.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
sylvestris]
Length=350

 Score =   393 bits (1009),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 189/350 (54%), Positives = 254/350 (73%), Gaps = 4/350 (1%)
 Frame = +3

Query  75    SHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKA  254
             S  ELLQA+AQTWNHI ++ +S+ ++CAVQLGIPD+++ H KPM L DL++ LP+HPSK 
Sbjct  5     SSSELLQAQAQTWNHIFDFTNSSAVRCAVQLGIPDVLYKHGKPMCLSDLLSQLPLHPSKV  64

Query  255   PYIHRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSC  434
               +  L R LVHSG L+  +      YSLTPA RL+V++EP+N+R+ L I +E   QK+ 
Sbjct  65    SSMPILLRLLVHSGFLN-QHEKDHYYYSLTPASRLLVRNEPLNIRSLLLINHEPFLQKAW  123

Query  435   YSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKRV  614
             + L  WFQN+ P+ F TAHG+  WDY + +P     FN+  A DS+L+  V +  E K V
Sbjct  124   FELSSWFQNDFPTAFHTAHGKSFWDYFTEKPRQGSDFNDAMASDSRLIADVFVK-ECKHV  182

Query  615   FDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFEN  794
             F+G+ SLVDV GG G VA+ IAK  P +KC V DLP V+A +  +   N+EFV G+MF+ 
Sbjct  183   FEGLESLVDVGGGTGTVATVIAKANPTIKCIVFDLPRVVADLKGSG--NLEFVGGSMFDE  240

Query  795   IPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYSRA  974
             IP  NA+LLK I+HDW DE+CVKILKKCKE+IPSR++GGKVIIID+V+ED      + RA
Sbjct  241   IPHVNAILLKCILHDWSDEDCVKILKKCKESIPSRDKGGKVIIIDIVMEDPTQSDEFVRA  300

Query  975   ELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             +  MDLL+M L+ +KER KK+W+KL +EAGF++ KITP+LGLRSLIE++P
Sbjct  301   QHSMDLLMMILFAAKERTKKEWQKLFTEAGFTECKITPSLGLRSLIEIYP  350



>ref|XP_009605623.1| PREDICTED: myricetin O-methyltransferase-like [Nicotiana tomentosiformis]
Length=364

 Score =   393 bits (1009),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 192/363 (53%), Positives = 253/363 (70%), Gaps = 9/363 (2%)
 Frame = +3

Query  45    RKIMGENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLI  224
             R +     +    +LL+A+AQ WNH+ ++I+S+  KCAVQLGIPDI++ H KPM   +L 
Sbjct  8     RNLKMSTNENGSTDLLRAQAQIWNHMFSFINSSAAKCAVQLGIPDILYKHDKPMSFSNLS  67

Query  225   AALP-IHPSKAPYIHRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLH  401
             A LP +H SK  ++  L RFLVHSG L   N   +  YSLTPA RL+V + P   R+   
Sbjct  68    AELPLVHLSKVSFLPILMRFLVHSGFL---NQHDQNHYSLTPASRLLVTNNPSGTRSHFL  124

Query  402   ICNEYVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLM  581
             I ++ +FQK+ + L  WFQN+ P+ F TA+G   WDY   +P   + FN+  A DS L+ 
Sbjct  125   INHDQLFQKASFELSSWFQNDSPTAFHTAYGISFWDYFVEKPKLGESFNDAMASDSMLVA  184

Query  582   IVLLSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVEN  761
              VL++ E K VF+G++SLVDV GG G VA AIAK FP + CTV DLPHVI  +  +   N
Sbjct  185   NVLIT-ECKYVFEGLTSLVDVGGGTGTVAIAIAKAFPMINCTVFDLPHVIGDLKGSG--N  241

Query  762   VEFVAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIE  941
             ++FV G+MF+ IP ANA+LLKWI+HDW DE+CVKILKKCKEAIP RE+GGKVIIIDMV+E
Sbjct  242   LDFVGGSMFDKIPNANAILLKWILHDWSDEDCVKILKKCKEAIPCREKGGKVIIIDMVME  301

Query  942   DKK--HDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIE  1115
             D K   D  + R +  MDLL+M L+ +KER KK+WEKL +E+GF+ YKITP+LG RSLIE
Sbjct  302   DPKLISDEEFVRTQHNMDLLMMLLFAAKERTKKEWEKLFTESGFTQYKITPSLGSRSLIE  361

Query  1116  LFP  1124
             ++P
Sbjct  362   IYP  364



>emb|CAQ76879.1| resveratrol O-methyltransferase [Vitis vinifera]
Length=357

 Score =   392 bits (1007),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 187/350 (53%), Positives = 247/350 (71%), Gaps = 6/350 (2%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPYI  263
             ELL A+A  WNHI N+I S +LKCA+QLGIPDIIHNH KPM L +L+A LP+HP ++  +
Sbjct  11    ELLHAQAHVWNHIFNFIKSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  264   HRLTRFLVHSGLLS---VTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSC  434
             +RL R LVHSG L+   V    +EE Y LT A RL++ D+ +++R  +    + +  K  
Sbjct  71    YRLMRILVHSGFLAAQRVQQGKEEEGYVLTDASRLLLMDDSLSIRPLVLAMLDPILTKPW  130

Query  435   YSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKRV  614
             + L  WFQN+DP+PF TAH    WDY  HEP  N+ FNE  A D++LL  VLL  E + V
Sbjct  131   HYLSAWFQNDDPTPFHTAHERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLLK-EGQGV  189

Query  615   FDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFEN  794
             F G++SLVDV GG G VA AIA  FP + CTVLDLPHV+A +  +  +N+ + AG+MFE 
Sbjct  190   FAGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQGS--KNLNYFAGDMFEA  247

Query  795   IPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYSRA  974
             IP A+A+LLKWI+HDW DEECVKILK+C+EAIPS+E GGKVIIIDM++   + D   +  
Sbjct  248   IPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQGDYKSTET  307

Query  975   ELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             +L+ D+ +M     +ER++ +WEKL  +AGFS YKITP LGLRSLIE++P
Sbjct  308   QLFFDMTMMIFAPGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>gb|AEF97347.1| O-methyltransferase [Vitis pseudoreticulata]
Length=357

 Score =   392 bits (1007),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 187/350 (53%), Positives = 246/350 (70%), Gaps = 6/350 (2%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPYI  263
             ELL A+A  WNHI N+I S +LKCA QLGIPDIIHNH KPM L +L+A LP+HP ++  +
Sbjct  11    ELLHAQAHVWNHIFNFIKSMSLKCATQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  264   HRLTRFLVHSGLLS---VTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSC  434
             +RL R LVHSG L+   V    +EE Y LT A RL++ D+ +++R  +    + +  K  
Sbjct  71    YRLMRILVHSGFLAAQRVQQGKEEEGYVLTDASRLLLMDDSLSIRPLVLAMLDPILTKPW  130

Query  435   YSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKRV  614
             + L  WFQN+DP+PF TAH    WDY  HEP  N+ FNE  A D++LL  VLL  E + V
Sbjct  131   HYLSAWFQNDDPTPFHTAHERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLLK-EGQGV  189

Query  615   FDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFEN  794
             F G++SLVDV GG G VA AIA  FP + CTVLDLPHV+A +  +  +N+ + AG+MFE 
Sbjct  190   FAGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQGS--KNLNYFAGDMFEA  247

Query  795   IPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYSRA  974
             IP A+A+LLKWI+HDW DEECVKILK+C+EAIPS+E GGKVIIIDM++   + D   +  
Sbjct  248   IPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQGDYKSTET  307

Query  975   ELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             +L+ D+ +M     +ER++ +WEKL  +AGFS YKITP LGLRSLIE++P
Sbjct  308   QLFFDMTMMIFAAGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>ref|XP_002281368.2| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score =   391 bits (1004),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 190/357 (53%), Positives = 250/357 (70%), Gaps = 7/357 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S  ELL A+A  WNHI N+I S +LKCA QLGIPDIIHNH KPM L +L+A LP+H
Sbjct  5     NGEIS-AELLHAQAHVWNHIFNFIKSMSLKCATQLGIPDIIHNHGKPMTLPELVAKLPVH  63

Query  243   PSKAPYIHRLTRFLVHSGLLS---VTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNE  413
             P ++  ++RL R LVHSG L+   V    +EE Y LT A RL++ D+ +++R  +    +
Sbjct  64    PKRSQCVYRLMRILVHSGFLAAQRVQQGEEEEGYVLTDASRLLLMDDSLSIRPLVLAMLD  123

Query  414   YVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLL  593
              +  K  + L  WFQN+DP+PF TA+    WDY  HEP  N+ FNE  A D++LL  VLL
Sbjct  124   PILTKPWHYLSAWFQNDDPTPFHTAYERPFWDYAGHEPQLNNSFNEAMASDARLLTSVLL  183

Query  594   SGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFV  773
               E K VF G++SLVDV GG G VA AIA  FP + CTVLDLPHV+A +  +  +N+ + 
Sbjct  184   K-EGKGVFAGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQGS--KNLNYF  240

Query  774   AGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKH  953
             AG+MFE IP A+A+LLKWI+HDW DEECVKILK+C+EAIPS+E GGKVIIIDM++   + 
Sbjct  241   AGDMFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQG  300

Query  954   DPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             D   +  +L+ D+ +M     +ER++ +WEKL  +AGFS YKITP LGLRSLIE++P
Sbjct  301   DYKSTETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>ref|XP_011002662.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=357

 Score =   390 bits (1002),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 186/350 (53%), Positives = 255/350 (73%), Gaps = 7/350 (2%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPYI  263
             ELL+A+A  WNHI ++I+S +LKCA+ LGIPDII+ H KP+ L +LIAALP+HPSKA  +
Sbjct  12    ELLKAQAHIWNHIFSFINSMSLKCAIDLGIPDIINKHSKPVTLPELIAALPVHPSKARCV  71

Query  264   HRLTRFLVHSGLLS---VTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSC  434
              RL R L+HSG      V+   QEE Y LT A +L++KD P ++  FL    + +  K  
Sbjct  72    PRLMRLLIHSGFFEKQKVSEDDQEEGYVLTNASQLLLKDNPFSVAPFLQAVLDPILTKPW  131

Query  435   YSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKRV  614
             + +  W +N+DP+PF TAHG   WDY+ HEP +N +FN+  A D++L+  VL++ E K V
Sbjct  132   HFVSTWLKNDDPTPFDTAHGRTFWDYVGHEPVFNHLFNDAMASDARLVTRVLIN-ECKEV  190

Query  615   FDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFEN  794
             F+G+ SLVDV GG G VA++IAK FP + CTV DLPHV+A  D    EN+++V G+MFE 
Sbjct  191   FEGLGSLVDVGGGTGTVANSIAKAFPHLDCTVFDLPHVVA--DLQGSENLKYVGGDMFEA  248

Query  795   IPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYSRA  974
             IP A+ ++LKWI+HDW DEECVKILKKCKEAI  R EGGKV+II+M++E++K +      
Sbjct  249   IPPADGIVLKWILHDWNDEECVKILKKCKEAIKDR-EGGKVMIIEMMMENQKGEDESIET  307

Query  975   ELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             +++ D+L+M L+  +ERN+K+W KL S+AGFS+YKITP LGLRS+IE+FP
Sbjct  308   QIFFDMLMMILFTGQERNEKEWAKLFSDAGFSNYKITPILGLRSIIEVFP  357



>ref|XP_002278316.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=359

 Score =   389 bits (999),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 191/359 (53%), Positives = 254/359 (71%), Gaps = 9/359 (3%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG +S  ELLQA+   WNHI N+I+S +LKCA+QLGIPDIIHNH +PM L +L+A LP+ 
Sbjct  5     NGGRSS-ELLQAQTHVWNHIFNFINSMSLKCAIQLGIPDIIHNHCQPMTLHELVAKLPVR  63

Query  243   PSKAPYIHRLTRFLVHSGLLS---VTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNE  413
             P+K   +HRL R LVHSG  +   V  S  EE Y+L  A RL++KD P++   FL    +
Sbjct  64    PNKTLCVHRLMRILVHSGFFTMQRVQESADEEGYALANASRLLLKDHPLSATPFLLAMLD  123

Query  414   YVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLL  593
                 +  + +  WFQN+DP+PF TAHG  IWDY  HEP +N+ FNE  A D++L+  VL+
Sbjct  124   PDLTEPWHYVSAWFQNDDPTPFFTAHGRTIWDYGCHEPRFNNFFNEAMASDARLVTSVLI  183

Query  594   SGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFV  773
               E K  F+G++S VDV GG G VA  I   FP +  TVLDLPHV+A  D    +N+ ++
Sbjct  184   K-ECKGAFEGLNSFVDVGGGTGTVAKTIVDAFPHLHSTVLDLPHVVA--DLQGSKNLTYL  240

Query  774   AGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKH  953
             AG+MFE IP A+A+LLKWI+HDW DEEC+KIL++C+ AIPS+E+GGKV+IIDM I +KK 
Sbjct  241   AGDMFEAIPPADAILLKWILHDWSDEECLKILEQCRGAIPSKEKGGKVMIIDMAILNKKG  300

Query  954   DPCYSRAE--LYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             D   S+ E  L+MD+L+M LY  +ER +K+W+KL  ++GFS YKITP LGLRSLIE++P
Sbjct  301   DEDESKVETQLFMDMLMMVLYPGREREEKEWKKLFLDSGFSGYKITPILGLRSLIEVYP  359



>ref|XP_011002663.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=357

 Score =   389 bits (998),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 185/350 (53%), Positives = 254/350 (73%), Gaps = 7/350 (2%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPYI  263
             ELL+A+A  WNHI ++I+S +LKCA+ LGIPDII+ H KP+ L +LIA LP+HPSKA  +
Sbjct  12    ELLKAQAHIWNHIFSFINSMSLKCAIDLGIPDIINKHSKPVTLPELIATLPVHPSKARCV  71

Query  264   HRLTRFLVHSGLLS---VTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSC  434
              RL R L+HSG      V+   QEE Y LT A +L++KD P ++  FL    + +  K  
Sbjct  72    PRLMRLLIHSGFFEKQKVSEDDQEEGYVLTNASQLLLKDNPFSVAPFLQAVLDPILTKPW  131

Query  435   YSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKRV  614
             + +  W +N+DP+PF TAHG   WDY+ HEP +N +FN+  A D++L+  VL++ E K V
Sbjct  132   HFVSTWLKNDDPTPFDTAHGRTFWDYVGHEPVFNHLFNDAMASDARLVTRVLIN-ECKEV  190

Query  615   FDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFEN  794
             F+G+ SLVDV GG G VA++IAK FP + CTV DLPHV+A  D    EN+++V G+MFE 
Sbjct  191   FEGLGSLVDVGGGTGTVANSIAKAFPHLDCTVFDLPHVVA--DLQGSENLKYVGGDMFEA  248

Query  795   IPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYSRA  974
             IP A+ ++LKWI+HDW DEECVKILKKCKEAI  R EGGKV+II+M++E++K +      
Sbjct  249   IPPADGIVLKWILHDWNDEECVKILKKCKEAIKDR-EGGKVMIIEMMMENQKGEDESIET  307

Query  975   ELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             +++ D+L+M L+  +ERN+K+W KL S+AGFS+YKITP LGLRS+IE+FP
Sbjct  308   QIFFDMLMMILFTGQERNEKEWAKLFSDAGFSNYKITPILGLRSIIEVFP  357



>ref|XP_002277927.2| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   387 bits (993),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 197/351 (56%), Positives = 255/351 (73%), Gaps = 8/351 (2%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPYI  263
             ELLQA+A  WNHI N+++S +LKCA+QLGIPDIIHNH KPM L  L+A LP+HP K  Y+
Sbjct  11    ELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDIIHNHGKPMTLPQLVAKLPVHPKKTQYV  70

Query  264   HRLTRFLVHSGLLSVTNSGQ---EECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSC  434
             +RL R LV S   +   + Q   EE Y LT A RL++KD+ +++R FL    +    K  
Sbjct  71    YRLMRVLVQSDFFAAQRAQQSEEEEGYVLTHASRLLLKDDSLSVRPFLLAMLDPTLTKPW  130

Query  435   YSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKRV  614
             + +  WFQN+DP+PF TAH   +WDY  HEP  N  FNE  A D++L+  VL+  E K V
Sbjct  131   HYVSAWFQNDDPTPFDTAHERTLWDYAGHEPQLNYFFNEAMASDARLVTSVLVK-EGKGV  189

Query  615   FDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFEN  794
             F+G++SLVDV GG G VA AIA  FP +KCTVLDLPHV+A +  +  +N+ + AG+MFE 
Sbjct  190   FEGLNSLVDVGGGTGTVAKAIANAFPHLKCTVLDLPHVVAGLQGS--KNLNYFAGDMFEA  247

Query  795   IPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYSR-  971
             IP A+A+LLKWI+HDW DEECVKILK+C+EAIPS+E GGKVIIIDM+++++K D C SR 
Sbjct  248   IPPADAILLKWILHDWSDEECVKILKRCREAIPSKERGGKVIIIDMMVKNQKGD-CKSRE  306

Query  972   AELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
              +L+ D+L+M L   KER +K+WEKL  EAGFS YKITP LGLRSLIE++P
Sbjct  307   TQLFFDMLMMVLVTGKEREEKEWEKLFLEAGFSHYKITPILGLRSLIEVYP  357



>ref|XP_011002666.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=357

 Score =   387 bits (993),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 187/357 (52%), Positives = 254/357 (71%), Gaps = 8/357 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             +GK    ELL+A+A  WNHI N+I+S +LKCA+ LGIPDII+ H KP+ L +LIAALP+H
Sbjct  6     DGKHDR-ELLKAQAHIWNHIFNFINSMSLKCAIDLGIPDIINKHSKPVTLPELIAALPVH  64

Query  243   PSKAPYIHRLTRFLVHSGLLS---VTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNE  413
             P KA  + RL R L+HSG      V+   QEE Y LT A +L++KD P ++  FL    +
Sbjct  65    PGKARCVPRLMRLLIHSGFFEKQKVSEDDQEEGYILTNASQLLLKDNPFSVAPFLQAVLD  124

Query  414   YVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLL  593
              +  K  + +  W +N+DP+PF TAHG   WDY+ HEP +N +FN+  A D++L+  VL+
Sbjct  125   PILTKPWHFVSTWLKNDDPTPFDTAHGRTFWDYVGHEPVFNHLFNDAMASDARLVTRVLI  184

Query  594   SGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFV  773
             + E K VF+G+ SLVDV GG G VA +IAK FP + CTV DLPHV+A  D    EN+++V
Sbjct  185   N-ECKEVFEGLGSLVDVGGGTGTVAKSIAKAFPHLDCTVFDLPHVVA--DLQGSENLKYV  241

Query  774   AGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKH  953
              G+MFE IP A+ ++LKWI+HDW DEECVKILKKCKEAI  R EGGKV+II+M++E++K 
Sbjct  242   GGDMFEAIPPADGIVLKWILHDWNDEECVKILKKCKEAIKDR-EGGKVMIIEMMMENQKG  300

Query  954   DPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             +      +++ D+L+M L   +ERN+K+W KL S+A FS+YKITP LGLRS+IE+FP
Sbjct  301   EDDSIETQIFFDMLMMILVTGQERNEKEWAKLFSDASFSNYKITPILGLRSIIEVFP  357



>ref|XP_002278517.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=359

 Score =   386 bits (992),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 189/359 (53%), Positives = 254/359 (71%), Gaps = 9/359 (3%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG +S  ELLQA+   WNHI N+I+S +LKCA+QLGIPDIIHNH +PM L +L+A LP+ 
Sbjct  5     NGGRSS-ELLQAQTHVWNHIFNFINSMSLKCAIQLGIPDIIHNHCQPMTLHELVAKLPVR  63

Query  243   PSKAPYIHRLTRFLVHSGLLS---VTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNE  413
             P+K   +HRL R LVHSG  +   V  S  EE Y L  A RL++KD P+++  FL    +
Sbjct  64    PNKTLCVHRLMRILVHSGFFTMQRVQESADEEGYVLANASRLLLKDHPLSVTPFLLAMLD  123

Query  414   YVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLL  593
                 +  + +  WFQN+DP+PF TAHG  IWDY  HEP +N+ FNE  A D++L+  VL+
Sbjct  124   PDLTEPWHYVSAWFQNDDPTPFFTAHGRTIWDYGCHEPRFNNFFNEAMASDARLVTSVLV  183

Query  594   SGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFV  773
               E K  F+G++S VDV GG G VA  I + FP +  TVLDLPHV+A +     +++ ++
Sbjct  184   K-ECKGAFEGLNSFVDVGGGTGTVAKTIVEAFPHLHSTVLDLPHVVADLQGG--KSLTYL  240

Query  774   AGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKH  953
             AG+MFE IP A+A+LLKWI+HDW DEEC+KILK+C+EAIPS+E+GGKV+IIDM I++KK 
Sbjct  241   AGDMFEAIPPADAILLKWILHDWSDEECLKILKQCREAIPSKEKGGKVMIIDMAIQNKKG  300

Query  954   DPCYSRAE--LYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             D   S  E  L+ D+L+M L   +ER +K+W+KL  ++GFS YKITP LGLRSLIE++P
Sbjct  301   DDDESNVETQLFFDMLMMVLLPGREREEKEWKKLFLDSGFSGYKITPILGLRSLIEVYP  359



>ref|XP_002274019.2| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   385 bits (990),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 199/358 (56%), Positives = 259/358 (72%), Gaps = 9/358 (3%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S  ELLQA+A  WNHI N+++S +LKCA+QLGIPDIIHNH KPM L +L+A LP+H
Sbjct  5     NGEISS-ELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVTNSGQ---EECYSLTPAGRLVVKDEPINLRAFLHICNE  413
             P K  Y++RL R LV S   +   + Q   EE Y LT A RL++KD+ +++R FL    +
Sbjct  64    PKKTQYVYRLMRVLVQSDFFAAQRAQQSEEEEGYVLTHASRLLLKDDSLSVRPFLLAMLD  123

Query  414   YVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLL  593
                 K  + +  WFQN+DP+PF TAH   +WDY  HEP  N  FNE  A D++L+  VL+
Sbjct  124   PTLTKPWHYVSAWFQNDDPTPFDTAHERTLWDYAGHEPQLNYFFNEAMASDARLVTSVLV  183

Query  594   SGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFV  773
               E K VF+G++SLVDV GG G VA AIA  FP + CTVLDLPHV+A +  +  +N+ + 
Sbjct  184   K-EGKGVFEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVLDLPHVVAGLQGS--KNLNYF  240

Query  774   AGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKH  953
             AG+MFE IP A+A+LLKWI+HDW DEECVKILK+C+EAIPS+E GGKVIIIDM+++++K 
Sbjct  241   AGDMFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKERGGKVIIIDMMVKNQKG  300

Query  954   DPCYSR-AELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             D C SR  +L+ D+L+M L   KER +K+WEKL  EAGFS YKITP LGLRSLIE++P
Sbjct  301   D-CKSRETQLFFDMLMMVLVTGKEREEKEWEKLFLEAGFSHYKITPILGLRSLIEVYP  357



>sp|B6VJS4.2|ROMT_VITVI RecName: Full=Trans-resveratrol di-O-methyltransferase; AltName: 
Full=Resveratrol O-methyltransferase; Short=ROMT; Short=VvROMT 
[Vitis vinifera]
Length=357

 Score =   385 bits (988),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 184/350 (53%), Positives = 246/350 (70%), Gaps = 6/350 (2%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPYI  263
             ELL A+A  WNHI N+I S +LKCA+QLGIPDIIHNH KPM L +L+A LP+HP ++  +
Sbjct  11    ELLHAQAHVWNHIFNFIKSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  264   HRLTRFLVHSGLLS---VTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSC  434
             +RL R LVHSG L+   V    +EE Y LT A RL++ D+ +++R  +    + +  K  
Sbjct  71    YRLMRILVHSGFLAAQRVQQGKEEEGYVLTDASRLLLMDDSLSIRPLVLAMLDPILTKPW  130

Query  435   YSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKRV  614
             + L  WFQN+DP+PF TA+    WDY  HEP  N+ FNE  A D++LL  VLL  E + V
Sbjct  131   HYLSAWFQNDDPTPFHTAYERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLLK-EGQGV  189

Query  615   FDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFEN  794
             F G++SLVDV GG G VA AIA  FP + CTVLDL HV+A +  +  +N+ + AG+MFE 
Sbjct  190   FAGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLSHVVAGLQGS--KNLNYFAGDMFEA  247

Query  795   IPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYSRA  974
             IP A+A+LLKWI+HDW +EECVKILK+C+EAIPS+E GGKVIIIDM++   + D   +  
Sbjct  248   IPPADAILLKWILHDWSNEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQGDYKSTET  307

Query  975   ELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             +L+ D+ +M     +ER++ +WEKL  +AGFS YKITP LGLRSLIE++P
Sbjct  308   QLFFDMTMMIFAPGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>gb|AEC13057.1| orcinol O-methyltransferase-like protein [Rosa chinensis]
Length=367

 Score =   385 bits (988),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 187/356 (53%), Positives = 254/356 (71%), Gaps = 6/356 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  16    NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  74

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  75    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDP  134

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  135   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIID  194

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  195   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  251

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEECVKILK+ +EAI S+++ GKVIIIDM++E++K D
Sbjct  252   GDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKNGKVIIIDMMMENQKGD  311

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYKITP LGLRSLIE++P
Sbjct  312   EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPILGLRSLIEVYP  367



>emb|CAN69333.1| hypothetical protein VITISV_003273 [Vitis vinifera]
Length=350

 Score =   384 bits (987),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 196/351 (56%), Positives = 254/351 (72%), Gaps = 8/351 (2%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPYI  263
             ELLQA+A  WNHI N+++S +LKCA+QLGIPDIIHNH KPM L  L+A LP+HP K  Y+
Sbjct  4     ELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDIIHNHGKPMTLPQLVAKLPVHPKKTQYV  63

Query  264   HRLTRFLVHSGLLSVTNSGQ---EECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSC  434
             +RL R LV S   +   + Q   EE Y LT A RL++KD+ +++R FL    +    K  
Sbjct  64    YRLMRVLVQSDFFAAPRAQQSEEEEGYVLTHASRLLLKDDSLSVRPFLLAMLDPTLTKPW  123

Query  435   YSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKRV  614
             + +  WFQN+DP+PF TAH   +WDY  HEP  N  FNE  A D++L+  VL+  E K V
Sbjct  124   HYVSAWFQNDDPTPFDTAHERTLWDYAGHEPQLNYXFNEAMASDARLVTSVLVK-EGKGV  182

Query  615   FDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFEN  794
             F+G++SLVDV GG G VA AIA  FP + CTVLDLPHV+A +  +  +N+ + AG+MFE 
Sbjct  183   FEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVLDLPHVVAGLQGS--KNLNYFAGDMFEA  240

Query  795   IPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYSR-  971
             IP A+A+LLKWI+HDW DEECVKILK+C+EAIPS+E GGKVIIIDM+++++K D C SR 
Sbjct  241   IPPADAILLKWILHDWSDEECVKILKRCREAIPSKERGGKVIIIDMMVKNQKGD-CKSRE  299

Query  972   AELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
              +L+ D+L+M L   KER +K+WEKL  EAGFS YKITP LGLRSLIE++P
Sbjct  300   TQLFFDMLMMVLVTGKEREEKEWEKLFLEAGFSHYKITPILGLRSLIEVYP  350



>emb|CDP15886.1| unnamed protein product [Coffea canephora]
Length=348

 Score =   384 bits (986),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 184/351 (52%), Positives = 256/351 (73%), Gaps = 7/351 (2%)
 Frame = +3

Query  72    QSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSK  251
             ++  ELL A+    N +LN+  SA+LKCA++LGIPD I+ H KP+ L +L++ALPI+PSK
Sbjct  5     ENLTELLAAQNHVGNQMLNFRKSASLKCAIELGIPDAINQHGKPITLSELVSALPINPSK  64

Query  252   APYIHRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKS  431
             A +I+RL RFL ++G   + + G    Y+LT AGRL++K+EP NLRAF+   ++ V  K 
Sbjct  65    ANHIYRLMRFLSNAGFFVLQDQG----YALTAAGRLLLKEEPFNLRAFIFYMSDPVLVKP  120

Query  432   CYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKR  611
               SL +WF+N+DPSPF TAHG+  W Y + EP + ++FNE  A DS L++ V+++ + K 
Sbjct  121   WNSLTEWFRNDDPSPFHTAHGKNFWAYAAEEPNFANLFNEAMANDSTLIVQVMMT-QCKF  179

Query  612   VFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFE  791
             VFDG++SL DV GG GAVA AIA+ FP +KC V DLPHVIA  +    EN++FVAG+M E
Sbjct  180   VFDGLTSLADVGGGTGAVARAIAQNFPNLKCVVCDLPHVIAGQEG--TENLDFVAGDMLE  237

Query  792   NIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYSR  971
              +PAA+A+LLKWI+HDW DE+CVKILK CKEAIP R++GGKVIIIDM++E +  D     
Sbjct  238   KVPAADAILLKWILHDWSDEDCVKILKNCKEAIPGRDKGGKVIIIDMILESQVKDDDSVE  297

Query  972   AELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
              ++ +D+ ++  YG+KER +K+W KL  +AGFSDYKI PALG+  LI ++P
Sbjct  298   TQVGVDMQMLMCYGAKERTEKEWAKLFQDAGFSDYKILPALGVCCLIAVYP  348



>emb|CAN79968.1| hypothetical protein VITISV_043678 [Vitis vinifera]
Length=357

 Score =   384 bits (985),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 187/357 (52%), Positives = 247/357 (69%), Gaps = 7/357 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S  ELL A+A  WNHI N+I S +LKCA QLGIPDIIHNH KPM L +L+A LP+H
Sbjct  5     NGEIS-AELLHAQAHVWNHIFNFIKSMSLKCATQLGIPDIIHNHGKPMTLPELVAKLPVH  63

Query  243   PSKAPYIHRLTRFLVHSGLLS---VTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNE  413
             P ++  ++RL R LVHSG L+   V    +EE Y LT A RL++ D+ +++R  +    +
Sbjct  64    PKRSQCVYRLMRILVHSGFLAAQRVQQGEEEEGYVLTDASRLLLMDDSLSIRPLVLAMLD  123

Query  414   YVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLL  593
              +  K  + L  WFQN+DP+PF TA+    WDY  HEP  N+ FNE  A D++LL  VLL
Sbjct  124   PILTKPWHYLSAWFQNDDPTPFHTAYEXXFWDYAGHEPQLNNSFNEAMASDARLLTXVLL  183

Query  594   SGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFV  773
               E   VF G++SLVDV GG G VA AIA  FP + CTVLDL HV+A +  +  +N+ + 
Sbjct  184   K-EGXGVFAGLNSLVDVGGGTGKVAKAIAXAFPHLNCTVLDLSHVVAGLQGS--KNLNYF  240

Query  774   AGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKH  953
             AG+MFE IP A+A+LLKWI+HDW DEECVKILK+C+EAIPS+E GGKVIIIDM++   + 
Sbjct  241   AGDMFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQG  300

Query  954   DPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             D      +L+ D+ +M     +ER++ +WEK+  +AGFS YKITP LGLRSLIE++P
Sbjct  301   DDKSIETQLFFDMTMMIFSAGRERDENEWEKIFLDAGFSHYKITPILGLRSLIEVYP  357



>ref|XP_004303127.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=367

 Score =   384 bits (986),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 185/356 (52%), Positives = 255/356 (72%), Gaps = 6/356 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H +PM L +L +ALPI+
Sbjct  16    NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGRPMTLSELTSALPIN  74

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  I+RL R L+HSG  +    +   EE Y LT A +L++KD P+++  FL+   + 
Sbjct  75    PTKSHSIYRLMRILIHSGFFAKKKLSKSDEEGYVLTDASQLLLKDHPLSITPFLNAMLDP  134

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K  +    WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  135   VLTKPWHYFSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIVD  194

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              E + VF+G+ SLVDV GG G VA AIA  FP +KCTVLDLPHV+A  D    +N+++  
Sbjct  195   -ECRGVFEGLDSLVDVGGGTGTVAKAIADAFPHIKCTVLDLPHVVA--DLQGSKNLKYTG  251

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+AVLLKWI+HDW DEECVKIL++ KEAI  +++ GKVIIIDM++E++K D
Sbjct  252   GDMFEAVPPADAVLLKWILHDWNDEECVKILERSKEAITGKDKKGKVIIIDMMMENQKGD  311

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYKITP LGLRSLIE++P
Sbjct  312   EESMETQLFFDMLMMALVTGKERNEKEWSKLFTDAGFSDYKITPILGLRSLIEVYP  367



>gb|AFX68805.1| O-metyltransferase [Vitis riparia]
Length=357

 Score =   384 bits (985),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 185/350 (53%), Positives = 244/350 (70%), Gaps = 6/350 (2%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPYI  263
             ELL A+A  WNHI N+I S +LKCA QLGIPDIIHNH KPM L +L+A LP+HP ++  +
Sbjct  11    ELLHAQAHVWNHIFNFIKSMSLKCATQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  264   HRLTRFLVHSGLLS---VTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSC  434
             +RL R LVHSG L+   V    +EE Y LT A RL++ D+ +++R  +    + +  K  
Sbjct  71    YRLMRILVHSGFLAAQRVQQGEEEEGYVLTDASRLLLMDDSLSIRPLVLAMLDPILTKPW  130

Query  435   YSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKRV  614
             + L  WFQN+DP+PF TA+    WDY  HEP  N+ FNE  A D++LL  VL+  E K V
Sbjct  131   HYLSAWFQNDDPTPFHTAYERPFWDYAGHEPQLNNSFNEAMASDARLLTSVLIK-EGKGV  189

Query  615   FDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFEN  794
             F G++SLVDV GG G VA AIA  FP + CTVLDLPHV+A +  +  +N+ + AG+MFE 
Sbjct  190   FAGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQGS--KNLNYFAGDMFEA  247

Query  795   IPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYSRA  974
             IP A+A+LLKWI+HDW DEECVKILK+C+EAIPS+E GGKVIIIDM++   + D      
Sbjct  248   IPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQGDYKSIET  307

Query  975   ELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             +L+ D+ +      +ER++ +WEKL  +AGFS YKITP LGLRSLIE++P
Sbjct  308   QLFFDMTMTIFAPGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>ref|XP_006357086.1| PREDICTED: tabersonine 16-O-methyltransferase-like [Solanum tuberosum]
Length=351

 Score =   383 bits (983),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 186/353 (53%), Positives = 258/353 (73%), Gaps = 8/353 (2%)
 Frame = +3

Query  72    QSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIA--ALPIHP  245
             +S+ ELLQA+ Q WNHI +++ S+ L+CAVQL IPDI++ H KPM L DL    +L I P
Sbjct  5     ESNSELLQAQTQIWNHIFSFMSSSALRCAVQLDIPDILYKHGKPMHLSDLSTELSLIIDP  64

Query  246   SKAPYIHRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQ  425
             SK  ++  L RFLVHSG++        + YSLTP+ R +VKDEP NLR+ + + ++   Q
Sbjct  65    SKISFLPNLMRFLVHSGIIE---QHDHDYYSLTPSSRFLVKDEPFNLRSLVLLTHDPSVQ  121

Query  426   KSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGES  605
             K+ + LG+W++N+ P+ F TA+G+  WDY S EP   D+FN+V A +S L++ +L++ E 
Sbjct  122   KAWFELGNWYKNDIPTSFHTANGKYFWDYFSKEPKLGDIFNDVMASESGLIVNMLIT-EC  180

Query  606   KRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNM  785
             + VF+G++SLVDV GG G +A AIAK FP++ C V DLPHVI   D  S  N+EFV G+M
Sbjct  181   RHVFEGLTSLVDVGGGTGTMAIAIAKAFPSINCIVFDLPHVIE--DLKSNGNMEFVGGDM  238

Query  786   FENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCY  965
             F+ IP ANA+LLKWI+H+W DE+CVKILKKCKE+IPSR+EGGK+IIID+V+ED K+   Y
Sbjct  239   FQKIPNANAILLKWILHNWNDEDCVKILKKCKESIPSRDEGGKLIIIDIVLEDPKNMSDY  298

Query  966   SRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
              RA+  MD+++M  + +KER KK+WEKL +EAGF++ KIT   G RSLIE++P
Sbjct  299   VRAQHNMDMMMMVCFAAKERTKKEWEKLFNEAGFNECKITSIPGSRSLIEVYP  351



>ref|XP_009625456.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=357

 Score =   383 bits (983),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 195/360 (54%), Positives = 262/360 (73%), Gaps = 12/360 (3%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIA--ALP  236
             +  +S  ELL+A+AQ WNHI N+I S+ ++CA+QLGI D+++ + KPM L DL A  +L 
Sbjct  2     SASESSTELLRAQAQIWNHIFNFISSSAVRCALQLGILDVLYKYGKPMSLSDLSAELSLV  61

Query  237   IHPSKAPYIHRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             I+PSK  ++  L RFLVHSG L+     Q+  YSLTPA  L+VK+EP N+R+ L I ++ 
Sbjct  62    INPSKVSFLPILMRFLVHSGFLN--QDDQDHHYSLTPASCLLVKNEPFNVRSLLVINHDP  119

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPG--YNDVFNEVTAKDSQLLMIVL  590
             VF K+ + L  WFQN+ P+ F TA+G+ +WDYI  +      D+FN+  A DS+L   VL
Sbjct  120   VFSKAWFVLSTWFQNDSPTAFHTANGKSLWDYIVDQESRVLGDIFNDALASDSRLNTNVL  179

Query  591   LSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEF  770
             ++ E K VF+G++SLVDV GG G V+ AIAK FP +KCTVLDLPHV+   D     N+EF
Sbjct  180   IT-ECKHVFEGLNSLVDVGGGTGTVSIAIAKAFPNIKCTVLDLPHVVE--DCKGSGNLEF  236

Query  771   VAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIED--  944
             V G+MF+NIP ANA+LLK I+HDW DE+CVKILKKCKE+IP+RE+GGKVIIID V+ED  
Sbjct  237   VGGDMFDNIPHANAILLKCILHDWRDEDCVKILKKCKESIPNREKGGKVIIIDTVMEDDT  296

Query  945   -KKHDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELF  1121
              K+ +  + RA+  MD+L+M L  SKER KK+WEKL ++AGF++YKI  ALGLRSLIE++
Sbjct  297   KKQSNDEFIRAQHNMDMLMMVLCASKERTKKEWEKLFTDAGFTEYKIISALGLRSLIEIY  356



>ref|XP_009780812.1| PREDICTED: myricetin O-methyltransferase-like [Nicotiana sylvestris]
Length=353

 Score =   382 bits (982),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 191/358 (53%), Positives = 245/358 (68%), Gaps = 12/358 (3%)
 Frame = +3

Query  60    ENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALP-  236
             ENG     +LL+A+AQ WNH+ ++I+S+  KCAVQLGIPD+++ H KPM   DL A LP 
Sbjct  5     ENGS---TDLLRAQAQIWNHMFSFINSSATKCAVQLGIPDVLYKHGKPMSFSDLSAELPL  61

Query  237   IHPSKAPYIHRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             +HPSK  ++  L RFLVHSG L   N   +  YSLTP  RL+  + P   R+   I +  
Sbjct  62    VHPSKVSFLTILMRFLVHSGFL---NQHDQNHYSLTPVSRLLATNNPSGTRSHFLINHIQ  118

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             +  K+ + L  WFQN+ P+ F TAHG   WDY    P   + FN   A DS L+  VL++
Sbjct  119   LLSKASFELSRWFQNDSPTAFHTAHGISFWDYFVENPKLGESFNVAMASDSMLVANVLIT  178

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              E K VF+G++SLVDV GG G V+ AIAK FP + CTV DLPHVI  +  +   N+EFV 
Sbjct  179   -ECKYVFEGLTSLVDVGGGTGTVSIAIAKAFPMINCTVFDLPHVIGDLKGSG--NLEFVR  235

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKK--  950
             G+MF+ IP ANA+LLKWI+HDW DE+CVKILKKCKEAIP RE+GGKVIIIDMV+ED K  
Sbjct  236   GSMFDKIPKANAILLKWILHDWSDEDCVKILKKCKEAIPCREKGGKVIIIDMVMEDPKLI  295

Query  951   HDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
              D  + RA+  MDLL+  L  +KER KK+WEKL +E+GF+ Y ITP+LG RSLIE++P
Sbjct  296   SDEEFVRAQHNMDLLMTVLCAAKERTKKEWEKLFTESGFTQYNITPSLGSRSLIEIYP  353



>emb|CDP19709.1| unnamed protein product [Coffea canephora]
Length=348

 Score =   382 bits (981),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 181/351 (52%), Positives = 255/351 (73%), Gaps = 7/351 (2%)
 Frame = +3

Query  72    QSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSK  251
             ++  ELL A+    N + N+  SA+LKCA++LGIPD I+ H KP+ L +L++ALPI+PSK
Sbjct  5     ENLTELLAAQNHVGNQMPNFRKSASLKCAIELGIPDAINQHGKPITLSELVSALPINPSK  64

Query  252   APYIHRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKS  431
             A +I+RL RFL ++G   +    Q++ Y+LT AGRL++K+EP NLRAF+   ++ V  K 
Sbjct  65    ANHIYRLMRFLSNAGFFVL----QDQGYALTAAGRLLLKEEPFNLRAFIFYTSDPVLVKP  120

Query  432   CYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKR  611
               SL +WF+N+DPSPF TAHG+  W Y + EP + ++FNE  A DS L + V+++ + K 
Sbjct  121   WNSLTEWFRNDDPSPFHTAHGKNFWAYAAEEPNFANLFNEAMANDSTLTVQVMMT-QCKF  179

Query  612   VFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFE  791
             VFDG++SLVDV GG GAVA AIA+ FP ++C V DLPHVIA  +    EN++FVAG+M E
Sbjct  180   VFDGLTSLVDVGGGTGAVARAIAQNFPNLECVVCDLPHVIAGQEG--TENLDFVAGDMLE  237

Query  792   NIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYSR  971
              +PAA+A+LLKWI+HDW D++CVKILK CKEAIP R++GGKVIIIDM++E    D     
Sbjct  238   KVPAADAILLKWILHDWSDDDCVKILKNCKEAIPGRDKGGKVIIIDMILESHMKDDESVE  297

Query  972   AELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
              +  +D+ ++  YG+KER +K+W K+  +AGFSDYK+ P LG+R LIE++P
Sbjct  298   TQFVVDMQMLTCYGAKERTEKEWAKVFQDAGFSDYKVLPVLGVRCLIEVYP  348



>ref|XP_003527407.1| PREDICTED: trans-resveratrol di-O-methyltransferase isoform 1 
[Glycine max]
Length=352

 Score =   382 bits (982),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 188/350 (54%), Positives = 247/350 (71%), Gaps = 11/350 (3%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPYI  263
             +LL A+   WNHI ++I+S +LKCA++L IPDIIH + +PMPL  L  +L IHPSKA  I
Sbjct  11    KLLGAQTHVWNHIFSFINSMSLKCAIELDIPDIIHKYGQPMPLSKLTTSLSIHPSKANCI  70

Query  264   HRLTRFLVHSGLLS---VTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSC  434
             +RL R L HSG  S   V  +  E  Y LT A  L++KD P+++  FLH   +    +  
Sbjct  71    YRLMRILTHSGFFSQHKVNENELEMGYVLTDASTLLLKDNPLSMVPFLHAMLDPTLTQPW  130

Query  435   YSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKRV  614
               L  WF+N+DPSPF TAHG KIWDY   EP  ND+FN+  A D+QL+  V++    K V
Sbjct  131   LQLPTWFKNDDPSPFQTAHGMKIWDYADREPRLNDLFNDAMASDTQLVANVVIE-RCKGV  189

Query  615   FDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFEN  794
             F+G+ SLVDV GG G +A AIAK FP ++CTV DLPHV+A++  +  EN+++V G+MFE+
Sbjct  190   FNGLESLVDVGGGTGTMAMAIAKSFPQLECTVFDLPHVVATLQGS--ENLKYVGGDMFES  247

Query  795   IPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYSRA  974
             IP+A+A+LLKWI+HDW DE+CVKILKKCKEAI S     KVIIIDMV+E++K D      
Sbjct  248   IPSADAILLKWILHDWNDEQCVKILKKCKEAIKS-----KVIIIDMVVENEKGDDESIET  302

Query  975   ELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             +L++D++VM LY  KER +K+W KLI   GFSDYKITP LGLRSLIE++P
Sbjct  303   QLFIDMVVMVLYPGKERTEKEWAKLIFSTGFSDYKITPVLGLRSLIEIYP  352



>gb|ABQ02270.2| O-methyltransferase [Vitis vinifera]
Length=357

 Score =   382 bits (982),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 183/350 (52%), Positives = 245/350 (70%), Gaps = 6/350 (2%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPYI  263
             ELL A+A  WNHI N+I S +LKCA+QLGIPDIIHNH KPM L +L+A LP+HP ++  +
Sbjct  11    ELLHAQAHVWNHIFNFIKSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  264   HRLTRFLVHSGLLS---VTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSC  434
             +RL R LVHSG L+   V    +EE Y LT A RL++ D+ +++R  +    + +  K  
Sbjct  71    YRLMRILVHSGFLAAQRVQQGKEEEGYVLTDASRLLLMDDSLSIRPLVLAMLDPILTKPW  130

Query  435   YSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKRV  614
             + L  WFQN+DP+PF TA+    WDY  HEP  N+ FNE  A D++LL  VLL  E + V
Sbjct  131   HYLSAWFQNDDPTPFHTAYERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLLK-EGQGV  189

Query  615   FDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFEN  794
             F G++SLVDV GG G VA AIA  FP + CTVLDL HV+A +  +  +N+ + AG+MF  
Sbjct  190   FAGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLSHVVAGLQGS--KNLNYFAGDMFGA  247

Query  795   IPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYSRA  974
             IP A+A+LLKWI+HDW +EECVKILK+C+EAIPS+E GGKVIIIDM++   + D   +  
Sbjct  248   IPPADAILLKWILHDWSNEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQGDYKSTET  307

Query  975   ELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             +L+ D+ +M     +ER++ +WEKL  +AGFS YKITP LGLRSLIE++P
Sbjct  308   QLFFDMTMMIFAPGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>ref|XP_002278398.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
 emb|CBI21930.3| unnamed protein product [Vitis vinifera]
Length=358

 Score =   382 bits (981),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 192/359 (53%), Positives = 258/359 (72%), Gaps = 10/359 (3%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG++S  ELLQA+A  WNHI N+I+S +LKCA+QLGIPDIIHNH KPM L +L+A LP+ 
Sbjct  5     NGERSS-ELLQAQAHVWNHIFNFINSMSLKCAIQLGIPDIIHNHCKPMTLHELVAKLPVR  63

Query  243   PSKAPYIHRLTRFLVHSGLLS---VTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNE  413
             P+K   +HRL R LVHSG  +   V  S  EE Y L  A RL++KD P+++  FL + + 
Sbjct  64    PNKTLCVHRLMRILVHSGFFTKQRVQESADEEGYVLANASRLLLKDHPLSITPFLLLLDP  123

Query  414   YVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLL  593
              + +   Y+   WFQN+DP+PF TAHG  +WDY  HEP +N+ FNE  A D++L+  VL+
Sbjct  124   DLTEPWDYA-SAWFQNDDPTPFFTAHGRTLWDYGCHEPRFNNFFNEGMASDARLVTSVLV  182

Query  594   SGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFV  773
               E K  F+G++S VDV GG G VA  I + FP +  TVLDLPHV+A  D    +N+ ++
Sbjct  183   K-ECKGAFEGLNSFVDVGGGTGTVAKTIVEAFPHLHGTVLDLPHVVA--DLRGSKNLTYL  239

Query  774   AGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKH  953
             AG++FE IP A+A+LLKWI+HDW DEEC+KILK+C+EAIPS+E+GGKV+IIDM I++KK 
Sbjct  240   AGDLFEAIPPADAILLKWILHDWSDEECLKILKQCREAIPSKEKGGKVMIIDMAIQNKKG  299

Query  954   DPCYSRAE--LYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             D   S  E  L+ D+L+M L   +ER +K+W+KL  ++GFS YKITP LGLRSLIE++P
Sbjct  300   DDDESNVETQLFFDMLMMVLLPGREREEKEWKKLFLDSGFSGYKITPILGLRSLIEVYP  358



>ref|NP_001267963.1| O-methyltransferase [Vitis vinifera]
 gb|AEP17010.1| O-methyltransferase [Vitis vinifera]
Length=357

 Score =   381 bits (979),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 184/350 (53%), Positives = 244/350 (70%), Gaps = 6/350 (2%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPYI  263
             ELL A+A  WNHI N+I S +LKCA+QLGIPDIIHNH KPM L +L+A LP+HP ++  +
Sbjct  11    ELLHAQAHVWNHIFNFIKSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  264   HRLTRFLVHSGLLS---VTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSC  434
             +RL R LVHSG L+   V    +EE Y LT A RL++ D+ +++R  +    + +  K  
Sbjct  71    YRLMRILVHSGFLAAQRVQQGKEEEGYVLTDASRLLLMDDSLSIRPLVLAMLDPILTKPW  130

Query  435   YSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKRV  614
             + L  WFQN+DP+PF TA+    WDY  HEP  N+ FNE  A D++LL  VLL  E + V
Sbjct  131   HYLSAWFQNDDPTPFHTAYERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLLK-EGQGV  189

Query  615   FDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFEN  794
             F G++SLVDV GG G VA AIA  FP + CTVLDL HV+A +  +  +N+ + AG+MFE 
Sbjct  190   FAGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLSHVVAGLQGS--KNLNYFAGDMFEA  247

Query  795   IPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYSRA  974
             IP A A+LLKWI+HDW DEECVKILK+C+ AIPS+E+GGKVIIIDM++   + D      
Sbjct  248   IPPAVAILLKWILHDWSDEECVKILKRCRGAIPSKEKGGKVIIIDMIMMKNQGDYKSIET  307

Query  975   ELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             +L+ D+ +M     +ER++ +WEKL  +AGFS YKITP LGLRSLIE++P
Sbjct  308   QLFFDMTMMIFAPGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>ref|NP_001268044.1| trans-resveratrol di-O-methyltransferase [Vitis vinifera]
 gb|AEP17011.1| O-methyltransferase [Vitis vinifera]
Length=357

 Score =   381 bits (979),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 183/350 (52%), Positives = 242/350 (69%), Gaps = 6/350 (2%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPYI  263
             ELL A+A  WNHI N+I S +LKCA+QLGIPD IHNH KPM L +L+A LP+HP ++  +
Sbjct  11    ELLHAQAHVWNHIFNFIKSMSLKCAIQLGIPDTIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  264   HRLTRFLVHSGLLS---VTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSC  434
             +RL R LVHSG L+   V    +EE Y LT A RL++ D+ +++R  +    + +  K  
Sbjct  71    YRLMRILVHSGFLAAQRVQQGKEEEGYVLTDASRLLLMDDSLSIRPLVLAMLDPILTKPW  130

Query  435   YSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKRV  614
             + L  WFQN+DP+PF T +    WDY  HEP  N+ FNE  A D++LL  VLL  E + V
Sbjct  131   HYLSAWFQNDDPTPFHTTYERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLLK-EGQGV  189

Query  615   FDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFEN  794
             F G++SLVDV GG G VA AIA  FP + CTVLDLPHV+A +  +  +N+ + AG+MFE 
Sbjct  190   FAGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQGS--KNLNYFAGDMFEA  247

Query  795   IPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYSRA  974
             IP A+A+LLKW +HDW DEECVKILK+C+EAIPS+E GGKVIIIDM++   + D      
Sbjct  248   IPPADAILLKWTLHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQGDYKSIET  307

Query  975   ELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             +L+ D+ +M     +ER++ +WEKL   AGFS YKITP LGLRSLIE++P
Sbjct  308   QLFFDMTMMIFAPGRERDENEWEKLFLGAGFSHYKITPILGLRSLIEVYP  357



>ref|XP_006365444.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=352

 Score =   380 bits (977),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 187/347 (54%), Positives = 250/347 (72%), Gaps = 10/347 (3%)
 Frame = +3

Query  93    QAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPI-HPSKAPYIHR  269
              A+AQ WN+I N++ S+ +KCA+QL IPD+++ H KPM L DL A L + + SK  ++  
Sbjct  13    HAQAQIWNYIFNFVSSSAVKCALQLEIPDVLYKHEKPMCLSDLSAELSVVNSSKISFLPI  72

Query  270   LTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSCYSLGD  449
             L RFLV SG L+      E+ Y LTPA RL+VK+E  N+R+FL + +   F K+   L D
Sbjct  73    LMRFLVQSGFLN----QHEDHYFLTPASRLLVKNESFNVRSFLLLSHSQAFSKAWSELSD  128

Query  450   WFQNNDPSPFCTAHGEKIWDYISHEPG--YNDVFNEVTAKDSQLLMIVLLSGESKRVFDG  623
             WFQN+ P+PF TAHG+ +WDYI  E      D+FN+  A DS+L   +L++ E K VF+G
Sbjct  129   WFQNDSPTPFHTAHGKSVWDYIGEEQPSVLGDIFNDALASDSRLNTNILIT-ECKHVFEG  187

Query  624   VSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFENIPA  803
             ++SLVDV GG G V+ AIAK FP +KCTVLDLP VI  +  +   N++F+ G+MF+ IP 
Sbjct  188   LTSLVDVGGGTGTVSIAIAKAFPNIKCTVLDLPQVIGYLKGSG--NLDFIGGDMFDKIPQ  245

Query  804   ANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYSRAELY  983
             ANA+LLK ++HDW DE+CVKILKKC+E+IPS+EEGGKVIIID V+ED K    + RA+  
Sbjct  246   ANAILLKCVLHDWNDEDCVKILKKCRESIPSKEEGGKVIIIDTVLEDPKQRNEFVRAQHN  305

Query  984   MDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             MD+L+M L+GSKER KK+WEKL  E GF++YKI PALGLRSLIE++P
Sbjct  306   MDMLMMVLFGSKERTKKEWEKLFIEVGFNEYKIIPALGLRSLIEIYP  352



>ref|XP_002278149.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   380 bits (975),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 187/358 (52%), Positives = 256/358 (72%), Gaps = 9/358 (3%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             +GK++ + LLQA+A  WNH +N+++S  LKCAV+LGIPD I+NH +P+ L +L+ AL I+
Sbjct  5     SGKRASL-LLQAQAHVWNHTMNFVNSMALKCAVRLGIPDAINNHGQPITLSELVTALSIN  63

Query  243   PSKAPYIHRLTRFLVHSGLLS---VTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNE  413
             P KAP +HRL R LVHSG  +     ++ QE+ YSLT A R ++KDEP +    L +  +
Sbjct  64    PIKAPCLHRLMRVLVHSGFFAQQQADHNEQEQLYSLTYASRFLLKDEPTSGAPLLLVQVD  123

Query  414   YVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLL  593
                   C+ L DWF+N+DP+PF TA+G+  WDY +HEP +N+ FNE  A DSQL+  V++
Sbjct  124   PHLTNPCHFLSDWFRNSDPTPFVTAYGKPFWDYAAHEPKFNNFFNEAMASDSQLIASVVV  183

Query  594   SGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFV  773
              GE K VF G+SSL+DV GG G +A  IAK FP +KCTV D PHV+A++     EN+EFV
Sbjct  184   -GECKEVFRGLSSLIDVGGGTGTMAKVIAKAFPHLKCTVFDQPHVVANLQGG--ENLEFV  240

Query  774   AGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAI-PSREEGGKVIIIDMVIEDKK  950
              G++FE IP A+A+LLK I+H+W D ECVKILKKCKEAI P +++GGKVIIID+V+E+ K
Sbjct  241   GGDIFEAIPPADAILLKSILHNWSDGECVKILKKCKEAIHPRKDKGGKVIIIDIVMENNK  300

Query  951   HDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
              D     A+L+ D+L+M +   KERN+++WE L   AGF+ YKIT  LG RSLIE++P
Sbjct  301   GDEAV-EAQLFYDILMMVVVAGKERNEREWENLFLAAGFAHYKITSTLGPRSLIEVYP  357



>ref|XP_008229109.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=354

 Score =   380 bits (975),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 186/358 (52%), Positives = 246/358 (69%), Gaps = 5/358 (1%)
 Frame = +3

Query  54    MGENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAAL  233
             MG   + SH ELLQA+A  WNHI ++I+S +LKCAVQLGIPD+I  H +PM L +L++AL
Sbjct  1     MGSEVRASH-ELLQAQAHIWNHIFSFINSMSLKCAVQLGIPDVIQKHGQPMTLSELVSAL  59

Query  234   PIHPSKAPYIHRLTRFLVHSGLLSVTN-SGQEECYSLTPAGRLVVKDEPINLRAFLHICN  410
             PI P+KA +I RL R LVHS   +  + SG E+ Y LT A  L+++D P++ R FL    
Sbjct  60    PISPTKAHFIPRLMRILVHSSFFARESLSGGEQGYVLTDASTLLLEDNPMSARPFLLAVL  119

Query  411   EYVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVL  590
               +       L  WFQN++P+PF   HG   WDY + +P     FN+  A D++L+  ++
Sbjct  120   NPILTDPWQYLTTWFQNDNPTPFHMVHGMTFWDYGNQDPTIAHFFNDAMASDARLISSLV  179

Query  591   LSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEF  770
             +  E K VF GV SLVDV GG G VA +IA  FP MKCTVLDLPHV+A  D    +N+E+
Sbjct  180   ID-ECKGVFQGVDSLVDVGGGTGTVAKSIADAFPHMKCTVLDLPHVVA--DLKGSKNLEY  236

Query  771   VAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKK  950
             VAG+MF+ +PAA+A+ LKWI+HDW DEECVKIL++CKEAI    + GKVII+DM +EDK 
Sbjct  237   VAGDMFDAVPAADAIFLKWILHDWSDEECVKILERCKEAITREGKKGKVIIVDMTVEDKN  296

Query  951   HDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
              D      +L+ D+ +M L   KERN+K+W KL S+AGFS YKITP+LGLRSLIE++P
Sbjct  297   TDKESGETQLFFDMEMMVLATGKERNEKEWAKLFSDAGFSHYKITPSLGLRSLIEVYP  354



>ref|XP_002278057.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   379 bits (974),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 193/351 (55%), Positives = 255/351 (73%), Gaps = 8/351 (2%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPYI  263
             ELLQA+A  WNHI N+++S +LKCA+QLGIPDIIHNH KPM L +L+A LP+HP K  Y+
Sbjct  11    ELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKKTQYV  70

Query  264   HRLTRFLVHSGLLSVTNSGQ---EECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSC  434
             +RL R LV S   +   + Q   EE Y LT A +L++KD+ +++R FL    +    K  
Sbjct  71    YRLMRVLVQSDFFAAQRAQQSEEEEGYVLTHASQLLLKDDSLSVRPFLLAMLDPTLTKPW  130

Query  435   YSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKRV  614
             + +  WFQN+DP+PF TAH   +WDY  HEP  N   NE  A D++L+  VL+  E K V
Sbjct  131   HYVSAWFQNDDPTPFNTAHERTLWDYAGHEPQLNYFINEAMASDARLVTSVLVK-EGKGV  189

Query  615   FDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFEN  794
             F+G++SLVDV GG G VA AIA  FP + CTVLDLPHV+A +  +  +N+ + AG+MFE 
Sbjct  190   FEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVLDLPHVVAGLQGS--KNLNYFAGDMFEP  247

Query  795   IPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYSR-  971
             IP A+A+LLKWI+HDW DEECVKILK+C+EAIPS+E+GGKVIIIDM+++++K D C SR 
Sbjct  248   IPPADAILLKWILHDWSDEECVKILKRCREAIPSKEKGGKVIIIDMMMKNQKGD-CKSRE  306

Query  972   AELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
              +L+ D+L+M L   KER +K+WEKL  +AGFS YKITP LGLRSLIE++P
Sbjct  307   TQLFFDMLMMVLVTGKEREEKEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>ref|XP_003544912.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
1 [Glycine max]
Length=358

 Score =   379 bits (973),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 181/361 (50%), Positives = 251/361 (70%), Gaps = 7/361 (2%)
 Frame = +3

Query  54    MGENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAAL  233
             M  + ++   +LL+A+   WNHI ++I+S +LKC V LGIPDIIHN+ +PMPL +LIA+L
Sbjct  1     MESHDEEHAAKLLRAQTHIWNHIFSFINSMSLKCVVDLGIPDIIHNYGQPMPLSNLIASL  60

Query  234   PIHPSKAPYIHRLTRFLVHSGLLSVTNSGQEE----CYSLTPAGRLVVKDEPINLRAFLH  401
             PIHPSK  ++HRL R ++HSG  S+ N   E      Y LT A  L++K+ P+++  FLH
Sbjct  61    PIHPSKTCFVHRLMRIMIHSGFFSLQNHDLENELEAKYVLTDASVLLLKNHPMSVTPFLH  120

Query  402   ICNEYVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLM  581
                + V          WF+N DP+PF TAHG+  WDY   +P  N +FN+  A D++ + 
Sbjct  121   AMLDPVLTNPWNQFSTWFKNGDPTPFETAHGKMFWDYAGADPKLNHLFNDAMASDARFVT  180

Query  582   IVLLSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVEN  761
              +++  + K VF G+ SLVDV GG G +A AIAK FP ++C V DLPHV++ +  +  EN
Sbjct  181   SLVIE-KCKGVFMGLESLVDVGGGTGTMAKAIAKSFPRVECIVFDLPHVVSGLKGS--EN  237

Query  762   VEFVAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIE  941
             +++VAG+MFE IP A+A+LLKWI+HDW DEECV ILKKCKEAI  + + GKVIIIDMV+E
Sbjct  238   LKYVAGDMFEAIPPADAILLKWILHDWNDEECVDILKKCKEAITRKGKEGKVIIIDMVVE  297

Query  942   DKKHDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELF  1121
             ++K D      +L+ D+L+M L   KER+KK+W KLIS AG+++YKITP LGLRSLIE++
Sbjct  298   NEKRDDESVETQLFFDMLMMVLVTGKERSKKEWAKLISSAGYNNYKITPVLGLRSLIEIY  357

Query  1122  P  1124
             P
Sbjct  358   P  358



>gb|KDP24061.1| hypothetical protein JCGZ_25718 [Jatropha curcas]
Length=367

 Score =   378 bits (971),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 190/361 (53%), Positives = 245/361 (68%), Gaps = 14/361 (4%)
 Frame = +3

Query  72    QSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSK  251
             Q H +LLQA+A  WNHI N+I+S +LKCA+QLGIPD I+ H KPM L DLI AL IHP+K
Sbjct  11    QDHNQLLQAQAHIWNHIFNFINSMSLKCAIQLGIPDAINKHGKPMTLSDLIIALSIHPAK  70

Query  252   APYIHRLTRFLVHSGLL----SVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYV  419
                I RL R LVHSG L    +  NS + E Y LT A +L+VK+ P +L+ FL    + V
Sbjct  71    THAIPRLVRILVHSGFLDKEKTEENSQETEGYVLTNASKLLVKEHPFSLKTFLLAMLDPV  130

Query  420   FQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSG  599
                    L  WF N+DP+PF T HG  IW Y  H P  N  FNE  A D++++  +L+  
Sbjct  131   LTGPWDHLTTWFLNDDPTPFQTCHGRGIWKYAGHNPELNSSFNEAMACDAKMVASILIK-  189

Query  600   ESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAG  779
             E + VFDG+ SLVDV GG G VA A+A  FP + C V DLPHV+A +     +N++FV G
Sbjct  190   ECEGVFDGLKSLVDVGGGTGTVAKALADSFPQLDCCVFDLPHVVAGLQDG--DNLKFVGG  247

Query  780   NMFENIPAANAVLLK------WIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIE  941
             +MFE IP A+A+LLK      WIMHDW DE+C+KILK CKEAI  R +GGK+IIIDMV+E
Sbjct  248   DMFEEIPPADAILLKACYYIYWIMHDWHDEKCIKILKNCKEAIKGR-KGGKLIIIDMVME  306

Query  942   DKKHDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELF  1121
              +K D   +  EL++D+L++ LY  KERNKK+W KL  +AGFSD+KITP LGLRS++E++
Sbjct  307   TQKEDKDATETELFLDMLMIVLYNGKERNKKEWAKLFFDAGFSDFKITPVLGLRSVVEVY  366

Query  1122  P  1124
             P
Sbjct  367   P  367



>ref|XP_002262833.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=358

 Score =   378 bits (970),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 179/351 (51%), Positives = 242/351 (69%), Gaps = 7/351 (2%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPYI  263
             ELLQA+AQ  NH+ N+++S  LKCA+ L IPD+IH+H +PM L  L+ AL + PSKAP +
Sbjct  11    ELLQAQAQVVNHVFNFMNSMALKCAIDLAIPDVIHSHGQPMLLSQLVTALSVQPSKAPCL  70

Query  264   HRLTRFLVHSGLLS----VTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKS  431
             HRL R LVHSG  S    + N+ QEE YSLT A R ++KDEP+       +    V    
Sbjct  71    HRLMRLLVHSGFFSQQQVIHNNEQEEGYSLTSASRFLLKDEPLTGLPLSLLHLNPVLTAP  130

Query  432   CYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKR  611
              + L  WF+N DP+PF TAHG+  WDY + EP +ND+FNE  A DS+++  VL++ + K 
Sbjct  131   WHFLSGWFRNGDPTPFYTAHGKPYWDYTAQEPDFNDLFNEAMASDSRIIASVLIT-KCKE  189

Query  612   VFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFE  791
              F G+ SLVDV  G G +  AIAK FP +KC V D PHV+A +      N+E V G+MFE
Sbjct  190   QFKGLFSLVDVGAGTGTMTKAIAKAFPHLKCIVFDQPHVVADLQGGG--NLEVVGGDMFE  247

Query  792   NIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYSR  971
              IP+ANAV+LKWI+H+W DEECVKILKKCKEAIP++++GGK++IIDMV+E+ K D     
Sbjct  248   TIPSANAVILKWILHNWSDEECVKILKKCKEAIPTKDKGGKLMIIDMVMENNKGDDQAVE  307

Query  972   AELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
              +L+ D+L+M +   K+RN+ +W+KL   AGF+ YKI+  LG RSLIE++P
Sbjct  308   TQLFWDMLMMTVLTGKQRNENEWKKLFVTAGFTHYKISAVLGFRSLIEVYP  358



>emb|CAN83014.1| hypothetical protein VITISV_029725 [Vitis vinifera]
Length=357

 Score =   377 bits (968),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 189/350 (54%), Positives = 250/350 (71%), Gaps = 6/350 (2%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPYI  263
             ELLQA+A  WNHI N+++S +LKCA+QLGIPDIIHNH KPM L +L+A LP+HP K  Y+
Sbjct  11    ELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKKTQYV  70

Query  264   HRLTRFLVHSGLLSVTNSGQ---EECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSC  434
             +RL R LV S   +   + Q   EE Y LT A  L++KD+ +++R FL    +    K  
Sbjct  71    YRLMRVLVQSDFFAAQRAQQSEEEEGYVLTHASXLLLKDDSLSVRPFLLAMLDPTLTKPW  130

Query  435   YSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKRV  614
             + +  WFQN+DP+PF TAH   +WDY  HEP  N   NE  A D++L+  VL+  E K V
Sbjct  131   HYVSAWFQNDDPTPFNTAHERTLWDYAGHEPQLNYFINEAMASDARLVTSVLVK-EGKGV  189

Query  615   FDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFEN  794
             F+G++SLVDV GG G VA AIA  FP + CTVLDLPHV+A +  +  +N+ + AG+MFE 
Sbjct  190   FEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVLDLPHVVAGLQGS--KNLNYFAGDMFEX  247

Query  795   IPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYSRA  974
             IP A+A+LLKWI+HDW DEECVKILK+C+EAIPS+E+GGKVIIIDM+++++K D      
Sbjct  248   IPPADAILLKWILHDWSDEECVKILKRCREAIPSKEKGGKVIIIDMMMKNQKGDXKSRET  307

Query  975   ELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             +L+ D+L+M     KER +K+WEKL  +AGFS YKITP LGLRSLIE++P
Sbjct  308   QLFFDMLMMVXVTGKEREEKEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>ref|XP_006469135.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=402

 Score =   379 bits (972),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 184/361 (51%), Positives = 252/361 (70%), Gaps = 9/361 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             N  +   ELL+A+A  WNHI N+I+S +LKCAV+LGIPDII+ H KPM L +L++AL I+
Sbjct  44    NDGEHDTELLEAQAHVWNHIFNFINSMSLKCAVELGIPDIINKHGKPMTLNELVSALTIN  103

Query  243   PSKAPYIHRLTRFLVHSGLL-------SVTNSGQEECYSLTPAGRLVVKDEPINLRAFLH  401
             PSK   ++RL R L+HSG         S  N+ +E+ Y LT A +L++KD P+++  FL 
Sbjct  104   PSKTRCVYRLMRILIHSGFFAQQTLNSSRNNNDEEQGYVLTNASKLLLKDNPLSVTPFLQ  163

Query  402   ICNEYVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLM  581
                + +       L  WFQN+DP+PF TAHG+ +W+Y   EP  N+ FNE  A D++L  
Sbjct  164   AMLDPILLSPWLKLSTWFQNDDPTPFDTAHGKSLWEYAGDEPKINNFFNEAMASDARLAT  223

Query  582   IVLLSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVEN  761
              V++  + K VF+G++SLVDV GG G VA AIAK FP ++CT  DLPHV+  +++  + N
Sbjct  224   RVVIH-KCKDVFEGLNSLVDVGGGTGTVAKAIAKAFPNLECTDFDLPHVVNGLES-DLAN  281

Query  762   VEFVAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIE  941
             ++++ G+MFE IP A+AVL KWI+HDW DEECVKILKKCKEAI S  + GKVIIIDM+ E
Sbjct  282   LKYIGGDMFEAIPPADAVLFKWILHDWNDEECVKILKKCKEAITSDGKKGKVIIIDMMRE  341

Query  942   DKKHDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELF  1121
             +KK D      +L+ D+L+M L    ER++K+W KL ++AGFSDYKITP LGLRSLIE++
Sbjct  342   NKKGDSESIETQLFFDMLMMVLVTGTERDEKEWAKLFADAGFSDYKITPILGLRSLIEVY  401

Query  1122  P  1124
             P
Sbjct  402   P  402



>ref|XP_006368013.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=353

 Score =   377 bits (967),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 177/348 (51%), Positives = 250/348 (72%), Gaps = 8/348 (2%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKA-PY  260
             E+L A+A   NH+LNY++S +LKCA+QLGIPDIIH+H + M   DL+ ALPI+ SK    
Sbjct  13    EVLAAQAHILNHVLNYVNSMSLKCAIQLGIPDIIHSHGRAMTRSDLVNALPINKSKGHEC  72

Query  261   IHRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSCYS  440
             I+RL R L+H+G         EE Y LTP  RL++K+EP+NL  F+    + +     +S
Sbjct  73    IYRLMRILIHTGFFIEG----EEGYLLTPTSRLLLKNEPLNLAPFVQAHLDPILMDPWHS  128

Query  441   LGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKRVFD  620
             LG+WF N D +PF TAHG+ ++DY   +P  N +FNE    D++L+M VL+    KRVF+
Sbjct  129   LGEWFANGDSTPFATAHGKPLFDYAGDDPRLNRIFNEAMESDARLIMSVLIK-NGKRVFE  187

Query  621   GVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFENIP  800
             G++SLVDV GG G VA AI+  FP +KC+V DLPHV+  ++  +  N+ ++ G+MF+++P
Sbjct  188   GLTSLVDVGGGIGTVAKAISNAFPELKCSVFDLPHVVEGLEGGN--NLSYITGDMFKSVP  245

Query  801   AANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYSRAEL  980
             +A+A+LLKWI+HDW DE+C KILKKCKEAIPS+E GGKVI+ID VI+++K D      +L
Sbjct  246   SADAILLKWILHDWSDEDCAKILKKCKEAIPSKENGGKVIVIDTVIDNQKGDDKSFETQL  305

Query  981   YMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             ++D+L+M     KERN+++W KL S+AGFSDYKI+P LGLRS+IE++P
Sbjct  306   FLDVLMMVHVSGKERNEQEWAKLFSDAGFSDYKISPILGLRSVIEVYP  353



>emb|CAN73269.1| hypothetical protein VITISV_021917 [Vitis vinifera]
Length=357

 Score =   377 bits (967),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 186/358 (52%), Positives = 255/358 (71%), Gaps = 9/358 (3%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             +GK++ + LLQA+A  WNH +N+++S  LKCAV+LGIPD I+NH +P+ L +L+ AL I+
Sbjct  5     SGKRASL-LLQAQAHVWNHTMNFVNSMALKCAVRLGIPDAINNHGQPITLSELVTALSIN  63

Query  243   PSKAPYIHRLTRFLVHSGLLS---VTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNE  413
             P KAP +HRL R LV SG  +     ++ QE+ YSLT A R ++KDEP +    L +  +
Sbjct  64    PIKAPCLHRLMRVLVXSGFFAQQQADHNEQEQLYSLTYASRFLLKDEPTSGAPLLLVQVD  123

Query  414   YVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLL  593
                   C+ L DWF+N+DP+PF TA+G+  WDY +HEP +N+ FNE  A DSQL+  V++
Sbjct  124   PHLTNPCHFLSDWFRNSDPTPFVTAYGKPFWDYAAHEPKFNNFFNEAMASDSQLIASVVV  183

Query  594   SGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFV  773
              GE K VF G+SSL+DV GG G +A  IAK FP +KCTV D PHV+A++     EN+EFV
Sbjct  184   -GECKEVFRGLSSLIDVGGGTGTMAKVIAKAFPHLKCTVFDQPHVVANLQGG--ENLEFV  240

Query  774   AGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAI-PSREEGGKVIIIDMVIEDKK  950
              G++FE IP A+A+LLK I+H+W D ECVKILKKCKEAI P +++GGKVIIID+V+E+ K
Sbjct  241   GGDIFEAIPPADAILLKSILHNWSDGECVKILKKCKEAIHPRKDKGGKVIIIDVVMENNK  300

Query  951   HDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
              D     A+L+ D+L+M +   KERN+++WE L   AGF+ YKIT  LG RSLIE++P
Sbjct  301   GDEAV-EAQLFYDILMMVVVAGKERNEREWENLFLAAGFAHYKITSTLGPRSLIEVYP  357



>gb|AAM23004.1|AF502433_1 orcinol O-methyltransferase [Rosa hybrid cultivar]
 emb|CAD29458.1| orcinol O-methyltransferase [Rosa chinensis]
 emb|CAH05077.1| orcinol O-methyltransferase 1 [Rosa chinensis]
Length=367

 Score =   376 bits (966),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 181/356 (51%), Positives = 253/356 (71%), Gaps = 6/356 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  16    NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  74

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  +L    + 
Sbjct  75    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDP  134

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V       L  WFQN+DP+PF TAHG   WDY +H+P    +FN+  A D++L+  V+++
Sbjct  135   VLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIN  194

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G +A AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  195   -DCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  251

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEEC+KIL++ + AI  +E+ GKVIIIDM++E++K D
Sbjct  252   GDMFEAVPPADTVLLKWILHDWSDEECIKILERSRVAITGKEKKGKVIIIDMMMENQKGD  311

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
                   +L+ D+L+MAL G KERN+K+W KL ++AGFSDYKITP  GLRSLIE++P
Sbjct  312   EESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPISGLRSLIEVYP  367



>ref|XP_004490696.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cicer 
arietinum]
Length=359

 Score =   375 bits (963),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 181/359 (50%), Positives = 245/359 (68%), Gaps = 7/359 (2%)
 Frame = +3

Query  60    ENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPI  239
             +NG+     LL+A++  WNHI N+I+S +LKC V LGIPDIIHN+ KPM L  LI  LPI
Sbjct  4     QNGEHDASNLLKAQSHIWNHIFNFINSMSLKCVVDLGIPDIIHNYGKPMSLSKLIPLLPI  63

Query  240   HPSKAPYIHRLTRFLVHSGLLSVTNSGQEEC---YSLTPAGRLVVKDEPINLRAFLHICN  410
             HPSK  +I+RL R + HSG  S  N  + E    Y LT    L++KD P+N+R+F+H+  
Sbjct  64    HPSKTFFIYRLMRIMTHSGFFSQHNISENELETEYVLTDTSLLLLKDNPMNMRSFVHLVF  123

Query  411   EYVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVL  590
             + V  K  + L  W  N+DP+ F T HG   WDY   E   N++FN+  A D++L+  V+
Sbjct  124   DPVLTKPWHQLSSWLTNDDPTAFETTHGMLFWDYAERESKINNLFNDAMASDARLVSSVV  183

Query  591   LSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEF  770
             +  + K VF+G+ SLVDV GG G +A A+AK FP ++CTV DLPHV+  +     +N+++
Sbjct  184   IE-KCKEVFNGLESLVDVGGGTGTMAKALAKSFPQLECTVFDLPHVVVGLQGT--DNLKY  240

Query  771   VAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKK  950
             V G+MF+ IP A+A+LLKWI+HDW D+ECVKILKKCKE++  +   GKVIIIDMV++ KK
Sbjct  241   VGGDMFKEIPPADAILLKWILHDWNDDECVKILKKCKESLLKKGNEGKVIIIDMVLDTKK  300

Query  951   HDPCYS-RAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
              D   S + +L+ D+L+  L   KERN K+W KLIS AGFSDYKI P LGLRSLIE++P
Sbjct  301   GDINESGKTQLFFDMLMTVLVKGKERNDKEWIKLISLAGFSDYKIIPILGLRSLIEVYP  359



>ref|XP_003544914.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X1 [Glycine max]
Length=358

 Score =   375 bits (962),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 177/361 (49%), Positives = 251/361 (70%), Gaps = 7/361 (2%)
 Frame = +3

Query  54    MGENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAAL  233
             M  + ++   +LL+A+   WNHI ++I+S +LKC V LGIPDIIHN+ +PMPL +LIA+L
Sbjct  1     MDSHDEEHAAKLLRAQTHIWNHIFSFINSMSLKCVVDLGIPDIIHNYGQPMPLSNLIASL  60

Query  234   PIHPSKAPYIHRLTRFLVHSGLLSVTNSGQEEC----YSLTPAGRLVVKDEPINLRAFLH  401
             PIHPSK  ++HRL R ++HSG  S  N   E      Y LT A  L++K+ P+++  FLH
Sbjct  61    PIHPSKTCFVHRLMRIMIHSGFFSQQNHDMENQLDAKYVLTDASVLLLKNHPMSVTPFLH  120

Query  402   ICNEYVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLM  581
                + +          WF+N D +PF TAHG  +WDY   +P +N++FN+  A D++ + 
Sbjct  121   AMLDPILTNPWNQFSTWFKNGDTTPFETAHGMMLWDYAGADPKHNNLFNDAMASDARFVT  180

Query  582   IVLLSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVEN  761
              +++  + K +F G+ SLVDV GG G +A AIAK FP ++C V DLPHV++ +  +  EN
Sbjct  181   SLVIE-KCKGMFMGLESLVDVGGGTGTMAKAIAKSFPRVECIVFDLPHVVSGLKGS--EN  237

Query  762   VEFVAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIE  941
             +++VAG+MFE IP A+A+LLKWI+HDW D+ECV ILKKCKEAI  + + GKVIIIDMV+E
Sbjct  238   LKYVAGDMFEAIPPADAILLKWILHDWNDKECVDILKKCKEAITRKGKEGKVIIIDMVVE  297

Query  942   DKKHDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELF  1121
             ++K D      +L+ D+L+M L   KER+KK+W KLIS AG+++YKITP LGLRSLIE++
Sbjct  298   NEKRDDESVETQLFFDMLMMVLVTGKERSKKEWAKLISSAGYNNYKITPVLGLRSLIEIY  357

Query  1122  P  1124
             P
Sbjct  358   P  358



>ref|XP_006446728.1| hypothetical protein CICLE_v10015708mg [Citrus clementina]
 gb|ESR59968.1| hypothetical protein CICLE_v10015708mg [Citrus clementina]
Length=362

 Score =   375 bits (962),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 181/355 (51%), Positives = 249/355 (70%), Gaps = 9/355 (3%)
 Frame = +3

Query  81    VELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPY  260
              ELL+A+A  WNHI N+I+S +LKCAV+LGIPD+I+ H KPM L +L++AL I+PSK   
Sbjct  10    TELLEAQAHVWNHIFNFINSMSLKCAVELGIPDLINKHGKPMTLNELVSALTINPSKTRC  69

Query  261   IHRLTRFLVHSGLL-------SVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYV  419
             ++RL R L+HSG         S  N+ +E+ Y LT A +L++KD P+++  FL    + +
Sbjct  70    VYRLMRILIHSGFFAQQTLNSSRNNNDEEQGYVLTNASKLLLKDNPLSVTPFLQAMLDPI  129

Query  420   FQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSG  599
                    L  WFQN+DP+PF TAHG+  W+Y   EP  N+ FNE  A D++L   V++  
Sbjct  130   LLSPWLKLSTWFQNDDPTPFDTAHGKSFWEYAGDEPKINNFFNEAMASDARLATSVVIH-  188

Query  600   ESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAG  779
             + K VF+G++SLVDV GG G VA AIAK FP ++CT  DLPHV+  +++  + N+++V G
Sbjct  189   KCKDVFEGLNSLVDVGGGTGTVAKAIAKAFPNLECTDFDLPHVVNGLES-DLANLKYVGG  247

Query  780   NMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDP  959
             ++FE IP A+AVL KWI+HDW DEECVKIL+KCKEAI S  + GKVIIIDM+ E+KK D 
Sbjct  248   DVFEAIPPADAVLFKWILHDWNDEECVKILQKCKEAITSDVKKGKVIIIDMMRENKKGDS  307

Query  960   CYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
                  +L+ D+L+M L    ER++K+W KL ++AGFSDYKITP LGLRSLIE++P
Sbjct  308   ESIETQLFFDMLMMVLVTGTERDEKEWAKLFADAGFSDYKITPILGLRSLIEVYP  362



>ref|XP_003557042.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Glycine 
max]
Length=358

 Score =   374 bits (960),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 178/361 (49%), Positives = 249/361 (69%), Gaps = 7/361 (2%)
 Frame = +3

Query  54    MGENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAAL  233
             M  + ++   +LL+A+   WNHI ++I+S +LKC V LGIPDIIHN+ +PMPL +LIA+L
Sbjct  1     MESHDEEHAAKLLRAQTHIWNHIFSFINSMSLKCVVDLGIPDIIHNYGQPMPLSNLIASL  60

Query  234   PIHPSKAPYIHRLTRFLVHSGLLSVTNSGQEE----CYSLTPAGRLVVKDEPINLRAFLH  401
             PIHPSK  ++HRL R ++HSG  S      E      Y LT A  L++K+ P+++  FLH
Sbjct  61    PIHPSKTCFVHRLMRIMIHSGFFSQQKHDLENELEAKYVLTDASVLLLKNHPMSVTPFLH  120

Query  402   ICNEYVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLM  581
                + V          WF+N DP+PF TAHG  +WDY   +P  N++FN+  A D++ + 
Sbjct  121   AMLDPVLTNPWNQFSTWFKNGDPTPFETAHGMMLWDYAGADPKLNNLFNDAMASDARFVT  180

Query  582   IVLLSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVEN  761
              +++  + K VF G+ SLVDV GG G +A AIAK FP ++C V DLPHV++ +  +  EN
Sbjct  181   SLVIE-KCKGVFMGLESLVDVGGGTGTMAKAIAKSFPRVECIVFDLPHVVSGLKGS--EN  237

Query  762   VEFVAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIE  941
             +++V+G+MFE IP A+A+LLKWI+HDW DEECV ILKKCKEAI  + + GKVIIIDMV+E
Sbjct  238   LKYVSGDMFEAIPPADAILLKWILHDWNDEECVDILKKCKEAITRKGKEGKVIIIDMVVE  297

Query  942   DKKHDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELF  1121
             ++K D      +L+ D+L+M L   KER+KK+W KLIS AG+++YKITP  GLRSLIE++
Sbjct  298   NEKRDDESVETQLFFDMLMMVLVTGKERSKKEWAKLISSAGYNNYKITPVFGLRSLIEIY  357

Query  1122  P  1124
             P
Sbjct  358   P  358



>ref|XP_002517827.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44345.1| o-methyltransferase, putative [Ricinus communis]
Length=356

 Score =   374 bits (959),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 181/357 (51%), Positives = 256/357 (72%), Gaps = 8/357 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             + K + VELLQA+A  WNHI N+I+S +LK A+QLGIPD IH+H +P+ L  LIAALP+ 
Sbjct  3     DAKHAAVELLQAQAHIWNHIFNFINSMSLKSAIQLGIPDAIHSHGRPISLSQLIAALPVL  62

Query  243   PSKAPYIHRLTRFLVHSGLLS---VTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNE  413
             P+KA  I RL R LVHSG  +   +  + +EE + LT A +L++KD P+++  FL    +
Sbjct  63    PAKARCIPRLMRILVHSGFFANAKIKGNDEEEGFVLTSASKLLLKDNPLSVTPFLLAMLD  122

Query  414   YVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLL  593
              +  +  + +  WFQN+D +PF T HG   W+Y  +EP +N+ FNE  A D++L+M VL+
Sbjct  123   PILTEPWHYVSTWFQNDDATPFDTVHGMPFWEYAGNEPKFNNFFNEAMASDARLVMRVLI  182

Query  594   SGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFV  773
               E K VF+G++SLVDV GG G +A+AIAK FP + C V DLPHV+A + +++  N+++V
Sbjct  183   D-EYKGVFEGLNSLVDVGGGTGTMAAAIAKAFPQLDCIVFDLPHVVAGLQSSA--NLKYV  239

Query  774   AGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKH  953
              GNMFE +P A+A+LLKWI+HDW DEEC+KIL++ KEAI  + +GGK+IIIDMV E+++ 
Sbjct  240   GGNMFEGVPPADAILLKWIIHDWSDEECLKILQRSKEAIKGK-KGGKLIIIDMVSENQQV  298

Query  954   -DPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELF  1121
              D  Y   +L+ D+L+MAL   KERN K+W KL  +AGFS+YKITP LGLRS+IE++
Sbjct  299   IDDQYVETQLFYDMLMMALQTGKERNNKEWGKLFLDAGFSNYKITPILGLRSVIEVY  355



>gb|AAM23005.1|AF502434_1 orcinol O-methyltransferase [Rosa hybrid cultivar]
 emb|CAD29459.1| orcinol O-methyltransferase [Rosa chinensis]
 emb|CAH05078.1| orcinol O-methyltransferase 2 [Rosa chinensis]
 dbj|BAQ20440.1| 3,5-dimethoxytoluene [Rosa hybrid cultivar]
Length=366

 Score =   374 bits (960),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 183/356 (51%), Positives = 252/356 (71%), Gaps = 7/356 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  16    NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKH-GPMTLSELTSALPIH  73

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  74    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDP  133

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V       L  WFQN DP+PF TAHG   WDY +H+P    +FN+  A D++L+  V++ 
Sbjct  134   VLTTPWNYLSTWFQNEDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIID  193

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  194   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  250

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEEC+KILK+ + AI S+++ GKVIIIDM++E++K D
Sbjct  251   GDMFEAVPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGD  310

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
                   +L+ D+L+MAL   +ERN+K+W KL ++AGFSDYKITP LGLRSLIE++P
Sbjct  311   EESIETQLFFDMLMMALVRGQERNEKEWAKLFTDAGFSDYKITPILGLRSLIEVYP  366



>ref|XP_007043718.1| Flavonoid o-methyltransferase related [Theobroma cacao]
 gb|EOX99549.1| Flavonoid o-methyltransferase related [Theobroma cacao]
Length=364

 Score =   374 bits (960),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 183/363 (50%), Positives = 251/363 (69%), Gaps = 9/363 (2%)
 Frame = +3

Query  51    IMGENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAA  230
             + GE     H ELLQA+A  WN++ N+I+S +LKCA+ LGIPD+I NH KPM + +L+AA
Sbjct  6     VNGEKHINDH-ELLQAQAHVWNYLFNFINSMSLKCAIDLGIPDVIQNHGKPMTVTELVAA  64

Query  231   LPIHPSKAPYIHRLTRFLVHSGLLS---VTNSGQEECYSLTPAGRLVVKDEPINLRAFLH  401
             LPI+ +KA  I+RL R LVHSG  +   + N+ QEE Y LT A RL++  +P+++  FL 
Sbjct  65    LPINATKASSIYRLMRILVHSGFFAQQKLGNNDQEEGYVLTHASRLLLNGDPLSVTPFLK  124

Query  402   ICNEYVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLM  581
                + +  K  + LG WFQN+DP+PF TAHG   WDY  H+P  +  FNE  A D++L+ 
Sbjct  125   AMLDPILTKPWHFLGAWFQNDDPTPFDTAHGRTFWDYGGHDPMLSHFFNEGMASDARLVS  184

Query  582   IVLLSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVEN  761
              +L+  + + VF G++S+VDV GG G VA AI+  FP ++CTV DLP V+A +      N
Sbjct  185   SILIH-KCEGVFQGLNSMVDVGGGIGTVAKAISDAFPHLECTVFDLPRVVAGLQDRG--N  241

Query  762   VEFVAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIE  941
             +++V G+MFE +PAA+AVLLKWI+HDW DEECVKILK+CKEAI    +GGK IIIDMV+ 
Sbjct  242   LKYVGGDMFEAVPAADAVLLKWILHDWNDEECVKILKRCKEAISRGGKGGKAIIIDMVLT  301

Query  942   DKKH--DPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIE  1115
             +K H  +      +L+ D+L+M L   KERN+++W  L   AGFSDYKITP +GLRSLIE
Sbjct  302   EKNHKVNDASIETQLFFDMLMMVLVTGKERNEEEWATLFLAAGFSDYKITPIMGLRSLIE  361

Query  1116  LFP  1124
             ++P
Sbjct  362   VYP  364



>ref|XP_008245137.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=354

 Score =   373 bits (958),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 184/358 (51%), Positives = 245/358 (68%), Gaps = 5/358 (1%)
 Frame = +3

Query  54    MGENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAAL  233
             MG + + SH ELL+A+AQ WNH  ++I+S +LKCAVQL IPD+I  H +PM L +L++AL
Sbjct  1     MGSDVRASH-ELLKAQAQIWNHTFSFINSMSLKCAVQLDIPDVIQKHGQPMTLSELVSAL  59

Query  234   PIHPSKAPYIHRLTRFLVHSGLL-SVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICN  410
             PI P+KA +I RL R LVHSG   S + +G E+ Y LT A  L++KD P++ R FL    
Sbjct  60    PISPTKAHFIPRLIRILVHSGFFASESLNGGEQGYVLTDASALLLKDNPMSARPFLLAML  119

Query  411   EYVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVL  590
               +       L  WFQN++P+PF  AHG   WDY + +      FNE  A D++L+  ++
Sbjct  120   NPILTDPWQYLTTWFQNDNPTPFHVAHGMTFWDYGNQDTTLAHFFNEAMASDARLISSLM  179

Query  591   LSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEF  770
             +  + K VF GV SLVDV GG G VA +IA  FP MKCTVLDLPHV+A +  ++  N+E+
Sbjct  180   ID-DCKGVFQGVDSLVDVGGGTGTVAKSIAAAFPHMKCTVLDLPHVVADLKGSN--NLEY  236

Query  771   VAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKK  950
             VAG+MFE IP A+A+ LKWI+HDW DEECVKIL++CKEAI    + GKVII+DM +E+K 
Sbjct  237   VAGDMFEAIPGADAIFLKWILHDWSDEECVKILERCKEAITRDGKKGKVIIVDMTVENKN  296

Query  951   HDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
              D      +L+ D+ +M L   KERN+K+W  L S+AGFS YKITP LGLRSLIE++P
Sbjct  297   TDKESGETQLFFDMEMMVLATGKERNEKEWAMLFSDAGFSHYKITPGLGLRSLIEVYP  354



>ref|XP_002525159.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF37286.1| o-methyltransferase, putative [Ricinus communis]
Length=356

 Score =   373 bits (958),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 186/358 (52%), Positives = 250/358 (70%), Gaps = 8/358 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             +GK    ELLQA+A  WNHI N+I+S +LK A+QLGIPD IH+H KP+ L  LIAALPIH
Sbjct  3     DGKHDAQELLQAQAYIWNHIFNFINSMSLKTAIQLGIPDAIHSHGKPISLSLLIAALPIH  62

Query  243   PSKAPYIHRLTRFLVHSGLLS---VTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNE  413
             P+KA  I RL R L+HSG  +   +  + + E Y LT A +L++KD P ++  FL    +
Sbjct  63    PAKARCIPRLMRILIHSGFFAKAKLKENDEAEGYVLTKASKLLLKDNPFSVTPFLLAMLD  122

Query  414   YVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLL  593
              +  +  + L  WFQN+D + F TAHG   W+Y  +EP  N+ FNE  A D++L+M VL+
Sbjct  123   RILTEPWHYLSTWFQNDDATAFTTAHGMGFWEYAGNEPKLNNFFNEAMASDARLVMRVLI  182

Query  594   SGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFV  773
               E K VF+G+ SLVDV GG G +A AIAK FP + C V DLPHV+A +  A  EN+++V
Sbjct  183   D-EYKGVFEGLKSLVDVGGGTGTMAKAIAKAFPRLDCIVFDLPHVVAGL--AGSENLKYV  239

Query  774   AGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKK-  950
             AG+MFE +P A+A+LLKWIMH W DEEC+K+LK  KEAI   +E GK+IIIDMV+E+++ 
Sbjct  240   AGDMFEGVPPADAILLKWIMHVWSDEECLKLLKLSKEAIKGNKE-GKLIIIDMVLENRQV  298

Query  951   HDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
              D     ++L+ D+L+M L   K+RNKK+W KL  +AGFSDYKITP LGLRS+IE++P
Sbjct  299   TDHQSIESQLFFDMLMMTLQTGKQRNKKEWGKLFLDAGFSDYKITPILGLRSVIEVYP  356



>ref|XP_006428632.1| hypothetical protein CICLE_v10012033mg [Citrus clementina]
 gb|ESR41872.1| hypothetical protein CICLE_v10012033mg [Citrus clementina]
Length=362

 Score =   374 bits (959),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 182/355 (51%), Positives = 245/355 (69%), Gaps = 9/355 (3%)
 Frame = +3

Query  81    VELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPY  260
              ELL+A+   WNHI N+I+S TLKCA+QLGIPDII  H KPM L +L++AL I+PSK+  
Sbjct  10    TELLEAQTHVWNHIFNFINSMTLKCAIQLGIPDIISKHGKPMTLNELVSALTINPSKSRC  69

Query  261   IHRLTRFLVHSGLL-------SVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYV  419
             ++RL R L+H+G         S  N+ +E+ Y LT A +L++KD P+++  FL    + +
Sbjct  70    VYRLMRILIHTGFFAQQKLISSRNNNDEEQGYVLTNASKLLLKDNPLSVTPFLQAMLDPI  129

Query  420   FQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSG  599
                    L  WFQN+DP+PF TAHG+ +W+Y   EP  N+ FNE  A D+ L   V++  
Sbjct  130   LLSPWQQLRTWFQNDDPTPFDTAHGKTLWEYAGDEPKLNNFFNEAMASDAWLATSVMIH-  188

Query  600   ESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAG  779
             + K VF+G++SLVDV GG G  A AIAK FP ++CT  DLPHV+  +D+  + N+++V G
Sbjct  189   KCKDVFEGLNSLVDVGGGIGTAAKAIAKAFPKLECTCFDLPHVVNGLDS-DLANLKYVGG  247

Query  780   NMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDP  959
             +MFE I  A+AVLLKWI+HDW DEECVKILKKCKEAI S  + GKVIIIDM+ E+KK D 
Sbjct  248   DMFEAISPADAVLLKWILHDWNDEECVKILKKCKEAITSDGKKGKVIIIDMIRENKKGDD  307

Query  960   CYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
                  +L+ D+L+M L    ER++K+W KL + AGFSDYKI P LGLRSLIE++P
Sbjct  308   KSIETQLFFDMLMMVLLTGTERDEKEWTKLFTYAGFSDYKIIPILGLRSLIEVYP  362



>ref|XP_004229155.1| PREDICTED: myricetin O-methyltransferase-like isoform X1 [Solanum 
lycopersicum]
Length=352

 Score =   372 bits (955),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 184/349 (53%), Positives = 250/349 (72%), Gaps = 10/349 (3%)
 Frame = +3

Query  87    LLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPI-HPSKAPYI  263
             LL A+AQ WN+I N+I S+ ++CA QLGIPD+++ H KPM L D+ A L + + SK  ++
Sbjct  11    LLHAQAQIWNYIFNFISSSAVRCAFQLGIPDVLYKHDKPMCLSDISAELSVVNSSKVSFL  70

Query  264   HRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSCYSL  443
               L +FLV SG L+      E+ YSLTPA  L+ KD+P N+R+ L + +   F K+   L
Sbjct  71    PILMQFLVQSGFLN----QHEDHYSLTPASCLLAKDDPFNVRSLLLLNHGQAFSKAWPEL  126

Query  444   GDWFQNNDPSPFCTAHGEKIWDYISHEPG--YNDVFNEVTAKDSQLLMIVLLSGESKRVF  617
              DWFQN+ P+PF TAHG+ +WD+I  E      D+FN+  A DS+L   VL++ E K VF
Sbjct  127   SDWFQNDSPTPFHTAHGKSLWDFIGEEQPSVLGDIFNDALASDSRLNTNVLIA-ECKHVF  185

Query  618   DGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFENI  797
             +G++SLVDV GG G V+ AIAK FP +KCTVLDLP V+  +  +   N++FV G+MF+ I
Sbjct  186   EGLTSLVDVGGGTGTVSIAIAKAFPNIKCTVLDLPQVVGDLKGSG--NLDFVGGDMFDMI  243

Query  798   PAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYSRAE  977
             P  NA+LLK ++HDW DE+CVK+LKKCKE+IPSRE+GGKVIIID V+ED K    + RA+
Sbjct  244   PHTNAILLKCVLHDWNDEDCVKVLKKCKESIPSREKGGKVIIIDTVLEDPKQSNEFVRAQ  303

Query  978   LYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
               M +L+M L+ +KER +K+WEKL SEAGF++YKI PALGLRSLIE++P
Sbjct  304   HNMGMLMMVLFAAKERTEKEWEKLFSEAGFTEYKIFPALGLRSLIEIYP  352



>ref|XP_008229108.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=355

 Score =   372 bits (954),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 183/359 (51%), Positives = 243/359 (68%), Gaps = 6/359 (2%)
 Frame = +3

Query  54    MGENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAAL  233
             MG   + SH ELL+A+A  WNHI ++++S +LKCAVQL I D+I  H +PM L +L++AL
Sbjct  1     MGSEVRASH-ELLKAQAHIWNHIFSFVNSMSLKCAVQLDIADVIQKHGQPMILSELVSAL  59

Query  234   PIHPSKAPYIHRLTRFLVHSGLLS--VTNSGQEECYSLTPAGRLVVKDEPINLRAFLHIC  407
             PI P+KA +I RL R LVHSG  +    + G E+ Y LT A  L++KD P++ R FL   
Sbjct  60    PISPTKAHFIPRLMRILVHSGFFARESLSGGGEQGYVLTDASALLLKDNPMSARPFLLAM  119

Query  408   NEYVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIV  587
                +       L  WFQN++P+PF   HG   WDY + +P     FN+  A D+QL+  +
Sbjct  120   LNPMLTDPWQYLTTWFQNDNPTPFHVVHGMTFWDYGNQDPTLAHFFNDAMASDAQLISSL  179

Query  588   LLSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVE  767
             ++  + K VF GV SLVDV GG G VA +IA  FP MKCTVLDLPHV+A  D    +N+E
Sbjct  180   MID-DCKGVFQGVDSLVDVGGGTGTVAKSIADAFPHMKCTVLDLPHVVA--DLKGSKNLE  236

Query  768   FVAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDK  947
             +VAG+MFE +P A+A+ LKWI+HDW DEECVKIL++CKEAI    + GKVII+DM +E+K
Sbjct  237   YVAGDMFEAVPEADAIFLKWILHDWSDEECVKILERCKEAITREGKKGKVIIVDMTVENK  296

Query  948   KHDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
               D      +L+ D+L+M L   KERN+K+W KL S+AGFS YKITP LGLRSLIE++P
Sbjct  297   NTDKESGETQLFFDMLMMVLVKGKERNEKEWAKLFSDAGFSHYKITPCLGLRSLIEVYP  355



>ref|XP_006480453.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=362

 Score =   371 bits (953),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 184/355 (52%), Positives = 246/355 (69%), Gaps = 9/355 (3%)
 Frame = +3

Query  81    VELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPY  260
              ELL+A+   WNHI N+I+S TLKCA+QLGIPDII  H KPM L +L++AL I+PSK+  
Sbjct  10    TELLEAQTHVWNHIFNFINSMTLKCAIQLGIPDIISKHGKPMTLNELVSALTINPSKSRC  69

Query  261   IHRLTRFLVHSG------LLSVTNSGQEEC-YSLTPAGRLVVKDEPINLRAFLHICNEYV  419
             ++RL R L+H+G      L+S  N+  EE  Y LT A +L++KD P+++  FL    + +
Sbjct  70    VYRLMRILIHTGFFAQQKLISSRNNNDEELGYVLTNASKLLLKDNPLSVTPFLQAMLDPI  129

Query  420   FQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSG  599
                    L  WFQN+DP+PF TAHG+ +W+Y   EP  N+ FNE  A D+ L   V++  
Sbjct  130   LLSPWQQLRTWFQNDDPTPFDTAHGKTLWEYAGDEPKLNNFFNEAMASDAWLATSVMIH-  188

Query  600   ESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAG  779
             + K VF+G++SLVDV GG G  A AIAK FP ++CT  DLPHV+  +D+  + N+++V G
Sbjct  189   KCKDVFEGLNSLVDVGGGIGTAAKAIAKAFPKLECTCFDLPHVVNGLDS-DLANLKYVGG  247

Query  780   NMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDP  959
             +MFE I  A+AVLLKWI+HDW DEECVKILKKCKEAI S  + GKVIIIDM+ E+KK D 
Sbjct  248   DMFEAISPADAVLLKWILHDWNDEECVKILKKCKEAITSDGKKGKVIIIDMIRENKKGDD  307

Query  960   CYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
                  +L+ D+L+M L    ER++K+W KL + AGFSDYKI P LGLRSLIE++P
Sbjct  308   KSIETQLFFDMLMMVLLTGTERDEKEWTKLFTYAGFSDYKIIPILGLRSLIEVYP  362



>ref|XP_010088036.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXB31255.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=373

 Score =   370 bits (951),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 182/358 (51%), Positives = 242/358 (68%), Gaps = 9/358 (3%)
 Frame = +3

Query  69    KQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPS  248
             ++   ELL A+A  WN+I N+I+S +LKCAVQLGIPD IH H KPM L  LI ALP+H +
Sbjct  19    EEKATELLGAQAHIWNNIFNFINSMSLKCAVQLGIPDTIHKHGKPMTLSKLIGALPVHQN  78

Query  249   KAPYIHRLTRFLVHSGLLSVTNSG-----QEECYSLTPAGRLVVKDEPINLRAFLHICNE  413
             KAPY++RL R LVHSG  S+   G     +EE Y LT A +L+V D P+++  FL    +
Sbjct  79    KAPYVYRLMRILVHSGFFSLQTIGESDHQEEEGYVLTDASKLLVGDNPLSVAPFLLAMLD  138

Query  414   YVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLL  593
              V  K    L  WFQN+DP+ F T +G   W Y   EP   + FN+  A D++L++ V++
Sbjct  139   PVLTKPWDFLSTWFQNDDPTAFDTVNGLPFWKYGGQEPKMANFFNDAMASDARLVISVVI  198

Query  594   SGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFV  773
                 K VFD + S VDV GG G VA AIA  FP M+CTV DLPHV+   D    +N++FV
Sbjct  199   EN-CKWVFDELESFVDVGGGTGTVAKAIAATFPKMECTVFDLPHVVG--DLQGKDNLKFV  255

Query  774   AGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSR-EEGGKVIIIDMVIEDKK  950
              G+MF+ +P A+A+LLKWI+HDW D+ECVKILKKCKEAI S+  + GKVIIID++IE+K 
Sbjct  256   GGDMFQQVPPADAILLKWILHDWSDDECVKILKKCKEAITSKGSKKGKVIIIDIMIENKD  315

Query  951   HDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
              D      +L+ D+++M L   +ERN+K+W KL  ++GFSDYKI P LGLRSLIE++P
Sbjct  316   EDDKSYETQLFFDMMMMVLATGQERNEKEWAKLFQDSGFSDYKIIPILGLRSLIEVYP  373



>emb|CAJ65638.1| putative orcinol O-methyltransferase [Rosa hugonis]
Length=346

 Score =   369 bits (948),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 181/346 (52%), Positives = 246/346 (71%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGCPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K  + L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWHYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSMAHFFNDAMACDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEECVKILK+CKEAI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDEECVKILKRCKEAITSKDKKGKVIIIDMIMENQKVD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALLTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65632.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
 emb|CAJ65658.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   369 bits (948),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 181/346 (52%), Positives = 244/346 (71%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE IP AN VLLKWI+HDW DEECVKILK+ +EAI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAIPPANTVLLKWILHDWNDEECVKILKQSREAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>ref|XP_006346268.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=353

 Score =   369 bits (948),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 174/356 (49%), Positives = 255/356 (72%), Gaps = 9/356 (3%)
 Frame = +3

Query  60    ENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPI  239
             +NG +++ E+L A+A   NH+LNY++S +LKCA+QLGIPDIIH+H + M   DL+ ALPI
Sbjct  6     KNGDETN-EVLAAQAHILNHVLNYVNSMSLKCAIQLGIPDIIHSHGRAMTRSDLVNALPI  64

Query  240   HPSKA-PYIHRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             + SK    I+RL R L+H+          E+ Y LTP  RL++K+EP++L  F+    + 
Sbjct  65    NKSKGHECIYRLMRILIHASFFIEG----EDGYLLTPTSRLLLKNEPLSLAPFVQAQLDP  120

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             +     +SLG+WF N D +PF TAHG+ ++DY   +P  N +FNE    D++L+M  L+ 
Sbjct  121   ILMDPWHSLGEWFANGDSTPFATAHGKPLFDYAGDDPRLNRIFNEAMESDARLIMSALIK  180

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
                KRVF+G++SLVDV GG G VA AI+  FP +KC+V DLPHV+  ++  +  N+ ++ 
Sbjct  181   -NGKRVFEGLTSLVDVGGGIGTVAKAISNAFPELKCSVFDLPHVVEGLEGGN--NLSYIT  237

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MF+++P+A+A+LLKWI+HDW D++C KILKKCKEAIPS+E GGKVI+ID VI+++K D
Sbjct  238   GDMFKSVPSADAILLKWILHDWSDKDCAKILKKCKEAIPSKENGGKVIVIDTVIDNQKGD  297

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
                  ++L++D+L+M     KERN+++W KL S+AGFSDYKI+P LGLRS+IE++P
Sbjct  298   DKSFESQLFLDVLMMVHVSGKERNEQEWAKLFSDAGFSDYKISPILGLRSVIEVYP  353



>emb|CAJ65607.1| putative orcinol O-methyltransferase [Rosa beggeriana]
Length=346

 Score =   369 bits (947),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 180/346 (52%), Positives = 244/346 (71%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEECVKILK+ +EAI SR++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSRDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65602.1| putative orcinol O-methyltransferase [Rosa banksiae]
Length=346

 Score =   369 bits (947),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 180/346 (52%), Positives = 246/346 (71%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    ++  EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRTLVHSGFFAKKKLSTTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPAPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+AVLLKWI+HDW DEECVKILK+ +EAI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADAVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>ref|XP_006351391.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=355

 Score =   369 bits (947),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 189/353 (54%), Positives = 242/353 (69%), Gaps = 15/353 (4%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPYI  263
             ELLQAE Q+WN +  +I+  TLKCA+QL IP++I  H KPM +  L+++LPI PSK PY 
Sbjct  12    ELLQAETQSWNQLYFFIEHVTLKCALQLDIPNVITKHGKPMTISKLMSSLPISPSKFPYF  71

Query  264   HRLTRFLVHSGLLSVTN------SGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQ  425
             HRLTR LVH G L +           + CYSL PA R VVKD P N         +  F 
Sbjct  72    HRLTRILVHYGFLILQKHDDNDVDDDKGCYSLAPADRYVVKDGPWNSME----DQDTFFF  127

Query  426   KSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGES  605
             K+   LGDWF+N+DPS F TA+G+  W  +S +P     FNE  ++DS+  M VL+  E 
Sbjct  128   KAWNCLGDWFKNDDPSAFYTAYGDLFWSKLSSDPSTGSWFNENMSRDSRSFMNVLIGNEF  187

Query  606   KRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNM  785
             K VF+G+ SLVDV GG G VA +IAK FP MKC VLDLP V+A++  +  EN+EFVAG+M
Sbjct  188   KDVFEGLPSLVDVGGGTGTVAMSIAKSFPDMKCIVLDLPPVVANLQGS--ENLEFVAGDM  245

Query  786   FENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCY  965
             F+ IP ANAVLLK I+HDW DEECVKILK CKEA   +   GKVIIIDMV+E+ + D   
Sbjct  246   FQKIPPANAVLLKSILHDWNDEECVKILKNCKEA---KTGSGKVIIIDMVMENPELDDES  302

Query  966   SRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
              +A+L++D+L+M   GSKERNKK+WEKL  ++GF+ YKIT  LGL+S+IEL+P
Sbjct  303   VQAQLFIDMLMMVFVGSKERNKKEWEKLFLDSGFTSYKITLTLGLKSIIELYP  355



>emb|CAJ65641.1| putative orcinol O-methyltransferase [Rosa marretii]
Length=346

 Score =   369 bits (946),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 179/346 (52%), Positives = 245/346 (71%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ +LL A+A TWNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-DLLHAQAHTWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAVLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLKSLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEECVKILK+ +EAI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65609.1| putative orcinol O-methyltransferase [Rosa bracteata]
Length=346

 Score =   369 bits (946),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 179/346 (52%), Positives = 246/346 (71%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    ++  EE Y+LT A +L++KD P+++  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSTTDEEGYTLTDASQLLLKDHPLSITPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+AVLLKWI+HDW DEECVKILK+ +EAI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADAVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65663.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   368 bits (945),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 181/346 (52%), Positives = 243/346 (70%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE IP AN VLLKWI+HDW DEECVKILK+ +EAI S ++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAIPPANTVLLKWILHDWNDEECVKILKQSREAITSEDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65628.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   368 bits (945),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 180/346 (52%), Positives = 244/346 (71%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A++  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQSHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE IP AN VLLKWI+HDW DEECVKILK+ +EAI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAIPPANTVLLKWILHDWNDEECVKILKQSREAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65601.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   368 bits (945),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 178/346 (51%), Positives = 246/346 (71%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A++  +  +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVANLQGS--KNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEECVKILK+ +EAI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKNGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65624.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   368 bits (945),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 178/346 (51%), Positives = 245/346 (71%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A +  ++  N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGST--NLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEECVKILK+ +EAI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65630.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   368 bits (944),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 180/346 (52%), Positives = 243/346 (70%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A++  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQSHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D     N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSRNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE IP AN VLLKWI+HDW DEECVKILK+ +EAI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAIPPANTVLLKWILHDWNDEECVKILKQSREAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAH05081.1| putative orcinol O-methyltransferase [Rosa hybrid cultivar]
 emb|CAJ65644.1| putative orcinol O-methyltransferase [Rosa phoenicia]
Length=346

 Score =   368 bits (944),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 180/346 (52%), Positives = 243/346 (70%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHHPSIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEECVKILK+ +EAI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERNKK+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALLTGKERNKKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65621.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   368 bits (944),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 180/346 (52%), Positives = 243/346 (70%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NGK S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGKHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHHPSIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEECVKILK+ +EAI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALLTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAH05089.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   368 bits (944),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 179/346 (52%), Positives = 244/346 (71%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE IP AN VLLKWI+HDW DEECVKILK+ ++AI S+++ GKVII+DM++E++K D
Sbjct  241   GDMFEAIPPANTVLLKWILHDWNDEECVKILKRSRKAITSKDKKGKVIILDMMMENQKRD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65665.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   368 bits (944),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 179/346 (52%), Positives = 244/346 (71%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSVSLKSAIQLGIPDIINKHGYPMTLFELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEECVKILK+ +EAI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKSGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65640.1| putative orcinol O-methyltransferase [Rosa majalis]
 emb|CAJ65650.1| putative orcinol O-methyltransferase [Rosa lucieae]
 emb|CAJ65651.1| putative orcinol O-methyltransferase [Rosa lucieae]
 emb|CAJ65652.1| putative orcinol O-methyltransferase [Rosa lucieae]
 emb|CAJ65653.1| putative orcinol O-methyltransferase [Rosa lucieae]
 emb|CAJ65654.1| putative orcinol O-methyltransferase [Rosa lucieae]
Length=346

 Score =   367 bits (943),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 179/346 (52%), Positives = 244/346 (71%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEECVKILK+ +EAI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65626.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   367 bits (942),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 179/346 (52%), Positives = 242/346 (70%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGTTFWDYGNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D     N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSRNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A  VLLKWI+HDW DEECVKILK+ +EAI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPAGTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>ref|XP_006365443.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=352

 Score =   367 bits (943),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 184/351 (52%), Positives = 245/351 (70%), Gaps = 10/351 (3%)
 Frame = +3

Query  81    VELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPI-HPSKAP  257
              ELL A+ Q WN+I N+I S+ + CA QLGIPD+++ H KPM L DL A L + + SK  
Sbjct  9     TELLHAQEQIWNYIFNFISSSAVTCAFQLGIPDVLYKHEKPMCLSDLSAKLSVVNSSKIS  68

Query  258   YIHRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSCY  437
             ++  L RFLV SG L+      E+ Y LTPA RL+VK+EP N+R+FL   N     K+ +
Sbjct  69    FLPILMRFLVQSGFLN----QHEDHYFLTPASRLLVKNEPFNVRSFLLFTNIQACSKAWH  124

Query  438   SLGDWFQNNDPSPFCTAHGEKIWDYISHEPG--YNDVFNEVTAKDSQLLMIVLLSGESKR  611
              L DWFQN+ P+PF TAHG+ +WDY+  E      D+F +  A DS+L+  VL++ E K 
Sbjct  125   ELSDWFQNDSPTPFHTAHGKSLWDYMGEEKHRVLGDIFYDALASDSRLITNVLIT-ECKH  183

Query  612   VFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFE  791
             VF+G++SLVDV GG G VA AIAK FP + C VLDLP VI  +  +   N+ F+ G+MF+
Sbjct  184   VFEGLTSLVDVGGGTGTVAIAIAKAFPNINCAVLDLPQVIGDLKGSG--NLAFIGGDMFD  241

Query  792   NIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYSR  971
              IP ANA+LLK ++HDW DE CV+ILKKCKE+IPSR +GGKVIIID+V+E+ K    + R
Sbjct  242   KIPHANAILLKSVLHDWNDENCVRILKKCKESIPSRAKGGKVIIIDIVLENPKERNEFVR  301

Query  972   AELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             A+  MD+L+M L G+KER +K+WEKL  EAGF++YKI   LGLRSLIE++P
Sbjct  302   AQHNMDMLMMVLCGAKERTEKEWEKLFIEAGFNEYKIFHVLGLRSLIEIYP  352



>emb|CAJ65623.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   367 bits (942),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 179/346 (52%), Positives = 243/346 (70%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEECVKILK+ +EAI S+ + GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKAKNGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>gb|ABK96707.1| unknown [Populus trichocarpa x Populus deltoides]
Length=359

 Score =   367 bits (943),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 184/357 (52%), Positives = 245/357 (69%), Gaps = 8/357 (2%)
 Frame = +3

Query  69    KQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPS  248
             ++S  ELLQA+   WNHI  +I+S TLKCAVQLGIPD+I  H KPM L +L++ALPIHPS
Sbjct  6     EESASELLQAQTHVWNHIFYFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPS  65

Query  249   KAPYIHRLTRFLVHSGLLSVTNSG---QEECYSLTPAGRLVVKDEPINLRAFLHICNEYV  419
             KA Y+HRL R LVHSG  S  N      +E YSLT + RL++KD P ++RA L    + V
Sbjct  66    KAQYVHRLMRILVHSGFFSQRNLNGVDNQEAYSLTQSTRLLLKDNPWSVRAHLLFVLDPV  125

Query  420   FQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSG  599
               K    L  WFQN+D + F  AH +  W+Y+  +P  N++ NEV A+DS +L   L+  
Sbjct  126   LTKPWDCLSTWFQNDDRTAFSVAHEKAPWEYVGQDPRINNLCNEVMARDS-ILACKLVVN  184

Query  600   ESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAG  779
             + K +F+GVSSLVDV GG G +A  I + FP M CTVLDLPHV++  D    +N++FVAG
Sbjct  185   KCKGIFEGVSSLVDVGGGLGTMAKGITEAFPHMDCTVLDLPHVVS--DLQGCKNLKFVAG  242

Query  780   NMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSR--EEGGKVIIIDMVIEDKKH  953
             +MF+ +P A A+LLKWI+H+W DE+CVKILK+CK+AI S+  ++ GKVIIIDMV E+   
Sbjct  243   DMFQAVPPAEAILLKWILHNWSDEDCVKILKRCKQAIMSKGQQKAGKVIIIDMVRENLNG  302

Query  954   DPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             D      +L+ DL +M + G  ERN+K+W KL  +AGF +YKI P LG R+LIEL+P
Sbjct  303   DEGSIETQLFFDLQMMVVAGGMERNEKEWAKLFFDAGFLNYKIYPVLGPRALIELYP  359



>gb|AFK40900.1| unknown [Lotus japonicus]
Length=357

 Score =   367 bits (942),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 186/359 (52%), Positives = 246/359 (69%), Gaps = 10/359 (3%)
 Frame = +3

Query  57    GENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALP  236
             GEN  +    LL+A++  WNHIL+YI+S +LKC V LGIPDIIHN+ KPMPL  LIA+LP
Sbjct  6     GENAAK----LLRAQSHIWNHILSYINSMSLKCVVDLGIPDIIHNYGKPMPLSKLIASLP  61

Query  237   IHPSKAPYIHRLTRFLVHSGLLSVTNSGQEEC---YSLTPAGRLVVKDEPINLRAFLHIC  407
             IH SKA  I RL R ++HSG  S  N  + E    Y+LT    L++K  P ++  FL   
Sbjct  62    IHSSKAGNIPRLMRVMIHSGFFSQHNITENELEVEYTLTDDSILLLKGHPFSILPFLLCS  121

Query  408   NEYVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIV  587
             N+ + +K  + L  WF+N+D +PF TAHG   WDY + +P  N++ NE  A D+QL+  V
Sbjct  122   NDPILKKPWHHLSTWFKNDDLTPFETAHGMLPWDYANRDPKVNNLLNESMACDAQLIAGV  181

Query  588   LLSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVE  767
              +  + K + +G+ SLVDV GG G +A AIAK FP +KCTV DLPHV+A  D    EN+E
Sbjct  182   FIE-KCKDMLNGLESLVDVGGGTGTMARAIAKSFPRLKCTVFDLPHVVA--DLQGSENLE  238

Query  768   FVAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDK  947
             ++ G+MF+ IP A+A+LLKWI+HDW DEEC+KILK CKEAI S+ + GKVIIIDMVIE+ 
Sbjct  239   YIGGDMFKEIPPADAILLKWILHDWSDEECLKILKNCKEAIKSKGKEGKVIIIDMVIEED  298

Query  948   KHDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             K D      +L  D+ +M L   KER+ K+W  LIS AGFSDYKI+P LGLRS++E++P
Sbjct  299   KGDDKSVETQLLFDMGMMVLTTGKERSMKEWGILISSAGFSDYKISPVLGLRSVVEIYP  357



>emb|CAH05084.1| orcinol O-methyltransferase 3 [Rosa hybrid cultivar]
Length=346

 Score =   367 bits (941),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 178/346 (51%), Positives = 246/346 (71%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  +L    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V       L  WFQN+DP+PF TAHG   WDY +H+P    +FN+  A D++L+  V+++
Sbjct  124   VLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIN  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G +A AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE IP AN VLLKWI+HDW DEECVKILK+ + AI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAIPPANTVLLKWILHDWNDEECVKILKRSRVAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L++D+L+MAL G KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFLDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65612.1| putative orcinol O-methyltransferase [Rosa canina]
Length=346

 Score =   367 bits (941),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 179/346 (52%), Positives = 244/346 (71%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNCLSTWFQNDDPTPFDTAHGMTFWDYGNHQPRIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEECVKILK+ +EAI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFETVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>ref|XP_007142076.1| hypothetical protein PHAVU_008G250600g [Phaseolus vulgaris]
 gb|ESW14070.1| hypothetical protein PHAVU_008G250600g [Phaseolus vulgaris]
Length=357

 Score =   367 bits (942),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 173/356 (49%), Positives = 245/356 (69%), Gaps = 6/356 (2%)
 Frame = +3

Query  66    GKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHP  245
             G+    +LL+A+   WNHIL++I+S +LKC V LGIPDIIHNH +PM L +LI++LPIH 
Sbjct  5     GEDQSAKLLRAQTHVWNHILSFINSMSLKCIVDLGIPDIIHNHGQPMSLSNLISSLPIHS  64

Query  246   SKAPYIHRLTRFLVHSGLLSVTNSGQEEC---YSLTPAGRLVVKDEPINLRAFLHICNEY  416
             SK  +IHRL R +V SG  S  N  + E    Y+LT +  L++K   +++  +L    + 
Sbjct  65    SKTHFIHRLMRIMVQSGFFSQHNPTENELEVKYALTDSSLLLLKSHAMSMTPYLQAKLDP  124

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
              F        +WF+N+ P+ F  AHG+  W+Y   +P +N +FN+  A D+QL+  V++ 
Sbjct  125   AFTNPWNQFSNWFKNDSPTTFEMAHGKPFWEYAGSDPRFNILFNDAMASDAQLVTSVVIE  184

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF G+ SLVDV GG G +  AI+K FP ++CTV DLPHV++ +  +  EN+++V 
Sbjct  185   -KCKGVFMGLESLVDVGGGTGTMGKAISKSFPQLECTVFDLPHVVSGLQGS--ENLKYVG  241

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE IP A+A+LLKWI+HDW DEECVKILKKCKEAI  + + GKVIIIDMV++ +  D
Sbjct  242   GDMFEAIPPADAILLKWILHDWSDEECVKILKKCKEAISRKGKEGKVIIIDMVVDKEMKD  301

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
                   +L+ DL++M L+  KERNKK+W KLIS AGF++YKITP +G+RSLIE++P
Sbjct  302   DESFETQLFFDLMMMVLFNGKERNKKEWVKLISSAGFNNYKITPVMGIRSLIEIYP  357



>ref|XP_009780941.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
sylvestris]
Length=363

 Score =   367 bits (942),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 179/366 (49%), Positives = 250/366 (68%), Gaps = 15/366 (4%)
 Frame = +3

Query  51    IMGENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAA  230
             I+GE+      E+L A+   WNHI ++I+S +LK A+QL IPDIIH H KPM L  L  A
Sbjct  5     IVGEH----ETEILHAQTHIWNHIFSFINSMSLKSAIQLNIPDIIHKHGKPMTLDQLANA  60

Query  231   LPIHPSKAPYIHRLTRFLVHSGLLSVT----NSGQEE----CYSLTPAGRLVVKDEPINL  386
             L I+ +K  ++ RL R L+HSG    +    N G+ E     Y+L P  RL++KDEP+++
Sbjct  61    LSINKAKTTHLRRLMRILIHSGFFVKSRIQENEGESERIGEGYALAPPSRLLLKDEPLSV  120

Query  387   RAFLHICNEYVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKD  566
               FL    + +  K  + + +WF+N+ P+PF TAHG   WDY  HEP  N  FN+  A D
Sbjct  121   TPFLLAMLDPILVKPWHHVSEWFENDHPTPFDTAHGRTFWDYAGHEPRLNHFFNDAMASD  180

Query  567   SQLLMIVLLSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDA  746
             ++L+M V++   SK VF+G++S+VDV GG G VA +IA  FP ++CTV DLPHV+  ++ 
Sbjct  181   AKLVMNVVIK-YSKDVFEGLNSIVDVGGGTGTVAKSIANAFPDLQCTVFDLPHVVEGLEG  239

Query  747   ASVENVEFVAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIII  926
                +N+ +V G+ F +IP A+A+LLKWI+HDW DEE VKILKKCKEAIPSRE+GGKVIII
Sbjct  240   N--KNLNYVGGDFFVSIPPADALLLKWILHDWSDEESVKILKKCKEAIPSREKGGKVIII  297

Query  927   DMVIEDKKHDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRS  1106
             DM++++K  D      +++ D+L+M L   +ER++K W KL S+AGFSDYK+TP LGLRS
Sbjct  298   DMMVDNKIGDDESIETQIFFDMLMMVLVTGRERSEKGWAKLFSDAGFSDYKVTPILGLRS  357

Query  1107  LIELFP  1124
             LIE++P
Sbjct  358   LIEVYP  363



>emb|CAJ65622.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   366 bits (940),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 179/346 (52%), Positives = 243/346 (70%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHHPSIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEECVKILK+ +EAI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALLTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65642.1| putative orcinol O-methyltransferase [Rosa marretii]
Length=346

 Score =   366 bits (940),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 179/346 (52%), Positives = 243/346 (70%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSTSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEECVKILK+ +EAI S+++ GKVIIIDM+ E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMRENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAD29556.1| orcinol O-methyltransferase [Rosa hybrid cultivar]
Length=348

 Score =   366 bits (939),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 177/347 (51%), Positives = 245/347 (71%), Gaps = 6/347 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  6     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELSSALPIH  64

Query  243   PSKAPYIHRLTRFLVHSGLLSVTNSGQ--EECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +     +  EE Y+LT A +L++KD P++L  FL    + 
Sbjct  65    PTKSHSVYRLMRILVHSGFFAKKKLSKIDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDP  124

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF T HG   WDY +H+P    +FN+  A D++L+  V++ 
Sbjct  125   VLTKPWNYLSTWFQNDDPTPFDTTHGMTFWDYGNHQPNIAHLFNDAMASDARLVTSVIID  184

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+   D    +N+++  
Sbjct  185   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVG--DLQGSKNLKYTG  241

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEEC+KILK+ + AI S+++ GKVIIIDM++E++K D
Sbjct  242   GDMFEAVPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGD  301

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALG  1097
                   +L++D+L+MAL G KERN+K+W KL ++AGFSDYKITP LG
Sbjct  302   EESIETQLFLDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPILG  348



>emb|CAJ65625.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   366 bits (939),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 179/346 (52%), Positives = 242/346 (70%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D     N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSRNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI HDW DEECVKILK+ +EAI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWISHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65598.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   365 bits (938),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 177/346 (51%), Positives = 245/346 (71%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A++  +  +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVANLQGS--KNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEECVKILK+ +EAI  +++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITRKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65648.1| putative orcinol O-methyltransferase [Rosa woodsii var. ultramontana]
Length=346

 Score =   365 bits (938),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 177/346 (51%), Positives = 244/346 (71%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ +LL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-DLLHAQAHIWNHIFSFINSTSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEECVKILK+ +EAI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   +ERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVTGRERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65603.1| putative orcinol O-methyltransferase [Rosa banksiae]
Length=346

 Score =   365 bits (938),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 179/346 (52%), Positives = 245/346 (71%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGFPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    ++  EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSTTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTSWDYGNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  F  ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFSHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+AVLLKWI+HDW DEECVKILK+ +EAI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADAVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAH05082.1| putative orcinol O-methyltransferase [Rosa hybrid cultivar]
Length=346

 Score =   365 bits (938),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 179/346 (52%), Positives = 243/346 (70%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPCIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEECVKILK+ +EAI S+++ GKVIIIDM +E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMTMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAH05087.1| orcinol O-methyltransferase 4 [Rosa hybrid cultivar]
Length=346

 Score =   365 bits (938),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 180/346 (52%), Positives = 243/346 (70%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGI DII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHVWNHIFSFINSMSLKSAIQLGILDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE IP AN VLLKWI+HDW DEECVKILK+ +EAI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAIPPANTVLLKWILHDWNDEECVKILKQSREAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>ref|XP_006376396.1| hypothetical protein POPTR_0013s12670g [Populus trichocarpa]
 gb|ERP54193.1| hypothetical protein POPTR_0013s12670g [Populus trichocarpa]
Length=359

 Score =   366 bits (939),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 182/357 (51%), Positives = 245/357 (69%), Gaps = 8/357 (2%)
 Frame = +3

Query  69    KQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPS  248
             ++S  ELLQA+   WNHI  +I+S TLKCAVQLGIPD+I  H KPM L +L++ALPIHPS
Sbjct  6     EESASELLQAQTHVWNHIFYFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPS  65

Query  249   KAPYIHRLTRFLVHSGLLSVTNSG---QEECYSLTPAGRLVVKDEPINLRAFLHICNEYV  419
             KA Y+HRL R LVHSG  S  N      +E YSLT + RL++KD P ++RA L    + V
Sbjct  66    KAQYVHRLMRILVHSGFFSQRNLNGVDNQEAYSLTQSTRLLLKDNPWSVRAHLLFVLDPV  125

Query  420   FQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSG  599
               K    L  WFQN+D + F  AH +  W+Y+  +P  N++ NEV A+DS +L   L+  
Sbjct  126   LTKPWDCLSTWFQNDDRTAFSVAHEKAPWEYVGQDPRINNLCNEVMARDS-ILACKLVVN  184

Query  600   ESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAG  779
             + K +F+GVSSLVDV GG G +A  I + FP M CTVLDLPHV++  D    +N+++VAG
Sbjct  185   KCKGIFEGVSSLVDVGGGIGTMAKGITEAFPHMDCTVLDLPHVVS--DLQGCKNLKYVAG  242

Query  780   NMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSR--EEGGKVIIIDMVIEDKKH  953
             +MF+ +P A A+LLKW++H+W DE+CVKILK+CK+AI S+  ++ GKVIIIDMV E+   
Sbjct  243   DMFQAVPPAEAILLKWMLHNWSDEDCVKILKRCKQAIMSKGQQKAGKVIIIDMVRENLNG  302

Query  954   DPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             D      +L+ DL +M + G  ERN+K+W KL  +AGF +YKI P LG R+LIEL+P
Sbjct  303   DEGSIETQLFFDLQMMVVVGGMERNEKEWAKLFFDAGFLNYKIHPVLGTRALIELYP  359



>emb|CAJ65618.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   365 bits (938),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 177/344 (51%), Positives = 243/344 (71%), Gaps = 6/344 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEECVKILK+ +EAI  +++ GKVIIIDM++E++K +
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITRKDKKGKVIIIDMMMENQKGE  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITP  1088
                   +L+ D+L+MAL G KERN+K+W KL ++AGFSDYKITP
Sbjct  301   EESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITP  344



>emb|CAJ65613.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
 emb|CAJ65619.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   365 bits (937),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 178/346 (51%), Positives = 243/346 (70%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEECVKILK+ +EAI  +++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITRKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65635.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   365 bits (937),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 180/346 (52%), Positives = 243/346 (70%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGI DII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGILDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE IP AN VLLKWI+HDW DEECVKILK+ +EAI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAIPPANTVLLKWILHDWNDEECVKILKQSREAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65639.1| putative orcinol O-methyltransferase [Rosa hugonis]
Length=346

 Score =   365 bits (937),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 179/346 (52%), Positives = 245/346 (71%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++++S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFMNSMSLKSAIQLGIPDIINKHGCPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A + ++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQPLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K  + L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWHYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSMAHFFNDAMACDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEECVKILK+CKEAI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDEECVKILKRCKEAITSKDKKGKVIIIDMIMENQKVD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALLTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>ref|XP_004235335.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
lycopersicum]
Length=445

 Score =   369 bits (946),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 177/348 (51%), Positives = 248/348 (71%), Gaps = 8/348 (2%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKA-PY  260
             E+L A+A   NH+ NYI+S +LKCA+QLGIPDIIHNH + M   DL+ ALPI+ SK    
Sbjct  105   EVLAAQAHIANHVFNYINSMSLKCAIQLGIPDIIHNHGRAMTQSDLVNALPINKSKGHDC  164

Query  261   IHRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSCYS  440
             I+RL R L+H+G  +      EE Y LTP  RL++K+EP++L  F+    + V     +S
Sbjct  165   IYRLMRILIHAGFFT----QGEEGYLLTPTSRLLLKNEPLSLAPFVQAQLDPVLMDPWHS  220

Query  441   LGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKRVFD  620
             LG+WF N D +PF TAHG+ +++Y   E   N++FNE    D++L+M VL+    K VF+
Sbjct  221   LGEWFANEDSTPFATAHGKPLFEYAGDEQRLNNLFNEAMGCDARLIMSVLIK-NGKGVFE  279

Query  621   GVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFENIP  800
             G+ SLVDV GG G VA AI+  FP +KC+V DLPHV+  ++    +N+ ++AG+MF+ +P
Sbjct  280   GLKSLVDVGGGIGTVAKAISNAFPELKCSVFDLPHVVEGLEGG--KNLTYIAGDMFKFVP  337

Query  801   AANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYSRAEL  980
             +A+A+LLKWI+HDW D++CVKILKKCKEAIPS+E GGKVI+ID+VI+++K D      +L
Sbjct  338   SADAILLKWILHDWSDKDCVKILKKCKEAIPSKENGGKVIVIDIVIDNQKRDNKSFETQL  397

Query  981   YMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             + D+L+M     KERN+++W KL S AGFSDYKI+P LGLRS+IE++P
Sbjct  398   FSDVLMMVHVSGKERNEQEWAKLFSNAGFSDYKISPILGLRSVIEVYP  445



>emb|CAJ65604.1| putative orcinol O-methyltransferase [Rosa beggeriana]
Length=346

 Score =   365 bits (936),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 178/346 (51%), Positives = 243/346 (70%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEECVKILK+ + AI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDEECVKILKRSRGAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>ref|XP_006469069.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=353

 Score =   365 bits (937),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 178/358 (50%), Positives = 249/358 (70%), Gaps = 6/358 (2%)
 Frame = +3

Query  51    IMGENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAA  230
             I GEN   S  ELL+A+AQ WN   NY++S +LKCAV+LGI DIIH+H +P  L  + +A
Sbjct  2     INGENAASSS-ELLKAQAQVWNCTFNYVNSMSLKCAVELGIADIIHSHGQPTTLSQIASA  60

Query  231   LPIHPSKAPYIHRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICN  410
             L I P+K   I  + R LVHSG  +     +++ Y LTPA RL++KD P+    F+ +  
Sbjct  61    LNIKPNKVECIQSVMRILVHSGFFA---QQKDDEYFLTPASRLLLKDTPLKAAPFVDLVA  117

Query  411   EYVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVL  590
             + ++  + + LG W QN+DP+ F TAHG+K+WD ++ EP +  +F ++   DS+L+  ++
Sbjct  118   DPLYTTAFHCLGTWLQNDDPTLFETAHGKKVWDRVADEPKFKSLFYDLMITDSELIAGIV  177

Query  591   LSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEF  770
             +  + K VF+G+ SLVDVAGG G +A AIA  FP +KCTV DLPHV+ ++   + +N++F
Sbjct  178   IK-DCKEVFEGLKSLVDVAGGTGIMARAIATAFPDIKCTVFDLPHVVDNLQGTN-DNLDF  235

Query  771   VAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKK  950
             + GNMFE IP ANAVLLKWI+H+W DEE VK+LKKCKEAIPS++EGGKVIIIDM IE++ 
Sbjct  236   LGGNMFEAIPQANAVLLKWILHNWNDEESVKLLKKCKEAIPSKDEGGKVIIIDMAIENQS  295

Query  951   HDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
              D      +L  D+L+++L+  KER+   W+KL   AGFS YKITP LG+RSLIE +P
Sbjct  296   QDKESMETQLCFDILMVSLFRGKERSVDDWKKLFLAAGFSHYKITPMLGVRSLIEAYP  353



>emb|CAJ65645.1| putative orcinol O-methyltransferase [Rosa roxburghii]
Length=346

 Score =   364 bits (935),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 178/346 (51%), Positives = 243/346 (70%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEECVKIL++  EAI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDEECVKILERSGEAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65647.1| putative orcinol O-methyltransferase [Rosa rugosa]
Length=346

 Score =   364 bits (935),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 177/346 (51%), Positives = 243/346 (70%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW +EECVKILK+ +EAI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNNEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+M L   KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMTLVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>ref|XP_009764108.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
sylvestris]
Length=360

 Score =   365 bits (936),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 175/351 (50%), Positives = 248/351 (71%), Gaps = 7/351 (2%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAP-Y  260
             E+L A+A   NH+ NY++S +LKCA+QL IPDIIHNH KPM L +L+ ALPI+ +K    
Sbjct  13    EILAAQAHIANHVFNYLNSMSLKCAIQLEIPDIIHNHGKPMTLSNLVNALPINKAKGQDC  72

Query  261   IHRLTRFLVHSGLL---SVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKS  431
             I+RL R L+HSG      +  + +EE Y LTP  RL++K+EP++L  F+    + +    
Sbjct  73    IYRLMRILIHSGFFIQTKINETEEEEGYLLTPNSRLLLKNEPLSLVPFVLAQLDPILMDP  132

Query  432   CYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKR  611
               SL  W QN+D +PF TAHG+ +++Y   EP  N +FNE  A D++L++ V++   S  
Sbjct  133   FQSLSKWLQNDDSTPFATAHGKPLFEYAGEEPRLNYLFNEAMASDARLMISVVIKTGSG-  191

Query  612   VFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFE  791
             +FDG+ SLVDV GG G VA AI+  FP +KCTV DLPHV+  ++ +  +N+ +V G+MF+
Sbjct  192   IFDGLKSLVDVGGGIGTVAKAISNAFPEVKCTVFDLPHVVEGLEGS--KNLSYVGGDMFK  249

Query  792   NIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYSR  971
             ++P+A+A+LLKWI+HDW DE+CVKILKKCKEAIPS+E  GKVIIID+V++ +K D     
Sbjct  250   SVPSADAILLKWILHDWSDEDCVKILKKCKEAIPSKENRGKVIIIDIVVDSQKGDNKSFE  309

Query  972   AELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
              +L+ D+L+M     KERN+++W KL  +AGFSDYKI P LGLRS+IE++P
Sbjct  310   TQLFSDILMMVHVSGKERNREEWAKLFCDAGFSDYKINPILGLRSVIEVYP  360



>emb|CAJ65610.1| putative orcinol O-methyltransferase [Rosa canina]
Length=346

 Score =   364 bits (935),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 178/346 (51%), Positives = 244/346 (71%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +AL IH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALLIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P    +FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEECVKILK+ +EAI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65664.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   364 bits (934),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 176/346 (51%), Positives = 244/346 (71%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELSSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVTNSGQ--EECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +     +  EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKIDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF T HG   WDY +H+P    +FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTTHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+   D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVG--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEEC+KILK+ + AI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L++D+L+MAL G KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFLDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAH05091.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   364 bits (934),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 177/346 (51%), Positives = 245/346 (71%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ +  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P    +FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMAFWDYGNHQPSIAHLFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G +A AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEECVKILK+ +EAI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPLADTVLLKWILHDWNDEECVKILKQSREAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65655.1| putative orcinol O-methyltransferase [Rosa lucieae]
Length=346

 Score =   364 bits (934),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 177/346 (51%), Positives = 243/346 (70%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKRLSKTDEEGYTLTDASQLLLKDHPLSLTPFLAAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEECV+ILK+ +EAI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDEECVEILKRSREAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGF DYKITP L
Sbjct  301   EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFGDYKITPIL  346



>emb|CAJ65597.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   364 bits (934),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 176/346 (51%), Positives = 245/346 (71%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A++  +  +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVANLQGS--KNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEECVKILK+ +EAI  +++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITRKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   +ERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVRGQERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65608.1| putative orcinol O-methyltransferase [Rosa bracteata]
Length=346

 Score =   364 bits (934),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 178/346 (51%), Positives = 244/346 (71%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ E L A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-EPLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    ++  EE Y+LT A +L++KD P+++  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSTTDEEGYTLTDASQLLLKDHPLSITPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE  P A+AVLLKWI+HDW DEECVKILK+ +EAI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAAPPADAVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65620.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   363 bits (933),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 177/346 (51%), Positives = 242/346 (70%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL  +A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHVQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEECVKILK+ +EAI  +++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITRKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>ref|XP_007142077.1| hypothetical protein PHAVU_008G250700g [Phaseolus vulgaris]
 gb|ESW14071.1| hypothetical protein PHAVU_008G250700g [Phaseolus vulgaris]
Length=357

 Score =   364 bits (934),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 172/360 (48%), Positives = 243/360 (68%), Gaps = 6/360 (2%)
 Frame = +3

Query  54    MGENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAAL  233
             MG + +    +LL+A+   WNHIL++I+S +LKC V LGIPDIIHNH +PM L +LI++L
Sbjct  1     MGSHEEDQSAKLLKAQTHVWNHILSFINSMSLKCIVDLGIPDIIHNHGQPMSLSNLISSL  60

Query  234   PIHPSKAPYIHRLTRFLVHSGLLSVTNSGQEEC---YSLTPAGRLVVKDEPINLRAFLHI  404
             PIH SK  +IHRL R +VHSG  S  N  + E    Y+LT +  L++K   +++  FL  
Sbjct  61    PIHSSKTHFIHRLMRIMVHSGFFSQHNHTENELEVKYALTDSSLLLLKSNAMSVTPFLQA  120

Query  405   CNEYVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMI  584
               + V         +WF+N +P+ F  A G+  W+Y   +P  N +FN+  A D+QL+  
Sbjct  121   MLDPVLTTPWNQFANWFKNGNPTTFEMAQGKPFWEYAGSDPRINSLFNDAMASDAQLVTS  180

Query  585   VLLSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENV  764
             V++  + KRVF G+ SLVDV GG G +  AIAK FP ++CTV DLPHV++ +  +  EN+
Sbjct  181   VVIE-KCKRVFMGLESLVDVGGGTGTMGKAIAKSFPQLECTVFDLPHVVSGLQGS--ENL  237

Query  765   EFVAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIED  944
             ++V G+MFE IP A+A+LLKWI+HDW DE+ V ILKKCKEA+  + + GKVIIIDMV++ 
Sbjct  238   KYVGGDMFEAIPPADAILLKWILHDWSDEDSVNILKKCKEALSRKGKEGKVIIIDMVVDK  297

Query  945   KKHDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             +  D      +L+ D+L+M  +  KERNKK+W KL S AGF++YKITP +GLRSLIE++P
Sbjct  298   EMKDDESFETQLFFDMLMMVFFTGKERNKKEWVKLFSSAGFNNYKITPVVGLRSLIEIYP  357



>emb|CAJ65646.1| putative orcinol O-methyltransferase [Rosa rugosa]
Length=346

 Score =   363 bits (933),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 176/346 (51%), Positives = 243/346 (70%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEEC+KILK+ + AI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYK+TP L
Sbjct  301   EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKVTPIL  346



>emb|CAJ65606.1| putative orcinol O-methyltransferase [Rosa beggeriana]
Length=346

 Score =   363 bits (932),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 178/346 (51%), Positives = 243/346 (70%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +AL IH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALLIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEECVKILK+ +EAI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65633.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   363 bits (932),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 175/346 (51%), Positives = 242/346 (70%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL  +A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHVQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P+ L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLTLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF T HG   WDY +H+P    +FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTTHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+   D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVG--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEEC+KILK+ + AI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L++D+L+MAL G KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFLDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65656.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   363 bits (932),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 175/346 (51%), Positives = 243/346 (70%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI N+I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFNFINSMSLKSAIQLGIPDIINKHGYPMTLSELSSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++K  P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKGHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF T HG   WDY +H+P    +FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTTHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+   D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVG--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEEC+K+LK+ + AI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDEECIKVLKRSRVAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L++D+L+MAL G KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFLDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPIL  346



>ref|XP_006446726.1| hypothetical protein CICLE_v10015705mg [Citrus clementina]
 gb|ESR59966.1| hypothetical protein CICLE_v10015705mg [Citrus clementina]
Length=362

 Score =   363 bits (933),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 179/355 (50%), Positives = 245/355 (69%), Gaps = 9/355 (3%)
 Frame = +3

Query  81    VELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPY  260
              ELL+A+A  WNHI N+I+S +LKCAV+L IPDII+ H KPM L  L++AL I+PSK   
Sbjct  10    TELLEAQAHVWNHIFNFINSMSLKCAVELSIPDIINKHGKPMTLNKLVSALTINPSKTRC  69

Query  261   IHRLTRFLVHSGLL-------SVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYV  419
             ++RL R L+HSG         S  N+ +E+ Y LT A +L++KD P+++  FL    + +
Sbjct  70    VYRLMRILIHSGFFAQQTLNSSRNNNDEEQGYVLTNASKLLLKDSPLSVTPFLQAMLDPI  129

Query  420   FQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSG  599
                    L  WFQ++DP+PF TAHG+  W+Y   EP  N+ FNE  A D++L   V++  
Sbjct  130   LLSPWLKLSTWFQSDDPAPFDTAHGKSFWEYAGDEPKINNFFNEAMASDARLATRVVIH-  188

Query  600   ESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAG  779
             + K VF G++SLVDV GG G VA AIA  FP ++CT  DLPHV+  +++  + N+++V G
Sbjct  189   KCKDVFQGLNSLVDVGGGTGTVAKAIAIAFPNLECTDFDLPHVVNGLES-DLANLKYVGG  247

Query  780   NMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDP  959
             +MFE IP A+AV+LKWI+HDW DEECVKILKKCKEAI S  + GKVIIIDM+ E+KK + 
Sbjct  248   DMFEAIPPADAVVLKWILHDWNDEECVKILKKCKEAITSDGKKGKVIIIDMMRENKKGND  307

Query  960   CYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
               +  +L+ D+L+M L    ER++K+W KL ++AGFSDYKIT  LGLRSLIE+ P
Sbjct  308   ESTETQLFFDMLMMVLATGTERDEKEWAKLFADAGFSDYKITSILGLRSLIEVCP  362



>emb|CAJ65661.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   363 bits (931),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 178/346 (51%), Positives = 243/346 (70%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAEKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L   FQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTRFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEECVKILK+ +EAI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKNGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAH05079.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   363 bits (931),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 177/346 (51%), Positives = 242/346 (70%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHHPSIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G +A AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEECVKILK+ +EAI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AG SDYKITP L
Sbjct  301   EESIETQLFFDMLMMALLTGKERNEKEWAKLFTDAGLSDYKITPIL  346



>emb|CAH05080.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   363 bits (931),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 178/346 (51%), Positives = 243/346 (70%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A   NHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIRNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMPDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H P     FN+  A D++L+  V+++
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHHPSIAHFFNDAMASDARLVTSVIIN  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G +A AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEECVKILK+ +EAI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERNKK+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALLTGKERNKKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65634.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   362 bits (929),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 176/346 (51%), Positives = 243/346 (70%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELSSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVTNSGQ--EECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +     +  EE Y+LT A +L+ KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKIDEEGYTLTDASQLLPKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF T HG   WDY +H+P    +FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTTHGMTFWDYGNHQPNIAHLFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+   D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVG--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEEC+KILK+ + AI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L++D+L+MAL G KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFLDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPIL  346



>ref|XP_002525160.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF37287.1| o-methyltransferase, putative [Ricinus communis]
Length=356

 Score =   362 bits (930),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 181/358 (51%), Positives = 245/358 (68%), Gaps = 8/358 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             +GK    ELLQA+A  WNHI ++I+S +LK AVQLGIPD IH+H +P+ L  LIAALPIH
Sbjct  3     DGKYDANELLQAQAHIWNHIFSFINSMSLKSAVQLGIPDAIHSHGRPISLSQLIAALPIH  62

Query  243   PSKAPYIHRLTRFLVHSGLLS---VTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNE  413
             P+KA  I RL R L+HSG  +   +    +EE Y LT A +L++KD P+++  FL    +
Sbjct  63    PAKARGIPRLMRILIHSGFFAKAKIEEKDEEEGYVLTNASKLLLKDNPLSIAPFLLAMLD  122

Query  414   YVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLL  593
              +  K  + L  WFQN+D + F TAHG   W+Y + +P  N+ FNE  A D++L+M VL+
Sbjct  123   PILIKPWHYLSTWFQNDDATAFDTAHGMGFWEYTASDPNLNNFFNEAMASDARLVMKVLI  182

Query  594   SGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFV  773
               E K +F+G+ SLVDV GG G +A+AIAK FP ++CTV DLPHV+  +     EN+++V
Sbjct  183   D-EHKGLFEGLKSLVDVGGGTGTMAAAIAKAFPQLECTVFDLPHVVVGLQG--TENLKYV  239

Query  774   AGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKK-  950
             AG+MFE IP A+AVLLKWIMH W  E CVK+LK CKEAI  + +GGK+II+D+V+E +  
Sbjct  240   AGDMFEAIPPADAVLLKWIMHGWTHEGCVKLLKLCKEAIKGK-KGGKLIIVDLVLESQHV  298

Query  951   HDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
              D      + + D+L+M L   KE+N K W KL  +AGFSDYKI P LGLRS+IE++P
Sbjct  299   TDHQDVETQFFFDILLMTLQTGKEKNNKDWGKLFMDAGFSDYKINPILGLRSVIEVYP  356



>gb|ABZ89567.1| O-methyltransferase 3 [Humulus lupulus]
Length=377

 Score =   363 bits (932),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 184/361 (51%), Positives = 251/361 (70%), Gaps = 12/361 (3%)
 Frame = +3

Query  69    KQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPS  248
             +++  E+L A+A  WN I N+I+S +LKCA+QLGIPDII+NH KPM +  L  ALPI+  
Sbjct  20    EENSTEILGAQAHIWNQIFNFINSMSLKCAIQLGIPDIINNHGKPMTISQLTLALPINRK  79

Query  249   KAPYIHRLTRFLVHSGLLSVTNS-------GQEECYSLTPAGRLVVKDEPINLRAFLHIC  407
             K+P ++RL R L+HSG  ++  +       G+EE Y +T A +L++KD P+++  FL   
Sbjct  80    KSPCVYRLMRILIHSGFFALQKAEVGEEGGGEEEGYVITDASKLLLKDNPMSVTPFLLAM  139

Query  408   NEYVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIV  587
              + V  K    L +WFQN DP+PF TA+G   WDY SHEP     FN+  A D++L+  V
Sbjct  140   LDPVMTKPWDFLSNWFQNGDPTPFDTANGMAFWDYGSHEPKLARFFNDAMASDARLVTSV  199

Query  588   LLSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVE  767
             ++  + K VF+GV SLVDV GG G VAS+IA  FP ++CTV DLPHV+A +   +  N+ 
Sbjct  200   VIE-KCKGVFEGVESLVDVGGGTGTVASSIAAAFPHIQCTVFDLPHVVADLQGGN--NLN  256

Query  768   FVAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIP-SREEGGKVIIIDMVIED  944
             FV G+MF ++PA   VLLKWI+HDW DEE VKILKKCKEAI  S ++GGKVIIIDM +E+
Sbjct  257   FVGGDMFVDVPATEVVLLKWILHDWNDEESVKILKKCKEAISKSNKKGGKVIIIDMKVEN  316

Query  945   KKHDPCYS-RAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELF  1121
             +K +   S   +L+ D+L+MAL   +ERN+K+W KL  +AGFS+YKITP LGLRSLIE++
Sbjct  317   EKDEDDESYETQLFFDMLMMALVTGRERNEKEWAKLFKDAGFSNYKITPILGLRSLIEVY  376

Query  1122  P  1124
             P
Sbjct  377   P  377



>ref|XP_006376386.1| hypothetical protein POPTR_0013s12560g [Populus trichocarpa]
 ref|XP_006376390.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP54183.1| hypothetical protein POPTR_0013s12560g [Populus trichocarpa]
 gb|ERP54187.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=359

 Score =   362 bits (930),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 179/357 (50%), Positives = 242/357 (68%), Gaps = 8/357 (2%)
 Frame = +3

Query  69    KQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPS  248
             ++S  ELLQA+   WNHI  +I+S TLKCAVQLGIPD+I  H KPM L +L++ALPIHPS
Sbjct  6     EESASELLQAQTHVWNHIFYFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPS  65

Query  249   KAPYIHRLTRFLVHSGLLSVTNSG---QEECYSLTPAGRLVVKDEPINLRAFLHICNEYV  419
             KA Y+HRL R LVHSG  S  N      ++ YSLT + RL++KD P ++R  L +  + V
Sbjct  66    KAQYVHRLMRILVHSGFFSQQNLNDIHNQDAYSLTQSTRLLLKDNPWSMRPLLLVFLDPV  125

Query  420   FQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSG  599
               K    L  WFQN+D + F  AH    W+Y   +P  N++FN+  A+DS L+  V++  
Sbjct  126   LTKPWDCLSTWFQNDDRNAFSVAHENTFWEYAGQDPRINNLFNDAMARDSILVSKVVVC-  184

Query  600   ESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAG  779
             + K +FDGV+SLVDV GG G +A  IA+ FP M CTV DLPHV++  D    +N+++V G
Sbjct  185   KCKGIFDGVNSLVDVGGGLGTMAKGIAEAFPHMDCTVFDLPHVVS--DLQGSKNLKYVGG  242

Query  780   NMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPS--REEGGKVIIIDMVIEDKKH  953
             +MFE +P A+A+LLKWI+HDW DE+CVKIL++CK+AI S  +++ GKVIIIDMV E+   
Sbjct  243   DMFEAVPPADAILLKWILHDWSDEDCVKILRRCKQAIMSTGQQKAGKVIIIDMVRENLNG  302

Query  954   DPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             D      +L  DL +M  +   ERN+K+W KL  +AGF +YKI P LG R+LIEL+P
Sbjct  303   DEGSIETQLLFDLQLMVGFSGMERNEKEWAKLFFDAGFLNYKIHPVLGTRALIELYP  359



>emb|CAH05085.1| orcinol O-methyltransferase 3 [Rosa hybrid cultivar]
Length=346

 Score =   362 bits (929),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 174/346 (50%), Positives = 245/346 (71%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  +L    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V       L  WFQN+DP+PF TAHG   WDY +H+P    +FN+  A D++L+  V+++
Sbjct  124   VLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIN  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G +A AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW D+EC+KILK+ + AI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL G KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAH05083.1| putative orcinol O-methyltransferase [Rosa hybrid cultivar]
Length=346

 Score =   362 bits (929),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 175/346 (51%), Positives = 244/346 (71%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEDSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGPPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  + RL R LVHSG  +    +   EE Y+LT   +L++KD P++L  FL    + 
Sbjct  64    PTKSHSLDRLMRILVHSGFFAKEKLSETDEEGYTLTDTSQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K  + L  WFQN+D +PF TAHG  +WDY +H+P ++  FN+  A D++L+  V+++
Sbjct  124   VLTKPWHHLSTWFQNDDLTPFATAHGMTMWDYGNHQPSFSHFFNDAMASDARLVASVIIN  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              E K VF+G+ SLVDV GG G +A AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -ECKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEECVKIL++ KEAI S+++ GKVIIIDM++ ++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDEECVKILQRSKEAITSKDKKGKVIIIDMIMGNQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+M L   KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIEMQLFFDMLMMVLLKGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65615.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   362 bits (929),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 174/346 (50%), Positives = 245/346 (71%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  +L    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V       L  WFQN+DP+PF TAHG   WDY +H+P    +FN+  A D++L+  V+++
Sbjct  124   VLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIN  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G +A AIA  FP ++CTVLDLPHV+A  D    +N++++ 
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYIG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEEC+KIL++ + AI  +E+ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDEECIKILERSRVAITGKEKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL G KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAH05086.1| orcinol O-methyltransferase 4 [Rosa hybrid cultivar]
Length=346

 Score =   362 bits (928),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 176/346 (51%), Positives = 243/346 (70%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGI DII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGILDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSTAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW D+EC+KILK+ + AI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL G KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAD29555.1| orcinol O-methyltransferase [Rosa hybrid cultivar]
Length=348

 Score =   362 bits (928),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 174/347 (50%), Positives = 245/347 (71%), Gaps = 6/347 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ +  PM L +L +ALPIH
Sbjct  6     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIH  64

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  +L    + 
Sbjct  65    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDP  124

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V       L  WFQN+DP+PF TAHG   WDY +H+P    +FN+  A D++L+  V++ 
Sbjct  125   VLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIID  184

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G +A AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  185   -DCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  241

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW D+EC+KILK+ + AI S+++ GKVIIIDM++E++K D
Sbjct  242   GDMFEAVPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGD  301

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALG  1097
                   +L+ D+L+MAL G KERN+K+W KL ++AGFSDYKITP LG
Sbjct  302   EESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPILG  348



>emb|CAJ65605.1| putative orcinol O-methyltransferase [Rosa beggeriana]
Length=346

 Score =   362 bits (928),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 177/346 (51%), Positives = 242/346 (70%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +AL IH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALLIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              +   VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCNGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEECVKILK+ +EAI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>gb|AAB71213.1| methyltransferase [Prunus armeniaca]
Length=354

 Score =   362 bits (929),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 177/355 (50%), Positives = 241/355 (68%), Gaps = 8/355 (2%)
 Frame = +3

Query  69    KQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPS  248
             + SH ELLQA+A  WNHI ++I+S +LKCAVQL IPD+I  H +PM L +L++ALPI P+
Sbjct  5     RASH-ELLQAQAHIWNHIFSFINSLSLKCAVQLDIPDVIQKHGQPMTLSELVSALPISPT  63

Query  249   KAPYIHRLTRFLVHSGLL---SVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYV  419
             KA +I RL R LVHSG     S++  G E+ Y LT A  L++KD P++ R FL      +
Sbjct  64    KAHFIPRLMRILVHSGFFAKESLSGCG-EQGYILTDASALLLKDNPMSARPFLLAMLSPI  122

Query  420   FQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSG  599
                    L  WFQN++P+PF   +G   WDY++ +P     FN+  A D+QL+  +++  
Sbjct  123   LTDPYQYLTTWFQNDNPTPFHVVNGMTCWDYVNQDPTLAHFFNDAMASDAQLISSLVID-  181

Query  600   ESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAG  779
             + K VF GV SLVDV GG G VA +IA  FP MKCTVLDLPHV+A  D    +N+E+VAG
Sbjct  182   DCKEVFQGVDSLVDVGGGTGTVAKSIADAFPHMKCTVLDLPHVVA--DLKGSKNLEYVAG  239

Query  780   NMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDP  959
             +MFE +PAA+A+ LKWI+HDW DEECVKIL++CK A+    + GKVII++M +E+K  D 
Sbjct  240   DMFEAVPAADAIFLKWILHDWSDEECVKILERCKAAVTREGKKGKVIIVEMTVENKNTDK  299

Query  960   CYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
                  +L+ D+ +M +   KERN+K+W KL S+AGFS YKITP  G +SLIE++P
Sbjct  300   ESGETQLFFDMHMMVMSTGKERNEKEWAKLFSDAGFSQYKITPLFGFKSLIEVYP  354



>emb|CAJ65629.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   361 bits (927),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 174/346 (50%), Positives = 244/346 (71%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLFELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  +L    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V       L  WFQN+DP+PF TAHG   WDY +H+P    +FN+  A D++L+  V++ 
Sbjct  124   VLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G +A AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW D+EC+KILK+ + AI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPLADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL G KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAH05090.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   361 bits (927),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 178/346 (51%), Positives = 242/346 (70%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGI D+I+ H   M L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGILDVINKHGYLMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE IP AN VLLKWI+HDW DEECVKILK+ +EAI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAIPPANTVLLKWILHDWNDEECVKILKQSREAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>gb|KHN07780.1| Tabersonine 16-O-methyltransferase [Glycine soja]
Length=323

 Score =   360 bits (924),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 179/330 (54%), Positives = 233/330 (71%), Gaps = 11/330 (3%)
 Frame = +3

Query  144   TLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPYIHRLTRFLVHSGLLS---VTN  314
             +LKCA++L IPDIIH + +PMPL  L  +L IHPSKA  I+RL R L HSG  S   V  
Sbjct  2     SLKCAIELDIPDIIHKYGQPMPLSKLTTSLSIHPSKANCIYRLMRILTHSGFFSQHKVNE  61

Query  315   SGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSCYSLGDWFQNNDPSPFCTAHG  494
             +  E  Y LT A  L++KD P+++  FLH   +    +    L  WF+N+DPSPF TAHG
Sbjct  62    NELEMGYVLTDASTLLLKDNPLSMVPFLHAMLDPTLTQPWLQLPTWFKNDDPSPFQTAHG  121

Query  495   EKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKRVFDGVSSLVDVAGGKGAVASA  674
              KIWDY   EP  ND+FN+  A D+QL+  V++    K VF+G+ SLVDV GG G +A A
Sbjct  122   MKIWDYADREPRLNDLFNDAMASDTQLVANVVIE-RCKGVFNGLESLVDVGGGTGTMAMA  180

Query  675   IAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFENIPAANAVLLKWIMHDWEDEE  854
             IAK FP ++CTV DLPHV+A++  +  EN+++V G+MFE+IP+A+A+LLKWI+HDW DE+
Sbjct  181   IAKSFPQLECTVFDLPHVVATLQGS--ENLKYVGGDMFESIPSADAILLKWILHDWNDEQ  238

Query  855   CVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYSRAELYMDLLVMALYGSKERNKK  1034
             CVKILKKCKEAI S     KVIIIDMV+E++K D      +L++D++VM LY  KER +K
Sbjct  239   CVKILKKCKEAIKS-----KVIIIDMVVENEKGDDESIETQLFIDMVVMVLYPGKERTEK  293

Query  1035  QWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             +W KLI   GFSDYKITP LGLRSLIE++P
Sbjct  294   EWAKLIFSTGFSDYKITPVLGLRSLIEIYP  323



>emb|CAJ65614.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   361 bits (926),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 173/344 (50%), Positives = 244/344 (71%), Gaps = 6/344 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  +L    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V       L  WFQN+DP+PF TAHG   WDY +H+P    +FN+  A D++L+  V+++
Sbjct  124   VLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIN  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G +A AIA  FP ++CTVLDLPHV+A  D    +N++++ 
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYIG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEEC+KIL++ + AI  +E+ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDEECIKILERSRVAITGKEKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITP  1088
                   +L+ D+L+MAL G KERN+K+W KL ++AGFSDYKITP
Sbjct  301   EESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITP  344



>emb|CAH05088.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   360 bits (925),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 174/346 (50%), Positives = 244/346 (71%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLFELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  +L    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V       L  WFQN+DP+PF TAHG   WDY +H+P    +FN+  A D++L+  V++ 
Sbjct  124   VLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G +A AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTR  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW D+EC+KILK+ + AI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL G KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65649.1| putative orcinol O-methyltransferase [Rosa woodsii var. ultramontana]
Length=346

 Score =   360 bits (925),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 175/346 (51%), Positives = 241/346 (70%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L + LPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSTLPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLAPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
                K    L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   ALTKPWNYLSIWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEEC+KILK+ + AI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPLADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMIMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   EL+ D+L+MA+   KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETELFFDMLMMAILTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>ref|XP_006376381.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP54178.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=359

 Score =   361 bits (926),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 179/357 (50%), Positives = 241/357 (68%), Gaps = 8/357 (2%)
 Frame = +3

Query  69    KQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPS  248
             ++S  E+LQA++  WNHI N+I+S TLKCAVQLGIPD+I  H KPM L +L++ALPIHPS
Sbjct  6     EESAGEMLQAQSHVWNHIFNFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPS  65

Query  249   KAPYIHRLTRFLVHSGLLSVTNSG---QEECYSLTPAGRLVVKDEPINLRAFLHICNEYV  419
             KA Y+HRL R LVHSG  S  N      +E YSLT + RL++KD P ++R  L +  + V
Sbjct  66    KAQYVHRLMRILVHSGFFSQQNLNGIHNQEAYSLTQSTRLLLKDNPWSVRPLLLLLLDPV  125

Query  420   FQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSG  599
               K    L  WFQN+D + F  AH +  W+Y   +   N++FNE  A DS +L   L+  
Sbjct  126   LTKPWDCLSTWFQNDDRNAFSVAHEKTFWEYAGQDARLNNLFNEAMASDS-ILASKLVVS  184

Query  600   ESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAG  779
             + K +FDGV+SLVDV GG G +   IA+ FP M CTV DLPHV++ +     +N+++V G
Sbjct  185   KCKGIFDGVNSLVDVGGGLGTMTKGIAEAFPHMDCTVFDLPHVVSDLQGG--KNLKYVGG  242

Query  780   NMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSR--EEGGKVIIIDMVIEDKKH  953
             +MFE +P A+A+LLKWI+HDW DE+CVKILK+CK+AI S+  ++ GKVIIIDMV E++  
Sbjct  243   DMFEAVPPADALLLKWILHDWSDEDCVKILKRCKQAIASKGQQKVGKVIIIDMVRENQNR  302

Query  954   DPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             D      +L  DL +M      ERN+K+W KL  +AGF +YKI P LG R+LIEL+P
Sbjct  303   DEGSIETQLLFDLEMMVAVSGMERNEKEWAKLFFDAGFLNYKIHPVLGTRALIELYP  359



>emb|CAJ65611.1| putative orcinol O-methyltransferase [Rosa canina]
Length=346

 Score =   360 bits (924),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 177/346 (51%), Positives = 241/346 (70%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +AL IH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALLIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P +L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPSSLTPFLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P    +FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEECVKILK+ +EA  S+ + GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREATTSKAKNGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>ref|XP_009594948.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=359

 Score =   360 bits (925),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 175/360 (49%), Positives = 247/360 (69%), Gaps = 6/360 (2%)
 Frame = +3

Query  54    MGENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAAL  233
             +  N +    E+L A+A   NH+ NYI+  +LKCA+QL IPDIIHNH KPM L +L+ AL
Sbjct  3     LSNNIRDKTREILAAQAHIANHVFNYINFVSLKCAIQLEIPDIIHNHGKPMTLSNLVNAL  62

Query  234   PIHPSKAP-YIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHI  404
             PI+ +K    I+RL R L+HSG    T  N  +EE Y LTP   L++K+EP++L  F+  
Sbjct  63    PINKAKGQDCIYRLMRILIHSGFFIQTKINENEEEGYLLTPNSHLLLKNEPLSLAPFVLA  122

Query  405   CNEYVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMI  584
               + +      SL  W QN+D +PF TAHG+ +++Y   EP  N +FNE  A D++L++ 
Sbjct  123   QLDPILMDPFQSLSKWLQNSDSTPFATAHGKPLFEYAGDEPRLNYLFNEAMASDARLMIS  182

Query  585   VLLSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENV  764
             V++    + +F+G+ SL DV GG G VA AI+  FP +KCTV DLPHV+  ++ ++   +
Sbjct  183   VVIK-NGRGIFEGLKSLADVGGGIGTVAKAISNAFPEIKCTVFDLPHVVEGLEGSN--KL  239

Query  765   EFVAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIED  944
              +V G+MF+++P+A+A+LLKWI+HDW DE+CVKILKKCKEAIPS+E GGKVIIID+V++ 
Sbjct  240   SYVGGDMFKSVPSADAILLKWILHDWSDEDCVKILKKCKEAIPSKENGGKVIIIDIVVDS  299

Query  945   KKHDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             +K D      +L+ D L+M     KERN+++W KL  +AGFSDYKI P LGLRSLIE++P
Sbjct  300   QKGDNKSFETQLFSDTLMMVHVSGKERNREEWVKLFCDAGFSDYKIIPILGLRSLIEVYP  359



>ref|XP_009618299.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=356

 Score =   360 bits (924),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 186/354 (53%), Positives = 241/354 (68%), Gaps = 16/354 (5%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPYI  263
             ELL+AEA +WN +  +I+   LKCA+QLGIP+ I  H KPM L +LIAALPI+PSK+ Y 
Sbjct  12    ELLRAEAHSWNQLYYFIEPVALKCALQLGIPNAITKHSKPMTLSELIAALPINPSKSHYF  71

Query  264   HRLTRFLVHSGLLSVTNS-------GQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVF  422
             HRLTR LVH GLL +  S         E  YSL  A R  VK+    L        +  F
Sbjct  72    HRLTRILVHYGLLILHKSEGRDNENDDEGYYSLATADRYAVKNATWKLME----EQDTFF  127

Query  423   QKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGE  602
              K+  S+ DWF+N DPS F TA+G+  WD +S +P   + FNE+ AK+S+  M VLL  +
Sbjct  128   LKAWNSMSDWFKNEDPSAFYTAYGDLFWDKLSRDPSIGNWFNEIMAKESRSFMKVLLEYK  187

Query  603   SKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGN  782
              K VFDG++S+VDV GG G VA AIAK FP MKCTVLDLP ++A++  +  EN+EFVA +
Sbjct  188   YKDVFDGLTSIVDVGGGTGTVAMAIAKTFPDMKCTVLDLPRLVANLQGS--ENLEFVAAD  245

Query  783   MFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPC  962
             MF+ IP ANAVLLK I+HDW D+ECV+ILK  K+AI  R   GK III+MV+E+ + D  
Sbjct  246   MFQKIPPANAVLLKSILHDWNDKECVRILKNSKKAITGR---GKAIIIEMVMENPEMDDE  302

Query  963   YSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
               +A+L +D+++M   GSKERNK++WEKL  +AGFS YKI   LGLRS+IEL+P
Sbjct  303   SVQAQLLIDMVIMVFLGSKERNKQEWEKLFLDAGFSSYKINQTLGLRSVIELYP  356



>emb|CAJ65599.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   360 bits (923),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 172/344 (50%), Positives = 243/344 (71%), Gaps = 6/344 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  +L    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V       L  WFQN+DP+PF TAHG   WDY +H+P    +FN+  A D++L+  V+++
Sbjct  124   VLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIN  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G +A AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEEC+KIL++ + AI  +E+ GKVII+DM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWSDEECIKILERSRVAITGKEKKGKVIIVDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITP  1088
                   +L+ D+L+MAL G KERN+K+W KL ++AGFSDYKITP
Sbjct  301   EESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITP  344



>emb|CAJ65659.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   360 bits (923),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 173/346 (50%), Positives = 244/346 (71%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ +  PM L +L +ALPIH
Sbjct  5     NGQHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  +L    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V       L  WFQN+DP+PF TAHG   WDY +H+P    +FN+  A D++L+  V++ 
Sbjct  124   VLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G +A AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW D+EC+KILK+ + AI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL G KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CDP19711.1| unnamed protein product [Coffea canephora]
Length=349

 Score =   360 bits (923),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 176/348 (51%), Positives = 242/348 (70%), Gaps = 8/348 (2%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPYI  263
             EL++A+   WN + ++  SA LKCAV+LGIPD+I NH KP+ L DLI+ LPIHPSK+ +I
Sbjct  9     ELIEAQTHVWNAMFHFKKSACLKCAVELGIPDVIRNHGKPITLSDLISVLPIHPSKSAHI  68

Query  264   HRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSCYSL  443
              RL RFL +SG       G    Y+LT AGRL++KDEP N+RA + +  +    K    L
Sbjct  69    FRLMRFLANSGFFVENPQG----YALTSAGRLLLKDEPFNVRAHIFLSCDPAMLKPWNFL  124

Query  444   GDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKRVFDG  623
               WFQN+DPSPF TA+G   W Y + E  +  +FNE  A D+QL + VL++ + K VF+G
Sbjct  125   TKWFQNDDPSPFDTAYGNNFWHYNAQEVRFGKMFNEAMASDNQLSVEVLMT-KCKFVFEG  183

Query  624   VSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFENIPA  803
             +++L DV GG G V  AIA+ FP +KCTV DLPHV+A+ + A  EN+EF+AG+MF+++P 
Sbjct  184   LTTLADVGGGTGKVDRAIAQNFPNIKCTVYDLPHVVANQEGA--ENLEFLAGDMFQSVPR  241

Query  804   ANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYSRAELY  983
             ANA+LLK I+HDW DE+C+KILK CK+AIP ++ GGKVIIID V+  +  D      E  
Sbjct  242   ANAILLKRILHDWSDEDCLKILKNCKKAIPEKDNGGKVIIIDGVMGSQIQDKTSFETEFS  301

Query  984   MDLLVMALYG-SKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             MD+ ++ + G +KER +K+W KL S+AGFS YK+ P LG+R LIE++P
Sbjct  302   MDMQMLVMLGPAKERTEKEWSKLFSDAGFSSYKVYPVLGMRCLIEVYP  349



>emb|CAJ65643.1| putative orcinol O-methyltransferase [Rosa marretii]
Length=346

 Score =   359 bits (922),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 174/346 (50%), Positives = 242/346 (70%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAVLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K    L  WFQN+DP+PF TAHG   WDY +H+P     FN+  A D++L+  V++ 
Sbjct  124   VLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLP V+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPQVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEEC+KILK+ + AI S+++ G+VIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGEVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYK+TP L
Sbjct  301   EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKVTPIL  346



>emb|CAJ65627.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   359 bits (922),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 173/346 (50%), Positives = 244/346 (71%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ +  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  +L    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V       L  WFQN+DP+PF TAHG   WDY +H+P    +FN+  A D++L+  V++ 
Sbjct  124   VLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G +A AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW D+EC+KILK+ + AI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL G KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPIL  346



>ref|XP_006376388.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP54185.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=365

 Score =   360 bits (924),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 176/351 (50%), Positives = 235/351 (67%), Gaps = 8/351 (2%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPYI  263
             ELLQA+   WNHI N+I+S TLKCAVQLGIPD+I  H KPM L +L++ALPIHPSKA Y+
Sbjct  17    ELLQAQTHVWNHIFNFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSKAQYV  76

Query  264   HRLTRFLVHSGLLSVTNSG---QEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSC  434
             HRL R LVHSG  S  N      +E YSLT + RL++KD P N+R  L    + V  K  
Sbjct  77    HRLMRILVHSGFFSQQNLNGVHNQEAYSLTQSTRLLLKDNPWNMRPLLLFELDSVLTKPW  136

Query  435   YSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKRV  614
               L  WF+N++ + F  AH    W+Y   +P   ++FNE  A DS +L   L+  + K +
Sbjct  137   DCLSTWFRNDEATAFSVAHENTFWEYAGQDPRIKNLFNEAMASDS-ILASKLVVSKCKGI  195

Query  615   FDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFEN  794
             F+G+SSLVDV GG G +A  IA+ FP M CTV DLPHV++  D    +N+++V G+MF+ 
Sbjct  196   FEGLSSLVDVGGGFGTMAKGIAEAFPHMDCTVFDLPHVVS--DLQGCKNLKYVGGDMFQA  253

Query  795   IPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSR--EEGGKVIIIDMVIEDKKHDPCYS  968
             +P A A+LLKWI+HDW DE+CVKIL++C++AI S+  ++ GKVIIIDMV E+   D    
Sbjct  254   VPPAEAILLKWILHDWSDEDCVKILRRCRQAIMSKGQQKAGKVIIIDMVRENLNGDEGSI  313

Query  969   RAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELF  1121
               +L+ DLL+M      ERN+K+W KL  +AGF +YKI P LG R+LIEL+
Sbjct  314   ETQLFFDLLMMVAVSGMERNEKEWAKLFFDAGFLNYKIHPVLGTRALIELY  364



>ref|XP_004241912.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
lycopersicum]
Length=356

 Score =   359 bits (922),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 183/359 (51%), Positives = 249/359 (69%), Gaps = 5/359 (1%)
 Frame = +3

Query  54    MGENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKP-MPLCDLIAA  230
             M  N      EL++AEAQ+W++IL+Y+  + +KCA+QLGIPDI+H +  P M L DLIAA
Sbjct  1     MASNNNICAYELIEAEAQSWDYILSYLRPSCIKCAIQLGIPDILHKNADPIMSLSDLIAA  60

Query  231   LP-IHPSKAPYIHRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHIC  407
             LP ++PSK  +I  L R LV  GL +  +  Q + YSLT  GRL+V++     R+F    
Sbjct  61    LPNLNPSKTTFIPILMRVLVDFGLFNY-HQQQGDGYSLTTVGRLLVENHHFGNRSFFLFA  119

Query  408   NEYVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIV  587
                V   +  S+GDW +++  + F TA G+  WDY   +P +N VFN+  A DS+L+  +
Sbjct  120   QHPVVLNTAASVGDWLKDDLRTAFETADGKSHWDYCGADPEFNGVFNDAMAGDSRLMSNL  179

Query  588   LLSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVE  767
             L+S     VF+G++SLVD+ GG GAVA AIA  FP++KC VLDLPHVIA  D     N+E
Sbjct  180   LISDCCAGVFEGLTSLVDIGGGTGAVAMAIAGAFPSLKCIVLDLPHVIA--DRKGSGNLE  237

Query  768   FVAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDK  947
             FVAG+MF+ IP ANA+LLKWI+H+W+DE+CVK+LKKCKE+I SRE GGKVIIIDM++ED 
Sbjct  238   FVAGSMFDKIPHANAILLKWILHNWDDEDCVKLLKKCKESISSRENGGKVIIIDMIMEDN  297

Query  948   KHDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
              ++    +++  MDL++   Y SKER +K+WEKL  EAGFS YKI  +LGLRSLIE++P
Sbjct  298   YNNKQLVQSQHLMDLIMRITYASKERTEKEWEKLFLEAGFSGYKIITSLGLRSLIEIYP  356



>ref|XP_006469137.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=362

 Score =   360 bits (923),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 175/355 (49%), Positives = 243/355 (68%), Gaps = 9/355 (3%)
 Frame = +3

Query  81    VELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPY  260
              ELL+A+A  WNHI N+I+S +LKCAV+L IPDII+ H KP  L DL++AL I+PSK   
Sbjct  10    TELLEAQAHVWNHIFNFINSMSLKCAVELSIPDIINKHGKPTTLNDLVSALTINPSKTRC  69

Query  261   IHRLTRFLVHSGLL-------SVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYV  419
             ++RL R L+HSG         S  N+ +E+ Y LT A +L++KD P+++   L    + +
Sbjct  70    VYRLMRILIHSGFFAQQTLNSSRNNNDEEQGYVLTNASKLLLKDSPLSVTPLLQAVLDPI  129

Query  420   FQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSG  599
                    L  WFQ++DP+PF   HG+  W+Y   EP  N+ FNE  A D++L   V++  
Sbjct  130   LLSPWLKLSTWFQSDDPAPFDMVHGKSFWEYAGDEPKINNFFNEAMASDARLATRVVIH-  188

Query  600   ESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAG  779
             + K VF+G++SLVDV G  G VA AIAK FP ++CT  DLPHV+  +++  + N+++V G
Sbjct  189   KCKNVFEGLNSLVDVGGATGTVAKAIAKAFPNLECTDFDLPHVVNGLES-DLANLKYVGG  247

Query  780   NMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDP  959
             +MFE IP A+AV+LKWI+HDW DEECVKILKKCKEAI S  + GKVIIIDM+ E+KK D 
Sbjct  248   DMFEAIPPADAVVLKWILHDWNDEECVKILKKCKEAITSNSKIGKVIIIDMMRENKKGDD  307

Query  960   CYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
               +  +L+  +L+M L    ER++K+W KL+++ GFSDYKIT  LGLRSLIE++P
Sbjct  308   ESTETQLFFYMLMMVLATGTERDEKEWAKLLADVGFSDYKITSILGLRSLIEVYP  362



>emb|CAJ65631.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   359 bits (921),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 172/346 (50%), Positives = 244/346 (71%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ +  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  +L    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V       L  WFQN+DP+PF TAHG   WDY +H+P    +FN+  A D++L+  V++ 
Sbjct  124   VLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G +A AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW D+EC+KIL++ + AI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWSDQECIKILRRSRVAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL G KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPIL  346



>gb|AES89720.2| orcinol O-methyltransferase [Medicago truncatula]
Length=355

 Score =   359 bits (922),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 173/358 (48%), Positives = 245/358 (68%), Gaps = 4/358 (1%)
 Frame = +3

Query  54    MGENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAAL  233
             MG   +    +LLQA+ Q +NHI ++I+S +LKCA++L IPD+IHN+ +P+PL  LI+ L
Sbjct  1     MGSQSEDHVAKLLQAQTQVFNHIFSFINSMSLKCAIELCIPDVIHNYGQPIPLSKLISLL  60

Query  234   PIHPSKAPYIHRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNE  413
             PIHPSK   IHRL R L HSG  +V+ +  E  Y L  A RL++KD P ++ + LH+   
Sbjct  61    PIHPSKTGDIHRLMRVLTHSGFFNVSKNDLEVMYELNDASRLLLKDHPFSMTSLLHVILG  120

Query  414   YVFQKSCYSLGDWFQNNDPSPFCTA-HGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVL  590
              +  K  Y L +W++N+DPSPF T  +G   WDY  H+P +N++FNE  A +++L   V+
Sbjct  121   PILSKPWYQLSNWYKNDDPSPFHTENNGVAFWDYAGHDPNHNNLFNEAMACETRLASSVV  180

Query  591   LSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEF  770
             + G+ K VF+G+ SLVDV GG G +   IAK FP ++C V DLPHV+  +  +  EN+++
Sbjct  181   M-GKCKGVFEGLESLVDVGGGIGTITKVIAKSFPNIECIVFDLPHVVDGLQGS--ENLKY  237

Query  771   VAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKK  950
             V G+MFE IP  +++LLK ++HDW DEEC+KILKKCKEAI ++ + GKVIIID V+ ++K
Sbjct  238   VGGDMFEAIPPTHSILLKGVLHDWNDEECLKILKKCKEAIGNKGKEGKVIIIDAVMGNEK  297

Query  951   HDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
              D     A+L+ DL +M L   KERN+K+W  L   AGFS+YKIT  LG +SLIE+FP
Sbjct  298   EDNESIEAQLFYDLEMMVLVNGKERNEKEWSNLFLSAGFSNYKITHGLGFKSLIEVFP  355



>emb|CDP15888.1| unnamed protein product [Coffea canephora]
Length=362

 Score =   359 bits (922),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 174/362 (48%), Positives = 248/362 (69%), Gaps = 10/362 (3%)
 Frame = +3

Query  54    MGENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAAL  233
             +  NG  +  EL QA+A  WNHI N+I+S +LKCA+QLGIPDIIH H +PM L  LI AL
Sbjct  3     LARNGDHTG-ELFQAQAHIWNHIFNFINSMSLKCAIQLGIPDIIHKHGQPMALAQLIDAL  61

Query  234   PIHPSKAPYIHRLTRFLVHSGLL---SVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHI  404
             PI+ +KAP+++RL R L+HSG      + ++  +E Y+LT A +L++ ++P ++  FL  
Sbjct  62    PINNAKAPFVYRLMRILIHSGFFIKAKIPDNEGQEGYALTSASKLLLANDPFSVTPFLLA  121

Query  405   CNEYVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMI  584
               + +     +    WFQN++ +PF T HG  +W+    +P  N  FNE  A D++L+  
Sbjct  122   MLDPILTDPWHHFSQWFQNSEETPFHTCHGTSLWELAGRQPQLNQFFNEGMASDARLVST  181

Query  585   VLLSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENV  764
             +++    K VF G++SL+DV GG G VA AIA  FP ++C+VLDLPHV+   +  S +N+
Sbjct  182   MVIE-NCKDVFMGLNSLIDVGGGTGTVAKAIADAFPHLQCSVLDLPHVVDGWE--SSKNL  238

Query  765   EFVAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIED  944
              +V G+MFE IP A+AVLLKWI+HDW DEECV+IL+KCKEAIPS E+GGKVIIIDM+++ 
Sbjct  239   AYVGGDMFEAIPPADAVLLKWILHDWSDEECVQILRKCKEAIPSMEKGGKVIIIDMLLKS  298

Query  945   KKH---DPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIE  1115
             +++   D      +L+ D+L+M     +ERN+K WEKL  EAGF+ YKITP LGLRS+IE
Sbjct  299   QQNGDDDAEAIETQLFFDMLMMVHVKGRERNEKDWEKLFLEAGFNGYKITPVLGLRSIIE  358

Query  1116  LF  1121
             ++
Sbjct  359   VY  360



>ref|XP_009602136.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=361

 Score =   359 bits (921),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 176/364 (48%), Positives = 247/364 (68%), Gaps = 13/364 (4%)
 Frame = +3

Query  51    IMGENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAA  230
             I+GE+      E+L A+   WNHI ++I+S +LK A+QL IPDIIH H KPM L  L  A
Sbjct  5     IVGEH----ETEILHAQTHIWNHIFSFINSMSLKSAIQLNIPDIIHKHGKPMTLDQLANA  60

Query  231   LPIHPSKAPYIHRLTRFLVHSGLLSVTN------SGQEECYSLTPAGRLVVKDEPINLRA  392
             L I+ +K  ++ RL R L+ SG    +         + E YSL P  RL++KDEP+++  
Sbjct  61    LSINKAKTTHLRRLMRILIRSGFFVKSRIQENEGESEGEGYSLAPPSRLLLKDEPLSVTP  120

Query  393   FLHICNEYVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQ  572
             FL    + +  K  + + +WF+N+ P+PF TAHG   WDY  HEP  N  FN+  A D++
Sbjct  121   FLLAMLDPILVKPWHHVSEWFENDHPTPFDTAHGRTFWDYAGHEPRLNHFFNDAMASDAK  180

Query  573   LLMIVLLSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAAS  752
             L+M V++   SK VF+G++S+VDV GG G VA +IA  FP ++CTV DLPHV+  ++ + 
Sbjct  181   LVMNVVIK-YSKDVFEGLNSIVDVGGGTGTVAKSIANAFPDLQCTVFDLPHVVEGLEES-  238

Query  753   VENVEFVAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDM  932
              +N+ +V G+ F +IP A+A+LLKWI+HDW DEE VKILKKCKEAIPSRE+GGKVIIIDM
Sbjct  239   -KNLNYVGGDFFVSIPPADALLLKWILHDWSDEESVKILKKCKEAIPSREKGGKVIIIDM  297

Query  933   VIEDKKHDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLI  1112
             ++++K  D      +++ D+L+M L   +ER++K W KL  +AGFSDYK+TP LGLRSLI
Sbjct  298   MVDNKIGDDESIETQIFFDMLMMVLVTGRERSEKGWAKLFLDAGFSDYKVTPILGLRSLI  357

Query  1113  ELFP  1124
             E++P
Sbjct  358   EVYP  361



>ref|XP_002522501.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF39801.1| o-methyltransferase, putative [Ricinus communis]
Length=359

 Score =   358 bits (920),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 180/363 (50%), Positives = 251/363 (69%), Gaps = 10/363 (3%)
 Frame = +3

Query  54    MGENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAAL  233
             M     Q   ELLQA+   +NHI NYI+S  LKCAVQLGIPDIIH H KP+ L +L++AL
Sbjct  1     MDSTDSQKATELLQAQLHVYNHIFNYINSMCLKCAVQLGIPDIIHKHGKPITLPELVSAL  60

Query  234   PIHPSKAPYIHRLTRFLVHSGLLSVTNS--GQE---ECYSLTPAGRLVVKDEPINLRAFL  398
              IHP+K  +++RL R LVHSG  S+T +  GQE   E Y LTP+ +L+VKD P  L+ F+
Sbjct  61    HIHPTKINFMYRLMRMLVHSGFFSITKAANGQEEGQEVYVLTPSSKLLVKDNPNCLKPFV  120

Query  399   HICNEYVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLL  578
                 +  F    + LGDWF+ N+ + F  AHG   W+Y    P +N +FNE  A DS+++
Sbjct  121   DSLLKPDFVTPGHVLGDWFRGNELTVFQRAHGMAFWEYNERNPEFNQLFNEAMASDSRMM  180

Query  579   MIVLLSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVE  758
              +V+   + K +F+GV+SLVDV GG G++A  I++ FP MKCTVL+LP VI +++    +
Sbjct  181   NLVI--RDCKPIFEGVNSLVDVGGGNGSLARIISEAFPDMKCTVLELPQVIGNLEGT--K  236

Query  759   NVEFVAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGG-KVIIIDMV  935
             N+ +V G+MF++IP+A+A++LK I+H W DEECVKILKKCKEAI S  +G  KVI+ID+V
Sbjct  237   NLNYVGGDMFQHIPSADAIILKLILHGWNDEECVKILKKCKEAISSTGKGSEKVIVIDLV  296

Query  936   IEDKKHDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIE  1115
             I DKK +  ++  +L  D+L+M +   KER +K+W +L  +AGFS +KITP LGLRSLIE
Sbjct  297   INDKKDEYEFTETKLLFDMLMMFVATGKERTEKEWGELFLKAGFSHFKITPILGLRSLIE  356

Query  1116  LFP  1124
             ++P
Sbjct  357   VYP  359



>emb|CAJ65636.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   358 bits (918),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 172/346 (50%), Positives = 243/346 (70%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ +  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  +L    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V       L  WFQN+DP+PF TAHG   WDY +H+P    +FN+  A D++L+  V++ 
Sbjct  124   VLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SL DV GG G +A AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLADVGGGTGTMAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW D+EC+KILK+ + AI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL G KERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65616.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=345

 Score =   357 bits (917),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 175/346 (51%), Positives = 244/346 (71%), Gaps = 7/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKYAIQLGIPDIINKH-GPMTLSELTSALPIH  62

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+P ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  63    PTKSPSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLMPFLTAMLDP  122

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V       L  WFQN+DP+PF TAHG   WDY +H+P    +FN+  A D++L+  V+++
Sbjct  123   VLTTPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIN  182

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SL+DV GG G VA AIA  FP ++CTVLDLP+V+A  D    +N+++  
Sbjct  183   -DCKGVFEGLESLIDVGGGIGTVAKAIADAFPHIECTVLDLPYVVA--DLQGSKNLKYTG  239

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEECVKILK+ +EAI  +++ GKVIIIDM++E++K D
Sbjct  240   GDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITRKDKKGKVIIIDMMMENQKGD  299

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AG SDYKITP L
Sbjct  300   EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGISDYKITPIL  345



>gb|ADZ76434.1| myricetin O-methyltransferase 2 [Solanum habrochaites]
Length=355

 Score =   357 bits (917),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 181/349 (52%), Positives = 247/349 (71%), Gaps = 5/349 (1%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKP-MPLCDLIAALP-IHPSKAP  257
             EL++AEAQ+W++IL+Y+  + +KCA+QLGIPDI+H +  P M L DLIAALP ++PSK  
Sbjct  10    ELIEAEAQSWDYILSYLRPSCIKCAIQLGIPDILHKNADPIMSLSDLIAALPNLNPSKTT  69

Query  258   YIHRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSCY  437
             +I  L R LV  GL +  +  Q + YSLT  GRL+V++     R+F       V   +  
Sbjct  70    FIPILMRVLVDFGLFNY-HQQQGDGYSLTTVGRLLVENHHFGNRSFFLFAQHPVVLNTAA  128

Query  438   SLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKRVF  617
             S+GDW +++  + F TA G+  WDY   +P +N VFN+  A DS+L+  +L+S     VF
Sbjct  129   SVGDWLKDDLRTAFETADGKSHWDYCGADPEFNGVFNDAMAGDSRLMSNLLISDCCAGVF  188

Query  618   DGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFENI  797
             +G++SLVD+ GG GAVA AIA  FP++KC VLDLPHVIA  D     N+EFVAG+MF+ I
Sbjct  189   EGLTSLVDIGGGTGAVAMAIAGAFPSLKCIVLDLPHVIA--DRKGSGNLEFVAGSMFDKI  246

Query  798   PAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYSRAE  977
             P ANA+LLKWI+H+W+DE+CVK+LKKCKE+I SRE GGKVIIIDM++ED  ++    +++
Sbjct  247   PHANAILLKWILHNWDDEDCVKLLKKCKESISSRENGGKVIIIDMIMEDNYNNKQLVQSQ  306

Query  978   LYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
               MDL++   Y SKER +K+WEKL  EAGFS YKI  +LGLRSLIE++P
Sbjct  307   HLMDLIMRITYASKERTEKEWEKLFLEAGFSGYKIITSLGLRSLIEIYP  355



>ref|XP_004241914.1| PREDICTED: myricetin O-methyltransferase-like [Solanum lycopersicum]
Length=355

 Score =   357 bits (917),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 185/350 (53%), Positives = 244/350 (70%), Gaps = 9/350 (3%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKP-MPLCDLIAALP-IHPSKAP  257
             EL++AEA +W++IL Y+    ++CA+QLGIPDI+H    P M L DLIAALP ++PSK  
Sbjct  12    ELIEAEALSWDYILTYLRPPCIRCAIQLGIPDILHKSAHPIMSLSDLIAALPNVNPSKTT  71

Query  258   YIHRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSCY  437
             +I  L R LV  GL +  +  Q + YSLT  GRL V+ +P N R+      ++    S  
Sbjct  72    FIPILMRVLVDLGLFNY-HPQQGDGYSLTSVGRLFVESDPSNKRSIFTFLIQFEIVDS--  128

Query  438   SLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKRVF  617
              + DW +N+ P+ F TAHG+ IWDY S E  Y+ VFN+  A DS+L+  +L+S     VF
Sbjct  129   -MSDWLRNDLPTAFETAHGKSIWDYCSGESEYSGVFNDAMASDSKLISNLLISDCCSGVF  187

Query  618   DGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFENI  797
             +G++SLVDV GG G VA AIA  FP++KCTVLDLPH I   D    +N+EFVAGNMF+ I
Sbjct  188   EGLTSLVDVGGGTGTVAMAIAGAFPSLKCTVLDLPHAIG--DRKGTQNLEFVAGNMFDKI  245

Query  798   PAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDK-KHDPCYSRA  974
             P ANA+LLKWI+HDW DE+CVKILKKCKE+IPS+E GGKVIIID+V+ED   ++    ++
Sbjct  246   PHANAILLKWILHDWNDEDCVKILKKCKESIPSKENGGKVIIIDIVMEDNCSNNEQLVQS  305

Query  975   ELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             +  MDLLV   Y SKER+ K+WEKL  +AGFS YKI  +LGLRSL+E++P
Sbjct  306   QHLMDLLVRITYDSKERSNKEWEKLFLDAGFSGYKIITSLGLRSLMEVYP  355



>emb|CAA11131.1| O-methyltransferase [Prunus dulcis]
Length=356

 Score =   357 bits (917),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 178/360 (49%), Positives = 240/360 (67%), Gaps = 7/360 (2%)
 Frame = +3

Query  54    MGENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAAL  233
             M  + + S   LLQA+A  WN I ++I+  +LKCAVQLGIPDII  H  PM L DLI+AL
Sbjct  1     MDLSNEMSSANLLQAQAHIWNCIFSFINPMSLKCAVQLGIPDIIKKHGNPMSLSDLISAL  60

Query  234   PIHPSKAPYIHRLTRFLVHSGLL---SVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHI  404
             PIHP K+  ++RL R LVHSG      ++   +EE Y LT A RL++KD+P++ R FL  
Sbjct  61    PIHPKKSNCVYRLMRILVHSGFFCRQKLSELDEEEGYVLTDASRLLLKDDPLSARPFLLG  120

Query  405   CNEYVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMI  584
               +    K  +    WFQN+DP+   TAHG   WD+   EP  + +FN+  A D++L+  
Sbjct  121   ALDPFMTKPWHYFSTWFQNDDPTACVTAHGTTFWDFGCLEPSLSHIFNDAMASDARLISK  180

Query  585   VLLSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENV  764
             V +S E K VF+G+ SLVDV GG G +  AIA  FP ++C V DLPHV+A  D    EN+
Sbjct  181   V-VSNEYKGVFEGLESLVDVGGGIGTMPKAIADVFPHVECIVFDLPHVVA--DLKGSENL  237

Query  765   EFVAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIED  944
             +F  G+MFE IP  +A+L+KWI+HDW DEEC+KIL++ KEAI  +E+ GKVII+DMV++ 
Sbjct  238   KFFGGDMFEAIPPTDAILMKWILHDWSDEECIKILQRSKEAITRKEKKGKVIIVDMVMKQ  297

Query  945   KKHDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             K  D      +L+ D+L+M L+  KER +K+W KL S+AGFSDYKITP  GLR LIE++P
Sbjct  298   KGDDQSI-ETQLFFDMLMMVLFTGKERTEKEWAKLFSDAGFSDYKITPICGLRYLIEVYP  356



>emb|CAJ65600.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   357 bits (915),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 172/344 (50%), Positives = 241/344 (70%), Gaps = 6/344 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVTN--SGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +        EE Y+LT A +L++KD P++L  +L    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKGKLCKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V       L  WFQN+DP+PF TAHG   WDY +H+P    +FN+  A D++L+  V+++
Sbjct  124   VLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIN  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G +A AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEEC+KIL++ + AI  +E+ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWSDEECIKILERSRVAITGKEKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITP  1088
                   +L+ D+L+MAL G KERN+K+W KL ++AG SDYKITP
Sbjct  301   EESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGLSDYKITP  344



>ref|XP_003615966.1| O-methyltransferase [Medicago truncatula]
 gb|AES98924.1| orcinol O-methyltransferase [Medicago truncatula]
Length=360

 Score =   357 bits (915),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 172/359 (48%), Positives = 243/359 (68%), Gaps = 7/359 (2%)
 Frame = +3

Query  60    ENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPI  239
             +N +     LL+A++  WNHI N+I+S +LKC V LGIPDIIHN+ KP+ L  LI+ LPI
Sbjct  5     KNEENVTSNLLKAQSHIWNHIFNFINSMSLKCVVDLGIPDIIHNYGKPISLSKLISLLPI  64

Query  240   HPSKAPYIHRLTRFLVHSGLLSVTNSGQEEC---YSLTPAGRLVVKDEPINLRAFLHICN  410
             HPSK  +IHRL R + HS   S  N  + E    Y LT A  L++KD P+++  F+H   
Sbjct  65    HPSKTCFIHRLMRIMTHSSFFSQYNVTENELEIEYMLTDASILLLKDNPMSVTPFVHAML  124

Query  411   EYVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVL  590
             + V     +    W +N+DP+ F T H   +W+Y++ +  ++++FNE  A D++L+  +L
Sbjct  125   DPVLTNPWHQFSTWLKNDDPTTFETTHRMLLWEYVACDSKFSNLFNESMASDTRLVTNLL  184

Query  591   LSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEF  770
             +  + + VF+G+ SLVDV GG G +A A+AK FP M+ +V DLPHV+  +  +  EN+ +
Sbjct  185   IE-KCRGVFNGLESLVDVGGGTGTMAKALAKSFPQMEFSVFDLPHVVDGLQGS--ENLNY  241

Query  771   VAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKK  950
             V G+MF+ IP  +A+LLKWI+HDW DEECVKILK CK+AI  + + GKVI+IDMV+E +K
Sbjct  242   VGGDMFKEIPPTDAILLKWILHDWNDEECVKILKNCKDAISKKGKQGKVIVIDMVLESEK  301

Query  951   HDPCYS-RAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
                  S   +L+ D+L+M +   KERNKK+W KLIS AGFSDYKITP LGLRSLIE++P
Sbjct  302   ESINESVETQLFFDMLMMVVLAGKERNKKEWIKLISSAGFSDYKITPILGLRSLIEIYP  360



>ref|XP_003607523.1| O-methyltransferase [Medicago truncatula]
Length=370

 Score =   357 bits (916),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 174/370 (47%), Positives = 250/370 (68%), Gaps = 5/370 (1%)
 Frame = +3

Query  21    KVQKYSAQRKIMGENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPK  200
             +++    + K MG   +    +LLQA+ Q +NHI ++I+S +LKCA++L IPD+IHN+ +
Sbjct  4     QIETIVEESKPMGSQSEDHVAKLLQAQTQVFNHIFSFINSMSLKCAIELCIPDVIHNYGQ  63

Query  201   PMPLCDLIAALPIHPSKAPYIHRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPI  380
             P+PL  LI+ LPIHPSK   IHRL R L HSG  +V+ +  E  Y L  A RL++KD P 
Sbjct  64    PIPLSKLISLLPIHPSKTGDIHRLMRVLTHSGFFNVSKNDLEVMYELNDASRLLLKDHPF  123

Query  381   NLRAFLHICNEYVFQKSCYSLGDWFQNNDPSPFCTA-HGEKIWDYISHEPGYNDVFNEVT  557
             ++ + LH+    +  K  Y L +W++N+DPSPF T  +G   WDY  H+P +N++FNE  
Sbjct  124   SMTSLLHVILGPILSKPWYQLSNWYKNDDPSPFHTENNGVAFWDYAGHDPNHNNLFNEAM  183

Query  558   AKDSQLLMIVLLSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIAS  737
             A +++L   V++ G+ K VF+G+ SLVDV GG G +   IAK FP ++C V DLPHV+  
Sbjct  184   ACETRLASSVVM-GKCKGVFEGLESLVDVGGGIGTITKVIAKSFPNIECIVFDLPHVVDG  242

Query  738   VDAASVENVEFVAGNMFENIPAANAVLLK-WIMHDWEDEECVKILKKCKEAIPSREEGGK  914
             +  +  EN+++V G+MFE IP  +++LLK  ++HDW DEEC+KILKKCKEAI ++ + GK
Sbjct  243   LQGS--ENLKYVGGDMFEAIPPTHSILLKVGVLHDWNDEECLKILKKCKEAIGNKGKEGK  300

Query  915   VIIIDMVIEDKKHDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
             VIIID V+ ++K D     A+L+ DL +M L   KERN+K+W  L   AGFS+YKIT  L
Sbjct  301   VIIIDAVMGNEKEDNESIEAQLFYDLEMMVLVNGKERNEKEWSNLFLSAGFSNYKITHGL  360

Query  1095  GLRSLIELFP  1124
             G +SLIE+FP
Sbjct  361   GFKSLIEVFP  370



>emb|CDP19713.1| unnamed protein product [Coffea canephora]
Length=350

 Score =   356 bits (914),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 172/352 (49%), Positives = 246/352 (70%), Gaps = 9/352 (3%)
 Frame = +3

Query  72    QSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSK  251
             ++  ELL A+    N +LN+  SA+LKCA++LGIP+ I+ H KP+ L +L++ALP++PSK
Sbjct  5     ENLTELLAAQNHVRNQMLNFRKSASLKCAIELGIPEAINQHGKPITLSELVSALPVNPSK  64

Query  252   APYIHRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKS  431
             A +I+RL RFL  +G   +    Q++CY+LT AGRL++KD+P NLRA +   ++ V  K 
Sbjct  65    ASHIYRLMRFLSKAGFFVL----QDQCYALTAAGRLLLKDDPFNLRALIFFMSDPVLVKP  120

Query  432   CYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKR  611
               SL +WF+N+DP+PF TAHG+  W Y + EP + + FNE  A DS  ++ V+++   K 
Sbjct  121   WNSLTEWFRNDDPAPFDTAHGKNFWAYAAEEPNFANRFNEAMANDSTFIVQVMMT-RCKF  179

Query  612   VFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFE  791
             VFDG++SLVDV GG G VA AIA+ FP ++C V DLPHVIA  +    EN++FVAG+M E
Sbjct  180   VFDGLTSLVDVGGGTGTVARAIAQNFPNLECVVCDLPHVIACQEG--TENLDFVAGDMLE  237

Query  792   NIPAANAVLLKW--IMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCY  965
              +P A+A+LLK    +HDW DE+CVKILK CKEAIP R +GG+VIIIDM++E +  D   
Sbjct  238   KVPTADAILLKKPDSIHDWSDEDCVKILKNCKEAIPGRNKGGRVIIIDMILESQIKDDES  297

Query  966   SRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELF  1121
                ++ MD+ ++  + +KER +K+W KL  +AGFS YKI P  G+R LIE++
Sbjct  298   VETQVGMDMQMLMCHAAKERTEKEWAKLFRDAGFSYYKILPVFGVRCLIEVY  349



>emb|CAJ65617.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   356 bits (913),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 172/344 (50%), Positives = 243/344 (71%), Gaps = 6/344 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  +L    + 
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V       L  WFQN+DP+PF TAHG   WDY +H+P    +FN+  A D++L+  V+++
Sbjct  124   VLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIN  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G +A AIA  FP ++CTVLDLPHV+A  D    +N++++ 
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYIG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HD  DEEC+KIL++ + AI  +E+ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDRNDEECIKILERSRVAITGKEKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITP  1088
                   +L+ D+L+MAL G KERN+K+W KL ++AGFSDYKITP
Sbjct  301   EESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITP  344



>emb|CAJ65637.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=341

 Score =   355 bits (911),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 175/346 (51%), Positives = 241/346 (70%), Gaps = 11/346 (3%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGI D+I+ H   M L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGILDVINKHGYLMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVTNSGQ--EECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +     +  EE Y+LT A +L++KD+P++L  FL   N  
Sbjct  64    PTKSHSVYRLMRILVHSGFFAKKKLSKIDEEGYTLTNASQLLLKDDPLSLTPFLTAMN--  121

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
                K    L  WFQNNDP+PF TAHG   WDY +H+P     FN   A D++L+  V++ 
Sbjct  122   ---KPWNYLSTWFQNNDPTPFDTAHGMTFWDYGNHQPSIAHFFNNAMASDARLVTSVIID  178

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  179   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTR  235

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEECVKILK+ ++AI S+++ GKVII+DM++E++K D
Sbjct  236   GDMFEAVPPADTVLLKWILHDWNDEECVKILKRSRKAITSKDKKGKVIILDMMMENQKRD  295

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   KERN+K+W KL ++AGFSDYKITP L
Sbjct  296   EESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  341



>ref|XP_006356531.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=359

 Score =   355 bits (912),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 181/351 (52%), Positives = 248/351 (71%), Gaps = 6/351 (2%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKP-MPLCDLIAALP-IHPSKAP  257
             +L++AEAQ+W+HIL+Y+  + +KCA+QLGIPDI+H +  P M L DLIAALP ++PSK  
Sbjct  11    QLIEAEAQSWDHILSYLRPSCIKCAIQLGIPDILHKNVNPIMSLSDLIAALPNLNPSKTT  70

Query  258   YIHRLTRFLVHSGLLSVTNSGQE-ECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSC  434
             +I  L R LV  GL       Q+ + YSLT  GRL+V+++    R+F       V   + 
Sbjct  71    FIPILMRVLVDFGLFKYHQHQQQGDGYSLTSVGRLLVENDLSGKRSFFLFAQHPVVLNTA  130

Query  435   YSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKRV  614
              S+GDW +++ P+ F TAHG+  WDY   EP +N VFN+  A DS+L+  +L+S     V
Sbjct  131   SSVGDWLRDDLPTAFETAHGKSHWDYCVEEPEFNGVFNDAMAGDSRLISNLLISDCCAGV  190

Query  615   FDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFEN  794
             F+G++SLVD+ GG GAVA AIA+ FP++KC VLDLPHVI   D     N+EFVAG+MF+ 
Sbjct  191   FEGLTSLVDIGGGTGAVAMAIAEAFPSLKCIVLDLPHVIG--DRKGSGNLEFVAGSMFDK  248

Query  795   IPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDK-KHDPCYSR  971
             IP ANA+LLKWI+H+W+DE+CVK+LKKCKE+IP++E GGKVIIID+V+ED   ++    +
Sbjct  249   IPHANAILLKWILHNWDDEDCVKLLKKCKESIPNKENGGKVIIIDIVMEDNCSNNEQLVQ  308

Query  972   AELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             ++  MDLL+   Y SKER +K+WEKL  +A FS YKI  +LGLRSLIE +P
Sbjct  309   SQHLMDLLMRITYASKERTEKEWEKLFLDADFSGYKIITSLGLRSLIEFYP  359



>gb|KHN08844.1| 8-hydroxyquercetin 8-O-methyltransferase [Glycine soja]
Length=329

 Score =   354 bits (909),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 171/331 (52%), Positives = 231/331 (70%), Gaps = 7/331 (2%)
 Frame = +3

Query  144   TLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPYIHRLTRFLVHSGLLSVTNSGQ  323
             +LKC V LGIPDIIHN+ +PMPL +LIA+LPIHPSK  ++HRL R ++HSG  S  N   
Sbjct  2     SLKCVVDLGIPDIIHNYGQPMPLSNLIASLPIHPSKTCFVHRLMRIMIHSGFFSQQNHDL  61

Query  324   EE----CYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSCYSLGDWFQNNDPSPFCTAH  491
             E      Y LT A  L++K+ P+++  FLH   + V          WF+N DP+PF TAH
Sbjct  62    ENELEAKYVLTDASVLLLKNHPMSVTPFLHAMLDPVLTNPWNQFSTWFKNGDPTPFETAH  121

Query  492   GEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKRVFDGVSSLVDVAGGKGAVAS  671
             G  +WDY   +P  N +FN+  A D++ +  +++  + K VF G+ SLVDV GG G +A 
Sbjct  122   GMMLWDYAGADPKLNHLFNDAMASDARFVTSLVIE-KCKGVFMGLESLVDVGGGTGTMAK  180

Query  672   AIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFENIPAANAVLLKWIMHDWEDE  851
             AIAK FP ++C V DLPHV++ +  +  EN+++VAG+MFE IP A+A+LLKWI+HDW DE
Sbjct  181   AIAKSFPRVECIVFDLPHVVSGLKGS--ENLKYVAGDMFEAIPPADAILLKWILHDWNDE  238

Query  852   ECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYSRAELYMDLLVMALYGSKERNK  1031
             ECV ILKKCKEAI  + + GKVIIIDMV+E++K D      +L+ D+L+M L   KER+K
Sbjct  239   ECVDILKKCKEAITRKGKEGKVIIIDMVVENEKRDDESVETQLFFDMLMMVLVTGKERSK  298

Query  1032  KQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             K+W KLIS AG+++YKITP LGLRSLIE++P
Sbjct  299   KEWAKLISSAGYNNYKITPVLGLRSLIEIYP  329



>ref|XP_004505627.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cicer 
arietinum]
Length=389

 Score =   356 bits (914),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 175/362 (48%), Positives = 249/362 (69%), Gaps = 5/362 (1%)
 Frame = +3

Query  42    QRKIMGENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDL  221
             Q K M ++ + +  +LLQA+ Q +N I ++I+S +LKCA++L IPDIIHN+ +P+PL  L
Sbjct  32    QAKPMAQSEEHA-TKLLQAQTQVFNQIFSFINSMSLKCAIELSIPDIIHNYGQPIPLSQL  90

Query  222   IAALPIHPSKAPYIHRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLH  401
             I++LPIHPSK+  I RL R L HS    VT +  E  Y LT A RL++KD P ++ + LH
Sbjct  91    ISSLPIHPSKSGDIDRLMRVLTHSNFFIVTKNELEVMYELTDASRLLLKDHPFSMTSMLH  150

Query  402   ICNEYVFQKSCYSLGDWFQNNDPSPFCTAH-GEKIWDYISHEPGYNDVFNEVTAKDSQLL  578
             +    +  K  + L +W++N DPSPF T + G + WDY  H+P +N +FNE  A ++++ 
Sbjct  151   VILGPIMSKPWHQLSNWYKNEDPSPFYTENNGIEFWDYAGHDPEFNHLFNEAMACETRMA  210

Query  579   MIVLLSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVE  758
               V++ G+ K VF G+ SLVDV GG G ++ AIAK FP ++C V DLPHV+  +  +  E
Sbjct  211   STVVM-GKCKGVFQGLESLVDVGGGIGTMSKAIAKSFPNIECIVFDLPHVVDGLQGS--E  267

Query  759   NVEFVAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVI  938
             N ++VAG+MFE+IP   ++LLK ++HDW DEEC+KILKKCKEAI S+ + GKVIIID V+
Sbjct  268   NFKYVAGDMFESIPPTQSILLKGVLHDWNDEECLKILKKCKEAIKSKGKEGKVIIIDAVM  327

Query  939   EDKKHDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIEL  1118
              ++K D     A+L+ DL +M L   KERN+K+W KL   AGF++YKIT  LG +SLIE+
Sbjct  328   GNEKADNESFEAQLFYDLEMMVLVNGKERNEKEWSKLFFSAGFNNYKITHGLGFKSLIEV  387

Query  1119  FP  1124
             FP
Sbjct  388   FP  389



>emb|CAJ65657.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=345

 Score =   355 bits (910),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 174/346 (50%), Positives = 241/346 (70%), Gaps = 7/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+  +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINPMSLKSAIQLGIPDIINKH-GPMTLSELTSALPIH  62

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  63    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDP  122

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V       L  WFQN DP+PF TAHG   WDY +H+P    +FN+  A D++L+  V++ 
Sbjct  123   VLTTPWNYLSTWFQNEDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIID  182

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  183   -DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  239

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEEC+KILK+ + AI S+++ GKVIIIDM++E++K D
Sbjct  240   GDMFEAVPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGD  299

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   +ERN+K+W KL ++AGFSDYKITP L
Sbjct  300   EESIETQLFFDMLMMALVRGQERNEKEWAKLFTDAGFSDYKITPIL  345



>ref|XP_011016237.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=359

 Score =   355 bits (910),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 177/357 (50%), Positives = 240/357 (67%), Gaps = 8/357 (2%)
 Frame = +3

Query  69    KQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPS  248
             ++S  ELLQA+   WNHI N+I+S TLKCAVQLGIPD+I  H KPM L +L++ALPIHPS
Sbjct  6     EESATELLQAQTHVWNHIFNFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPS  65

Query  249   KAPYIHRLTRFLVHSGLLSVTNSG---QEECYSLTPAGRLVVKDEPINLRAFLHICNEYV  419
             KA Y+HRL R LVHSG  S  N      +E YSLT + RL++KD P ++R  L +  + V
Sbjct  66    KAQYVHRLMRILVHSGFFSQQNLNGIHNQEAYSLTQSTRLLLKDNPWSVRPLLLLVLDPV  125

Query  420   FQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSG  599
               K    L  WF+N+D + F  AH + +W+Y   +  +N++FNE  A DS +L   L+  
Sbjct  126   LTKPWDCLSTWFRNDDCNAFIVAHEKTLWEYAGQDARFNNLFNEAMASDS-ILASKLVVS  184

Query  600   ESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAG  779
             + K +FDGV+SLVDV GG G +A  IA+ FP M CTV DLPHV++ +     +N+++V G
Sbjct  185   KCKGIFDGVNSLVDVGGGLGTMAKGIAEAFPHMDCTVFDLPHVVSDLQGG--KNLKYVGG  242

Query  780   NMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSR--EEGGKVIIIDMVIEDKKH  953
             +MFE +P A+A+LLKW++HDW DE CVKILK+CK+A+ S+  ++ GKVIIIDMV E+   
Sbjct  243   DMFEAVPPADALLLKWVLHDWSDEYCVKILKRCKQAVVSKGQQKAGKVIIIDMVRENLSG  302

Query  954   DPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             D      +L  DL +M      ERN+K+W KL  +AGF +YKI   LG R+LIEL+P
Sbjct  303   DEGSIETQLLFDLEIMVAASGMERNEKEWAKLFFDAGFLNYKIHSVLGTRALIELYP  359



>emb|CAJ65660.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=345

 Score =   354 bits (908),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 174/346 (50%), Positives = 241/346 (70%), Gaps = 7/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKH-GPMTLSELTSALPIH  62

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  FL    + 
Sbjct  63    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLDP  122

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V       L  WFQN DP+PF TAHG   WDY +H+P    +FN+  A D++L+  V++ 
Sbjct  123   VLTTPWNYLSTWFQNEDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIID  182

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G VA AIA   P ++CTVLDLPHV+A  D    +N+++  
Sbjct  183   -DCKGVFEGLESLVDVGGGTGTVAKAIADALPHIECTVLDLPHVVA--DLQGSKNLKYTG  239

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEEC+KILK+ + AI S+++ GKVIIIDM++E++K D
Sbjct  240   GDMFEAVPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGD  299

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL   +ERN+K+W KL ++AGFSDYKITP L
Sbjct  300   EESIETQLFFDMLMMALVRGQERNEKEWAKLFTDAGFSDYKITPIL  345



>ref|XP_007142043.1| hypothetical protein PHAVU_008G247600g [Phaseolus vulgaris]
 gb|ESW14037.1| hypothetical protein PHAVU_008G247600g [Phaseolus vulgaris]
Length=357

 Score =   354 bits (909),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 170/350 (49%), Positives = 239/350 (68%), Gaps = 6/350 (2%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPYI  263
             +LL+A+   WNHI ++I+S +LKC V LGIPDIIHNH +PM L +LI++LPIH SK  +I
Sbjct  11    KLLRAQTHVWNHIFSFINSMSLKCIVDLGIPDIIHNHGQPMSLSNLISSLPIHSSKTHFI  70

Query  264   HRLTRFLVHSGLLSVTNSGQEEC---YSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSC  434
             HRL R +VHSG  S  N  + E    Y+LT +  L++K   +++  FL    + V     
Sbjct  71    HRLMRIMVHSGFFSQHNPTENELELKYALTDSSLLLLKSNAMSVTPFLQAMLDPVMTNPW  130

Query  435   YSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKRV  614
                 +WF+N +P+ F   +G+  W+Y S +P +N +FN+  A D+QL+   L++ + K V
Sbjct  131   NQFSNWFKNGNPTTFEMENGKPFWEYASCDPRFNILFNDAMASDAQLV-TSLVTEKCKGV  189

Query  615   FDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFEN  794
             F G+ SLVDV GG G +  AIAK FP ++CTV DLPHV++ +  +  EN+++V G+MFE 
Sbjct  190   FMGLESLVDVGGGTGIMGKAIAKSFPQLECTVFDLPHVVSGLQGS--ENLKYVGGDMFEA  247

Query  795   IPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYSRA  974
             IP A+A+LLKWI+HDW DEECV ILKKCKEA+  + + GKVIIIDMV++ +  D      
Sbjct  248   IPPADAILLKWILHDWSDEECVNILKKCKEALSRKGKEGKVIIIDMVVDKEMKDDESFET  307

Query  975   ELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             +L+ D+L+M L   KERNKK+W KL S AGF++YKITP +G RSLIE++P
Sbjct  308   QLFFDILMMVLLTGKERNKKEWVKLFSSAGFNNYKITPFVGSRSLIEIYP  357



>ref|XP_010093978.1| Tabersonine 16-O-methyltransferase [Morus notabilis]
 gb|EXB54965.1| Tabersonine 16-O-methyltransferase [Morus notabilis]
Length=364

 Score =   355 bits (910),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 182/357 (51%), Positives = 238/357 (67%), Gaps = 13/357 (4%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPYI  263
             ELLQA    WN  LN+I   +LKCAV+LGIPDII+NH +P+ L  LI++LPIH SKA  I
Sbjct  11    ELLQAHGLIWNCSLNFIKPMSLKCAVELGIPDIINNHGQPITLSKLISSLPIHSSKAHCI  70

Query  264   HRLTRFLVHSGLLSVTNSGQE----------ECYSLTPAGRLVVKDEPINLRAFLHICNE  413
             +RL R LVHSG  +      +          E YSLT A RL++KD P     F  +  E
Sbjct  71    YRLMRILVHSGFFATQKVDNKIDEGEEEEEEEAYSLTIASRLLLKDGPWRATPFFLVQLE  130

Query  414   YVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLL  593
                    + +  W QN+DP+PF   HG+  WD +  EP    +F E  A DSQL++ V++
Sbjct  131   PHLMTPWHFVSTWLQNSDPTPFEMVHGKTFWDGVGDEPRLKYLFTEAMATDSQLMVKVIV  190

Query  594   SGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFV  773
               E K+VF+G++SLVDV GG G VA AIAK FP + CTVLDLP+V+A+   A  +N+ F+
Sbjct  191   E-ECKQVFEGLTSLVDVGGGTGIVAKAIAKTFPNIMCTVLDLPYVVANSQGA--KNLNFI  247

Query  774   AGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKH  953
             AG+MF+ IP ANA+LLKWI+HDW DEE V ILK+C+EAI S+E+G KVIIIDMVIE+ K 
Sbjct  248   AGDMFKEIPPANAILLKWILHDWSDEEAVMILKRCREAIWSKEKGEKVIIIDMVIENPKM  307

Query  954   DPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             D   +  +LY D+L+M     +ERN+K+WE L   AGFS YKITP +GLRSL+E++P
Sbjct  308   DKKSAETQLYFDMLMMVNLTGRERNQKEWESLFVAAGFSHYKITPIVGLRSLMEVYP  364



>sp|B0EXJ8.1|HTOMT_CATRO RecName: Full=Tabersonine 16-O-methyltransferase [Catharanthus 
roseus]
 gb|ABR20103.1| 16-hydroxytabersonine O-methyltransferase [Catharanthus roseus]
Length=355

 Score =   354 bits (908),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 184/354 (52%), Positives = 243/354 (69%), Gaps = 12/354 (3%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAAL--PIHPSKAP  257
             E   A+AQ W+   ++I SA+LKCAV+LGIPD I NH KP+ L +L  AL  P+HPSKAP
Sbjct  7     EFRGAQAQIWSQSCSFITSASLKCAVKLGIPDTIDNHGKPITLSELTNALVPPVHPSKAP  66

Query  258   YIHRLTRFLVHSGLLS--VTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKS  431
             +I+RL R L  +G  S    +   E  YSLTP+ R+++K EP+NLR  +    + V  K+
Sbjct  67    FIYRLMRVLAKNGFCSEEQLDGETEPLYSLTPSSRILLKKEPLNLRGIVLTMADPVQLKA  126

Query  432   CYSLGDWFQNNDPSP--FCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGES  605
               SL DW+QN D S   F TAHG+  W Y S    + + FNE  A DSQL+  +L+ GE 
Sbjct  127   WESLSDWYQNEDDSSTAFETAHGKNFWGYSSEHMEHAEFFNEAMASDSQLISKLLI-GEY  185

Query  606   KRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNM  785
             K +F+G++SLVD+ GG G +A AIAK FP +KCTV DLPHV+A+++  S ENVEFVAG+M
Sbjct  186   KFLFEGLASLVDIGGGTGTIAKAIAKNFPQLKCTVFDLPHVVANLE--SKENVEFVAGDM  243

Query  786   FENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCY  965
             FE IP+ANA+ LKWI+HDW DE+CVKILK CK+AIP++  GGKVIIIDMV+   K D   
Sbjct  244   FEKIPSANAIFLKWILHDWNDEDCVKILKSCKKAIPAK--GGKVIIIDMVMYSDKKDDHL  301

Query  966   SRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGL-RSLIELFP  1124
              + +  MD+ ++  + +KER +K+W  L  EAGFSDYKI P L   RSLIE++P
Sbjct  302   VKTQTSMDMAMLVNFAAKERCEKEWAFLFKEAGFSDYKIYPKLDFTRSLIEVYP  355



>ref|XP_006376392.1| hypothetical protein POPTR_0013s12620g [Populus trichocarpa]
 gb|ERP54189.1| hypothetical protein POPTR_0013s12620g [Populus trichocarpa]
Length=355

 Score =   353 bits (907),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 176/354 (50%), Positives = 238/354 (67%), Gaps = 6/354 (2%)
 Frame = +3

Query  69    KQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPS  248
             ++S  ELLQA+   WNHI  +I+S TLKCAVQLGIPD+I  H KPM L +L++ALPIHPS
Sbjct  6     EESAGELLQAQTHVWNHIFCFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPS  65

Query  249   KAPYIHRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQK  428
             KA Y+HRL R LVHSG  S  N  Q E YSLT + RL++KD P+++R  L    + V  K
Sbjct  66    KAQYVHRLMRILVHSGFFSQQNLNQ-EAYSLTQSTRLLLKDNPLSMRTLLLFVLDPVLTK  124

Query  429   SCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESK  608
                 L  WF+N++ + F  AH    W+Y   +   N++FN+  A DS L+  V++S + K
Sbjct  125   PHDCLSTWFRNDEATAFSIAHESIFWEYAGQDSRINNLFNDAMASDSILVSKVVVS-KCK  183

Query  609   RVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMF  788
              +F+GV+SLVDV GG G +A  IA+ FP M CTV DLP V++  D    +N+++V G+MF
Sbjct  184   GIFEGVNSLVDVGGGLGTMAKGIAEAFPHMDCTVFDLPRVVS--DLQGSKNLKYVGGDMF  241

Query  789   ENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPS--REEGGKVIIIDMVIEDKKHDPC  962
             E +P A+ +LLKWI+H W DE+CVKILK+CK+AI S  +++ GKVIIIDMV E+   D  
Sbjct  242   EAVPPADVILLKWILHAWSDEDCVKILKRCKQAIMSEGQQKAGKVIIIDMVRENLNGDGG  301

Query  963   YSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
                 +L+ DL +M      ERN+K+W KL  +AGF +YKI P LG R+LIEL+P
Sbjct  302   SIETQLFFDLQMMVAATGMERNEKEWAKLFFDAGFLNYKIHPVLGTRALIELYP  355



>ref|XP_011037437.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=359

 Score =   353 bits (906),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 176/357 (49%), Positives = 240/357 (67%), Gaps = 8/357 (2%)
 Frame = +3

Query  69    KQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPS  248
             ++S  ELLQA+   WNHI N+I+S TLKCAVQLGIPD+I  H KPM L +L++ALPIHPS
Sbjct  6     EESATELLQAQTHVWNHIFNFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPS  65

Query  249   KAPYIHRLTRFLVHSGLLSVTNSG---QEECYSLTPAGRLVVKDEPINLRAFLHICNEYV  419
             KA Y+HRL R LVHSG  S  N      +E YSLT + RL++KD P ++R  L +  + V
Sbjct  66    KAQYVHRLMRILVHSGFFSQQNLNGIHNQEAYSLTQSTRLLLKDNPWSVRPLLLLVLDPV  125

Query  420   FQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSG  599
               K    L  WF+N+D + F  AH + +W+Y   +  +N++FNE  A DS +L   L+  
Sbjct  126   LTKPWDCLSTWFRNDDCNAFIVAHEKTLWEYAGQDARFNNLFNEAMASDS-ILASKLVVS  184

Query  600   ESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAG  779
             + K +FDGV+SLVDV GG G +A  IA+ FP M CTV DLPHV++ +     +N+++V G
Sbjct  185   KCKGIFDGVNSLVDVGGGLGTMAKGIAEAFPHMDCTVFDLPHVVSDLQGG--KNLKYVGG  242

Query  780   NMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSR--EEGGKVIIIDMVIEDKKH  953
             +MFE +P A+A+LLKW++HDW DE CVKILK+CK+A+ S+  ++ GKVIIIDMV E+   
Sbjct  243   DMFEAVPPADALLLKWVLHDWSDEYCVKILKRCKQAVVSKGQQKAGKVIIIDMVRENLSG  302

Query  954   DPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             D      +L  DL +M      ERN+++W KL  +AGF +YKI   LG R+LIEL+P
Sbjct  303   DEGSIETQLLFDLEIMVAASGMERNEEEWAKLFFDAGFLNYKIHSVLGTRALIELYP  359



>ref|XP_006356529.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=357

 Score =   353 bits (905),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 181/350 (52%), Positives = 248/350 (71%), Gaps = 6/350 (2%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKP-MPLCDLIAALP-IHPSKAP  257
             EL++AEAQ+W++IL+Y+    +KCA++LGI DI++ +  P M L DLIAALP ++PSK  
Sbjct  11    ELIEAEAQSWDYILSYLRPLCIKCAIELGISDILYKNVTPIMSLSDLIAALPNLNPSKTT  70

Query  258   YIHRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSCY  437
             +I  L R LV  G+ +  +  Q + YSLT  GRL+V+++P + R +  +    V  K   
Sbjct  71    FIPILMRALVDFGVFNY-HQQQGDGYSLTNVGRLLVENDPSSKRLYFILFQHPVLLKIVA  129

Query  438   SLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKRVF  617
             S+ DW +++ P+ F TAHG+ +WDY S EP ++ VFN+  A DS+L+  +L+S     VF
Sbjct  130   SMSDWLRDDLPTAFETAHGKSVWDYCSEEPEFSGVFNDAMASDSRLISNLLISDCCAGVF  189

Query  618   DGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFENI  797
             +G++SLVDV GG G VA AIA  FP +KC VLDLPHVI   D    EN+EFVAGNMF+ I
Sbjct  190   EGLTSLVDVGGGTGTVAMAIAGAFPRLKCIVLDLPHVIG--DRRGTENLEFVAGNMFDKI  247

Query  798   PAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDK-KHDPCYSRA  974
             P ANA+ LKWI+H W D +CVKILKKCKE+IPS+E+GGKVIIID+V+ED   ++    ++
Sbjct  248   PHANAIFLKWILHSWSDHDCVKILKKCKESIPSKEKGGKVIIIDIVMEDNCSNNEQLVQS  307

Query  975   ELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             +  MD+L+   Y SKER+KK+WEKL  EAGFS YKI  +LGLRSLIE++P
Sbjct  308   QHLMDVLMRISYASKERSKKEWEKLFLEAGFSGYKIITSLGLRSLIEVYP  357



>emb|CAJ65596.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=345

 Score =   352 bits (903),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 171/346 (49%), Positives = 244/346 (71%), Gaps = 7/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ H  PM L +L +ALPIH
Sbjct  5     NGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKH-GPMTLSELTSALPIH  62

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHSG  +    +   EE Y+LT A +L++KD P++L  +L    + 
Sbjct  63    PTKSHSVYRLMRILVHSGFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDP  122

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V       L  WFQN+DP+PF TAHG   WDY +H+P    +FN+  A D++L+  V+++
Sbjct  123   VLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVIIN  182

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SL DV GG G VA AIA  FP ++CTVLDLPHV+A++  +  +N+++  
Sbjct  183   -DCKGVFEGLESLADVGGGTGTVAKAIADAFPYIECTVLDLPHVVANLQGS--KNLKYTG  239

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW DEEC+KILK+ + AI S+++ GKVIIIDM++E++K D
Sbjct  240   GDMFEAVPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGD  299

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   + + D+L+MAL   +ERN+K+W KL ++AGFSDYKITP L
Sbjct  300   EESIETQPFFDMLMMALVRGQERNEKEWAKLFTDAGFSDYKITPIL  345



>emb|CDP21836.1| unnamed protein product [Coffea canephora]
Length=365

 Score =   353 bits (905),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 173/356 (49%), Positives = 241/356 (68%), Gaps = 15/356 (4%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPYI  263
             EL QA+A  WNHI N+I+S ++KCA+QLGIPD+IH H +P+ L  LI ALPI  +KAP++
Sbjct  13    ELFQAQAHIWNHIFNFINSMSVKCAIQLGIPDVIHKHGQPITLDQLIDALPIKNAKAPFV  72

Query  264   HRLTRFLVHSGL-----LSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQK  428
             +RL + L+HSG      +    +  ++ Y LT A  L++K  P ++  FL    +     
Sbjct  73    YRLMQILIHSGFFIEAKIPGNENDNQKGYLLTSASELLLKSNPFSMTPFLLAMLDPTLTD  132

Query  429   SCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESK  608
               + L  WFQN+D +PF T HG  I+ + SHEP  N  FNE  A D++L+  V+ + + K
Sbjct  133   PWHHLSQWFQNSDETPFYTCHGRSIYAFASHEPWLNQFFNEAMASDTRLVSSVV-TKDCK  191

Query  609   RVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMF  788
              VF+ ++SLVDV GG G  A AIA  FP +KCTVLDLPHV+  ++++  +N+ +V GNMF
Sbjct  192   HVFESLNSLVDVGGGTGTFAKAIADAFPRLKCTVLDLPHVVDGLESS--KNLGYVGGNMF  249

Query  789   ENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIE-----DKKH  953
             E IP A+AVL+KWI+ DW D+ECV+ILKKCKEAIPS+E+GGKVII+DM  +     D  H
Sbjct  250   EAIPPADAVLMKWILIDWSDDECVQILKKCKEAIPSKEKGGKVIIVDMFCKSLQKGDDDH  309

Query  954   DPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELF  1121
             +      +L+ D++VM L   ++RN+K W KL +EAGFSDYKIT  LGLRS+IE++
Sbjct  310   EAI--ETQLFFDMVVMVLLKRRQRNEKDWAKLFTEAGFSDYKITAVLGLRSIIEVY  363



>ref|XP_007132709.1| hypothetical protein PHAVU_011G118100g [Phaseolus vulgaris]
 gb|ESW04703.1| hypothetical protein PHAVU_011G118100g [Phaseolus vulgaris]
Length=352

 Score =   352 bits (904),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 174/350 (50%), Positives = 238/350 (68%), Gaps = 11/350 (3%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPYI  263
             +LL+A+   WNHI ++++S +LKCA+ L IPDIIH + + MP   L A+L ++PSKA  I
Sbjct  11    KLLRAQTHVWNHIFSFVNSMSLKCAIDLEIPDIIHKYGETMPFSQLTASLSLNPSKANCI  70

Query  264   HRLTRFLVHSGLLS---VTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSC  434
             +RL R L HSG  S   V  +  E  Y LT A  L++KD P+++  F H   + +  K  
Sbjct  71    YRLMRILTHSGFFSQLQVNENDLEMGYVLTDASTLLLKDNPLSMLPFFHAMLDPILTKPW  130

Query  435   YSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKRV  614
             + L  WF+N+DP+PF TAH  KIWDY   +P  N +FN+  A D+QL+  V++   S  V
Sbjct  131   HQLPTWFRNDDPTPFHTAHEMKIWDYAGRDPKLNQLFNDAMASDAQLVSNVVIERCSG-V  189

Query  615   FDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFEN  794
             F G+ SLVDV GG G +A AIAK FP + CTV DLPHV+A++     EN+++V G+MFE+
Sbjct  190   FKGLESLVDVGGGTGIMAKAIAKSFPHIDCTVFDLPHVVANLKGC--ENLKYVGGDMFES  247

Query  795   IPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYSRA  974
             +P A+AVLLKWI+HDW DE+CVKILKKCKE I       KVI+IDMV+E ++ D   +  
Sbjct  248   VPPADAVLLKWILHDWNDEQCVKILKKCKEGIKR-----KVIVIDMVVESEEEDFESTET  302

Query  975   ELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             +L +D++VM LY  KER +K+W K+I  AGFSDYKITP +GLRS IE++P
Sbjct  303   KLLVDMVVMVLYPGKERTEKEWAKIIFSAGFSDYKITPVVGLRSFIEIYP  352



>ref|XP_004490686.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cicer 
arietinum]
Length=358

 Score =   352 bits (904),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 174/358 (49%), Positives = 243/358 (68%), Gaps = 6/358 (2%)
 Frame = +3

Query  60    ENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPI  239
             +NG+     LL+A++  WNHI N+I+S +LKC V LGIPDIIHN+ KP+ L  LI  LPI
Sbjct  4     QNGEHVASNLLKAQSHIWNHIFNFINSMSLKCVVDLGIPDIIHNYGKPISLSKLIPLLPI  63

Query  240   HPSKAPYIHRLTRFLVHSGLLSVTNSGQEEC---YSLTPAGRLVVKDEPINLRAFLHICN  410
             HPSK  +I+RL R + HSG  S  N  + E    Y LT    L++ D P+++  F+H   
Sbjct  64    HPSKTIFIYRLMRIMTHSGFFSQQNITENELETEYMLTDTSLLLLSDNPMSVAPFVHAML  123

Query  411   EYVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVL  590
             + V     + L  W  N DP+ F T HG   WD    EP +N++FN+  A D++L+  V+
Sbjct  124   DPVLTNPWHQLSTWLTNGDPTAFETKHGMLFWDCAEREPKFNNLFNDAMASDARLVSSVV  183

Query  591   LSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEF  770
             +  + K VF+G+ S+VDV GG G +A A+AK FP ++CTVLDLPHV+A +     EN+++
Sbjct  184   IE-KCKEVFNGLESIVDVGGGIGTMAKALAKSFPQLECTVLDLPHVVAGLQ--ETENLKY  240

Query  771   VAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKK  950
             V G+MF+ IP+A+A+LLKWI+HDW D+ECVKILK CK+AI  + + GKVIIIDMV+E++K
Sbjct  241   VGGDMFKEIPSADAILLKWILHDWNDDECVKILKNCKDAIAKKGKEGKVIIIDMVMENEK  300

Query  951   HDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
                   + +L+ D+L+M L   KER KK+W  LIS +GFS+YKITP LGLRS+IE++P
Sbjct  301   GKNESLQTQLFFDMLMMVLVTGKERTKKEWVNLISSSGFSNYKITPILGLRSVIEIYP  358



>ref|XP_003615973.1| O-methyltransferase [Medicago truncatula]
 gb|AES98931.1| orcinol O-methyltransferase [Medicago truncatula]
Length=363

 Score =   352 bits (904),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 172/349 (49%), Positives = 235/349 (67%), Gaps = 7/349 (2%)
 Frame = +3

Query  87    LLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPYIH  266
             LL+A++  WNHI N+I+S +LKC V LGIPDIIHNH KPMP+  LI++LPIHPSK P IH
Sbjct  14    LLKAQSHVWNHIFNFINSMSLKCVVDLGIPDIIHNHGKPMPISKLISSLPIHPSKKPCIH  73

Query  267   RLTRFLVHSGLLSVTNSGQEEC---YSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSCY  437
             RL R + HSG  S  N    E    Y LT A RL++KD P+++  F++   + V     +
Sbjct  74    RLMRIMTHSGFFSQQNIAANEPEIEYMLTDASRLLLKDNPMSVTPFVYAMLDPVMMNPWH  133

Query  438   SLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKRVF  617
                 W +N+D + F T HG  +W+Y + +  +N++FNE  A D+QL+  +L+  + K VF
Sbjct  134   QFSMWLKNDDTTSFETTHGMLLWEYAACDSKFNNLFNESMANDAQLVSNLLVE-KCKGVF  192

Query  618   DGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFENI  797
             +   SLVDV GG G +A   AK FP M+C V DLPHV+  +  +  EN+ +V G+MF+ I
Sbjct  193   NEFESLVDVGGGTGTMAKTFAKSFPQMECIVFDLPHVVDGLQGS--ENLSYVGGDMFKEI  250

Query  798   PAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYS-RA  974
             P  +A+LLKWI+HDW DEECVKILK CK+AI  + + GKV+IIDMV++ +K D   S   
Sbjct  251   PPTDAILLKWILHDWNDEECVKILKNCKDAISKKGKEGKVVIIDMVLDCEKGDNNESVET  310

Query  975   ELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELF  1121
             +L+ D+L+M     KER KK+W KLIS AGF DYKITP LGLR++IE++
Sbjct  311   KLFFDMLMMVTLTGKERTKKEWVKLISSAGFCDYKITPILGLRAVIEIY  359



>ref|XP_006366298.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=365

 Score =   352 bits (903),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 171/357 (48%), Positives = 242/357 (68%), Gaps = 13/357 (4%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPYI  263
             E+L A+   WNHI ++I+S +LK A+QL IPDIIH H KPM L +L  AL I+ SK  ++
Sbjct  12    EILHAQTHIWNHIFSFINSMSLKSAIQLNIPDIIHKHGKPMTLNELANALSINKSKITHL  71

Query  264   HRLTRFLVHSGLL----------SVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNE  413
              RL R L+HSG              + SG+ E Y L P  RL++KDEP+ +  FL    +
Sbjct  72    RRLMRILIHSGFFLKFAMIPLEEGSSGSGEGEGYVLAPPARLLLKDEPLTVTPFLLAMLD  131

Query  414   YVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLL  593
              +  K  + + +WF +++P+PF  AHG   WDY  HE   N  FN+  A D++L+M V++
Sbjct  132   PILVKPWHHVNEWFSSDEPTPFEVAHGRTFWDYAGHEQRLNHFFNDAMASDAKLVMSVVM  191

Query  594   SGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFV  773
                SK VF+G++S+VDV GG G VA  IAK FP ++CTV DLPHV+  ++ +  +N+ +V
Sbjct  192   K-YSKDVFEGLNSIVDVGGGTGTVAKTIAKKFPNLQCTVFDLPHVVEGLEGS--DNLSYV  248

Query  774   AGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKH  953
              G+ F ++P A+A+LLKWI+HDW DEE VKILKKCKEAIPS+E+GGKVIIIDM++++K  
Sbjct  249   GGDFFVSVPPADALLLKWILHDWSDEESVKILKKCKEAIPSKEKGGKVIIIDMMVDNKIG  308

Query  954   DPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             D      +++ D+L+M L   +ER+++ W K+  EAGFSDYK+TP LGLRSLIE++P
Sbjct  309   DDESIETQIFFDMLMMVLVTGRERSERGWAKIFFEAGFSDYKVTPILGLRSLIEVYP  365



>emb|CAJ65662.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   351 bits (900),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 168/346 (49%), Positives = 243/346 (70%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             +G+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ +  PM L +L +ALPIH
Sbjct  5     HGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHS   +    +   EE Y+LT A +L++KD P++L  +L    + 
Sbjct  64    PTKSHSVYRLMRILVHSSFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V       L  WFQN+DP+PF TAHG   WDY +++P    +FN+  A D++L+  V++ 
Sbjct  124   VLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNYQPSIAHLFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G +A AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLL+WI+HDW D+EC+KILK+ + AI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLRWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL G +ERN+K+W KL ++AGFSDYKITP L
Sbjct  301   EESIETQLFFDMLMMALVGGRERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CDP21787.1| unnamed protein product [Coffea canephora]
Length=365

 Score =   351 bits (901),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 173/356 (49%), Positives = 238/356 (67%), Gaps = 15/356 (4%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPYI  263
             EL QA+A  WNHI N+I+S ++KCA QLGIPD+IH H +PM L  LI ALPI  +KAP++
Sbjct  13    ELFQAQAHIWNHIFNFINSMSVKCATQLGIPDVIHKHGQPMTLDQLIDALPIKNAKAPFV  72

Query  264   HRLTRFLVHSGL-----LSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQK  428
             +RL + L+HSG      +    +  ++ Y LT A  L++K  P ++  FL    +     
Sbjct  73    YRLMQILIHSGFFIEAKIPGNENDNQKGYLLTSASELLLKSNPFSMTPFLLAMLDPTLTD  132

Query  429   SCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESK  608
                +L  WFQN+D +PF T HG  I+ + SHEP  N  FNE  A D++L+  V+ + + K
Sbjct  133   PWQNLSQWFQNSDETPFYTCHGRSIYAFASHEPWLNQFFNEAMASDTRLVSSVV-TKDCK  191

Query  609   RVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMF  788
              VF+ ++SLVDV GG G  A AIA  FP +KCTVLDLPHV+  ++++  +N+ +V GNMF
Sbjct  192   HVFESLNSLVDVGGGTGTFAKAIADAFPRLKCTVLDLPHVVDGLESS--KNLAYVGGNMF  249

Query  789   ENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIE-----DKKH  953
             E IP A+AVL+KWI+ DW D+ECV+ILKKCKEA PS+E+GGKVII+DM  +     D  H
Sbjct  250   EAIPPADAVLMKWILIDWSDDECVQILKKCKEAFPSKEKGGKVIIVDMFCKSLQKGDDDH  309

Query  954   DPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELF  1121
             +      +L+ D+ VM L   ++RN+K W KL +EAGFSDYKIT  LGLRS+IE++
Sbjct  310   ETI--ETQLFFDMEVMVLLKGRQRNEKDWAKLFTEAGFSDYKITAVLGLRSIIEVY  363



>emb|CAN70493.1| hypothetical protein VITISV_002330 [Vitis vinifera]
Length=363

 Score =   350 bits (899),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 179/362 (49%), Positives = 238/362 (66%), Gaps = 11/362 (3%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG +S  ELLQA+   WNHI N+I+S +LKCA+QLGIPDIIHNH +PM L +L+A LP+ 
Sbjct  5     NGGRSS-ELLQAQTHVWNHIFNFINSMSLKCAIQLGIPDIIHNHCQPMTLHELVAKLPVR  63

Query  243   PSKAPYIHRLTRFLVHSGLLS---VTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNE  413
             P+K   +HRL R LVHSG  +   V  S  EE Y L  A RL++KD P++   FL    +
Sbjct  64    PNKTLCVHRLMRILVHSGFFTMQRVQESADEEGYXLANASRLLLKDHPLSATPFLLAMLD  123

Query  414   YVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLL  593
                 +  + +  WFQN+DP+PF TAHG  IWDY  HEP +N+ FNE  A D++L+  VL+
Sbjct  124   PDLTEPWHYVSAWFQNDDPTPFFTAHGRTIWDYGCHEPRFNNFFNEAMASDARLVTSVLI  183

Query  594   SGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVE--  767
               E K  F+G++S VDV GG G VA  I   FP +  TVLDLPHV+A +      ++   
Sbjct  184   K-ECKGAFEGLNSFVDVGGGTGTVAKTIVXAFPHLHSTVLDLPHVVADLQGXKXLDLPRR  242

Query  768   -FVAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIED  944
              +V GN          +  +WI+HDW DEEC+KILK+C+ AIPS+E+GGKV+IIDM I +
Sbjct  243   GYVRGNSSCGCHFTEGI-TQWILHDWSDEECLKILKQCRXAIPSKEKGGKVMIIDMAIXN  301

Query  945   KKHDPCYSRAE--LYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIEL  1118
             KK D   S  E  L+ D+L+M L   +ER +K+W+KL  ++GFS YKITP LGLRSLIE+
Sbjct  302   KKGDDDESXVETQLFXDMLMMVLXPGREREEKEWKKLFLDSGFSGYKITPILGLRSLIEV  361

Query  1119  FP  1124
             +P
Sbjct  362   YP  363



>ref|XP_004490687.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cicer 
arietinum]
Length=354

 Score =   350 bits (899),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 175/349 (50%), Positives = 244/349 (70%), Gaps = 6/349 (2%)
 Frame = +3

Query  87    LLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPYIH  266
             LL+A++  WNH+ N+I+S +LKC V LGIPDIIHN+ KPMPL  LI++LPIHPSK P I+
Sbjct  9     LLKAQSHIWNHMCNFINSMSLKCVVDLGIPDIIHNYEKPMPLSVLISSLPIHPSKIPCIY  68

Query  267   RLTRFLVHSGLLSVTNSGQEEC---YSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSCY  437
             RL R + H G  S  N  + E    Y LT    L++KD P+++  FL +  + +     +
Sbjct  69    RLMRIMTHLGFFSKDNVTENELEIEYMLTDESILLLKDHPMSVTPFLQVVLDPIVANPWH  128

Query  438   SLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKRVF  617
             +L  W +N+DP+ F T HG  IWDY + EP +N++FN+  A D++L+  V++  + K VF
Sbjct  129   NLSTWLKNDDPTTFETTHGMLIWDYAAREPKFNNLFNDAMASDARLVTSVVIE-KCKGVF  187

Query  618   DGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFENI  797
             +G+ SLVDV GG G +A A+AK FP M+C V DLPHV+  +  +  +N+ +V G+MF+NI
Sbjct  188   NGLESLVDVGGGTGTMAKALAKTFPMMECNVFDLPHVVDGLQGS--DNLNYVGGDMFKNI  245

Query  798   PAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYSRAE  977
             P A+A+LLKWI+HDW D+ECVKILK CK+AI  + + GKVIIIDMV+E +K +      +
Sbjct  246   PPADAILLKWILHDWNDDECVKILKNCKDAIAKKGKKGKVIIIDMVMEKEKGNNETLGTQ  305

Query  978   LYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             L+ D+L+M L   KER KK+W  LIS +GFSDYKITP LGLRS+IE++P
Sbjct  306   LFFDMLMMVLATGKERTKKEWVNLISSSGFSDYKITPVLGLRSVIEIYP  354



>ref|XP_003615967.1| O-methyltransferase [Medicago truncatula]
 gb|AES98925.1| orcinol O-methyltransferase [Medicago truncatula]
Length=359

 Score =   350 bits (899),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 171/359 (48%), Positives = 240/359 (67%), Gaps = 7/359 (2%)
 Frame = +3

Query  60    ENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPI  239
             +N +Q    LL+A++  WNH+ N+I+S +LKC V LGIPDIIHN+ KP+PL  LI++L I
Sbjct  4     QNIEQVASNLLKAQSHVWNHMFNFINSMSLKCVVDLGIPDIIHNYGKPIPLSKLISSLSI  63

Query  240   HPSKAPYIHRLTRFLVHSGLLSVTNSGQEEC---YSLTPAGRLVVKDEPINLRAFLHICN  410
             HPSK   IHRL R + HSG  S  N    E    Y LT A +L++KD P+++  ++H   
Sbjct  64    HPSKNHGIHRLMRIMTHSGFFSQKNVIGNELEIEYMLTDASKLLLKDNPMSVAPYVHAMV  123

Query  411   EYVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVL  590
               V     Y    W +N+D + F T HG   W+Y + +   N++FNE  A D++L+  +L
Sbjct  124   NPVMMNPWYQFSTWLKNDDTNTFETTHGMSTWEYAARDSEINNLFNESMANDTRLVSDLL  183

Query  591   LSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEF  770
             +  + K VF+ V SLVDV GG G +A  + K FP M+C V DLPHV+  +  +  E + +
Sbjct  184   VE-KCKGVFNEVESLVDVGGGTGTMAKTLVKSFPQMECIVFDLPHVVDGLQGS--EKLRY  240

Query  771   VAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKK  950
             V G+MF+ IP A+A+LLKWI+HDW DE+C+KILK CK+AI  + + GKV+IIDMV++ +K
Sbjct  241   VGGDMFKEIPPADAILLKWILHDWNDEQCLKILKNCKDAISKKGKEGKVVIIDMVLDCEK  300

Query  951   HDPCYS-RAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
              D   S   +L+ D+L+MAL   KERN+K+W KLIS AGF+DYKITP LGLRS+IE++P
Sbjct  301   GDNNESVETQLFFDMLMMALLTGKERNEKEWMKLISLAGFNDYKITPILGLRSMIEIYP  359



>emb|CAJ65666.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   350 bits (898),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 169/346 (49%), Positives = 242/346 (70%), Gaps = 6/346 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             +G+ S+ ELL A+A  WNHI ++I+S +LK A+QLGIPDII+ +  PM L +L +ALPIH
Sbjct  5     HGEHSN-ELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIH  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVT--NSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             P+K+  ++RL R LVHS   +    +   EE Y+LT A +L++KD P++L  +L    + 
Sbjct  64    PTKSHSVYRLMRILVHSSFFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLDP  123

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V       L  WFQN+DP+PF TAHG   WDY +++P    +FN+  A D++L+  V++ 
Sbjct  124   VLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNYQPSIAHLFNDAMASDARLVTSVIID  183

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDV GG G +A AIA  FP ++CTVLDLPHV+A  D    +N+++  
Sbjct  184   -DCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVA--DLQGSKNLKYTG  240

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MFE +P A+ VLLKWI+HDW D+EC+KILK+ + AI S+++ GKVIIIDM++E++K D
Sbjct  241   GDMFEAVPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMMENQKGD  300

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPAL  1094
                   +L+ D+L+MAL G KERN+K+W KL ++AGFS YKITP L
Sbjct  301   EESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSGYKITPIL  346



>dbj|BAI79244.1| O-methyltransferase [Carapichea ipecacuanha]
 dbj|BAJ05386.1| O-methyltransferase [Carapichea ipecacuanha]
Length=350

 Score =   350 bits (897),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 174/351 (50%), Positives = 238/351 (68%), Gaps = 7/351 (2%)
 Frame = +3

Query  72    QSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSK  251
              S  ELL+A+      + ++ + A+LKCA+ LGIPD I  H KPM L +L +ALPI+PSK
Sbjct  7     SSSAELLRAQTHFSTQLFSFQNYASLKCALHLGIPDAIKQHGKPMNLSELTSALPINPSK  66

Query  252   APYIHRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKS  431
             APYIHRL R LV +G  +  N    EC+ LTP G L++KD+PIN+RA + +         
Sbjct  67    APYIHRLMRMLVKAGYFAQEN----ECFDLTPIGLLLLKDDPINIRALVLLELHPALLMP  122

Query  432   CYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKR  611
               +L +WFQN+D +PF TAHG+  WDY S +P +  +F+E  A DS+L+  VL++ E K 
Sbjct  123   WIALSEWFQNDDATPFVTAHGKSFWDYTSRDPEFRKLFDEAMAGDSELISKVLVT-EFKY  181

Query  612   VFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFE  791
             VF+G+ SLVDV GG G +A +IAK FP +KCTV DLP  +A+       N++FVAG+MF+
Sbjct  182   VFEGLKSLVDVGGGNGTLARSIAKAFPNLKCTVFDLPEAVANEQGDG--NLDFVAGDMFD  239

Query  792   NIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYSR  971
              +P+A+A+LLK I+HDW DE CVKILK CK++IP +++GGKVIII+ V+E +K+      
Sbjct  240   RVPSADAILLKIILHDWSDENCVKILKNCKKSIPGKDKGGKVIIIEGVVELEKNAGNEYA  299

Query  972   AELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
                 +D+ +M LY SKER KK+W KL S+AGFSDYK  PAL    +IEL P
Sbjct  300   GLENLDMEMMVLYNSKERTKKEWAKLFSDAGFSDYKFIPALDSWCIIELSP  350



>ref|XP_006356530.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=355

 Score =   350 bits (897),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 177/349 (51%), Positives = 243/349 (70%), Gaps = 6/349 (2%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKP-MPLCDLIAALP-IHPSKAP  257
             +L++AEAQ+W+HIL+Y+  + +KCA+QLGIPDI+H +P P M L +LI ALP ++PSK  
Sbjct  11    QLIEAEAQSWDHILSYLRPSCIKCAIQLGIPDILHKNPNPIMSLSNLIIALPNLNPSKIT  70

Query  258   YIHRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSCY  437
             +I  L R LV  GL +  + G  + YSLT  GRL+V+++    R+F       V   +  
Sbjct  71    FIPILMRVLVDFGLFNYHHQG--DGYSLTRVGRLLVENDLSGKRSFFLFAQHPVVLNTAA  128

Query  438   SLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKRVF  617
              +GDW +++  + F TA+G+  WDY + EP +N +FN+  A DS+L+  +L+S     VF
Sbjct  129   YMGDWLRDDLSTAFETAYGKSHWDYCAEEPKFNGIFNDAMASDSRLISNLLISDCCVGVF  188

Query  618   DGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFENI  797
             +G++SLVD+ GG GAVA AIA  F  +KC VLDLPHVI   D     N+EFVAG+MF+ I
Sbjct  189   EGLTSLVDIGGGTGAVAMAIAGAFQRLKCIVLDLPHVIG--DRKGSGNLEFVAGSMFDKI  246

Query  798   PAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYSRAE  977
             P ANA+LLKWI+H+W DE CV +LKKCKE+IPS+E GGKVIIIDMV+ED   +    +++
Sbjct  247   PHANAILLKWILHNWSDENCVNLLKKCKESIPSKENGGKVIIIDMVMEDNCSNEQLVQSQ  306

Query  978   LYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
               MDLL+   + SKER KK+WEKL  +AGFS YKI  +LGLRSLIE++P
Sbjct  307   HLMDLLMRITHASKERTKKEWEKLFLDAGFSGYKIITSLGLRSLIEIYP  355



>ref|XP_002278092.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=361

 Score =   350 bits (897),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 175/366 (48%), Positives = 247/366 (67%), Gaps = 16/366 (4%)
 Frame = +3

Query  51    IMGENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAA  230
             I GE G     EL QA++  + HI N+I+S  LKCAV+LGIPDIIH H  P+ L  L++A
Sbjct  4     IHGEGGS----ELFQAQSHMYKHIFNFINSMALKCAVELGIPDIIHTHNHPISLPQLVSA  59

Query  231   LPIHPSKAPYIHRLTRFLVHSGLLSV-----TNSGQEECYSLTPAGRLVV---KDEPINL  386
             L + P+K  Y++RL R LVHSG  +          ++E Y LT + RL++    +   NL
Sbjct  60    LHLPPTKTRYVNRLMRVLVHSGFFATAKVHENQEEEDEGYVLTTSSRLLLSKDNNNVPNL  119

Query  387   RAFLHICNEYVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKD  566
              AF+    + V     + LGDWF+ ND + F TAHG+  WDY SH+  + ++FNE  A D
Sbjct  120   SAFVLAMLDPVLVTPWHFLGDWFRGNDLTAFDTAHGKSFWDYGSHDHKFFNLFNEAMASD  179

Query  567   SQLLMIVLLSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDA  746
             S+++ +V+   + + VF+G+ SLVDV GGKG +A  I++ FP +KCTV DLPHV+++   
Sbjct  180   SRMMSLVI--KDCRPVFEGLGSLVDVGGGKGLIARIISEAFPQLKCTVFDLPHVVSNFPE  237

Query  747   ASVENVEFVAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIII  926
                 N+++V G+MF+++P A+A+LLK ++H   DEECVKILKKC+EAIPS+E+GGKVI+I
Sbjct  238   CG--NLKYVGGDMFQSVPTADAILLKLVLHSLSDEECVKILKKCREAIPSKEKGGKVIVI  295

Query  927   DMVIEDKKHDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRS  1106
             D+VI +KK +   + A+L  DLL+M +   +ERN+K+WEKL  EAGFS YKI P  GLRS
Sbjct  296   DIVINEKKEEHDITEAKLLFDLLMMTVVTGRERNEKEWEKLFLEAGFSHYKINPIFGLRS  355

Query  1107  LIELFP  1124
             LIE+FP
Sbjct  356   LIEVFP  361



>dbj|BAJ05387.1| O-methyltransferase [Carapichea ipecacuanha]
Length=350

 Score =   349 bits (895),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 174/351 (50%), Positives = 238/351 (68%), Gaps = 7/351 (2%)
 Frame = +3

Query  72    QSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSK  251
              S  ELL+A+      + ++ + A+LKCA+ LGIPD I  H KPM L +L +ALPI+PSK
Sbjct  7     SSSAELLRAQTHFSTQLFSFQNYASLKCALHLGIPDAIKQHGKPMNLSELTSALPINPSK  66

Query  252   APYIHRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKS  431
             APYIHRL R LV +G  +  N    EC+ LTP G L++KD+PIN+RA + +         
Sbjct  67    APYIHRLMRMLVKAGYFAQEN----ECFDLTPIGLLLLKDDPINIRALVLLELHPALLMP  122

Query  432   CYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKR  611
               +L +WFQN+D +PF TAHG+  WDY S +P +  +F+E  A DS+L+  VL++ E K 
Sbjct  123   WIALSEWFQNDDATPFVTAHGKSFWDYTSRDPEFRKLFDEAMAGDSELISKVLVT-EFKY  181

Query  612   VFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFE  791
             VF+G+ SLVDV GG G +A +IAK FP +KCTV DLP  +A+       N++FVAG+MF+
Sbjct  182   VFEGLKSLVDVGGGNGTLARSIAKAFPNLKCTVFDLPESVANEQGDG--NLDFVAGDMFD  239

Query  792   NIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYSR  971
              +P+A+A+LLK I+HDW DE CVKILK CK++IP +++GGKVIII+ V+E +K+      
Sbjct  240   RVPSADAILLKIILHDWSDENCVKILKNCKKSIPGKDKGGKVIIIEGVVELEKNAGNEYA  299

Query  972   AELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
                 +D+ +M LY SKER KK+W KL S+AGFSDYK  PAL    +IEL P
Sbjct  300   GLENLDMEMMVLYNSKERTKKEWAKLFSDAGFSDYKFIPALDSWCIIELSP  350



>ref|XP_011037442.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=355

 Score =   348 bits (894),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 174/354 (49%), Positives = 236/354 (67%), Gaps = 6/354 (2%)
 Frame = +3

Query  69    KQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPS  248
             ++S  ELLQA+   WNH+ N+I+S TLKCAV+LGIPD+I  H KPM L +L+ ALPIHPS
Sbjct  6     EESAGELLQAQTHVWNHLFNFINSMTLKCAVELGIPDVIQKHGKPMTLSELVTALPIHPS  65

Query  249   KAPYIHRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQK  428
             KA Y+HRL R LVHSG  S  N  Q E YSLT + RL++KD P ++R  L    + V  K
Sbjct  66    KAQYVHRLMRILVHSGFFSQQNLKQ-EAYSLTQSTRLLLKDNPWSMRTLLLFVLDPVLTK  124

Query  429   SCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESK  608
                 L  WF+N++ S F  AH    W+Y   +P  N++FN+  A DS L   V++S + K
Sbjct  125   PHDCLSTWFRNDEASAFSVAHENTFWEYAGQDPRINNLFNDAMASDSILASKVVVS-KCK  183

Query  609   RVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMF  788
              +F+GV+SLVDV GG G +A  I + FP M CTV DLPHV++  D    +N+++V G+MF
Sbjct  184   GIFEGVNSLVDVGGGLGTMAKGIVEAFPHMDCTVFDLPHVVS--DLQGSKNLKYVGGDMF  241

Query  789   ENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSR--EEGGKVIIIDMVIEDKKHDPC  962
             + +P A+A+LLK I+H W DE+CVKIL++CK+AI S+  ++ GKVIIIDMV E+   D  
Sbjct  242   QAVPPADAILLKLILHCWRDEDCVKILRRCKQAIMSKGQQKAGKVIIIDMVRENLNGDEG  301

Query  963   YSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
                 +L+ DL +M      ERN+K+W KL  +AGF +YKI   LG R+LIEL+P
Sbjct  302   SIETQLFFDLQLMVAASGIERNEKEWAKLFFDAGFLNYKIHSVLGTRALIELYP  355



>emb|CDP19840.1| unnamed protein product [Coffea canephora]
Length=363

 Score =   348 bits (894),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 171/354 (48%), Positives = 237/354 (67%), Gaps = 11/354 (3%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPYI  263
             EL QA+A  WNHI N+I+S ++KCA+QLGIPD+IH H +PM L  LI ALPI  +KAP++
Sbjct  13    ELFQAQAHIWNHIFNFINSMSVKCAIQLGIPDVIHKHGQPMTLDQLIDALPIKNAKAPFV  72

Query  264   HRLTRFLVHSGL-----LSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQK  428
             +RL + L+HSG      +    +  ++ Y LT A  L++K  P ++  FL    +     
Sbjct  73    YRLMQILIHSGFFIEAKIPGNENDNQKGYLLTSASELLLKSNPFSVTPFLLAMLDPALTD  132

Query  429   SCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESK  608
               + L  WFQN+D +PF T HG  I+ + SHEP  N  FNE  A D++++  V ++ + K
Sbjct  133   PWHHLSQWFQNSDETPFYTCHGRSIYAFASHEPWLNQFFNEAMASDARMVSSV-VTKDCK  191

Query  609   RVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMF  788
              VF+G++SLVD+ GG G  A AIA  FP +KCTVLDLPHV+  ++  S +N+ +V GNMF
Sbjct  192   HVFEGLNSLVDIGGGTGTFAKAIADAFPRLKCTVLDLPHVVDGLE--SSKNLAYVGGNMF  249

Query  789   ENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKH---DP  959
             E IP A+AVL+KWI+ DW D+ECV+ILKKCKEAIPS+E+GGKVII+D   + ++    D 
Sbjct  250   EAIPPADAVLMKWILIDWSDDECVQILKKCKEAIPSKEKGGKVIIVDTFCKSQQKGDDDH  309

Query  960   CYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELF  1121
                  +L+ D+  M L   ++RN+  W KL SEAGFSDYKIT  LGLRS+IE++
Sbjct  310   EAIETQLFYDMGAMVLVKGRQRNETDWAKLFSEAGFSDYKITAVLGLRSIIEVY  363



>ref|XP_006388573.1| hypothetical protein POPTR_0151s00210g [Populus trichocarpa]
 gb|ERP47487.1| hypothetical protein POPTR_0151s00210g [Populus trichocarpa]
Length=359

 Score =   348 bits (893),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 174/357 (49%), Positives = 238/357 (67%), Gaps = 8/357 (2%)
 Frame = +3

Query  69    KQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPS  248
             ++S  ELLQA+   WNHI N+I+S TLKCAVQLGIPD+I  H KPM L +L++ALPIHPS
Sbjct  6     EESAGELLQAQTHVWNHIFNFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPS  65

Query  249   KAPYIHRLTRFLVHSGLLSVTNSG---QEECYSLTPAGRLVVKDEPINLRAFLHICNEYV  419
             KA Y+HRL R LVHSG  S  N      +  YSLT + RL++KD P ++R  L +  + V
Sbjct  66    KAQYVHRLMRILVHSGFFSQQNLNGIHNQVAYSLTQSTRLLLKDNPWSVRPLLLLVLDPV  125

Query  420   FQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSG  599
               K    L  WF+N+D + F  AH + +W+Y   +   N++FN+  A DS +L   L+  
Sbjct  126   LTKPWDCLSTWFRNDDRNAFSVAHEKTLWEYAGQDARLNNLFNDAMASDS-ILASKLVVS  184

Query  600   ESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAG  779
             + K +FDGV+SLVDV GG G +A  IA+ FP M CTV DLPHV++ +     +N+++  G
Sbjct  185   KCKGIFDGVNSLVDVGGGLGTMAKGIAEAFPHMDCTVFDLPHVVSDLQGG--KNLKYAGG  242

Query  780   NMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSR--EEGGKVIIIDMVIEDKKH  953
             +MFE +P  +A+LLKWI+HDW DE+CVKILK+CK+AI S+  ++ GKVIIIDMV +++  
Sbjct  243   DMFEAVPPVDALLLKWILHDWSDEDCVKILKRCKQAITSKGQQKVGKVIIIDMVRDNRNG  302

Query  954   DPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             D      +L  DL +M      ERN+K+W KL  +AGF +YKI P LG R+L EL+P
Sbjct  303   DEGSIGTQLLFDLEMMVALSGMERNEKEWAKLFFDAGFLNYKIHPVLGTRALFELYP  359



>dbj|BAJ72588.1| 7'-O-demethylcephaeline/cephaeline O-methyltransferase [Carapichea 
ipecacuanha]
Length=350

 Score =   348 bits (892),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 171/350 (49%), Positives = 237/350 (68%), Gaps = 7/350 (2%)
 Frame = +3

Query  75    SHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKA  254
             S  ELL+A+      + ++ + A+LKCA+ LGIPD I  H KPM L +L +ALPI PSKA
Sbjct  8     SSAELLRAQTHFSTQLFSFQNYASLKCALHLGIPDAIKQHGKPMNLSELTSALPIKPSKA  67

Query  255   PYIHRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSC  434
             PYIHRL R LV +G  +  N    EC+ LTP G L++KD+PIN+RA + +          
Sbjct  68    PYIHRLMRMLVKAGYFAQEN----ECFDLTPIGLLLLKDDPINIRALVLLELHPALLLPW  123

Query  435   YSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKRV  614
              +L +WFQN+D +PF TAHG+  WDY S +P +  +F+E  A DS+L+  VL++ E K V
Sbjct  124   IALSEWFQNDDATPFVTAHGKSFWDYTSRDPEFRKLFDEAMAGDSELISKVLVT-EFKYV  182

Query  615   FDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFEN  794
             F+G+ SLVDV GG G +A +IAK FP +KCTV DLP  +A+       N++FVAG+MF+ 
Sbjct  183   FEGLKSLVDVGGGNGTLARSIAKAFPNLKCTVFDLPEAVANEQGDG--NLDFVAGDMFDR  240

Query  795   IPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYSRA  974
             +P+A+A+LLK ++HDW DE CVKILK C+++IP +++GGKVIII+ V+E +K+       
Sbjct  241   VPSADAILLKIVLHDWSDENCVKILKNCRKSIPVKDKGGKVIIIEGVVELEKNAGNEYAG  300

Query  975   ELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
                +D+ ++ LY SKER KK+W KL S+AGFSDYK  PAL    +IEL P
Sbjct  301   LENLDMEMLVLYNSKERTKKEWAKLFSDAGFSDYKFIPALDSWCIIELTP  350



>dbj|BAJ05384.1| O-methyltransferase [Carapichea ipecacuanha]
 dbj|BAJ05385.1| O-methyltransferase [Carapichea ipecacuanha]
Length=350

 Score =   347 bits (890),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 173/351 (49%), Positives = 237/351 (68%), Gaps = 7/351 (2%)
 Frame = +3

Query  72    QSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSK  251
              S  ELL+A+      + ++ + A+LKCA+ LGIPD I  H KPM L +L +ALPI+PSK
Sbjct  7     SSSAELLRAQTHFSTQLFSFQNYASLKCALHLGIPDAIKQHGKPMNLSELTSALPINPSK  66

Query  252   APYIHRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKS  431
             APYIHRL R LV +G  +  N    EC+ LTP G L++KD+PIN+RA + +         
Sbjct  67    APYIHRLMRMLVKAGYFAQEN----ECFDLTPIGLLLLKDDPINIRALVLLELHPALLMP  122

Query  432   CYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKR  611
               +L +WFQN+D +PF TAHG+  WDY S +P +  +F+E  A DS+L+  VL++ E K 
Sbjct  123   WIALSEWFQNDDATPFVTAHGKSFWDYTSRDPEFRKLFDEAMAGDSELISKVLVT-EFKY  181

Query  612   VFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFE  791
             VF+G+ SLVDV G  G +A +IAK FP +KCTV DLP  +A+       N++FVAG+MF+
Sbjct  182   VFEGLKSLVDVGGANGTLARSIAKAFPNLKCTVFDLPEAVANEQGDG--NLDFVAGDMFD  239

Query  792   NIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYSR  971
              +P+A+A+LLK I+HDW DE CVKILK CK++IP +++GGKVIII+ V+E +K+      
Sbjct  240   RVPSADAILLKIILHDWSDENCVKILKNCKKSIPGKDKGGKVIIIEGVVELEKNAGNEYA  299

Query  972   AELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
                 +D+ +M LY SKER KK+W KL S+AGFSDYK  PAL    +IEL P
Sbjct  300   GLENLDMEMMVLYNSKERTKKEWAKLFSDAGFSDYKFIPALDSWCIIELSP  350



>ref|XP_011100233.1| PREDICTED: 8-hydroxyquercetin 8-O-methyltransferase-like [Sesamum 
indicum]
Length=359

 Score =   347 bits (891),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 166/361 (46%), Positives = 242/361 (67%), Gaps = 8/361 (2%)
 Frame = +3

Query  54    MGENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAAL  233
             +  NG QS  ELL A++  WNH+ N+++S +LKC +QLGIPDII  H KPM L +L  +L
Sbjct  3     LSSNGIQSTQELLDAQSHVWNHLFNFVNSMSLKCVIQLGIPDIILKHGKPMTLSELTHSL  62

Query  234   PIHPSKAPYIHRLTRFLVHSGLL---SVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHI  404
              ++ +K+P + RL R ++HS       ++   + E Y LTPA  L+++DEP+++R F   
Sbjct  63    HLNDAKSPSLERLMRIMIHSKFFINVKISQVEESEGYWLTPASHLLLRDEPLSVRPFALG  122

Query  405   CNEYVFQKSCYSLGDWFQNN-DPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLM  581
               + +     + L +WF+ + D +PF T HG  +W++   +P  N++FNE  A DS+L+ 
Sbjct  123   MLDPILTDPWHHLSEWFKTDGDLTPFLTTHGRTLWEHAGQDPRLNELFNEGMASDSELVA  182

Query  582   IVLLSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVEN  761
              V+ + + + VF+G+ S+VDV GG G VA AIA  F  + C VLDLPHV+A  +    E+
Sbjct  183   TVI-TKDCRNVFEGLKSMVDVGGGTGTVAKAIADAFTGLNCVVLDLPHVVAGCEGT--ES  239

Query  762   VEFVAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIE  941
             + FVAG+MF+ IP A+AV +KWI+HDW DE+C+KILKKCK+AI ++++GGKVII+DMV++
Sbjct  240   LTFVAGDMFDYIPPADAVFMKWILHDWPDEQCLKILKKCKQAISNKDKGGKVIIVDMVVD  299

Query  942   DKKHDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELF  1121
              KK        +L+ D+L++ L    ER +K W KL S AGF+ YKITPA GLRSLIELF
Sbjct  300   FKKEHKAI-ETQLFFDMLMINLTSGIERTEKDWAKLFSAAGFTSYKITPAFGLRSLIELF  358

Query  1122  P  1124
             P
Sbjct  359   P  359



>ref|XP_002305103.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|EEE85614.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=359

 Score =   347 bits (891),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 173/357 (48%), Positives = 242/357 (68%), Gaps = 11/357 (3%)
 Frame = +3

Query  72    QSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSK  251
             Q   EL QA     + + NYI+S +L CA QLGIPDIIHNH +P+ L  L++AL I P+K
Sbjct  8     QKATELFQAHTHLHSQMFNYINSMSLMCAAQLGIPDIIHNHGRPITLPHLVSALHIAPNK  67

Query  252   APYIHRLTRFLVHSGLLSVTNS------GQEECYSLTPAGRLVVKDEPINLRAFLHICNE  413
                I+RL R LVHSG  + T +      G+EE Y LTP  +L+VKD    L  F+ + N 
Sbjct  68    TSIIYRLMRMLVHSGFFATTKAANGQGEGEEEAYVLTPPSQLLVKDNTNCLSPFMSLINP  127

Query  414   YVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLL  593
               F     SLGDWF+ N+P+ F  A+G   W+Y +  P  N +FNE  A DSQ++ +V+ 
Sbjct  128   -AFVTPWLSLGDWFRGNEPTAFEHAYGMAFWEYHNQNPELNRLFNEAMACDSQMMNLVI-  185

Query  594   SGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFV  773
               + K +F+G++S+VDV GG G+++  I++ FP M CTVL+LP VI +++    +N+ +V
Sbjct  186   -RDCKPIFEGLNSMVDVGGGTGSLSRIISEAFPHMNCTVLELPQVITNLEGT--KNLNYV  242

Query  774   AGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKH  953
              G+MF++IP+A+AVLLK I H W DE+C+KILKKCKEAI S+E+GGKVII+D+VI++KK 
Sbjct  243   GGDMFQHIPSADAVLLKLIFHGWSDEDCLKILKKCKEAISSKEKGGKVIIVDVVIDEKKD  302

Query  954   DPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             +   +  +L  D+L+M +   KER+ K+WEKL  EAGFS YKITP  GLRSLIE++P
Sbjct  303   EKELTETKLLFDMLMMVVAAGKERSVKEWEKLFLEAGFSHYKITPLFGLRSLIEVYP  359



>ref|XP_006474725.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=365

 Score =   347 bits (891),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 178/363 (49%), Positives = 241/363 (66%), Gaps = 10/363 (3%)
 Frame = +3

Query  57    GENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALP  236
             G+N      ELLQ++A  WN+I ++++S +LKCA+QLGIPDIIHNH KPM L  L+ AL 
Sbjct  6     GKNNDNISDELLQSQAHVWNNIFSFVNSMSLKCAIQLGIPDIIHNHAKPMTLNQLLTALQ  65

Query  237   IHPSKAPYIHRLTRFLVHSGLLSVTNSG---QEECYSLTPAGRLVVKDEPINLRAFLHIC  407
             IHP+K   ++RL R LVHSG  ++  +    QEE Y LT A +L++KD P++L  FL   
Sbjct  66    IHPTKTQCVYRLMRILVHSGFFALQKTSENEQEEGYILTSASKLLLKDHPLSLAPFLLAM  125

Query  408   NEYVFQKSCYSLGDWFQNNDPSP----FCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQL  575
              + +  K  + +  W QN+D       F   HG   WDY   E   N  FNE  A D++L
Sbjct  126   LDPILTKPWHQVSTWIQNDDDDDAATTFALPHGMNFWDYAVRETRLNHFFNEGMASDTRL  185

Query  576   LMIVLLSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASV  755
                 L+  + K VF+G+++LVDV GG G +ASAIAK FP ++CTV D PHV+A  D  S 
Sbjct  186   TSSALIH-KCKDVFEGLNTLVDVGGGTGTLASAIAKKFPHIECTVFDQPHVVA--DLKSN  242

Query  756   ENVEFVAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMV  935
              N+++V GNMFE IP A+AVL+K ++H+W DEECVKILK CK+AI    + GKVIIID+ 
Sbjct  243   GNLKYVGGNMFEAIPPADAVLIKCVLHNWNDEECVKILKNCKKAIAINGKAGKVIIIDIK  302

Query  936   IEDKKHDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIE  1115
             +E +K D   +  +L+MD+L+M L   +ERN+K+W KL  EAGFSDYKIT  LG+RSLIE
Sbjct  303   MESEKADYKTTETQLFMDMLMMVLVKGEERNEKEWAKLFFEAGFSDYKITDVLGVRSLIE  362

Query  1116  LFP  1124
             ++P
Sbjct  363   VYP  365



>ref|XP_006346269.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=364

 Score =   347 bits (891),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 172/356 (48%), Positives = 240/356 (67%), Gaps = 14/356 (4%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPS--KAP  257
             ++L A+A  WNHI NYI+S +LKCA+QL IPDIIH+H +PM L DL  ALPI+ +  KA 
Sbjct  14    QVLAAQAHIWNHIFNYINSMSLKCAIQLEIPDIIHSHGRPMNLSDLAEALPINNNHDKAK  73

Query  258   Y---IHRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQK  428
                 ++RL R LVH+G         EE Y LTP  RL++KDEP+++  FL+   +     
Sbjct  74    THDCVYRLMRILVHAGFFI---QEAEEGYLLTPTSRLLLKDEPMSMIPFLNFQLDPNLMD  130

Query  429   SCYSLGDWFQN----NDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
               +SL  WF N    ++ +P+ TAHG   + Y  +EP  N +FNE  A D++L+M VL+ 
Sbjct  131   PWHSLSKWFNNVSDDSNTTPYATAHGMPFFKYAENEPRLNHLFNEAMASDTRLVMTVLIQ  190

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
                  +F+G+ SLVDV GG G +A AIA  FP + CTV +LPHVI  +  +  +N+ FV 
Sbjct  191   NGKGLIFEGLKSLVDVGGGTGTIAKAIADTFPQINCTVFELPHVIEGLKGS--KNLSFVG  248

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             G+MF +IP+ANA+LLKWI+HDW D +C+KILKKCKEAIPS+E GGKVI+I++V++  K D
Sbjct  249   GDMFNSIPSANAILLKWILHDWSDGDCIKILKKCKEAIPSKENGGKVILIEIVMDQNKDD  308

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
                   +L +D+L+M L   KER++++W KL  +AG+SDYKI P LGLR +IE++P
Sbjct  309   DKSYETQLLIDILMMILLSGKERSQQEWAKLFFDAGYSDYKIIPILGLRCVIEVYP  364



>emb|CAN69556.1| hypothetical protein VITISV_027590 [Vitis vinifera]
Length=323

 Score =   346 bits (887),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 175/354 (49%), Positives = 229/354 (65%), Gaps = 35/354 (10%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ S  ELL A+A  WNHILN+I S +LKCA+QLGIPDIIHNH KPM L +        
Sbjct  5     NGEIS-AELLHAQAHVWNHILNFIKSVSLKCAIQLGIPDIIHNHGKPMTLPE--------  55

Query  243   PSKAPYIHRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVF  422
                                       +EE Y LT A RL++ D+ +++R  L    + + 
Sbjct  56    -----------------------AGEEEEGYVLTDASRLLLMDDSLSIRPLLLAMLDPIL  92

Query  423   QKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGE  602
              K  + L  WFQN+DP+PF TAH    WDY  HEP  N+ FNE  A D++L+  VLL  E
Sbjct  93    TKPWHYLSAWFQNDDPTPFHTAHERPFWDYAGHEPQLNNFFNEAMASDARLVTSVLLK-E  151

Query  603   SKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGN  782
              K VF+G++SLVDV GG G VA AIA  FP + CTVLDLPHV+A +  +  +N+ + AG+
Sbjct  152   GKGVFEGLNSLVDVGGGTGQVAKAIANAFPHLNCTVLDLPHVVAGLQGS--KNLNYFAGD  209

Query  783   MFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPC  962
             +FE IP A+A+LLKWI+HDW DEECVKILK+C+EAIPS+E GGKVIIIDM++   + D  
Sbjct  210   IFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQGDYK  269

Query  963   YSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
                 +L+ D+ +M     +ER++ +WEKL  +AGFS YKITP LGLRSLIE++P
Sbjct  270   SIETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  323



>ref|XP_006469138.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=551

 Score =   353 bits (907),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 175/356 (49%), Positives = 242/356 (68%), Gaps = 5/356 (1%)
 Frame = +3

Query  57    GENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALP  236
             GEN   S  ELL+A+AQ WN   NY++S +LKCAV+L I DIIH+H +P  L  + +AL 
Sbjct  201   GENAASSS-ELLKAQAQVWNCTFNYVNSMSLKCAVELDIADIIHSHGQPTTLSQIASALN  259

Query  237   IHPSKAPYIHRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             I P+K   I  + R LVHSG  +      E  Y LTPA RL++KD P+    F+ +  + 
Sbjct  260   IKPNKVQCIQSVMRILVHSGFFAQQKDDDE--YFLTPASRLLLKDTPLKAAPFVDLVADP  317

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             ++  + + LG W QN+DP+ F TAHG+  WD ++ EP +  +F ++   DS+L+  +++ 
Sbjct  318   LYTTAFHYLGTWLQNDDPTLFETAHGKNFWDRVADEPKFKSLFYDLMITDSELIARIVIK  377

Query  597   GESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVA  776
              + K VF+G+ SLVDVAGG G +A AIA  FP +KCTV DLPHV+ ++   + +N++F+ 
Sbjct  378   -DCKEVFEGLKSLVDVAGGTGTMARAIAAAFPDIKCTVFDLPHVVDNLQGTN-DNLDFLG  435

Query  777   GNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHD  956
             GNMFE IP ANAVLLK I+H+W DEE VK+LKKCKEAIPS++EGGKVIIIDM IE++  D
Sbjct  436   GNMFEAIPQANAVLLKGILHNWNDEESVKLLKKCKEAIPSKDEGGKVIIIDMAIENQSQD  495

Query  957   PCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
                   +L  D+L+++L+  KER+   W+KL   AGFS YKITP LG+RSLIE +P
Sbjct  496   KESMETQLCFDILMVSLFRGKERSVDDWKKLFLAAGFSHYKITPILGVRSLIEAYP  551



>gb|KDP21023.1| hypothetical protein JCGZ_21494 [Jatropha curcas]
Length=358

 Score =   345 bits (886),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 170/362 (47%), Positives = 250/362 (69%), Gaps = 9/362 (2%)
 Frame = +3

Query  54    MGENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAAL  233
             M     Q   E+LQA+    NH+LNY++S  LKCAVQLGIPDI+H+H KP+ L +L++AL
Sbjct  1     MDSTHSQKASEILQAQVHLINHMLNYMNSMALKCAVQLGIPDILHSHGKPITLPELLSAL  60

Query  234   PIHPSKAPYIHRLTRFLVHSGLLSVTN--SGQ---EECYSLTPAGRLVVKDEPINLRAFL  398
              I P+K   ++RL R LV SG  S T   +GQ   +E Y LTP+ RL+VK  P  L  F+
Sbjct  61    HIPPTKLSNMYRLMRMLVFSGFFSTTKVLNGQGDGQEAYVLTPSSRLLVKGNPNCLAPFV  120

Query  399   HICNEYVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLL  578
             +   +  F    + LGDWFQ N+ + F  AHG   W+Y   +P +N +FNE  A DS+++
Sbjct  121   NSLLKAEFVSPGHLLGDWFQGNELTVFEKAHGMAFWEYNERKPEFNQLFNEAMACDSRMM  180

Query  579   MIVLLSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVE  758
              +V+   + K++F+GV+SLVDV GG G++A  I++ FP MKCTVLDLP VIA+++    +
Sbjct  181   NLVI--RDCKQIFEGVNSLVDVGGGNGSLARIISEAFPDMKCTVLDLPQVIANLEGT--K  236

Query  759   NVEFVAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVI  938
             N+ +V G+MF++IP+ + ++LK I+H W D+EC+ ILKKCKEAI S+ +GGK+++ID+VI
Sbjct  237   NLSYVGGDMFKHIPSGDCIILKLILHGWSDDECLTILKKCKEAISSKGKGGKLVVIDLVI  296

Query  939   EDKKHDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIEL  1118
              +KK +P  +  +L  D+L+M++   +ER +++WE L  +AGFS +KITP LGLRSLIE+
Sbjct  297   NEKKDEPELTETKLLFDMLMMSVTCGRERTEREWEGLFLKAGFSHFKITPLLGLRSLIEV  356

Query  1119  FP  1124
             +P
Sbjct  357   YP  358



>ref|XP_009593020.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=361

 Score =   345 bits (886),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 170/360 (47%), Positives = 246/360 (68%), Gaps = 8/360 (2%)
 Frame = +3

Query  60    ENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALP-  236
             EN    H +LLQAEA TW+HIL+++  + ++CAV+L IPDI+  H   M + DL+A+LP 
Sbjct  5     ENNCVDHEQLLQAEALTWDHILSFVRPSCIRCAVELRIPDILRKH-GIMTISDLVASLPN  63

Query  237   IHPSKAPYIHRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEY  416
             ++PSK  ++  L R LVHSGLL+     + + YSLT AG L+V++EP + R+        
Sbjct  64    LNPSKISFLPVLMRILVHSGLLNYQK--EVDGYSLTTAGSLLVENEPFSKRSHFLFSQNP  121

Query  417   VFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLS  596
             V  K   SL  W Q++ P+ F T +G+ +WDY + EP +  +FN+  A DS+L+  + ++
Sbjct  122   VSLKPFSSLSHWLQDDLPTAFDTTYGKSMWDYCADEPKFGSIFNDAMASDSKLISHLFIN  181

Query  597   GES-KRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFV  773
              E  K VF+G++SLVDV GG G +  AIA  FP + C V DLPHVI      +  N+EFV
Sbjct  182   SEQYKHVFEGLTSLVDVGGGTGTLGMAIANAFPRLNCIVFDLPHVIGDRKGITTGNLEFV  241

Query  774   AGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKH  953
             AG+MF+NIP ANA+LLK+I+H+W DE+CVK+LKKC+E+IPS+E+GGKV++ID+V+ED   
Sbjct  242   AGSMFDNIPYANAILLKFILHNWSDEDCVKLLKKCRESIPSKEKGGKVMVIDIVMEDYSS  301

Query  954   DPCYS---RAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             +       + + +MD+++   YG+KER K +WEKL  +AGFSDYKIT   G+RSLIE++P
Sbjct  302   NNINEQLVQVQHFMDVIMRISYGAKERTKTEWEKLFLDAGFSDYKITANFGMRSLIEIYP  361



>ref|XP_004248183.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
lycopersicum]
Length=362

 Score =   344 bits (883),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 174/365 (48%), Positives = 243/365 (67%), Gaps = 14/365 (4%)
 Frame = +3

Query  51    IMGENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAA  230
             I+GE+      E+L A+   WNHI ++I+S +LK A+QL IPDIIH H KPM L +L  A
Sbjct  5     IVGEH----ETEILHAQTHIWNHIFSFINSMSLKSAIQLNIPDIIHKHGKPMTLDELANA  60

Query  231   LPIHPSKAPYIHRLTRFLVHSGLL-------SVTNSGQEECYSLTPAGRLVVKDEPINLR  389
             L I+ SK  ++ RL R LVHSG            +   E  Y L P   L++KDEP+ + 
Sbjct  61    LSINHSKITHLRRLMRILVHSGFFLKSVSGSGSESGSGEGGYVLAPPALLLLKDEPLTVT  120

Query  390   AFLHICNEYVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDS  569
              FL    + +  K  + + +WF +++P+ F  AHG   WDY  HEP  N  FN+  A D+
Sbjct  121   PFLLAMLDPILVKPWHHVSEWFTSDEPTAFEVAHGRTFWDYAGHEPRLNHFFNDAMASDA  180

Query  570   QLLMIVLLSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAA  749
             +L+M V++   SK VF+G++S+VDV GG G VA  IAK FP ++CTV DLPHV+  ++ +
Sbjct  181   KLVMSVVMK-YSKDVFEGLNSIVDVGGGTGTVAKTIAKTFPNLQCTVFDLPHVVEGLEGS  239

Query  750   SVENVEFVAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIID  929
               +N+ +V G+ F +IP A A+LLKWI+HDW DEE VKILKKCKEAIPS+E+GGKVIIID
Sbjct  240   --DNLTYVGGDFFVSIPHAEALLLKWILHDWSDEESVKILKKCKEAIPSKEKGGKVIIID  297

Query  930   MVIEDKKHDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSL  1109
             M++++K  D      +++ D+L+M L   +ER+++ W K+ SEAGFSDYK+TP LGLRSL
Sbjct  298   MMVDNKIGDDESIETQIFFDMLMMVLVTGRERSERGWAKIFSEAGFSDYKVTPILGLRSL  357

Query  1110  IELFP  1124
             IE++P
Sbjct  358   IEVYP  362



>ref|XP_006377432.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP55229.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=372

 Score =   344 bits (882),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 170/357 (48%), Positives = 244/357 (68%), Gaps = 10/357 (3%)
 Frame = +3

Query  69    KQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPS  248
             +Q   EL QA+   +  + NY++S +L CA QLGIPDIIHNH +P+ L +L++AL I P+
Sbjct  21    EQKATELFQAQTHLYGQMFNYLNSMSLVCAAQLGIPDIIHNHGRPITLPELVSALHIPPN  80

Query  249   KAPYIHRLTRFLVHSGLLSVTNS-----GQEECYSLTPAGRLVVKDEPINLRAFLHICNE  413
             K+  I+RL R LVHSG  + T +     G EE Y LTP  +L+VKD    L  F+ + N 
Sbjct  81    KSSCIYRLMRMLVHSGFFATTKAVIGQGGGEEAYVLTPPSQLLVKDNTNCLSPFMSLINP  140

Query  414   YVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLL  593
               F    +SLGDWF+ ++P+ F  A+G   W+Y +  P  N +FN   A DSQ++ +V+ 
Sbjct  141   -AFVTPWHSLGDWFRGSEPTAFQQAYGMAFWEYNNQNPELNGLFNAAMACDSQMMNLVIR  199

Query  594   SGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFV  773
               + K +F+G+ S+VDV GG G++A  I++ FP M CTVL++P VIA+++    EN+++V
Sbjct  200   --DCKPIFEGLDSMVDVGGGTGSLARIISETFPHMNCTVLEIPQVIANLEGT--ENLKYV  255

Query  774   AGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKH  953
              G+MF++IP+A+AVLLK I H W DE+CVKILKKCKEAI S+E+GGKVII+D+VI +KK 
Sbjct  256   GGDMFQHIPSADAVLLKLIFHGWSDEDCVKILKKCKEAISSKEKGGKVIIVDVVINEKKD  315

Query  954   DPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             +   +  +L  D+L+M +   KER+ ++WE+L  EAGFS YKIT   GLRSLIE++P
Sbjct  316   EHELTETKLLFDMLMMVVAAGKERSVEEWERLFLEAGFSHYKITSLFGLRSLIEVYP  372



>gb|KDO73905.1| hypothetical protein CISIN_1g017835mg [Citrus sinensis]
Length=365

 Score =   343 bits (880),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 176/363 (48%), Positives = 239/363 (66%), Gaps = 10/363 (3%)
 Frame = +3

Query  57    GENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALP  236
             G+N      ELLQ++A  WN+I ++++S +LKCA+QLGIPDIIHNH KPM L  L+  L 
Sbjct  6     GKNNDNISDELLQSQAHVWNNIFSFVNSMSLKCAIQLGIPDIIHNHAKPMTLNQLLTTLQ  65

Query  237   IHPSKAPYIHRLTRFLVHSGLLSVTNSG---QEECYSLTPAGRLVVKDEPINLRAFLHIC  407
             IHP+K   ++ L R LVHSG  ++  +    QEE Y LT A +L++KD P++L  FL   
Sbjct  66    IHPTKTQCVYHLMRILVHSGFFALQKTSENEQEEGYILTSASKLLLKDHPLSLAPFLLAM  125

Query  408   NEYVFQKSCYSLGDWFQNNDPSP----FCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQL  575
              + +  K  + +  W QN+D       F   HG   WDY   E   N  FNE  A D++L
Sbjct  126   LDPILTKPWHQVSTWIQNDDDDDAATTFALPHGMNFWDYAVRETRLNHFFNEGMASDTRL  185

Query  576   LMIVLLSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASV  755
                 L+  + K VF+G+++LVDV GG G +ASAIAK FP ++CTV D PHV+A  D  S 
Sbjct  186   TSSALIH-KCKDVFEGLNTLVDVGGGTGTLASAIAKKFPHIECTVFDQPHVVA--DLKSN  242

Query  756   ENVEFVAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMV  935
              N+++V GNMFE IP A+AVL+K ++H+W DEECVKILK CK+AI    + GKVIIID+ 
Sbjct  243   GNLKYVGGNMFEAIPPADAVLIKCVLHNWNDEECVKILKNCKKAIAINGKAGKVIIIDIK  302

Query  936   IEDKKHDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIE  1115
             +E +K D   +  +L+MD+L+M L   +ERN+K+W KL  EAGFSDYKIT  LG+RSLIE
Sbjct  303   MESEKADYKTTETQLFMDMLMMVLVKGEERNEKEWAKLFFEAGFSDYKITDVLGVRSLIE  362

Query  1116  LFP  1124
             ++P
Sbjct  363   VYP  365



>ref|XP_010320673.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X2 [Solanum lycopersicum]
Length=339

 Score =   342 bits (876),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 176/349 (50%), Positives = 239/349 (68%), Gaps = 23/349 (7%)
 Frame = +3

Query  87    LLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPI-HPSKAPYI  263
             LL A+AQ WN+I N+I S+ ++CA QLGIPD+++ H KPM L D+ A L + + SK  ++
Sbjct  11    LLHAQAQIWNYIFNFISSSAVRCAFQLGIPDVLYKHDKPMCLSDISAELSVVNSSKVSFL  70

Query  264   HRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSCYSL  443
               L +FLV SG L+      E+ YSLTPA  L+ KD+P N+R+ L + +   F K+   L
Sbjct  71    PILMQFLVQSGFLN----QHEDHYSLTPASCLLAKDDPFNVRSLLLLNHGQAFSKAWPEL  126

Query  444   GDWFQNNDPSPFCTAHGEKIWDYISHEPG--YNDVFNEVTAKDSQLLMIVLLSGESKRVF  617
              DWFQN+ P+PF TAHG+ +WD+I  E      D+FN+  A DS+L   VL++ E K VF
Sbjct  127   SDWFQNDSPTPFHTAHGKSLWDFIGEEQPSVLGDIFNDALASDSRLNTNVLIA-ECKHVF  185

Query  618   DGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFENI  797
             +G++SLVDV GG G V+ AIAK FP +KCTVLDLP V+  +  +   N++FV G+MF+ I
Sbjct  186   EGLTSLVDVGGGTGTVSIAIAKAFPNIKCTVLDLPQVVGDLKGSG--NLDFVGGDMFDMI  243

Query  798   PAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYSRAE  977
             P  NA+LLK             +LKKCKE+IPSRE+GGKVIIID V+ED K    + RA+
Sbjct  244   PHTNAILLK-------------VLKKCKESIPSREKGGKVIIIDTVLEDPKQSNEFVRAQ  290

Query  978   LYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
               M +L+M L+ +KER +K+WEKL SEAGF++YKI PALGLRSLIE++P
Sbjct  291   HNMGMLMMVLFAAKERTEKEWEKLFSEAGFTEYKIFPALGLRSLIEIYP  339



>ref|XP_011001214.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=373

 Score =   343 bits (879),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 171/358 (48%), Positives = 242/358 (68%), Gaps = 11/358 (3%)
 Frame = +3

Query  69    KQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPS  248
             +Q   EL QA+   +  + NY++S +L CA QLGIPDIIHNH  P+ L +L++AL I P+
Sbjct  21    EQKETELFQAQTHLYGQMFNYLNSMSLVCAAQLGIPDIIHNHGSPITLPELVSALHIPPN  80

Query  249   KAPYIHRLTRFLVHSGLLSVTNS------GQEECYSLTPAGRLVVKDEPINLRAFLHICN  410
             K   I+RL R LVHSG  + T +      G+EE Y LTP  +L+VKD    L  F+ + N
Sbjct  81    KTSCIYRLMRMLVHSGFFATTRAANGQGEGEEEAYVLTPPSQLLVKDNTNCLSPFMSLIN  140

Query  411   EYVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVL  590
                F    +SLGDWF+ ++P+ F  A+G   W+Y +  P  N +FN   A DSQ++ +V+
Sbjct  141   P-AFVTPWHSLGDWFRGSEPTAFQQAYGMAFWEYNNQNPELNCLFNAAMACDSQMMNLVI  199

Query  591   LSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEF  770
                + K +F+G+ S+VDV GG G++A  I++ FP MKCTVL+ P VIA+++    EN+++
Sbjct  200   R--DCKPIFEGLDSMVDVGGGTGSLARIISETFPHMKCTVLETPQVIANLEGT--ENLKY  255

Query  771   VAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKK  950
             V G+MF++IP+A+AVLLK I H W DE+CVKILKKCKEAI S+E+GGKVII+D+VI  KK
Sbjct  256   VGGDMFQHIPSADAVLLKLIFHGWSDEDCVKILKKCKEAISSKEKGGKVIIVDVVINKKK  315

Query  951   HDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
              +   +  +L  D+L+M +   KER+ ++WE+L  EAGFS YKIT   GLRSLIE++P
Sbjct  316   DEHELTETKLLFDMLMMVVAAGKERSVEEWERLFLEAGFSHYKITSLFGLRSLIEVYP  373



>ref|XP_010110664.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXC27579.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=377

 Score =   342 bits (878),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 172/373 (46%), Positives = 245/373 (66%), Gaps = 20/373 (5%)
 Frame = +3

Query  57    GENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALP  236
             G + +    E L+A+A  WN I N+I+S +LKCA+QLGIPD IH+H KPM L  LI+ALP
Sbjct  8     GHDLQVGATEQLKAQAHIWNQIFNFINSMSLKCAIQLGIPDAIHSHGKPMTLSQLISALP  67

Query  237   IHPSK---APYIHRLTRFLVHSGLLS----VTNSGQ-EECYSLTPAGRLVVKDEPINLRA  392
             IH +K   +  I+RL R LV+S   S    V  + Q E+ Y LT + +L+V+D P +L  
Sbjct  68    IHQNKKLDSHLIYRLMRILVNSSFFSLQEVVGETDQLEDGYVLTNSSKLLVRDNPFSLTP  127

Query  393   FLHICNEYVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQ  572
              L    + +  K  +S+  W Q++DP+PF T HG + WDY   +P + +VFNE  A D++
Sbjct  128   ILLTVLDPIMTKPWHSISTWLQSDDPTPFATTHGMEFWDYTVRDPRFGNVFNEAMASDAR  187

Query  573   LLMIVLLSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAAS  752
             L++ VL   +   VF+G+ SLVD+AGG G V  AIA  FP ++CTV DLPHVIA +  ++
Sbjct  188   LVVSVLFD-KRISVFEGLESLVDLAGGTGTVGKAIADAFPHVECTVFDLPHVIADLQGST  246

Query  753   VENVEFVAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSR-EEGGKVIIID  929
               N++FV G+MF+ IP A+A+ +KWI+HDW DE+CVK+LK+CK AI  +  + GKVI++D
Sbjct  247   --NLKFVGGDMFDEIPPADAIFMKWILHDWSDEDCVKLLKRCKVAITCKGNKNGKVILVD  304

Query  930   MVIEDKK--------HDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKIT  1085
             MVI +K+        HD      ++  D+L+M  +  +ER + +W KL S+AGFS YKIT
Sbjct  305   MVIVEKQNNKDIGHDHDHQLYETQILFDMLMMVSFPGRERKETEWAKLFSDAGFSTYKIT  364

Query  1086  PALGLRSLIELFP  1124
             P LG+RSLIE+FP
Sbjct  365   PILGVRSLIEVFP  377



>sp|Q8GSN1.1|MOMT_CATRO RecName: Full=Myricetin O-methyltransferase; AltName: Full=CrOMT2; 
AltName: Full=Flavonoid O-methyltransferase [Catharanthus 
roseus]
 gb|AAM97497.1| flavonoid O-methyltransferase [Catharanthus roseus]
Length=348

 Score =   341 bits (875),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 170/349 (49%), Positives = 242/349 (69%), Gaps = 9/349 (3%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPYI  263
             E+  A+A  +  + ++   ++LKCAVQLGIPD IH+H KPM L DL  +LPI+PSKAPYI
Sbjct  7     EIRNAQAHFFTQVFSFTSMSSLKCAVQLGIPDAIHSHGKPMALSDLTNSLPINPSKAPYI  66

Query  264   HRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSCYSL  443
             +RL R LV +G  S     ++  YSLTP  RL++K++P+N  + +   N+    K+  ++
Sbjct  67    YRLMRILVAAGYFS---EEEKNVYSLTPFTRLLLKNDPLNSISMVLGVNQIAELKAWNAM  123

Query  444   GDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKRVFDG  623
              +WFQN D + F TAHG+  WD+   E  Y   F+ V A DS L+  +L+  E   +F+G
Sbjct  124   SEWFQNEDLTAFETAHGKNFWDF-GAEDKYGKNFDGVMAADSILVSKMLIP-EFNYLFEG  181

Query  624   VSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFENIPA  803
             + SLVDV GG G +A AIAK FP +KCTV DLPHV+A+++  S EN+EFV G+MFE IP+
Sbjct  182   LDSLVDVGGGTGTIAKAIAKSFPDLKCTVFDLPHVVANLE--STENLEFVGGDMFEKIPS  239

Query  804   ANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIED-KKHDPCYS-RAE  977
             ANA+LLKWI+HDW+DEECVK+LK C++AIP +E+GGKVI+I+ V+ D KKH+   + +A+
Sbjct  240   ANAILLKWILHDWKDEECVKVLKMCRKAIPEKEKGGKVILIETVLMDSKKHENEEAVKAQ  299

Query  978   LYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             +  D+ +M  + +KER +++W  L  EAGFS YKI P +  RS IE++P
Sbjct  300   ISSDIDMMVFFTAKERTEEEWATLFREAGFSGYKIFPMIDFRSPIEVYP  348



>ref|XP_011027757.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=359

 Score =   341 bits (875),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 170/357 (48%), Positives = 240/357 (67%), Gaps = 11/357 (3%)
 Frame = +3

Query  72    QSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSK  251
             Q   EL QA     + + NYI+S +L CA QLGIPDIIH+H +P+ L  L++AL I P+K
Sbjct  8     QKATELFQAHTHLHSQMFNYINSMSLMCAAQLGIPDIIHDHGRPITLPHLVSALHIAPNK  67

Query  252   APYIHRLTRFLVHSGLLSVTNS------GQEECYSLTPAGRLVVKDEPINLRAFLHICNE  413
                I+RL R LVHSG  + T +      G+EE Y LTP  +L+VKD    L  F+ + N 
Sbjct  68    TSIIYRLMRMLVHSGFFATTRAANGQGEGEEEAYVLTPPSQLLVKDNTNCLSPFMSLINP  127

Query  414   YVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLL  593
               F     SLGDWF+ N+P+ F  A+G   W+Y +  P  N +FNE  A DSQ++ +V+ 
Sbjct  128   -AFVTPWLSLGDWFRGNEPTAFEQAYGMAFWEYHNQNPELNRLFNEAMACDSQMMNLVI-  185

Query  594   SGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFV  773
               + K +F+G++S+VDV GG G+++  I++ FP M CTVL+LP VI +++    +N+ +V
Sbjct  186   -RDCKPIFEGLNSMVDVGGGTGSLSRIISEAFPHMNCTVLELPQVITNLEGT--KNLNYV  242

Query  774   AGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKH  953
              G+MF++IP+A+AVLLK I H W DE+C+KILKKCKEAI S+ +GGKVII+D+VI++KK 
Sbjct  243   GGDMFQHIPSADAVLLKLIFHGWSDEDCLKILKKCKEAISSKGKGGKVIIVDVVIDEKKD  302

Query  954   DPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             +   +  +L  D+L+M +   KER+ K+WEKL  EAGFS Y ITP  GLRSLIE++P
Sbjct  303   EKELTETKLLFDMLMMVVAAGKERSVKEWEKLFLEAGFSHYMITPLFGLRSLIEVYP  359



>gb|KDP35397.1| hypothetical protein JCGZ_10381 [Jatropha curcas]
Length=355

 Score =   341 bits (874),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 170/350 (49%), Positives = 237/350 (68%), Gaps = 8/350 (2%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPYI  263
             ELL+A+   WNH L +I S +LKCAV+LGIPDII+NH +PMPL DL++AL ++P+K  ++
Sbjct  11    ELLKAQTHMWNHTLQFIKSMSLKCAVELGIPDIINNHDQPMPLSDLVSALQVNPAKTHHV  70

Query  264   HRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSCYSL  443
             +RL RFLVHSG  S+    QEE Y LTP  R ++KD  +    F+ +  + +       L
Sbjct  71    YRLMRFLVHSGFFSL----QEEGYLLTPFSRFLLKDTSVGSIPFISLFLDPIMMDPFNCL  126

Query  444   GDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKRVFDG  623
               W +N+D +PF TA G+ +++Y  H+   N++ NEVTA DS  L  V  + + K VF G
Sbjct  127   SRWLKNDDQTPFVTAFGKSLYEYAGHDIRANNMVNEVTACDSIFLGQVT-TLKCKEVFKG  185

Query  624   VSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFENIPA  803
             ++SLVDVAGG G ++ +IA  FP++KCT+LDLPHV+A VD+   +N+ FVAG+MF+ +P 
Sbjct  186   LNSLVDVAGGTGNMSKSIANAFPSIKCTILDLPHVVAVVDSQGAKNLNFVAGDMFQAVPP  245

Query  804   ANAVLLKWIMHDWEDEECVKILKKCKEAIP---SREEGGKVIIIDMVIEDKKHDPCYSRA  974
             A+AVL+KW++ DW DE CVKILK CKEAI     +E   KVIIIDMV+ +K  D     A
Sbjct  246   ADAVLIKWVLCDWADEYCVKILKNCKEAITRNGKQENNNKVIIIDMVMGNKNSDDDCIEA  305

Query  975   ELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             EL+ D+  MA    K+RN+++W KL  +AGF  YKI   LG R+LIE++P
Sbjct  306   ELFFDMAEMAYLTGKQRNEEEWAKLFFDAGFIKYKINYVLGPRALIEVYP  355



>emb|CDP21661.1| unnamed protein product [Coffea canephora]
Length=364

 Score =   341 bits (874),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 171/356 (48%), Positives = 233/356 (65%), Gaps = 15/356 (4%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPYI  263
             EL QA+A  WNHI N+I+S +LKCA+QL IPD+IH H +PM L  LI ALPI   KAP++
Sbjct  13    ELFQAQAHIWNHIFNFINSMSLKCAIQLDIPDVIHKHGRPMTLDQLIDALPIKNEKAPFV  72

Query  264   HRLTRFLVHSGL-----LSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQK  428
             +RL + L+HSG      +    +  ++ Y LT A  L++K  P ++  FL    +     
Sbjct  73    YRLMQILIHSGFFIEAKIPGNENDNQKGYLLTSASELLLKSNPFSVTPFLLAMLDPALTD  132

Query  429   SCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESK  608
               + L  WFQN+  SPF T HG  ++D+ SHE   N  FNE  A D++++  V+ + + K
Sbjct  133   PWHHLSQWFQNSYESPFYTCHGRSLYDFASHESQLNQFFNEAMASDARMVSSVV-TKDCK  191

Query  609   RVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMF  788
              VF+ ++SLVDV GG G  A AIA  FP +KCTVLDLPHV+  ++  S +N+ +V GNMF
Sbjct  192   HVFESLNSLVDVGGGTGTFAKAIADAFPRLKCTVLDLPHVVDGLE--STKNLGYVGGNMF  249

Query  789   ENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIE-----DKKH  953
             E IP A+AVL+KWI+ DW D+ECV+ILKKCKEAIPS+E+GGKVII+D   +     D  H
Sbjct  250   EAIPPADAVLMKWILIDWSDDECVQILKKCKEAIPSKEKGGKVIIVDTFCKSLQKGDDDH  309

Query  954   DPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELF  1121
             +      +L+ D+  M L   ++RN+K W KL SEAGF DYKIT  LGLRS+IE++
Sbjct  310   EAI--ETQLFYDMGAMVLVKGRQRNEKDWAKLFSEAGFCDYKITAVLGLRSIIEVY  363



>ref|XP_011085377.1| PREDICTED: chavicol O-methyltransferase-like [Sesamum indicum]
Length=368

 Score =   341 bits (874),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 167/369 (45%), Positives = 247/369 (67%), Gaps = 9/369 (2%)
 Frame = +3

Query  30    KYSAQRKIMGENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMP  209
             +Y   R +  + G+ S  +LL  +A  WNH+ ++I+S +LKCA++LGIPDIIHNH KPM 
Sbjct  5     QYLILRDMAFQIGEMSAEQLLDGQAHVWNHLFSFINSMSLKCAIELGIPDIIHNHAKPMS  64

Query  210   LCDLIAALPIHPSKAPYIHRLTRFLVHSGL---LSVTNSGQEECYSLTPAGRLVVKDEPI  380
             L  L+ ALPI   K+ +++RL R L+HS     + V++  ++E Y LTPA  L++++ P+
Sbjct  65    LSQLVDALPIPKVKSHFVYRLMRLLIHSEFFVKVDVSDEEEKEHYWLTPASLLLLRNAPL  124

Query  381   NLRAFLHICNEYVFQKSCYSLGDWF-QNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVT  557
             ++   + +  +    +    L +W       SP+   HG+ +++++  +PG N+++N+ T
Sbjct  125   SVAPLVQLILDPNMTEPLDHLSEWLASQRHTSPYELVHGKVLFEHLGLQPGLNNLYNDAT  184

Query  558   AKDSQLLMIVLLSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIAS  737
             + DS+LL  VL+  + K++F+G+ SLVDV GG G  A AIA  FP MKC VLDLPHV+  
Sbjct  185   SSDSRLLTHVLVR-DCKQIFEGIKSLVDVGGGTGTTAKAIADAFPDMKCIVLDLPHVVGG  243

Query  738   VDAASVENVEFVAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKV  917
             ++  +  N  +VAG+MFENIP+A+AV LKWI+HDW DE+CVKILKKCKEAI    EGGKV
Sbjct  244   LEGTN--NFTYVAGDMFENIPSADAVFLKWILHDWNDEDCVKILKKCKEAIAV--EGGKV  299

Query  918   IIIDMVIEDKKHDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALG  1097
             IIIDMV++    D       L +D+ V+  Y  KER +K++ KL+ +AGF+ YKITPA G
Sbjct  300   IIIDMVLDVHGTDSGVRETHLLLDMAVLGYYNGKERTEKEFAKLLFDAGFTSYKITPAFG  359

Query  1098  LRSLIELFP  1124
             +RSLIE++P
Sbjct  360   MRSLIEIYP  368



>ref|XP_006452811.1| hypothetical protein CICLE_v10008718mg [Citrus clementina]
 gb|ESR66051.1| hypothetical protein CICLE_v10008718mg [Citrus clementina]
Length=365

 Score =   341 bits (874),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 175/363 (48%), Positives = 239/363 (66%), Gaps = 10/363 (3%)
 Frame = +3

Query  57    GENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALP  236
             G+N      ELLQ++A  WN+I ++++S +LKCA+QLGIPDIIHNH KPM L  L+  L 
Sbjct  6     GKNNDNISDELLQSQAHVWNNIFSFVNSMSLKCAIQLGIPDIIHNHAKPMTLNQLLTTLQ  65

Query  237   IHPSKAPYIHRLTRFLVHSGLLSVTNSG---QEECYSLTPAGRLVVKDEPINLRAFLHIC  407
             IHP+K   ++ L R LVHSG  ++  +    QEE Y LT A +L++KD P++L  FL   
Sbjct  66    IHPTKTQCVYHLMRILVHSGFFALQKTSENEQEEGYILTSASKLLLKDHPLSLAPFLLAM  125

Query  408   NEYVFQKSCYSLGDWFQNNDPSP----FCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQL  575
              + +  K  + +  W QN+D       F   HG   WDY   E   N  FNE  A D++L
Sbjct  126   LDPILTKPWHQVSTWIQNDDDDDAATTFALPHGMNFWDYAVRETRLNHFFNEGMASDTRL  185

Query  576   LMIVLLSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASV  755
                 L++ + K VF+G+++LVDV GG G +ASAIAK FP ++CTV D PHV+A  D  S 
Sbjct  186   TSSALIN-KCKDVFEGLNTLVDVGGGTGTLASAIAKKFPHIECTVFDQPHVVA--DLKSN  242

Query  756   ENVEFVAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMV  935
               +++V GNMFE IP A+AVL+K ++H+W DEECVKILK CK+AI    + GKVIIID+ 
Sbjct  243   GYLKYVGGNMFEAIPPADAVLIKCVLHNWNDEECVKILKNCKKAIAINGKAGKVIIIDIK  302

Query  936   IEDKKHDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIE  1115
             +E +K D   +  +L+MD+L+M L   +ERN+K+W KL  EAGFSDYKIT  LG+RSLIE
Sbjct  303   MESEKADYKTTETQLFMDMLMMVLVKGEERNEKEWAKLFFEAGFSDYKITDVLGVRSLIE  362

Query  1116  LFP  1124
             ++P
Sbjct  363   VYP  365



>ref|XP_004151735.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cucumis 
sativus]
Length=357

 Score =   340 bits (873),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 173/349 (50%), Positives = 234/349 (67%), Gaps = 8/349 (2%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNH-PKPMPLCDLIAALPIHPSKAPY  260
             ELL+A++  WNHI N+I+S +LKCA+QLGIPD IH+H P P+PL  L+++L +HP+K  +
Sbjct  15    ELLEAQSHVWNHIFNFINSMSLKCAIQLGIPDAIHSHGPNPVPLSILVSSLQLHPNKTQF  74

Query  261   IHRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSCYS  440
             I+RL R L HSG        QEE Y LT + RL++KD P  +  FL    +         
Sbjct  75    IYRLMRLLTHSGFFV----QQEEGYILTNSSRLLLKDNPCAVSPFLLSMLQPALTDPWQF  130

Query  441   LGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKRVFD  620
             L  WFQ +D +PF TAHG   W Y+ ++P   +VFN   A D++L++ VLL  + + VF+
Sbjct  131   LSIWFQTDDQTPFETAHGVPFWKYMRNKPKEGEVFNAGMASDARLVINVLLE-KHRSVFE  189

Query  621   GVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFENIP  800
             GV SLVDV GG G VA AI++ FP M+CTVLDLP V+A +      N ++V G+MF  IP
Sbjct  190   GVESLVDVGGGTGTVAKAISQAFPQMECTVLDLPQVVAHLKGDQ-PNFKYVEGDMFTLIP  248

Query  801   AANAVLLKWIMHDWEDEECVKILKKCKEAIP-SREEGGKVIIIDMVIEDKKHDPCYSRAE  977
              A+ +LLKWI+HDW DEECV+ILKKCKEAI  S  + GKV++ID+V+ + K+D      +
Sbjct  249   PADTILLKWILHDWSDEECVEILKKCKEAITGSGSKKGKVMVIDLVLFNTKNDADSIETQ  308

Query  978   LYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             L  D+L+M + G KER +K+W KLI EAGF  YKI P L LRSLIE++P
Sbjct  309   LLYDMLMMIVPGGKEREEKEWAKLIKEAGFRAYKIFPILDLRSLIEIYP  357



>ref|XP_004169298.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cucumis 
sativus]
 gb|KGN43482.1| hypothetical protein Csa_7G039790 [Cucumis sativus]
Length=357

 Score =   340 bits (873),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 173/349 (50%), Positives = 234/349 (67%), Gaps = 8/349 (2%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNH-PKPMPLCDLIAALPIHPSKAPY  260
             ELL+A++  WNHI N+I+S +LKCA+QLGIPD IH+H P P+PL  L+++L +HP+K  +
Sbjct  15    ELLEAQSHVWNHIFNFINSMSLKCAIQLGIPDAIHSHGPNPVPLSILVSSLQLHPNKTQF  74

Query  261   IHRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSCYS  440
             I+RL R L HSG        QEE Y LT + RL++KD P  +  FL    +         
Sbjct  75    IYRLMRLLTHSGFFV----QQEEGYILTNSSRLLLKDNPCAVSPFLLSMLQPALTDPWQF  130

Query  441   LGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKRVFD  620
             L  WFQ +D +PF TAHG   W Y+ ++P   +VFN   A D++L++ VLL  + + VF+
Sbjct  131   LSIWFQTDDQTPFETAHGVPFWKYMRNKPKEGEVFNAGMASDARLVINVLLE-KHRSVFE  189

Query  621   GVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFENIP  800
             GV SLVDV GG G VA AI++ FP M+CTVLDLP V+A +      N ++V G+MF  IP
Sbjct  190   GVESLVDVGGGTGTVAKAISQAFPQMECTVLDLPQVVAHLKGDQ-PNFKYVEGDMFTLIP  248

Query  801   AANAVLLKWIMHDWEDEECVKILKKCKEAIP-SREEGGKVIIIDMVIEDKKHDPCYSRAE  977
              A+ +LLKWI+HDW DEECV+ILKKCKEAI  S  + GKV++ID+V+ + K+D      +
Sbjct  249   PADTILLKWILHDWSDEECVEILKKCKEAITGSGSKKGKVMVIDLVLFNTKNDADSIETQ  308

Query  978   LYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             L  D+L+M + G KER +K+W KLI EAGF  YKI P L LRSLIE++P
Sbjct  309   LLYDMLMMIVPGGKEREEKEWAKLIKEAGFRAYKIFPILDLRSLIEIYP  357



>ref|XP_011100228.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=367

 Score =   340 bits (873),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 163/369 (44%), Positives = 241/369 (65%), Gaps = 16/369 (4%)
 Frame = +3

Query  54    MGENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAAL  233
             +  NG QS  ELL A++  WNH+ N+I+S +LKC +QLGIPDII  H KPM L +L  +L
Sbjct  3     LSSNGIQSTQELLDAQSHVWNHLFNFINSMSLKCVIQLGIPDIILKHGKPMTLSELTHSL  62

Query  234   PIHPSKAPYIHRLTRFLVHSGLL---SVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHI  404
              ++ +K+P + RL R ++HS       +++  + E Y LTPA  L+++DEP+++R F   
Sbjct  63    HLNEAKSPSLERLMRIMIHSKFFINVKISHVEETEGYWLTPASHLLLRDEPLSVRPFALS  122

Query  405   CNEYVFQKSCYSLGDWFQNN---------DPSPFCTAHGEKIWDYISHEPGYNDVFNEVT  557
               + +     + + +WF+ +         D +PF T HG  +W+Y   +P  N +FNE  
Sbjct  123   MLDPILTDPWHHVSEWFKTDVSEWFKTDGDLTPFLTTHGRTLWEYAGQDPRLNGLFNEGM  182

Query  558   AKDSQLLMIVLLSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIAS  737
             A DS+L+  V+ + + + VF+G+ S+VDV GG G VA A+A  F  + C VLDLPHV+A 
Sbjct  183   ASDSKLVATVI-TKDCRNVFEGLKSMVDVGGGTGTVAKAVADAFTGLNCVVLDLPHVVAG  241

Query  738   VDAASVENVEFVAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKV  917
              +  +  N+ FVAG+MFE IP A+AV +KWI+HDW DE+C+KIL+KCK+AI  +++ GKV
Sbjct  242   CEGTA--NLVFVAGDMFEYIPPADAVFMKWILHDWPDEKCLKILEKCKQAISDKDKEGKV  299

Query  918   IIIDMVIEDKKHDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALG  1097
             II+DMV++ +K        +L+ D+L+M L   ++R +K W +L S AGF+ YKITP LG
Sbjct  300   IIVDMVVDFQKEHKAI-ETQLFFDMLIMNLASGRQRTEKDWAELFSAAGFTSYKITPVLG  358

Query  1098  LRSLIELFP  1124
             LRSLIELFP
Sbjct  359   LRSLIELFP  367



>emb|CAN73270.1| hypothetical protein VITISV_021918 [Vitis vinifera]
Length=328

 Score =   338 bits (866),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 175/355 (49%), Positives = 236/355 (66%), Gaps = 37/355 (10%)
 Frame = +3

Query  72    QSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSK  251
             ++  ELL A A  WNHI N+I+S +LKCA++LGIPDIIHNH KPM L +L+A LP++P K
Sbjct  7     ETSTELLHAHAHVWNHIFNFINSMSLKCAIELGIPDIIHNHGKPMTLSELVAELPVNPEK  66

Query  252   APYIHRLTRFLVHSGLLS---VTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVF  422
                ++RL R LV SG  +   V  SGQEE Y LT A RL++KD+P++ R FL        
Sbjct  67    TKCVYRLMRLLVQSGFFTRKRVQESGQEEGYVLTHASRLLLKDDPLSARPFL--------  118

Query  423   QKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGE  602
                           DP           W Y+      N+ FNE  A D++L+  VL+  +
Sbjct  119   ----------LAMLDPVLITP------WQYL------NNFFNEAMASDARLVTSVLIK-D  155

Query  603   SKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGN  782
              K +F G++SLVDV GG G VA AIA  FP + CTVLDLPHV+A ++ +  +N+ ++AG+
Sbjct  156   CKGIFVGLNSLVDVGGGTGTVARAIANAFPHLNCTVLDLPHVVAGLEGS--KNLNYLAGD  213

Query  783   MFENIPAANAVLLK-WIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDP  959
             MFE IP A+A+LLK WI+HDW  +ECVKILK+C++AIPS+E+GGKVIIIDM++E++K D 
Sbjct  214   MFEAIPPADAILLKQWILHDWNHDECVKILKRCRDAIPSKEKGGKVIIIDMMMENQKADD  273

Query  960   CYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
                  +L+ D+L+M +   +ERN K WEKL  +AGFS YKITP LGLRSLIE++P
Sbjct  274   ESIETQLFWDMLMMIVLTGQERNIKDWEKLFFDAGFSGYKITPMLGLRSLIEVYP  328



>ref|XP_011091580.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=358

 Score =   338 bits (868),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 165/361 (46%), Positives = 248/361 (69%), Gaps = 7/361 (2%)
 Frame = +3

Query  54    MGENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAAL  233
             MG   ++   ELL+AEA+ WN + +YI+S +LKC  +LGIP II+ H +PM L +L+ AL
Sbjct  1     MGTIKQEPSSELLEAEARIWNQVFSYINSMSLKCVTELGIPGIINKHGRPMTLTELMEAL  60

Query  234   P-IHPSKAPYIHRLTRFLVHSG--LLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHI  404
             P +  +KA ++ RL R +VHSG  +L   +S  E+ Y LTPA RL+++D P++++AFL  
Sbjct  61    PGVDRAKADHVRRLMRTVVHSGFFVLEKVDSSDEQGYWLTPASRLLMEDHPMSMKAFLLS  120

Query  405   CNEYVFQKSCYSLGDWFQN-NDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLM  581
               + V  +    L  WF+N  D + F T HG  +W+     P +  +F++    D+ ++ 
Sbjct  121   QLDSVLCEPWQHLSGWFRNIEDRTAFHTTHGMSLWEQKEQNPRFGHLFDQGMGNDTPMVA  180

Query  582   IVLLSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVEN  761
              V+ + + ++VF+G+ SLVDV GG G +A AIA+ FP + CTVLDL  ++A ++     N
Sbjct  181   DVI-ARDCRQVFEGLGSLVDVGGGTGTLAKAIAEAFPEIHCTVLDLAPIVAGLEGT--RN  237

Query  762   VEFVAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIE  941
             +++V G+MFE IP A+AVLLKWI+HDW DEECV+ILK+CKEAI S E+GGKV+II+MV++
Sbjct  238   LKYVEGDMFEYIPPADAVLLKWILHDWSDEECVEILKRCKEAIKSNEKGGKVVIIEMVVD  297

Query  942   DKKHDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELF  1121
             D+  D      +L  D+L+M + G KERN+K+W KL S+AGF++YKI+P LG+RS+IE++
Sbjct  298   DQNSDHKSVETQLLFDMLMMTVVGGKERNQKEWAKLFSDAGFTNYKISPLLGIRSIIEVY  357

Query  1122  P  1124
             P
Sbjct  358   P  358



>ref|XP_002517832.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44350.1| o-methyltransferase, putative [Ricinus communis]
Length=362

 Score =   338 bits (868),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 164/350 (47%), Positives = 239/350 (68%), Gaps = 6/350 (2%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPYI  263
             EL++A+   WNH  ++I S +LKCAVQLGIPDII++H +PM L +L+  L +HP+K  ++
Sbjct  11    ELIKAQTHIWNHTFHFIKSMSLKCAVQLGIPDIINSHGQPMTLSELVLTLQVHPTKTDHL  70

Query  264   HRLTRFLVHSGLLSVTNSG---QEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSC  434
             +RL R LVHSG  ++ N+     +E Y LTPA RL++KD   + R F+ +  + V  +  
Sbjct  71    YRLMRVLVHSGFFNLQNASDNHSQEGYILTPASRLLLKDCSFDTRPFISLALDPVATEPY  130

Query  435   YSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKRV  614
               L  + +N+DP+ F TA GE ++ Y  +E   N +FNE  A DS ++   ++  + K+V
Sbjct  131   NYLIPFLRNDDPTAFVTAFGETLFGYAGNEARINHLFNECMASDSSVIGRAVII-KCKKV  189

Query  615   FDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFEN  794
             F+GV+SLVDV GG G +A AI + FP +KCTVLDLPHV+  +  ++  N+ F+ G+MF+ 
Sbjct  190   FEGVNSLVDVGGGTGNMAKAIGQTFPNLKCTVLDLPHVVDKLQGSN--NLSFLGGDMFQA  247

Query  795   IPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYSRA  974
             +P A+A+LLKWI+HDW DEEC+KILK CKEA+  +  GGKV+IIDMV+ ++  D     A
Sbjct  248   VPPADAILLKWILHDWPDEECIKILKNCKEAVSEKGTGGKVMIIDMVMGNQSWDDSLMEA  307

Query  975   ELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             +L  D+ +MAL   KERN+++W+KL  +AGFS+YKI P LG R+LIE  P
Sbjct  308   QLCFDMQMMALLMGKERNEEEWKKLFFDAGFSNYKIYPVLGPRALIEFLP  357



>gb|AAR02421.1| putative O-methyltransferase [Catharanthus roseus]
 gb|AAR02422.1| putative O-methyltransferase [Catharanthus roseus]
Length=354

 Score =   338 bits (867),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 163/351 (46%), Positives = 235/351 (67%), Gaps = 7/351 (2%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPYI  263
             E  +A+   W+   ++I  A+LKCA+QLGI D I NH KPM L DL   L I+PSK+ Y+
Sbjct  7     EFRKAQVHIWSQSFSFITCASLKCALQLGIADAIENHGKPMALSDLTNTLQINPSKSQYL  66

Query  264   HRLTRFLVHSGLLSVTN----SGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKS  431
              RL R LV+SG  S        G E  Y LTP+ RL++K+EP+NLR  +    + +  K+
Sbjct  67    PRLMRLLVNSGFFSEQQLGDAGGGENVYGLTPSMRLLLKNEPLNLRGIVLPMLDPLQIKA  126

Query  432   CYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKR  611
               SLG+WF+N D + F TAHG+  WD ++ +P   ++F E  A DS LL+   +  E K 
Sbjct  127   WNSLGNWFKNEDGTAFETAHGKSYWDCVTEDPKDVEIFTETMASDS-LLVAKFVITEHKS  185

Query  612   VFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFE  791
             +F+G+ S++DV G  G  A AIA+ FP++KCTVLDLP  +A+++  +  N+EFV GNMFE
Sbjct  186   LFEGLDSIIDVGGSTGTFARAIAESFPSLKCTVLDLPETVANIEPTN--NLEFVGGNMFE  243

Query  792   NIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYSR  971
              IP A+ V LK ++HDW DE+CVKILK C++AIP +E+GGKVI+I+ V++ + HD    +
Sbjct  244   KIPPAHVVFLKMVLHDWNDEDCVKILKNCRKAIPEKEKGGKVILIETVVQGQMHDSESVK  303

Query  972   AELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
              ++ MD+ ++  +G+KER +K+WE L  EAGFS YKI P + +RSLIE++P
Sbjct  304   TQIAMDMDMLVSFGTKERTEKEWEILFKEAGFSSYKIFPIVDIRSLIEVYP  354



>ref|XP_002278208.2| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=369

 Score =   338 bits (866),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 175/351 (50%), Positives = 242/351 (69%), Gaps = 7/351 (2%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPYI  263
             EL QA++  + HI ++++S  L+CAVQLGIPDIIHNH  P  L  L++AL I P+KA  +
Sbjct  22    ELFQAQSHMYKHICSFMNSMALRCAVQLGIPDIIHNHAHPTTLPQLVSALHIPPTKASCV  81

Query  264   HRLTRFLVHSGLLS---VTNSGQEECYSLTPAGRLVVKDEPI-NLRAFLHICNEYVFQKS  431
             HRL R LVHSG  +   V    +EE Y LTP+ RL++KD P  NL   +      V    
Sbjct  82    HRLMRLLVHSGFFAMAKVHEHEEEEGYILTPSSRLLLKDNPTSNLSPLVLTMLHPVLVTP  141

Query  432   CYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKR  611
              +  GDW + +D + F TAHG   WD+ SH P   ++FNE  A DSQ++ +V    E K 
Sbjct  142   WHFFGDWLRGDDLTAFETAHGVSFWDHGSHNPEIFNLFNEGMASDSQMMSVVNFR-ELKP  200

Query  612   VFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFE  791
             VF+G+SSLVD+ GG G +A  I++ FP +KCTV DLPHV+A++  +   N+E+V G+MF+
Sbjct  201   VFEGLSSLVDLGGGTGLLARIISEAFPQLKCTVFDLPHVVANLPES--RNLEYVGGDMFQ  258

Query  792   NIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYSR  971
             ++P+A+A+LLK ++HDW DE+C+KILKKC+EAI S EEGGKVIIID+VI +KK +   + 
Sbjct  259   SVPSADAILLKCVLHDWSDEDCLKILKKCREAIRSEEEGGKVIIIDVVINEKKDEDDITE  318

Query  972   AELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
              +L MD+++M L   +ERN+K+WEKL  EAGF  +KI+P  GLRSLIE+FP
Sbjct  319   TKLLMDMMMMTLVNGRERNEKEWEKLFLEAGFRHHKISPIFGLRSLIEVFP  369



>ref|XP_008783119.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008783121.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X2 [Phoenix dactylifera]
 ref|XP_008783122.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X3 [Phoenix dactylifera]
Length=366

 Score =   337 bits (865),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 166/356 (47%), Positives = 230/356 (65%), Gaps = 5/356 (1%)
 Frame = +3

Query  69    KQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPS  248
             KQ   E LQ  AQ WNH L+++ S +LKCA++LGIPD++HNH KP+ L +L  +L I PS
Sbjct  10    KQLAREQLQDTAQLWNHALSFLRSMSLKCAIELGIPDVLHNHGKPITLSELATSLSIPPS  69

Query  249   KAPYIHRLTRFLVHSGLLSV---TNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYV  419
             KAP +  L R LVHSGL +       G+EE Y LTPA +L+VK++   L  F  +   + 
Sbjct  70    KAPALGSLMRLLVHSGLFASHRDQEGGEEESYFLTPASKLLVKEKKACLSPFALMILNWT  129

Query  420   FQKSCYSLGDWFQNN--DPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLL  593
                  + LG WF+      +PF  AHG+  ++  +    +N++FNE  A D++L+  V +
Sbjct  130   LLAPAHQLGAWFRAGAARATPFDMAHGKGFFEETNARADFNELFNEGMASDARLVTEVAV  189

Query  594   SGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFV  773
                   V  GV S+VDV GG G +A AIAK FP ++C VLDLPHV+A+VD    E VEF+
Sbjct  190   GRRQWEVLHGVRSVVDVGGGTGTLAKAIAKAFPGVRCAVLDLPHVVATVDEEEREGVEFI  249

Query  774   AGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKH  953
              G+MFE+IP A+AVL KWI+HDW D +C++IL +CKEAIP +++GGKVIIIDMV+     
Sbjct  250   GGDMFEHIPPADAVLFKWILHDWSDGDCIRILNRCKEAIPPKKDGGKVIIIDMVVGVTTD  309

Query  954   DPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELF  1121
                    +L  D+ +M L   KER++ +W +L   AGFSDYKIT ++GLRS+IEL+
Sbjct  310   VSISVEPQLLFDMEMMILCTGKERSETEWSRLFHAAGFSDYKITASMGLRSVIELY  365



>ref|XP_010320677.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X3 [Solanum lycopersicum]
Length=336

 Score =   336 bits (862),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 174/349 (50%), Positives = 236/349 (68%), Gaps = 26/349 (7%)
 Frame = +3

Query  87    LLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPI-HPSKAPYI  263
             LL A+AQ WN+I N+I S+ ++CA QLGIPD+++ H KPM L D+ A L + + SK  ++
Sbjct  11    LLHAQAQIWNYIFNFISSSAVRCAFQLGIPDVLYKHDKPMCLSDISAELSVVNSSKVSFL  70

Query  264   HRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSCYSL  443
               L +FLV SG L+      E+ YSLTPA  L+ KD+P N+R+ L + +   F K+   L
Sbjct  71    PILMQFLVQSGFLN----QHEDHYSLTPASCLLAKDDPFNVRSLLLLNHGQAFSKAWPEL  126

Query  444   GDWFQNNDPSPFCTAHGEKIWDYISHEPG--YNDVFNEVTAKDSQLLMIVLLSGESKRVF  617
              DWFQN+ P+PF TAHG+ +WD+I  E      D+FN+  A DS+L   VL++ E K VF
Sbjct  127   SDWFQNDSPTPFHTAHGKSLWDFIGEEQPSVLGDIFNDALASDSRLNTNVLIA-ECKHVF  185

Query  618   DGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFENI  797
             +G++SLVDV GG G V+ AIAK FP +KCTVLDLP V+  +  +   N++FV G+MF+ I
Sbjct  186   EGLTSLVDVGGGTGTVSIAIAKAFPNIKCTVLDLPQVVGDLKGSG--NLDFVGGDMFDMI  243

Query  798   PAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYSRAE  977
             P  NA+LLK                KCKE+IPSRE+GGKVIIID V+ED K    + RA+
Sbjct  244   PHTNAILLK----------------KCKESIPSREKGGKVIIIDTVLEDPKQSNEFVRAQ  287

Query  978   LYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
               M +L+M L+ +KER +K+WEKL SEAGF++YKI PALGLRSLIE++P
Sbjct  288   HNMGMLMMVLFAAKERTEKEWEKLFSEAGFTEYKIFPALGLRSLIEIYP  336



>ref|XP_010097399.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXB67905.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=384

 Score =   338 bits (866),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 172/379 (45%), Positives = 248/379 (65%), Gaps = 26/379 (7%)
 Frame = +3

Query  57    GENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALP  236
             G + +    EL++A+A  WN+I N+I+S +LKCAVQLGIPD IH+H KPM L  LI+ALP
Sbjct  9     GHDLEIHSTELVKAQAHIWNYIFNFINSMSLKCAVQLGIPDAIHSHGKPMTLSQLISALP  68

Query  237   IHPSK---APYIHRLTRFLVHSGLLSVTN--SGQ----EECYSLTPAGRLVVKDEPINLR  389
             IH +K   +  I+RL R LV+SG   +     G+    EE Y LT A +L+++D P+++ 
Sbjct  69    IHQNKKSDSRLIYRLMRILVNSGFFVLQEVVVGETDLLEEGYVLTTASKLLLRDNPLSVT  128

Query  390   AFLHICNEYVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDS  569
               L    + +  K  +SL  W Q++DP+PF   HG  IWDY  ++P   ++FNE  A D+
Sbjct  129   PLLLSMLDPIMTKPWHSLSTWLQSDDPTPFAATHGMGIWDYNEYDPRLGNLFNEAMASDA  188

Query  570   QLLMIVLLSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAA  749
             +L+  VL+  + K V +G+ SLVD+AGG G VA AIA  FP + CTV DLPHVIA  D  
Sbjct  189   RLVTSVLID-KCKSVLEGLESLVDLAGGTGTVAKAIAYAFPHLACTVFDLPHVIA--DLQ  245

Query  750   SVENVEFVAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSR-EEGGKVIII  926
               +N++FV G+MF+ IP A+A+ +KWI+HDW DE+CVK+L++CK AI  +  + GKVI++
Sbjct  246   GSKNLKFVGGDMFDEIPPADAIFMKWILHDWSDEDCVKLLERCKVAITCKGNKNGKVILV  305

Query  927   DMVIEDKKHDPCYS-------------RAELYMDLLVMALYGSKERNKKQWEKLISEAGF  1067
             DMVI +++++                   +L+ D+L+M LY  +ER + +W KL S+AGF
Sbjct  306   DMVIVEEQNNKDIGHDHHAHDHDHQSYETQLFFDMLMMVLYPGRERKETEWAKLFSDAGF  365

Query  1068  SDYKITPALGLRSLIELFP  1124
             + YKITP LG+RSLIE+FP
Sbjct  366   NTYKITPILGVRSLIEVFP  384



>ref|XP_003527405.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
1 [Glycine max]
 gb|KHN07776.1| 8-hydroxyquercetin 8-O-methyltransferase [Glycine soja]
Length=359

 Score =   337 bits (863),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 169/363 (47%), Positives = 238/363 (66%), Gaps = 10/363 (3%)
 Frame = +3

Query  54    MGENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAAL  233
             M  + +  + +LL+A+   ++    +I+S +LKCA+ L IPD+IH + +PMPL  LIA+L
Sbjct  1     MEFDNEDHYAKLLRAQTHIFDQTFGFINSMSLKCAIDLCIPDVIHKYGQPMPLSQLIASL  60

Query  234   PIHPSKAPYIHRLTRFLVHSGLLSVTNSG-----QEEC-YSLTPAGRLVVKDEPINLRAF  395
             PIHPSKA +I RL + L HSG  S  N+      QEE  Y LT A +L++KD   ++ + 
Sbjct  61    PIHPSKACFIFRLMQILTHSGFFSQHNNATENYEQEEVSYVLTDASKLLLKDHHFSMISL  120

Query  396   LHICNEYVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQL  575
               +  + +     +    WF N DP+PF T +G   WDY S EP  N +FN+    DS+L
Sbjct  121   PQVILDPILVNPWFQFSTWFTNEDPTPFHTQNGMAFWDYASSEPKLNHLFNDAMTNDSRL  180

Query  576   LMIVLLSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASV  755
             +  VL+  + K VF G+ SLVDV GG G +A AIAK FP +KC V DLPHV+  +     
Sbjct  181   ISSVLIE-KCKGVFSGLESLVDVGGGTGTMAKAIAKSFPQLKCIVFDLPHVVDGLQGT--  237

Query  756   ENVEFVAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMV  935
             ENVE+V G+MFE IP+A++++LK IMH+W DEEC+KILK+CKEAI ++++ GKVIIID+V
Sbjct  238   ENVEYVHGDMFEAIPSADSIMLKTIMHNWNDEECLKILKRCKEAIANKDK-GKVIIIDVV  296

Query  936   IEDKKHDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIE  1115
             I ++K D    + +L+ D+ +M L   KERN+K W KL   AGF+ YKITP LG +SLIE
Sbjct  297   IGNEKGDSELDQTKLFYDIEMMVLVTGKERNEKDWAKLFLSAGFNSYKITPVLGFKSLIE  356

Query  1116  LFP  1124
             ++P
Sbjct  357   VYP  359



>gb|KGN43480.1| hypothetical protein Csa_7G039280 [Cucumis sativus]
Length=380

 Score =   337 bits (865),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 170/349 (49%), Positives = 231/349 (66%), Gaps = 10/349 (3%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNH-PKPMPLCDLIAALPIHPSKAPY  260
             ELL+A++  WNHI N+I+S +LKCA+QLGIPD IH+H P P+PL  L+++L +HP+K  +
Sbjct  40    ELLEAQSHIWNHIFNFINSMSLKCAIQLGIPDAIHSHGPNPVPLSILVSSLQLHPNKTQF  99

Query  261   IHRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSCYS  440
             I+RL R L HSG        QEE Y LT + RL++KD P  +  FL    +         
Sbjct  100   IYRLMRLLTHSGFFV----QQEEGYILTNSSRLLLKDNPCAVSPFLLSMLQPALTDPWQF  155

Query  441   LGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKRVFD  620
             L  WFQ +D +PF TAHG   W Y+ ++P   +VFN   A D++L+  VLL G+ K VF+
Sbjct  156   LSIWFQTDDQTPFETAHGVPFWKYMRNKPKEGEVFNAGMASDARLVNSVLL-GKHKSVFE  214

Query  621   GVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFENIP  800
             GV SLVDV GG G +A AI++ FP M+CTV DLP V+A +      N+ +V G+MF+ IP
Sbjct  215   GVKSLVDVGGGTGTMAKAISQAFPQMECTVFDLPQVVAHLRGDQ-PNLNYVEGDMFKRIP  273

Query  801   AANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVI-EDKKHDPCYSRAE  977
              A+ +LLKWI+HDW DEECV+ILK CK AI S    GKV++ID+V+  + K D      +
Sbjct  274   PADVLLLKWILHDWSDEECVEILKNCKAAIRSNGNKGKVMVIDIVLFGNYKKDSM--ETQ  331

Query  978   LYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             L  D+L+M L G KER +K+W KLI EAGF  YKI P +G+RSL+E++P
Sbjct  332   LLFDMLMMTLVGGKEREEKEWAKLIKEAGFGSYKIFPIMGVRSLVEIYP  380



>ref|XP_006446725.1| hypothetical protein CICLE_v10015630mg [Citrus clementina]
 gb|ESR59965.1| hypothetical protein CICLE_v10015630mg [Citrus clementina]
Length=377

 Score =   337 bits (864),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 175/359 (49%), Positives = 237/359 (66%), Gaps = 13/359 (4%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPYI  263
             ELL+A+AQ WN   +YI+S +LKCAV+LGIPD+IH H +PM L  + +AL I  +KA  I
Sbjct  20    ELLKAQAQVWNCAFSYINSMSLKCAVELGIPDVIHKHGQPMTLSQIASALDIQKNKAHCI  79

Query  264   HRLTRFLVHSGLLSVTN----SGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKS  431
              RL R LVHSG  +  N       E  YSLTPA RL++KDEP+    F+ +    +    
Sbjct  80    QRLMRILVHSGFFAQQNKIDKDESEVYYSLTPASRLLLKDEPLRAAPFMFLITHPIITTP  139

Query  432   CYSLGDWFQNNDPSP---FCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGE  602
                L  WF+N+DPS    F + HG+ IW  ++ E  + +VF +    DSQ +  VL+  +
Sbjct  140   FNFLSSWFKNDDPSTPTVFESTHGKDIWGCLAQEAKFKNVFYDAMMTDSQFISSVLIK-D  198

Query  603   SKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIAS---VDAASVENVEFV  773
              K VF G+  LVD+ GG G +A AIA+ FP MKC V DLPHV+ +       + +N+EF+
Sbjct  199   CKVVFKGLKCLVDLGGGTGTMAKAIAEAFPEMKCIVFDLPHVVDNNLQQQQGTNKNLEFL  258

Query  774   AGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIP-SREEGGKVIIIDMVIEDKK  950
              G+MFE IP A+AVLLKW++H+W DEE VKILKKCKEAI  S+++GGKVI+IDMVIED+ 
Sbjct  259   GGDMFEAIPPADAVLLKWVLHNWGDEESVKILKKCKEAIDGSKDKGGKVIVIDMVIEDQS  318

Query  951   HDPCYSRAELYMDLLVMALYG-SKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
              D   +  +L  D+L+M+L+  +KER+ K+W+KL  EAGFS Y +   LGLRSLIEL+P
Sbjct  319   IDKDSTETQLCSDMLMMSLFSVAKERSIKEWKKLFLEAGFSHYNVNSTLGLRSLIELYP  377



>ref|XP_011037440.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
 ref|XP_011037441.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=355

 Score =   335 bits (860),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 172/349 (49%), Positives = 233/349 (67%), Gaps = 6/349 (2%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPYI  263
             ELLQA+   WNHI N+I+S TLKCAVQLGIPD+I  H KPM L +L++ALPIHPSKA Y+
Sbjct  11    ELLQAQTHVWNHIFNFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSKAQYV  70

Query  264   HRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSCYSL  443
             HRL R LVH+G  S  N  Q E YSLT + RL++KD P+++R  L +  + V  K    L
Sbjct  71    HRLMRILVHAGFFSQQNLNQ-EAYSLTQSTRLLLKDNPLSMRPLLLMLLDPVLTKPHDCL  129

Query  444   GDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKRVFDG  623
               WFQN++ + F  AH   +W+Y   +P  +++FNE  A DS +L   L+  + + +F+G
Sbjct  130   STWFQNDEATAFSVAHERTLWEYAGQDPRLSNLFNEAMASDS-ILASKLVVSKCQGIFEG  188

Query  624   VSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFENIPA  803
             V+SLVDV GG G +A  IA+ FP M CTV DLP V++ + A S +N+++V G+MFE +P 
Sbjct  189   VNSLVDVGGGSGTMAKGIAEAFPHMDCTVFDLPRVVSDLQAGS-KNLKYVGGDMFEAVPP  247

Query  804   ANAVLLKWIMHDWEDEECVKILKKCKEAIPSR--EEGGKVIIIDMVIEDKKHDPCYSRAE  977
             A+ +LLKW +HDW DE+CVKILK+CK AI S+  ++ GKVIIID+V   +  D   +  +
Sbjct  248   ADVILLKWTLHDWNDEDCVKILKQCKHAIMSKGQQKAGKVIIIDIVRGSQNGDES-NETQ  306

Query  978   LYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             L  DL +M      ERN+ +W KL  +AGF  YKI   LG R+LIEL P
Sbjct  307   LLWDLEMMVTVTGLERNEMEWAKLFFDAGFVSYKIHNVLGTRALIELHP  355



>emb|CBI22005.3| unnamed protein product [Vitis vinifera]
Length=309

 Score =   334 bits (856),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 169/329 (51%), Positives = 223/329 (68%), Gaps = 23/329 (7%)
 Frame = +3

Query  144   TLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPYIHRLTRFLVHSGLLSV--TNS  317
             +LKCA+QLGIPDIIHNH KPM L +L+A LP+HP ++  ++RL R LVHSG L+      
Sbjct  2     SLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCVYRLMRILVHSGFLAAQRVQQ  61

Query  318   GQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSCYSLGDWFQNNDPSPFCTAHGE  497
             G+EE       G LV+        A L    + +  K  + L  WFQN+DP+PF TA+  
Sbjct  62    GKEE------EGPLVL--------AML----DPILTKPWHYLSAWFQNDDPTPFHTAYER  103

Query  498   KIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKRVFDGVSSLVDVAGGKGAVASAI  677
               WDY  HEP  N+ FNE  A D++LL  VLL  E + VF G++SLVDV GG G VA AI
Sbjct  104   SFWDYAGHEPQLNNSFNEAMASDARLLTSVLLK-EGQGVFAGLNSLVDVGGGTGKVAKAI  162

Query  678   AKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFENIPAANAVLLKWIMHDWEDEEC  857
             A  FP + CTVLDL HV+A +  +  +N+ + AG+MFE IP A+A+LLKWI+HDW +EEC
Sbjct  163   ANAFPHLNCTVLDLSHVVAGLQGS--KNLNYFAGDMFEAIPPADAILLKWILHDWSNEEC  220

Query  858   VKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDPCYSRAELYMDLLVMALYGSKERNKKQ  1037
             VKILK+C+EAIPS+E GGKVIIIDM++   + D   +  +L+ D+ +M     +ER++ +
Sbjct  221   VKILKRCREAIPSKENGGKVIIIDMIMMKNQGDYKSTETQLFFDMTMMIFAPGRERDENE  280

Query  1038  WEKLISEAGFSDYKITPALGLRSLIELFP  1124
             WEKL  +AGFS YKITP LGLRSLIE++P
Sbjct  281   WEKLFLDAGFSHYKITPILGLRSLIEVYP  309



>ref|XP_006469063.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X1 [Citrus sinensis]
 ref|XP_006469064.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X2 [Citrus sinensis]
Length=378

 Score =   336 bits (861),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 176/359 (49%), Positives = 235/359 (65%), Gaps = 13/359 (4%)
 Frame = +3

Query  84    ELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPYI  263
             ELL+A+AQ WN   NYI+S +LKCAV+LGIPD+IH H +PM L  + +AL I  +KA  I
Sbjct  21    ELLKAQAQVWNCAFNYINSMSLKCAVELGIPDVIHKHGQPMTLSQIASALDIQKNKAHCI  80

Query  264   HRLTRFLVHSGLLSVTN----SGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKS  431
              RL R LVHSG  +  N       E  YSLT A RL++KDEP     F+ +         
Sbjct  81    QRLMRILVHSGFFAQQNKIDKDESEVYYSLTLASRLLLKDEPSRAAPFMFLITHPTITTP  140

Query  432   CYSLGDWFQNNDPSP---FCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGE  602
                L  WF+N+DPS    F + HG+ IW  ++ E  + +VF +    DSQ +  VL+  +
Sbjct  141   FNFLSSWFKNDDPSTPTVFESTHGKDIWGCLAQEAKFKNVFYDAMMADSQFISSVLIK-D  199

Query  603   SKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIAS---VDAASVENVEFV  773
              K VF G+  LVD+ GG G +A AIA+ FP MKC V DLPHV+ +       + +N+EF+
Sbjct  200   CKEVFKGLKCLVDLGGGTGTMAKAIAEAFPEMKCIVFDLPHVVDNNLQQQQGTNKNLEFL  259

Query  774   AGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIP-SREEGGKVIIIDMVIEDKK  950
              G+MFE IP A+AVLLKW++H+W DEE VKILKKCKEAI  S+++GGKVI+IDMVIED+ 
Sbjct  260   GGDMFEAIPPADAVLLKWVLHNWGDEESVKILKKCKEAIDGSKDKGGKVIVIDMVIEDQS  319

Query  951   HDPCYSRAELYMDLLVMALYG-SKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
              D   +  +L  D+L+M+L+  +KER+ K+W+KL SEAGFS Y +   LGLRSLIEL+P
Sbjct  320   IDKDSTETQLCCDMLMMSLFSVAKERSIKEWKKLFSEAGFSHYNVNSTLGLRSLIELYP  378



>ref|XP_011100227.1| PREDICTED: 8-hydroxyquercetin 8-O-methyltransferase-like [Sesamum 
indicum]
Length=359

 Score =   335 bits (859),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 160/358 (45%), Positives = 238/358 (66%), Gaps = 8/358 (2%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG QS  ELL A++  WNH+ N+I+S +LKC +QLGIPDII  H KPM L +L  +L ++
Sbjct  6     NGIQSTQELLDAQSHVWNHLFNFINSMSLKCVIQLGIPDIILKHGKPMTLSELTHSLHLN  65

Query  243   PSKAPYIHRLTRFLVHSGLL---SVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNE  413
              +K+P + RL R ++HS       ++   + + Y LTPA  L+++DEP ++R F  +  +
Sbjct  66    DAKSPSLERLMRIMIHSKFFINVKISQVEETDGYWLTPASHLLLRDEPSSMRPFALVLLD  125

Query  414   YVFQKSCYSLGDWFQNN-DPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVL  590
              +     + +  WF+++ D +PF T HG   W+Y + +P  N  FNE  A D+ L+  V+
Sbjct  126   PILIDPWHHVSKWFKSDHDLTPFLTTHGRTFWEYAAQDPRLNCFFNEAMACDTVLVASVI  185

Query  591   LSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEF  770
              +G+ + VF+G+ S+VDV GG G VA A+A  F  + C VLDLPHV+A  +    EN+ F
Sbjct  186   -TGDCRNVFEGLKSMVDVGGGTGTVAKAVADAFTGLNCVVLDLPHVVAGCEGT--ENLVF  242

Query  771   VAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKK  950
             VAG+MFE IP+A+AV +KWI+HDW DE+C+KIL+KCK+A+  +++ GKVII+D+V++ +K
Sbjct  243   VAGDMFEYIPSADAVFMKWILHDWPDEKCLKILEKCKQAVSDKDKKGKVIIVDIVVDFQK  302

Query  951   HDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
                     +L+ D+L+M +   +ER +K W +L   AGF+ YKITP LGLRSLIELFP
Sbjct  303   EHKAI-ETQLFFDMLMMNVASGRERTEKDWAELFFAAGFTSYKITPVLGLRSLIELFP  359



>gb|KDP24062.1| hypothetical protein JCGZ_25719 [Jatropha curcas]
Length=358

 Score =   335 bits (858),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 174/359 (48%), Positives = 237/359 (66%), Gaps = 10/359 (3%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             NG+ ++ ELL+A A  WNH  N++ S +LKCA++LGIPDIIH+H +PM L DL++AL I 
Sbjct  5     NGESTN-ELLRAHAHIWNHTFNFVKSMSLKCAIELGIPDIIHSHGQPMTLSDLVSALKIP  63

Query  243   PSKAPYIHRLTRFLVHSGLLSVTNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYVF  422
              SK+ +IHRL + LV SG  S+     E  Y LT +  L+VK+ P+  R ++    + + 
Sbjct  64    QSKSHHIHRLMQVLVQSGFFSLQKVSDENGYLLTQSSLLLVKEHPVTARPYVLAVLDPIL  123

Query  423   QKSCYSLGDWFQNND---PSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLL  593
              K  + L  WFQN D    +PF  AH +K WD  S+E  +N  FNE  A DS ++  V++
Sbjct  124   TKPWHFLSSWFQNTDDKETTPFSVAHEQKFWDLASNEDRFNKFFNEAMASDSSIVKQVVI  183

Query  594   SGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFV  773
             S   K VF G+ SLVDV G  GA+  AIA+ FP +KCTVLDLPHV+A +     +N+ ++
Sbjct  184   SN-CKEVFKGLKSLVDVGGNTGAMTKAIAETFPNLKCTVLDLPHVVAGLKGT--KNLNYI  240

Query  774   AGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEG-GKVIIIDMVIEDKK  950
              GNMFE IP A+A+LLK I H  +DE+C+K+LKKCKEA+ + EEG GKVIIID+V+E   
Sbjct  241   GGNMFEFIPPADAILLKMICHILDDEDCLKLLKKCKEAVMNNEEGSGKVIIIDIVMESPN  300

Query  951   H-DPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
               D      +LY DL ++ L   +ERN+K W KL  +AGFS+YKI P LGLRS+IE+FP
Sbjct  301   WVDKATETIQLY-DLEMLVLVSGQERNEKDWAKLFFDAGFSNYKINPVLGLRSIIEVFP  358



>ref|XP_010260367.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nelumbo 
nucifera]
Length=366

 Score =   335 bits (858),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 174/355 (49%), Positives = 243/355 (68%), Gaps = 12/355 (3%)
 Frame = +3

Query  87    LLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPYIH  266
             L+QA+A  WNHI N+++S +LKCAVQLGIPD++H+H KPM L +L+ AL +  S+   +H
Sbjct  15    LVQAQAHIWNHIFNFLNSMSLKCAVQLGIPDVLHSHGKPMLLSELVLALGVPQSRTACLH  74

Query  267   RLTRFLVHSGLLSVTNSGQE--------ECYSLTPAGRLVVKDEPINLRAFLHICNEYVF  422
             RL R LVHSG  S+    ++        + Y LTP+ RL++KD P+N+  FL    + V 
Sbjct  75    RLMRMLVHSGFFSMHRVYKDPEEEEEEEKGYVLTPSSRLLLKDNPLNVSQFLIAMLDPVL  134

Query  423   QKSCYSLGDWFQNND-PSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSG  599
                 + L  WFQ N   +PF   +G   W+Y +H+P YN++FN   A D++L+M V+L  
Sbjct  135   VTPWHFLSAWFQGNGLATPFEATNGRAFWNYGAHDPEYNNLFNVAMANDARLVMSVVLR-  193

Query  600   ESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAG  779
             E +  F G+ SLVDV GG GA A AIA  FP +KC V DLPHV+ ++  +  +N+++V G
Sbjct  194   ECEATFQGLGSLVDVGGGTGAAAMAIADKFPQLKCIVFDLPHVVGNLVGS--KNLDYVGG  251

Query  780   NMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKHDP  959
             +MF+ IP A+AVLLKWI+HDW DEECVKILK+C+EAIP  ++GG+VIIIDMVI D K + 
Sbjct  252   DMFDFIPHADAVLLKWILHDWSDEECVKILKRCREAIPCTDKGGRVIIIDMVIGDNKMEN  311

Query  960   CYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
               +  +L  D+L+M L   +ER+K++ EKL+ EAGF+ YKI P LGLRSLIE++P
Sbjct  312   ELTETQLLFDMLMMGLVTGRERSKQELEKLLLEAGFTHYKIIPILGLRSLIEVYP  366



>ref|XP_010110665.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXC27580.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=384

 Score =   335 bits (859),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 166/379 (44%), Positives = 250/379 (66%), Gaps = 26/379 (7%)
 Frame = +3

Query  57    GENGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALP  236
             G + + +  EL++++A  WN I N+I+S +LKCA+QLGIPD I++H KPM L  LI++LP
Sbjct  9     GHDLEINATELVKSQAHIWNQIFNFINSMSLKCAIQLGIPDAIYSHGKPMILSQLISSLP  68

Query  237   IHPSKAP---YIHRLTRFLVHSGLLSVT------NSGQEECYSLTPAGRLVVKDEPINLR  389
             IH +K P    I+RL R LV+SG  ++        +  EE Y LT A +L+++D P+++ 
Sbjct  69    IHQNKRPDSRLIYRLMRILVNSGFFALEEVVVGETNLLEEGYVLTNASKLLLRDNPLSVT  128

Query  390   AFLHICNEYVFQKSCYSLGDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDS  569
              FL    + +  K  +S+  W Q++DP+PF T HG++ WDY  ++P   ++FNE  A D+
Sbjct  129   PFLLSMLDPIMTKPWHSISTWLQSDDPTPFATTHGKEFWDYNEYDPRLGNLFNEAMASDA  188

Query  570   QLLMIVLLSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAA  749
             +L+  V++  + K +F+G+ SLVD+AGG G VA AIA  FP + CTV DLPHVIA  D  
Sbjct  189   RLVTSVVIE-KCKSMFEGLESLVDLAGGTGTVAKAIAYAFPHLACTVFDLPHVIA--DLQ  245

Query  750   SVENVEFVAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSR-EEGGKVIII  926
               +N++FV G+MF+ IP A+A+ +KWI+HDW DE+CVK+L++CK AI  +  + GKVI++
Sbjct  246   GSKNLKFVGGDMFDEIPPADAIFVKWILHDWSDEDCVKLLERCKVAITCKGNKNGKVILV  305

Query  927   DMVIEDKKHDPCYS-------------RAELYMDLLVMALYGSKERNKKQWEKLISEAGF  1067
             DMVI +++++                   +L+ D+L+M L   +ER + +W KL  +AGF
Sbjct  306   DMVIVEEQNNKDIGHDHHAHDHDHQSYETQLFFDMLMMVLLSGRERKETEWAKLFFDAGF  365

Query  1068  SDYKITPALGLRSLIELFP  1124
             S YKITP LG+RSLIE+FP
Sbjct  366   STYKITPILGVRSLIEVFP  384



>ref|XP_004303135.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=365

 Score =   334 bits (856),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 166/350 (47%), Positives = 236/350 (67%), Gaps = 9/350 (3%)
 Frame = +3

Query  87    LLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPSKAPYIH  266
             ++Q++    NHIL  ++S  L CA+QLGIPDIIHNH +P+ L DL +AL +HPSK+ +++
Sbjct  21    IVQSQLHVRNHILQLMNSMVLNCAIQLGIPDIIHNHAQPITLSDLTSALNVHPSKSRFLY  80

Query  267   RLTRFLVHSGLLSVTNSGQEE-CYSLTPAGRLVVKDEPINLRAFLHICNEYVFQKSCYSL  443
             RL   LV  G  +  N       YSLTP+ +L++KD  +       +  + +     + L
Sbjct  81    RLMCILVQQGFFTKHNDVHHGIVYSLTPSSKLLLKDGLMTTFLL--LLLDPLLTSPWHLL  138

Query  444   GDWFQNNDPSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLLSGESKRVFDG  623
             G WFQN   +PF  AHG   +D ++HEP + ++FNE    DS+L+   ++  E + VF+G
Sbjct  139   GTWFQNCASTPFEMAHGMSFFDLVAHEPVFGNMFNEAMVADSKLVSRAVVK-ECQGVFEG  197

Query  624   VSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFVAGNMFENIPA  803
             + SLVDV GGKG +ASAIA  FP +KCTVLDLPHVI ++  ++  N++F+ GNMFE IP 
Sbjct  198   LKSLVDVGGGKGTMASAIADAFPQIKCTVLDLPHVIENLKGSN--NLDFIGGNMFEQIPP  255

Query  804   ANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVI---EDKKHDPCYSRA  974
             ANA+LLKWI+HDW DEE V+ILK+C++AIPS+ +GGKVIII+MV+   +DKK +   +  
Sbjct  256   ANAILLKWILHDWNDEESVEILKRCRDAIPSKSDGGKVIIIEMVVTVDDDKKMNNKSTET  315

Query  975   ELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELFP  1124
             +L+ D+L+M     +ER +K WEKL   AGFS YKIT  LG+RS IE++P
Sbjct  316   QLFWDMLMMVCLTGRERTEKDWEKLFLAAGFSHYKITHTLGIRSFIEVYP  365



>ref|XP_010920172.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Elaeis 
guineensis]
Length=362

 Score =   333 bits (855),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 174/361 (48%), Positives = 238/361 (66%), Gaps = 12/361 (3%)
 Frame = +3

Query  63    NGKQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIH  242
             +G+   +ELL+A+A  WNHI ++I S +LKCAV+LGI DIIH H KP+ L +L A L I 
Sbjct  5     DGECQSLELLKAQAHAWNHIFSFIKSMSLKCAVELGIADIIHTHDKPISLTELAAKLSIP  64

Query  243   PSKAPYIHRLTRFLVHSGLLSVTNSGQ-----EECYSLTPAGRLVVKDEPINLRAF-LHI  404
             P+K   + RL R LV SG  +    G      EE Y  T    L+VK+   N+ +F L I
Sbjct  65    PTKNNDLRRLMRLLVFSGFFARKRDGNSHDHDEELYIPTTMSALLVKENDANVSSFVLAI  124

Query  405   CNEYVFQKSCYSLGDWFQNND--PSPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLL  578
              ++ +F    Y L  WF+ +    +PF  AHG  +W+ IS  P +N +  E  A DS+ +
Sbjct  125   LDQTLFN-PWYHLSSWFKQDKVPATPFEVAHGRDVWEAISRSPAFNSLCYEAMASDSRFV  183

Query  579   MIVLLSGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVE  758
               +++  E   VF G+ SLVDV GGKG +A AIA  +P +KCTVLDLPHV+AS +A+  E
Sbjct  184   AKLVVE-ECGEVFRGLRSLVDVGGGKGTMARAIAVAYPQVKCTVLDLPHVVASPEAS--E  240

Query  759   NVEFVAGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVI  938
              V+ VAG+MF+ +P A+AVLLKW++HDW D++CVKILK+CKEAIPS+EEGGKVIIIDMV+
Sbjct  241   EVQLVAGDMFQYVPPADAVLLKWVLHDWSDDDCVKILKRCKEAIPSKEEGGKVIIIDMVV  300

Query  939   EDKKHDPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIEL  1118
             +     P     +L  DL +M     KERN+ +W+K+  +AGF+DYKI PALGLRS+IE+
Sbjct  301   DLDIGFPELGETQLLFDLEMMVQTTGKERNECEWKKIFMDAGFTDYKIIPALGLRSIIEV  360

Query  1119  F  1121
             +
Sbjct  361   Y  361



>ref|XP_008779514.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Phoenix 
dactylifera]
Length=366

 Score =   333 bits (855),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 171/356 (48%), Positives = 234/356 (66%), Gaps = 5/356 (1%)
 Frame = +3

Query  69    KQSHVELLQAEAQTWNHILNYIDSATLKCAVQLGIPDIIHNHPKPMPLCDLIAALPIHPS  248
             KQ   E LQ  AQ WNH L+++ S +LKCA++LGIPD++HNH KP+ LC+L  +L I PS
Sbjct  10    KQPAKEQLQDTAQLWNHALSFVRSMSLKCAIELGIPDVLHNHGKPITLCELATSLSIPPS  69

Query  249   KAPYIHRLTRFLVHSGLLSV---TNSGQEECYSLTPAGRLVVKDEPINLRAFLHICNEYV  419
             KAP +  L R LVHSGL +        +EE Y LTPA +L+VK+E   L  F  I  ++ 
Sbjct  70    KAPALGSLMRLLVHSGLFASHRDQEGEEEESYFLTPASKLLVKEEKACLSPFALIVLKWT  129

Query  420   FQKSCYSLGDWFQNNDP--SPFCTAHGEKIWDYISHEPGYNDVFNEVTAKDSQLLMIVLL  593
                  + LG WF+   P  +PF  AHG+ +++       +N++FNE  A D++L+  V L
Sbjct  130   MLGPAHQLGAWFRAGAPRATPFDMAHGKGLFEETDARADFNELFNEGMASDARLVTEVAL  189

Query  594   SGESKRVFDGVSSLVDVAGGKGAVASAIAKCFPAMKCTVLDLPHVIASVDAASVENVEFV  773
               +   V  GV S+VDV GG G +A AIAK  P ++C VLDLPHV+A+VD    E VEF+
Sbjct  190   LRQQWEVLRGVRSVVDVGGGTGTLAKAIAKALPGVRCAVLDLPHVVATVDEEEREGVEFI  249

Query  774   AGNMFENIPAANAVLLKWIMHDWEDEECVKILKKCKEAIPSREEGGKVIIIDMVIEDKKH  953
              G+MFE+IP A+AVL KWI+HDW DE+C++ILK+CKEAIP +++GGKVIIID+V+     
Sbjct  250   GGDMFEHIPPADAVLFKWILHDWSDEDCIRILKRCKEAIPPKKDGGKVIIIDIVVGVTTD  309

Query  954   DPCYSRAELYMDLLVMALYGSKERNKKQWEKLISEAGFSDYKITPALGLRSLIELF  1121
                    +L  D+ +M L   KER++ +W +L   AGFSDYKIT +LGLRS+IEL+
Sbjct  310   VSISVEPQLLFDIEMMILTRGKERSETEWRRLFHAAGFSDYKITASLGLRSVIELY  365



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3289209284890