BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24056_g2_i1 len=1297 path=[6968:0-136 145:137-172 2504:173-228
237:229-275 7722:276-284 3257:285-360 3333:361-466 463:467-512
5602:513-816 5906:817-840 5930:841-1023 1017:1024-1052
3462:1053-1296]

Length=1297
                                                                      Score     E

ref|XP_002278294.1|  PREDICTED: trans-resveratrol di-O-methyltran...    403   2e-134   Vitis vinifera
emb|CAN78992.1|  hypothetical protein VITISV_005827                     400   1e-133   Vitis vinifera
ref|XP_003633248.1|  PREDICTED: trans-resveratrol di-O-methyltran...    397   4e-132   
ref|XP_003633249.1|  PREDICTED: trans-resveratrol di-O-methyltran...    396   7e-132   
ref|XP_009612081.1|  PREDICTED: trans-resveratrol di-O-methyltran...    395   1e-131   
ref|XP_011002662.1|  PREDICTED: trans-resveratrol di-O-methyltran...    395   1e-131   
ref|XP_009778350.1|  PREDICTED: trans-resveratrol di-O-methyltran...    395   1e-131   
ref|XP_003633245.1|  PREDICTED: trans-resveratrol di-O-methyltran...    394   3e-131   
ref|XP_011002663.1|  PREDICTED: trans-resveratrol di-O-methyltran...    394   4e-131   
ref|XP_002278211.1|  PREDICTED: trans-resveratrol di-O-methyltran...    394   5e-131   Vitis vinifera
ref|XP_002326036.2|  hypothetical protein POPTR_0019s12290g             392   3e-130   Populus trichocarpa [western balsam poplar]
ref|XP_009605623.1|  PREDICTED: myricetin O-methyltransferase-like      392   4e-130   
ref|XP_002281368.2|  PREDICTED: trans-resveratrol di-O-methyltran...    391   5e-130   Vitis vinifera
emb|CAN61955.1|  hypothetical protein VITISV_020020                     391   5e-130   Vitis vinifera
gb|AEF97347.1|  O-methyltransferase                                     391   9e-130   
ref|XP_002277927.2|  PREDICTED: trans-resveratrol di-O-methyltran...    390   2e-129   Vitis vinifera
emb|CAQ76879.1|  resveratrol O-methyltransferase                        390   2e-129   Vitis vinifera
ref|XP_002274019.2|  PREDICTED: trans-resveratrol di-O-methyltran...    389   4e-129   Vitis vinifera
ref|XP_011002666.1|  PREDICTED: trans-resveratrol di-O-methyltran...    388   9e-129   
ref|XP_002278149.1|  PREDICTED: trans-resveratrol di-O-methyltran...    388   1e-128   Vitis vinifera
ref|XP_002278190.1|  PREDICTED: trans-resveratrol di-O-methyltran...    386   7e-128   Vitis vinifera
ref|XP_009779391.1|  PREDICTED: trans-resveratrol di-O-methyltran...    385   8e-128   
ref|XP_009780812.1|  PREDICTED: myricetin O-methyltransferase-like      385   2e-127   
ref|NP_001268044.1|  trans-resveratrol di-O-methyltransferase           385   2e-127   
emb|CAN69333.1|  hypothetical protein VITISV_003273                     384   2e-127   Vitis vinifera
gb|AEC13057.1|  orcinol O-methyltransferase-like protein                385   2e-127   
emb|CAN73269.1|  hypothetical protein VITISV_021917                     385   2e-127   Vitis vinifera
gb|AFX68805.1|  O-metyltransferase                                      385   2e-127   
emb|CAN79968.1|  hypothetical protein VITISV_043678                     384   5e-127   Vitis vinifera
sp|B6VJS4.2|ROMT_VITVI  RecName: Full=Trans-resveratrol di-O-meth...    383   8e-127   Vitis vinifera
ref|XP_004303127.1|  PREDICTED: trans-resveratrol di-O-methyltran...    384   9e-127   
ref|XP_002278057.1|  PREDICTED: trans-resveratrol di-O-methyltran...    383   1e-126   Vitis vinifera
emb|CDP15886.1|  unnamed protein product                                381   4e-126   
emb|CDP19709.1|  unnamed protein product                                380   6e-126   
gb|ABQ02270.2|  O-methyltransferase                                     380   1e-125   Vitis vinifera
emb|CAN83014.1|  hypothetical protein VITISV_029725                     380   1e-125   Vitis vinifera
ref|XP_002278517.1|  PREDICTED: trans-resveratrol di-O-methyltran...    380   1e-125   Vitis vinifera
ref|NP_001267963.1|  O-methyltransferase                                380   2e-125   
ref|XP_002517827.1|  o-methyltransferase, putative                      379   5e-125   Ricinus communis
gb|KDP24061.1|  hypothetical protein JCGZ_25718                         379   5e-125   
ref|XP_002525159.1|  o-methyltransferase, putative                      379   6e-125   Ricinus communis
gb|AAM23004.1|AF502433_1  orcinol O-methyltransferase                   379   6e-125   Rosa hybrid cultivar
ref|XP_006357086.1|  PREDICTED: tabersonine 16-O-methyltransferas...    376   3e-124   
ref|XP_006365444.1|  PREDICTED: trans-resveratrol di-O-methyltran...    376   3e-124   
ref|XP_002278316.1|  PREDICTED: trans-resveratrol di-O-methyltran...    376   6e-124   Vitis vinifera
ref|XP_003544912.1|  PREDICTED: trans-resveratrol di-O-methyltran...    376   6e-124   
ref|XP_006368013.1|  PREDICTED: trans-resveratrol di-O-methyltran...    375   1e-123   
ref|XP_003557042.1|  PREDICTED: trans-resveratrol di-O-methyltran...    375   2e-123   
ref|XP_002262833.1|  PREDICTED: trans-resveratrol di-O-methyltran...    374   2e-123   Vitis vinifera
ref|XP_002278398.1|  PREDICTED: trans-resveratrol di-O-methyltran...    374   6e-123   Vitis vinifera
ref|XP_008229109.1|  PREDICTED: trans-resveratrol di-O-methyltran...    373   6e-123   
gb|AAM23005.1|AF502434_1  orcinol O-methyltransferase                   373   1e-122   Rosa hybrid cultivar
ref|XP_006346268.1|  PREDICTED: trans-resveratrol di-O-methyltran...    372   1e-122   
ref|XP_002525160.1|  o-methyltransferase, putative                      372   2e-122   Ricinus communis
ref|XP_009625456.1|  PREDICTED: trans-resveratrol di-O-methyltran...    371   5e-122   
ref|XP_007043718.1|  Flavonoid o-methyltransferase related              371   6e-122   
ref|XP_003527407.1|  PREDICTED: trans-resveratrol di-O-methyltran...    370   1e-121   
emb|CAJ65641.1|  putative orcinol O-methyltransferase                   369   2e-121   Rosa marretii
emb|CAJ65638.1|  putative orcinol O-methyltransferase                   368   4e-121   Rosa hugonis
emb|CAH05089.1|  putative orcinol O-methyltransferase                   368   4e-121   Rosa odorata var. gigantea
ref|XP_003544914.1|  PREDICTED: trans-resveratrol di-O-methyltran...    369   5e-121   
emb|CAJ65632.1|  putative orcinol O-methyltransferase                   368   6e-121   Rosa odorata var. gigantea
emb|CAJ65607.1|  putative orcinol O-methyltransferase                   367   9e-121   Rosa beggeriana
ref|XP_006351391.1|  PREDICTED: trans-resveratrol di-O-methyltran...    367   1e-120   
ref|XP_006469135.1|  PREDICTED: trans-resveratrol di-O-methyltran...    369   1e-120   
emb|CAJ65663.1|  putative orcinol O-methyltransferase                   367   1e-120   Rosa odorata [tea rose]
emb|CAH05084.1|  orcinol O-methyltransferase 3                          367   2e-120   Rosa hybrid cultivar
emb|CAJ65628.1|  putative orcinol O-methyltransferase                   367   2e-120   Rosa odorata var. gigantea
ref|XP_009780941.1|  PREDICTED: trans-resveratrol di-O-methyltran...    367   2e-120   
emb|CAJ65601.1|  putative orcinol O-methyltransferase                   367   2e-120   Rosa chinensis [China rose]
emb|CAH05081.1|  putative orcinol O-methyltransferase                   367   2e-120   Rosa hybrid cultivar
emb|CAJ65621.1|  putative orcinol O-methyltransferase                   367   2e-120   Rosa gallica [apothecary rose]
emb|CAJ65630.1|  putative orcinol O-methyltransferase                   366   2e-120   Rosa odorata var. gigantea
emb|CAJ65640.1|  putative orcinol O-methyltransferase                   366   3e-120   Rosa majalis [cinnamon rose]
emb|CAJ65602.1|  putative orcinol O-methyltransferase                   366   3e-120   Rosa banksiae
emb|CAJ65612.1|  putative orcinol O-methyltransferase                   366   3e-120   Rosa canina [dog briar]
emb|CAJ65618.1|  putative orcinol O-methyltransferase                   366   3e-120   Rosa chinensis var. spontanea
emb|CAJ65598.1|  putative orcinol O-methyltransferase                   366   3e-120   Rosa chinensis [China rose]
ref|XP_006446728.1|  hypothetical protein CICLE_v10015708mg             367   3e-120   
ref|XP_009618299.1|  PREDICTED: trans-resveratrol di-O-methyltran...    366   4e-120   
emb|CAJ65624.1|  putative orcinol O-methyltransferase                   366   4e-120   Rosa gallica [apothecary rose]
emb|CAJ65609.1|  putative orcinol O-methyltransferase                   365   4e-120   Rosa bracteata [Macartny rose]
emb|CAJ65626.1|  putative orcinol O-methyltransferase                   365   4e-120   Rosa gallica [apothecary rose]
emb|CAJ65613.1|  putative orcinol O-methyltransferase                   365   4e-120   Rosa chinensis var. spontanea
ref|XP_010088036.1|  8-hydroxyquercetin 8-O-methyltransferase           367   5e-120   
emb|CAJ65623.1|  putative orcinol O-methyltransferase                   365   6e-120   Rosa gallica [apothecary rose]
emb|CAH05082.1|  putative orcinol O-methyltransferase                   365   6e-120   Rosa hybrid cultivar
ref|XP_009764108.1|  PREDICTED: trans-resveratrol di-O-methyltran...    365   7e-120   
emb|CAJ65622.1|  putative orcinol O-methyltransferase                   365   8e-120   Rosa gallica [apothecary rose]
emb|CAJ65648.1|  putative orcinol O-methyltransferase                   364   1e-119   Rosa woodsii var. ultramontana
emb|CAJ65597.1|  putative orcinol O-methyltransferase                   364   1e-119   Rosa chinensis [China rose]
emb|CAJ65665.1|  putative orcinol O-methyltransferase                   364   1e-119   Rosa odorata [tea rose]
emb|CAH05087.1|  orcinol O-methyltransferase 4                          364   1e-119   Rosa hybrid cultivar
emb|CAJ65625.1|  putative orcinol O-methyltransferase                   364   2e-119   Rosa gallica [apothecary rose]
emb|CAJ65620.1|  putative orcinol O-methyltransferase                   364   2e-119   Rosa chinensis var. spontanea
emb|CAD29556.1|  orcinol O-methyltransferase                            364   2e-119   Rosa hybrid cultivar
emb|CAJ65635.1|  putative orcinol O-methyltransferase                   364   2e-119   Rosa odorata var. gigantea
ref|XP_007142076.1|  hypothetical protein PHAVU_008G250600g             364   3e-119   
emb|CAJ65642.1|  putative orcinol O-methyltransferase                   363   3e-119   Rosa marretii
emb|CAJ65604.1|  putative orcinol O-methyltransferase                   363   3e-119   Rosa beggeriana
emb|CAJ65639.1|  putative orcinol O-methyltransferase                   363   3e-119   Rosa hugonis
emb|CAH05083.1|  putative orcinol O-methyltransferase                   363   4e-119   Rosa hybrid cultivar
ref|XP_008245137.1|  PREDICTED: trans-resveratrol di-O-methyltran...    363   4e-119   
emb|CAJ65615.1|  putative orcinol O-methyltransferase                   363   5e-119   Rosa chinensis var. spontanea
emb|CAJ65610.1|  putative orcinol O-methyltransferase                   363   5e-119   Rosa canina [dog briar]
emb|CAJ65647.1|  putative orcinol O-methyltransferase                   363   5e-119   Rosa rugosa [Japanese rose]
emb|CAJ65603.1|  putative orcinol O-methyltransferase                   363   5e-119   Rosa banksiae
emb|CAH05091.1|  putative orcinol O-methyltransferase                   363   6e-119   Rosa odorata var. gigantea
emb|CAH05080.1|  putative orcinol O-methyltransferase                   362   7e-119   Rosa gallica [apothecary rose]
emb|CAJ65633.1|  putative orcinol O-methyltransferase                   362   8e-119   Rosa odorata var. gigantea
emb|CAJ65646.1|  putative orcinol O-methyltransferase                   362   8e-119   Rosa rugosa [Japanese rose]
emb|CAH05085.1|  orcinol O-methyltransferase 3                          362   8e-119   Rosa hybrid cultivar
ref|XP_008229108.1|  PREDICTED: trans-resveratrol di-O-methyltran...    363   8e-119   
emb|CAJ65614.1|  putative orcinol O-methyltransferase                   362   1e-118   Rosa chinensis var. spontanea
emb|CAJ65606.1|  putative orcinol O-methyltransferase                   362   1e-118   Rosa beggeriana
emb|CAJ65664.1|  putative orcinol O-methyltransferase                   362   1e-118   Rosa odorata [tea rose]
emb|CAJ65655.1|  putative orcinol O-methyltransferase                   362   2e-118   Rosa lucieae [memorial rose]
ref|XP_007142077.1|  hypothetical protein PHAVU_008G250700g             362   2e-118   
ref|XP_004229155.1|  PREDICTED: myricetin O-methyltransferase-lik...    362   2e-118   
emb|CDP15888.1|  unnamed protein product                                362   2e-118   
emb|CAH05079.1|  putative orcinol O-methyltransferase                   361   2e-118   Rosa gallica [apothecary rose]
emb|CAJ65645.1|  putative orcinol O-methyltransferase                   361   2e-118   Rosa roxburghii [chestnut rose]
emb|CAJ65608.1|  putative orcinol O-methyltransferase                   361   2e-118   Rosa bracteata [Macartny rose]
ref|XP_006365443.1|  PREDICTED: trans-resveratrol di-O-methyltran...    361   2e-118   
ref|XP_004235335.1|  PREDICTED: trans-resveratrol di-O-methyltran...    364   3e-118   
emb|CAJ65599.1|  putative orcinol O-methyltransferase                   361   3e-118   Rosa chinensis [China rose]
emb|CAJ65661.1|  putative orcinol O-methyltransferase                   361   3e-118   Rosa odorata [tea rose]
emb|CAH05090.1|  putative orcinol O-methyltransferase                   360   4e-118   Rosa odorata var. gigantea
emb|CAH05086.1|  orcinol O-methyltransferase 4                          360   4e-118   Rosa hybrid cultivar
emb|CAD29555.1|  orcinol O-methyltransferase                            360   5e-118   Rosa hybrid cultivar
emb|CAJ65656.1|  putative orcinol O-methyltransferase                   360   5e-118   Rosa odorata [tea rose]
emb|CAJ65605.1|  putative orcinol O-methyltransferase                   360   5e-118   Rosa beggeriana
emb|CAJ65634.1|  putative orcinol O-methyltransferase                   360   7e-118   Rosa odorata var. gigantea
ref|XP_006356531.1|  PREDICTED: trans-resveratrol di-O-methyltran...    360   7e-118   
ref|XP_006428632.1|  hypothetical protein CICLE_v10012033mg             360   9e-118   
emb|CDP21836.1|  unnamed protein product                                360   1e-117   
emb|CAJ65611.1|  putative orcinol O-methyltransferase                   359   1e-117   Rosa canina [dog briar]
ref|XP_009594948.1|  PREDICTED: trans-resveratrol di-O-methyltran...    359   2e-117   
dbj|BAJ72588.1|  7'-O-demethylcephaeline/cephaeline O-methyltrans...    359   2e-117   
emb|CAA11131.1|  O-methyltransferase                                    359   2e-117   Prunus dulcis [sweet almond]
emb|CAJ65659.1|  putative orcinol O-methyltransferase                   358   3e-117   Rosa odorata [tea rose]
emb|CAJ65616.1|  putative orcinol O-methyltransferase                   358   3e-117   Rosa chinensis var. spontanea
emb|CAJ65627.1|  putative orcinol O-methyltransferase                   358   4e-117   Rosa odorata var. gigantea
gb|ABZ89567.1|  O-methyltransferase 3                                   359   4e-117   Humulus lupulus [common hop]
emb|CAJ65643.1|  putative orcinol O-methyltransferase                   358   5e-117   Rosa marretii
emb|CAJ65629.1|  putative orcinol O-methyltransferase                   358   5e-117   Rosa odorata var. gigantea
ref|XP_004490696.1|  PREDICTED: trans-resveratrol di-O-methyltran...    358   6e-117   
emb|CAJ65631.1|  putative orcinol O-methyltransferase                   357   7e-117   Rosa odorata var. gigantea
ref|XP_006480453.1|  PREDICTED: trans-resveratrol di-O-methyltran...    358   7e-117   
emb|CAH05088.1|  putative orcinol O-methyltransferase                   357   7e-117   Rosa odorata var. gigantea
emb|CAJ65617.1|  putative orcinol O-methyltransferase                   357   7e-117   Rosa chinensis var. spontanea
gb|AAB71213.1|  methyltransferase                                       358   7e-117   Prunus armeniaca
emb|CAJ65600.1|  putative orcinol O-methyltransferase                   357   9e-117   Rosa chinensis [China rose]
emb|CDP21787.1|  unnamed protein product                                357   1e-116   
ref|XP_006469069.1|  PREDICTED: trans-resveratrol di-O-methyltran...    357   1e-116   
emb|CAJ65649.1|  putative orcinol O-methyltransferase                   357   2e-116   Rosa woodsii var. ultramontana
emb|CAJ65636.1|  putative orcinol O-methyltransferase                   356   2e-116   Rosa odorata var. gigantea
ref|XP_006356529.1|  PREDICTED: trans-resveratrol di-O-methyltran...    356   3e-116   
sp|B0EXJ8.1|HTOMT_CATRO  RecName: Full=Tabersonine 16-O-methyltra...    356   3e-116   Catharanthus roseus [chatas]
ref|XP_006446726.1|  hypothetical protein CICLE_v10015705mg             356   3e-116   
ref|XP_009602136.1|  PREDICTED: trans-resveratrol di-O-methyltran...    356   3e-116   
emb|CDP19840.1|  unnamed protein product                                356   4e-116   
ref|XP_004241914.1|  PREDICTED: myricetin O-methyltransferase-like      355   6e-116   
dbj|BAI79244.1|  O-methyltransferase                                    355   8e-116   Carapichea ipecacuanha [ipecac]
gb|ADZ76434.1|  myricetin O-methyltransferase 2                         355   8e-116   
dbj|BAJ05387.1|  O-methyltransferase                                    354   1e-115   
ref|XP_007142043.1|  hypothetical protein PHAVU_008G247600g             354   2e-115   
gb|AFK40900.1|  unknown                                                 354   2e-115   
emb|CAJ65662.1|  putative orcinol O-methyltransferase                   353   2e-115   Rosa odorata [tea rose]
emb|CAJ65666.1|  putative orcinol O-methyltransferase                   352   5e-115   Rosa odorata [tea rose]
emb|CDP19711.1|  unnamed protein product                                353   6e-115   
emb|CAJ65657.1|  putative orcinol O-methyltransferase                   352   6e-115   Rosa odorata [tea rose]
emb|CAJ65660.1|  putative orcinol O-methyltransferase                   352   7e-115   Rosa odorata [tea rose]
emb|CAJ65596.1|  putative orcinol O-methyltransferase                   352   8e-115   Rosa chinensis [China rose]
dbj|BAJ05384.1|  O-methyltransferase                                    352   8e-115   
emb|CDP19713.1|  unnamed protein product                                352   1e-114   
emb|CAN69556.1|  hypothetical protein VITISV_027590                     351   1e-114   Vitis vinifera
ref|XP_004241912.1|  PREDICTED: trans-resveratrol di-O-methyltran...    352   1e-114   
emb|CAJ65637.1|  putative orcinol O-methyltransferase                   352   1e-114   Rosa odorata var. gigantea
gb|KHN08844.1|  8-hydroxyquercetin 8-O-methyltransferase                349   6e-114   
ref|XP_006474725.1|  PREDICTED: trans-resveratrol di-O-methyltran...    350   1e-113   
ref|XP_006346269.1|  PREDICTED: trans-resveratrol di-O-methyltran...    348   4e-113   
ref|XP_006366298.1|  PREDICTED: trans-resveratrol di-O-methyltran...    348   4e-113   
ref|XP_004505627.1|  PREDICTED: trans-resveratrol di-O-methyltran...    349   4e-113   
ref|XP_006376381.1|  6a-hydroxymaackiain methyltransferase family...    348   6e-113   
ref|XP_006376386.1|  hypothetical protein POPTR_0013s12560g             348   7e-113   
gb|KHN07780.1|  Tabersonine 16-O-methyltransferase                      346   1e-112   
ref|XP_003615966.1|  O-methyltransferase                                347   1e-112   
gb|ABK96707.1|  unknown                                                 347   1e-112   Populus trichocarpa x Populus deltoides
ref|XP_010093978.1|  Tabersonine 16-O-methyltransferase                 347   2e-112   
ref|XP_006469137.1|  PREDICTED: trans-resveratrol di-O-methyltran...    346   3e-112   
ref|XP_006376388.1|  6a-hydroxymaackiain methyltransferase family...    346   4e-112   
ref|XP_006376396.1|  hypothetical protein POPTR_0013s12670g             345   5e-112   
gb|KDO73905.1|  hypothetical protein CISIN_1g017835mg                   346   5e-112   
gb|AES89720.2|  orcinol O-methyltransferase                             345   8e-112   
ref|XP_006356530.1|  PREDICTED: trans-resveratrol di-O-methyltran...    345   8e-112   
ref|XP_006452811.1|  hypothetical protein CICLE_v10008718mg             345   1e-111   
emb|CDP21661.1|  unnamed protein product                                345   1e-111   
ref|XP_010110664.1|  8-hydroxyquercetin 8-O-methyltransferase           345   1e-111   
sp|Q8GSN1.1|MOMT_CATRO  RecName: Full=Myricetin O-methyltransfera...    344   2e-111   Catharanthus roseus [chatas]
ref|XP_002278092.1|  PREDICTED: trans-resveratrol di-O-methyltran...    343   4e-111   Vitis vinifera
ref|XP_003615973.1|  O-methyltransferase                                342   9e-111   
ref|XP_011085377.1|  PREDICTED: chavicol O-methyltransferase-like       342   2e-110   
ref|XP_009593020.1|  PREDICTED: trans-resveratrol di-O-methyltran...    342   2e-110   
ref|XP_002522501.1|  o-methyltransferase, putative                      340   4e-110   Ricinus communis
ref|XP_002278208.2|  PREDICTED: trans-resveratrol di-O-methyltran...    341   5e-110   Vitis vinifera
ref|XP_011100233.1|  PREDICTED: 8-hydroxyquercetin 8-O-methyltran...    340   5e-110   
ref|XP_003607523.1|  O-methyltransferase                                340   6e-110   
emb|CAN70493.1|  hypothetical protein VITISV_002330                     340   6e-110   Vitis vinifera
ref|XP_003615967.1|  O-methyltransferase                                340   7e-110   
ref|XP_006446725.1|  hypothetical protein CICLE_v10015630mg             340   7e-110   
ref|XP_004303135.1|  PREDICTED: trans-resveratrol di-O-methyltran...    340   8e-110   
gb|KDP24062.1|  hypothetical protein JCGZ_25719                         340   9e-110   
emb|CDP17644.1|  unnamed protein product                                338   2e-109   
ref|XP_004248183.1|  PREDICTED: trans-resveratrol di-O-methyltran...    339   2e-109   
ref|XP_006469138.1|  PREDICTED: trans-resveratrol di-O-methyltran...    345   2e-109   
ref|XP_003527405.1|  PREDICTED: trans-resveratrol di-O-methyltran...    338   2e-109   
ref|XP_002517832.1|  o-methyltransferase, putative                      338   3e-109   Ricinus communis
ref|XP_010097399.1|  8-hydroxyquercetin 8-O-methyltransferase           339   3e-109   
ref|XP_008229106.1|  PREDICTED: trans-resveratrol di-O-methyltran...    339   3e-109   
ref|XP_004232927.1|  PREDICTED: trans-resveratrol di-O-methyltran...    338   4e-109   
ref|XP_004490687.1|  PREDICTED: trans-resveratrol di-O-methyltran...    338   5e-109   
ref|XP_006364318.1|  PREDICTED: trans-resveratrol di-O-methyltran...    337   7e-109   
ref|XP_011016237.1|  PREDICTED: trans-resveratrol di-O-methyltran...    337   9e-109   
ref|XP_006376392.1|  hypothetical protein POPTR_0013s12620g             336   2e-108   
gb|AAR02421.1|  putative O-methyltransferase                            336   2e-108   Catharanthus roseus [chatas]
ref|XP_007132709.1|  hypothetical protein PHAVU_011G118100g             336   2e-108   
ref|XP_006469063.1|  PREDICTED: trans-resveratrol di-O-methyltran...    336   4e-108   
ref|XP_011037437.1|  PREDICTED: trans-resveratrol di-O-methyltran...    335   4e-108   
ref|XP_004490686.1|  PREDICTED: trans-resveratrol di-O-methyltran...    335   5e-108   
ref|XP_006388573.1|  hypothetical protein POPTR_0151s00210g             335   7e-108   
emb|CBI22005.3|  unnamed protein product                                332   1e-107   
ref|XP_006364328.1|  PREDICTED: trans-resveratrol di-O-methyltran...    333   2e-107   
ref|XP_011100228.1|  PREDICTED: trans-resveratrol di-O-methyltran...    333   3e-107   
dbj|BAJ05383.1|  O-methyltransferase                                    333   3e-107   
ref|XP_008455944.1|  PREDICTED: trans-resveratrol di-O-methyltran...    333   5e-107   
ref|XP_010320673.1|  PREDICTED: trans-resveratrol di-O-methyltran...    331   8e-107   
ref|XP_002305103.1|  6a-hydroxymaackiain methyltransferase family...    332   1e-106   Populus trichocarpa [western balsam poplar]
ref|XP_009351009.1|  PREDICTED: trans-resveratrol di-O-methyltran...    332   1e-106   
gb|KDP35397.1|  hypothetical protein JCGZ_10381                         332   1e-106   
ref|XP_011100227.1|  PREDICTED: 8-hydroxyquercetin 8-O-methyltran...    332   1e-106   
dbj|BAI79243.1|  O-methyltransferase                                    331   1e-106   Carapichea ipecacuanha [ipecac]
gb|KGN43480.1|  hypothetical protein Csa_7G039280                       332   1e-106   
ref|XP_010110665.1|  8-hydroxyquercetin 8-O-methyltransferase           332   2e-106   
ref|XP_010040912.1|  PREDICTED: trans-resveratrol di-O-methyltran...    331   3e-106   
ref|XP_004232928.1|  PREDICTED: trans-resveratrol di-O-methyltran...    330   4e-106   
ref|XP_011077108.1|  PREDICTED: chavicol O-methyltransferase-like       330   6e-106   
ref|XP_011037442.1|  PREDICTED: trans-resveratrol di-O-methyltran...    329   1e-105   
dbj|BAI79245.1|  O-methyltransferase                                    329   1e-105   Carapichea ipecacuanha [ipecac]
ref|XP_004169298.1|  PREDICTED: trans-resveratrol di-O-methyltran...    329   1e-105   
ref|XP_004151735.1|  PREDICTED: trans-resveratrol di-O-methyltran...    329   1e-105   
ref|XP_011085639.1|  PREDICTED: chavicol O-methyltransferase-like       328   2e-105   
ref|XP_010070255.1|  PREDICTED: trans-resveratrol di-O-methyltran...    328   3e-105   
gb|KCW89599.1|  hypothetical protein EUGRSUZ_A01884                     328   3e-105   
ref|XP_008783119.1|  PREDICTED: trans-resveratrol di-O-methyltran...    328   3e-105   
ref|XP_010058047.1|  PREDICTED: trans-resveratrol di-O-methyltran...    328   4e-105   
gb|KCW75545.1|  hypothetical protein EUGRSUZ_E04305                     327   5e-105   
gb|KDP21023.1|  hypothetical protein JCGZ_21494                         327   6e-105   
ref|XP_010052409.1|  PREDICTED: trans-resveratrol di-O-methyltran...    327   6e-105   
dbj|BAJ05388.1|  O-methyltransferase                                    327   7e-105   
ref|XP_004151906.1|  PREDICTED: trans-resveratrol di-O-methyltran...    327   8e-105   
emb|CDP19839.1|  unnamed protein product                                326   9e-105   
ref|XP_010260367.1|  PREDICTED: trans-resveratrol di-O-methyltran...    327   9e-105   
ref|XP_011091580.1|  PREDICTED: trans-resveratrol di-O-methyltran...    327   1e-104   
ref|XP_010058046.1|  PREDICTED: trans-resveratrol di-O-methyltran...    326   2e-104   
ref|NP_001267964.1|  O-methyltransferase                                326   2e-104   
ref|XP_010320677.1|  PREDICTED: trans-resveratrol di-O-methyltran...    325   2e-104   
gb|AEN94899.1|  desoxyhemigossypol-6-O-methyltransferase                326   2e-104   
emb|CAN73270.1|  hypothetical protein VITISV_021918                     325   2e-104   Vitis vinifera
ref|XP_010920172.1|  PREDICTED: trans-resveratrol di-O-methyltran...    326   2e-104   
ref|XP_011001214.1|  PREDICTED: trans-resveratrol di-O-methyltran...    326   2e-104   
gb|AAM97498.1|  O-methyltransferase                                     325   3e-104   Catharanthus roseus [chatas]
ref|XP_011027757.1|  PREDICTED: trans-resveratrol di-O-methyltran...    325   3e-104   
emb|CBI21921.3|  unnamed protein product                                323   3e-104   
ref|XP_004158564.1|  PREDICTED: LOW QUALITY PROTEIN: trans-resver...    325   4e-104   
ref|XP_006377432.1|  6a-hydroxymaackiain methyltransferase family...    325   4e-104   
ref|XP_010916033.1|  PREDICTED: trans-resveratrol di-O-methyltran...    325   4e-104   
ref|XP_002517834.1|  o-methyltransferase, putative                      325   4e-104   Ricinus communis
ref|XP_002278127.1|  PREDICTED: trans-resveratrol di-O-methyltran...    325   5e-104   Vitis vinifera
gb|AJD20223.1|  norcoclaurine 6-O-methyltransferase                     325   5e-104   
gb|ACV65500.1|  deoxyhemigossypol-6-O-methyltransferase                 324   1e-103   
ref|XP_009597680.1|  PREDICTED: trans-resveratrol di-O-methyltran...    323   2e-103   
ref|XP_010920173.1|  PREDICTED: trans-resveratrol di-O-methyltran...    323   2e-103   
ref|XP_007025515.1|  Flavonoid o-methyltransferase related, putative    324   2e-103   
ref|XP_008779514.1|  PREDICTED: trans-resveratrol di-O-methyltran...    323   2e-103   
ref|XP_010093977.1|  Tabersonine 16-O-methyltransferase                 323   4e-103   
gb|KDP24060.1|  hypothetical protein JCGZ_25717                         322   8e-103   
emb|CAN75971.1|  hypothetical protein VITISV_009882                     320   1e-102   
ref|XP_011037440.1|  PREDICTED: trans-resveratrol di-O-methyltran...    321   1e-102   
gb|AAR02417.1|  putative O-methyltransferase                            320   2e-102   
ref|XP_006388414.1|  6a-hydroxymaackiain methyltransferase family...    320   3e-102   
ref|XP_008364164.1|  PREDICTED: trans-resveratrol di-O-methyltran...    320   3e-102   
ref|XP_010057351.1|  PREDICTED: trans-resveratrol di-O-methyltran...    320   4e-102   
gb|AIY62760.1|  N-acetylserotonin O-methyltransferase                   320   5e-102   
ref|XP_008364163.1|  PREDICTED: trans-resveratrol di-O-methyltran...    320   5e-102   
ref|XP_002517833.1|  o-methyltransferase, putative                      320   6e-102   
gb|ACY41220.1|  O-methyltransferase-like protein                        319   8e-102   
ref|XP_004139732.1|  PREDICTED: trans-resveratrol di-O-methyltran...    320   8e-102   
ref|XP_008778275.1|  PREDICTED: trans-resveratrol di-O-methyltran...    319   8e-102   
ref|XP_002517835.1|  o-methyltransferase, putative                      319   9e-102   
gb|KHG15351.1|  8-hydroxyquercetin 8-O-methyltransferase                319   1e-101   
ref|XP_010916034.1|  PREDICTED: trans-resveratrol di-O-methyltran...    319   1e-101   
emb|CAN75970.1|  hypothetical protein VITISV_009881                     318   2e-101   
gb|KCW74500.1|  hypothetical protein EUGRSUZ_E03212                     318   2e-101   
ref|XP_002522586.1|  o-methyltransferase, putative                      318   2e-101   
ref|XP_004975403.1|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...    318   2e-101   
ref|XP_008343875.1|  PREDICTED: trans-resveratrol di-O-methyltran...    318   3e-101   
ref|XP_011070200.1|  PREDICTED: trans-resveratrol di-O-methyltran...    321   3e-101   
ref|XP_010057350.1|  PREDICTED: trans-resveratrol di-O-methyltran...    319   3e-101   
ref|XP_008362623.1|  PREDICTED: trans-resveratrol di-O-methyltran...    318   4e-101   
gb|KCW74501.1|  hypothetical protein EUGRSUZ_E03213                     317   5e-101   
ref|XP_004170024.1|  PREDICTED: trans-resveratrol di-O-methyltran...    317   8e-101   
ref|XP_011091578.1|  PREDICTED: trans-resveratrol di-O-methyltran...    317   8e-101   
ref|XP_004139733.1|  PREDICTED: LOW QUALITY PROTEIN: trans-resver...    318   1e-100   
ref|XP_006469136.1|  PREDICTED: trans-resveratrol di-O-methyltran...    317   1e-100   
ref|XP_002441380.1|  hypothetical protein SORBIDRAFT_09g025570          316   1e-100   
gb|AAR09603.1|  O-methyltransferase                                     316   2e-100   
ref|XP_009344934.1|  PREDICTED: trans-resveratrol di-O-methyltran...    316   2e-100   
ref|XP_008778001.1|  PREDICTED: trans-resveratrol di-O-methyltran...    315   2e-100   
gb|KHN07781.1|  Tabersonine 16-O-methyltransferase                      315   2e-100   
ref|XP_004961502.1|  PREDICTED: O-methyltransferase ZRP4-like iso...    316   3e-100   
gb|KDP35391.1|  hypothetical protein JCGZ_10375                         315   3e-100   
ref|XP_008807987.1|  PREDICTED: trans-resveratrol di-O-methyltran...    315   4e-100   
ref|XP_003615968.1|  O-methyltransferase                                313   5e-100   
ref|XP_009345025.1|  PREDICTED: trans-resveratrol di-O-methyltran...    315   5e-100   
gb|AAR02419.1|  flavonoid 4'-O-methyltransferase                        314   6e-100   
ref|XP_010920171.1|  PREDICTED: trans-resveratrol di-O-methyltran...    314   7e-100   
ref|XP_011091583.1|  PREDICTED: trans-resveratrol di-O-methyltran...    313   1e-99    
dbj|BAA86059.1|  O-methyltransferase                                    314   1e-99    
gb|AGQ21572.1|  flavone 8-O-methyltransferase                           313   2e-99    
ref|XP_006364329.1|  PREDICTED: uncharacterized protein LOC102587683    327   2e-99    
ref|XP_008455943.1|  PREDICTED: trans-resveratrol di-O-methyltran...    314   2e-99    
ref|XP_010694747.1|  PREDICTED: trans-resveratrol di-O-methyltran...    313   2e-99    
ref|XP_002522500.1|  o-methyltransferase, putative                      313   3e-99    
ref|XP_010111159.1|  6a-hydroxymaackiain methyltransferase 1            314   4e-99    
gb|EYU30737.1|  hypothetical protein MIMGU_mgv1a009866mg                311   5e-99    
ref|XP_008392935.1|  PREDICTED: trans-resveratrol di-O-methyltran...    313   6e-99    
ref|XP_006582298.1|  PREDICTED: trans-resveratrol di-O-methyltran...    311   7e-99    
ref|XP_004163430.1|  PREDICTED: LOW QUALITY PROTEIN: trans-resver...    311   8e-99    
ref|XP_004293905.1|  PREDICTED: trans-resveratrol di-O-methyltran...    311   1e-98    
ref|XP_004249745.2|  PREDICTED: trans-resveratrol di-O-methyltran...    309   2e-98    
ref|XP_010938927.1|  PREDICTED: trans-resveratrol di-O-methyltran...    311   2e-98    
emb|CDP21583.1|  unnamed protein product                                309   2e-98    
ref|XP_010916035.1|  PREDICTED: trans-resveratrol di-O-methyltran...    311   2e-98    
ref|XP_008455485.1|  PREDICTED: trans-resveratrol di-O-methyltran...    311   2e-98    
ref|XP_009791021.1|  PREDICTED: trans-resveratrol di-O-methyltran...    311   3e-98    
ref|XP_008788394.1|  PREDICTED: trans-resveratrol di-O-methyltran...    310   5e-98    
ref|XP_007025514.1|  Flavonoid o-methyltransferase related              309   5e-98    
ref|XP_006388574.1|  hypothetical protein POPTR_0151s00220g             308   6e-98    
ref|XP_010109381.1|  Tabersonine 16-O-methyltransferase                 309   6e-98    
ref|XP_011092041.1|  PREDICTED: trans-resveratrol di-O-methyltran...    309   7e-98    
ref|XP_004961504.1|  PREDICTED: O-methyltransferase ZRP4-like           309   9e-98    
gb|KCW44789.1|  hypothetical protein EUGRSUZ_L01645                     308   9e-98    
ref|XP_008778546.1|  PREDICTED: trans-resveratrol di-O-methyltran...    309   1e-97    
ref|XP_010057348.1|  PREDICTED: trans-resveratrol di-O-methyltran...    309   1e-97    
ref|XP_009398848.1|  PREDICTED: trans-resveratrol di-O-methyltran...    308   2e-97    
gb|KDO75191.1|  hypothetical protein CISIN_1g018205mg                   308   2e-97    
ref|XP_004987341.1|  PREDICTED: O-methyltransferase ZRP4-like iso...    309   2e-97    
ref|XP_003536186.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    308   2e-97    
ref|XP_010093975.1|  Isoflavone-7-O-methyltransferase 8                 308   2e-97    
ref|XP_010111158.1|  Tabersonine 16-O-methyltransferase                 308   3e-97    
ref|NP_001168311.1|  uncharacterized protein LOC100382077               306   5e-97    
gb|KDP24057.1|  hypothetical protein JCGZ_25714                         305   5e-97    
gb|KCW74499.1|  hypothetical protein EUGRSUZ_E03211                     307   5e-97    
ref|XP_010920170.1|  PREDICTED: trans-resveratrol di-O-methyltran...    307   6e-97    
gb|AFW60893.1|  O-methyltransferase ZRP4                                307   8e-97    
ref|XP_003536187.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    306   1e-96    
ref|XP_010916032.1|  PREDICTED: trans-resveratrol di-O-methyltran...    305   2e-96    
ref|XP_010023968.1|  PREDICTED: trans-resveratrol di-O-methyltran...    305   2e-96    
ref|XP_003615962.1|  O-methyltransferase                                304   3e-96    
gb|KDP21022.1|  hypothetical protein JCGZ_21493                         305   3e-96    
ref|XP_010093976.1|  Myricetin O-methyltransferase                      305   3e-96    
ref|XP_008788395.1|  PREDICTED: trans-resveratrol di-O-methyltran...    305   3e-96    
ref|XP_008359463.1|  PREDICTED: trans-resveratrol di-O-methyltran...    305   4e-96    
ref|XP_002305104.2|  6a-hydroxymaackiain methyltransferase family...    304   5e-96    
ref|XP_006371493.1|  hypothetical protein POPTR_0019s12280g             301   7e-96    
ref|XP_010052318.1|  PREDICTED: trans-resveratrol di-O-methyltran...    304   8e-96    
gb|KCW74012.1|  hypothetical protein EUGRSUZ_E02637                     303   8e-96    
ref|XP_002441376.1|  hypothetical protein SORBIDRAFT_09g025540          304   8e-96    
ref|XP_009628719.1|  PREDICTED: trans-resveratrol di-O-methyltran...    304   9e-96    
ref|XP_004252468.1|  PREDICTED: trans-resveratrol di-O-methyltran...    304   9e-96    
gb|EAZ42961.1|  hypothetical protein OsJ_27551                          303   1e-95    
ref|XP_008343876.1|  PREDICTED: trans-resveratrol di-O-methyltran...    304   1e-95    
ref|XP_008354304.1|  PREDICTED: trans-resveratrol di-O-methyltran...    304   1e-95    
gb|EAZ07211.1|  hypothetical protein OsI_29456                          303   2e-95    
ref|NP_001175192.1|  Os07g0463600                                       303   2e-95    
ref|XP_006471149.1|  PREDICTED: trans-resveratrol di-O-methyltran...    302   3e-95    
gb|KHN30531.1|  Isoflavone 7-O-methyltransferase                        301   5e-95    
ref|XP_011091736.1|  PREDICTED: trans-resveratrol di-O-methyltran...    308   6e-95    
ref|XP_009597678.1|  PREDICTED: trans-resveratrol di-O-methyltran...    303   7e-95    
ref|XP_010023967.1|  PREDICTED: trans-resveratrol di-O-methyltran...    301   7e-95    
emb|CBI21929.3|  unnamed protein product                                299   8e-95    
gb|EYU30782.1|  hypothetical protein MIMGU_mgv1a021078mg                301   8e-95    
gb|EMT10452.1|  O-methyltransferase ZRP4                                301   1e-94    
gb|KDO39394.1|  hypothetical protein CISIN_1g021867mg                   299   1e-94    
emb|CBI21931.3|  unnamed protein product                                298   1e-94    
ref|XP_011091579.1|  PREDICTED: trans-resveratrol di-O-methyltran...    300   2e-94    
ref|XP_010689977.1|  PREDICTED: trans-resveratrol di-O-methyltran...    300   2e-94    
ref|XP_009376908.1|  PREDICTED: trans-resveratrol di-O-methyltran...    301   2e-94    
ref|XP_011027758.1|  PREDICTED: trans-resveratrol di-O-methyltran...    300   2e-94    
ref|XP_003536188.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    300   2e-94    
ref|XP_003574581.2|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...    300   3e-94    
ref|XP_003569832.1|  PREDICTED: LOW QUALITY PROTEIN: O-methyltran...    300   3e-94    
ref|XP_008392936.1|  PREDICTED: trans-resveratrol di-O-methyltran...    300   3e-94    
ref|XP_003556407.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    299   4e-94    
ref|XP_008792251.1|  PREDICTED: trans-resveratrol di-O-methyltran...    299   6e-94    
gb|AAX82431.1|  3,5-dimethoxyphenol O-methyltransferase                 299   7e-94    
ref|XP_010680776.1|  PREDICTED: trans-resveratrol di-O-methyltran...    298   9e-94    
gb|ACU20151.1|  unknown                                                 298   1e-93    
ref|XP_006489814.1|  PREDICTED: trans-resveratrol di-O-methyltran...    298   1e-93    
ref|XP_008455942.1|  PREDICTED: trans-resveratrol di-O-methyltran...    297   2e-93    
gb|EMS45262.1|  O-methyltransferase ZRP4                                297   3e-93    
sp|Q6VMW0.1|Q8OMT_MENPI  RecName: Full=8-hydroxyquercetin 8-O-met...    297   3e-93    
ref|XP_011091734.1|  PREDICTED: trans-resveratrol di-O-methyltran...    296   3e-93    
ref|XP_006468348.1|  PREDICTED: trans-resveratrol di-O-methyltran...    296   5e-93    
ref|NP_001158962.1|  O-methyltransferase ZRP4                           297   6e-93    
ref|XP_011001215.1|  PREDICTED: trans-resveratrol di-O-methyltran...    296   6e-93    
ref|XP_006420642.1|  hypothetical protein CICLE_v10005275mg             296   8e-93    
ref|XP_006420643.1|  hypothetical protein CICLE_v10005276mg             296   1e-92    
gb|KHN30530.1|  Isoflavone 7-O-methyltransferase                        302   1e-92    
ref|XP_006448856.1|  hypothetical protein CICLE_v10015723mg             295   2e-92    
sp|Q93WU3.1|CVMT1_OCIBA  RecName: Full=Chavicol O-methyltransfera...    295   2e-92    
ref|XP_008649874.1|  PREDICTED: O-methyltransferase ZRP4-like           295   2e-92    
ref|XP_010070184.1|  PREDICTED: trans-resveratrol di-O-methyltran...    295   2e-92    
ref|XP_008677433.1|  PREDICTED: O-methyltransferase ZRP4 isoform X1     295   2e-92    
ref|XP_010070166.1|  PREDICTED: trans-resveratrol di-O-methyltran...    295   2e-92    
ref|XP_006377431.1|  6a-hydroxymaackiain methyltransferase family...    294   4e-92    
gb|KCW89595.1|  hypothetical protein EUGRSUZ_A01877                     294   5e-92    
ref|XP_007143925.1|  hypothetical protein PHAVU_007G114000g             293   7e-92    
ref|XP_006489813.1|  PREDICTED: 8-hydroxyquercetin 8-O-methyltran...    293   8e-92    
ref|XP_006420638.1|  hypothetical protein CICLE_v10005279mg             293   9e-92    
ref|XP_003555535.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    293   1e-91    
ref|XP_003568107.1|  PREDICTED: O-methyltransferase ZRP4-like           293   1e-91    
ref|XP_009396879.1|  PREDICTED: trans-resveratrol di-O-methyltran...    292   2e-91    
ref|XP_008359464.1|  PREDICTED: trans-resveratrol di-O-methyltran...    293   2e-91    
gb|KDO37374.1|  hypothetical protein CISIN_1g023625mg                   290   2e-91    
ref|XP_008649876.1|  PREDICTED: O-methyltransferase ZRP4-like           292   2e-91    
ref|XP_008454865.1|  PREDICTED: trans-resveratrol di-O-methyltran...    294   3e-91    
ref|XP_009791022.1|  PREDICTED: trans-resveratrol di-O-methyltran...    293   3e-91    
ref|XP_004983195.1|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...    292   3e-91    
gb|EAY82987.1|  hypothetical protein OsI_38209                          292   4e-91    
ref|XP_004489528.1|  PREDICTED: isoflavone-7-O-methyltransferase ...    291   5e-91    
gb|KHN05026.1|  Isoflavone 7-O-methyltransferase                        291   5e-91    
gb|ADO16249.1|  chavicol O-methyltransferase                            291   9e-91    
gb|KDO40717.1|  hypothetical protein CISIN_1g037127mg                   288   1e-90    
gb|AFW78710.1|  O-methyltransferase ZRP4                                290   2e-90    
ref|NP_001148593.1|  O-methyltransferase ZRP4                           290   2e-90    
ref|XP_008679470.1|  PREDICTED: O-methyltransferase ZRP4-like           290   3e-90    
dbj|BAI77794.1|  chavicol O-methyltransferase                           289   3e-90    
gb|ABA98340.1|  O-methyltransferase ZRP4, putative, expressed           289   3e-90    
ref|XP_003608210.1|  Isoflavone-7-O-methyltransferase                   289   4e-90    
ref|XP_003531866.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    288   6e-90    
ref|XP_006421002.1|  hypothetical protein CICLE_v10006550mg             288   9e-90    
gb|AEF14418.1|  isoflavone O-methyltranferase                           288   1e-89    
gb|EMS47465.1|  O-methyltransferase ZRP4                                288   1e-89    
gb|KGN44538.1|  hypothetical protein Csa_7G328260                       287   2e-89    
ref|NP_001140810.1|  uncharacterized protein LOC100272885               287   3e-89    
emb|CBI21927.3|  unnamed protein product                                284   3e-89    
ref|XP_003622357.1|  Isoflavone-7-O-methyltransferase                   287   4e-89    
ref|NP_001149121.1|  O-methyltransferase ZRP4                           287   4e-89    
ref|XP_006449423.1|  hypothetical protein CICLE_v10015724mg             286   4e-89    
emb|CBI21922.3|  unnamed protein product                                283   4e-89    
emb|CBI21932.3|  unnamed protein product                                289   5e-89    
ref|NP_001059585.2|  Os07g0464200                                       286   6e-89    
gb|EAZ39721.1|  hypothetical protein OsJ_24160                          286   6e-89    
gb|AFX68806.1|  O-metyltransferase                                      286   8e-89    
emb|CBI38115.3|  unnamed protein product                                283   8e-89    
gb|EAZ03784.1|  hypothetical protein OsI_25913                          285   9e-89    
gb|EMT18419.1|  O-methyltransferase ZRP4                                288   1e-88    
gb|KEH30963.1|  isoflavone-7-O-methyltransferase                        285   1e-88    
emb|CDM84119.1|  unnamed protein product                                285   2e-88    
ref|XP_010070153.1|  PREDICTED: trans-resveratrol di-O-methyltran...    285   2e-88    
gb|ABD83942.1|  IOMT 2                                                  285   2e-88    
ref|XP_010231163.1|  PREDICTED: O-methyltransferase ZRP4-like iso...    285   2e-88    
ref|XP_006467714.1|  PREDICTED: isoflavone 4'-O-methyltransferase...    285   2e-88    
gb|AFK42082.1|  unknown                                                 285   2e-88    
ref|XP_002447425.1|  hypothetical protein SORBIDRAFT_06g000820          285   2e-88    
ref|XP_002441372.1|  hypothetical protein SORBIDRAFT_09g025510          284   2e-88    
dbj|BAC99560.1|  putative flavonoid 7-O-methyltransferase               284   4e-88    
ref|XP_010231162.1|  PREDICTED: O-methyltransferase ZRP4-like iso...    285   4e-88    
ref|XP_003533873.1|  PREDICTED: isoflavone-7-O-methyltransferase ...    283   5e-88    
ref|XP_010683510.1|  PREDICTED: trans-resveratrol di-O-methyltran...    283   5e-88    
emb|CAA54616.1|  flavonoid 7-O-methyltransferase                        284   8e-88    
emb|CBI21926.3|  unnamed protein product                                281   8e-88    
gb|EAZ06414.1|  hypothetical protein OsI_28644                          283   9e-88    
sp|O24305.1|M3OM1_PEA  RecName: Full=(+)-6a-hydroxymaackiain 3-O-...    283   1e-87    
dbj|BAJ96211.1|  predicted protein                                      284   1e-87    
ref|XP_006467715.1|  PREDICTED: isoflavone 4'-O-methyltransferase...    283   1e-87    
gb|AES78096.2|  isoflavone-7-O-methyltransferase                        282   1e-87    
gb|KDP35402.1|  hypothetical protein JCGZ_10386                         281   1e-87    
sp|O24529.1|7OMT8_MEDSA  RecName: Full=Isoflavone-7-O-methyltrans...    282   1e-87    
gb|EAZ06416.1|  hypothetical protein OsI_28646                          283   2e-87    
sp|O22308.1|7OMT6_MEDSA  RecName: Full=Isoflavone-7-O-methyltrans...    282   2e-87    
sp|Q93WU2.1|EOMT1_OCIBA  RecName: Full=Eugenol O-methyltransferas...    282   2e-87    
ref|XP_002456368.1|  hypothetical protein SORBIDRAFT_03g034845          283   2e-87    
ref|XP_004505392.1|  PREDICTED: isoflavone-7-O-methyltransferase ...    282   2e-87    
gb|EMT10454.1|  O-methyltransferase ZRP4                                282   2e-87    
dbj|BAJ90281.1|  predicted protein                                      282   2e-87    
ref|NP_001241010.1|  uncharacterized protein LOC100812688               281   3e-87    
gb|ABD83944.1|  IOMT 4                                                  281   3e-87    



>ref|XP_002278294.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   403 bits (1035),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 196/358 (55%), Positives = 251/358 (70%), Gaps = 5/358 (1%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG++  ELL A+AH WNH  ++I+S +LKCA+QLGIPD IHNH KPM    L+A LP+HP
Sbjct  5     NGEISAELLHAQAHVWNHIFNFINSMSLKCAIQLGIPDIIHNHGKPMTFPELVAKLPVHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
              ++  ++RL R LVHS   L  +     EQEE Y LT   RLL+ ++++++R FL    +
Sbjct  65    KRSQCVYRLMRILVHSG-FLAAQRVQQGEQEEGYVLTDASRLLLMDDSLSIRPFLLAMLD  123

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K  + L  WFQNDDP+PF TAH +  WDY  HEP  N+ FNEA A DS L++ VLL
Sbjct  124   PVLTKPWHYLSAWFQNDDPTPFHTAHEQPFWDYAGHEPQLNNFFNEAMASDSRLVISVLL  183

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
               E K +F+GL SLVDV GG G VA AIA  FP + C VLDLPHV+A +     +N+ + 
Sbjct  184   K-EGKGLFEGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQES--KNLNYF  240

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
             AG+MFE+IP A+A+LLKWI+HDW DEECVKILK+CREAIP +E GGKVIIIDM+M    +
Sbjct  241   AGDMFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMK-NQ  299

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              D    + QLY D ++M L   +ER++ +WEKLF +AGFS YKITP LGLRSLIEV+P
Sbjct  300   GDYKSVETQLYFDMVMMILVTGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>emb|CAN78992.1| hypothetical protein VITISV_005827 [Vitis vinifera]
Length=357

 Score =   400 bits (1029),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 195/358 (54%), Positives = 250/358 (70%), Gaps = 5/358 (1%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG++  ELL A+AH WNH  ++I+S +LKCA+QLGIPD IHNH KPM    L+A LP+HP
Sbjct  5     NGEISAELLHAQAHVWNHIFNFINSMSLKCAIQLGIPDIIHNHGKPMTFPELVAKLPVHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
              ++  ++RL R LVHS   L  +     EQEE Y LT   RLL+ ++++++R FL    +
Sbjct  65    KRSQCVYRLMRILVHSG-FLAAQRVQQGEQEEGYVLTDASRLLLMDDSLSIRPFLLAMLD  123

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K  + L  WFQNDDP+PF TAH +  WDY  HEP  N+ FNEA A DS L++ VLL
Sbjct  124   PVLTKPWHYLSAWFQNDDPTPFHTAHEQPFWDYAGHEPQLNNFFNEAMASDSRLVISVLL  183

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
               E K +F+GL SLVDV GG G VA AIA  FP + C VLD PHV+A +     +N+ + 
Sbjct  184   K-EGKGLFEGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDPPHVVAGLQES--KNLNYF  240

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
             AG+MFE+IP A+A+LLKWI+HDW DEECVKILK+CREAIP +E GGKVIIIDM+M    +
Sbjct  241   AGDMFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMK-NQ  299

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              D    + QLY D ++M L   +ER++ +WEKLF +AGFS YKITP LGLRSLIEV+P
Sbjct  300   GDYKSVETQLYFDMVMMILVTGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>ref|XP_003633248.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score =   397 bits (1019),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 193/358 (54%), Positives = 248/358 (69%), Gaps = 5/358 (1%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG++  ELL A+AH WNH L++I S +LKCA+QLGIPD IHNH KPM L  L+A LP+HP
Sbjct  5     NGEISAELLHAQAHVWNHILNFIKSVSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
              ++  ++RL R LVHS   L  +S    E+EE Y LT   RLL+ ++++++R  L    +
Sbjct  65    KRSQCVYRLMRILVHSG-FLAAQSVQQGEEEEGYVLTDASRLLLMDDSLSIRPLLLAMLD  123

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              +  K  + L  WFQNDDP+PF TAH    WDY  HEP  N+ FNEA A D+ L+  VLL
Sbjct  124   PILTKPWHYLSAWFQNDDPTPFHTAHERPFWDYAGHEPQLNNFFNEAMASDARLVTSVLL  183

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
               E K VF+GL SLVDV GG G VA AIA  FP + C VLDLPHV+A +     +N+ + 
Sbjct  184   K-EGKGVFEGLNSLVDVGGGTGQVAKAIANAFPHLNCTVLDLPHVVAGLQGS--KNLNYF  240

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
             AG++FE+IP A+A+LLKWI+HDW DEECVKILK+CREAIP +E GGKVIIIDM+M    +
Sbjct  241   AGDIFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMK-NQ  299

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              D    + QL+ D  +M     +ER++ +WEKLF +AGFS YKITP LGLRSLIEV+P
Sbjct  300   GDYKSIETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>ref|XP_003633249.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score =   396 bits (1017),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 193/358 (54%), Positives = 247/358 (69%), Gaps = 5/358 (1%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG++  ELL A+AH WNH L++I S +LKCA+QLGIPD IHNH KPM L  L+A LP+HP
Sbjct  5     NGEISAELLHAQAHVWNHILNFIKSVSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
              ++  ++RL R LVHS  L   +    EE EE Y LT   RLL+ ++++++R  L    +
Sbjct  65    KRSQCVYRLMRILVHSGFLAAQRVQQGEE-EEGYVLTDASRLLLMDDSLSIRPLLLAMLD  123

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              +  K  + L  WFQNDDP+PF TAH    WDY  HEP  N+ FNEA A D+ L+  VLL
Sbjct  124   PILTKPWHYLSAWFQNDDPTPFHTAHERPFWDYAGHEPQLNNFFNEAMASDARLVTSVLL  183

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
               E K VF+GL SLVDV GG G VA AIA  FP + C VLDLPHV+A +     +N+ + 
Sbjct  184   K-EGKGVFEGLNSLVDVGGGTGQVAKAIANAFPHLNCTVLDLPHVVAGLQGS--KNLNYF  240

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
             AG++FE+IP A+A+LLKWI+HDW DEECVKILK+CREAIP +E GGKVIIIDM+M    +
Sbjct  241   AGDIFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMK-NQ  299

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              D    + QL+ D  +M     +ER++ +WEKLF +AGFS YKITP LGLRSLIEV+P
Sbjct  300   GDYKSIETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>ref|XP_009612081.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=350

 Score =   395 bits (1015),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 198/362 (55%), Positives = 257/362 (71%), Gaps = 15/362 (4%)
 Frame = +2

Query  50    MAENGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALP  229
             M ENG    ELLQA    WNH  +++ S+A KCAVQLGIPD ++ H K M LS+L AALP
Sbjct  3     MNENGST--ELLQAHTQIWNHIYNFVSSSAAKCAVQLGIPDVLYKHGKSMCLSDLSAALP  60

Query  230   IHPSKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNI  409
             ++PSK  ++  L R LVHS  L         E E+ YSLTP  RL +K++ +++R++  I
Sbjct  61    LNPSKISFLPILIRSLVHSGFL--------NEHEDYYSLTPASRLFLKDDPLSMRSYFLI  112

Query  410   CNEYVFQKSCYALGDWFQNDDPSPFCTAH-GEKIWDYISHEPVYNDVFNEATAKDSELIM  586
              ++   QK  + L  WFQND P+ F  AH G+  WDY + EP  N++FN++ A DS LI 
Sbjct  113   MHDPCVQKPWFELSSWFQNDFPTAFHAAHNGKSFWDYFADEPRVNNIFNDSMANDSSLIA  172

Query  587   EVLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIEN  766
              VL+  E K VF+GL SLVDV GG G +A AIAK FPA+ C VLDLPHVI  +      N
Sbjct  173   NVLIT-ECKHVFEGLTSLVDVGGGTGTLAIAIAKAFPAINCTVLDLPHVIGDLKGSG--N  229

Query  767   MEFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVME  946
             +EFV G+MFE IP ANA+LLKWI+H+W DE+CVKILKKC+E+IP RE+GGKVIIID+V+E
Sbjct  230   LEFVGGSMFEKIPNANAILLKWILHNWGDEDCVKILKKCKESIPSREKGGKVIIIDIVLE  289

Query  947   DPKRTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEV  1126
             +PK+ D    +AQ  MD ++M L+G+KER KK+WEKLF+EAGFS+Y+ITPTLG RSLIE+
Sbjct  290   NPKQKDDSV-RAQHNMDLVMMVLFGAKERTKKEWEKLFTEAGFSEYEITPTLGTRSLIEI  348

Query  1127  FP  1132
             +P
Sbjct  349   YP  350



>ref|XP_011002662.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=357

 Score =   395 bits (1016),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 193/358 (54%), Positives = 256/358 (72%), Gaps = 6/358 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             +GK   ELL+A+AH WNH  S+I+S +LKCA+ LGIPD I+ H+KP+ L  LIAALP+HP
Sbjct  6     DGKHDPELLKAQAHIWNHIFSFINSMSLKCAIDLGIPDIINKHSKPVTLPELIAALPVHP  65

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             SKA  + RL R L+HS      K   D +QEE Y LT   +LL+K+   ++  FL    +
Sbjct  66    SKARCVPRLMRLLIHSGFFEKQKVSED-DQEEGYVLTNASQLLLKDNPFSVAPFLQAVLD  124

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              +  K  + +  W +NDDP+PF TAHG   WDY+ HEPV+N +FN+A A D+ L+  VL+
Sbjct  125   PILTKPWHFVSTWLKNDDPTPFDTAHGRTFWDYVGHEPVFNHLFNDAMASDARLVTRVLI  184

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             N E K VF+GL SLVDV GG G VA++IAK FP + C V DLPHV+A +     EN+++V
Sbjct  185   N-ECKEVFEGLGSLVDVGGGTGTVANSIAKAFPHLDCTVFDLPHVVADLQGS--ENLKYV  241

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE+IP A+ ++LKWI+HDW DEECVKILKKC+EAI  R EGGKV+II+M+ME+ K 
Sbjct  242   GGDMFEAIPPADGIVLKWILHDWNDEECVKILKKCKEAIKDR-EGGKVMIIEMMMENQKG  300

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              D    + Q++ D L+M L+  +ERN+K+W KLFS+AGFS+YKITP LGLRS+IEVFP
Sbjct  301   EDESI-ETQIFFDMLMMILFTGQERNEKEWAKLFSDAGFSNYKITPILGLRSIIEVFP  357



>ref|XP_009778350.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
sylvestris]
Length=350

 Score =   395 bits (1015),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 192/353 (54%), Positives = 252/353 (71%), Gaps = 9/353 (3%)
 Frame = +2

Query  74    GELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPY  253
              ELLQA+A TWNH   + +S+A++CAVQLGIPD ++ H KPM LS+L++ LP+HPSK   
Sbjct  7     SELLQAQAQTWNHIFDFTNSSAVRCAVQLGIPDVLYKHGKPMCLSDLLSQLPLHPSKVSS  66

Query  254   IHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQK  433
             +  L R LVHS  L        E+    YSLTP  RLLV+ E +N+R+ L I +E   QK
Sbjct  67    MPILLRLLVHSGFL-----NQHEKDHYYYSLTPASRLLVRNEPLNIRSLLLINHEPFLQK  121

Query  434   SCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESK  613
             + + L  WFQND P+ F TAHG+  WDY + +P     FN+A A DS LI +V +  E K
Sbjct  122   AWFELSSWFQNDFPTAFHTAHGKSFWDYFTEKPRQGSDFNDAMASDSRLIADVFVK-ECK  180

Query  614   RVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMF  793
              VF+GL+SLVDV GG G VA+ IAK  P +KCIV DLP V+A +      N+EFV G+MF
Sbjct  181   HVFEGLESLVDVGGGTGTVATVIAKANPTIKCIVFDLPRVVADLKGSG--NLEFVGGSMF  238

Query  794   ESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAYY  973
             + IP  NA+LLK I+HDW DE+CVKILKKC+E+IP R++GGKVIIID+VMEDP ++D + 
Sbjct  239   DEIPHVNAILLKCILHDWSDEDCVKILKKCKESIPSRDKGGKVIIIDIVMEDPTQSDEFV  298

Query  974   NKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              +AQ  MD L+M L+ +KER KK+W+KLF+EAGF++ KITP+LGLRSLIE++P
Sbjct  299   -RAQHSMDLLMMILFAAKERTKKEWQKLFTEAGFTECKITPSLGLRSLIEIYP  350



>ref|XP_003633245.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score =   394 bits (1013),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 193/352 (55%), Positives = 249/352 (71%), Gaps = 6/352 (2%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYI  256
             ELLQA+ HTW H+ ++++S  LKCA+QLGIPD IH+H +PM LS LI AL + P+KAP +
Sbjct  12    ELLQAQVHTWKHTTNFVNSMVLKCAIQLGIPDVIHSHGQPMALSQLITALSLEPTKAPCL  71

Query  257   HRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQKS  436
             +RL R LVHS      K   + E+EE YSLT   + L+K+E ++   FL +  + +    
Sbjct  72    YRLMRVLVHSGFFAQQKLLHNSEEEEGYSLTFASQFLLKDEPVSGVPFLLLQLDPILTAP  131

Query  437   CYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESKR  616
              + LGDWFQN+DP+PF TAH +  WDY  HEP  ND+FNE    DS LI  +++  + K 
Sbjct  132   WHFLGDWFQNEDPTPFHTAHRKSFWDYAVHEPKLNDIFNETMVSDSRLIANMIVR-QYKE  190

Query  617   VFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMFE  796
             VF+GL SLVDV GG G +  AIAK FP +KCIV D PHV+A++  G  EN+E V GN+FE
Sbjct  191   VFEGLASLVDVGGGTGTMVKAIAKAFPQLKCIVFDQPHVVANLEVG--ENLEIVGGNIFE  248

Query  797   SIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAYYN  976
             +IP A+A+LLKWI+HDW DEECVKILKKC+ AIP   +GGKVIIIDMV+E  K  D    
Sbjct  249   AIPPADAILLKWILHDWSDEECVKILKKCKGAIP--NKGGKVIIIDMVVESNK-GDNKAV  305

Query  977   KAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
             + QL++D L+M +   KERN+K+WEKLF  AGF+ YKITP LGLRSLIEV+P
Sbjct  306   ETQLFIDMLMMVVVAGKERNEKEWEKLFLAAGFTHYKITPALGLRSLIEVYP  357



>ref|XP_011002663.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=357

 Score =   394 bits (1013),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 192/358 (54%), Positives = 255/358 (71%), Gaps = 6/358 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             +GK   ELL+A+AH WNH  S+I+S +LKCA+ LGIPD I+ H+KP+ L  LIA LP+HP
Sbjct  6     DGKHDPELLKAQAHIWNHIFSFINSMSLKCAIDLGIPDIINKHSKPVTLPELIATLPVHP  65

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             SKA  + RL R L+HS      K   D +QEE Y LT   +LL+K+   ++  FL    +
Sbjct  66    SKARCVPRLMRLLIHSGFFEKQKVSED-DQEEGYVLTNASQLLLKDNPFSVAPFLQAVLD  124

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              +  K  + +  W +NDDP+PF TAHG   WDY+ HEPV+N +FN+A A D+ L+  VL+
Sbjct  125   PILTKPWHFVSTWLKNDDPTPFDTAHGRTFWDYVGHEPVFNHLFNDAMASDARLVTRVLI  184

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             N E K VF+GL SLVDV GG G VA++IAK FP + C V DLPHV+A +     EN+++V
Sbjct  185   N-ECKEVFEGLGSLVDVGGGTGTVANSIAKAFPHLDCTVFDLPHVVADLQGS--ENLKYV  241

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE+IP A+ ++LKWI+HDW DEECVKILKKC+EAI  R EGGKV+II+M+ME+ K 
Sbjct  242   GGDMFEAIPPADGIVLKWILHDWNDEECVKILKKCKEAIKDR-EGGKVMIIEMMMENQKG  300

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              D    + Q++ D L+M L+  +ERN+K+W KLFS+AGFS+YKITP LGLRS+IEVFP
Sbjct  301   EDESI-ETQIFFDMLMMILFTGQERNEKEWAKLFSDAGFSNYKITPILGLRSIIEVFP  357



>ref|XP_002278211.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   394 bits (1012),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 193/359 (54%), Positives = 250/359 (70%), Gaps = 5/359 (1%)
 Frame = +2

Query  56    ENGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIH  235
             E+ +   ELL A+AH WNH  ++I+S +LKCA+QLGIPD IHNH KPM L  L+A LPIH
Sbjct  4     ESVETSSELLHAQAHVWNHIFNFINSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPIH  63

Query  236   PSKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICN  415
             P K   ++RL R LV S      K   + EQEE Y LT   RLL++++ +++R FL    
Sbjct  64    PKKVWCVYRLMRILVQSGFFARQKVE-ESEQEEGYVLTHASRLLLEDDPLSVRPFLLAML  122

Query  416   EYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVL  595
             + +  K  + +  WFQNDDP+PF TAHG   WDY  HEP  N+ FNEA A D+ L+  VL
Sbjct  123   DPILTKPWHYVSAWFQNDDPTPFDTAHGRTFWDYGGHEPKINNFFNEAMASDARLVTSVL  182

Query  596   LNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEF  775
             +  + K VF+GL SLVDV GG G VA AIA  FP + C V DLPHV+A +     +N+ +
Sbjct  183   IK-DCKGVFEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVFDLPHVVAGLEGS--KNLNY  239

Query  776   VAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPK  955
             + G+MF+ IP A+A+LLKWI+HDW DEECVKIL++CR+AIP +E+GGKVIIIDM+ME+ K
Sbjct  240   LGGDMFKGIPPADAILLKWILHDWNDEECVKILQQCRQAIPSKEKGGKVIIIDMMMENQK  299

Query  956   RTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
               D    + QL+ D L+M L   +ERN+K+WEKLF +AGFS YKITP LGLRSLIEV+P
Sbjct  300   GDDESM-ETQLFFDMLMMILVTGQERNEKEWEKLFLDAGFSGYKITPILGLRSLIEVYP  357



>ref|XP_002326036.2| hypothetical protein POPTR_0019s12290g [Populus trichocarpa]
 gb|EEF00418.2| hypothetical protein POPTR_0019s12290g [Populus trichocarpa]
Length=357

 Score =   392 bits (1007),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 196/358 (55%), Positives = 251/358 (70%), Gaps = 7/358 (2%)
 Frame = +2

Query  62    GKLHG-ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             G LHG ELLQA+AH WNH  ++++S +LKCA+QLGIPD IHNH KPM LS L+A LPIHP
Sbjct  6     GNLHGAELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDVIHNHGKPMTLSELVAVLPIHP  65

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             SKAP I+RL R LVHS     T++   E + E Y LT   +LL+K+   ++  FL    +
Sbjct  66    SKAPGIYRLMRILVHSG-FFATQNNSGETEGEGYVLTNASQLLIKDNPFSVTPFLLAMLD  124

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              +  +  + +  WFQND PS F TAH    W+Y  HE   N  FNEA A D+ L+  VL+
Sbjct  125   PILTQPWHYVSVWFQNDAPSSFYTAHQRTSWEYAGHETELNHFFNEAMASDARLVSSVLV  184

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             N E K VF+GL SLVDV GG G VA AIAK F  + C V DLPHV+A +     EN++++
Sbjct  185   N-ECKGVFEGLNSLVDVGGGTGTVAKAIAKEFQHLDCTVFDLPHVVAGLEGS--ENLKYL  241

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
             +G+MFE+IP A+A+LLKWI+HDW DEECVKILK+C+EAI  R EGGK+IIIDMV+E+ K 
Sbjct  242   SGDMFEAIPQADAILLKWILHDWNDEECVKILKQCKEAIKGR-EGGKLIIIDMVVENNKE  300

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              +    + QL+ D L+M L   KERN+K+W KLF++AGFS+YKI P LGLRSLIEV+P
Sbjct  301   VEG-STETQLFFDMLMMILVTGKERNEKEWAKLFTDAGFSNYKINPVLGLRSLIEVYP  357



>ref|XP_009605623.1| PREDICTED: myricetin O-methyltransferase-like [Nicotiana tomentosiformis]
Length=364

 Score =   392 bits (1007),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 195/363 (54%), Positives = 248/363 (68%), Gaps = 12/363 (3%)
 Frame = +2

Query  50    MAENGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALP  229
             M+ N     +LL+A+A  WNH  S+I+S+A KCAVQLGIPD ++ H KPM  SNL A LP
Sbjct  12    MSTNENGSTDLLRAQAQIWNHMFSFINSSAAKCAVQLGIPDILYKHDKPMSFSNLSAELP  71

Query  230   -IHPSKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLN  406
              +H SK  ++  L RFLVHS  L       ++  +  YSLTP  RLLV       R+   
Sbjct  72    LVHLSKVSFLPILMRFLVHSGFL-------NQHDQNHYSLTPASRLLVTNNPSGTRSHFL  124

Query  407   ICNEYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIM  586
             I ++ +FQK+ + L  WFQND P+ F TA+G   WDY   +P   + FN+A A DS L+ 
Sbjct  125   INHDQLFQKASFELSSWFQNDSPTAFHTAYGISFWDYFVEKPKLGESFNDAMASDSMLVA  184

Query  587   EVLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIEN  766
              VL+  E K VF+GL SLVDV GG G VA AIAK FP + C V DLPHVI  +      N
Sbjct  185   NVLIT-ECKYVFEGLTSLVDVGGGTGTVAIAIAKAFPMINCTVFDLPHVIGDLKGSG--N  241

Query  767   MEFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVME  946
             ++FV G+MF+ IP ANA+LLKWI+HDW DE+CVKILKKC+EAIP RE+GGKVIIIDMVME
Sbjct  242   LDFVGGSMFDKIPNANAILLKWILHDWSDEDCVKILKKCKEAIPCREKGGKVIIIDMVME  301

Query  947   DPKR-TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIE  1123
             DPK  +D  + + Q  MD L+M L+ +KER KK+WEKLF+E+GF+ YKITP+LG RSLIE
Sbjct  302   DPKLISDEEFVRTQHNMDLLMMLLFAAKERTKKEWEKLFTESGFTQYKITPSLGSRSLIE  361

Query  1124  VFP  1132
             ++P
Sbjct  362   IYP  364



>ref|XP_002281368.2| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score =   391 bits (1005),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 191/358 (53%), Positives = 244/358 (68%), Gaps = 5/358 (1%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG++  ELL A+AH WNH  ++I S +LKCA QLGIPD IHNH KPM L  L+A LP+HP
Sbjct  5     NGEISAELLHAQAHVWNHIFNFIKSMSLKCATQLGIPDIIHNHGKPMTLPELVAKLPVHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
              ++  ++RL R LVHS  L   +    EE EE Y LT   RLL+ ++++++R  +    +
Sbjct  65    KRSQCVYRLMRILVHSGFLAAQRVQQGEE-EEGYVLTDASRLLLMDDSLSIRPLVLAMLD  123

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              +  K  + L  WFQNDDP+PF TA+    WDY  HEP  N+ FNEA A D+ L+  VLL
Sbjct  124   PILTKPWHYLSAWFQNDDPTPFHTAYERPFWDYAGHEPQLNNSFNEAMASDARLLTSVLL  183

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
               E K VF GL SLVDV GG G VA AIA  FP + C VLDLPHV+A +     +N+ + 
Sbjct  184   K-EGKGVFAGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQGS--KNLNYF  240

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
             AG+MFE+IP A+A+LLKWI+HDW DEECVKILK+CREAIP +E GGKVIIIDM+M    +
Sbjct  241   AGDMFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMK-NQ  299

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              D    + QL+ D  +M     +ER++ +WEKLF +AGFS YKITP LGLRSLIEV+P
Sbjct  300   GDYKSTETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>emb|CAN61955.1| hypothetical protein VITISV_020020 [Vitis vinifera]
Length=357

 Score =   391 bits (1005),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 192/359 (53%), Positives = 249/359 (69%), Gaps = 5/359 (1%)
 Frame = +2

Query  56    ENGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIH  235
             E+ +   ELL A+AH WNH  ++I+S +LKCA+QLGIPD IHNH KPM L  L+A LPIH
Sbjct  4     ESVETSSELLHAQAHVWNHIFNFINSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPIH  63

Query  236   PSKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICN  415
             P K   ++RL R LV S      K   + EQEE Y LT   RLL++++ +++R FL    
Sbjct  64    PKKVWCVYRLMRILVQSGFFARQKVE-ESEQEEGYVLTHASRLLLEDDPLSVRPFLLAML  122

Query  416   EYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVL  595
             + +  K  + +  WFQNDDP+PF TAHG   WDY  HEP  N+ FNEA A D+ L+   L
Sbjct  123   DPILTKPWHYVSAWFQNDDPTPFDTAHGXTFWDYGGHEPKJNNFFNEAMASDARLVTSXL  182

Query  596   LNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEF  775
             +  + K VF+GL SLVDV GG G VA AIA  FP + C V DLPHV+A +     +N+ +
Sbjct  183   IK-DCKGVFEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVFDLPHVVAGLEGS--KNLNY  239

Query  776   VAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPK  955
             + G+MF+ IP A+A+LLKWI+HDW DEECVKIL++CR+AIP +E+GGKVIIIDM+ME+ K
Sbjct  240   LGGDMFKGIPPADAILLKWILHDWNDEECVKILQQCRQAIPSKEKGGKVIIIDMMMENQK  299

Query  956   RTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
               D    + QL+ D L+M L   +ERN+K+WEKLF +AGFS YKITP LGLRSLIEV+P
Sbjct  300   GDDESM-ETQLFFDMLMMILVTGQERNEKEWEKLFLDAGFSGYKITPILGLRSLIEVYP  357



>gb|AEF97347.1| O-methyltransferase [Vitis pseudoreticulata]
Length=357

 Score =   391 bits (1004),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 190/358 (53%), Positives = 243/358 (68%), Gaps = 5/358 (1%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG +  ELL A+AH WNH  ++I S +LKCA QLGIPD IHNH KPM L  L+A LP+HP
Sbjct  5     NGVISAELLHAQAHVWNHIFNFIKSMSLKCATQLGIPDIIHNHGKPMTLPELVAKLPVHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
              ++  ++RL R LVHS  L   +    +E EE Y LT   RLL+ ++++++R  +    +
Sbjct  65    KRSQCVYRLMRILVHSGFLAAQRVQQGKE-EEGYVLTDASRLLLMDDSLSIRPLVLAMLD  123

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              +  K  + L  WFQNDDP+PF TAH    WDY  HEP  N+ FNEA A D+ L+  VLL
Sbjct  124   PILTKPWHYLSAWFQNDDPTPFHTAHERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLL  183

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
               E + VF GL SLVDV GG G VA AIA  FP + C VLDLPHV+A +     +N+ + 
Sbjct  184   K-EGQGVFAGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQGS--KNLNYF  240

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
             AG+MFE+IP A+A+LLKWI+HDW DEECVKILK+CREAIP +E GGKVIIIDM+M    +
Sbjct  241   AGDMFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMK-NQ  299

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              D    + QL+ D  +M     +ER++ +WEKLF +AGFS YKITP LGLRSLIEV+P
Sbjct  300   GDYKSTETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>ref|XP_002277927.2| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   390 bits (1001),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 197/358 (55%), Positives = 253/358 (71%), Gaps = 5/358 (1%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             N ++  ELLQA+AH WNH  ++++S +LKCA+QLGIPD IHNH KPM L  L+A LP+HP
Sbjct  5     NSEMSSELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDIIHNHGKPMTLPQLVAKLPVHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
              K  Y++RL R LV S      ++   EE EE Y LT   RLL+K++++++R FL    +
Sbjct  65    KKTQYVYRLMRVLVQSDFFAAQRAQQSEE-EEGYVLTHASRLLLKDDSLSVRPFLLAMLD  123

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
                 K  + +  WFQNDDP+PF TAH   +WDY  HEP  N  FNEA A D+ L+  VL+
Sbjct  124   PTLTKPWHYVSAWFQNDDPTPFDTAHERTLWDYAGHEPQLNYFFNEAMASDARLVTSVLV  183

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
               E K VF+GL SLVDV GG G VA AIA  FP +KC VLDLPHV+A +     +N+ + 
Sbjct  184   K-EGKGVFEGLNSLVDVGGGTGTVAKAIANAFPHLKCTVLDLPHVVAGLQGS--KNLNYF  240

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
             AG+MFE+IP A+A+LLKWI+HDW DEECVKILK+CREAIP +E GGKVIIIDM++++ ++
Sbjct  241   AGDMFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKERGGKVIIIDMMVKN-QK  299

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              D    + QL+ D L+M L   KER +K+WEKLF EAGFS YKITP LGLRSLIEV+P
Sbjct  300   GDCKSRETQLFFDMLMMVLVTGKEREEKEWEKLFLEAGFSHYKITPILGLRSLIEVYP  357



>emb|CAQ76879.1| resveratrol O-methyltransferase [Vitis vinifera]
Length=357

 Score =   390 bits (1001),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 190/358 (53%), Positives = 244/358 (68%), Gaps = 5/358 (1%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG +  ELL A+AH WNH  ++I S +LKCA+QLGIPD IHNH KPM L  L+A LP+HP
Sbjct  5     NGVISAELLHAQAHVWNHIFNFIKSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
              ++  ++RL R LVHS  L   +    +E EE Y LT   RLL+ ++++++R  +    +
Sbjct  65    KRSQCVYRLMRILVHSGFLAAQRVQQGKE-EEGYVLTDASRLLLMDDSLSIRPLVLAMLD  123

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              +  K  + L  WFQNDDP+PF TAH    WDY  HEP  N+ FNEA A D+ L+  VLL
Sbjct  124   PILTKPWHYLSAWFQNDDPTPFHTAHERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLL  183

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
               E + VF GL SLVDV GG G VA AIA  FP + C VLDLPHV+A +     +N+ + 
Sbjct  184   K-EGQGVFAGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQGS--KNLNYF  240

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
             AG+MFE+IP A+A+LLKWI+HDW DEECVKILK+CREAIP +E GGKVIIIDM+M    +
Sbjct  241   AGDMFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMK-NQ  299

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              D    + QL+ D  +M     +ER++ +WEKLF +AGFS YKITP LGLRSLIEV+P
Sbjct  300   GDYKSTETQLFFDMTMMIFAPGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>ref|XP_002274019.2| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   389 bits (999),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 197/358 (55%), Positives = 253/358 (71%), Gaps = 5/358 (1%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG++  ELLQA+AH WNH  ++++S +LKCA+QLGIPD IHNH KPM L  L+A LP+HP
Sbjct  5     NGEISSELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
              K  Y++RL R LV S      ++   EE EE Y LT   RLL+K++++++R FL    +
Sbjct  65    KKTQYVYRLMRVLVQSDFFAAQRAQQSEE-EEGYVLTHASRLLLKDDSLSVRPFLLAMLD  123

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
                 K  + +  WFQNDDP+PF TAH   +WDY  HEP  N  FNEA A D+ L+  VL+
Sbjct  124   PTLTKPWHYVSAWFQNDDPTPFDTAHERTLWDYAGHEPQLNYFFNEAMASDARLVTSVLV  183

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
               E K VF+GL SLVDV GG G VA AIA  FP + C VLDLPHV+A +     +N+ + 
Sbjct  184   K-EGKGVFEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVLDLPHVVAGLQGS--KNLNYF  240

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
             AG+MFE+IP A+A+LLKWI+HDW DEECVKILK+CREAIP +E GGKVIIIDM++++ ++
Sbjct  241   AGDMFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKERGGKVIIIDMMVKN-QK  299

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              D    + QL+ D L+M L   KER +K+WEKLF EAGFS YKITP LGLRSLIEV+P
Sbjct  300   GDCKSRETQLFFDMLMMVLVTGKEREEKEWEKLFLEAGFSHYKITPILGLRSLIEVYP  357



>ref|XP_011002666.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=357

 Score =   388 bits (997),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 190/358 (53%), Positives = 252/358 (70%), Gaps = 6/358 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             +GK   ELL+A+AH WNH  ++I+S +LKCA+ LGIPD I+ H+KP+ L  LIAALP+HP
Sbjct  6     DGKHDRELLKAQAHIWNHIFNFINSMSLKCAIDLGIPDIINKHSKPVTLPELIAALPVHP  65

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
              KA  + RL R L+HS      K   D +QEE Y LT   +LL+K+   ++  FL    +
Sbjct  66    GKARCVPRLMRLLIHSGFFEKQKVSED-DQEEGYILTNASQLLLKDNPFSVAPFLQAVLD  124

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              +  K  + +  W +NDDP+PF TAHG   WDY+ HEPV+N +FN+A A D+ L+  VL+
Sbjct  125   PILTKPWHFVSTWLKNDDPTPFDTAHGRTFWDYVGHEPVFNHLFNDAMASDARLVTRVLI  184

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             N E K VF+GL SLVDV GG G VA +IAK FP + C V DLPHV+A +     EN+++V
Sbjct  185   N-ECKEVFEGLGSLVDVGGGTGTVAKSIAKAFPHLDCTVFDLPHVVADLQGS--ENLKYV  241

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE+IP A+ ++LKWI+HDW DEECVKILKKC+EAI  R EGGKV+II+M+ME+ K 
Sbjct  242   GGDMFEAIPPADGIVLKWILHDWNDEECVKILKKCKEAIKDR-EGGKVMIIEMMMENQKG  300

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              D    + Q++ D L+M L   +ERN+K+W KLFS+A FS+YKITP LGLRS+IEVFP
Sbjct  301   EDDSI-ETQIFFDMLMMILVTGQERNEKEWAKLFSDASFSNYKITPILGLRSIIEVFP  357



>ref|XP_002278149.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   388 bits (997),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 192/359 (53%), Positives = 255/359 (71%), Gaps = 7/359 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             +GK    LLQA+AH WNH++++++S ALKCAV+LGIPD I+NH +P+ LS L+ AL I+P
Sbjct  5     SGKRASLLLQAQAHVWNHTMNFVNSMALKCAVRLGIPDAINNHGQPITLSELVTALSINP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
              KAP +HRL R LVHS      +     EQE+ YSLT   R L+K+E  +    L +  +
Sbjct  65    IKAPCLHRLMRVLVHSG-FFAQQQADHNEQEQLYSLTYASRFLLKDEPTSGAPLLLVQVD  123

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
                   C+ L DWF+N DP+PF TA+G+  WDY +HEP +N+ FNEA A DS+LI  V++
Sbjct  124   PHLTNPCHFLSDWFRNSDPTPFVTAYGKPFWDYAAHEPKFNNFFNEAMASDSQLIASVVV  183

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
              GE K VF GL SL+DV GG G +A  IAK FP +KC V D PHV+A++  G  EN+EFV
Sbjct  184   -GECKEVFRGLSSLIDVGGGTGTMAKVIAKAFPHLKCTVFDQPHVVANLQGG--ENLEFV  240

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAI-PIREEGGKVIIIDMVMEDPK  955
              G++FE+IP A+A+LLK I+H+W D ECVKILKKC+EAI P +++GGKVIIID+VME+ K
Sbjct  241   GGDIFEAIPPADAILLKSILHNWSDGECVKILKKCKEAIHPRKDKGGKVIIIDIVMENNK  300

Query  956   RTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
               +A   +AQL+ D L+M +   KERN+++WE LF  AGF+ YKIT TLG RSLIEV+P
Sbjct  301   GDEAV--EAQLFYDILMMVVVAGKERNEREWENLFLAAGFAHYKITSTLGPRSLIEVYP  357



>ref|XP_002278190.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   386 bits (991),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 191/357 (54%), Positives = 244/357 (68%), Gaps = 5/357 (1%)
 Frame = +2

Query  62    GKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPS  241
             G+   ELL A AH WNH  ++I+S +LKCA++LGIPD IHNH KPM LS L+A LP++P 
Sbjct  6     GETSTELLHAHAHVWNHIFNFINSMSLKCAIELGIPDIIHNHGKPMTLSELVAELPVNPE  65

Query  242   KAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEY  421
             K   ++RL R LV S      K   +  QEE Y LT   RLL+K++ ++ R FL    + 
Sbjct  66    KTKCVYRLMRLLVQSG-FFTRKRVQESGQEEGYVLTHASRLLLKDDPLSARPFLLAMLDP  124

Query  422   VFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLN  601
             V       +  WFQNDDP+PF TAHG   WDY  HEP  N+ FNEA A D+ L+  VL+ 
Sbjct  125   VLITPWQYVSAWFQNDDPTPFDTAHGRTFWDYAGHEPKLNNFFNEAMASDARLVTSVLIK  184

Query  602   GESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVA  781
              + K +F GL SLVDV GG G VA AIA  FP + C VLDLPHV+A +     +N+ ++A
Sbjct  185   -DCKGIFVGLNSLVDVGGGTGTVARAIANAFPHLNCTVLDLPHVVAGLEGS--KNLNYLA  241

Query  782   GNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRT  961
             G+MFE+IP A+A+LLKWI+HDW  +ECVKILK+CR+AIP +E+GGKVIIIDM+ME+ K  
Sbjct  242   GDMFEAIPPADAILLKWILHDWNHDECVKILKRCRDAIPSKEKGGKVIIIDMMMENQKAD  301

Query  962   DAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
             D    + QL+ D L+M +   +ERN K WEKLF +AGFS YKITP LGLRSLIEV+P
Sbjct  302   DESI-ETQLFWDMLMMIVLTGQERNIKDWEKLFFDAGFSGYKITPMLGLRSLIEVYP  357



>ref|XP_009779391.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
sylvestris]
Length=351

 Score =   385 bits (990),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 190/362 (52%), Positives = 253/362 (70%), Gaps = 14/362 (4%)
 Frame = +2

Query  50    MAENGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALP  229
             M ENG +  +LL A+  TWNH  ++I S+A KCA+QLGIPD ++ H KP+ LS+L A L 
Sbjct  3     MNENGSI--DLLLAQTQTWNHMFNFISSSAAKCAIQLGIPDVVYKHGKPISLSDLTAELS  60

Query  230   -IHPSKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLN  406
              I  SK  ++  L RFLVHS  L       ++ + E YSLTP  +LLVK++ +++R++  
Sbjct  61    LIDRSKVSFLPILMRFLVHSGFL-------NQHENEHYSLTPASQLLVKDDPLSMRSYFL  113

Query  407   ICNEYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIM  586
             I ++ V  K+   L DW QND  + F TAH + +WDY   EP   D FNE+ A DS LI 
Sbjct  114   IIHDPVLLKAWSCLNDWLQNDSSTAFHTAHEKSLWDYYVQEPRVGDSFNESMASDSRLIA  173

Query  587   EVLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIEN  766
              VL+  E K VF+GL SLVDV GG G VA AIAK FPA+KC VLDLP V+ +       N
Sbjct  174   NVLIT-ECKHVFEGLTSLVDVGGGTGTVAIAIAKAFPAIKCTVLDLPRVVGNFKGNG--N  230

Query  767   MEFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVME  946
             +EFV G+MFE IP ANA+L KWI+H+W DE+CVKILKKC+++IP REEGGKVIIID+V+E
Sbjct  231   VEFVGGSMFEKIPNANAILFKWILHNWSDEDCVKILKKCKDSIPSREEGGKVIIIDIVLE  290

Query  947   DPKRTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEV  1126
             +P  ++ +  +AQ YMD L+M  Y +K+R K +WE+LF++AGF++YKITPTLG RSLIE+
Sbjct  291   NPNTSNEFV-RAQHYMDMLMMVFYAAKQRTKMEWERLFTDAGFNEYKITPTLGTRSLIEI  349

Query  1127  FP  1132
             +P
Sbjct  350   YP  351



>ref|XP_009780812.1| PREDICTED: myricetin O-methyltransferase-like [Nicotiana sylvestris]
Length=353

 Score =   385 bits (988),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 193/363 (53%), Positives = 242/363 (67%), Gaps = 12/363 (3%)
 Frame = +2

Query  50    MAENGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALP  229
             M+ N     +LL+A+A  WNH  S+I+S+A KCAVQLGIPD ++ H KPM  S+L A LP
Sbjct  1     MSRNENGSTDLLRAQAQIWNHMFSFINSSATKCAVQLGIPDVLYKHGKPMSFSDLSAELP  60

Query  230   -IHPSKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLN  406
              +HPSK  ++  L RFLVHS  L       ++  +  YSLTPV RLL        R+   
Sbjct  61    LVHPSKVSFLTILMRFLVHSGFL-------NQHDQNHYSLTPVSRLLATNNPSGTRSHFL  113

Query  407   ICNEYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIM  586
             I +  +  K+ + L  WFQND P+ F TAHG   WDY    P   + FN A A DS L+ 
Sbjct  114   INHIQLLSKASFELSRWFQNDSPTAFHTAHGISFWDYFVENPKLGESFNVAMASDSMLVA  173

Query  587   EVLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIEN  766
              VL+  E K VF+GL SLVDV GG G V+ AIAK FP + C V DLPHVI  +      N
Sbjct  174   NVLIT-ECKYVFEGLTSLVDVGGGTGTVSIAIAKAFPMINCTVFDLPHVIGDLKGSG--N  230

Query  767   MEFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVME  946
             +EFV G+MF+ IP ANA+LLKWI+HDW DE+CVKILKKC+EAIP RE+GGKVIIIDMVME
Sbjct  231   LEFVRGSMFDKIPKANAILLKWILHDWSDEDCVKILKKCKEAIPCREKGGKVIIIDMVME  290

Query  947   DPKR-TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIE  1123
             DPK  +D  + +AQ  MD L+  L  +KER KK+WEKLF+E+GF+ Y ITP+LG RSLIE
Sbjct  291   DPKLISDEEFVRAQHNMDLLMTVLCAAKERTKKEWEKLFTESGFTQYNITPSLGSRSLIE  350

Query  1124  VFP  1132
             ++P
Sbjct  351   IYP  353



>ref|NP_001268044.1| trans-resveratrol di-O-methyltransferase [Vitis vinifera]
 gb|AEP17011.1| O-methyltransferase [Vitis vinifera]
Length=357

 Score =   385 bits (988),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 188/358 (53%), Positives = 242/358 (68%), Gaps = 5/358 (1%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG +  ELL A+AH WNH  ++I S +LKCA+QLGIPDTIHNH KPM L  L+A LP+HP
Sbjct  5     NGVISAELLHAQAHVWNHIFNFIKSMSLKCAIQLGIPDTIHNHGKPMTLPELVAKLPVHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
              ++  ++RL R LVHS  L   +    +E EE Y LT   RLL+ ++++++R  +    +
Sbjct  65    KRSQCVYRLMRILVHSGFLAAQRVQQGKE-EEGYVLTDASRLLLMDDSLSIRPLVLAMLD  123

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              +  K  + L  WFQNDDP+PF T +    WDY  HEP  N+ FNEA A D+ L+  VLL
Sbjct  124   PILTKPWHYLSAWFQNDDPTPFHTTYERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLL  183

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
               E + VF GL SLVDV GG G VA AIA  FP + C VLDLPHV+A +     +N+ + 
Sbjct  184   K-EGQGVFAGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQGS--KNLNYF  240

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
             AG+MFE+IP A+A+LLKW +HDW DEECVKILK+CREAIP +E GGKVIIIDM+M    +
Sbjct  241   AGDMFEAIPPADAILLKWTLHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMK-NQ  299

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              D    + QL+ D  +M     +ER++ +WEKLF  AGFS YKITP LGLRSLIEV+P
Sbjct  300   GDYKSIETQLFFDMTMMIFAPGRERDENEWEKLFLGAGFSHYKITPILGLRSLIEVYP  357



>emb|CAN69333.1| hypothetical protein VITISV_003273 [Vitis vinifera]
Length=350

 Score =   384 bits (987),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 195/355 (55%), Positives = 250/355 (70%), Gaps = 5/355 (1%)
 Frame = +2

Query  68    LHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKA  247
             +  ELLQA+AH WNH  ++++S +LKCA+QLGIPD IHNH KPM L  L+A LP+HP K 
Sbjct  1     MSSELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDIIHNHGKPMTLPQLVAKLPVHPKKT  60

Query  248   PYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVF  427
              Y++RL R LV S      ++   EE EE Y LT   RLL+K++++++R FL    +   
Sbjct  61    QYVYRLMRVLVQSDFFAAPRAQQSEE-EEGYVLTHASRLLLKDDSLSVRPFLLAMLDPTL  119

Query  428   QKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGE  607
              K  + +  WFQNDDP+PF TAH   +WDY  HEP  N  FNEA A D+ L+  VL+  E
Sbjct  120   TKPWHYVSAWFQNDDPTPFDTAHERTLWDYAGHEPQLNYXFNEAMASDARLVTSVLVK-E  178

Query  608   SKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGN  787
              K VF+GL SLVDV GG G VA AIA  FP + C VLDLPHV+A +     +N+ + AG+
Sbjct  179   GKGVFEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVLDLPHVVAGLQGS--KNLNYFAGD  236

Query  788   MFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDA  967
             MFE+IP A+A+LLKWI+HDW DEECVKILK+CREAIP +E GGKVIIIDM++++ ++ D 
Sbjct  237   MFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKERGGKVIIIDMMVKN-QKGDC  295

Query  968   YYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
                + QL+ D L+M L   KER +K+WEKLF EAGFS YKITP LGLRSLIEV+P
Sbjct  296   KSRETQLFFDMLMMVLVTGKEREEKEWEKLFLEAGFSHYKITPILGLRSLIEVYP  350



>gb|AEC13057.1| orcinol O-methyltransferase-like protein [Rosa chinensis]
Length=367

 Score =   385 bits (989),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 189/358 (53%), Positives = 250/358 (70%), Gaps = 6/358 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  16    NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  75

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  76    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD  133

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  134   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVII  193

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  194   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  250

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEECVKILK+ REAI  +++ GKVIIIDM+ME+ ++
Sbjct  251   GGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKNGKVIIIDMMMEN-QK  309

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYKITP LGLRSLIEV+P
Sbjct  310   GDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPILGLRSLIEVYP  367



>emb|CAN73269.1| hypothetical protein VITISV_021917 [Vitis vinifera]
Length=357

 Score =   385 bits (988),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 191/359 (53%), Positives = 254/359 (71%), Gaps = 7/359 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             +GK    LLQA+AH WNH++++++S ALKCAV+LGIPD I+NH +P+ LS L+ AL I+P
Sbjct  5     SGKRASLLLQAQAHVWNHTMNFVNSMALKCAVRLGIPDAINNHGQPITLSELVTALSINP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
              KAP +HRL R LV S      +     EQE+ YSLT   R L+K+E  +    L +  +
Sbjct  65    IKAPCLHRLMRVLVXSG-FFAQQQADHNEQEQLYSLTYASRFLLKDEPTSGAPLLLVQVD  123

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
                   C+ L DWF+N DP+PF TA+G+  WDY +HEP +N+ FNEA A DS+LI  V++
Sbjct  124   PHLTNPCHFLSDWFRNSDPTPFVTAYGKPFWDYAAHEPKFNNFFNEAMASDSQLIASVVV  183

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
              GE K VF GL SL+DV GG G +A  IAK FP +KC V D PHV+A++  G  EN+EFV
Sbjct  184   -GECKEVFRGLSSLIDVGGGTGTMAKVIAKAFPHLKCTVFDQPHVVANLQGG--ENLEFV  240

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAI-PIREEGGKVIIIDMVMEDPK  955
              G++FE+IP A+A+LLK I+H+W D ECVKILKKC+EAI P +++GGKVIIID+VME+ K
Sbjct  241   GGDIFEAIPPADAILLKSILHNWSDGECVKILKKCKEAIHPRKDKGGKVIIIDVVMENNK  300

Query  956   RTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
               +A   +AQL+ D L+M +   KERN+++WE LF  AGF+ YKIT TLG RSLIEV+P
Sbjct  301   GDEAV--EAQLFYDILMMVVVAGKERNEREWENLFLAAGFAHYKITSTLGPRSLIEVYP  357



>gb|AFX68805.1| O-metyltransferase [Vitis riparia]
Length=357

 Score =   385 bits (988),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 189/358 (53%), Positives = 242/358 (68%), Gaps = 5/358 (1%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG +  ELL A+AH WNH  ++I S +LKCA QLGIPD IHNH KPM L  L+A LP+HP
Sbjct  5     NGVISAELLHAQAHVWNHIFNFIKSMSLKCATQLGIPDIIHNHGKPMTLPELVAKLPVHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
              ++  ++RL R LVHS  L   +    EE EE Y LT   RLL+ ++++++R  +    +
Sbjct  65    KRSQCVYRLMRILVHSGFLAAQRVQQGEE-EEGYVLTDASRLLLMDDSLSIRPLVLAMLD  123

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              +  K  + L  WFQNDDP+PF TA+    WDY  HEP  N+ FNEA A D+ L+  VL+
Sbjct  124   PILTKPWHYLSAWFQNDDPTPFHTAYERPFWDYAGHEPQLNNSFNEAMASDARLLTSVLI  183

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
               E K VF GL SLVDV GG G VA AIA  FP + C VLDLPHV+A +     +N+ + 
Sbjct  184   K-EGKGVFAGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQGS--KNLNYF  240

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
             AG+MFE+IP A+A+LLKWI+HDW DEECVKILK+CREAIP +E GGKVIIIDM+M    +
Sbjct  241   AGDMFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMK-NQ  299

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              D    + QL+ D  +      +ER++ +WEKLF +AGFS YKITP LGLRSLIEV+P
Sbjct  300   GDYKSIETQLFFDMTMTIFAPGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>emb|CAN79968.1| hypothetical protein VITISV_043678 [Vitis vinifera]
Length=357

 Score =   384 bits (985),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 188/358 (53%), Positives = 242/358 (68%), Gaps = 5/358 (1%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG++  ELL A+AH WNH  ++I S +LKCA QLGIPD IHNH KPM L  L+A LP+HP
Sbjct  5     NGEISAELLHAQAHVWNHIFNFIKSMSLKCATQLGIPDIIHNHGKPMTLPELVAKLPVHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
              ++  ++RL R LVHS  L   +    EE EE Y LT   RLL+ ++++++R  +    +
Sbjct  65    KRSQCVYRLMRILVHSGFLAAQRVQQGEE-EEGYVLTDASRLLLMDDSLSIRPLVLAMLD  123

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              +  K  + L  WFQNDDP+PF TA+    WDY  HEP  N+ FNEA A D+ L+  VLL
Sbjct  124   PILTKPWHYLSAWFQNDDPTPFHTAYEXXFWDYAGHEPQLNNSFNEAMASDARLLTXVLL  183

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
               E   VF GL SLVDV GG G VA AIA  FP + C VLDL HV+A +     +N+ + 
Sbjct  184   K-EGXGVFAGLNSLVDVGGGTGKVAKAIAXAFPHLNCTVLDLSHVVAGLQGS--KNLNYF  240

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
             AG+MFE+IP A+A+LLKWI+HDW DEECVKILK+CREAIP +E GGKVIIIDM+M   + 
Sbjct  241   AGDMFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQG  300

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              D    + QL+ D  +M     +ER++ +WEK+F +AGFS YKITP LGLRSLIEV+P
Sbjct  301   DDKSI-ETQLFFDMTMMIFSAGRERDENEWEKIFLDAGFSHYKITPILGLRSLIEVYP  357



>sp|B6VJS4.2|ROMT_VITVI RecName: Full=Trans-resveratrol di-O-methyltransferase; AltName: 
Full=Resveratrol O-methyltransferase; Short=ROMT; Short=VvROMT 
[Vitis vinifera]
Length=357

 Score =   383 bits (984),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 187/358 (52%), Positives = 243/358 (68%), Gaps = 5/358 (1%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG +  ELL A+AH WNH  ++I S +LKCA+QLGIPD IHNH KPM L  L+A LP+HP
Sbjct  5     NGVISAELLHAQAHVWNHIFNFIKSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
              ++  ++RL R LVHS  L   +    +E EE Y LT   RLL+ ++++++R  +    +
Sbjct  65    KRSQCVYRLMRILVHSGFLAAQRVQQGKE-EEGYVLTDASRLLLMDDSLSIRPLVLAMLD  123

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              +  K  + L  WFQNDDP+PF TA+    WDY  HEP  N+ FNEA A D+ L+  VLL
Sbjct  124   PILTKPWHYLSAWFQNDDPTPFHTAYERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLL  183

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
               E + VF GL SLVDV GG G VA AIA  FP + C VLDL HV+A +     +N+ + 
Sbjct  184   K-EGQGVFAGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLSHVVAGLQGS--KNLNYF  240

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
             AG+MFE+IP A+A+LLKWI+HDW +EECVKILK+CREAIP +E GGKVIIIDM+M    +
Sbjct  241   AGDMFEAIPPADAILLKWILHDWSNEECVKILKRCREAIPSKENGGKVIIIDMIMMK-NQ  299

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              D    + QL+ D  +M     +ER++ +WEKLF +AGFS YKITP LGLRSLIEV+P
Sbjct  300   GDYKSTETQLFFDMTMMIFAPGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>ref|XP_004303127.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=367

 Score =   384 bits (985),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 187/358 (52%), Positives = 251/358 (70%), Gaps = 6/358 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H +PM LS L +ALPI+P
Sbjct  16    NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGRPMTLSELTSALPINP  75

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  I+RL R L+HS      K    +  EE Y LT   +LL+K+  +++  FLN   +
Sbjct  76    TKSHSIYRLMRILIHSG--FFAKKKLSKSDEEGYVLTDASQLLLKDHPLSITPFLNAMLD  133

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K  +    WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  134   PVLTKPWHYFSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVIV  193

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + E + VF+GL SLVDV GG G VA AIA  FP +KC VLDLPHV+A +     +N+++ 
Sbjct  194   D-ECRGVFEGLDSLVDVGGGTGTVAKAIADAFPHIKCTVLDLPHVVADLQGS--KNLKYT  250

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+AVLLKWI+HDW DEECVKIL++ +EAI  +++ GKVIIIDM+ME+ ++
Sbjct  251   GGDMFEAVPPADAVLLKWILHDWNDEECVKILERSKEAITGKDKKGKVIIIDMMMEN-QK  309

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYKITP LGLRSLIEV+P
Sbjct  310   GDEESMETQLFFDMLMMALVTGKERNEKEWSKLFTDAGFSDYKITPILGLRSLIEVYP  367



>ref|XP_002278057.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   383 bits (983),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 194/357 (54%), Positives = 251/357 (70%), Gaps = 5/357 (1%)
 Frame = +2

Query  62    GKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPS  241
             G++  ELLQA+AH WNH  ++++S +LKCA+QLGIPD IHNH KPM L  L+A LP+HP 
Sbjct  6     GEISSELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPK  65

Query  242   KAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEY  421
             K  Y++RL R LV S      ++   EE EE Y LT   +LL+K++++++R FL    + 
Sbjct  66    KTQYVYRLMRVLVQSDFFAAQRAQQSEE-EEGYVLTHASQLLLKDDSLSVRPFLLAMLDP  124

Query  422   VFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLN  601
                K  + +  WFQNDDP+PF TAH   +WDY  HEP  N   NEA A D+ L+  VL+ 
Sbjct  125   TLTKPWHYVSAWFQNDDPTPFNTAHERTLWDYAGHEPQLNYFINEAMASDARLVTSVLVK  184

Query  602   GESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVA  781
              E K VF+GL SLVDV GG G VA AIA  FP + C VLDLPHV+A +     +N+ + A
Sbjct  185   -EGKGVFEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVLDLPHVVAGLQGS--KNLNYFA  241

Query  782   GNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRT  961
             G+MFE IP A+A+LLKWI+HDW DEECVKILK+CREAIP +E+GGKVIIIDM+M++ ++ 
Sbjct  242   GDMFEPIPPADAILLKWILHDWSDEECVKILKRCREAIPSKEKGGKVIIIDMMMKN-QKG  300

Query  962   DAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
             D    + QL+ D L+M L   KER +K+WEKLF +AGFS YKITP LGLRSLIEV+P
Sbjct  301   DCKSRETQLFFDMLMMVLVTGKEREEKEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>emb|CDP15886.1| unnamed protein product [Coffea canephora]
Length=348

 Score =   381 bits (978),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 188/352 (53%), Positives = 253/352 (72%), Gaps = 12/352 (3%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYI  256
             ELL A+ H  N  L++  SA+LKCA++LGIPD I+ H KP+ LS L++ALPI+PSKA +I
Sbjct  9     ELLAAQNHVGNQMLNFRKSASLKCAIELGIPDAINQHGKPITLSELVSALPINPSKANHI  68

Query  257   HRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQKS  436
             +RL RFL ++   ++        Q++ Y+LT  GRLL+KEE  NLRAF+   ++ V  K 
Sbjct  69    YRLMRFLSNAGFFVL--------QDQGYALTAAGRLLLKEEPFNLRAFIFYMSDPVLVKP  120

Query  437   CYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESKR  616
               +L +WF+NDDPSPF TAHG+  W Y + EP + ++FNEA A DS LI++V++  + K 
Sbjct  121   WNSLTEWFRNDDPSPFHTAHGKNFWAYAAEEPNFANLFNEAMANDSTLIVQVMMT-QCKF  179

Query  617   VFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMFE  796
             VFDGL SL DV GG GAVA AIA+ FP +KC+V DLPHVIA       EN++FVAG+M E
Sbjct  180   VFDGLTSLADVGGGTGAVARAIAQNFPNLKCVVCDLPHVIAGQEG--TENLDFVAGDMLE  237

Query  797   SIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAYYN  976
              +PAA+A+LLKWI+HDW DE+CVKILK C+EAIP R++GGKVIIIDM++E   + D    
Sbjct  238   KVPAADAILLKWILHDWSDEDCVKILKNCKEAIPGRDKGGKVIIIDMILESQVKDDDSV-  296

Query  977   KAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
             + Q+ +D  ++  YG+KER +K+W KLF +AGFSDYKI P LG+  LI V+P
Sbjct  297   ETQVGVDMQMLMCYGAKERTEKEWAKLFQDAGFSDYKILPALGVCCLIAVYP  348



>emb|CDP19709.1| unnamed protein product [Coffea canephora]
Length=348

 Score =   380 bits (977),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 185/352 (53%), Positives = 253/352 (72%), Gaps = 12/352 (3%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYI  256
             ELL A+ H  N   ++  SA+LKCA++LGIPD I+ H KP+ LS L++ALPI+PSKA +I
Sbjct  9     ELLAAQNHVGNQMPNFRKSASLKCAIELGIPDAINQHGKPITLSELVSALPINPSKANHI  68

Query  257   HRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQKS  436
             +RL RFL ++   ++        Q++ Y+LT  GRLL+KEE  NLRAF+   ++ V  K 
Sbjct  69    YRLMRFLSNAGFFVL--------QDQGYALTAAGRLLLKEEPFNLRAFIFYTSDPVLVKP  120

Query  437   CYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESKR  616
               +L +WF+NDDPSPF TAHG+  W Y + EP + ++FNEA A DS L ++V++  + K 
Sbjct  121   WNSLTEWFRNDDPSPFHTAHGKNFWAYAAEEPNFANLFNEAMANDSTLTVQVMMT-QCKF  179

Query  617   VFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMFE  796
             VFDGL SLVDV GG GAVA AIA+ FP ++C+V DLPHVIA       EN++FVAG+M E
Sbjct  180   VFDGLTSLVDVGGGTGAVARAIAQNFPNLECVVCDLPHVIAGQEG--TENLDFVAGDMLE  237

Query  797   SIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAYYN  976
              +PAA+A+LLKWI+HDW D++CVKILK C+EAIP R++GGKVIIIDM++E   + D    
Sbjct  238   KVPAADAILLKWILHDWSDDDCVKILKNCKEAIPGRDKGGKVIIIDMILESHMKDDESV-  296

Query  977   KAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
             + Q  +D  ++  YG+KER +K+W K+F +AGFSDYK+ P LG+R LIEV+P
Sbjct  297   ETQFVVDMQMLTCYGAKERTEKEWAKVFQDAGFSDYKVLPVLGVRCLIEVYP  348



>gb|ABQ02270.2| O-methyltransferase [Vitis vinifera]
Length=357

 Score =   380 bits (977),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 186/358 (52%), Positives = 242/358 (68%), Gaps = 5/358 (1%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG +  ELL A+AH WNH  ++I S +LKCA+QLGIPD IHNH KPM L  L+A LP+HP
Sbjct  5     NGVISAELLHAQAHVWNHIFNFIKSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
              ++  ++RL R LVHS  L   +    +E EE Y LT   RLL+ ++++++R  +    +
Sbjct  65    KRSQCVYRLMRILVHSGFLAAQRVQQGKE-EEGYVLTDASRLLLMDDSLSIRPLVLAMLD  123

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              +  K  + L  WFQNDDP+PF TA+    WDY  HEP  N+ FNEA A D+ L+  VLL
Sbjct  124   PILTKPWHYLSAWFQNDDPTPFHTAYERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLL  183

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
               E + VF GL SLVDV GG G VA AIA  FP + C VLDL HV+A +     +N+ + 
Sbjct  184   K-EGQGVFAGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLSHVVAGLQGS--KNLNYF  240

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
             AG+MF +IP A+A+LLKWI+HDW +EECVKILK+CREAIP +E GGKVIIIDM+M    +
Sbjct  241   AGDMFGAIPPADAILLKWILHDWSNEECVKILKRCREAIPSKENGGKVIIIDMIMMK-NQ  299

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              D    + QL+ D  +M     +ER++ +WEKLF +AGFS YKITP LGLRSLIEV+P
Sbjct  300   GDYKSTETQLFFDMTMMIFAPGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>emb|CAN83014.1| hypothetical protein VITISV_029725 [Vitis vinifera]
Length=357

 Score =   380 bits (976),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 193/357 (54%), Positives = 249/357 (70%), Gaps = 5/357 (1%)
 Frame = +2

Query  62    GKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPS  241
             G++  ELLQA+AH WNH  ++++S +LKCA+QLGIPD IHNH KPM L  L+A LP+HP 
Sbjct  6     GEISSELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPK  65

Query  242   KAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEY  421
             K  Y++RL R LV S      ++   EE EE Y LT    LL+K++++++R FL    + 
Sbjct  66    KTQYVYRLMRVLVQSDFFAAQRAQQSEE-EEGYVLTHASXLLLKDDSLSVRPFLLAMLDP  124

Query  422   VFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLN  601
                K  + +  WFQNDDP+PF TAH   +WDY  HEP  N   NEA A D+ L+  VL+ 
Sbjct  125   TLTKPWHYVSAWFQNDDPTPFNTAHERTLWDYAGHEPQLNYFINEAMASDARLVTSVLVK  184

Query  602   GESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVA  781
              E K VF+GL SLVDV GG G VA AIA  FP + C VLDLPHV+A +     +N+ + A
Sbjct  185   -EGKGVFEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVLDLPHVVAGLQGS--KNLNYFA  241

Query  782   GNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRT  961
             G+MFE IP A+A+LLKWI+HDW DEECVKILK+CREAIP +E+GGKVIIIDM+M++ ++ 
Sbjct  242   GDMFEXIPPADAILLKWILHDWSDEECVKILKRCREAIPSKEKGGKVIIIDMMMKN-QKG  300

Query  962   DAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
             D    + QL+ D L+M     KER +K+WEKLF +AGFS YKITP LGLRSLIEV+P
Sbjct  301   DXKSRETQLFFDMLMMVXVTGKEREEKEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>ref|XP_002278517.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=359

 Score =   380 bits (976),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 184/359 (51%), Positives = 246/359 (69%), Gaps = 5/359 (1%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG    ELLQA+ H WNH  ++I+S +LKCA+QLGIPD IHNH +PM L  L+A LP+ P
Sbjct  5     NGGRSSELLQAQTHVWNHIFNFINSMSLKCAIQLGIPDIIHNHCQPMTLHELVAKLPVRP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K   +HRL R LVHS    + +   +   EE Y L    RLL+K+  +++  FL    +
Sbjct  65    NKTLCVHRLMRILVHSGFFTMQRV-QESADEEGYVLANASRLLLKDHPLSVTPFLLAMLD  123

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
                 +  + +  WFQNDDP+PF TAHG  IWDY  HEP +N+ FNEA A D+ L+  VL+
Sbjct  124   PDLTEPWHYVSAWFQNDDPTPFFTAHGRTIWDYGCHEPRFNNFFNEAMASDARLVTSVLV  183

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
               E K  F+GL S VDV GG G VA  I + FP +   VLDLPHV+A +  G  +++ ++
Sbjct  184   K-ECKGAFEGLNSFVDVGGGTGTVAKTIVEAFPHLHSTVLDLPHVVADLQGG--KSLTYL  240

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
             AG+MFE+IP A+A+LLKWI+HDW DEEC+KILK+CREAIP +E+GGKV+IIDM +++ K 
Sbjct  241   AGDMFEAIPPADAILLKWILHDWSDEECLKILKQCREAIPSKEKGGKVMIIDMAIQNKKG  300

Query  959   TDAYYN-KAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              D   N + QL+ D L+M L   +ER +K+W+KLF ++GFS YKITP LGLRSLIEV+P
Sbjct  301   DDDESNVETQLFFDMLMMVLLPGREREEKEWKKLFLDSGFSGYKITPILGLRSLIEVYP  359



>ref|NP_001267963.1| O-methyltransferase [Vitis vinifera]
 gb|AEP17010.1| O-methyltransferase [Vitis vinifera]
Length=357

 Score =   380 bits (975),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 187/358 (52%), Positives = 242/358 (68%), Gaps = 5/358 (1%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG +  ELL A+AH WNH  ++I S +LKCA+QLGIPD IHNH KPM L  L+A LP+HP
Sbjct  5     NGVISAELLHAQAHVWNHIFNFIKSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
              ++  ++RL R LVHS  L   +    +E EE Y LT   RLL+ ++++++R  +    +
Sbjct  65    KRSQCVYRLMRILVHSGFLAAQRVQQGKE-EEGYVLTDASRLLLMDDSLSIRPLVLAMLD  123

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              +  K  + L  WFQNDDP+PF TA+    WDY  HEP  N+ FNEA A D+ L+  VLL
Sbjct  124   PILTKPWHYLSAWFQNDDPTPFHTAYERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLL  183

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
               E + VF GL SLVDV GG G VA AIA  FP + C VLDL HV+A +     +N+ + 
Sbjct  184   K-EGQGVFAGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLSHVVAGLQGS--KNLNYF  240

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
             AG+MFE+IP A A+LLKWI+HDW DEECVKILK+CR AIP +E+GGKVIIIDM+M    +
Sbjct  241   AGDMFEAIPPAVAILLKWILHDWSDEECVKILKRCRGAIPSKEKGGKVIIIDMIMMK-NQ  299

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              D    + QL+ D  +M     +ER++ +WEKLF +AGFS YKITP LGLRSLIEV+P
Sbjct  300   GDYKSIETQLFFDMTMMIFAPGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  357



>ref|XP_002517827.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44345.1| o-methyltransferase, putative [Ricinus communis]
Length=356

 Score =   379 bits (972),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 185/351 (53%), Positives = 250/351 (71%), Gaps = 5/351 (1%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYI  256
             ELLQA+AH WNH  ++I+S +LK A+QLGIPD IH+H +P+ LS LIAALP+ P+KA  I
Sbjct  10    ELLQAQAHIWNHIFNFINSMSLKSAIQLGIPDAIHSHGRPISLSQLIAALPVLPAKARCI  69

Query  257   HRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQKS  436
              RL R LVHS      K  G++E EE + LT   +LL+K+  +++  FL    + +  + 
Sbjct  70    PRLMRILVHSGFFANAKIKGNDE-EEGFVLTSASKLLLKDNPLSVTPFLLAMLDPILTEP  128

Query  437   CYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESKR  616
              + +  WFQNDD +PF T HG   W+Y  +EP +N+ FNEA A D+ L+M VL++ E K 
Sbjct  129   WHYVSTWFQNDDATPFDTVHGMPFWEYAGNEPKFNNFFNEAMASDARLVMRVLID-EYKG  187

Query  617   VFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMFE  796
             VF+GL SLVDV GG G +A+AIAK FP + CIV DLPHV+A + +    N+++V GNMFE
Sbjct  188   VFEGLNSLVDVGGGTGTMAAAIAKAFPQLDCIVFDLPHVVAGLQSS--ANLKYVGGNMFE  245

Query  797   SIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAYYN  976
              +P A+A+LLKWI+HDW DEEC+KIL++ +EAI   ++GGK+IIIDMV E+ +  D  Y 
Sbjct  246   GVPPADAILLKWIIHDWSDEECLKILQRSKEAIK-GKKGGKLIIIDMVSENQQVIDDQYV  304

Query  977   KAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVF  1129
             + QL+ D L+MAL   KERN K+W KLF +AGFS+YKITP LGLRS+IEV+
Sbjct  305   ETQLFYDMLMMALQTGKERNNKEWGKLFLDAGFSNYKITPILGLRSVIEVY  355



>gb|KDP24061.1| hypothetical protein JCGZ_25718 [Jatropha curcas]
Length=367

 Score =   379 bits (973),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 192/360 (53%), Positives = 245/360 (68%), Gaps = 11/360 (3%)
 Frame = +2

Query  71    HGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAP  250
             H +LLQA+AH WNH  ++I+S +LKCA+QLGIPD I+ H KPM LS+LI AL IHP+K  
Sbjct  13    HNQLLQAQAHIWNHIFNFINSMSLKCAIQLGIPDAINKHGKPMTLSDLIIALSIHPAKTH  72

Query  251   YIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQ  430
              I RL R LVHS  L   K+  + ++ E Y LT   +LLVKE   +L+ FL    + V  
Sbjct  73    AIPRLVRILVHSGFLDKEKTEENSQETEGYVLTNASKLLVKEHPFSLKTFLLAMLDPVLT  132

Query  431   KSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGES  610
                  L  WF NDDP+PF T HG  IW Y  H P  N  FNEA A D++++  +L+  E 
Sbjct  133   GPWDHLTTWFLNDDPTPFQTCHGRGIWKYAGHNPELNSSFNEAMACDAKMVASILIK-EC  191

Query  611   KRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNM  790
             + VFDGLKSLVDV GG G VA A+A  FP + C V DLPHV+A +  G  +N++FV G+M
Sbjct  192   EGVFDGLKSLVDVGGGTGTVAKALADSFPQLDCCVFDLPHVVAGLQDG--DNLKFVGGDM  249

Query  791   FESIPAANAVLLK------WIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDP  952
             FE IP A+A+LLK      WIMHDW DE+C+KILK C+EAI  R +GGK+IIIDMVME  
Sbjct  250   FEEIPPADAILLKACYYIYWIMHDWHDEKCIKILKNCKEAIKGR-KGGKLIIIDMVMETQ  308

Query  953   KRTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
             K  D    + +L++D L++ LY  KERNKK+W KLF +AGFSD+KITP LGLRS++EV+P
Sbjct  309   KE-DKDATETELFLDMLMIVLYNGKERNKKEWAKLFFDAGFSDFKITPVLGLRSVVEVYP  367



>ref|XP_002525159.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF37286.1| o-methyltransferase, putative [Ricinus communis]
Length=356

 Score =   379 bits (972),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 193/361 (53%), Positives = 254/361 (70%), Gaps = 5/361 (1%)
 Frame = +2

Query  50    MAENGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALP  229
             MA+      ELLQA+A+ WNH  ++I+S +LK A+QLGIPD IH+H KP+ LS LIAALP
Sbjct  1     MADGKHDAQELLQAQAYIWNHIFNFINSMSLKTAIQLGIPDAIHSHGKPISLSLLIAALP  60

Query  230   IHPSKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNI  409
             IHP+KA  I RL R L+HS      K   ++E  E Y LT   +LL+K+   ++  FL  
Sbjct  61    IHPAKARCIPRLMRILIHSGFFAKAKLKENDEA-EGYVLTKASKLLLKDNPFSVTPFLLA  119

Query  410   CNEYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIME  589
               + +  +  + L  WFQNDD + F TAHG   W+Y  +EP  N+ FNEA A D+ L+M 
Sbjct  120   MLDRILTEPWHYLSTWFQNDDATAFTTAHGMGFWEYAGNEPKLNNFFNEAMASDARLVMR  179

Query  590   VLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENM  769
             VL++ E K VF+GLKSLVDV GG G +A AIAK FP + CIV DLPHV+A + AG+ EN+
Sbjct  180   VLID-EYKGVFEGLKSLVDVGGGTGTMAKAIAKAFPRLDCIVFDLPHVVAGL-AGS-ENL  236

Query  770   EFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMED  949
             ++VAG+MFE +P A+A+LLKWIMH W DEEC+K+LK  +EAI   +E GK+IIIDMV+E+
Sbjct  237   KYVAGDMFEGVPPADAILLKWIMHVWSDEECLKLLKLSKEAIKGNKE-GKLIIIDMVLEN  295

Query  950   PKRTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVF  1129
              + TD    ++QL+ D L+M L   K+RNKK+W KLF +AGFSDYKITP LGLRS+IEV+
Sbjct  296   RQVTDHQSIESQLFFDMLMMTLQTGKQRNKKEWGKLFLDAGFSDYKITPILGLRSVIEVY  355

Query  1130  P  1132
             P
Sbjct  356   P  356



>gb|AAM23004.1|AF502433_1 orcinol O-methyltransferase [Rosa hybrid cultivar]
 emb|CAD29458.1| orcinol O-methyltransferase [Rosa chinensis]
 emb|CAH05077.1| orcinol O-methyltransferase 1 [Rosa chinensis]
Length=367

 Score =   379 bits (973),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 185/358 (52%), Positives = 249/358 (70%), Gaps = 6/358 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  16    NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  75

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  +L    +
Sbjct  76    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLD  133

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V       L  WFQNDDP+PF TAHG   WDY +H+P    +FN+A A D+ L+  V++
Sbjct  134   PVLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVII  193

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             N + K VF+GL+SLVDV GG G +A AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  194   N-DCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  250

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEEC+KIL++ R AI  +E+ GKVIIIDM+ME+ ++
Sbjct  251   GGDMFEAVPPADTVLLKWILHDWSDEECIKILERSRVAITGKEKKGKVIIIDMMMEN-QK  309

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              D    + QL+ D L+MAL G KERN+K+W KLF++AGFSDYKITP  GLRSLIEV+P
Sbjct  310   GDEESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPISGLRSLIEVYP  367



>ref|XP_006357086.1| PREDICTED: tabersonine 16-O-methyltransferase-like [Solanum tuberosum]
Length=351

 Score =   376 bits (966),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 185/356 (52%), Positives = 251/356 (71%), Gaps = 13/356 (4%)
 Frame = +2

Query  71    HGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIA--ALPIHPSK  244
             + ELLQA+   WNH  S++ S+AL+CAVQL IPD ++ H KPM LS+L    +L I PSK
Sbjct  7     NSELLQAQTQIWNHIFSFMSSSALRCAVQLDIPDILYKHGKPMHLSDLSTELSLIIDPSK  66

Query  245   APYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYV  424
               ++  L RFLVHS ++       ++   + YSLTP  R LVK+E  NLR+ + + ++  
Sbjct  67    ISFLPNLMRFLVHSGII-------EQHDHDYYSLTPSSRFLVKDEPFNLRSLVLLTHDPS  119

Query  425   FQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNG  604
              QK+ + LG+W++ND P+ F TA+G+  WDY S EP   D+FN+  A +S LI+ +L+  
Sbjct  120   VQKAWFELGNWYKNDIPTSFHTANGKYFWDYFSKEPKLGDIFNDVMASESGLIVNMLIT-  178

Query  605   ESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAG  784
             E + VF+GL SLVDV GG G +A AIAK FP++ CIV DLPHVI  + +    NMEFV G
Sbjct  179   ECRHVFEGLTSLVDVGGGTGTMAIAIAKAFPSINCIVFDLPHVIEDLKSNG--NMEFVGG  236

Query  785   NMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTD  964
             +MF+ IP ANA+LLKWI+H+W DE+CVKILKKC+E+IP R+EGGK+IIID+V+EDPK   
Sbjct  237   DMFQKIPNANAILLKWILHNWNDEDCVKILKKCKESIPSRDEGGKLIIIDIVLEDPKNMS  296

Query  965   AYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              Y  +AQ  MD ++M  + +KER KK+WEKLF+EAGF++ KIT   G RSLIEV+P
Sbjct  297   DYV-RAQHNMDMMMMVCFAAKERTKKEWEKLFNEAGFNECKITSIPGSRSLIEVYP  351



>ref|XP_006365444.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=352

 Score =   376 bits (966),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 188/352 (53%), Positives = 245/352 (70%), Gaps = 15/352 (4%)
 Frame = +2

Query  86    QAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPI-HPSKAPYIHR  262
              A+A  WN+  +++ S+A+KCA+QL IPD ++ H KPM LS+L A L + + SK  ++  
Sbjct  13    HAQAQIWNYIFNFVSSSAVKCALQLEIPDVLYKHEKPMCLSDLSAELSVVNSSKISFLPI  72

Query  263   LTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQKSCY  442
             L RFLV S  L         + E+ Y LTP  RLLVK E+ N+R+FL + +   F K+  
Sbjct  73    LMRFLVQSGFL--------NQHEDHYFLTPASRLLVKNESFNVRSFLLLSHSQAFSKAWS  124

Query  443   ALGDWFQNDDPSPFCTAHGEKIWDYISHE--PVYNDVFNEATAKDSELIMEVLLNGESKR  616
              L DWFQND P+PF TAHG+ +WDYI  E   V  D+FN+A A DS L   +L+  E K 
Sbjct  125   ELSDWFQNDSPTPFHTAHGKSVWDYIGEEQPSVLGDIFNDALASDSRLNTNILIT-ECKH  183

Query  617   VFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMFE  796
             VF+GL SLVDV GG G V+ AIAK FP +KC VLDLP VI  +      N++F+ G+MF+
Sbjct  184   VFEGLTSLVDVGGGTGTVSIAIAKAFPNIKCTVLDLPQVIGYLKGSG--NLDFIGGDMFD  241

Query  797   SIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAYYN  976
              IP ANA+LLK ++HDW DE+CVKILKKCRE+IP +EEGGKVIIID V+EDPK+ + +  
Sbjct  242   KIPQANAILLKCVLHDWNDEDCVKILKKCRESIPSKEEGGKVIIIDTVLEDPKQRNEFV-  300

Query  977   KAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
             +AQ  MD L+M L+GSKER KK+WEKLF E GF++YKI P LGLRSLIE++P
Sbjct  301   RAQHNMDMLMMVLFGSKERTKKEWEKLFIEVGFNEYKIIPALGLRSLIEIYP  352



>ref|XP_002278316.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=359

 Score =   376 bits (965),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 183/359 (51%), Positives = 243/359 (68%), Gaps = 5/359 (1%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG    ELLQA+ H WNH  ++I+S +LKCA+QLGIPD IHNH +PM L  L+A LP+ P
Sbjct  5     NGGRSSELLQAQTHVWNHIFNFINSMSLKCAIQLGIPDIIHNHCQPMTLHELVAKLPVRP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K   +HRL R LVHS    + +   +   EE Y+L    RLL+K+  ++   FL    +
Sbjct  65    NKTLCVHRLMRILVHSGFFTMQRV-QESADEEGYALANASRLLLKDHPLSATPFLLAMLD  123

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
                 +  + +  WFQNDDP+PF TAHG  IWDY  HEP +N+ FNEA A D+ L+  VL+
Sbjct  124   PDLTEPWHYVSAWFQNDDPTPFFTAHGRTIWDYGCHEPRFNNFFNEAMASDARLVTSVLI  183

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
               E K  F+GL S VDV GG G VA  I   FP +   VLDLPHV+A +     +N+ ++
Sbjct  184   K-ECKGAFEGLNSFVDVGGGTGTVAKTIVDAFPHLHSTVLDLPHVVADLQGS--KNLTYL  240

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPK-  955
             AG+MFE+IP A+A+LLKWI+HDW DEEC+KIL++CR AIP +E+GGKV+IIDM + + K 
Sbjct  241   AGDMFEAIPPADAILLKWILHDWSDEECLKILEQCRGAIPSKEKGGKVMIIDMAILNKKG  300

Query  956   RTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
               D    + QL+MD L+M LY  +ER +K+W+KLF ++GFS YKITP LGLRSLIEV+P
Sbjct  301   DEDESKVETQLFMDMLMMVLYPGREREEKEWKKLFLDSGFSGYKITPILGLRSLIEVYP  359



>ref|XP_003544912.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
1 [Glycine max]
Length=358

 Score =   376 bits (965),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 181/353 (51%), Positives = 244/353 (69%), Gaps = 4/353 (1%)
 Frame = +2

Query  74    GELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPY  253
              +LL+A+ H WNH  S+I+S +LKC V LGIPD IHN+ +PMPLSNLIA+LPIHPSK  +
Sbjct  10    AKLLRAQTHIWNHIFSFINSMSLKCVVDLGIPDIIHNYGQPMPLSNLIASLPIHPSKTCF  69

Query  254   IHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQK  433
             +HRL R ++HS    +     + E E  Y LT    LL+K   +++  FL+   + V   
Sbjct  70    VHRLMRIMIHSGFFSLQNHDLENELEAKYVLTDASVLLLKNHPMSVTPFLHAMLDPVLTN  129

Query  434   SCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESK  613
                    WF+N DP+PF TAHG+  WDY   +P  N +FN+A A D+  +  +++  + K
Sbjct  130   PWNQFSTWFKNGDPTPFETAHGKMFWDYAGADPKLNHLFNDAMASDARFVTSLVIE-KCK  188

Query  614   RVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMF  793
              VF GL+SLVDV GG G +A AIAK FP ++CIV DLPHV++ +     EN+++VAG+MF
Sbjct  189   GVFMGLESLVDVGGGTGTMAKAIAKSFPRVECIVFDLPHVVSGLKGS--ENLKYVAGDMF  246

Query  794   ESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAYY  973
             E+IP A+A+LLKWI+HDW DEECV ILKKC+EAI  + + GKVIIIDMV+E+ KR D   
Sbjct  247   EAIPPADAILLKWILHDWNDEECVDILKKCKEAITRKGKEGKVIIIDMVVENEKRDDESV  306

Query  974   NKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              + QL+ D L+M L   KER+KK+W KL S AG+++YKITP LGLRSLIE++P
Sbjct  307   -ETQLFFDMLMMVLVTGKERSKKEWAKLISSAGYNNYKITPVLGLRSLIEIYP  358



>ref|XP_006368013.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=353

 Score =   375 bits (962),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 181/353 (51%), Positives = 247/353 (70%), Gaps = 13/353 (4%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKA-PY  253
             E+L A+AH  NH L+Y++S +LKCA+QLGIPD IH+H + M  S+L+ ALPI+ SK    
Sbjct  13    EVLAAQAHILNHVLNYVNSMSLKCAIQLGIPDIIHSHGRAMTRSDLVNALPINKSKGHEC  72

Query  254   IHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQK  433
             I+RL R L+H+   +        E EE Y LTP  RLL+K E +NL  F+    + +   
Sbjct  73    IYRLMRILIHTGFFI--------EGEEGYLLTPTSRLLLKNEPLNLAPFVQAHLDPILMD  124

Query  434   SCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESK  613
               ++LG+WF N D +PF TAHG+ ++DY   +P  N +FNEA   D+ LIM VL+    K
Sbjct  125   PWHSLGEWFANGDSTPFATAHGKPLFDYAGDDPRLNRIFNEAMESDARLIMSVLIK-NGK  183

Query  614   RVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMF  793
             RVF+GL SLVDV GG G VA AI+  FP +KC V DLPHV+  +  GN  N+ ++ G+MF
Sbjct  184   RVFEGLTSLVDVGGGIGTVAKAISNAFPELKCSVFDLPHVVEGLEGGN--NLSYITGDMF  241

Query  794   ESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAYY  973
             +S+P+A+A+LLKWI+HDW DE+C KILKKC+EAIP +E GGKVI+ID V+++ K  D  +
Sbjct  242   KSVPSADAILLKWILHDWSDEDCAKILKKCKEAIPSKENGGKVIVIDTVIDNQKGDDKSF  301

Query  974   NKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              + QL++D L+M     KERN+++W KLFS+AGFSDYKI+P LGLRS+IEV+P
Sbjct  302   -ETQLFLDVLMMVHVSGKERNEQEWAKLFSDAGFSDYKISPILGLRSVIEVYP  353



>ref|XP_003557042.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Glycine 
max]
Length=358

 Score =   375 bits (962),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 180/353 (51%), Positives = 244/353 (69%), Gaps = 4/353 (1%)
 Frame = +2

Query  74    GELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPY  253
              +LL+A+ H WNH  S+I+S +LKC V LGIPD IHN+ +PMPLSNLIA+LPIHPSK  +
Sbjct  10    AKLLRAQTHIWNHIFSFINSMSLKCVVDLGIPDIIHNYGQPMPLSNLIASLPIHPSKTCF  69

Query  254   IHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQK  433
             +HRL R ++HS      K   + E E  Y LT    LL+K   +++  FL+   + V   
Sbjct  70    VHRLMRIMIHSGFFSQQKHDLENELEAKYVLTDASVLLLKNHPMSVTPFLHAMLDPVLTN  129

Query  434   SCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESK  613
                    WF+N DP+PF TAHG  +WDY   +P  N++FN+A A D+  +  +++  + K
Sbjct  130   PWNQFSTWFKNGDPTPFETAHGMMLWDYAGADPKLNNLFNDAMASDARFVTSLVIE-KCK  188

Query  614   RVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMF  793
              VF GL+SLVDV GG G +A AIAK FP ++CIV DLPHV++ +     EN+++V+G+MF
Sbjct  189   GVFMGLESLVDVGGGTGTMAKAIAKSFPRVECIVFDLPHVVSGLKGS--ENLKYVSGDMF  246

Query  794   ESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAYY  973
             E+IP A+A+LLKWI+HDW DEECV ILKKC+EAI  + + GKVIIIDMV+E+ KR D   
Sbjct  247   EAIPPADAILLKWILHDWNDEECVDILKKCKEAITRKGKEGKVIIIDMVVENEKRDDESV  306

Query  974   NKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              + QL+ D L+M L   KER+KK+W KL S AG+++YKITP  GLRSLIE++P
Sbjct  307   -ETQLFFDMLMMVLVTGKERSKKEWAKLISSAGYNNYKITPVFGLRSLIEIYP  358



>ref|XP_002262833.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=358

 Score =   374 bits (961),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 183/352 (52%), Positives = 239/352 (68%), Gaps = 4/352 (1%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYI  256
             ELLQA+A   NH  ++++S ALKCA+ L IPD IH+H +PM LS L+ AL + PSKAP +
Sbjct  11    ELLQAQAQVVNHVFNFMNSMALKCAIDLAIPDVIHSHGQPMLLSQLVTALSVQPSKAPCL  70

Query  257   HRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQKS  436
             HRL R LVHS      +   + EQEE YSLT   R L+K+E +       +    V    
Sbjct  71    HRLMRLLVHSGFFSQQQVIHNNEQEEGYSLTSASRFLLKDEPLTGLPLSLLHLNPVLTAP  130

Query  437   CYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESKR  616
              + L  WF+N DP+PF TAHG+  WDY + EP +ND+FNEA A DS +I  VL+  + K 
Sbjct  131   WHFLSGWFRNGDPTPFYTAHGKPYWDYTAQEPDFNDLFNEAMASDSRIIASVLIT-KCKE  189

Query  617   VFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMFE  796
              F GL SLVDV  G G +  AIAK FP +KCIV D PHV+A +  G   N+E V G+MFE
Sbjct  190   QFKGLFSLVDVGAGTGTMTKAIAKAFPHLKCIVFDQPHVVADLQGGG--NLEVVGGDMFE  247

Query  797   SIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAYYN  976
             +IP+ANAV+LKWI+H+W DEECVKILKKC+EAIP +++GGK++IIDMVME+ K  D    
Sbjct  248   TIPSANAVILKWILHNWSDEECVKILKKCKEAIPTKDKGGKLMIIDMVMENNKGDDQAV-  306

Query  977   KAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
             + QL+ D L+M +   K+RN+ +W+KLF  AGF+ YKI+  LG RSLIEV+P
Sbjct  307   ETQLFWDMLMMTVLTGKQRNENEWKKLFVTAGFTHYKISAVLGFRSLIEVYP  358



>ref|XP_002278398.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
 emb|CBI21930.3| unnamed protein product [Vitis vinifera]
Length=358

 Score =   374 bits (959),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 185/359 (52%), Positives = 247/359 (69%), Gaps = 6/359 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELLQA+AH WNH  ++I+S +LKCA+QLGIPD IHNH KPM L  L+A LP+ P
Sbjct  5     NGERSSELLQAQAHVWNHIFNFINSMSLKCAIQLGIPDIIHNHCKPMTLHELVAKLPVRP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K   +HRL R LVHS      +   +   EE Y L    RLL+K+  +++  FL + + 
Sbjct  65    NKTLCVHRLMRILVHSG-FFTKQRVQESADEEGYVLANASRLLLKDHPLSITPFLLLLDP  123

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              + +   YA   WFQNDDP+PF TAHG  +WDY  HEP +N+ FNE  A D+ L+  VL+
Sbjct  124   DLTEPWDYA-SAWFQNDDPTPFFTAHGRTLWDYGCHEPRFNNFFNEGMASDARLVTSVLV  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
               E K  F+GL S VDV GG G VA  I + FP +   VLDLPHV+A +     +N+ ++
Sbjct  183   K-ECKGAFEGLNSFVDVGGGTGTVAKTIVEAFPHLHGTVLDLPHVVADLRGS--KNLTYL  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
             AG++FE+IP A+A+LLKWI+HDW DEEC+KILK+CREAIP +E+GGKV+IIDM +++ K 
Sbjct  240   AGDLFEAIPPADAILLKWILHDWSDEECLKILKQCREAIPSKEKGGKVMIIDMAIQNKKG  299

Query  959   TDAYYN-KAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              D   N + QL+ D L+M L   +ER +K+W+KLF ++GFS YKITP LGLRSLIEV+P
Sbjct  300   DDDESNVETQLFFDMLMMVLLPGREREEKEWKKLFLDSGFSGYKITPILGLRSLIEVYP  358



>ref|XP_008229109.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=354

 Score =   373 bits (958),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 188/362 (52%), Positives = 244/362 (67%), Gaps = 9/362 (2%)
 Frame = +2

Query  50    MAENGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALP  229
             M    +   ELLQA+AH WNH  S+I+S +LKCAVQLGIPD I  H +PM LS L++ALP
Sbjct  1     MGSEVRASHELLQAQAHIWNHIFSFINSMSLKCAVQLGIPDVIQKHGQPMTLSELVSALP  60

Query  230   IHPSKAPYIHRLTRFLVHSSVLLV-TKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLN  406
             I P+KA +I RL R LVHSS     + SGG    E+ Y LT    LL+++  ++ R FL 
Sbjct  61    ISPTKAHFIPRLMRILVHSSFFARESLSGG----EQGYVLTDASTLLLEDNPMSARPFLL  116

Query  407   ICNEYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIM  586
                  +       L  WFQND+P+PF   HG   WDY + +P     FN+A A D+ LI 
Sbjct  117   AVLNPILTDPWQYLTTWFQNDNPTPFHMVHGMTFWDYGNQDPTIAHFFNDAMASDARLIS  176

Query  587   EVLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIEN  766
              ++++ E K VF G+ SLVDV GG G VA +IA  FP MKC VLDLPHV+A +     +N
Sbjct  177   SLVID-ECKGVFQGVDSLVDVGGGTGTVAKSIADAFPHMKCTVLDLPHVVADLKGS--KN  233

Query  767   MEFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVME  946
             +E+VAG+MF+++PAA+A+ LKWI+HDW DEECVKIL++C+EAI    + GKVII+DM +E
Sbjct  234   LEYVAGDMFDAVPAADAIFLKWILHDWSDEECVKILERCKEAITREGKKGKVIIVDMTVE  293

Query  947   DPKRTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEV  1126
             D K TD    + QL+ D  +M L   KERN+K+W KLFS+AGFS YKITP+LGLRSLIEV
Sbjct  294   D-KNTDKESGETQLFFDMEMMVLATGKERNEKEWAKLFSDAGFSHYKITPSLGLRSLIEV  352

Query  1127  FP  1132
             +P
Sbjct  353   YP  354



>gb|AAM23005.1|AF502434_1 orcinol O-methyltransferase [Rosa hybrid cultivar]
 emb|CAD29459.1| orcinol O-methyltransferase [Rosa chinensis]
 emb|CAH05078.1| orcinol O-methyltransferase 2 [Rosa chinensis]
 dbj|BAQ20440.1| 3,5-dimethoxytoluene [Rosa hybrid cultivar]
Length=366

 Score =   373 bits (957),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 184/358 (51%), Positives = 249/358 (70%), Gaps = 7/358 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  16    NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHG-PMTLSELTSALPIHP  74

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  75    TKSHSVYRLMRILVHSGFF--AKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD  132

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V       L  WFQN+DP+PF TAHG   WDY +H+P    +FN+A A D+ L+  V++
Sbjct  133   PVLTTPWNYLSTWFQNEDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVII  192

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  193   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  249

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEEC+KILK+ R AI  +++ GKVIIIDM+ME+ ++
Sbjct  250   GGDMFEAVPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMMEN-QK  308

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              D    + QL+ D L+MAL   +ERN+K+W KLF++AGFSDYKITP LGLRSLIEV+P
Sbjct  309   GDEESIETQLFFDMLMMALVRGQERNEKEWAKLFTDAGFSDYKITPILGLRSLIEVYP  366



>ref|XP_006346268.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=353

 Score =   372 bits (956),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 180/360 (50%), Positives = 251/360 (70%), Gaps = 13/360 (4%)
 Frame = +2

Query  56    ENGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIH  235
             +NG    E+L A+AH  NH L+Y++S +LKCA+QLGIPD IH+H + M  S+L+ ALPI+
Sbjct  6     KNGDETNEVLAAQAHILNHVLNYVNSMSLKCAIQLGIPDIIHSHGRAMTRSDLVNALPIN  65

Query  236   PSKA-PYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNIC  412
              SK    I+RL R L+H+S  +        E E+ Y LTP  RLL+K E ++L  F+   
Sbjct  66    KSKGHECIYRLMRILIHASFFI--------EGEDGYLLTPTSRLLLKNEPLSLAPFVQAQ  117

Query  413   NEYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEV  592
              + +     ++LG+WF N D +PF TAHG+ ++DY   +P  N +FNEA   D+ LIM  
Sbjct  118   LDPILMDPWHSLGEWFANGDSTPFATAHGKPLFDYAGDDPRLNRIFNEAMESDARLIMSA  177

Query  593   LLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENME  772
             L+    KRVF+GL SLVDV GG G VA AI+  FP +KC V DLPHV+  +  GN  N+ 
Sbjct  178   LIK-NGKRVFEGLTSLVDVGGGIGTVAKAISNAFPELKCSVFDLPHVVEGLEGGN--NLS  234

Query  773   FVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDP  952
             ++ G+MF+S+P+A+A+LLKWI+HDW D++C KILKKC+EAIP +E GGKVI+ID V+++ 
Sbjct  235   YITGDMFKSVPSADAILLKWILHDWSDKDCAKILKKCKEAIPSKENGGKVIVIDTVIDNQ  294

Query  953   KRTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
             K  D  + ++QL++D L+M     KERN+++W KLFS+AGFSDYKI+P LGLRS+IEV+P
Sbjct  295   KGDDKSF-ESQLFLDVLMMVHVSGKERNEQEWAKLFSDAGFSDYKISPILGLRSVIEVYP  353



>ref|XP_002525160.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF37287.1| o-methyltransferase, putative [Ricinus communis]
Length=356

 Score =   372 bits (954),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 187/361 (52%), Positives = 249/361 (69%), Gaps = 5/361 (1%)
 Frame = +2

Query  50    MAENGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALP  229
             MA+      ELLQA+AH WNH  S+I+S +LK AVQLGIPD IH+H +P+ LS LIAALP
Sbjct  1     MADGKYDANELLQAQAHIWNHIFSFINSMSLKSAVQLGIPDAIHSHGRPISLSQLIAALP  60

Query  230   IHPSKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNI  409
             IHP+KA  I RL R L+HS      K   ++++EE Y LT   +LL+K+  +++  FL  
Sbjct  61    IHPAKARGIPRLMRILIHSGFFAKAKI-EEKDEEEGYVLTNASKLLLKDNPLSIAPFLLA  119

Query  410   CNEYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIME  589
               + +  K  + L  WFQNDD + F TAHG   W+Y + +P  N+ FNEA A D+ L+M+
Sbjct  120   MLDPILIKPWHYLSTWFQNDDATAFDTAHGMGFWEYTASDPNLNNFFNEAMASDARLVMK  179

Query  590   VLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENM  769
             VL++ E K +F+GLKSLVDV GG G +A+AIAK FP ++C V DLPHV+  +     EN+
Sbjct  180   VLID-EHKGLFEGLKSLVDVGGGTGTMAAAIAKAFPQLECTVFDLPHVVVGLQG--TENL  236

Query  770   EFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMED  949
             ++VAG+MFE+IP A+AVLLKWIMH W  E CVK+LK C+EAI   ++GGK+II+D+V+E 
Sbjct  237   KYVAGDMFEAIPPADAVLLKWIMHGWTHEGCVKLLKLCKEAIK-GKKGGKLIIVDLVLES  295

Query  950   PKRTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVF  1129
                TD    + Q + D L+M L   KE+N K W KLF +AGFSDYKI P LGLRS+IEV+
Sbjct  296   QHVTDHQDVETQFFFDILLMTLQTGKEKNNKDWGKLFMDAGFSDYKINPILGLRSVIEVY  355

Query  1130  P  1132
             P
Sbjct  356   P  356



>ref|XP_009625456.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=357

 Score =   371 bits (952),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 191/357 (54%), Positives = 251/357 (70%), Gaps = 15/357 (4%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIA--ALPIHPSKAP  250
             ELL+A+A  WNH  ++I S+A++CA+QLGI D ++ + KPM LS+L A  +L I+PSK  
Sbjct  9     ELLRAQAQIWNHIFNFISSSAVRCALQLGILDVLYKYGKPMSLSDLSAELSLVINPSKVS  68

Query  251   YIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQ  430
             ++  L RFLVHS  L        ++Q+  YSLTP   LLVK E  N+R+ L I ++ VF 
Sbjct  69    FLPILMRFLVHSGFL------NQDDQDHHYSLTPASCLLVKNEPFNVRSLLVINHDPVFS  122

Query  431   KSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEP--VYNDVFNEATAKDSELIMEVLLNG  604
             K+ + L  WFQND P+ F TA+G+ +WDYI  +   V  D+FN+A A DS L   VL+  
Sbjct  123   KAWFVLSTWFQNDSPTAFHTANGKSLWDYIVDQESRVLGDIFNDALASDSRLNTNVLIT-  181

Query  605   ESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAG  784
             E K VF+GL SLVDV GG G V+ AIAK FP +KC VLDLPHV+         N+EFV G
Sbjct  182   ECKHVFEGLNSLVDVGGGTGTVSIAIAKAFPNIKCTVLDLPHVVEDCKGSG--NLEFVGG  239

Query  785   NMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMED--PKR  958
             +MF++IP ANA+LLK I+HDW DE+CVKILKKC+E+IP RE+GGKVIIID VMED   K+
Sbjct  240   DMFDNIPHANAILLKCILHDWRDEDCVKILKKCKESIPNREKGGKVIIIDTVMEDDTKKQ  299

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVF  1129
             ++  + +AQ  MD L+M L  SKER KK+WEKLF++AGF++YKI   LGLRSLIE++
Sbjct  300   SNDEFIRAQHNMDMLMMVLCASKERTKKEWEKLFTDAGFTEYKIISALGLRSLIEIY  356



>ref|XP_007043718.1| Flavonoid o-methyltransferase related [Theobroma cacao]
 gb|EOX99549.1| Flavonoid o-methyltransferase related [Theobroma cacao]
Length=364

 Score =   371 bits (952),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 186/367 (51%), Positives = 252/367 (69%), Gaps = 10/367 (3%)
 Frame = +2

Query  47    IMAENGKLH---GELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLI  217
             ++  NG+ H    ELLQA+AH WN+  ++I+S +LKCA+ LGIPD I NH KPM ++ L+
Sbjct  3     VVCVNGEKHINDHELLQAQAHVWNYLFNFINSMSLKCAIDLGIPDVIQNHGKPMTVTELV  62

Query  218   AALPIHPSKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRA  397
             AALPI+ +KA  I+RL R LVHS      K  G+ +QEE Y LT   RLL+  + +++  
Sbjct  63    AALPINATKASSIYRLMRILVHSGFFAQQKL-GNNDQEEGYVLTHASRLLLNGDPLSVTP  121

Query  398   FLNICNEYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSE  577
             FL    + +  K  + LG WFQNDDP+PF TAHG   WDY  H+P+ +  FNE  A D+ 
Sbjct  122   FLKAMLDPILTKPWHFLGAWFQNDDPTPFDTAHGRTFWDYGGHDPMLSHFFNEGMASDAR  181

Query  578   LIMEVLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGN  757
             L+  +L++ + + VF GL S+VDV GG G VA AI+  FP ++C V DLP V+A +   +
Sbjct  182   LVSSILIH-KCEGVFQGLNSMVDVGGGIGTVAKAISDAFPHLECTVFDLPRVVAGLQ--D  238

Query  758   IENMEFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDM  937
               N+++V G+MFE++PAA+AVLLKWI+HDW DEECVKILK+C+EAI    +GGK IIIDM
Sbjct  239   RGNLKYVGGDMFEAVPAADAVLLKWILHDWNDEECVKILKRCKEAISRGGKGGKAIIIDM  298

Query  938   VM--EDPKRTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLR  1111
             V+  ++ K  DA   + QL+ D L+M L   KERN+++W  LF  AGFSDYKITP +GLR
Sbjct  299   VLTEKNHKVNDASI-ETQLFFDMLMMVLVTGKERNEEEWATLFLAAGFSDYKITPIMGLR  357

Query  1112  SLIEVFP  1132
             SLIEV+P
Sbjct  358   SLIEVYP  364



>ref|XP_003527407.1| PREDICTED: trans-resveratrol di-O-methyltransferase isoform 1 
[Glycine max]
Length=352

 Score =   370 bits (949),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 186/360 (52%), Positives = 244/360 (68%), Gaps = 10/360 (3%)
 Frame = +2

Query  53    AENGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPI  232
             A+  +   +LL A+ H WNH  S+I+S +LKCA++L IPD IH + +PMPLS L  +L I
Sbjct  3     AQRDERVSKLLGAQTHVWNHIFSFINSMSLKCAIELDIPDIIHKYGQPMPLSKLTTSLSI  62

Query  233   HPSKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNIC  412
             HPSKA  I+RL R L HS      K   + E E  Y LT    LL+K+  +++  FL+  
Sbjct  63    HPSKANCIYRLMRILTHSGFFSQHKV-NENELEMGYVLTDASTLLLKDNPLSMVPFLHAM  121

Query  413   NEYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEV  592
              +    +    L  WF+NDDPSPF TAHG KIWDY   EP  ND+FN+A A D++L+  V
Sbjct  122   LDPTLTQPWLQLPTWFKNDDPSPFQTAHGMKIWDYADREPRLNDLFNDAMASDTQLVANV  181

Query  593   LLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENME  772
             ++    K VF+GL+SLVDV GG G +A AIAK FP ++C V DLPHV+A++     EN++
Sbjct  182   VIE-RCKGVFNGLESLVDVGGGTGTMAMAIAKSFPQLECTVFDLPHVVATLQGS--ENLK  238

Query  773   FVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDP  952
             +V G+MFESIP+A+A+LLKWI+HDW DE+CVKILKKC+EAI       KVIIIDMV+E+ 
Sbjct  239   YVGGDMFESIPSADAILLKWILHDWNDEQCVKILKKCKEAI-----KSKVIIIDMVVENE  293

Query  953   KRTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
             K  D    + QL++D +VM LY  KER +K+W KL    GFSDYKITP LGLRSLIE++P
Sbjct  294   KGDDESI-ETQLFIDMVVMVLYPGKERTEKEWAKLIFSTGFSDYKITPVLGLRSLIEIYP  352



>emb|CAJ65641.1| putative orcinol O-methyltransferase [Rosa marretii]
Length=346

 Score =   369 bits (947),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 181/348 (52%), Positives = 241/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   +LL A+AHTWNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNDLLHAQAHTWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAVLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GLKSLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLKSLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEECVKILK+ REAI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65638.1| putative orcinol O-methyltransferase [Rosa hugonis]
Length=346

 Score =   368 bits (945),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 180/348 (52%), Positives = 242/348 (70%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGCPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSGFF--AKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K  + L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWHYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSMAHFFNDAMACDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEECVKILK+C+EAI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDEECVKILKRCKEAITSKDKKGKVIIIDMIMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   VDEESIETQLFFDMLMMALLTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAH05089.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   368 bits (945),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 182/348 (52%), Positives = 240/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSGFF--AKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE+IP AN VLLKWI+HDW DEECVKILK+ R+AI  +++ GKVII+DM+ME+ KR
Sbjct  240   GGDMFEAIPPANTVLLKWILHDWNDEECVKILKRSRKAITSKDKKGKVIILDMMMENQKR  299

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYKITP L
Sbjct  300   -DEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>ref|XP_003544914.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X1 [Glycine max]
Length=358

 Score =   369 bits (946),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 175/353 (50%), Positives = 244/353 (69%), Gaps = 4/353 (1%)
 Frame = +2

Query  74    GELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPY  253
              +LL+A+ H WNH  S+I+S +LKC V LGIPD IHN+ +PMPLSNLIA+LPIHPSK  +
Sbjct  10    AKLLRAQTHIWNHIFSFINSMSLKCVVDLGIPDIIHNYGQPMPLSNLIASLPIHPSKTCF  69

Query  254   IHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQK  433
             +HRL R ++HS          + + +  Y LT    LL+K   +++  FL+   + +   
Sbjct  70    VHRLMRIMIHSGFFSQQNHDMENQLDAKYVLTDASVLLLKNHPMSVTPFLHAMLDPILTN  129

Query  434   SCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESK  613
                    WF+N D +PF TAHG  +WDY   +P +N++FN+A A D+  +  +++  + K
Sbjct  130   PWNQFSTWFKNGDTTPFETAHGMMLWDYAGADPKHNNLFNDAMASDARFVTSLVIE-KCK  188

Query  614   RVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMF  793
              +F GL+SLVDV GG G +A AIAK FP ++CIV DLPHV++ +     EN+++VAG+MF
Sbjct  189   GMFMGLESLVDVGGGTGTMAKAIAKSFPRVECIVFDLPHVVSGLKGS--ENLKYVAGDMF  246

Query  794   ESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAYY  973
             E+IP A+A+LLKWI+HDW D+ECV ILKKC+EAI  + + GKVIIIDMV+E+ KR D   
Sbjct  247   EAIPPADAILLKWILHDWNDKECVDILKKCKEAITRKGKEGKVIIIDMVVENEKRDDESV  306

Query  974   NKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              + QL+ D L+M L   KER+KK+W KL S AG+++YKITP LGLRSLIE++P
Sbjct  307   -ETQLFFDMLMMVLVTGKERSKKEWAKLISSAGYNNYKITPVLGLRSLIEIYP  358



>emb|CAJ65632.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
 emb|CAJ65658.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   368 bits (944),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 182/348 (52%), Positives = 240/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE+IP AN VLLKWI+HDW DEECVKILK+ REAI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAIPPANTVLLKWILHDWNDEECVKILKQSREAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65607.1| putative orcinol O-methyltransferase [Rosa beggeriana]
Length=346

 Score =   367 bits (943),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 181/348 (52%), Positives = 240/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEECVKILK+ REAI  R++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSRDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>ref|XP_006351391.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=355

 Score =   367 bits (943),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 190/354 (54%), Positives = 241/354 (68%), Gaps = 12/354 (3%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYI  256
             ELLQAE  +WN    +I+   LKCA+QL IP+ I  H KPM +S L+++LPI PSK PY 
Sbjct  12    ELLQAETQSWNQLYFFIEHVTLKCALQLDIPNVITKHGKPMTISKLMSSLPISPSKFPYF  71

Query  257   HRLTRFLVHSSVLLVTK--SGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQ  430
             HRLTR LVH   L++ K      ++ + CYSL P  R +VK+   N         +  F 
Sbjct  72    HRLTRILVHYGFLILQKHDDNDVDDDKGCYSLAPADRYVVKDGPWNSME----DQDTFFF  127

Query  431   KSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGES  610
             K+   LGDWF+NDDPS F TA+G+  W  +S +P     FNE  ++DS   M VL+  E 
Sbjct  128   KAWNCLGDWFKNDDPSAFYTAYGDLFWSKLSSDPSTGSWFNENMSRDSRSFMNVLIGNEF  187

Query  611   KRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNM  790
             K VF+GL SLVDV GG G VA +IAK FP MKCIVLDLP V+A++     EN+EFVAG+M
Sbjct  188   KDVFEGLPSLVDVGGGTGTVAMSIAKSFPDMKCIVLDLPPVVANLQGS--ENLEFVAGDM  245

Query  791   FESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAY  970
             F+ IP ANAVLLK I+HDW DEECVKILK C+EA   +   GKVIIIDMVME+P+  D  
Sbjct  246   FQKIPPANAVLLKSILHDWNDEECVKILKNCKEA---KTGSGKVIIIDMVMENPELDDES  302

Query  971   YNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
               +AQL++D L+M   GSKERNKK+WEKLF ++GF+ YKIT TLGL+S+IE++P
Sbjct  303   V-QAQLFIDMLMMVFVGSKERNKKEWEKLFLDSGFTSYKITLTLGLKSIIELYP  355



>ref|XP_006469135.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=402

 Score =   369 bits (947),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 180/361 (50%), Positives = 251/361 (70%), Gaps = 6/361 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             +G+   ELL+A+AH WNH  ++I+S +LKCAV+LGIPD I+ H KPM L+ L++AL I+P
Sbjct  45    DGEHDTELLEAQAHVWNHIFNFINSMSLKCAVELGIPDIINKHGKPMTLNELVSALTINP  104

Query  239   SKAPYIHRLTRFLVHSSVL---LVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNI  409
             SK   ++RL R L+HS       +  S  + ++E+ Y LT   +LL+K+  +++  FL  
Sbjct  105   SKTRCVYRLMRILIHSGFFAQQTLNSSRNNNDEEQGYVLTNASKLLLKDNPLSVTPFLQA  164

Query  410   CNEYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIME  589
               + +       L  WFQNDDP+PF TAHG+ +W+Y   EP  N+ FNEA A D+ L   
Sbjct  165   MLDPILLSPWLKLSTWFQNDDPTPFDTAHGKSLWEYAGDEPKINNFFNEAMASDARLATR  224

Query  590   VLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENM  769
             V+++ + K VF+GL SLVDV GG G VA AIAK FP ++C   DLPHV+  + + ++ N+
Sbjct  225   VVIH-KCKDVFEGLNSLVDVGGGTGTVAKAIAKAFPNLECTDFDLPHVVNGLES-DLANL  282

Query  770   EFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMED  949
             +++ G+MFE+IP A+AVL KWI+HDW DEECVKILKKC+EAI    + GKVIIIDM+ E+
Sbjct  283   KYIGGDMFEAIPPADAVLFKWILHDWNDEECVKILKKCKEAITSDGKKGKVIIIDMMREN  342

Query  950   PKRTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVF  1129
              K+ D+   + QL+ D L+M L    ER++K+W KLF++AGFSDYKITP LGLRSLIEV+
Sbjct  343   -KKGDSESIETQLFFDMLMMVLVTGTERDEKEWAKLFADAGFSDYKITPILGLRSLIEVY  401

Query  1130  P  1132
             P
Sbjct  402   P  402



>emb|CAJ65663.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   367 bits (941),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 182/348 (52%), Positives = 239/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE+IP AN VLLKWI+HDW DEECVKILK+ REAI   ++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAIPPANTVLLKWILHDWNDEECVKILKQSREAITSEDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAH05084.1| orcinol O-methyltransferase 3 [Rosa hybrid cultivar]
Length=346

 Score =   367 bits (941),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 180/348 (52%), Positives = 241/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  +L    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V       L  WFQNDDP+PF TAHG   WDY +H+P    +FN+A A D+ L+  V++
Sbjct  123   PVLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             N + K VF+GL+SLVDV GG G +A AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   N-DCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE+IP AN VLLKWI+HDW DEECVKILK+ R AI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAIPPANTVLLKWILHDWNDEECVKILKRSRVAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL++D L+MAL G KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFLDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65628.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   367 bits (941),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 181/348 (52%), Positives = 240/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A++H WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQSHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSGFF--AKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE+IP AN VLLKWI+HDW DEECVKILK+ REAI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAIPPANTVLLKWILHDWNDEECVKILKQSREAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>ref|XP_009780941.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
sylvestris]
Length=363

 Score =   367 bits (942),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 183/361 (51%), Positives = 243/361 (67%), Gaps = 8/361 (2%)
 Frame = +2

Query  62    GKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPS  241
             G+   E+L A+ H WNH  S+I+S +LK A+QL IPD IH H KPM L  L  AL I+ +
Sbjct  7     GEHETEILHAQTHIWNHIFSFINSMSLKSAIQLNIPDIIHKHGKPMTLDQLANALSINKA  66

Query  242   KAPYIHRLTRFLVHSSVLLVTK----SGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNI  409
             K  ++ RL R L+HS   + ++     G  E   E Y+L P  RLL+K+E +++  FL  
Sbjct  67    KTTHLRRLMRILIHSGFFVKSRIQENEGESERIGEGYALAPPSRLLLKDEPLSVTPFLLA  126

Query  410   CNEYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIME  589
               + +  K  + + +WF+ND P+PF TAHG   WDY  HEP  N  FN+A A D++L+M 
Sbjct  127   MLDPILVKPWHHVSEWFENDHPTPFDTAHGRTFWDYAGHEPRLNHFFNDAMASDAKLVMN  186

Query  590   VLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENM  769
             V++   SK VF+GL S+VDV GG G VA +IA  FP ++C V DLPHV+  +  GN +N+
Sbjct  187   VVIK-YSKDVFEGLNSIVDVGGGTGTVAKSIANAFPDLQCTVFDLPHVVEGL-EGN-KNL  243

Query  770   EFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMED  949
              +V G+ F SIP A+A+LLKWI+HDW DEE VKILKKC+EAIP RE+GGKVIIIDM M D
Sbjct  244   NYVGGDFFVSIPPADALLLKWILHDWSDEESVKILKKCKEAIPSREKGGKVIIIDM-MVD  302

Query  950   PKRTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVF  1129
              K  D    + Q++ D L+M L   +ER++K W KLFS+AGFSDYK+TP LGLRSLIEV+
Sbjct  303   NKIGDDESIETQIFFDMLMMVLVTGRERSEKGWAKLFSDAGFSDYKVTPILGLRSLIEVY  362

Query  1130  P  1132
             P
Sbjct  363   P  363



>emb|CAJ65601.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   367 bits (941),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 180/348 (52%), Positives = 241/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A++     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVANLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEECVKILK+ REAI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKNGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAH05081.1| putative orcinol O-methyltransferase [Rosa hybrid cultivar]
 emb|CAJ65644.1| putative orcinol O-methyltransferase [Rosa phoenicia]
Length=346

 Score =   367 bits (941),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 181/348 (52%), Positives = 239/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHHPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEECVKILK+ REAI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERNKK+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALLTGKERNKKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65621.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   367 bits (941),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 181/348 (52%), Positives = 239/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NGK   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGKHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHHPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEECVKILK+ REAI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALLTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65630.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   366 bits (940),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 181/348 (52%), Positives = 239/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A++H WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQSHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSGFF--AKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +      N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--RNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE+IP AN VLLKWI+HDW DEECVKILK+ REAI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAIPPANTVLLKWILHDWNDEECVKILKQSREAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65640.1| putative orcinol O-methyltransferase [Rosa majalis]
 emb|CAJ65650.1| putative orcinol O-methyltransferase [Rosa lucieae]
 emb|CAJ65651.1| putative orcinol O-methyltransferase [Rosa lucieae]
 emb|CAJ65652.1| putative orcinol O-methyltransferase [Rosa lucieae]
 emb|CAJ65653.1| putative orcinol O-methyltransferase [Rosa lucieae]
 emb|CAJ65654.1| putative orcinol O-methyltransferase [Rosa lucieae]
Length=346

 Score =   366 bits (939),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 180/348 (52%), Positives = 240/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEECVKILK+ REAI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65602.1| putative orcinol O-methyltransferase [Rosa banksiae]
Length=346

 Score =   366 bits (939),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 181/348 (52%), Positives = 240/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K       EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRTLVHSG--FFAKKKLSTTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPAPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+AVLLKWI+HDW DEECVKILK+ REAI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADAVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65612.1| putative orcinol O-methyltransferase [Rosa canina]
Length=346

 Score =   366 bits (939),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 180/348 (52%), Positives = 240/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNCLSTWFQNDDPTPFDTAHGMTFWDYGNHQPRIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEECVKILK+ REAI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFETVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65618.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   366 bits (939),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 180/346 (52%), Positives = 239/346 (69%), Gaps = 6/346 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEECVKILK+ REAI  +++ GKVIIIDM+ME+ K 
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITRKDKKGKVIIIDMMMENQKG  299

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITP  1096
              +    + QL+ D L+MAL G KERN+K+W KLF++AGFSDYKITP
Sbjct  300   EEESI-ETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITP  344



>emb|CAJ65598.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   366 bits (939),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 180/348 (52%), Positives = 241/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A++     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVANLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEECVKILK+ REAI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITRKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>ref|XP_006446728.1| hypothetical protein CICLE_v10015708mg [Citrus clementina]
 gb|ESR59968.1| hypothetical protein CICLE_v10015708mg [Citrus clementina]
Length=362

 Score =   367 bits (941),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 179/361 (50%), Positives = 250/361 (69%), Gaps = 6/361 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             +G+   ELL+A+AH WNH  ++I+S +LKCAV+LGIPD I+ H KPM L+ L++AL I+P
Sbjct  5     DGEHDTELLEAQAHVWNHIFNFINSMSLKCAVELGIPDLINKHGKPMTLNELVSALTINP  64

Query  239   SKAPYIHRLTRFLVHSSVL---LVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNI  409
             SK   ++RL R L+HS       +  S  + ++E+ Y LT   +LL+K+  +++  FL  
Sbjct  65    SKTRCVYRLMRILIHSGFFAQQTLNSSRNNNDEEQGYVLTNASKLLLKDNPLSVTPFLQA  124

Query  410   CNEYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIME  589
               + +       L  WFQNDDP+PF TAHG+  W+Y   EP  N+ FNEA A D+ L   
Sbjct  125   MLDPILLSPWLKLSTWFQNDDPTPFDTAHGKSFWEYAGDEPKINNFFNEAMASDARLATS  184

Query  590   VLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENM  769
             V+++ + K VF+GL SLVDV GG G VA AIAK FP ++C   DLPHV+  + + ++ N+
Sbjct  185   VVIH-KCKDVFEGLNSLVDVGGGTGTVAKAIAKAFPNLECTDFDLPHVVNGLES-DLANL  242

Query  770   EFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMED  949
             ++V G++FE+IP A+AVL KWI+HDW DEECVKIL+KC+EAI    + GKVIIIDM+ E+
Sbjct  243   KYVGGDVFEAIPPADAVLFKWILHDWNDEECVKILQKCKEAITSDVKKGKVIIIDMMREN  302

Query  950   PKRTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVF  1129
              K+ D+   + QL+ D L+M L    ER++K+W KLF++AGFSDYKITP LGLRSLIEV+
Sbjct  303   -KKGDSESIETQLFFDMLMMVLVTGTERDEKEWAKLFADAGFSDYKITPILGLRSLIEVY  361

Query  1130  P  1132
             P
Sbjct  362   P  362



>ref|XP_009618299.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=356

 Score =   366 bits (940),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 193/366 (53%), Positives = 249/366 (68%), Gaps = 15/366 (4%)
 Frame = +2

Query  50    MAENGK--LHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAA  223
             MA+N +     ELL+AEAH+WN    +I+  ALKCA+QLGIP+ I  H+KPM LS LIAA
Sbjct  1     MADNNENLTPSELLRAEAHSWNQLYYFIEPVALKCALQLGIPNAITKHSKPMTLSELIAA  60

Query  224   LPIHPSKAPYIHRLTRFLVHSSVLLVTKSGG---DEEQEECYSLTPVGRLLVKEEAINLR  394
             LPI+PSK+ Y HRLTR LVH  +L++ KS G   + + E  YSL    R  VK     L 
Sbjct  61    LPINPSKSHYFHRLTRILVHYGLLILHKSEGRDNENDDEGYYSLATADRYAVKNATWKLM  120

Query  395   AFLNICNEYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDS  574
                    +  F K+  ++ DWF+N+DPS F TA+G+  WD +S +P   + FNE  AK+S
Sbjct  121   E----EQDTFFLKAWNSMSDWFKNEDPSAFYTAYGDLFWDKLSRDPSIGNWFNEIMAKES  176

Query  575   ELIMEVLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAG  754
                M+VLL  + K VFDGL S+VDV GG G VA AIAK FP MKC VLDLP ++A++   
Sbjct  177   RSFMKVLLEYKYKDVFDGLTSIVDVGGGTGTVAMAIAKTFPDMKCTVLDLPRLVANLQGS  236

Query  755   NIENMEFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIID  934
               EN+EFVA +MF+ IP ANAVLLK I+HDW D+ECV+ILK  ++AI  R   GK III+
Sbjct  237   --ENLEFVAADMFQKIPPANAVLLKSILHDWNDKECVRILKNSKKAITGR---GKAIIIE  291

Query  935   MVMEDPKRTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRS  1114
             MVME+P+  D    +AQL +D ++M   GSKERNK++WEKLF +AGFS YKI  TLGLRS
Sbjct  292   MVMENPEMDDESV-QAQLLIDMVIMVFLGSKERNKQEWEKLFLDAGFSSYKINQTLGLRS  350

Query  1115  LIEVFP  1132
             +IE++P
Sbjct  351   VIELYP  356



>emb|CAJ65624.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   366 bits (939),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 180/348 (52%), Positives = 239/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +      N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGST--NLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEECVKILK+ REAI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65609.1| putative orcinol O-methyltransferase [Rosa bracteata]
Length=346

 Score =   365 bits (938),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 180/348 (52%), Positives = 240/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K       EE Y+LT   +LL+K+  +++  FL    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSTTDEEGYTLTDASQLLLKDHPLSITPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+AVLLKWI+HDW DEECVKILK+ REAI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADAVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65626.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   365 bits (938),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 180/348 (52%), Positives = 238/348 (68%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGTTFWDYGNHQPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +      N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--RNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A  VLLKWI+HDW DEECVKILK+ REAI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPAGTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65613.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
 emb|CAJ65619.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   365 bits (938),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 180/348 (52%), Positives = 240/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEECVKILK+ REAI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITRKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>ref|XP_010088036.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXB31255.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=373

 Score =   367 bits (941),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 182/354 (51%), Positives = 240/354 (68%), Gaps = 6/354 (2%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYI  256
             ELL A+AH WN+  ++I+S +LKCAVQLGIPDTIH H KPM LS LI ALP+H +KAPY+
Sbjct  24    ELLGAQAHIWNNIFNFINSMSLKCAVQLGIPDTIHKHGKPMTLSKLIGALPVHQNKAPYV  83

Query  257   HRLTRFLVHSSVL-LVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQK  433
             +RL R LVHS    L T    D ++EE Y LT   +LLV +  +++  FL    + V  K
Sbjct  84    YRLMRILVHSGFFSLQTIGESDHQEEEGYVLTDASKLLVGDNPLSVAPFLLAMLDPVLTK  143

Query  434   SCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESK  613
                 L  WFQNDDP+ F T +G   W Y   EP   + FN+A A D+ L++ V++    K
Sbjct  144   PWDFLSTWFQNDDPTAFDTVNGLPFWKYGGQEPKMANFFNDAMASDARLVISVVIE-NCK  202

Query  614   RVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMF  793
              VFD L+S VDV GG G VA AIA  FP M+C V DLPHV+  +     +N++FV G+MF
Sbjct  203   WVFDELESFVDVGGGTGTVAKAIAATFPKMECTVFDLPHVVGDLQGK--DNLKFVGGDMF  260

Query  794   ESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIR-EEGGKVIIIDMVMEDPKRTDAY  970
             + +P A+A+LLKWI+HDW D+ECVKILKKC+EAI  +  + GKVIIID+++E+    D  
Sbjct  261   QQVPPADAILLKWILHDWSDDECVKILKKCKEAITSKGSKKGKVIIIDIMIENKDEDDKS  320

Query  971   YNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
             Y + QL+ D ++M L   +ERN+K+W KLF ++GFSDYKI P LGLRSLIEV+P
Sbjct  321   Y-ETQLFFDMMMMVLATGQERNEKEWAKLFQDSGFSDYKIIPILGLRSLIEVYP  373



>emb|CAJ65623.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   365 bits (937),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 180/348 (52%), Positives = 239/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEECVKILK+ REAI  + + GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKAKNGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAH05082.1| putative orcinol O-methyltransferase [Rosa hybrid cultivar]
Length=346

 Score =   365 bits (937),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 180/348 (52%), Positives = 239/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPCIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEECVKILK+ REAI  +++ GKVIIIDM ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMTMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>ref|XP_009764108.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
sylvestris]
Length=360

 Score =   365 bits (938),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 182/353 (52%), Positives = 246/353 (70%), Gaps = 6/353 (2%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAP-Y  253
             E+L A+AH  NH  +Y++S +LKCA+QL IPD IHNH KPM LSNL+ ALPI+ +K    
Sbjct  13    EILAAQAHIANHVFNYLNSMSLKCAIQLEIPDIIHNHGKPMTLSNLVNALPINKAKGQDC  72

Query  254   IHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQK  433
             I+RL R L+HS   + TK   + E+EE Y LTP  RLL+K E ++L  F+    + +   
Sbjct  73    IYRLMRILIHSGFFIQTKIN-ETEEEEGYLLTPNSRLLLKNEPLSLVPFVLAQLDPILMD  131

Query  434   SCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESK  613
                +L  W QNDD +PF TAHG+ +++Y   EP  N +FNEA A D+ L++ V++   S 
Sbjct  132   PFQSLSKWLQNDDSTPFATAHGKPLFEYAGEEPRLNYLFNEAMASDARLMISVVIKTGSG  191

Query  614   RVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMF  793
              +FDGLKSLVDV GG G VA AI+  FP +KC V DLPHV+  +     +N+ +V G+MF
Sbjct  192   -IFDGLKSLVDVGGGIGTVAKAISNAFPEVKCTVFDLPHVVEGLEGS--KNLSYVGGDMF  248

Query  794   ESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAYY  973
             +S+P+A+A+LLKWI+HDW DE+CVKILKKC+EAIP +E  GKVIIID+V+ D ++ D   
Sbjct  249   KSVPSADAILLKWILHDWSDEDCVKILKKCKEAIPSKENRGKVIIIDIVV-DSQKGDNKS  307

Query  974   NKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              + QL+ D L+M     KERN+++W KLF +AGFSDYKI P LGLRS+IEV+P
Sbjct  308   FETQLFSDILMMVHVSGKERNREEWAKLFCDAGFSDYKINPILGLRSVIEVYP  360



>emb|CAJ65622.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   365 bits (937),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 180/348 (52%), Positives = 239/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHHPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEECVKILK+ REAI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALLTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65648.1| putative orcinol O-methyltransferase [Rosa woodsii var. ultramontana]
Length=346

 Score =   364 bits (935),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 178/348 (51%), Positives = 240/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   +LL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNDLLHAQAHIWNHIFSFINSTSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEECVKILK+ REAI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   +ERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVTGRERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65597.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   364 bits (935),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 179/348 (51%), Positives = 241/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A++     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVANLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEECVKILK+ REAI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITRKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   +ERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVRGQERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65665.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   364 bits (935),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 179/348 (51%), Positives = 239/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM L  L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSVSLKSAIQLGIPDIINKHGYPMTLFELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSGFF--AKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEECVKILK+ REAI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKSGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAH05087.1| orcinol O-methyltransferase 4 [Rosa hybrid cultivar]
Length=346

 Score =   364 bits (935),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 181/348 (52%), Positives = 239/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGI D I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHVWNHIFSFINSMSLKSAIQLGILDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSGFF--AKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE+IP AN VLLKWI+HDW DEECVKILK+ REAI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAIPPANTVLLKWILHDWNDEECVKILKQSREAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65625.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   364 bits (934),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 180/348 (52%), Positives = 238/348 (68%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +      N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--RNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI HDW DEECVKILK+ REAI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWISHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65620.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   364 bits (934),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 179/348 (51%), Positives = 239/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL  +AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHVQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEECVKILK+ REAI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITRKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAD29556.1| orcinol O-methyltransferase [Rosa hybrid cultivar]
Length=348

 Score =   364 bits (934),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 178/349 (51%), Positives = 241/349 (69%), Gaps = 6/349 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  6     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELSSALPIHP  65

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  66    TKSHSVYRLMRILVHSG--FFAKKKLSKIDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD  123

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF T HG   WDY +H+P    +FN+A A D+ L+  V++
Sbjct  124   PVLTKPWNYLSTWFQNDDPTPFDTTHGMTFWDYGNHQPNIAHLFNDAMASDARLVTSVII  183

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+  +     +N+++ 
Sbjct  184   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVGDLQGS--KNLKYT  240

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEEC+KILK+ R AI  +++ GKVIIIDM+ME+ ++
Sbjct  241   GGDMFEAVPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMMEN-QK  299

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLG  1105
              D    + QL++D L+MAL G KERN+K+W KLF++AGFSDYKITP LG
Sbjct  300   GDEESIETQLFLDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPILG  348



>emb|CAJ65635.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   364 bits (934),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 181/348 (52%), Positives = 239/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGI D I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGILDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSGFF--AKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE+IP AN VLLKWI+HDW DEECVKILK+ REAI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAIPPANTVLLKWILHDWNDEECVKILKQSREAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>ref|XP_007142076.1| hypothetical protein PHAVU_008G250600g [Phaseolus vulgaris]
 gb|ESW14070.1| hypothetical protein PHAVU_008G250600g [Phaseolus vulgaris]
Length=357

 Score =   364 bits (934),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 173/353 (49%), Positives = 243/353 (69%), Gaps = 5/353 (1%)
 Frame = +2

Query  74    GELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPY  253
              +LL+A+ H WNH LS+I+S +LKC V LGIPD IHNH +PM LSNLI++LPIH SK  +
Sbjct  10    AKLLRAQTHVWNHILSFINSMSLKCIVDLGIPDIIHNHGQPMSLSNLISSLPIHSSKTHF  69

Query  254   IHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQK  433
             IHRL R +V S       +  + E E  Y+LT    LL+K  A+++  +L    +  F  
Sbjct  70    IHRLMRIMVQSG-FFSQHNPTENELEVKYALTDSSLLLLKSHAMSMTPYLQAKLDPAFTN  128

Query  434   SCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESK  613
                   +WF+ND P+ F  AHG+  W+Y   +P +N +FN+A A D++L+  V++  + K
Sbjct  129   PWNQFSNWFKNDSPTTFEMAHGKPFWEYAGSDPRFNILFNDAMASDAQLVTSVVIE-KCK  187

Query  614   RVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMF  793
              VF GL+SLVDV GG G +  AI+K FP ++C V DLPHV++ +     EN+++V G+MF
Sbjct  188   GVFMGLESLVDVGGGTGTMGKAISKSFPQLECTVFDLPHVVSGLQGS--ENLKYVGGDMF  245

Query  794   ESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAYY  973
             E+IP A+A+LLKWI+HDW DEECVKILKKC+EAI  + + GKVIIIDMV++   + D  +
Sbjct  246   EAIPPADAILLKWILHDWSDEECVKILKKCKEAISRKGKEGKVIIIDMVVDKEMKDDESF  305

Query  974   NKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              + QL+ D ++M L+  KERNKK+W KL S AGF++YKITP +G+RSLIE++P
Sbjct  306   -ETQLFFDLMMMVLFNGKERNKKEWVKLISSAGFNNYKITPVMGIRSLIEIYP  357



>emb|CAJ65642.1| putative orcinol O-methyltransferase [Rosa marretii]
Length=346

 Score =   363 bits (933),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 179/348 (51%), Positives = 239/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSTSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEECVKILK+ REAI  +++ GKVIIIDM+ E+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMREN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65604.1| putative orcinol O-methyltransferase [Rosa beggeriana]
Length=346

 Score =   363 bits (933),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 179/348 (51%), Positives = 239/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEECVKILK+ R AI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSRGAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65639.1| putative orcinol O-methyltransferase [Rosa hugonis]
Length=346

 Score =   363 bits (933),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 178/348 (51%), Positives = 241/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+++S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFMNSMSLKSAIQLGIPDIINKHGCPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   + L+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSGFF--AKKKLSKTDEEGYTLTDASQPLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K  + L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWHYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSMAHFFNDAMACDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEECVKILK+C+EAI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDEECVKILKRCKEAITSKDKKGKVIIIDMIMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   VDEESIETQLFFDMLMMALLTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAH05083.1| putative orcinol O-methyltransferase [Rosa hybrid cultivar]
Length=346

 Score =   363 bits (932),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 177/348 (51%), Positives = 240/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEDSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGPPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  + RL R LVHS      K    E  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSLDRLMRILVHSG--FFAKEKLSETDEEGYTLTDTSQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K  + L  WFQNDD +PF TAHG  +WDY +H+P ++  FN+A A D+ L+  V++
Sbjct  123   PVLTKPWHHLSTWFQNDDLTPFATAHGMTMWDYGNHQPSFSHFFNDAMASDARLVASVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             N E K VF+GL+SLVDV GG G +A AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   N-ECKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEECVKIL++ +EAI  +++ GKVIIIDM+M + ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDEECVKILQRSKEAITSKDKKGKVIIIDMIMGN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+M L   KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIEMQLFFDMLMMVLLKGKERNEKEWAKLFTDAGFSDYKITPIL  346



>ref|XP_008245137.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=354

 Score =   363 bits (932),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 183/361 (51%), Positives = 237/361 (66%), Gaps = 7/361 (2%)
 Frame = +2

Query  50    MAENGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALP  229
             M  + +   ELL+A+A  WNH+ S+I+S +LKCAVQL IPD I  H +PM LS L++ALP
Sbjct  1     MGSDVRASHELLKAQAQIWNHTFSFINSMSLKCAVQLDIPDVIQKHGQPMTLSELVSALP  60

Query  230   IHPSKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNI  409
             I P+KA +I RL R LVHS         G E+    Y LT    LL+K+  ++ R FL  
Sbjct  61    ISPTKAHFIPRLIRILVHSGFFASESLNGGEQG---YVLTDASALLLKDNPMSARPFLLA  117

Query  410   CNEYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIME  589
                 +       L  WFQND+P+PF  AHG   WDY + +      FNEA A D+ LI  
Sbjct  118   MLNPILTDPWQYLTTWFQNDNPTPFHVAHGMTFWDYGNQDTTLAHFFNEAMASDARLISS  177

Query  590   VLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENM  769
             ++++ + K VF G+ SLVDV GG G VA +IA  FP MKC VLDLPHV+A +   N  N+
Sbjct  178   LMID-DCKGVFQGVDSLVDVGGGTGTVAKSIAAAFPHMKCTVLDLPHVVADLKGSN--NL  234

Query  770   EFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMED  949
             E+VAG+MFE+IP A+A+ LKWI+HDW DEECVKIL++C+EAI    + GKVII+DM +E+
Sbjct  235   EYVAGDMFEAIPGADAIFLKWILHDWSDEECVKILERCKEAITRDGKKGKVIIVDMTVEN  294

Query  950   PKRTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVF  1129
              K TD    + QL+ D  +M L   KERN+K+W  LFS+AGFS YKITP LGLRSLIEV+
Sbjct  295   -KNTDKESGETQLFFDMEMMVLATGKERNEKEWAMLFSDAGFSHYKITPGLGLRSLIEVY  353

Query  1130  P  1132
             P
Sbjct  354   P  354



>emb|CAJ65615.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   363 bits (931),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 177/348 (51%), Positives = 241/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  +L    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V       L  WFQNDDP+PF TAHG   WDY +H+P    +FN+A A D+ L+  V++
Sbjct  123   PVLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             N + K VF+GL+SLVDV GG G +A AIA  FP ++C VLDLPHV+A +     +N++++
Sbjct  183   N-DCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYI  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEEC+KIL++ R AI  +E+ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDEECIKILERSRVAITGKEKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL G KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65610.1| putative orcinol O-methyltransferase [Rosa canina]
Length=346

 Score =   363 bits (931),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 179/348 (51%), Positives = 240/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +AL IHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALLIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSGFF--AKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P    +FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEECVKILK+ REAI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65647.1| putative orcinol O-methyltransferase [Rosa rugosa]
Length=346

 Score =   363 bits (931),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 178/348 (51%), Positives = 239/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW +EECVKILK+ REAI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNNEECVKILKRSREAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+M L   KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMTLVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65603.1| putative orcinol O-methyltransferase [Rosa banksiae]
Length=346

 Score =   363 bits (931),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 180/348 (52%), Positives = 239/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGFPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K       EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSTTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTSWDYGNHQPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  F  ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFSHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+AVLLKWI+HDW DEECVKILK+ REAI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADAVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAH05091.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   363 bits (931),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 178/348 (51%), Positives = 241/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ +  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P    +FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMAFWDYGNHQPSIAHLFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G +A AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEECVKILK+ REAI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPLADTVLLKWILHDWNDEECVKILKQSREAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAH05080.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   362 bits (930),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 180/348 (52%), Positives = 238/348 (68%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH  NH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIRNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSGFF--AKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMPD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHHPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             N + K VF+GL+SLVDV GG G +A AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   N-DCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEECVKILK+ REAI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERNKK+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALLTGKERNKKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65633.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   362 bits (930),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 176/348 (51%), Positives = 238/348 (68%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL  +AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHVQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  + L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTDASQLLLKDHPLTLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF T HG   WDY +H+P    +FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTTHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+  +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVGDLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEEC+KILK+ R AI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL++D L+MAL G KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFLDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65646.1| putative orcinol O-methyltransferase [Rosa rugosa]
Length=346

 Score =   362 bits (930),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 177/348 (51%), Positives = 239/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEEC+KILK+ R AI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYK+TP L
Sbjct  299   GDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKVTPIL  346



>emb|CAH05085.1| orcinol O-methyltransferase 3 [Rosa hybrid cultivar]
Length=346

 Score =   362 bits (930),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 176/348 (51%), Positives = 240/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  +L    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V       L  WFQNDDP+PF TAHG   WDY +H+P    +FN+A A D+ L+  V++
Sbjct  123   PVLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             N + K VF+GL+SLVDV GG G +A AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   N-DCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW D+EC+KILK+ R AI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL G KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPIL  346



>ref|XP_008229108.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=355

 Score =   363 bits (931),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 181/352 (51%), Positives = 236/352 (67%), Gaps = 6/352 (2%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYI  256
             ELL+A+AH WNH  S+++S +LKCAVQL I D I  H +PM LS L++ALPI P+KA +I
Sbjct  10    ELLKAQAHIWNHIFSFVNSMSLKCAVQLDIADVIQKHGQPMILSELVSALPISPTKAHFI  69

Query  257   HRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQKS  436
              RL R LVHS         G  EQ   Y LT    LL+K+  ++ R FL      +    
Sbjct  70    PRLMRILVHSGFFARESLSGGGEQ--GYVLTDASALLLKDNPMSARPFLLAMLNPMLTDP  127

Query  437   CYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESKR  616
                L  WFQND+P+PF   HG   WDY + +P     FN+A A D++LI  ++++ + K 
Sbjct  128   WQYLTTWFQNDNPTPFHVVHGMTFWDYGNQDPTLAHFFNDAMASDAQLISSLMID-DCKG  186

Query  617   VFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMFE  796
             VF G+ SLVDV GG G VA +IA  FP MKC VLDLPHV+A +     +N+E+VAG+MFE
Sbjct  187   VFQGVDSLVDVGGGTGTVAKSIADAFPHMKCTVLDLPHVVADLKGS--KNLEYVAGDMFE  244

Query  797   SIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAYYN  976
             ++P A+A+ LKWI+HDW DEECVKIL++C+EAI    + GKVII+DM +E+ K TD    
Sbjct  245   AVPEADAIFLKWILHDWSDEECVKILERCKEAITREGKKGKVIIVDMTVEN-KNTDKESG  303

Query  977   KAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
             + QL+ D L+M L   KERN+K+W KLFS+AGFS YKITP LGLRSLIEV+P
Sbjct  304   ETQLFFDMLMMVLVKGKERNEKEWAKLFSDAGFSHYKITPCLGLRSLIEVYP  355



>emb|CAJ65614.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   362 bits (929),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 176/346 (51%), Positives = 240/346 (69%), Gaps = 6/346 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  +L    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V       L  WFQNDDP+PF TAHG   WDY +H+P    +FN+A A D+ L+  V++
Sbjct  123   PVLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             N + K VF+GL+SLVDV GG G +A AIA  FP ++C VLDLPHV+A +     +N++++
Sbjct  183   N-DCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYI  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEEC+KIL++ R AI  +E+ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDEECIKILERSRVAITGKEKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITP  1096
              D    + QL+ D L+MAL G KERN+K+W KLF++AGFSDYKITP
Sbjct  299   GDEESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITP  344



>emb|CAJ65606.1| putative orcinol O-methyltransferase [Rosa beggeriana]
Length=346

 Score =   362 bits (929),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 179/348 (51%), Positives = 239/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +AL IHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALLIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSGFF--AKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEECVKILK+ REAI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65664.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   362 bits (929),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 177/348 (51%), Positives = 240/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELSSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKIDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF T HG   WDY +H+P    +FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTTHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+  +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVGDLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEEC+KILK+ R AI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL++D L+MAL G KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFLDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65655.1| putative orcinol O-methyltransferase [Rosa lucieae]
Length=346

 Score =   362 bits (928),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 178/348 (51%), Positives = 239/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKRLSKTDEEGYTLTDASQLLLKDHPLSLTPFLAAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEECV+ILK+ REAI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDEECVEILKRSREAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGF DYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFGDYKITPIL  346



>ref|XP_007142077.1| hypothetical protein PHAVU_008G250700g [Phaseolus vulgaris]
 gb|ESW14071.1| hypothetical protein PHAVU_008G250700g [Phaseolus vulgaris]
Length=357

 Score =   362 bits (929),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 173/353 (49%), Positives = 241/353 (68%), Gaps = 5/353 (1%)
 Frame = +2

Query  74    GELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPY  253
              +LL+A+ H WNH LS+I+S +LKC V LGIPD IHNH +PM LSNLI++LPIH SK  +
Sbjct  10    AKLLKAQTHVWNHILSFINSMSLKCIVDLGIPDIIHNHGQPMSLSNLISSLPIHSSKTHF  69

Query  254   IHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQK  433
             IHRL R +VHS       +  + E E  Y+LT    LL+K  A+++  FL    + V   
Sbjct  70    IHRLMRIMVHSG-FFSQHNHTENELEVKYALTDSSLLLLKSNAMSVTPFLQAMLDPVLTT  128

Query  434   SCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESK  613
                   +WF+N +P+ F  A G+  W+Y   +P  N +FN+A A D++L+  V++  + K
Sbjct  129   PWNQFANWFKNGNPTTFEMAQGKPFWEYAGSDPRINSLFNDAMASDAQLVTSVVIE-KCK  187

Query  614   RVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMF  793
             RVF GL+SLVDV GG G +  AIAK FP ++C V DLPHV++ +     EN+++V G+MF
Sbjct  188   RVFMGLESLVDVGGGTGTMGKAIAKSFPQLECTVFDLPHVVSGLQGS--ENLKYVGGDMF  245

Query  794   ESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAYY  973
             E+IP A+A+LLKWI+HDW DE+ V ILKKC+EA+  + + GKVIIIDMV++   + D  +
Sbjct  246   EAIPPADAILLKWILHDWSDEDSVNILKKCKEALSRKGKEGKVIIIDMVVDKEMKDDESF  305

Query  974   NKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              + QL+ D L+M  +  KERNKK+W KLFS AGF++YKITP +GLRSLIE++P
Sbjct  306   -ETQLFFDMLMMVFFTGKERNKKEWVKLFSSAGFNNYKITPVVGLRSLIEIYP  357



>ref|XP_004229155.1| PREDICTED: myricetin O-methyltransferase-like isoform X1 [Solanum 
lycopersicum]
Length=352

 Score =   362 bits (928),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 181/354 (51%), Positives = 245/354 (69%), Gaps = 15/354 (4%)
 Frame = +2

Query  80    LLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPI-HPSKAPYI  256
             LL A+A  WN+  ++I S+A++CA QLGIPD ++ H KPM LS++ A L + + SK  ++
Sbjct  11    LLHAQAQIWNYIFNFISSSAVRCAFQLGIPDVLYKHDKPMCLSDISAELSVVNSSKVSFL  70

Query  257   HRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQKS  436
               L +FLV S  L         + E+ YSLTP   LL K++  N+R+ L + +   F K+
Sbjct  71    PILMQFLVQSGFL--------NQHEDHYSLTPASCLLAKDDPFNVRSLLLLNHGQAFSKA  122

Query  437   CYALGDWFQNDDPSPFCTAHGEKIWDYISHE--PVYNDVFNEATAKDSELIMEVLLNGES  610
                L DWFQND P+PF TAHG+ +WD+I  E   V  D+FN+A A DS L   VL+  E 
Sbjct  123   WPELSDWFQNDSPTPFHTAHGKSLWDFIGEEQPSVLGDIFNDALASDSRLNTNVLI-AEC  181

Query  611   KRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNM  790
             K VF+GL SLVDV GG G V+ AIAK FP +KC VLDLP V+  +      N++FV G+M
Sbjct  182   KHVFEGLTSLVDVGGGTGTVSIAIAKAFPNIKCTVLDLPQVVGDLKGSG--NLDFVGGDM  239

Query  791   FESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAY  970
             F+ IP  NA+LLK ++HDW DE+CVK+LKKC+E+IP RE+GGKVIIID V+EDPK+++ +
Sbjct  240   FDMIPHTNAILLKCVLHDWNDEDCVKVLKKCKESIPSREKGGKVIIIDTVLEDPKQSNEF  299

Query  971   YNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
               +AQ  M  L+M L+ +KER +K+WEKLFSEAGF++YKI P LGLRSLIE++P
Sbjct  300   V-RAQHNMGMLMMVLFAAKERTEKEWEKLFSEAGFTEYKIFPALGLRSLIEIYP  352



>emb|CDP15888.1| unnamed protein product [Coffea canephora]
Length=362

 Score =   362 bits (929),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 177/362 (49%), Positives = 241/362 (67%), Gaps = 6/362 (2%)
 Frame = +2

Query  50    MAENGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALP  229
             +A NG   GEL QA+AH WNH  ++I+S +LKCA+QLGIPD IH H +PM L+ LI ALP
Sbjct  3     LARNGDHTGELFQAQAHIWNHIFNFINSMSLKCAIQLGIPDIIHKHGQPMALAQLIDALP  62

Query  230   IHPSKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNI  409
             I+ +KAP+++RL R L+HS   +  K   D E +E Y+LT   +LL+  +  ++  FL  
Sbjct  63    INNAKAPFVYRLMRILIHSGFFIKAKI-PDNEGQEGYALTSASKLLLANDPFSVTPFLLA  121

Query  410   CNEYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIME  589
               + +     +    WFQN + +PF T HG  +W+    +P  N  FNE  A D+ L+  
Sbjct  122   MLDPILTDPWHHFSQWFQNSEETPFHTCHGTSLWELAGRQPQLNQFFNEGMASDARLVST  181

Query  590   VLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENM  769
             +++    K VF GL SL+DV GG G VA AIA  FP ++C VLDLPHV+    +   +N+
Sbjct  182   MVIE-NCKDVFMGLNSLIDVGGGTGTVAKAIADAFPHLQCSVLDLPHVVDGWESS--KNL  238

Query  770   EFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMED  949
              +V G+MFE+IP A+AVLLKWI+HDW DEECV+IL+KC+EAIP  E+GGKVIIIDM+++ 
Sbjct  239   AYVGGDMFEAIPPADAVLLKWILHDWSDEECVQILRKCKEAIPSMEKGGKVIIIDMLLKS  298

Query  950   PKR--TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIE  1123
              +    DA   + QL+ D L+M     +ERN+K WEKLF EAGF+ YKITP LGLRS+IE
Sbjct  299   QQNGDDDAEAIETQLFFDMLMMVHVKGRERNEKDWEKLFLEAGFNGYKITPVLGLRSIIE  358

Query  1124  VF  1129
             V+
Sbjct  359   VY  360



>emb|CAH05079.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   361 bits (927),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 178/348 (51%), Positives = 238/348 (68%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHHPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G +A AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEECVKILK+ REAI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AG SDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALLTGKERNEKEWAKLFTDAGLSDYKITPIL  346



>emb|CAJ65645.1| putative orcinol O-methyltransferase [Rosa roxburghii]
Length=346

 Score =   361 bits (927),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 178/348 (51%), Positives = 239/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEECVKIL++  EAI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDEECVKILERSGEAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65608.1| putative orcinol O-methyltransferase [Rosa bracteata]
Length=346

 Score =   361 bits (927),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 179/348 (51%), Positives = 238/348 (68%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   E L A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNEPLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K       EE Y+LT   +LL+K+  +++  FL    +
Sbjct  65    TKSHSVYRLMRILVHSGFF--AKKKLSTTDEEGYTLTDASQLLLKDHPLSITPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE+ P A+AVLLKWI+HDW DEECVKILK+ REAI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAAPPADAVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>ref|XP_006365443.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=352

 Score =   361 bits (927),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 186/364 (51%), Positives = 243/364 (67%), Gaps = 15/364 (4%)
 Frame = +2

Query  50    MAENGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALP  229
             M+ +  +  ELL A+   WN+  ++I S+A+ CA QLGIPD ++ H KPM LS+L A L 
Sbjct  1     MSTSETISTELLHAQEQIWNYIFNFISSSAVTCAFQLGIPDVLYKHEKPMCLSDLSAKLS  60

Query  230   I-HPSKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLN  406
             + + SK  ++  L RFLV S  L         + E+ Y LTP  RLLVK E  N+R+FL 
Sbjct  61    VVNSSKISFLPILMRFLVQSGFL--------NQHEDHYFLTPASRLLVKNEPFNVRSFLL  112

Query  407   ICNEYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEP--VYNDVFNEATAKDSEL  580
               N     K+ + L DWFQND P+PF TAHG+ +WDY+  E   V  D+F +A A DS L
Sbjct  113   FTNIQACSKAWHELSDWFQNDSPTPFHTAHGKSLWDYMGEEKHRVLGDIFYDALASDSRL  172

Query  581   IMEVLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNI  760
             I  VL+  E K VF+GL SLVDV GG G VA AIAK FP + C VLDLP VI  +     
Sbjct  173   ITNVLIT-ECKHVFEGLTSLVDVGGGTGTVAIAIAKAFPNINCAVLDLPQVIGDLKGSG-  230

Query  761   ENMEFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMV  940
              N+ F+ G+MF+ IP ANA+LLK ++HDW DE CV+ILKKC+E+IP R +GGKVIIID+V
Sbjct  231   -NLAFIGGDMFDKIPHANAILLKSVLHDWNDENCVRILKKCKESIPSRAKGGKVIIIDIV  289

Query  941   MEDPKRTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLI  1120
             +E+PK  + +  +AQ  MD L+M L G+KER +K+WEKLF EAGF++YKI   LGLRSLI
Sbjct  290   LENPKERNEFV-RAQHNMDMLMMVLCGAKERTEKEWEKLFIEAGFNEYKIFHVLGLRSLI  348

Query  1121  EVFP  1132
             E++P
Sbjct  349   EIYP  352



>ref|XP_004235335.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
lycopersicum]
Length=445

 Score =   364 bits (935),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 179/353 (51%), Positives = 247/353 (70%), Gaps = 13/353 (4%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKA-PY  253
             E+L A+AH  NH  +YI+S +LKCA+QLGIPD IHNH + M  S+L+ ALPI+ SK    
Sbjct  105   EVLAAQAHIANHVFNYINSMSLKCAIQLGIPDIIHNHGRAMTQSDLVNALPINKSKGHDC  164

Query  254   IHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQK  433
             I+RL R L+H+            + EE Y LTP  RLL+K E ++L  F+    + V   
Sbjct  165   IYRLMRILIHAGFF--------TQGEEGYLLTPTSRLLLKNEPLSLAPFVQAQLDPVLMD  216

Query  434   SCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESK  613
               ++LG+WF N+D +PF TAHG+ +++Y   E   N++FNEA   D+ LIM VL+    K
Sbjct  217   PWHSLGEWFANEDSTPFATAHGKPLFEYAGDEQRLNNLFNEAMGCDARLIMSVLIK-NGK  275

Query  614   RVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMF  793
              VF+GLKSLVDV GG G VA AI+  FP +KC V DLPHV+  +  G  +N+ ++AG+MF
Sbjct  276   GVFEGLKSLVDVGGGIGTVAKAISNAFPELKCSVFDLPHVVEGLEGG--KNLTYIAGDMF  333

Query  794   ESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAYY  973
             + +P+A+A+LLKWI+HDW D++CVKILKKC+EAIP +E GGKVI+ID+V+++ KR +  +
Sbjct  334   KFVPSADAILLKWILHDWSDKDCVKILKKCKEAIPSKENGGKVIVIDIVIDNQKRDNKSF  393

Query  974   NKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              + QL+ D L+M     KERN+++W KLFS AGFSDYKI+P LGLRS+IEV+P
Sbjct  394   -ETQLFSDVLMMVHVSGKERNEQEWAKLFSNAGFSDYKISPILGLRSVIEVYP  445



>emb|CAJ65599.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   361 bits (926),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 175/346 (51%), Positives = 239/346 (69%), Gaps = 6/346 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  +L    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V       L  WFQNDDP+PF TAHG   WDY +H+P    +FN+A A D+ L+  V++
Sbjct  123   PVLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             N + K VF+GL+SLVDV GG G +A AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   N-DCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEEC+KIL++ R AI  +E+ GKVII+DM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWSDEECIKILERSRVAITGKEKKGKVIIVDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITP  1096
              D    + QL+ D L+MAL G KERN+K+W KLF++AGFSDYKITP
Sbjct  299   GDEESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITP  344



>emb|CAJ65661.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   361 bits (926),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 179/348 (51%), Positives = 239/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSGFFAEKKLS--KTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L   FQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTRFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEECVKILK+ REAI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKNGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAH05090.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   360 bits (925),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 180/348 (52%), Positives = 238/348 (68%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGI D I+ H   M LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGILDVINKHGYLMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSGFF--AKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE+IP AN VLLKWI+HDW DEECVKILK+ REAI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAIPPANTVLLKWILHDWNDEECVKILKQSREAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAH05086.1| orcinol O-methyltransferase 4 [Rosa hybrid cultivar]
Length=346

 Score =   360 bits (925),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 177/348 (51%), Positives = 239/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGI D I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGILDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTNASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSTAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW D+EC+KILK+ R AI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL G KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAD29555.1| orcinol O-methyltransferase [Rosa hybrid cultivar]
Length=348

 Score =   360 bits (925),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 175/349 (50%), Positives = 241/349 (69%), Gaps = 6/349 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ +  PM LS L +ALPIHP
Sbjct  6     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIHP  65

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  +L    +
Sbjct  66    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLD  123

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V       L  WFQNDDP+PF TAHG   WDY +H+P    +FN+A A D+ L+  V++
Sbjct  124   PVLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVII  183

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G +A AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  184   D-DCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  240

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW D+EC+KILK+ R AI  +++ GKVIIIDM+ME+ ++
Sbjct  241   GGDMFEAVPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMMEN-QK  299

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLG  1105
              D    + QL+ D L+MAL G KERN+K+W KLF++AGFSDYKITP LG
Sbjct  300   GDEESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPILG  348



>emb|CAJ65656.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   360 bits (924),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 175/348 (50%), Positives = 239/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  ++I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFNFINSMSLKSAIQLGIPDIINKHGYPMTLSELSSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K   ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTDASQLLLKGHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF T HG   WDY +H+P    +FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTTHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+  +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVGDLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEEC+K+LK+ R AI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDEECIKVLKRSRVAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL++D L+MAL G KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFLDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65605.1| putative orcinol O-methyltransferase [Rosa beggeriana]
Length=346

 Score =   360 bits (924),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 178/348 (51%), Positives = 238/348 (68%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +AL IHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALLIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSGFF--AKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + +   VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCNGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEECVKILK+ REAI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65634.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   360 bits (924),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 177/348 (51%), Positives = 239/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELSSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKIDEEGYTLTDASQLLPKDHPLSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF T HG   WDY +H+P    +FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTTHGMTFWDYGNHQPNIAHLFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+  +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVGDLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEEC+KILK+ R AI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL++D L+MAL G KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFLDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPIL  346



>ref|XP_006356531.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=359

 Score =   360 bits (925),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 184/364 (51%), Positives = 247/364 (68%), Gaps = 7/364 (2%)
 Frame = +2

Query  47    IMAENGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKP-MPLSNLIAA  223
             ++  N     +L++AEA +W+H LSY+  + +KCA+QLGIPD +H +  P M LS+LIAA
Sbjct  1     MLNNNNICANQLIEAEAQSWDHILSYLRPSCIKCAIQLGIPDILHKNVNPIMSLSDLIAA  60

Query  224   LP-IHPSKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAF  400
             LP ++PSK  +I  L R LV   +    K    ++Q + YSLT VGRLLV+ +    R+F
Sbjct  61    LPNLNPSKTTFIPILMRVLVDFGLF---KYHQHQQQGDGYSLTSVGRLLVENDLSGKRSF  117

Query  401   LNICNEYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSEL  580
                    V   +  ++GDW ++D P+ F TAHG+  WDY   EP +N VFN+A A DS L
Sbjct  118   FLFAQHPVVLNTASSVGDWLRDDLPTAFETAHGKSHWDYCVEEPEFNGVFNDAMAGDSRL  177

Query  581   IMEVLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNI  760
             I  +L++     VF+GL SLVD+ GG GAVA AIA+ FP++KCIVLDLPHVI        
Sbjct  178   ISNLLISDCCAGVFEGLTSLVDIGGGTGAVAMAIAEAFPSLKCIVLDLPHVIGDRKGSG-  236

Query  761   ENMEFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMV  940
              N+EFVAG+MF+ IP ANA+LLKWI+H+W+DE+CVK+LKKC+E+IP +E GGKVIIID+V
Sbjct  237   -NLEFVAGSMFDKIPHANAILLKWILHNWDDEDCVKLLKKCKESIPNKENGGKVIIIDIV  295

Query  941   MEDPKRTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLI  1120
             MED    +    ++Q  MD L+   Y SKER +K+WEKLF +A FS YKI  +LGLRSLI
Sbjct  296   MEDNCSNNEQLVQSQHLMDLLMRITYASKERTEKEWEKLFLDADFSGYKIITSLGLRSLI  355

Query  1121  EVFP  1132
             E +P
Sbjct  356   EFYP  359



>ref|XP_006428632.1| hypothetical protein CICLE_v10012033mg [Citrus clementina]
 gb|ESR41872.1| hypothetical protein CICLE_v10012033mg [Citrus clementina]
Length=362

 Score =   360 bits (925),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 180/363 (50%), Positives = 245/363 (67%), Gaps = 10/363 (3%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             +G    ELL+A+ H WNH  ++I+S  LKCA+QLGIPD I  H KPM L+ L++AL I+P
Sbjct  5     DGDHDTELLEAQTHVWNHIFNFINSMTLKCAIQLGIPDIISKHGKPMTLNELVSALTINP  64

Query  239   SKAPYIHRLTRFLVHSSV-----LLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFL  403
             SK+  ++RL R L+H+       L+ +++  DEEQ   Y LT   +LL+K+  +++  FL
Sbjct  65    SKSRCVYRLMRILIHTGFFAQQKLISSRNNNDEEQ--GYVLTNASKLLLKDNPLSVTPFL  122

Query  404   NICNEYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELI  583
                 + +       L  WFQNDDP+PF TAHG+ +W+Y   EP  N+ FNEA A D+ L 
Sbjct  123   QAMLDPILLSPWQQLRTWFQNDDPTPFDTAHGKTLWEYAGDEPKLNNFFNEAMASDAWLA  182

Query  584   MEVLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIE  763
               V+++ + K VF+GL SLVDV GG G  A AIAK FP ++C   DLPHV+  + + ++ 
Sbjct  183   TSVMIH-KCKDVFEGLNSLVDVGGGIGTAAKAIAKAFPKLECTCFDLPHVVNGLDS-DLA  240

Query  764   NMEFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVM  943
             N+++V G+MFE+I  A+AVLLKWI+HDW DEECVKILKKC+EAI    + GKVIIIDM+ 
Sbjct  241   NLKYVGGDMFEAISPADAVLLKWILHDWNDEECVKILKKCKEAITSDGKKGKVIIIDMIR  300

Query  944   EDPKRTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIE  1123
             E+ K  D    + QL+ D L+M L    ER++K+W KLF+ AGFSDYKI P LGLRSLIE
Sbjct  301   ENKKGDDKSI-ETQLFFDMLMMVLLTGTERDEKEWTKLFTYAGFSDYKIIPILGLRSLIE  359

Query  1124  VFP  1132
             V+P
Sbjct  360   VYP  362



>emb|CDP21836.1| unnamed protein product [Coffea canephora]
Length=365

 Score =   360 bits (924),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 178/364 (49%), Positives = 242/364 (66%), Gaps = 7/364 (2%)
 Frame = +2

Query  50    MAEN-GKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAAL  226
             +A N G   GEL QA+AH WNH  ++I+S ++KCA+QLGIPD IH H +P+ L  LI AL
Sbjct  3     LARNIGDHTGELFQAQAHIWNHIFNFINSMSVKCAIQLGIPDVIHKHGQPITLDQLIDAL  62

Query  227   PIHPSKAPYIHRLTRFLVHSSVLLVTKSGGDE-EQEECYSLTPVGRLLVKEEAINLRAFL  403
             PI  +KAP+++RL + L+HS   +  K  G+E + ++ Y LT    LL+K    ++  FL
Sbjct  63    PIKNAKAPFVYRLMQILIHSGFFIEAKIPGNENDNQKGYLLTSASELLLKSNPFSMTPFL  122

Query  404   NICNEYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELI  583
                 +       + L  WFQN D +PF T HG  I+ + SHEP  N  FNEA A D+ L+
Sbjct  123   LAMLDPTLTDPWHHLSQWFQNSDETPFYTCHGRSIYAFASHEPWLNQFFNEAMASDTRLV  182

Query  584   MEVLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIE  763
               V +  + K VF+ L SLVDV GG G  A AIA  FP +KC VLDLPHV+  + +   +
Sbjct  183   SSV-VTKDCKHVFESLNSLVDVGGGTGTFAKAIADAFPRLKCTVLDLPHVVDGLESS--K  239

Query  764   NMEFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVM  943
             N+ +V GNMFE+IP A+AVL+KWI+ DW D+ECV+ILKKC+EAIP +E+GGKVII+DM  
Sbjct  240   NLGYVGGNMFEAIPPADAVLMKWILIDWSDDECVQILKKCKEAIPSKEKGGKVIIVDMFC  299

Query  944   EDPKRTDAYYN--KAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSL  1117
             +  ++ D  +   + QL+ D +VM L   ++RN+K W KLF+EAGFSDYKIT  LGLRS+
Sbjct  300   KSLQKGDDDHEAIETQLFFDMVVMVLLKRRQRNEKDWAKLFTEAGFSDYKITAVLGLRSI  359

Query  1118  IEVF  1129
             IEV+
Sbjct  360   IEVY  363



>emb|CAJ65611.1| putative orcinol O-methyltransferase [Rosa canina]
Length=346

 Score =   359 bits (922),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 178/348 (51%), Positives = 237/348 (68%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +AL IHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALLIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+   +L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTDASQLLLKDHPSSLTPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P    +FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEECVKILK+ REA   + + GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREATTSKAKNGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>ref|XP_009594948.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=359

 Score =   359 bits (922),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 179/353 (51%), Positives = 242/353 (69%), Gaps = 7/353 (2%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAP-Y  253
             E+L A+AH  NH  +YI+  +LKCA+QL IPD IHNH KPM LSNL+ ALPI+ +K    
Sbjct  13    EILAAQAHIANHVFNYINFVSLKCAIQLEIPDIIHNHGKPMTLSNLVNALPINKAKGQDC  72

Query  254   IHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQK  433
             I+RL R L+HS   + TK   +E +EE Y LTP   LL+K E ++L  F+    + +   
Sbjct  73    IYRLMRILIHSGFFIQTKI--NENEEEGYLLTPNSHLLLKNEPLSLAPFVLAQLDPILMD  130

Query  434   SCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESK  613
                +L  W QN D +PF TAHG+ +++Y   EP  N +FNEA A D+ L++ V++    +
Sbjct  131   PFQSLSKWLQNSDSTPFATAHGKPLFEYAGDEPRLNYLFNEAMASDARLMISVVIK-NGR  189

Query  614   RVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMF  793
              +F+GLKSL DV GG G VA AI+  FP +KC V DLPHV+  +   N   + +V G+MF
Sbjct  190   GIFEGLKSLADVGGGIGTVAKAISNAFPEIKCTVFDLPHVVEGLEGSN--KLSYVGGDMF  247

Query  794   ESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAYY  973
             +S+P+A+A+LLKWI+HDW DE+CVKILKKC+EAIP +E GGKVIIID+V+ D ++ D   
Sbjct  248   KSVPSADAILLKWILHDWSDEDCVKILKKCKEAIPSKENGGKVIIIDIVV-DSQKGDNKS  306

Query  974   NKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              + QL+ D L+M     KERN+++W KLF +AGFSDYKI P LGLRSLIEV+P
Sbjct  307   FETQLFSDTLMMVHVSGKERNREEWVKLFCDAGFSDYKIIPILGLRSLIEVYP  359



>dbj|BAJ72588.1| 7'-O-demethylcephaeline/cephaeline O-methyltransferase [Carapichea 
ipecacuanha]
Length=350

 Score =   359 bits (921),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 180/353 (51%), Positives = 239/353 (68%), Gaps = 12/353 (3%)
 Frame = +2

Query  74    GELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPY  253
              ELL+A+ H      S+ + A+LKCA+ LGIPD I  H KPM LS L +ALPI PSKAPY
Sbjct  10    AELLRAQTHFSTQLFSFQNYASLKCALHLGIPDAIKQHGKPMNLSELTSALPIKPSKAPY  69

Query  254   IHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQK  433
             IHRL R LV        K+G   ++ EC+ LTP+G LL+K++ IN+RA + +        
Sbjct  70    IHRLMRMLV--------KAGYFAQENECFDLTPIGLLLLKDDPINIRALVLLELHPALLL  121

Query  434   SCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESK  613
                AL +WFQNDD +PF TAHG+  WDY S +P +  +F+EA A DSELI +VL+  E K
Sbjct  122   PWIALSEWFQNDDATPFVTAHGKSFWDYTSRDPEFRKLFDEAMAGDSELISKVLVT-EFK  180

Query  614   RVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMF  793
              VF+GLKSLVDV GGNG +A +IAK FP +KC V DLP  +A+       N++FVAG+MF
Sbjct  181   YVFEGLKSLVDVGGGNGTLARSIAKAFPNLKCTVFDLPEAVANEQGDG--NLDFVAGDMF  238

Query  794   ESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAYY  973
             + +P+A+A+LLK ++HDW DE CVKILK CR++IP++++GGKVIII+ V+E  K     Y
Sbjct  239   DRVPSADAILLKIVLHDWSDENCVKILKNCRKSIPVKDKGGKVIIIEGVVELEKNAGNEY  298

Query  974   NKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
                +  +D  ++ LY SKER KK+W KLFS+AGFSDYK  P L    +IE+ P
Sbjct  299   AGLE-NLDMEMLVLYNSKERTKKEWAKLFSDAGFSDYKFIPALDSWCIIELTP  350



>emb|CAA11131.1| O-methyltransferase [Prunus dulcis]
Length=356

 Score =   359 bits (921),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 180/351 (51%), Positives = 240/351 (68%), Gaps = 6/351 (2%)
 Frame = +2

Query  80    LLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYIH  259
             LLQA+AH WN   S+I+  +LKCAVQLGIPD I  H  PM LS+LI+ALPIHP K+  ++
Sbjct  12    LLQAQAHIWNCIFSFINPMSLKCAVQLGIPDIIKKHGNPMSLSDLISALPIHPKKSNCVY  71

Query  260   RLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQKSC  439
             RL R LVHS      K   + ++EE Y LT   RLL+K++ ++ R FL    +    K  
Sbjct  72    RLMRILVHSGFFCRQKL-SELDEEEGYVLTDASRLLLKDDPLSARPFLLGALDPFMTKPW  130

Query  440   YALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESKRV  619
             +    WFQNDDP+   TAHG   WD+   EP  + +FN+A A D+ LI +V+ N E K V
Sbjct  131   HYFSTWFQNDDPTACVTAHGTTFWDFGCLEPSLSHIFNDAMASDARLISKVVSN-EYKGV  189

Query  620   FDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMFES  799
             F+GL+SLVDV GG G +  AIA  FP ++CIV DLPHV+A +     EN++F  G+MFE+
Sbjct  190   FEGLESLVDVGGGIGTMPKAIADVFPHVECIVFDLPHVVADLKGS--ENLKFFGGDMFEA  247

Query  800   IPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAYYNK  979
             IP  +A+L+KWI+HDW DEEC+KIL++ +EAI  +E+ GKVII+DMVM+  ++ D    +
Sbjct  248   IPPTDAILMKWILHDWSDEECIKILQRSKEAITRKEKKGKVIIVDMVMK--QKGDDQSIE  305

Query  980   AQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              QL+ D L+M L+  KER +K+W KLFS+AGFSDYKITP  GLR LIEV+P
Sbjct  306   TQLFFDMLMMVLFTGKERTEKEWAKLFSDAGFSDYKITPICGLRYLIEVYP  356



>emb|CAJ65659.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   358 bits (920),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 174/348 (50%), Positives = 240/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ +  PM LS L +ALPIHP
Sbjct  5     NGQHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  +L    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V       L  WFQNDDP+PF TAHG   WDY +H+P    +FN+A A D+ L+  V++
Sbjct  123   PVLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G +A AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW D+EC+KILK+ R AI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL G KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65616.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=345

 Score =   358 bits (919),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 178/348 (51%), Positives = 240/348 (69%), Gaps = 7/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKYAIQLGIPDIINKHG-PMTLSELTSALPIHP  63

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+P ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  64    TKSPSVYRLMRILVHSGFF--AKKKLSKTDEEGYTLTDASQLLLKDHPLSLMPFLTAMLD  121

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V       L  WFQNDDP+PF TAHG   WDY +H+P    +FN+A A D+ L+  V++
Sbjct  122   PVLTTPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVII  181

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             N + K VF+GL+SL+DV GG G VA AIA  FP ++C VLDLP+V+A +     +N+++ 
Sbjct  182   N-DCKGVFEGLESLIDVGGGIGTVAKAIADAFPHIECTVLDLPYVVADLQGS--KNLKYT  238

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEECVKILK+ REAI  +++ GKVIIIDM+ME+ ++
Sbjct  239   GGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSREAITRKDKKGKVIIIDMMMEN-QK  297

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AG SDYKITP L
Sbjct  298   GDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGISDYKITPIL  345



>emb|CAJ65627.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   358 bits (919),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 174/348 (50%), Positives = 240/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ +  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  +L    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V       L  WFQNDDP+PF TAHG   WDY +H+P    +FN+A A D+ L+  V++
Sbjct  123   PVLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G +A AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW D+EC+KILK+ R AI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL G KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPIL  346



>gb|ABZ89567.1| O-methyltransferase 3 [Humulus lupulus]
Length=377

 Score =   359 bits (921),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 182/356 (51%), Positives = 242/356 (68%), Gaps = 7/356 (2%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYI  256
             E+L A+AH WN   ++I+S +LKCA+QLGIPD I+NH KPM +S L  ALPI+  K+P +
Sbjct  25    EILGAQAHIWNQIFNFINSMSLKCAIQLGIPDIINNHGKPMTISQLTLALPINRKKSPCV  84

Query  257   HRLTRFLVHSSVLLVTKS---GGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVF  427
             +RL R L+HS    + K+        +EE Y +T   +LL+K+  +++  FL    + V 
Sbjct  85    YRLMRILIHSGFFALQKAEVGEEGGGEEEGYVITDASKLLLKDNPMSVTPFLLAMLDPVM  144

Query  428   QKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGE  607
              K    L +WFQN DP+PF TA+G   WDY SHEP     FN+A A D+ L+  V++  +
Sbjct  145   TKPWDFLSNWFQNGDPTPFDTANGMAFWDYGSHEPKLARFFNDAMASDARLVTSVVIE-K  203

Query  608   SKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGN  787
              K VF+G++SLVDV GG G VAS+IA  FP ++C V DLPHV+A +  GN  N+ FV G+
Sbjct  204   CKGVFEGVESLVDVGGGTGTVASSIAAAFPHIQCTVFDLPHVVADLQGGN--NLNFVGGD  261

Query  788   MFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIP-IREEGGKVIIIDMVMEDPKRTD  964
             MF  +PA   VLLKWI+HDW DEE VKILKKC+EAI    ++GGKVIIIDM +E+ K  D
Sbjct  262   MFVDVPATEVVLLKWILHDWNDEESVKILKKCKEAISKSNKKGGKVIIIDMKVENEKDED  321

Query  965   AYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
                 + QL+ D L+MAL   +ERN+K+W KLF +AGFS+YKITP LGLRSLIEV+P
Sbjct  322   DESYETQLFFDMLMMALVTGRERNEKEWAKLFKDAGFSNYKITPILGLRSLIEVYP  377



>emb|CAJ65643.1| putative orcinol O-methyltransferase [Rosa marretii]
Length=346

 Score =   358 bits (918),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 175/348 (50%), Positives = 238/348 (68%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAVLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V  K    L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLP V+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPQVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEEC+KILK+ R AI  +++ G+VIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGEVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYK+TP L
Sbjct  299   GDEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKVTPIL  346



>emb|CAJ65629.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   358 bits (918),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 174/348 (50%), Positives = 239/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM L  L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLFELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  +L    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V       L  WFQNDDP+PF TAHG   WDY +H+P    +FN+A A D+ L+  V++
Sbjct  123   PVLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G +A AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW D+EC+KILK+ R AI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPLADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL G KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPIL  346



>ref|XP_004490696.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cicer 
arietinum]
Length=359

 Score =   358 bits (919),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 174/351 (50%), Positives = 234/351 (67%), Gaps = 4/351 (1%)
 Frame = +2

Query  80    LLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYIH  259
             LL+A++H WNH  ++I+S +LKC V LGIPD IHN+ KPM LS LI  LPIHPSK  +I+
Sbjct  13    LLKAQSHIWNHIFNFINSMSLKCVVDLGIPDIIHNYGKPMSLSKLIPLLPIHPSKTFFIY  72

Query  260   RLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQKSC  439
             RL R + HS       +  + E E  Y LT    LL+K+  +N+R+F+++  + V  K  
Sbjct  73    RLMRIMTHSG-FFSQHNISENELETEYVLTDTSLLLLKDNPMNMRSFVHLVFDPVLTKPW  131

Query  440   YALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESKRV  619
             + L  W  NDDP+ F T HG   WDY   E   N++FN+A A D+ L+  V++  + K V
Sbjct  132   HQLSSWLTNDDPTAFETTHGMLFWDYAERESKINNLFNDAMASDARLVSSVVIE-KCKEV  190

Query  620   FDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMFES  799
             F+GL+SLVDV GG G +A A+AK FP ++C V DLPHV+  +     +N+++V G+MF+ 
Sbjct  191   FNGLESLVDVGGGTGTMAKALAKSFPQLECTVFDLPHVVVGLQG--TDNLKYVGGDMFKE  248

Query  800   IPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAYYNK  979
             IP A+A+LLKWI+HDW D+ECVKILKKC+E++  +   GKVIIIDMV++  K       K
Sbjct  249   IPPADAILLKWILHDWNDDECVKILKKCKESLLKKGNEGKVIIIDMVLDTKKGDINESGK  308

Query  980   AQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              QL+ D L+  L   KERN K+W KL S AGFSDYKI P LGLRSLIEV+P
Sbjct  309   TQLFFDMLMTVLVKGKERNDKEWIKLISLAGFSDYKIIPILGLRSLIEVYP  359



>emb|CAJ65631.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   357 bits (917),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 173/348 (50%), Positives = 240/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ +  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  +L    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V       L  WFQNDDP+PF TAHG   WDY +H+P    +FN+A A D+ L+  V++
Sbjct  123   PVLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G +A AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW D+EC+KIL++ R AI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWSDQECIKILRRSRVAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL G KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPIL  346



>ref|XP_006480453.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=362

 Score =   358 bits (919),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 178/361 (49%), Positives = 242/361 (67%), Gaps = 6/361 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             +G    ELL+A+ H WNH  ++I+S  LKCA+QLGIPD I  H KPM L+ L++AL I+P
Sbjct  5     DGDHDTELLEAQTHVWNHIFNFINSMTLKCAIQLGIPDIISKHGKPMTLNELVSALTINP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTK---SGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNI  409
             SK+  ++RL R L+H+      K   S  + ++E  Y LT   +LL+K+  +++  FL  
Sbjct  65    SKSRCVYRLMRILIHTGFFAQQKLISSRNNNDEELGYVLTNASKLLLKDNPLSVTPFLQA  124

Query  410   CNEYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIME  589
               + +       L  WFQNDDP+PF TAHG+ +W+Y   EP  N+ FNEA A D+ L   
Sbjct  125   MLDPILLSPWQQLRTWFQNDDPTPFDTAHGKTLWEYAGDEPKLNNFFNEAMASDAWLATS  184

Query  590   VLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENM  769
             V+++ + K VF+GL SLVDV GG G  A AIAK FP ++C   DLPHV+  + + ++ N+
Sbjct  185   VMIH-KCKDVFEGLNSLVDVGGGIGTAAKAIAKAFPKLECTCFDLPHVVNGLDS-DLANL  242

Query  770   EFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMED  949
             ++V G+MFE+I  A+AVLLKWI+HDW DEECVKILKKC+EAI    + GKVIIIDM+ E+
Sbjct  243   KYVGGDMFEAISPADAVLLKWILHDWNDEECVKILKKCKEAITSDGKKGKVIIIDMIREN  302

Query  950   PKRTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVF  1129
              K  D    + QL+ D L+M L    ER++K+W KLF+ AGFSDYKI P LGLRSLIEV+
Sbjct  303   KKGDDKSI-ETQLFFDMLMMVLLTGTERDEKEWTKLFTYAGFSDYKIIPILGLRSLIEVY  361

Query  1130  P  1132
             P
Sbjct  362   P  362



>emb|CAH05088.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   357 bits (917),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 174/348 (50%), Positives = 239/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM L  L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLFELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  +L    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V       L  WFQNDDP+PF TAHG   WDY +H+P    +FN+A A D+ L+  V++
Sbjct  123   PVLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G +A AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW D+EC+KILK+ R AI  +++ GKVIIIDM+ME+ ++
Sbjct  240   RGDMFEAVPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL G KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65617.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   357 bits (917),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 175/346 (51%), Positives = 239/346 (69%), Gaps = 6/346 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  +L    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V       L  WFQNDDP+PF TAHG   WDY +H+P    +FN+A A D+ L+  V++
Sbjct  123   PVLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             N + K VF+GL+SLVDV GG G +A AIA  FP ++C VLDLPHV+A +     +N++++
Sbjct  183   N-DCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYI  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HD  DEEC+KIL++ R AI  +E+ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDRNDEECIKILERSRVAITGKEKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITP  1096
              D    + QL+ D L+MAL G KERN+K+W KLF++AGFSDYKITP
Sbjct  299   GDEESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITP  344



>gb|AAB71213.1| methyltransferase [Prunus armeniaca]
Length=354

 Score =   358 bits (918),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 176/352 (50%), Positives = 235/352 (67%), Gaps = 6/352 (2%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYI  256
             ELLQA+AH WNH  S+I+S +LKCAVQL IPD I  H +PM LS L++ALPI P+KA +I
Sbjct  9     ELLQAQAHIWNHIFSFINSLSLKCAVQLDIPDVIQKHGQPMTLSELVSALPISPTKAHFI  68

Query  257   HRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQKS  436
              RL R LVHS         G  EQ   Y LT    LL+K+  ++ R FL      +    
Sbjct  69    PRLMRILVHSGFFAKESLSGCGEQG--YILTDASALLLKDNPMSARPFLLAMLSPILTDP  126

Query  437   CYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESKR  616
                L  WFQND+P+PF   +G   WDY++ +P     FN+A A D++LI  ++++ + K 
Sbjct  127   YQYLTTWFQNDNPTPFHVVNGMTCWDYVNQDPTLAHFFNDAMASDAQLISSLVID-DCKE  185

Query  617   VFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMFE  796
             VF G+ SLVDV GG G VA +IA  FP MKC VLDLPHV+A +     +N+E+VAG+MFE
Sbjct  186   VFQGVDSLVDVGGGTGTVAKSIADAFPHMKCTVLDLPHVVADLKGS--KNLEYVAGDMFE  243

Query  797   SIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAYYN  976
             ++PAA+A+ LKWI+HDW DEECVKIL++C+ A+    + GKVII++M +E+ K TD    
Sbjct  244   AVPAADAIFLKWILHDWSDEECVKILERCKAAVTREGKKGKVIIVEMTVEN-KNTDKESG  302

Query  977   KAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
             + QL+ D  +M +   KERN+K+W KLFS+AGFS YKITP  G +SLIEV+P
Sbjct  303   ETQLFFDMHMMVMSTGKERNEKEWAKLFSDAGFSQYKITPLFGFKSLIEVYP  354



>emb|CAJ65600.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   357 bits (916),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 175/346 (51%), Positives = 238/346 (69%), Gaps = 6/346 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  +L    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKGKLCKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V       L  WFQNDDP+PF TAHG   WDY +H+P    +FN+A A D+ L+  V++
Sbjct  123   PVLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             N + K VF+GL+SLVDV GG G +A AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   N-DCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEEC+KIL++ R AI  +E+ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWSDEECIKILERSRVAITGKEKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITP  1096
              D    + QL+ D L+MAL G KERN+K+W KLF++AG SDYKITP
Sbjct  299   GDEESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGLSDYKITP  344



>emb|CDP21787.1| unnamed protein product [Coffea canephora]
Length=365

 Score =   357 bits (917),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 178/364 (49%), Positives = 238/364 (65%), Gaps = 7/364 (2%)
 Frame = +2

Query  50    MAEN-GKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAAL  226
             +A N G   GEL QA+AH WNH  ++I+S ++KCA QLGIPD IH H +PM L  LI AL
Sbjct  3     LARNLGDHTGELFQAQAHIWNHIFNFINSMSVKCATQLGIPDVIHKHGQPMTLDQLIDAL  62

Query  227   PIHPSKAPYIHRLTRFLVHSSVLLVTKSGGDE-EQEECYSLTPVGRLLVKEEAINLRAFL  403
             PI  +KAP+++RL + L+HS   +  K  G+E + ++ Y LT    LL+K    ++  FL
Sbjct  63    PIKNAKAPFVYRLMQILIHSGFFIEAKIPGNENDNQKGYLLTSASELLLKSNPFSMTPFL  122

Query  404   NICNEYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELI  583
                 +         L  WFQN D +PF T HG  I+ + SHEP  N  FNEA A D+ L+
Sbjct  123   LAMLDPTLTDPWQNLSQWFQNSDETPFYTCHGRSIYAFASHEPWLNQFFNEAMASDTRLV  182

Query  584   MEVLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIE  763
               V +  + K VF+ L SLVDV GG G  A AIA  FP +KC VLDLPHV+  + +   +
Sbjct  183   SSV-VTKDCKHVFESLNSLVDVGGGTGTFAKAIADAFPRLKCTVLDLPHVVDGLESS--K  239

Query  764   NMEFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVM  943
             N+ +V GNMFE+IP A+AVL+KWI+ DW D+ECV+ILKKC+EA P +E+GGKVII+DM  
Sbjct  240   NLAYVGGNMFEAIPPADAVLMKWILIDWSDDECVQILKKCKEAFPSKEKGGKVIIVDMFC  299

Query  944   EDPKRTDAYYN--KAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSL  1117
             +  ++ D  +   + QL+ D  VM L   ++RN+K W KLF+EAGFSDYKIT  LGLRS+
Sbjct  300   KSLQKGDDDHETIETQLFFDMEVMVLLKGRQRNEKDWAKLFTEAGFSDYKITAVLGLRSI  359

Query  1118  IEVF  1129
             IEV+
Sbjct  360   IEVY  363



>ref|XP_006469069.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=353

 Score =   357 bits (916),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 175/362 (48%), Positives = 246/362 (68%), Gaps = 10/362 (3%)
 Frame = +2

Query  47    IMAENGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAAL  226
             I  EN     ELL+A+A  WN + +Y++S +LKCAV+LGI D IH+H +P  LS + +AL
Sbjct  2     INGENAASSSELLKAQAQVWNCTFNYVNSMSLKCAVELGIADIIHSHGQPTTLSQIASAL  61

Query  227   PIHPSKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLN  406
              I P+K   I  + R LVHS           +++++ Y LTP  RLL+K+  +    F++
Sbjct  62    NIKPNKVECIQSVMRILVHSGFFA-------QQKDDEYFLTPASRLLLKDTPLKAAPFVD  114

Query  407   ICNEYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIM  586
             +  + ++  + + LG W QNDDP+ F TAHG+K+WD ++ EP +  +F +    DSELI 
Sbjct  115   LVADPLYTTAFHCLGTWLQNDDPTLFETAHGKKVWDRVADEPKFKSLFYDLMITDSELIA  174

Query  587   EVLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIEN  766
              +++  + K VF+GLKSLVDVAGG G +A AIA  FP +KC V DLPHV+ ++   N +N
Sbjct  175   GIVIK-DCKEVFEGLKSLVDVAGGTGIMARAIATAFPDIKCTVFDLPHVVDNLQGTN-DN  232

Query  767   MEFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVME  946
             ++F+ GNMFE+IP ANAVLLKWI+H+W DEE VK+LKKC+EAIP ++EGGKVIIIDM +E
Sbjct  233   LDFLGGNMFEAIPQANAVLLKWILHNWNDEESVKLLKKCKEAIPSKDEGGKVIIIDMAIE  292

Query  947   DPKRTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEV  1126
             + +  D    + QL  D L+++L+  KER+   W+KLF  AGFS YKITP LG+RSLIE 
Sbjct  293   N-QSQDKESMETQLCFDILMVSLFRGKERSVDDWKKLFLAAGFSHYKITPMLGVRSLIEA  351

Query  1127  FP  1132
             +P
Sbjct  352   YP  353



>emb|CAJ65649.1| putative orcinol O-methyltransferase [Rosa woodsii var. ultramontana]
Length=346

 Score =   357 bits (915),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 174/348 (50%), Positives = 237/348 (68%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L + LPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSTLPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLAPFLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
                 K    L  WFQNDDP+PF TAHG   WDY +H+P     FN+A A D+ L+  V++
Sbjct  123   PALTKPWNYLSIWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEEC+KILK+ R AI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPLADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMIMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + +L+ D L+MA+   KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETELFFDMLMMAILTGKERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65636.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   356 bits (914),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 173/348 (50%), Positives = 239/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ +  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  +L    +
Sbjct  65    TKSHSVYRLMRILVHSG--FFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V       L  WFQNDDP+PF TAHG   WDY +H+P    +FN+A A D+ L+  V++
Sbjct  123   PVLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SL DV GG G +A AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLADVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW D+EC+KILK+ R AI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL G KERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSDYKITPIL  346



>ref|XP_006356529.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=357

 Score =   356 bits (914),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 186/355 (52%), Positives = 241/355 (68%), Gaps = 9/355 (3%)
 Frame = +2

Query  74    GELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKP-MPLSNLIAALP-IHPSKA  247
             GEL++AEA +W++ LSY+    +KCA++LGI D ++ +  P M LS+LIAALP ++PSK 
Sbjct  10    GELIEAEAQSWDYILSYLRPLCIKCAIELGISDILYKNVTPIMSLSDLIAALPNLNPSKT  69

Query  248   PYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVF  427
              +I  L R LV   V    +  GD      YSLT VGRLLV+ +  + R +  +    V 
Sbjct  70    TFIPILMRALVDFGVFNYHQQQGDG-----YSLTNVGRLLVENDPSSKRLYFILFQHPVL  124

Query  428   QKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGE  607
              K   ++ DW ++D P+ F TAHG+ +WDY S EP ++ VFN+A A DS LI  +L++  
Sbjct  125   LKIVASMSDWLRDDLPTAFETAHGKSVWDYCSEEPEFSGVFNDAMASDSRLISNLLISDC  184

Query  608   SKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGN  787
                VF+GL SLVDV GG G VA AIA  FP +KCIVLDLPHVI        EN+EFVAGN
Sbjct  185   CAGVFEGLTSLVDVGGGTGTVAMAIAGAFPRLKCIVLDLPHVIGD--RRGTENLEFVAGN  242

Query  788   MFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDA  967
             MF+ IP ANA+ LKWI+H W D +CVKILKKC+E+IP +E+GGKVIIID+VMED    + 
Sbjct  243   MFDKIPHANAIFLKWILHSWSDHDCVKILKKCKESIPSKEKGGKVIIIDIVMEDNCSNNE  302

Query  968   YYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
                ++Q  MD L+   Y SKER+KK+WEKLF EAGFS YKI  +LGLRSLIEV+P
Sbjct  303   QLVQSQHLMDVLMRISYASKERSKKEWEKLFLEAGFSGYKIITSLGLRSLIEVYP  357



>sp|B0EXJ8.1|HTOMT_CATRO RecName: Full=Tabersonine 16-O-methyltransferase [Catharanthus 
roseus]
 gb|ABR20103.1| 16-hydroxytabersonine O-methyltransferase [Catharanthus roseus]
Length=355

 Score =   356 bits (914),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 189/357 (53%), Positives = 245/357 (69%), Gaps = 13/357 (4%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAAL--PIHPSKAP  250
             E   A+A  W+ S S+I SA+LKCAV+LGIPDTI NH KP+ LS L  AL  P+HPSKAP
Sbjct  7     EFRGAQAQIWSQSCSFITSASLKCAVKLGIPDTIDNHGKPITLSELTNALVPPVHPSKAP  66

Query  251   YIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQ  430
             +I+RL R L  +     ++   D E E  YSLTP  R+L+K+E +NLR  +    + V  
Sbjct  67    FIYRLMRVLAKNG--FCSEEQLDGETEPLYSLTPSSRILLKKEPLNLRGIVLTMADPVQL  124

Query  431   KSCYALGDWFQNDDPSP--FCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNG  604
             K+  +L DW+QN+D S   F TAHG+  W Y S    + + FNEA A DS+LI ++L+ G
Sbjct  125   KAWESLSDWYQNEDDSSTAFETAHGKNFWGYSSEHMEHAEFFNEAMASDSQLISKLLI-G  183

Query  605   ESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAG  784
             E K +F+GL SLVD+ GG G +A AIAK FP +KC V DLPHV+A++ +   EN+EFVAG
Sbjct  184   EYKFLFEGLASLVDIGGGTGTIAKAIAKNFPQLKCTVFDLPHVVANLESK--ENVEFVAG  241

Query  785   NMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTD  964
             +MFE IP+ANA+ LKWI+HDW DE+CVKILK C++AIP +  GGKVIIIDMVM   K+ D
Sbjct  242   DMFEKIPSANAIFLKWILHDWNDEDCVKILKSCKKAIPAK--GGKVIIIDMVMYSDKKDD  299

Query  965   AYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGL-RSLIEVFP  1132
              +  K Q  MD  ++  + +KER +K+W  LF EAGFSDYKI P L   RSLIEV+P
Sbjct  300   -HLVKTQTSMDMAMLVNFAAKERCEKEWAFLFKEAGFSDYKIYPKLDFTRSLIEVYP  355



>ref|XP_006446726.1| hypothetical protein CICLE_v10015705mg [Citrus clementina]
 gb|ESR59966.1| hypothetical protein CICLE_v10015705mg [Citrus clementina]
Length=362

 Score =   356 bits (914),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 177/361 (49%), Positives = 244/361 (68%), Gaps = 6/361 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             +G+   ELL+A+AH WNH  ++I+S +LKCAV+L IPD I+ H KPM L+ L++AL I+P
Sbjct  5     DGEHDTELLEAQAHVWNHIFNFINSMSLKCAVELSIPDIINKHGKPMTLNKLVSALTINP  64

Query  239   SKAPYIHRLTRFLVHSSVL---LVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNI  409
             SK   ++RL R L+HS       +  S  + ++E+ Y LT   +LL+K+  +++  FL  
Sbjct  65    SKTRCVYRLMRILIHSGFFAQQTLNSSRNNNDEEQGYVLTNASKLLLKDSPLSVTPFLQA  124

Query  410   CNEYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIME  589
               + +       L  WFQ+DDP+PF TAHG+  W+Y   EP  N+ FNEA A D+ L   
Sbjct  125   MLDPILLSPWLKLSTWFQSDDPAPFDTAHGKSFWEYAGDEPKINNFFNEAMASDARLATR  184

Query  590   VLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENM  769
             V+++ + K VF GL SLVDV GG G VA AIA  FP ++C   DLPHV+  + + ++ N+
Sbjct  185   VVIH-KCKDVFQGLNSLVDVGGGTGTVAKAIAIAFPNLECTDFDLPHVVNGLES-DLANL  242

Query  770   EFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMED  949
             ++V G+MFE+IP A+AV+LKWI+HDW DEECVKILKKC+EAI    + GKVIIIDM+ E+
Sbjct  243   KYVGGDMFEAIPPADAVVLKWILHDWNDEECVKILKKCKEAITSDGKKGKVIIIDMMREN  302

Query  950   PKRTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVF  1129
              K  D    + QL+ D L+M L    ER++K+W KLF++AGFSDYKIT  LGLRSLIEV 
Sbjct  303   KKGNDE-STETQLFFDMLMMVLATGTERDEKEWAKLFADAGFSDYKITSILGLRSLIEVC  361

Query  1130  P  1132
             P
Sbjct  362   P  362



>ref|XP_009602136.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=361

 Score =   356 bits (914),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 179/359 (50%), Positives = 239/359 (67%), Gaps = 6/359 (2%)
 Frame = +2

Query  62    GKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPS  241
             G+   E+L A+ H WNH  S+I+S +LK A+QL IPD IH H KPM L  L  AL I+ +
Sbjct  7     GEHETEILHAQTHIWNHIFSFINSMSLKSAIQLNIPDIIHKHGKPMTLDQLANALSINKA  66

Query  242   KAPYIHRLTRFLVHSSVLLVTK--SGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICN  415
             K  ++ RL R L+ S   + ++      E + E YSL P  RLL+K+E +++  FL    
Sbjct  67    KTTHLRRLMRILIRSGFFVKSRIQENEGESEGEGYSLAPPSRLLLKDEPLSVTPFLLAML  126

Query  416   EYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVL  595
             + +  K  + + +WF+ND P+PF TAHG   WDY  HEP  N  FN+A A D++L+M V+
Sbjct  127   DPILVKPWHHVSEWFENDHPTPFDTAHGRTFWDYAGHEPRLNHFFNDAMASDAKLVMNVV  186

Query  596   LNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEF  775
             +   SK VF+GL S+VDV GG G VA +IA  FP ++C V DLPHV+  +     +N+ +
Sbjct  187   IK-YSKDVFEGLNSIVDVGGGTGTVAKSIANAFPDLQCTVFDLPHVVEGLEES--KNLNY  243

Query  776   VAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPK  955
             V G+ F SIP A+A+LLKWI+HDW DEE VKILKKC+EAIP RE+GGKVIIIDM M D K
Sbjct  244   VGGDFFVSIPPADALLLKWILHDWSDEESVKILKKCKEAIPSREKGGKVIIIDM-MVDNK  302

Query  956   RTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
               D    + Q++ D L+M L   +ER++K W KLF +AGFSDYK+TP LGLRSLIEV+P
Sbjct  303   IGDDESIETQIFFDMLMMVLVTGRERSEKGWAKLFLDAGFSDYKVTPILGLRSLIEVYP  361



>emb|CDP19840.1| unnamed protein product [Coffea canephora]
Length=363

 Score =   356 bits (913),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 176/364 (48%), Positives = 239/364 (66%), Gaps = 7/364 (2%)
 Frame = +2

Query  50    MAEN-GKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAAL  226
             +A N G   GEL QA+AH WNH  ++I+S ++KCA+QLGIPD IH H +PM L  LI AL
Sbjct  3     LARNIGDHTGELFQAQAHIWNHIFNFINSMSVKCAIQLGIPDVIHKHGQPMTLDQLIDAL  62

Query  227   PIHPSKAPYIHRLTRFLVHSSVLLVTKSGGDE-EQEECYSLTPVGRLLVKEEAINLRAFL  403
             PI  +KAP+++RL + L+HS   +  K  G+E + ++ Y LT    LL+K    ++  FL
Sbjct  63    PIKNAKAPFVYRLMQILIHSGFFIEAKIPGNENDNQKGYLLTSASELLLKSNPFSVTPFL  122

Query  404   NICNEYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELI  583
                 +       + L  WFQN D +PF T HG  I+ + SHEP  N  FNEA A D+ ++
Sbjct  123   LAMLDPALTDPWHHLSQWFQNSDETPFYTCHGRSIYAFASHEPWLNQFFNEAMASDARMV  182

Query  584   MEVLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIE  763
               V+   + K VF+GL SLVD+ GG G  A AIA  FP +KC VLDLPHV+  + +   +
Sbjct  183   SSVVTK-DCKHVFEGLNSLVDIGGGTGTFAKAIADAFPRLKCTVLDLPHVVDGLESS--K  239

Query  764   NMEFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVM  943
             N+ +V GNMFE+IP A+AVL+KWI+ DW D+ECV+ILKKC+EAIP +E+GGKVII+D   
Sbjct  240   NLAYVGGNMFEAIPPADAVLMKWILIDWSDDECVQILKKCKEAIPSKEKGGKVIIVDTFC  299

Query  944   EDPKRTDAYYN--KAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSL  1117
             +  ++ D  +   + QL+ D   M L   ++RN+  W KLFSEAGFSDYKIT  LGLRS+
Sbjct  300   KSQQKGDDDHEAIETQLFYDMGAMVLVKGRQRNETDWAKLFSEAGFSDYKITAVLGLRSI  359

Query  1118  IEVF  1129
             IEV+
Sbjct  360   IEVY  363



>ref|XP_004241914.1| PREDICTED: myricetin O-methyltransferase-like [Solanum lycopersicum]
Length=355

 Score =   355 bits (912),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 186/361 (52%), Positives = 240/361 (66%), Gaps = 12/361 (3%)
 Frame = +2

Query  56    ENGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKP-MPLSNLIAALP-  229
             +N     EL++AEA +W++ L+Y+    ++CA+QLGIPD +H  A P M LS+LIAALP 
Sbjct  5     KNNMYANELIEAEALSWDYILTYLRPPCIRCAIQLGIPDILHKSAHPIMSLSDLIAALPN  64

Query  230   IHPSKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNI  409
             ++PSK  +I  L R LV   +       GD      YSLT VGRL V+ +  N R+    
Sbjct  65    VNPSKTTFIPILMRVLVDLGLFNYHPQQGDG-----YSLTSVGRLFVESDPSNKRSIFTF  119

Query  410   CNEYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIME  589
               ++    S   + DW +ND P+ F TAHG+ IWDY S E  Y+ VFN+A A DS+LI  
Sbjct  120   LIQFEIVDS---MSDWLRNDLPTAFETAHGKSIWDYCSGESEYSGVFNDAMASDSKLISN  176

Query  590   VLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENM  769
             +L++     VF+GL SLVDV GG G VA AIA  FP++KC VLDLPH I        +N+
Sbjct  177   LLISDCCSGVFEGLTSLVDVGGGTGTVAMAIAGAFPSLKCTVLDLPHAIGDRKG--TQNL  234

Query  770   EFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMED  949
             EFVAGNMF+ IP ANA+LLKWI+HDW DE+CVKILKKC+E+IP +E GGKVIIID+VMED
Sbjct  235   EFVAGNMFDKIPHANAILLKWILHDWNDEDCVKILKKCKESIPSKENGGKVIIIDIVMED  294

Query  950   PKRTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVF  1129
                 +    ++Q  MD LV   Y SKER+ K+WEKLF +AGFS YKI  +LGLRSL+EV+
Sbjct  295   NCSNNEQLVQSQHLMDLLVRITYDSKERSNKEWEKLFLDAGFSGYKIITSLGLRSLMEVY  354

Query  1130  P  1132
             P
Sbjct  355   P  355



>dbj|BAI79244.1| O-methyltransferase [Carapichea ipecacuanha]
 dbj|BAJ05386.1| O-methyltransferase [Carapichea ipecacuanha]
Length=350

 Score =   355 bits (910),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 181/353 (51%), Positives = 239/353 (68%), Gaps = 12/353 (3%)
 Frame = +2

Query  74    GELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPY  253
              ELL+A+ H      S+ + A+LKCA+ LGIPD I  H KPM LS L +ALPI+PSKAPY
Sbjct  10    AELLRAQTHFSTQLFSFQNYASLKCALHLGIPDAIKQHGKPMNLSELTSALPINPSKAPY  69

Query  254   IHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQK  433
             IHRL R LV        K+G   ++ EC+ LTP+G LL+K++ IN+RA + +        
Sbjct  70    IHRLMRMLV--------KAGYFAQENECFDLTPIGLLLLKDDPINIRALVLLELHPALLM  121

Query  434   SCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESK  613
                AL +WFQNDD +PF TAHG+  WDY S +P +  +F+EA A DSELI +VL+  E K
Sbjct  122   PWIALSEWFQNDDATPFVTAHGKSFWDYTSRDPEFRKLFDEAMAGDSELISKVLVT-EFK  180

Query  614   RVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMF  793
              VF+GLKSLVDV GGNG +A +IAK FP +KC V DLP  +A+       N++FVAG+MF
Sbjct  181   YVFEGLKSLVDVGGGNGTLARSIAKAFPNLKCTVFDLPEAVANEQGDG--NLDFVAGDMF  238

Query  794   ESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAYY  973
             + +P+A+A+LLK I+HDW DE CVKILK C+++IP +++GGKVIII+ V+E  K     Y
Sbjct  239   DRVPSADAILLKIILHDWSDENCVKILKNCKKSIPGKDKGGKVIIIEGVVELEKNAGNEY  298

Query  974   NKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
                +  +D  +M LY SKER KK+W KLFS+AGFSDYK  P L    +IE+ P
Sbjct  299   AGLE-NLDMEMMVLYNSKERTKKEWAKLFSDAGFSDYKFIPALDSWCIIELSP  350



>gb|ADZ76434.1| myricetin O-methyltransferase 2 [Solanum habrochaites]
Length=355

 Score =   355 bits (911),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 188/368 (51%), Positives = 244/368 (66%), Gaps = 20/368 (5%)
 Frame = +2

Query  50    MAENGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKP-MPLSNLIAAL  226
             MA N     EL++AEA +W++ LSY+  + +KCA+QLGIPD +H +A P M LS+LIAAL
Sbjct  1     MASNNNCAYELIEAEAQSWDYILSYLRPSCIKCAIQLGIPDILHKNADPIMSLSDLIAAL  60

Query  227   P-IHPSKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFL  403
             P ++PSK  +I  L R LV   +    +  GD      YSLT VGRLLV+      R+F 
Sbjct  61    PNLNPSKTTFIPILMRVLVDFGLFNYHQQQGDG-----YSLTTVGRLLVENHHFGNRSFF  115

Query  404   NICNEYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELI  583
                   V   +  ++GDW ++D  + F TA G+  WDY   +P +N VFN+A A DS L+
Sbjct  116   LFAQHPVVLNTAASVGDWLKDDLRTAFETADGKSHWDYCGADPEFNGVFNDAMAGDSRLM  175

Query  584   MEVLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIE  763
               +L++     VF+GL SLVD+ GG GAVA AIA  FP++KCIVLDLPHVIA        
Sbjct  176   SNLLISDCCAGVFEGLTSLVDIGGGTGAVAMAIAGAFPSLKCIVLDLPHVIADRKGSG--  233

Query  764   NMEFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVM  943
             N+EFVAG+MF+ IP ANA+LLKWI+H+W+DE+CVK+LKKC+E+I  RE GGKVIIIDM+M
Sbjct  234   NLEFVAGSMFDKIPHANAILLKWILHNWDDEDCVKLLKKCKESISSRENGGKVIIIDMIM  293

Query  944   EDPKRTDAYYNKAQL-----YMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGL  1108
             ED       YN  QL      MD ++   Y SKER +K+WEKLF EAGFS YKI  +LGL
Sbjct  294   EDN------YNNKQLVQSQHLMDLIMRITYASKERTEKEWEKLFLEAGFSGYKIITSLGL  347

Query  1109  RSLIEVFP  1132
             RSLIE++P
Sbjct  348   RSLIEIYP  355



>dbj|BAJ05387.1| O-methyltransferase [Carapichea ipecacuanha]
Length=350

 Score =   354 bits (909),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 181/353 (51%), Positives = 239/353 (68%), Gaps = 12/353 (3%)
 Frame = +2

Query  74    GELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPY  253
              ELL+A+ H      S+ + A+LKCA+ LGIPD I  H KPM LS L +ALPI+PSKAPY
Sbjct  10    AELLRAQTHFSTQLFSFQNYASLKCALHLGIPDAIKQHGKPMNLSELTSALPINPSKAPY  69

Query  254   IHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQK  433
             IHRL R LV        K+G   ++ EC+ LTP+G LL+K++ IN+RA + +        
Sbjct  70    IHRLMRMLV--------KAGYFAQENECFDLTPIGLLLLKDDPINIRALVLLELHPALLM  121

Query  434   SCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESK  613
                AL +WFQNDD +PF TAHG+  WDY S +P +  +F+EA A DSELI +VL+  E K
Sbjct  122   PWIALSEWFQNDDATPFVTAHGKSFWDYTSRDPEFRKLFDEAMAGDSELISKVLVT-EFK  180

Query  614   RVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMF  793
              VF+GLKSLVDV GGNG +A +IAK FP +KC V DLP  +A+       N++FVAG+MF
Sbjct  181   YVFEGLKSLVDVGGGNGTLARSIAKAFPNLKCTVFDLPESVANEQGDG--NLDFVAGDMF  238

Query  794   ESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAYY  973
             + +P+A+A+LLK I+HDW DE CVKILK C+++IP +++GGKVIII+ V+E  K     Y
Sbjct  239   DRVPSADAILLKIILHDWSDENCVKILKNCKKSIPGKDKGGKVIIIEGVVELEKNAGNEY  298

Query  974   NKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
                +  +D  +M LY SKER KK+W KLFS+AGFSDYK  P L    +IE+ P
Sbjct  299   AGLE-NLDMEMMVLYNSKERTKKEWAKLFSDAGFSDYKFIPALDSWCIIELSP  350



>ref|XP_007142043.1| hypothetical protein PHAVU_008G247600g [Phaseolus vulgaris]
 gb|ESW14037.1| hypothetical protein PHAVU_008G247600g [Phaseolus vulgaris]
Length=357

 Score =   354 bits (909),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 173/353 (49%), Positives = 240/353 (68%), Gaps = 5/353 (1%)
 Frame = +2

Query  74    GELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPY  253
              +LL+A+ H WNH  S+I+S +LKC V LGIPD IHNH +PM LSNLI++LPIH SK  +
Sbjct  10    AKLLRAQTHVWNHIFSFINSMSLKCIVDLGIPDIIHNHGQPMSLSNLISSLPIHSSKTHF  69

Query  254   IHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQK  433
             IHRL R +VHS       +  + E E  Y+LT    LL+K  A+++  FL    + V   
Sbjct  70    IHRLMRIMVHSG-FFSQHNPTENELELKYALTDSSLLLLKSNAMSVTPFLQAMLDPVMTN  128

Query  434   SCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESK  613
                   +WF+N +P+ F   +G+  W+Y S +P +N +FN+A A D++L+   L+  + K
Sbjct  129   PWNQFSNWFKNGNPTTFEMENGKPFWEYASCDPRFNILFNDAMASDAQLVTS-LVTEKCK  187

Query  614   RVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMF  793
              VF GL+SLVDV GG G +  AIAK FP ++C V DLPHV++ +     EN+++V G+MF
Sbjct  188   GVFMGLESLVDVGGGTGIMGKAIAKSFPQLECTVFDLPHVVSGLQGS--ENLKYVGGDMF  245

Query  794   ESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAYY  973
             E+IP A+A+LLKWI+HDW DEECV ILKKC+EA+  + + GKVIIIDMV++   + D  +
Sbjct  246   EAIPPADAILLKWILHDWSDEECVNILKKCKEALSRKGKEGKVIIIDMVVDKEMKDDESF  305

Query  974   NKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              + QL+ D L+M L   KERNKK+W KLFS AGF++YKITP +G RSLIE++P
Sbjct  306   -ETQLFFDILMMVLLTGKERNKKEWVKLFSSAGFNNYKITPFVGSRSLIEIYP  357



>gb|AFK40900.1| unknown [Lotus japonicus]
Length=357

 Score =   354 bits (908),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 180/359 (50%), Positives = 244/359 (68%), Gaps = 5/359 (1%)
 Frame = +2

Query  56    ENGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIH  235
             ++G+   +LL+A++H WNH LSYI+S +LKC V LGIPD IHN+ KPMPLS LIA+LPIH
Sbjct  4     KDGENAAKLLRAQSHIWNHILSYINSMSLKCVVDLGIPDIIHNYGKPMPLSKLIASLPIH  63

Query  236   PSKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICN  415
              SKA  I RL R ++HS       +  + E E  Y+LT    LL+K    ++  FL   N
Sbjct  64    SSKAGNIPRLMRVMIHSG-FFSQHNITENELEVEYTLTDDSILLLKGHPFSILPFLLCSN  122

Query  416   EYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVL  595
             + + +K  + L  WF+NDD +PF TAHG   WDY + +P  N++ NE+ A D++LI  V 
Sbjct  123   DPILKKPWHHLSTWFKNDDLTPFETAHGMLPWDYANRDPKVNNLLNESMACDAQLIAGVF  182

Query  596   LNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEF  775
             +  + K + +GL+SLVDV GG G +A AIAK FP +KC V DLPHV+A +     EN+E+
Sbjct  183   IE-KCKDMLNGLESLVDVGGGTGTMARAIAKSFPRLKCTVFDLPHVVADLQGS--ENLEY  239

Query  776   VAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPK  955
             + G+MF+ IP A+A+LLKWI+HDW DEEC+KILK C+EAI  + + GKVIIIDMV+E+ K
Sbjct  240   IGGDMFKEIPPADAILLKWILHDWSDEECLKILKNCKEAIKSKGKEGKVIIIDMVIEEDK  299

Query  956   RTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
               D    + QL  D  +M L   KER+ K+W  L S AGFSDYKI+P LGLRS++E++P
Sbjct  300   GDDKSV-ETQLLFDMGMMVLTTGKERSMKEWGILISSAGFSDYKISPVLGLRSVVEIYP  357



>emb|CAJ65662.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   353 bits (907),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 171/348 (49%), Positives = 241/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             +G+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ +  PM LS L +ALPIHP
Sbjct  5     HGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHSS     K    +  EE Y+LT   +LL+K+  ++L  +L    +
Sbjct  65    TKSHSVYRLMRILVHSS--FFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V       L  WFQNDDP+PF TAHG   WDY +++P    +FN+A A D+ L+  V++
Sbjct  123   PVLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNYQPSIAHLFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G +A AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLL+WI+HDW D+EC+KILK+ R AI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLRWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL G +ERN+K+W KLF++AGFSDYKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVGGRERNEKEWAKLFTDAGFSDYKITPIL  346



>emb|CAJ65666.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   352 bits (904),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 172/348 (49%), Positives = 240/348 (69%), Gaps = 6/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             +G+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ +  PM LS L +ALPIHP
Sbjct  5     HGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHSS     K    +  EE Y+LT   +LL+K+  ++L  +L    +
Sbjct  65    TKSHSVYRLMRILVHSS--FFAKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLD  122

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V       L  WFQNDDP+PF TAHG   WDY +++P    +FN+A A D+ L+  V++
Sbjct  123   PVLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNYQPSIAHLFNDAMASDARLVTSVII  182

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G +A AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  183   D-DCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  239

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW D+EC+KILK+ R AI  +++ GKVIIIDM+ME+ ++
Sbjct  240   GGDMFEAVPPADTVLLKWILHDWNDQECIKILKRSRVAITSKDKKGKVIIIDMMMEN-QK  298

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL G KERN+K+W KLF++AGFS YKITP L
Sbjct  299   GDEESIETQLFFDMLMMALVGGKERNEKEWAKLFTDAGFSGYKITPIL  346



>emb|CDP19711.1| unnamed protein product [Coffea canephora]
Length=349

 Score =   353 bits (905),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 177/354 (50%), Positives = 239/354 (68%), Gaps = 13/354 (4%)
 Frame = +2

Query  74    GELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPY  253
             GEL++A+ H WN    +  SA LKCAV+LGIPD I NH KP+ LS+LI+ LPIHPSK+ +
Sbjct  8     GELIEAQTHVWNAMFHFKKSACLKCAVELGIPDVIRNHGKPITLSDLISVLPIHPSKSAH  67

Query  254   IHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQK  433
             I RL RFL +S   +        E  + Y+LT  GRLL+K+E  N+RA + +  +    K
Sbjct  68    IFRLMRFLANSGFFV--------ENPQGYALTSAGRLLLKDEPFNVRAHIFLSCDPAMLK  119

Query  434   SCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESK  613
                 L  WFQNDDPSPF TA+G   W Y + E  +  +FNEA A D++L +EVL+  + K
Sbjct  120   PWNFLTKWFQNDDPSPFDTAYGNNFWHYNAQEVRFGKMFNEAMASDNQLSVEVLMT-KCK  178

Query  614   RVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMF  793
              VF+GL +L DV GG G V  AIA+ FP +KC V DLPHV+A+      EN+EF+AG+MF
Sbjct  179   FVFEGLTTLADVGGGTGKVDRAIAQNFPNIKCTVYDLPHVVANQEGA--ENLEFLAGDMF  236

Query  794   ESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAYY  973
             +S+P ANA+LLK I+HDW DE+C+KILK C++AIP ++ GGKVIIID VM    +    +
Sbjct  237   QSVPRANAILLKRILHDWSDEDCLKILKNCKKAIPEKDNGGKVIIIDGVMGSQIQDKTSF  296

Query  974   NKAQLYMDFLVMALYG-SKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              + +  MD  ++ + G +KER +K+W KLFS+AGFS YK+ P LG+R LIEV+P
Sbjct  297   -ETEFSMDMQMLVMLGPAKERTEKEWSKLFSDAGFSSYKVYPVLGMRCLIEVYP  349



>emb|CAJ65657.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=345

 Score =   352 bits (904),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 174/348 (50%), Positives = 238/348 (68%), Gaps = 7/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+  +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINPMSLKSAIQLGIPDIINKHG-PMTLSELTSALPIHP  63

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  64    TKSHSVYRLMRILVHSGFF--AKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD  121

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V       L  WFQN+DP+PF TAHG   WDY +H+P    +FN+A A D+ L+  V++
Sbjct  122   PVLTTPWNYLSTWFQNEDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVII  181

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  182   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  238

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEEC+KILK+ R AI  +++ GKVIIIDM+ME+ ++
Sbjct  239   GGDMFEAVPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMMEN-QK  297

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   +ERN+K+W KLF++AGFSDYKITP L
Sbjct  298   GDEESIETQLFFDMLMMALVRGQERNEKEWAKLFTDAGFSDYKITPIL  345



>emb|CAJ65660.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=345

 Score =   352 bits (904),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 174/348 (50%), Positives = 238/348 (68%), Gaps = 7/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHG-PMTLSELTSALPIHP  63

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  FL    +
Sbjct  64    TKSHSVYRLMRILVHSGFF--AKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPFLTAMLD  121

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V       L  WFQN+DP+PF TAHG   WDY +H+P    +FN+A A D+ L+  V++
Sbjct  122   PVLTTPWNYLSTWFQNEDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVII  181

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA   P ++C VLDLPHV+A +     +N+++ 
Sbjct  182   D-DCKGVFEGLESLVDVGGGTGTVAKAIADALPHIECTVLDLPHVVADLQGS--KNLKYT  238

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEEC+KILK+ R AI  +++ GKVIIIDM+ME+ ++
Sbjct  239   GGDMFEAVPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMMEN-QK  297

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   +ERN+K+W KLF++AGFSDYKITP L
Sbjct  298   GDEESIETQLFFDMLMMALVRGQERNEKEWAKLFTDAGFSDYKITPIL  345



>emb|CAJ65596.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=345

 Score =   352 bits (903),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 174/348 (50%), Positives = 238/348 (68%), Gaps = 7/348 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGIPD I+ H  PM LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHG-PMTLSELTSALPIHP  63

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K+  ++L  +L    +
Sbjct  64    TKSHSVYRLMRILVHSGFF--AKKKLSKTDEEGYTLTDASQLLLKDHPLSLTPYLTAMLD  121

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              V       L  WFQNDDP+PF TAHG   WDY +H+P    +FN+A A D+ L+  V++
Sbjct  122   PVLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVII  181

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             N + K VF+GL+SL DV GG G VA AIA  FP ++C VLDLPHV+A++     +N+++ 
Sbjct  182   N-DCKGVFEGLESLADVGGGTGTVAKAIADAFPYIECTVLDLPHVVANLQGS--KNLKYT  238

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEEC+KILK+ R AI  +++ GKVIIIDM+ME+ ++
Sbjct  239   GGDMFEAVPPADTVLLKWILHDWNDEECIKILKRSRVAITSKDKKGKVIIIDMMMEN-QK  297

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + Q + D L+MAL   +ERN+K+W KLF++AGFSDYKITP L
Sbjct  298   GDEESIETQPFFDMLMMALVRGQERNEKEWAKLFTDAGFSDYKITPIL  345



>dbj|BAJ05384.1| O-methyltransferase [Carapichea ipecacuanha]
 dbj|BAJ05385.1| O-methyltransferase [Carapichea ipecacuanha]
Length=350

 Score =   352 bits (904),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 180/353 (51%), Positives = 238/353 (67%), Gaps = 12/353 (3%)
 Frame = +2

Query  74    GELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPY  253
              ELL+A+ H      S+ + A+LKCA+ LGIPD I  H KPM LS L +ALPI+PSKAPY
Sbjct  10    AELLRAQTHFSTQLFSFQNYASLKCALHLGIPDAIKQHGKPMNLSELTSALPINPSKAPY  69

Query  254   IHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQK  433
             IHRL R LV        K+G   ++ EC+ LTP+G LL+K++ IN+RA + +        
Sbjct  70    IHRLMRMLV--------KAGYFAQENECFDLTPIGLLLLKDDPINIRALVLLELHPALLM  121

Query  434   SCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESK  613
                AL +WFQNDD +PF TAHG+  WDY S +P +  +F+EA A DSELI +VL+  E K
Sbjct  122   PWIALSEWFQNDDATPFVTAHGKSFWDYTSRDPEFRKLFDEAMAGDSELISKVLVT-EFK  180

Query  614   RVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMF  793
              VF+GLKSLVDV G NG +A +IAK FP +KC V DLP  +A+       N++FVAG+MF
Sbjct  181   YVFEGLKSLVDVGGANGTLARSIAKAFPNLKCTVFDLPEAVANEQGDG--NLDFVAGDMF  238

Query  794   ESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAYY  973
             + +P+A+A+LLK I+HDW DE CVKILK C+++IP +++GGKVIII+ V+E  K     Y
Sbjct  239   DRVPSADAILLKIILHDWSDENCVKILKNCKKSIPGKDKGGKVIIIEGVVELEKNAGNEY  298

Query  974   NKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
                +  +D  +M LY SKER KK+W KLFS+AGFSDYK  P L    +IE+ P
Sbjct  299   AGLE-NLDMEMMVLYNSKERTKKEWAKLFSDAGFSDYKFIPALDSWCIIELSP  350



>emb|CDP19713.1| unnamed protein product [Coffea canephora]
Length=350

 Score =   352 bits (903),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 177/353 (50%), Positives = 244/353 (69%), Gaps = 14/353 (4%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYI  256
             ELL A+ H  N  L++  SA+LKCA++LGIP+ I+ H KP+ LS L++ALP++PSKA +I
Sbjct  9     ELLAAQNHVRNQMLNFRKSASLKCAIELGIPEAINQHGKPITLSELVSALPVNPSKASHI  68

Query  257   HRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQKS  436
             +RL RFL        +K+G    Q++CY+LT  GRLL+K++  NLRA +   ++ V  K 
Sbjct  69    YRLMRFL--------SKAGFFVLQDQCYALTAAGRLLLKDDPFNLRALIFFMSDPVLVKP  120

Query  437   CYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESKR  616
               +L +WF+NDDP+PF TAHG+  W Y + EP + + FNEA A DS  I++V++    K 
Sbjct  121   WNSLTEWFRNDDPAPFDTAHGKNFWAYAAEEPNFANRFNEAMANDSTFIVQVMMT-RCKF  179

Query  617   VFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMFE  796
             VFDGL SLVDV GG G VA AIA+ FP ++C+V DLPHVIA       EN++FVAG+M E
Sbjct  180   VFDGLTSLVDVGGGTGTVARAIAQNFPNLECVVCDLPHVIACQEG--TENLDFVAGDMLE  237

Query  797   SIPAANAVLLKW--IMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAY  970
              +P A+A+LLK    +HDW DE+CVKILK C+EAIP R +GG+VIIIDM++E   + D  
Sbjct  238   KVPTADAILLKKPDSIHDWSDEDCVKILKNCKEAIPGRNKGGRVIIIDMILESQIKDDES  297

Query  971   YNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVF  1129
               + Q+ MD  ++  + +KER +K+W KLF +AGFS YKI P  G+R LIEV+
Sbjct  298   V-ETQVGMDMQMLMCHAAKERTEKEWAKLFRDAGFSYYKILPVFGVRCLIEVY  349



>emb|CAN69556.1| hypothetical protein VITISV_027590 [Vitis vinifera]
Length=323

 Score =   351 bits (900),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 179/358 (50%), Positives = 229/358 (64%), Gaps = 39/358 (11%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG++  ELL A+AH WNH L++I S +LKCA+QLGIPD IHNH KPM L           
Sbjct  5     NGEISAELLHAQAHVWNHILNFIKSVSLKCAIQLGIPDIIHNHGKPMTLP----------  54

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
                                   ++G   E+EE Y LT   RLL+ ++++++R  L    +
Sbjct  55    ----------------------EAG---EEEEGYVLTDASRLLLMDDSLSIRPLLLAMLD  89

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
              +  K  + L  WFQNDDP+PF TAH    WDY  HEP  N+ FNEA A D+ L+  VLL
Sbjct  90    PILTKPWHYLSAWFQNDDPTPFHTAHERPFWDYAGHEPQLNNFFNEAMASDARLVTSVLL  149

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
               E K VF+GL SLVDV GG G VA AIA  FP + C VLDLPHV+A +     +N+ + 
Sbjct  150   K-EGKGVFEGLNSLVDVGGGTGQVAKAIANAFPHLNCTVLDLPHVVAGLQGS--KNLNYF  206

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
             AG++FE+IP A+A+LLKWI+HDW DEECVKILK+CREAIP +E GGKVIIIDM+M    +
Sbjct  207   AGDIFEAIPPADAILLKWILHDWSDEECVKILKRCREAIPSKENGGKVIIIDMIMMK-NQ  265

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              D    + QL+ D  +M     +ER++ +WEKLF +AGFS YKITP LGLRSLIEV+P
Sbjct  266   GDYKSIETQLFFDMTMMIFAAGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  323



>ref|XP_004241912.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
lycopersicum]
Length=356

 Score =   352 bits (903),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 188/369 (51%), Positives = 245/369 (66%), Gaps = 21/369 (6%)
 Frame = +2

Query  50    MAENGKLHG-ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKP-MPLSNLIAA  223
             MA N  +   EL++AEA +W++ LSY+  + +KCA+QLGIPD +H +A P M LS+LIAA
Sbjct  1     MASNNNICAYELIEAEAQSWDYILSYLRPSCIKCAIQLGIPDILHKNADPIMSLSDLIAA  60

Query  224   LP-IHPSKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAF  400
             LP ++PSK  +I  L R LV   +    +  GD      YSLT VGRLLV+      R+F
Sbjct  61    LPNLNPSKTTFIPILMRVLVDFGLFNYHQQQGDG-----YSLTTVGRLLVENHHFGNRSF  115

Query  401   LNICNEYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSEL  580
                    V   +  ++GDW ++D  + F TA G+  WDY   +P +N VFN+A A DS L
Sbjct  116   FLFAQHPVVLNTAASVGDWLKDDLRTAFETADGKSHWDYCGADPEFNGVFNDAMAGDSRL  175

Query  581   IMEVLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNI  760
             +  +L++     VF+GL SLVD+ GG GAVA AIA  FP++KCIVLDLPHVIA       
Sbjct  176   MSNLLISDCCAGVFEGLTSLVDIGGGTGAVAMAIAGAFPSLKCIVLDLPHVIADRKGSG-  234

Query  761   ENMEFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMV  940
              N+EFVAG+MF+ IP ANA+LLKWI+H+W+DE+CVK+LKKC+E+I  RE GGKVIIIDM+
Sbjct  235   -NLEFVAGSMFDKIPHANAILLKWILHNWDDEDCVKLLKKCKESISSRENGGKVIIIDMI  293

Query  941   MEDPKRTDAYYNKAQL-----YMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLG  1105
             MED       YN  QL      MD ++   Y SKER +K+WEKLF EAGFS YKI  +LG
Sbjct  294   MEDN------YNNKQLVQSQHLMDLIMRITYASKERTEKEWEKLFLEAGFSGYKIITSLG  347

Query  1106  LRSLIEVFP  1132
             LRSLIE++P
Sbjct  348   LRSLIEIYP  356



>emb|CAJ65637.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=341

 Score =   352 bits (902),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 177/348 (51%), Positives = 237/348 (68%), Gaps = 11/348 (3%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL A+AH WNH  S+I+S +LK A+QLGI D I+ H   M LS L +ALPIHP
Sbjct  5     NGEHSNELLHAQAHIWNHIFSFINSMSLKSAIQLGILDVINKHGYLMTLSELTSALPIHP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K+  ++RL R LVHS      K    +  EE Y+LT   +LL+K++ ++L  FL   N 
Sbjct  65    TKSHSVYRLMRILVHSGFF--AKKKLSKIDEEGYTLTNASQLLLKDDPLSLTPFLTAMN-  121

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
                 K    L  WFQN+DP+PF TAHG   WDY +H+P     FN A A D+ L+  V++
Sbjct  122   ----KPWNYLSTWFQNNDPTPFDTAHGMTFWDYGNHQPSIAHFFNNAMASDARLVTSVII  177

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
             + + K VF+GL+SLVDV GG G VA AIA  FP ++C VLDLPHV+A +     +N+++ 
Sbjct  178   D-DCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGS--KNLKYT  234

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
              G+MFE++P A+ VLLKWI+HDW DEECVKILK+ R+AI  +++ GKVII+DM+ME+ KR
Sbjct  235   RGDMFEAVPPADTVLLKWILHDWNDEECVKILKRSRKAITSKDKKGKVIILDMMMENQKR  294

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
              D    + QL+ D L+MAL   KERN+K+W KLF++AGFSDYKITP L
Sbjct  295   -DEESIETQLFFDMLMMALVTGKERNEKEWAKLFTDAGFSDYKITPIL  341



>gb|KHN08844.1| 8-hydroxyquercetin 8-O-methyltransferase [Glycine soja]
Length=329

 Score =   349 bits (896),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 171/332 (52%), Positives = 228/332 (69%), Gaps = 4/332 (1%)
 Frame = +2

Query  137   ALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYIHRLTRFLVHSSVLLVTKSGG  316
             +LKC V LGIPD IHN+ +PMPLSNLIA+LPIHPSK  ++HRL R ++HS          
Sbjct  2     SLKCVVDLGIPDIIHNYGQPMPLSNLIASLPIHPSKTCFVHRLMRIMIHSGFFSQQNHDL  61

Query  317   DEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQKSCYALGDWFQNDDPSPFCTAH  496
             + E E  Y LT    LL+K   +++  FL+   + V          WF+N DP+PF TAH
Sbjct  62    ENELEAKYVLTDASVLLLKNHPMSVTPFLHAMLDPVLTNPWNQFSTWFKNGDPTPFETAH  121

Query  497   GEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESKRVFDGLKSLVDVAGGNGAVAS  676
             G  +WDY   +P  N +FN+A A D+  +  +++  + K VF GL+SLVDV GG G +A 
Sbjct  122   GMMLWDYAGADPKLNHLFNDAMASDARFVTSLVIE-KCKGVFMGLESLVDVGGGTGTMAK  180

Query  677   AIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMFESIPAANAVLLKWIMHDWEDE  856
             AIAK FP ++CIV DLPHV++ +     EN+++VAG+MFE+IP A+A+LLKWI+HDW DE
Sbjct  181   AIAKSFPRVECIVFDLPHVVSGLKGS--ENLKYVAGDMFEAIPPADAILLKWILHDWNDE  238

Query  857   ECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAYYNKAQLYMDFLVMALYGSKERN  1036
             ECV ILKKC+EAI  + + GKVIIIDMV+E+ KR D    + QL+ D L+M L   KER+
Sbjct  239   ECVDILKKCKEAITRKGKEGKVIIIDMVVENEKRDDESV-ETQLFFDMLMMVLVTGKERS  297

Query  1037  KKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
             KK+W KL S AG+++YKITP LGLRSLIE++P
Sbjct  298   KKEWAKLISSAGYNNYKITPVLGLRSLIEIYP  329



>ref|XP_006474725.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=365

 Score =   350 bits (897),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 179/362 (49%), Positives = 239/362 (66%), Gaps = 9/362 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             N  +  ELLQ++AH WN+  S+++S +LKCA+QLGIPD IHNHAKPM L+ L+ AL IHP
Sbjct  9     NDNISDELLQSQAHVWNNIFSFVNSMSLKCAIQLGIPDIIHNHAKPMTLNQLLTALQIHP  68

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K   ++RL R LVHS    + K+  + EQEE Y LT   +LL+K+  ++L  FL    +
Sbjct  69    TKTQCVYRLMRILVHSGFFALQKT-SENEQEEGYILTSASKLLLKDHPLSLAPFLLAMLD  127

Query  419   YVFQKSCYALGDWFQN----DDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIM  586
              +  K  + +  W QN    D  + F   HG   WDY   E   N  FNE  A D+ L  
Sbjct  128   PILTKPWHQVSTWIQNDDDDDAATTFALPHGMNFWDYAVRETRLNHFFNEGMASDTRLTS  187

Query  587   EVLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIEN  766
               L++ + K VF+GL +LVDV GG G +ASAIAK FP ++C V D PHV+A + +    N
Sbjct  188   SALIH-KCKDVFEGLNTLVDVGGGTGTLASAIAKKFPHIECTVFDQPHVVADLKSNG--N  244

Query  767   MEFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVME  946
             +++V GNMFE+IP A+AVL+K ++H+W DEECVKILK C++AI I  + GKVIIID+ ME
Sbjct  245   LKYVGGNMFEAIPPADAVLIKCVLHNWNDEECVKILKNCKKAIAINGKAGKVIIIDIKME  304

Query  947   DPKRTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEV  1126
               K  D    + QL+MD L+M L   +ERN+K+W KLF EAGFSDYKIT  LG+RSLIEV
Sbjct  305   SEK-ADYKTTETQLFMDMLMMVLVKGEERNEKEWAKLFFEAGFSDYKITDVLGVRSLIEV  363

Query  1127  FP  1132
             +P
Sbjct  364   YP  365



>ref|XP_006346269.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=364

 Score =   348 bits (894),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 177/361 (49%), Positives = 241/361 (67%), Gaps = 19/361 (5%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPS--KAP  250
             ++L A+AH WNH  +YI+S +LKCA+QL IPD IH+H +PM LS+L  ALPI+ +  KA 
Sbjct  14    QVLAAQAHIWNHIFNYINSMSLKCAIQLEIPDIIHSHGRPMNLSDLAEALPINNNHDKAK  73

Query  251   Y---IHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEY  421
                 ++RL R LVH+   +       +E EE Y LTP  RLL+K+E +++  FLN   + 
Sbjct  74    THDCVYRLMRILVHAGFFI-------QEAEEGYLLTPTSRLLLKDEPMSMIPFLNFQLDP  126

Query  422   VFQKSCYALGDWFQN--DDP--SPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIME  589
                   ++L  WF N  DD   +P+ TAHG   + Y  +EP  N +FNEA A D+ L+M 
Sbjct  127   NLMDPWHSLSKWFNNVSDDSNTTPYATAHGMPFFKYAENEPRLNHLFNEAMASDTRLVMT  186

Query  590   VLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENM  769
             VL+      +F+GLKSLVDV GG G +A AIA  FP + C V +LPHVI  +     +N+
Sbjct  187   VLIQNGKGLIFEGLKSLVDVGGGTGTIAKAIADTFPQINCTVFELPHVIEGLKGS--KNL  244

Query  770   EFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMED  949
              FV G+MF SIP+ANA+LLKWI+HDW D +C+KILKKC+EAIP +E GGKVI+I++VM+ 
Sbjct  245   SFVGGDMFNSIPSANAILLKWILHDWSDGDCIKILKKCKEAIPSKENGGKVILIEIVMDQ  304

Query  950   PKRTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVF  1129
              K  D  Y + QL +D L+M L   KER++++W KLF +AG+SDYKI P LGLR +IEV+
Sbjct  305   NKDDDKSY-ETQLLIDILMMILLSGKERSQQEWAKLFFDAGYSDYKIIPILGLRCVIEVY  363

Query  1130  P  1132
             P
Sbjct  364   P  364



>ref|XP_006366298.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=365

 Score =   348 bits (894),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 175/363 (48%), Positives = 236/363 (65%), Gaps = 10/363 (3%)
 Frame = +2

Query  62    GKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPS  241
             G+   E+L A+ H WNH  S+I+S +LK A+QL IPD IH H KPM L+ L  AL I+ S
Sbjct  7     GEHESEILHAQTHIWNHIFSFINSMSLKSAIQLNIPDIIHKHGKPMTLNELANALSINKS  66

Query  242   KAPYIHRLTRFLVHSSVLL------VTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFL  403
             K  ++ RL R L+HS   L      + +      + E Y L P  RLL+K+E + +  FL
Sbjct  67    KITHLRRLMRILIHSGFFLKFAMIPLEEGSSGSGEGEGYVLAPPARLLLKDEPLTVTPFL  126

Query  404   NICNEYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELI  583
                 + +  K  + + +WF +D+P+PF  AHG   WDY  HE   N  FN+A A D++L+
Sbjct  127   LAMLDPILVKPWHHVNEWFSSDEPTPFEVAHGRTFWDYAGHEQRLNHFFNDAMASDAKLV  186

Query  584   MEVLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIE  763
             M V++   SK VF+GL S+VDV GG G VA  IAK FP ++C V DLPHV+  +     +
Sbjct  187   MSVVMK-YSKDVFEGLNSIVDVGGGTGTVAKTIAKKFPNLQCTVFDLPHVVEGLEGS--D  243

Query  764   NMEFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVM  943
             N+ +V G+ F S+P A+A+LLKWI+HDW DEE VKILKKC+EAIP +E+GGKVIIIDM M
Sbjct  244   NLSYVGGDFFVSVPPADALLLKWILHDWSDEESVKILKKCKEAIPSKEKGGKVIIIDM-M  302

Query  944   EDPKRTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIE  1123
              D K  D    + Q++ D L+M L   +ER+++ W K+F EAGFSDYK+TP LGLRSLIE
Sbjct  303   VDNKIGDDESIETQIFFDMLMMVLVTGRERSERGWAKIFFEAGFSDYKVTPILGLRSLIE  362

Query  1124  VFP  1132
             V+P
Sbjct  363   VYP  365



>ref|XP_004505627.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cicer 
arietinum]
Length=389

 Score =   349 bits (896),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 176/362 (49%), Positives = 249/362 (69%), Gaps = 9/362 (2%)
 Frame = +2

Query  50    MAENGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALP  229
             MA++ +   +LLQA+   +N   S+I+S +LKCA++L IPD IHN+ +P+PLS LI++LP
Sbjct  36    MAQSEEHATKLLQAQTQVFNQIFSFINSMSLKCAIELSIPDIIHNYGQPIPLSQLISSLP  95

Query  230   IHPSKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNI  409
             IHPSK+  I RL R L HS+  +VTK+    E E  Y LT   RLL+K+   ++ + L++
Sbjct  96    IHPSKSGDIDRLMRVLTHSNFFIVTKN----ELEVMYELTDASRLLLKDHPFSMTSMLHV  151

Query  410   CNEYVFQKSCYALGDWFQNDDPSPFCTA-HGEKIWDYISHEPVYNDVFNEATAKDSELIM  586
                 +  K  + L +W++N+DPSPF T  +G + WDY  H+P +N +FNEA A ++ +  
Sbjct  152   ILGPIMSKPWHQLSNWYKNEDPSPFYTENNGIEFWDYAGHDPEFNHLFNEAMACETRMAS  211

Query  587   EVLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIEN  766
              V++ G+ K VF GL+SLVDV GG G ++ AIAK FP ++CIV DLPHV+  +     EN
Sbjct  212   TVVM-GKCKGVFQGLESLVDVGGGIGTMSKAIAKSFPNIECIVFDLPHVVDGLQGS--EN  268

Query  767   MEFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVME  946
              ++VAG+MFESIP   ++LLK ++HDW DEEC+KILKKC+EAI  + + GKVIIID VM 
Sbjct  269   FKYVAGDMFESIPPTQSILLKGVLHDWNDEECLKILKKCKEAIKSKGKEGKVIIIDAVMG  328

Query  947   DPKRTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEV  1126
             + K  +  + +AQL+ D  +M L   KERN+K+W KLF  AGF++YKIT  LG +SLIEV
Sbjct  329   NEKADNESF-EAQLFYDLEMMVLVNGKERNEKEWSKLFFSAGFNNYKITHGLGFKSLIEV  387

Query  1127  FP  1132
             FP
Sbjct  388   FP  389



>ref|XP_006376381.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP54178.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=359

 Score =   348 bits (892),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 174/355 (49%), Positives = 236/355 (66%), Gaps = 7/355 (2%)
 Frame = +2

Query  74    GELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPY  253
             GE+LQA++H WNH  ++I+S  LKCAVQLGIPD I  H KPM LS L++ALPIHPSKA Y
Sbjct  10    GEMLQAQSHVWNHIFNFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSKAQY  69

Query  254   IHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQK  433
             +HRL R LVHS         G   Q E YSLT   RLL+K+   ++R  L +  + V  K
Sbjct  70    VHRLMRILVHSGFFSQQNLNGIHNQ-EAYSLTQSTRLLLKDNPWSVRPLLLLLLDPVLTK  128

Query  434   SCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESK  613
                 L  WFQNDD + F  AH +  W+Y   +   N++FNEA A DS L  +++++ + K
Sbjct  129   PWDCLSTWFQNDDRNAFSVAHEKTFWEYAGQDARLNNLFNEAMASDSILASKLVVS-KCK  187

Query  614   RVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMF  793
              +FDG+ SLVDV GG G +   IA+ FP M C V DLPHV++ +  G  +N+++V G+MF
Sbjct  188   GIFDGVNSLVDVGGGLGTMTKGIAEAFPHMDCTVFDLPHVVSDLQGG--KNLKYVGGDMF  245

Query  794   ESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIR--EEGGKVIIIDMVMEDPKRTDA  967
             E++P A+A+LLKWI+HDW DE+CVKILK+C++AI  +  ++ GKVIIIDMV E+  R + 
Sbjct  246   EAVPPADALLLKWILHDWSDEDCVKILKRCKQAIASKGQQKVGKVIIIDMVRENQNRDEG  305

Query  968   YYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
                + QL  D  +M      ERN+K+W KLF +AGF +YKI P LG R+LIE++P
Sbjct  306   SI-ETQLLFDLEMMVAVSGMERNEKEWAKLFFDAGFLNYKIHPVLGTRALIELYP  359



>ref|XP_006376386.1| hypothetical protein POPTR_0013s12560g [Populus trichocarpa]
 ref|XP_006376390.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP54183.1| hypothetical protein POPTR_0013s12560g [Populus trichocarpa]
 gb|ERP54187.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=359

 Score =   348 bits (892),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 172/354 (49%), Positives = 236/354 (67%), Gaps = 7/354 (2%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYI  256
             ELLQA+ H WNH   +I+S  LKCAVQLGIPD I  H KPM LS L++ALPIHPSKA Y+
Sbjct  11    ELLQAQTHVWNHIFYFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSKAQYV  70

Query  257   HRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQKS  436
             HRL R LVHS      ++  D   ++ YSLT   RLL+K+   ++R  L +  + V  K 
Sbjct  71    HRLMRILVHSG-FFSQQNLNDIHNQDAYSLTQSTRLLLKDNPWSMRPLLLVFLDPVLTKP  129

Query  437   CYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESKR  616
                L  WFQNDD + F  AH    W+Y   +P  N++FN+A A+DS L+ +V++  + K 
Sbjct  130   WDCLSTWFQNDDRNAFSVAHENTFWEYAGQDPRINNLFNDAMARDSILVSKVVV-CKCKG  188

Query  617   VFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMFE  796
             +FDG+ SLVDV GG G +A  IA+ FP M C V DLPHV++ +     +N+++V G+MFE
Sbjct  189   IFDGVNSLVDVGGGLGTMAKGIAEAFPHMDCTVFDLPHVVSDLQGS--KNLKYVGGDMFE  246

Query  797   SIPAANAVLLKWIMHDWEDEECVKILKKCREAI--PIREEGGKVIIIDMVMEDPKRTDAY  970
             ++P A+A+LLKWI+HDW DE+CVKIL++C++AI    +++ GKVIIIDMV E+    D  
Sbjct  247   AVPPADAILLKWILHDWSDEDCVKILRRCKQAIMSTGQQKAGKVIIIDMVREN-LNGDEG  305

Query  971   YNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
               + QL  D  +M  +   ERN+K+W KLF +AGF +YKI P LG R+LIE++P
Sbjct  306   SIETQLLFDLQLMVGFSGMERNEKEWAKLFFDAGFLNYKIHPVLGTRALIELYP  359



>gb|KHN07780.1| Tabersonine 16-O-methyltransferase [Glycine soja]
Length=323

 Score =   346 bits (887),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 175/332 (53%), Positives = 227/332 (68%), Gaps = 10/332 (3%)
 Frame = +2

Query  137   ALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYIHRLTRFLVHSSVLLVTKSGG  316
             +LKCA++L IPD IH + +PMPLS L  +L IHPSKA  I+RL R L HS      K   
Sbjct  2     SLKCAIELDIPDIIHKYGQPMPLSKLTTSLSIHPSKANCIYRLMRILTHSGFFSQHKVN-  60

Query  317   DEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQKSCYALGDWFQNDDPSPFCTAH  496
             + E E  Y LT    LL+K+  +++  FL+   +    +    L  WF+NDDPSPF TAH
Sbjct  61    ENELEMGYVLTDASTLLLKDNPLSMVPFLHAMLDPTLTQPWLQLPTWFKNDDPSPFQTAH  120

Query  497   GEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESKRVFDGLKSLVDVAGGNGAVAS  676
             G KIWDY   EP  ND+FN+A A D++L+  V++    K VF+GL+SLVDV GG G +A 
Sbjct  121   GMKIWDYADREPRLNDLFNDAMASDTQLVANVVIE-RCKGVFNGLESLVDVGGGTGTMAM  179

Query  677   AIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMFESIPAANAVLLKWIMHDWEDE  856
             AIAK FP ++C V DLPHV+A++     EN+++V G+MFESIP+A+A+LLKWI+HDW DE
Sbjct  180   AIAKSFPQLECTVFDLPHVVATLQGS--ENLKYVGGDMFESIPSADAILLKWILHDWNDE  237

Query  857   ECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAYYNKAQLYMDFLVMALYGSKERN  1036
             +CVKILKKC+EAI       KVIIIDMV+E+ K  D    + QL++D +VM LY  KER 
Sbjct  238   QCVKILKKCKEAI-----KSKVIIIDMVVENEKGDDESI-ETQLFIDMVVMVLYPGKERT  291

Query  1037  KKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
             +K+W KL    GFSDYKITP LGLRSLIE++P
Sbjct  292   EKEWAKLIFSTGFSDYKITPVLGLRSLIEIYP  323



>ref|XP_003615966.1| O-methyltransferase [Medicago truncatula]
 gb|AES98924.1| orcinol O-methyltransferase [Medicago truncatula]
Length=360

 Score =   347 bits (890),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 167/351 (48%), Positives = 236/351 (67%), Gaps = 4/351 (1%)
 Frame = +2

Query  80    LLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYIH  259
             LL+A++H WNH  ++I+S +LKC V LGIPD IHN+ KP+ LS LI+ LPIHPSK  +IH
Sbjct  14    LLKAQSHIWNHIFNFINSMSLKCVVDLGIPDIIHNYGKPISLSKLISLLPIHPSKTCFIH  73

Query  260   RLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQKSC  439
             RL R + HSS      +  + E E  Y LT    LL+K+  +++  F++   + V     
Sbjct  74    RLMRIMTHSS-FFSQYNVTENELEIEYMLTDASILLLKDNPMSVTPFVHAMLDPVLTNPW  132

Query  440   YALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESKRV  619
             +    W +NDDP+ F T H   +W+Y++ +  ++++FNE+ A D+ L+  +L+  + + V
Sbjct  133   HQFSTWLKNDDPTTFETTHRMLLWEYVACDSKFSNLFNESMASDTRLVTNLLIE-KCRGV  191

Query  620   FDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMFES  799
             F+GL+SLVDV GG G +A A+AK FP M+  V DLPHV+  +     EN+ +V G+MF+ 
Sbjct  192   FNGLESLVDVGGGTGTMAKALAKSFPQMEFSVFDLPHVVDGLQGS--ENLNYVGGDMFKE  249

Query  800   IPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAYYNK  979
             IP  +A+LLKWI+HDW DEECVKILK C++AI  + + GKVI+IDMV+E  K +     +
Sbjct  250   IPPTDAILLKWILHDWNDEECVKILKNCKDAISKKGKQGKVIVIDMVLESEKESINESVE  309

Query  980   AQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              QL+ D L+M +   KERNKK+W KL S AGFSDYKITP LGLRSLIE++P
Sbjct  310   TQLFFDMLMMVVLAGKERNKKEWIKLISSAGFSDYKITPILGLRSLIEIYP  360



>gb|ABK96707.1| unknown [Populus trichocarpa x Populus deltoides]
Length=359

 Score =   347 bits (890),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 175/354 (49%), Positives = 237/354 (67%), Gaps = 7/354 (2%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYI  256
             ELLQA+ H WNH   +I+S  LKCAVQLGIPD I  H KPM LS L++ALPIHPSKA Y+
Sbjct  11    ELLQAQTHVWNHIFYFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSKAQYV  70

Query  257   HRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQKS  436
             HRL R LVHS         G + Q E YSLT   RLL+K+   ++RA L    + V  K 
Sbjct  71    HRLMRILVHSGFFSQRNLNGVDNQ-EAYSLTQSTRLLLKDNPWSVRAHLLFVLDPVLTKP  129

Query  437   CYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESKR  616
                L  WFQNDD + F  AH +  W+Y+  +P  N++ NE  A+DS L  ++++N + K 
Sbjct  130   WDCLSTWFQNDDRTAFSVAHEKAPWEYVGQDPRINNLCNEVMARDSILACKLVVN-KCKG  188

Query  617   VFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMFE  796
             +F+G+ SLVDV GG G +A  I + FP M C VLDLPHV++ +     +N++FVAG+MF+
Sbjct  189   IFEGVSSLVDVGGGLGTMAKGITEAFPHMDCTVLDLPHVVSDLQG--CKNLKFVAGDMFQ  246

Query  797   SIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIR--EEGGKVIIIDMVMEDPKRTDAY  970
             ++P A A+LLKWI+H+W DE+CVKILK+C++AI  +  ++ GKVIIIDMV E+    D  
Sbjct  247   AVPPAEAILLKWILHNWSDEDCVKILKRCKQAIMSKGQQKAGKVIIIDMVREN-LNGDEG  305

Query  971   YNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
               + QL+ D  +M + G  ERN+K+W KLF +AGF +YKI P LG R+LIE++P
Sbjct  306   SIETQLFFDLQMMVVAGGMERNEKEWAKLFFDAGFLNYKIYPVLGPRALIELYP  359



>ref|XP_010093978.1| Tabersonine 16-O-methyltransferase [Morus notabilis]
 gb|EXB54965.1| Tabersonine 16-O-methyltransferase [Morus notabilis]
Length=364

 Score =   347 bits (889),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 182/358 (51%), Positives = 236/358 (66%), Gaps = 10/358 (3%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYI  256
             ELLQA    WN SL++I   +LKCAV+LGIPD I+NH +P+ LS LI++LPIH SKA  I
Sbjct  11    ELLQAHGLIWNCSLNFIKPMSLKCAVELGIPDIINNHGQPITLSKLISSLPIHSSKAHCI  70

Query  257   HRLTRFLVHSSVLLVTKSGGDEEQEE------CYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +RL R LVHS      K     ++ E       YSLT   RLL+K+       F  +  E
Sbjct  71    YRLMRILVHSGFFATQKVDNKIDEGEEEEEEEAYSLTIASRLLLKDGPWRATPFFLVQLE  130

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
                    + +  W QN DP+PF   HG+  WD +  EP    +F EA A DS+L+++V++
Sbjct  131   PHLMTPWHFVSTWLQNSDPTPFEMVHGKTFWDGVGDEPRLKYLFTEAMATDSQLMVKVIV  190

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFV  778
               E K+VF+GL SLVDV GG G VA AIAK FP + C VLDLP+V+A+  +   +N+ F+
Sbjct  191   E-ECKQVFEGLTSLVDVGGGTGIVAKAIAKTFPNIMCTVLDLPYVVAN--SQGAKNLNFI  247

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR  958
             AG+MF+ IP ANA+LLKWI+HDW DEE V ILK+CREAI  +E+G KVIIIDMV+E+PK 
Sbjct  248   AGDMFKEIPPANAILLKWILHDWSDEEAVMILKRCREAIWSKEKGEKVIIIDMVIENPK-  306

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              D    + QLY D L+M     +ERN+K+WE LF  AGFS YKITP +GLRSL+EV+P
Sbjct  307   MDKKSAETQLYFDMLMMVNLTGRERNQKEWESLFVAAGFSHYKITPIVGLRSLMEVYP  364



>ref|XP_006469137.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=362

 Score =   346 bits (888),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 170/361 (47%), Positives = 240/361 (66%), Gaps = 6/361 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             +G    ELL+A+AH WNH  ++I+S +LKCAV+L IPD I+ H KP  L++L++AL I+P
Sbjct  5     DGDHDTELLEAQAHVWNHIFNFINSMSLKCAVELSIPDIINKHGKPTTLNDLVSALTINP  64

Query  239   SKAPYIHRLTRFLVHSSVL---LVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNI  409
             SK   ++RL R L+HS       +  S  + ++E+ Y LT   +LL+K+  +++   L  
Sbjct  65    SKTRCVYRLMRILIHSGFFAQQTLNSSRNNNDEEQGYVLTNASKLLLKDSPLSVTPLLQA  124

Query  410   CNEYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIME  589
               + +       L  WFQ+DDP+PF   HG+  W+Y   EP  N+ FNEA A D+ L   
Sbjct  125   VLDPILLSPWLKLSTWFQSDDPAPFDMVHGKSFWEYAGDEPKINNFFNEAMASDARLATR  184

Query  590   VLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENM  769
             V+++ + K VF+GL SLVDV G  G VA AIAK FP ++C   DLPHV+  + + ++ N+
Sbjct  185   VVIH-KCKNVFEGLNSLVDVGGATGTVAKAIAKAFPNLECTDFDLPHVVNGLES-DLANL  242

Query  770   EFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMED  949
             ++V G+MFE+IP A+AV+LKWI+HDW DEECVKILKKC+EAI    + GKVIIIDM+ E+
Sbjct  243   KYVGGDMFEAIPPADAVVLKWILHDWNDEECVKILKKCKEAITSNSKIGKVIIIDMMREN  302

Query  950   PKRTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVF  1129
              K+ D    + QL+   L+M L    ER++K+W KL ++ GFSDYKIT  LGLRSLIEV+
Sbjct  303   -KKGDDESTETQLFFYMLMMVLATGTERDEKEWAKLLADVGFSDYKITSILGLRSLIEVY  361

Query  1130  P  1132
             P
Sbjct  362   P  362



>ref|XP_006376388.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP54185.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=365

 Score =   346 bits (887),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/354 (49%), Positives = 232/354 (66%), Gaps = 7/354 (2%)
 Frame = +2

Query  74    GELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPY  253
             GELLQA+ H WNH  ++I+S  LKCAVQLGIPD I  H KPM LS L++ALPIHPSKA Y
Sbjct  16    GELLQAQTHVWNHIFNFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSKAQY  75

Query  254   IHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQK  433
             +HRL R LVHS         G   Q E YSLT   RLL+K+   N+R  L    + V  K
Sbjct  76    VHRLMRILVHSGFFSQQNLNGVHNQ-EAYSLTQSTRLLLKDNPWNMRPLLLFELDSVLTK  134

Query  434   SCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESK  613
                 L  WF+ND+ + F  AH    W+Y   +P   ++FNEA A DS L  +++++ + K
Sbjct  135   PWDCLSTWFRNDEATAFSVAHENTFWEYAGQDPRIKNLFNEAMASDSILASKLVVS-KCK  193

Query  614   RVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMF  793
              +F+GL SLVDV GG G +A  IA+ FP M C V DLPHV++ +     +N+++V G+MF
Sbjct  194   GIFEGLSSLVDVGGGFGTMAKGIAEAFPHMDCTVFDLPHVVSDLQG--CKNLKYVGGDMF  251

Query  794   ESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIR--EEGGKVIIIDMVMEDPKRTDA  967
             +++P A A+LLKWI+HDW DE+CVKIL++CR+AI  +  ++ GKVIIIDMV E+    + 
Sbjct  252   QAVPPAEAILLKWILHDWSDEDCVKILRRCRQAIMSKGQQKAGKVIIIDMVRENLNGDEG  311

Query  968   YYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVF  1129
                + QL+ D L+M      ERN+K+W KLF +AGF +YKI P LG R+LIE++
Sbjct  312   SI-ETQLFFDLLMMVAVSGMERNEKEWAKLFFDAGFLNYKIHPVLGTRALIELY  364



>ref|XP_006376396.1| hypothetical protein POPTR_0013s12670g [Populus trichocarpa]
 gb|ERP54193.1| hypothetical protein POPTR_0013s12670g [Populus trichocarpa]
Length=359

 Score =   345 bits (886),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 173/354 (49%), Positives = 237/354 (67%), Gaps = 7/354 (2%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYI  256
             ELLQA+ H WNH   +I+S  LKCAVQLGIPD I  H KPM LS L++ALPIHPSKA Y+
Sbjct  11    ELLQAQTHVWNHIFYFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSKAQYV  70

Query  257   HRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQKS  436
             HRL R LVHS         G + Q E YSLT   RLL+K+   ++RA L    + V  K 
Sbjct  71    HRLMRILVHSGFFSQRNLNGVDNQ-EAYSLTQSTRLLLKDNPWSVRAHLLFVLDPVLTKP  129

Query  437   CYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESKR  616
                L  WFQNDD + F  AH +  W+Y+  +P  N++ NE  A+DS L  ++++N + K 
Sbjct  130   WDCLSTWFQNDDRTAFSVAHEKAPWEYVGQDPRINNLCNEVMARDSILACKLVVN-KCKG  188

Query  617   VFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMFE  796
             +F+G+ SLVDV GG G +A  I + FP M C VLDLPHV++ +     +N+++VAG+MF+
Sbjct  189   IFEGVSSLVDVGGGIGTMAKGITEAFPHMDCTVLDLPHVVSDLQG--CKNLKYVAGDMFQ  246

Query  797   SIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIR--EEGGKVIIIDMVMEDPKRTDAY  970
             ++P A A+LLKW++H+W DE+CVKILK+C++AI  +  ++ GKVIIIDMV E+    D  
Sbjct  247   AVPPAEAILLKWMLHNWSDEDCVKILKRCKQAIMSKGQQKAGKVIIIDMVREN-LNGDEG  305

Query  971   YNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
               + QL+ D  +M + G  ERN+K+W KLF +AGF +YKI P LG R+LIE++P
Sbjct  306   SIETQLFFDLQMMVVVGGMERNEKEWAKLFFDAGFLNYKIHPVLGTRALIELYP  359



>gb|KDO73905.1| hypothetical protein CISIN_1g017835mg [Citrus sinensis]
Length=365

 Score =   346 bits (887),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 177/362 (49%), Positives = 237/362 (65%), Gaps = 9/362 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             N  +  ELLQ++AH WN+  S+++S +LKCA+QLGIPD IHNHAKPM L+ L+  L IHP
Sbjct  9     NDNISDELLQSQAHVWNNIFSFVNSMSLKCAIQLGIPDIIHNHAKPMTLNQLLTTLQIHP  68

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K   ++ L R LVHS    + K+  + EQEE Y LT   +LL+K+  ++L  FL    +
Sbjct  69    TKTQCVYHLMRILVHSGFFALQKT-SENEQEEGYILTSASKLLLKDHPLSLAPFLLAMLD  127

Query  419   YVFQKSCYALGDWFQN----DDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIM  586
              +  K  + +  W QN    D  + F   HG   WDY   E   N  FNE  A D+ L  
Sbjct  128   PILTKPWHQVSTWIQNDDDDDAATTFALPHGMNFWDYAVRETRLNHFFNEGMASDTRLTS  187

Query  587   EVLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIEN  766
               L++ + K VF+GL +LVDV GG G +ASAIAK FP ++C V D PHV+A + +    N
Sbjct  188   SALIH-KCKDVFEGLNTLVDVGGGTGTLASAIAKKFPHIECTVFDQPHVVADLKSNG--N  244

Query  767   MEFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVME  946
             +++V GNMFE+IP A+AVL+K ++H+W DEECVKILK C++AI I  + GKVIIID+ ME
Sbjct  245   LKYVGGNMFEAIPPADAVLIKCVLHNWNDEECVKILKNCKKAIAINGKAGKVIIIDIKME  304

Query  947   DPKRTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEV  1126
               K  D    + QL+MD L+M L   +ERN+K+W KLF EAGFSDYKIT  LG+RSLIEV
Sbjct  305   SEK-ADYKTTETQLFMDMLMMVLVKGEERNEKEWAKLFFEAGFSDYKITDVLGVRSLIEV  363

Query  1127  FP  1132
             +P
Sbjct  364   YP  365



>gb|AES89720.2| orcinol O-methyltransferase [Medicago truncatula]
Length=355

 Score =   345 bits (884),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 174/353 (49%), Positives = 239/353 (68%), Gaps = 9/353 (3%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYI  256
             +LLQA+   +NH  S+I+S +LKCA++L IPD IHN+ +P+PLS LI+ LPIHPSK   I
Sbjct  11    KLLQAQTQVFNHIFSFINSMSLKCAIELCIPDVIHNYGQPIPLSKLISLLPIHPSKTGDI  70

Query  257   HRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQKS  436
             HRL R L HS    V+K+    + E  Y L    RLL+K+   ++ + L++    +  K 
Sbjct  71    HRLMRVLTHSGFFNVSKN----DLEVMYELNDASRLLLKDHPFSMTSLLHVILGPILSKP  126

Query  437   CYALGDWFQNDDPSPFCTA-HGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESK  613
              Y L +W++NDDPSPF T  +G   WDY  H+P +N++FNEA A ++ L   V++ G+ K
Sbjct  127   WYQLSNWYKNDDPSPFHTENNGVAFWDYAGHDPNHNNLFNEAMACETRLASSVVM-GKCK  185

Query  614   RVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMF  793
              VF+GL+SLVDV GG G +   IAK FP ++CIV DLPHV+  +     EN+++V G+MF
Sbjct  186   GVFEGLESLVDVGGGIGTITKVIAKSFPNIECIVFDLPHVVDGLQGS--ENLKYVGGDMF  243

Query  794   ESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAYY  973
             E+IP  +++LLK ++HDW DEEC+KILKKC+EAI  + + GKVIIID VM + K  D   
Sbjct  244   EAIPPTHSILLKGVLHDWNDEECLKILKKCKEAIGNKGKEGKVIIIDAVMGNEKE-DNES  302

Query  974   NKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              +AQL+ D  +M L   KERN+K+W  LF  AGFS+YKIT  LG +SLIEVFP
Sbjct  303   IEAQLFYDLEMMVLVNGKERNEKEWSNLFLSAGFSNYKITHGLGFKSLIEVFP  355



>ref|XP_006356530.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=355

 Score =   345 bits (884),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 180/364 (49%), Positives = 238/364 (65%), Gaps = 11/364 (3%)
 Frame = +2

Query  47    IMAENGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKP-MPLSNLIAA  223
             ++  N     +L++AEA +W+H LSY+  + +KCA+QLGIPD +H +  P M LSNLI A
Sbjct  1     MLNNNNICANQLIEAEAQSWDHILSYLRPSCIKCAIQLGIPDILHKNPNPIMSLSNLIIA  60

Query  224   LP-IHPSKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAF  400
             LP ++PSK  +I  L R LV   +           Q + YSLT VGRLLV+ +    R+F
Sbjct  61    LPNLNPSKITFIPILMRVLVDFGLF------NYHHQGDGYSLTRVGRLLVENDLSGKRSF  114

Query  401   LNICNEYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSEL  580
                    V   +   +GDW ++D  + F TA+G+  WDY + EP +N +FN+A A DS L
Sbjct  115   FLFAQHPVVLNTAAYMGDWLRDDLSTAFETAYGKSHWDYCAEEPKFNGIFNDAMASDSRL  174

Query  581   IMEVLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNI  760
             I  +L++     VF+GL SLVD+ GG GAVA AIA  F  +KCIVLDLPHVI        
Sbjct  175   ISNLLISDCCVGVFEGLTSLVDIGGGTGAVAMAIAGAFQRLKCIVLDLPHVIGDRKGSG-  233

Query  761   ENMEFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMV  940
              N+EFVAG+MF+ IP ANA+LLKWI+H+W DE CV +LKKC+E+IP +E GGKVIIIDMV
Sbjct  234   -NLEFVAGSMFDKIPHANAILLKWILHNWSDENCVNLLKKCKESIPSKENGGKVIIIDMV  292

Query  941   MEDPKRTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLI  1120
             MED    +    ++Q  MD L+   + SKER KK+WEKLF +AGFS YKI  +LGLRSLI
Sbjct  293   MEDNCSNEQLV-QSQHLMDLLMRITHASKERTKKEWEKLFLDAGFSGYKIITSLGLRSLI  351

Query  1121  EVFP  1132
             E++P
Sbjct  352   EIYP  355



>ref|XP_006452811.1| hypothetical protein CICLE_v10008718mg [Citrus clementina]
 gb|ESR66051.1| hypothetical protein CICLE_v10008718mg [Citrus clementina]
Length=365

 Score =   345 bits (884),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 177/362 (49%), Positives = 236/362 (65%), Gaps = 9/362 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             N  +  ELLQ++AH WN+  S+++S +LKCA+QLGIPD IHNHAKPM L+ L+  L IHP
Sbjct  9     NDNISDELLQSQAHVWNNIFSFVNSMSLKCAIQLGIPDIIHNHAKPMTLNQLLTTLQIHP  68

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K   ++ L R LVHS    + K+  + EQEE Y LT   +LL+K+  ++L  FL    +
Sbjct  69    TKTQCVYHLMRILVHSGFFALQKT-SENEQEEGYILTSASKLLLKDHPLSLAPFLLAMLD  127

Query  419   YVFQKSCYALGDWFQN----DDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIM  586
              +  K  + +  W QN    D  + F   HG   WDY   E   N  FNE  A D+ L  
Sbjct  128   PILTKPWHQVSTWIQNDDDDDAATTFALPHGMNFWDYAVRETRLNHFFNEGMASDTRLTS  187

Query  587   EVLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIEN  766
               L+N + K VF+GL +LVDV GG G +ASAIAK FP ++C V D PHV+A + +     
Sbjct  188   SALIN-KCKDVFEGLNTLVDVGGGTGTLASAIAKKFPHIECTVFDQPHVVADLKSNGY--  244

Query  767   MEFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVME  946
             +++V GNMFE+IP A+AVL+K ++H+W DEECVKILK C++AI I  + GKVIIID+ ME
Sbjct  245   LKYVGGNMFEAIPPADAVLIKCVLHNWNDEECVKILKNCKKAIAINGKAGKVIIIDIKME  304

Query  947   DPKRTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEV  1126
               K  D    + QL+MD L+M L   +ERN+K+W KLF EAGFSDYKIT  LG+RSLIEV
Sbjct  305   SEK-ADYKTTETQLFMDMLMMVLVKGEERNEKEWAKLFFEAGFSDYKITDVLGVRSLIEV  363

Query  1127  FP  1132
             +P
Sbjct  364   YP  365



>emb|CDP21661.1| unnamed protein product [Coffea canephora]
Length=364

 Score =   345 bits (884),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 174/364 (48%), Positives = 234/364 (64%), Gaps = 7/364 (2%)
 Frame = +2

Query  50    MAEN-GKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAAL  226
             +A N G    EL QA+AH WNH  ++I+S +LKCA+QL IPD IH H +PM L  LI AL
Sbjct  3     LARNIGDHTDELFQAQAHIWNHIFNFINSMSLKCAIQLDIPDVIHKHGRPMTLDQLIDAL  62

Query  227   PIHPSKAPYIHRLTRFLVHSSVLLVTKSGGDE-EQEECYSLTPVGRLLVKEEAINLRAFL  403
             PI   KAP+++RL + L+HS   +  K  G+E + ++ Y LT    LL+K    ++  FL
Sbjct  63    PIKNEKAPFVYRLMQILIHSGFFIEAKIPGNENDNQKGYLLTSASELLLKSNPFSVTPFL  122

Query  404   NICNEYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELI  583
                 +       + L  WFQN   SPF T HG  ++D+ SHE   N  FNEA A D+ ++
Sbjct  123   LAMLDPALTDPWHHLSQWFQNSYESPFYTCHGRSLYDFASHESQLNQFFNEAMASDARMV  182

Query  584   MEVLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIE  763
               V+   + K VF+ L SLVDV GG G  A AIA  FP +KC VLDLPHV+  + +   +
Sbjct  183   SSVVTK-DCKHVFESLNSLVDVGGGTGTFAKAIADAFPRLKCTVLDLPHVVDGLES--TK  239

Query  764   NMEFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVM  943
             N+ +V GNMFE+IP A+AVL+KWI+ DW D+ECV+ILKKC+EAIP +E+GGKVII+D   
Sbjct  240   NLGYVGGNMFEAIPPADAVLMKWILIDWSDDECVQILKKCKEAIPSKEKGGKVIIVDTFC  299

Query  944   EDPKRTDAYYN--KAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSL  1117
             +  ++ D  +   + QL+ D   M L   ++RN+K W KLFSEAGF DYKIT  LGLRS+
Sbjct  300   KSLQKGDDDHEAIETQLFYDMGAMVLVKGRQRNEKDWAKLFSEAGFCDYKITAVLGLRSI  359

Query  1118  IEVF  1129
             IEV+
Sbjct  360   IEVY  363



>ref|XP_010110664.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXC27579.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=377

 Score =   345 bits (884),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 170/364 (47%), Positives = 242/364 (66%), Gaps = 15/364 (4%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSK---A  247
             E L+A+AH WN   ++I+S +LKCA+QLGIPD IH+H KPM LS LI+ALPIH +K   +
Sbjct  17    EQLKAQAHIWNQIFNFINSMSLKCAIQLGIPDAIHSHGKPMTLSQLISALPIHQNKKLDS  76

Query  248   PYIHRLTRFLVHSSVLLVTKSGGDEEQ-EECYSLTPVGRLLVKEEAINLRAFLNICNEYV  424
               I+RL R LV+SS   + +  G+ +Q E+ Y LT   +LLV++   +L   L    + +
Sbjct  77    HLIYRLMRILVNSSFFSLQEVVGETDQLEDGYVLTNSSKLLVRDNPFSLTPILLTVLDPI  136

Query  425   FQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNG  604
               K  +++  W Q+DDP+PF T HG + WDY   +P + +VFNEA A D+ L++ VL + 
Sbjct  137   MTKPWHSISTWLQSDDPTPFATTHGMEFWDYTVRDPRFGNVFNEAMASDARLVVSVLFD-  195

Query  605   ESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAG  784
             +   VF+GL+SLVD+AGG G V  AIA  FP ++C V DLPHVIA +      N++FV G
Sbjct  196   KRISVFEGLESLVDLAGGTGTVGKAIADAFPHVECTVFDLPHVIADLQGST--NLKFVGG  253

Query  785   NMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIR-EEGGKVIIIDMVMEDPKRT  961
             +MF+ IP A+A+ +KWI+HDW DE+CVK+LK+C+ AI  +  + GKVI++DMV+ + +  
Sbjct  254   DMFDEIPPADAIFMKWILHDWSDEDCVKLLKRCKVAITCKGNKNGKVILVDMVIVEKQNN  313

Query  962   -------DAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLI  1120
                    D    + Q+  D L+M  +  +ER + +W KLFS+AGFS YKITP LG+RSLI
Sbjct  314   KDIGHDHDHQLYETQILFDMLMMVSFPGRERKETEWAKLFSDAGFSTYKITPILGVRSLI  373

Query  1121  EVFP  1132
             EVFP
Sbjct  374   EVFP  377



>sp|Q8GSN1.1|MOMT_CATRO RecName: Full=Myricetin O-methyltransferase; AltName: Full=CrOMT2; 
AltName: Full=Flavonoid O-methyltransferase [Catharanthus 
roseus]
 gb|AAM97497.1| flavonoid O-methyltransferase [Catharanthus roseus]
Length=348

 Score =   344 bits (882),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 174/353 (49%), Positives = 238/353 (67%), Gaps = 12/353 (3%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYI  256
             E+  A+AH +    S+   ++LKCAVQLGIPD IH+H KPM LS+L  +LPI+PSKAPYI
Sbjct  7     EIRNAQAHFFTQVFSFTSMSSLKCAVQLGIPDAIHSHGKPMALSDLTNSLPINPSKAPYI  66

Query  257   HRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQKS  436
             +RL R LV +           EE++  YSLTP  RLL+K + +N  + +   N+    K+
Sbjct  67    YRLMRILVAAGYF-------SEEEKNVYSLTPFTRLLLKNDPLNSISMVLGVNQIAELKA  119

Query  437   CYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESKR  616
               A+ +WFQN+D + F TAHG+  WD+   E  Y   F+   A DS L+ ++L+  E   
Sbjct  120   WNAMSEWFQNEDLTAFETAHGKNFWDF-GAEDKYGKNFDGVMAADSILVSKMLI-PEFNY  177

Query  617   VFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMFE  796
             +F+GL SLVDV GG G +A AIAK FP +KC V DLPHV+A++ +   EN+EFV G+MFE
Sbjct  178   LFEGLDSLVDVGGGTGTIAKAIAKSFPDLKCTVFDLPHVVANLES--TENLEFVGGDMFE  235

Query  797   SIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKR-TDAYY  973
              IP+ANA+LLKWI+HDW+DEECVK+LK CR+AIP +E+GGKVI+I+ V+ D K+  +   
Sbjct  236   KIPSANAILLKWILHDWKDEECVKVLKMCRKAIPEKEKGGKVILIETVLMDSKKHENEEA  295

Query  974   NKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              KAQ+  D  +M  + +KER +++W  LF EAGFS YKI P +  RS IEV+P
Sbjct  296   VKAQISSDIDMMVFFTAKERTEEEWATLFREAGFSGYKIFPMIDFRSPIEVYP  348



>ref|XP_002278092.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=361

 Score =   343 bits (880),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 174/362 (48%), Positives = 244/362 (67%), Gaps = 9/362 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             +G+   EL QA++H + H  ++I+S ALKCAV+LGIPD IH H  P+ L  L++AL + P
Sbjct  5     HGEGGSELFQAQSHMYKHIFNFINSMALKCAVELGIPDIIHTHNHPISLPQLVSALHLPP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTK-SGGDEEQEECYSLTPVGRLLVKEE---AINLRAFLN  406
             +K  Y++RL R LVHS      K     EE++E Y LT   RLL+ ++     NL AF+ 
Sbjct  65    TKTRYVNRLMRVLVHSGFFATAKVHENQEEEDEGYVLTTSSRLLLSKDNNNVPNLSAFVL  124

Query  407   ICNEYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIM  586
                + V     + LGDWF+ +D + F TAHG+  WDY SH+  + ++FNEA A DS ++ 
Sbjct  125   AMLDPVLVTPWHFLGDWFRGNDLTAFDTAHGKSFWDYGSHDHKFFNLFNEAMASDSRMMS  184

Query  587   EVLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIEN  766
              V+   + + VF+GL SLVDV GG G +A  I++ FP +KC V DLPHV+++ P     N
Sbjct  185   LVI--KDCRPVFEGLGSLVDVGGGKGLIARIISEAFPQLKCTVFDLPHVVSNFPECG--N  240

Query  767   MEFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVME  946
             +++V G+MF+S+P A+A+LLK ++H   DEECVKILKKCREAIP +E+GGKVI+ID+V+ 
Sbjct  241   LKYVGGDMFQSVPTADAILLKLVLHSLSDEECVKILKKCREAIPSKEKGGKVIVIDIVIN  300

Query  947   DPKRTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEV  1126
             + K+ +    +A+L  D L+M +   +ERN+K+WEKLF EAGFS YKI P  GLRSLIEV
Sbjct  301   E-KKEEHDITEAKLLFDLLMMTVVTGRERNEKEWEKLFLEAGFSHYKINPIFGLRSLIEV  359

Query  1127  FP  1132
             FP
Sbjct  360   FP  361



>ref|XP_003615973.1| O-methyltransferase [Medicago truncatula]
 gb|AES98931.1| orcinol O-methyltransferase [Medicago truncatula]
Length=363

 Score =   342 bits (878),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 166/353 (47%), Positives = 233/353 (66%), Gaps = 5/353 (1%)
 Frame = +2

Query  80    LLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYIH  259
             LL+A++H WNH  ++I+S +LKC V LGIPD IHNH KPMP+S LI++LPIHPSK P IH
Sbjct  14    LLKAQSHVWNHIFNFINSMSLKCVVDLGIPDIIHNHGKPMPISKLISSLPIHPSKKPCIH  73

Query  260   RLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQKSC  439
             RL R + HS          +E + E Y LT   RLL+K+  +++  F+    + V     
Sbjct  74    RLMRIMTHSGFFSQQNIAANEPEIE-YMLTDASRLLLKDNPMSVTPFVYAMLDPVMMNPW  132

Query  440   YALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESKRV  619
             +    W +NDD + F T HG  +W+Y + +  +N++FNE+ A D++L+  +L+  + K V
Sbjct  133   HQFSMWLKNDDTTSFETTHGMLLWEYAACDSKFNNLFNESMANDAQLVSNLLVE-KCKGV  191

Query  620   FDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMFES  799
             F+  +SLVDV GG G +A   AK FP M+CIV DLPHV+  +     EN+ +V G+MF+ 
Sbjct  192   FNEFESLVDVGGGTGTMAKTFAKSFPQMECIVFDLPHVVDGLQGS--ENLSYVGGDMFKE  249

Query  800   IPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAYYNK  979
             IP  +A+LLKWI+HDW DEECVKILK C++AI  + + GKV+IIDMV++  K  +    +
Sbjct  250   IPPTDAILLKWILHDWNDEECVKILKNCKDAISKKGKEGKVVIIDMVLDCEKGDNNESVE  309

Query  980   AQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVF-PK  1135
              +L+ D L+M     KER KK+W KL S AGF DYKITP LGLR++IE++ PK
Sbjct  310   TKLFFDMLMMVTLTGKERTKKEWVKLISSAGFCDYKITPILGLRAVIEIYTPK  362



>ref|XP_011085377.1| PREDICTED: chavicol O-methyltransferase-like [Sesamum indicum]
Length=368

 Score =   342 bits (877),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 172/366 (47%), Positives = 245/366 (67%), Gaps = 9/366 (2%)
 Frame = +2

Query  41    RSIMAENGKLHGE-LLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLI  217
             R +  + G++  E LL  +AH WNH  S+I+S +LKCA++LGIPD IHNHAKPM LS L+
Sbjct  10    RDMAFQIGEMSAEQLLDGQAHVWNHLFSFINSMSLKCAIELGIPDIIHNHAKPMSLSQLV  69

Query  218   AALPIHPSKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRA  397
              ALPI   K+ +++RL R L+HS    V     DEE++E Y LTP   LL++   +++  
Sbjct  70    DALPIPKVKSHFVYRLMRLLIHSE-FFVKVDVSDEEEKEHYWLTPASLLLLRNAPLSVAP  128

Query  398   FLNICNEYVFQKSCYALGDWFQND-DPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDS  574
              + +  +    +    L +W  +    SP+   HG+ +++++  +P  N+++N+AT+ DS
Sbjct  129   LVQLILDPNMTEPLDHLSEWLASQRHTSPYELVHGKVLFEHLGLQPGLNNLYNDATSSDS  188

Query  575   ELIMEVLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAG  754
              L+  VL+  + K++F+G+KSLVDV GG G  A AIA  FP MKCIVLDLPHV+  +   
Sbjct  189   RLLTHVLVR-DCKQIFEGIKSLVDVGGGTGTTAKAIADAFPDMKCIVLDLPHVVGGLEGT  247

Query  755   NIENMEFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIID  934
             N  N  +VAG+MFE+IP+A+AV LKWI+HDW DE+CVKILKKC+EAI +  EGGKVIIID
Sbjct  248   N--NFTYVAGDMFENIPSADAVFLKWILHDWNDEDCVKILKKCKEAIAV--EGGKVIIID  303

Query  935   MVMEDPKRTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRS  1114
             MV+ D   TD+   +  L +D  V+  Y  KER +K++ KL  +AGF+ YKITP  G+RS
Sbjct  304   MVL-DVHGTDSGVRETHLLLDMAVLGYYNGKERTEKEFAKLLFDAGFTSYKITPAFGMRS  362

Query  1115  LIEVFP  1132
             LIE++P
Sbjct  363   LIEIYP  368



>ref|XP_009593020.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=361

 Score =   342 bits (876),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 171/358 (48%), Positives = 239/358 (67%), Gaps = 11/358 (3%)
 Frame = +2

Query  71    HGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALP-IHPSKA  247
             H +LLQAEA TW+H LS++  + ++CAV+L IPD +  H   M +S+L+A+LP ++PSK 
Sbjct  11    HEQLLQAEALTWDHILSFVRPSCIRCAVELRIPDILRKHG-IMTISDLVASLPNLNPSKI  69

Query  248   PYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVF  427
              ++  L R LVHS +L        +++ + YSLT  G LLV+ E  + R+        V 
Sbjct  70    SFLPVLMRILVHSGLL------NYQKEVDGYSLTTAGSLLVENEPFSKRSHFLFSQNPVS  123

Query  428   QKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGE  607
              K   +L  W Q+D P+ F T +G+ +WDY + EP +  +FN+A A DS+LI  + +N E
Sbjct  124   LKPFSSLSHWLQDDLPTAFDTTYGKSMWDYCADEPKFGSIFNDAMASDSKLISHLFINSE  183

Query  608   S-KRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAG  784
               K VF+GL SLVDV GG G +  AIA  FP + CIV DLPHVI         N+EFVAG
Sbjct  184   QYKHVFEGLTSLVDVGGGTGTLGMAIANAFPRLNCIVFDLPHVIGDRKGITTGNLEFVAG  243

Query  785   NMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMED--PKR  958
             +MF++IP ANA+LLK+I+H+W DE+CVK+LKKCRE+IP +E+GGKV++ID+VMED     
Sbjct  244   SMFDNIPYANAILLKFILHNWSDEDCVKLLKKCRESIPSKEKGGKVMVIDIVMEDYSSNN  303

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              +    + Q +MD ++   YG+KER K +WEKLF +AGFSDYKIT   G+RSLIE++P
Sbjct  304   INEQLVQVQHFMDVIMRISYGAKERTKTEWEKLFLDAGFSDYKITANFGMRSLIEIYP  361



>ref|XP_002522501.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF39801.1| o-methyltransferase, putative [Ricinus communis]
Length=359

 Score =   340 bits (873),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 171/354 (48%), Positives = 241/354 (68%), Gaps = 7/354 (2%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYI  256
             ELLQA+ H +NH  +YI+S  LKCAVQLGIPD IH H KP+ L  L++AL IHP+K  ++
Sbjct  11    ELLQAQLHVYNHIFNYINSMCLKCAVQLGIPDIIHKHGKPITLPELVSALHIHPTKINFM  70

Query  257   HRLTRFLVHSSVLLVTKSG-GDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQK  433
             +RL R LVHS    +TK+  G EE +E Y LTP  +LLVK+    L+ F++   +  F  
Sbjct  71    YRLMRMLVHSGFFSITKAANGQEEGQEVYVLTPSSKLLVKDNPNCLKPFVDSLLKPDFVT  130

Query  434   SCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESK  613
               + LGDWF+ ++ + F  AHG   W+Y    P +N +FNEA A DS ++  V+   + K
Sbjct  131   PGHVLGDWFRGNELTVFQRAHGMAFWEYNERNPEFNQLFNEAMASDSRMMNLVIR--DCK  188

Query  614   RVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMF  793
              +F+G+ SLVDV GGNG++A  I++ FP MKC VL+LP VI ++     +N+ +V G+MF
Sbjct  189   PIFEGVNSLVDVGGGNGSLARIISEAFPDMKCTVLELPQVIGNLEG--TKNLNYVGGDMF  246

Query  794   ESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGG-KVIIIDMVMEDPKRTDAY  970
             + IP+A+A++LK I+H W DEECVKILKKC+EAI    +G  KVI+ID+V+ D K+ +  
Sbjct  247   QHIPSADAIILKLILHGWNDEECVKILKKCKEAISSTGKGSEKVIVIDLVIND-KKDEYE  305

Query  971   YNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
             + + +L  D L+M +   KER +K+W +LF +AGFS +KITP LGLRSLIEV+P
Sbjct  306   FTETKLLFDMLMMFVATGKERTEKEWGELFLKAGFSHFKITPILGLRSLIEVYP  359



>ref|XP_002278208.2| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=369

 Score =   341 bits (874),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 178/359 (50%), Positives = 238/359 (66%), Gaps = 6/359 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             +G+  GEL QA++H + H  S+++S AL+CAVQLGIPD IHNHA P  L  L++AL I P
Sbjct  16    HGEGAGELFQAQSHMYKHICSFMNSMALRCAVQLGIPDIIHNHAHPTTLPQLVSALHIPP  75

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAI-NLRAFLNICN  415
             +KA  +HRL R LVHS    + K   + E+EE Y LTP  RLL+K+    NL   +    
Sbjct  76    TKASCVHRLMRLLVHSGFFAMAKVH-EHEEEEGYILTPSSRLLLKDNPTSNLSPLVLTML  134

Query  416   EYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVL  595
               V     +  GDW + DD + F TAHG   WD+ SH P   ++FNE  A DS++ M V+
Sbjct  135   HPVLVTPWHFFGDWLRGDDLTAFETAHGVSFWDHGSHNPEIFNLFNEGMASDSQM-MSVV  193

Query  596   LNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEF  775
                E K VF+GL SLVD+ GG G +A  I++ FP +KC V DLPHV+A++P     N+E+
Sbjct  194   NFRELKPVFEGLSSLVDLGGGTGLLARIISEAFPQLKCTVFDLPHVVANLPESR--NLEY  251

Query  776   VAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPK  955
             V G+MF+S+P+A+A+LLK ++HDW DE+C+KILKKCREAI   EEGGKVIIID+V+ + K
Sbjct  252   VGGDMFQSVPSADAILLKCVLHDWSDEDCLKILKKCREAIRSEEEGGKVIIIDVVINEKK  311

Query  956   RTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
               D       L    ++  + G +ERN+K+WEKLF EAGF  +KI+P  GLRSLIEVFP
Sbjct  312   DEDDITETKLLMDMMMMTLVNG-RERNEKEWEKLFLEAGFRHHKISPIFGLRSLIEVFP  369



>ref|XP_011100233.1| PREDICTED: 8-hydroxyquercetin 8-O-methyltransferase-like [Sesamum 
indicum]
Length=359

 Score =   340 bits (873),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 166/353 (47%), Positives = 234/353 (66%), Gaps = 7/353 (2%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYI  256
             ELL A++H WNH  ++++S +LKC +QLGIPD I  H KPM LS L  +L ++ +K+P +
Sbjct  13    ELLDAQSHVWNHLFNFVNSMSLKCVIQLGIPDIILKHGKPMTLSELTHSLHLNDAKSPSL  72

Query  257   HRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQKS  436
              RL R ++HS   +  K    EE E  Y LTP   LL+++E +++R F     + +    
Sbjct  73    ERLMRIMIHSKFFINVKISQVEESE-GYWLTPASHLLLRDEPLSVRPFALGMLDPILTDP  131

Query  437   CYALGDWFQND-DPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESK  613
              + L +WF+ D D +PF T HG  +W++   +P  N++FNE  A DSEL+  V+   + +
Sbjct  132   WHHLSEWFKTDGDLTPFLTTHGRTLWEHAGQDPRLNELFNEGMASDSELVATVI-TKDCR  190

Query  614   RVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMF  793
              VF+GLKS+VDV GG G VA AIA  F  + C+VLDLPHV+A       E++ FVAG+MF
Sbjct  191   NVFEGLKSMVDVGGGTGTVAKAIADAFTGLNCVVLDLPHVVAGCEG--TESLTFVAGDMF  248

Query  794   ESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAYY  973
             + IP A+AV +KWI+HDW DE+C+KILKKC++AI  +++GGKVII+DMV++  K   A  
Sbjct  249   DYIPPADAVFMKWILHDWPDEQCLKILKKCKQAISNKDKGGKVIIVDMVVDFKKEHKAI-  307

Query  974   NKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              + QL+ D L++ L    ER +K W KLFS AGF+ YKITP  GLRSLIE+FP
Sbjct  308   -ETQLFFDMLMINLTSGIERTEKDWAKLFSAAGFTSYKITPAFGLRSLIELFP  359



>ref|XP_003607523.1| O-methyltransferase [Medicago truncatula]
Length=370

 Score =   340 bits (873),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 174/354 (49%), Positives = 239/354 (68%), Gaps = 10/354 (3%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYI  256
             +LLQA+   +NH  S+I+S +LKCA++L IPD IHN+ +P+PLS LI+ LPIHPSK   I
Sbjct  25    KLLQAQTQVFNHIFSFINSMSLKCAIELCIPDVIHNYGQPIPLSKLISLLPIHPSKTGDI  84

Query  257   HRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQKS  436
             HRL R L HS    V+K+    + E  Y L    RLL+K+   ++ + L++    +  K 
Sbjct  85    HRLMRVLTHSGFFNVSKN----DLEVMYELNDASRLLLKDHPFSMTSLLHVILGPILSKP  140

Query  437   CYALGDWFQNDDPSPFCTA-HGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESK  613
              Y L +W++NDDPSPF T  +G   WDY  H+P +N++FNEA A ++ L   V++ G+ K
Sbjct  141   WYQLSNWYKNDDPSPFHTENNGVAFWDYAGHDPNHNNLFNEAMACETRLASSVVM-GKCK  199

Query  614   RVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMF  793
              VF+GL+SLVDV GG G +   IAK FP ++CIV DLPHV+  +     EN+++V G+MF
Sbjct  200   GVFEGLESLVDVGGGIGTITKVIAKSFPNIECIVFDLPHVVDGLQGS--ENLKYVGGDMF  257

Query  794   ESIPAANAVLLK-WIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAY  970
             E+IP  +++LLK  ++HDW DEEC+KILKKC+EAI  + + GKVIIID VM + K  D  
Sbjct  258   EAIPPTHSILLKVGVLHDWNDEECLKILKKCKEAIGNKGKEGKVIIIDAVMGNEKE-DNE  316

Query  971   YNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
               +AQL+ D  +M L   KERN+K+W  LF  AGFS+YKIT  LG +SLIEVFP
Sbjct  317   SIEAQLFYDLEMMVLVNGKERNEKEWSNLFLSAGFSNYKITHGLGFKSLIEVFP  370



>emb|CAN70493.1| hypothetical protein VITISV_002330 [Vitis vinifera]
Length=363

 Score =   340 bits (872),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 172/362 (48%), Positives = 227/362 (63%), Gaps = 7/362 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG    ELLQA+ H WNH  ++I+S +LKCA+QLGIPD IHNH +PM L  L+A LP+ P
Sbjct  5     NGGRSSELLQAQTHVWNHIFNFINSMSLKCAIQLGIPDIIHNHCQPMTLHELVAKLPVRP  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             +K   +HRL R LVHS    + +   +   EE Y L    RLL+K+  ++   FL    +
Sbjct  65    NKTLCVHRLMRILVHSGFFTMQRV-QESADEEGYXLANASRLLLKDHPLSATPFLLAMLD  123

Query  419   YVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLL  598
                 +  + +  WFQNDDP+PF TAHG  IWDY  HEP +N+ FNEA A D+ L+  VL+
Sbjct  124   PDLTEPWHYVSAWFQNDDPTPFFTAHGRTIWDYGCHEPRFNNFFNEAMASDARLVTSVLI  183

Query  599   NGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAG---NIENM  769
               E K  F+GL S VDV GG G VA  I   FP +   VLDLPHV+A +      ++   
Sbjct  184   K-ECKGAFEGLNSFVDVGGGTGTVAKTIVXAFPHLHSTVLDLPHVVADLQGXKXLDLPRR  242

Query  770   EFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMED  949
              +V GN          +  +WI+HDW DEEC+KILK+CR AIP +E+GGKV+IIDM + +
Sbjct  243   GYVRGNSSCGCHFTEGI-TQWILHDWSDEECLKILKQCRXAIPSKEKGGKVMIIDMAIXN  301

Query  950   PK-RTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEV  1126
              K   D    + QL+ D L+M L   +ER +K+W+KLF ++GFS YKITP LGLRSLIEV
Sbjct  302   KKGDDDESXVETQLFXDMLMMVLXPGREREEKEWKKLFLDSGFSGYKITPILGLRSLIEV  361

Query  1127  FP  1132
             +P
Sbjct  362   YP  363



>ref|XP_003615967.1| O-methyltransferase [Medicago truncatula]
 gb|AES98925.1| orcinol O-methyltransferase [Medicago truncatula]
Length=359

 Score =   340 bits (872),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 163/351 (46%), Positives = 234/351 (67%), Gaps = 4/351 (1%)
 Frame = +2

Query  80    LLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYIH  259
             LL+A++H WNH  ++I+S +LKC V LGIPD IHN+ KP+PLS LI++L IHPSK   IH
Sbjct  13    LLKAQSHVWNHMFNFINSMSLKCVVDLGIPDIIHNYGKPIPLSKLISSLSIHPSKNHGIH  72

Query  260   RLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQKSC  439
             RL R + HS         G+E + E Y LT   +LL+K+  +++  +++     V     
Sbjct  73    RLMRIMTHSGFFSQKNVIGNELEIE-YMLTDASKLLLKDNPMSVAPYVHAMVNPVMMNPW  131

Query  440   YALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESKRV  619
             Y    W +NDD + F T HG   W+Y + +   N++FNE+ A D+ L+ ++L+  + K V
Sbjct  132   YQFSTWLKNDDTNTFETTHGMSTWEYAARDSEINNLFNESMANDTRLVSDLLVE-KCKGV  190

Query  620   FDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMFES  799
             F+ ++SLVDV GG G +A  + K FP M+CIV DLPHV+  +     E + +V G+MF+ 
Sbjct  191   FNEVESLVDVGGGTGTMAKTLVKSFPQMECIVFDLPHVVDGLQGS--EKLRYVGGDMFKE  248

Query  800   IPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAYYNK  979
             IP A+A+LLKWI+HDW DE+C+KILK C++AI  + + GKV+IIDMV++  K  +    +
Sbjct  249   IPPADAILLKWILHDWNDEQCLKILKNCKDAISKKGKEGKVVIIDMVLDCEKGDNNESVE  308

Query  980   AQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              QL+ D L+MAL   KERN+K+W KL S AGF+DYKITP LGLRS+IE++P
Sbjct  309   TQLFFDMLMMALLTGKERNEKEWMKLISLAGFNDYKITPILGLRSMIEIYP  359



>ref|XP_006446725.1| hypothetical protein CICLE_v10015630mg [Citrus clementina]
 gb|ESR59965.1| hypothetical protein CICLE_v10015630mg [Citrus clementina]
Length=377

 Score =   340 bits (873),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 178/360 (49%), Positives = 238/360 (66%), Gaps = 10/360 (3%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYI  256
             ELL+A+A  WN + SYI+S +LKCAV+LGIPD IH H +PM LS + +AL I  +KA  I
Sbjct  20    ELLKAQAQVWNCAFSYINSMSLKCAVELGIPDVIHKHGQPMTLSQIASALDIQKNKAHCI  79

Query  257   HRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQKS  436
              RL R LVHS           +E E  YSLTP  RLL+K+E +    F+ +    +    
Sbjct  80    QRLMRILVHSGFFAQQNKIDKDESEVYYSLTPASRLLLKDEPLRAAPFMFLITHPIITTP  139

Query  437   CYALGDWFQNDDPSP---FCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGE  607
                L  WF+NDDPS    F + HG+ IW  ++ E  + +VF +A   DS+ I  VL+  +
Sbjct  140   FNFLSSWFKNDDPSTPTVFESTHGKDIWGCLAQEAKFKNVFYDAMMTDSQFISSVLIK-D  198

Query  608   SKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIAS---VPAGNIENMEFV  778
              K VF GLK LVD+ GG G +A AIA+ FP MKCIV DLPHV+ +      G  +N+EF+
Sbjct  199   CKVVFKGLKCLVDLGGGTGTMAKAIAEAFPEMKCIVFDLPHVVDNNLQQQQGTNKNLEFL  258

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIP-IREEGGKVIIIDMVMEDPK  955
              G+MFE+IP A+AVLLKW++H+W DEE VKILKKC+EAI   +++GGKVI+IDMV+ED +
Sbjct  259   GGDMFEAIPPADAVLLKWVLHNWGDEESVKILKKCKEAIDGSKDKGGKVIVIDMVIED-Q  317

Query  956   RTDAYYNKAQLYMDFLVMALYG-SKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
               D    + QL  D L+M+L+  +KER+ K+W+KLF EAGFS Y +  TLGLRSLIE++P
Sbjct  318   SIDKDSTETQLCSDMLMMSLFSVAKERSIKEWKKLFLEAGFSHYNVNSTLGLRSLIELYP  377



>ref|XP_004303135.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=365

 Score =   340 bits (872),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 174/353 (49%), Positives = 237/353 (67%), Gaps = 10/353 (3%)
 Frame = +2

Query  80    LLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYIH  259
             ++Q++ H  NH L  ++S  L CA+QLGIPD IHNHA+P+ LS+L +AL +HPSK+ +++
Sbjct  21    IVQSQLHVRNHILQLMNSMVLNCAIQLGIPDIIHNHAQPITLSDLTSALNVHPSKSRFLY  80

Query  260   RLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQKSC  439
             RL   LV       TK   D      YSLTP  +LL+K+  +     L +  + +     
Sbjct  81    RLMCILVQQGFF--TKHN-DVHHGIVYSLTPSSKLLLKDGLMTTFLLLLL--DPLLTSPW  135

Query  440   YALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESKRV  619
             + LG WFQN   +PF  AHG   +D ++HEPV+ ++FNEA   DS+L+   ++  E + V
Sbjct  136   HLLGTWFQNCASTPFEMAHGMSFFDLVAHEPVFGNMFNEAMVADSKLVSRAVVK-ECQGV  194

Query  620   FDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMFES  799
             F+GLKSLVDV GG G +ASAIA  FP +KC VLDLPHVI ++   N  N++F+ GNMFE 
Sbjct  195   FEGLKSLVDVGGGKGTMASAIADAFPQIKCTVLDLPHVIENLKGSN--NLDFIGGNMFEQ  252

Query  800   IPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMV--MEDPKRTDAYY  973
             IP ANA+LLKWI+HDW DEE V+ILK+CR+AIP + +GGKVIII+MV  ++D K+ +   
Sbjct  253   IPPANAILLKWILHDWNDEESVEILKRCRDAIPSKSDGGKVIIIEMVVTVDDDKKMNNKS  312

Query  974   NKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              + QL+ D L+M     +ER +K WEKLF  AGFS YKIT TLG+RS IEV+P
Sbjct  313   TETQLFWDMLMMVCLTGRERTEKDWEKLFLAAGFSHYKITHTLGIRSFIEVYP  365



>gb|KDP24062.1| hypothetical protein JCGZ_25719 [Jatropha curcas]
Length=358

 Score =   340 bits (871),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 177/362 (49%), Positives = 236/362 (65%), Gaps = 12/362 (3%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG+   ELL+A AH WNH+ +++ S +LKCA++LGIPD IH+H +PM LS+L++AL I  
Sbjct  5     NGESTNELLRAHAHIWNHTFNFVKSMSLKCAIELGIPDIIHSHGQPMTLSDLVSALKIPQ  64

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             SK+ +IHRL + LV S    + K       E  Y LT    LLVKE  +  R ++    +
Sbjct  65    SKSHHIHRLMQVLVQSGFFSLQKVS----DENGYLLTQSSLLLVKEHPVTARPYVLAVLD  120

Query  419   YVFQKSCYALGDWFQNDD---PSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIME  589
              +  K  + L  WFQN D    +PF  AH +K WD  S+E  +N  FNEA A DS ++ +
Sbjct  121   PILTKPWHFLSSWFQNTDDKETTPFSVAHEQKFWDLASNEDRFNKFFNEAMASDSSIVKQ  180

Query  590   VLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENM  769
             V+++   K VF GLKSLVDV G  GA+  AIA+ FP +KC VLDLPHV+A +     +N+
Sbjct  181   VVISN-CKEVFKGLKSLVDVGGNTGAMTKAIAETFPNLKCTVLDLPHVVAGLKG--TKNL  237

Query  770   EFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEG-GKVIIIDMVME  946
              ++ GNMFE IP A+A+LLK I H  +DE+C+K+LKKC+EA+   EEG GKVIIID+VME
Sbjct  238   NYIGGNMFEFIPPADAILLKMICHILDDEDCLKLLKKCKEAVMNNEEGSGKVIIIDIVME  297

Query  947   DPKRTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEV  1126
              P   D      QLY D  ++ L   +ERN+K W KLF +AGFS+YKI P LGLRS+IEV
Sbjct  298   SPNWVDKATETIQLY-DLEMLVLVSGQERNEKDWAKLFFDAGFSNYKINPVLGLRSIIEV  356

Query  1127  FP  1132
             FP
Sbjct  357   FP  358



>emb|CDP17644.1| unnamed protein product [Coffea canephora]
Length=347

 Score =   338 bits (868),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 170/364 (47%), Positives = 232/364 (64%), Gaps = 25/364 (7%)
 Frame = +2

Query  50    MAENGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALP  229
              A NG   GEL QA+AH WNH  ++I+S +LKCA+QLGIPD IH H +PM L+ LI ALP
Sbjct  3     FARNGDHTGELFQAQAHIWNHLFNFINSMSLKCAIQLGIPDIIHKHGQPMALAQLIDALP  62

Query  230   IHPSKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNI  409
             I+ +KA +++RL R L+HS   +  K   +E  E    +TP               FL  
Sbjct  63    INNAKAHFVYRLMRILIHSGFFIKAKMPDNEGHE---GVTP---------------FLLA  104

Query  410   CNEYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIME  589
               + +     +    WFQ+++ +PF + HG  +W+    +P  N  FNE  A D+ L+  
Sbjct  105   MLDPILTDPWHHFSQWFQDNEETPFHSCHGTSMWELAGRQPRLNQFFNEGMASDARLVCT  164

Query  590   VLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENM  769
             +++    K VF GL SL+DV GG G VA AIA  FP +KC VLDLPHV+    +   +N+
Sbjct  165   MVIK-NCKDVFMGLNSLIDVGGGTGTVAKAIADAFPHLKCSVLDLPHVVDGSESS--KNL  221

Query  770   EFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMED  949
              +V G+MFE+IP ++AVLLKWI+HDW DEECV+IL+KC+EAIP +E+GGKVIIIDM+++ 
Sbjct  222   AYVGGDMFEAIPPSDAVLLKWILHDWSDEECVQILRKCKEAIPSKEKGGKVIIIDMLLKS  281

Query  950   PKRTDAYYN----KAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSL  1117
              +  D   N    + QL+ D L+M L   +ERN+K W KLF EAGF+ YKITP LGLRS+
Sbjct  282   RQNGDDDDNAEAIETQLFFDMLMMVLVKGRERNEKDWAKLFFEAGFNGYKITPVLGLRSI  341

Query  1118  IEVF  1129
             IEV+
Sbjct  342   IEVY  345



>ref|XP_004248183.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
lycopersicum]
Length=362

 Score =   339 bits (869),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 177/360 (49%), Positives = 231/360 (64%), Gaps = 7/360 (2%)
 Frame = +2

Query  62    GKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPS  241
             G+   E+L A+ H WNH  S+I+S +LK A+QL IPD IH H KPM L  L  AL I+ S
Sbjct  7     GEHETEILHAQTHIWNHIFSFINSMSLKSAIQLNIPDIIHKHGKPMTLDELANALSINHS  66

Query  242   KAPYIHRLTRFLVHSSVLL---VTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNIC  412
             K  ++ RL R LVHS   L             E  Y L P   LL+K+E + +  FL   
Sbjct  67    KITHLRRLMRILVHSGFFLKSVSGSGSESGSGEGGYVLAPPALLLLKDEPLTVTPFLLAM  126

Query  413   NEYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEV  592
              + +  K  + + +WF +D+P+ F  AHG   WDY  HEP  N  FN+A A D++L+M V
Sbjct  127   LDPILVKPWHHVSEWFTSDEPTAFEVAHGRTFWDYAGHEPRLNHFFNDAMASDAKLVMSV  186

Query  593   LLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENME  772
             ++   SK VF+GL S+VDV GG G VA  IAK FP ++C V DLPHV+  +   +  N+ 
Sbjct  187   VMK-YSKDVFEGLNSIVDVGGGTGTVAKTIAKTFPNLQCTVFDLPHVVEGLEGSD--NLT  243

Query  773   FVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDP  952
             +V G+ F SIP A A+LLKWI+HDW DEE VKILKKC+EAIP +E+GGKVIIIDM M D 
Sbjct  244   YVGGDFFVSIPHAEALLLKWILHDWSDEESVKILKKCKEAIPSKEKGGKVIIIDM-MVDN  302

Query  953   KRTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
             K  D    + Q++ D L+M L   +ER+++ W K+FSEAGFSDYK+TP LGLRSLIEV+P
Sbjct  303   KIGDDESIETQIFFDMLMMVLVTGRERSERGWAKIFSEAGFSDYKVTPILGLRSLIEVYP  362



>ref|XP_006469138.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=551

 Score =   345 bits (885),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 174/360 (48%), Positives = 240/360 (67%), Gaps = 9/360 (3%)
 Frame = +2

Query  53    AENGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPI  232
              EN     ELL+A+A  WN + +Y++S +LKCAV+L I D IH+H +P  LS + +AL I
Sbjct  201   GENAASSSELLKAQAQVWNCTFNYVNSMSLKCAVELDIADIIHSHGQPTTLSQIASALNI  260

Query  233   HPSKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNIC  412
              P+K   I  + R LVHS      K   D+E    Y LTP  RLL+K+  +    F+++ 
Sbjct  261   KPNKVQCIQSVMRILVHSGFFAQQKD--DDE----YFLTPASRLLLKDTPLKAAPFVDLV  314

Query  413   NEYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEV  592
              + ++  + + LG W QNDDP+ F TAHG+  WD ++ EP +  +F +    DSELI  +
Sbjct  315   ADPLYTTAFHYLGTWLQNDDPTLFETAHGKNFWDRVADEPKFKSLFYDLMITDSELIARI  374

Query  593   LLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENME  772
             ++  + K VF+GLKSLVDVAGG G +A AIA  FP +KC V DLPHV+ ++   N +N++
Sbjct  375   VIK-DCKEVFEGLKSLVDVAGGTGTMARAIAAAFPDIKCTVFDLPHVVDNLQGTN-DNLD  432

Query  773   FVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDP  952
             F+ GNMFE+IP ANAVLLK I+H+W DEE VK+LKKC+EAIP ++EGGKVIIIDM +E+ 
Sbjct  433   FLGGNMFEAIPQANAVLLKGILHNWNDEESVKLLKKCKEAIPSKDEGGKVIIIDMAIENQ  492

Query  953   KRTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              + D    + QL  D L+++L+  KER+   W+KLF  AGFS YKITP LG+RSLIE +P
Sbjct  493   SQ-DKESMETQLCFDILMVSLFRGKERSVDDWKKLFLAAGFSHYKITPILGVRSLIEAYP  551



>ref|XP_003527405.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
1 [Glycine max]
 gb|KHN07776.1| 8-hydroxyquercetin 8-O-methyltransferase [Glycine soja]
Length=359

 Score =   338 bits (868),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 168/361 (47%), Positives = 242/361 (67%), Gaps = 7/361 (2%)
 Frame = +2

Query  56    ENGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIH  235
             +N   + +LL+A+ H ++ +  +I+S +LKCA+ L IPD IH + +PMPLS LIA+LPIH
Sbjct  4     DNEDHYAKLLRAQTHIFDQTFGFINSMSLKCAIDLCIPDVIHKYGQPMPLSQLIASLPIH  63

Query  236   PSKAPYIHRLTRFLVHSSVLLVTKSGGD--EEQEECYSLTPVGRLLVKEEAINLRAFLNI  409
             PSKA +I RL + L HS       +  +  E++E  Y LT   +LL+K+   ++ +   +
Sbjct  64    PSKACFIFRLMQILTHSGFFSQHNNATENYEQEEVSYVLTDASKLLLKDHHFSMISLPQV  123

Query  410   CNEYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIME  589
               + +     +    WF N+DP+PF T +G   WDY S EP  N +FN+A   DS LI  
Sbjct  124   ILDPILVNPWFQFSTWFTNEDPTPFHTQNGMAFWDYASSEPKLNHLFNDAMTNDSRLISS  183

Query  590   VLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENM  769
             VL+  + K VF GL+SLVDV GG G +A AIAK FP +KCIV DLPHV+  +     EN+
Sbjct  184   VLIE-KCKGVFSGLESLVDVGGGTGTMAKAIAKSFPQLKCIVFDLPHVVDGLQG--TENV  240

Query  770   EFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMED  949
             E+V G+MFE+IP+A++++LK IMH+W DEEC+KILK+C+EAI  +++ GKVIIID+V+ +
Sbjct  241   EYVHGDMFEAIPSADSIMLKTIMHNWNDEECLKILKRCKEAIANKDK-GKVIIIDVVIGN  299

Query  950   PKRTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVF  1129
              ++ D+  ++ +L+ D  +M L   KERN+K W KLF  AGF+ YKITP LG +SLIEV+
Sbjct  300   -EKGDSELDQTKLFYDIEMMVLVTGKERNEKDWAKLFLSAGFNSYKITPVLGFKSLIEVY  358

Query  1130  P  1132
             P
Sbjct  359   P  359



>ref|XP_002517832.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44350.1| o-methyltransferase, putative [Ricinus communis]
Length=362

 Score =   338 bits (868),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 166/352 (47%), Positives = 238/352 (68%), Gaps = 5/352 (1%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYI  256
             EL++A+ H WNH+  +I S +LKCAVQLGIPD I++H +PM LS L+  L +HP+K  ++
Sbjct  11    ELIKAQTHIWNHTFHFIKSMSLKCAVQLGIPDIINSHGQPMTLSELVLTLQVHPTKTDHL  70

Query  257   HRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQKS  436
             +RL R LVHS    + ++  D   +E Y LTP  RLL+K+ + + R F+++  + V  + 
Sbjct  71    YRLMRVLVHSGFFNL-QNASDNHSQEGYILTPASRLLLKDCSFDTRPFISLALDPVATEP  129

Query  437   CYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESKR  616
                L  + +NDDP+ F TA GE ++ Y  +E   N +FNE  A DS +I   ++  + K+
Sbjct  130   YNYLIPFLRNDDPTAFVTAFGETLFGYAGNEARINHLFNECMASDSSVIGRAVII-KCKK  188

Query  617   VFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMFE  796
             VF+G+ SLVDV GG G +A AI + FP +KC VLDLPHV+  +   N  N+ F+ G+MF+
Sbjct  189   VFEGVNSLVDVGGGTGNMAKAIGQTFPNLKCTVLDLPHVVDKLQGSN--NLSFLGGDMFQ  246

Query  797   SIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAYYN  976
             ++P A+A+LLKWI+HDW DEEC+KILK C+EA+  +  GGKV+IIDMVM +    D+   
Sbjct  247   AVPPADAILLKWILHDWPDEECIKILKNCKEAVSEKGTGGKVMIIDMVMGNQSWDDSLM-  305

Query  977   KAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
             +AQL  D  +MAL   KERN+++W+KLF +AGFS+YKI P LG R+LIE  P
Sbjct  306   EAQLCFDMQMMALLMGKERNEEEWKKLFFDAGFSNYKIYPVLGPRALIEFLP  357



>ref|XP_010097399.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXB67905.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=384

 Score =   339 bits (870),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 171/370 (46%), Positives = 245/370 (66%), Gaps = 21/370 (6%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSK---A  247
             EL++A+AH WN+  ++I+S +LKCAVQLGIPD IH+H KPM LS LI+ALPIH +K   +
Sbjct  18    ELVKAQAHIWNYIFNFINSMSLKCAVQLGIPDAIHSHGKPMTLSQLISALPIHQNKKSDS  77

Query  248   PYIHRLTRFLVHSSVLLVTK--SGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEY  421
               I+RL R LV+S   ++ +   G  +  EE Y LT   +LL+++  +++   L    + 
Sbjct  78    RLIYRLMRILVNSGFFVLQEVVVGETDLLEEGYVLTTASKLLLRDNPLSVTPLLLSMLDP  137

Query  422   VFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLN  601
             +  K  ++L  W Q+DDP+PF   HG  IWDY  ++P   ++FNEA A D+ L+  VL++
Sbjct  138   IMTKPWHSLSTWLQSDDPTPFAATHGMGIWDYNEYDPRLGNLFNEAMASDARLVTSVLID  197

Query  602   GESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVA  781
              + K V +GL+SLVD+AGG G VA AIA  FP + C V DLPHVIA +     +N++FV 
Sbjct  198   -KCKSVLEGLESLVDLAGGTGTVAKAIAYAFPHLACTVFDLPHVIADLQGS--KNLKFVG  254

Query  782   GNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIR-EEGGKVIIIDMVM-EDPK  955
             G+MF+ IP A+A+ +KWI+HDW DE+CVK+L++C+ AI  +  + GKVI++DMV+ E+  
Sbjct  255   GDMFDEIPPADAIFMKWILHDWSDEDCVKLLERCKVAITCKGNKNGKVILVDMVIVEEQN  314

Query  956   RTD-----------AYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
               D               + QL+ D L+M LY  +ER + +W KLFS+AGF+ YKITP L
Sbjct  315   NKDIGHDHHAHDHDHQSYETQLFFDMLMMVLYPGRERKETEWAKLFSDAGFNTYKITPIL  374

Query  1103  GLRSLIEVFP  1132
             G+RSLIEVFP
Sbjct  375   GVRSLIEVFP  384



>ref|XP_008229106.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=391

 Score =   339 bits (870),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 184/383 (48%), Positives = 236/383 (62%), Gaps = 34/383 (9%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYI  256
             ELLQA+AH WNH   +I+S +LKCAVQLGIPD IH+H +P+ LSNLI+ L +HPSKA +I
Sbjct  12    ELLQAQAHVWNHIFQFINSMSLKCAVQLGIPDVIHSHGQPISLSNLISGLNVHPSKAHFI  71

Query  257   HRLTRFLVHSSVL--------------------LVTKSGGDEEQEEC---YSLTPVGRLL  367
              RL R LVHS+                      +V +   DEE+E+    Y LTP  RLL
Sbjct  72    ARLMRILVHSNFFAQDQQVQLPLLPNDNNNNENIVHQDLDDEEEEKTVVVYRLTPASRLL  131

Query  368   VKEEAINLRAFLNICNEYVFQKSCYALGDWFQ------NDDP-SPFCTAHGEKIWDYISH  526
             +KE  ++   FL +  + V     + +G W Q       D P SPF  AHG   W   + 
Sbjct  132   LKESPLSTTQFLLMILDPVVTDPFHLMGTWCQMNNHGNQDHPASPFEMAHGRPFWGLAAQ  191

Query  527   EPVYNDVFNEATAKDSELIMEVLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMK  706
             +P +  +FNEA   DS+L+   ++  E + VF+GL SLVDV GG G +A AIAK FP + 
Sbjct  192   QPKFGSLFNEAMEADSQLLARAVVE-ECEGVFEGLNSLVDVGGGTGTMAKAIAKAFPNIN  250

Query  707   CIVLDLPHVIASVPAGNIENMEFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCR  886
             C V D PHV+A++      N++FV G+MFE IP ANA+ LKWI+HDW DEE VKILKK R
Sbjct  251   CTVFDQPHVVANLQG--THNLDFVGGDMFEKIPPANAIFLKWILHDWSDEESVKILKKSR  308

Query  887   EAIPIREEGGKVIIIDM-VMEDPKRTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFS  1063
             EAI  +  GGKVII+D+ V  D K+ D    + QL  D L+M     KER++ +WEKLF 
Sbjct  309   EAILSKNGGGKVIILDINVSVDNKKMDKKSIETQLMWDILMMVDLNGKERSEAEWEKLFL  368

Query  1064  EAGFSDYKITPTLGLRSLIEVFP  1132
              AGFS YKIT  LGLRSLIEV+P
Sbjct  369   TAGFSHYKITHILGLRSLIEVYP  391



>ref|XP_004232927.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
lycopersicum]
Length=360

 Score =   338 bits (867),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 171/356 (48%), Positives = 239/356 (67%), Gaps = 9/356 (3%)
 Frame = +2

Query  74    GELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPY  253
              EL +A+AH + H+ +Y +S AL CA+QLGIPD IHNH KP+ L +L++ L +  SK+  
Sbjct  11    NELFKAQAHIYKHAFAYANSMALNCAIQLGIPDIIHNHKKPITLPDLLSGLKLPSSKSNA  70

Query  254   IHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQK  433
             IHRL R LVH+    + K   + E  E Y LT   RLL+K E  NL   + +  + V   
Sbjct  71    IHRLMRLLVHAQFFDIIKLEENSET-EGYVLTTSSRLLLKSEIPNLLPCVRLMVDPVLVT  129

Query  434   SCYALGDWF-QNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGES  610
                 LG+WF +N++ +PF TAHG  +WD+ +  P+++  FNEA A DS+++   L+  + 
Sbjct  130   PWQLLGEWFHKNEEATPFETAHGMPMWDFCAQNPIFDTAFNEAMASDSQMMK--LVVKDC  187

Query  611   KRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNM  790
             + VF+GL SLVDV GG G +A  I +  P +KC VLDLPHV+A++P    EN+ +V GNM
Sbjct  188   REVFEGLNSLVDVGGGTGVIAKTILEAIPHLKCTVLDLPHVVANMP--QTENLIYVGGNM  245

Query  791   FESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEG--GKVIIIDMVMEDPKRTD  964
             F+ IP A+A+LLK +MHDW DE+CVKILK+CREAI  ++EG  GKV+IIDMV+   +  +
Sbjct  246   FQCIPHADAILLKHVMHDWSDEDCVKILKRCREAIEDKDEGRKGKVLIIDMVLGRDEE-E  304

Query  965   AYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
             A   + +L  D L+M +   ++R +K+WEKLF+EAGF  YKITP LGLRSLI+VFP
Sbjct  305   ANMTEVKLIFDVLMMVVTTGRQRTEKEWEKLFTEAGFMSYKITPLLGLRSLIQVFP  360



>ref|XP_004490687.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cicer 
arietinum]
Length=354

 Score =   338 bits (866),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 175/352 (50%), Positives = 239/352 (68%), Gaps = 7/352 (2%)
 Frame = +2

Query  80    LLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYIH  259
             LL+A++H WNH  ++I+S +LKC V LGIPD IHN+ KPMPLS LI++LPIHPSK P I+
Sbjct  9     LLKAQSHIWNHMCNFINSMSLKCVVDLGIPDIIHNYEKPMPLSVLISSLPIHPSKIPCIY  68

Query  260   RLTRFLVHSSVLLVTKSGGDEEQEEC-YSLTPVGRLLVKEEAINLRAFLNICNEYVFQKS  436
             RL R + H      +K    E + E  Y LT    LL+K+  +++  FL +  + +    
Sbjct  69    RLMRIMTHLG--FFSKDNVTENELEIEYMLTDESILLLKDHPMSVTPFLQVVLDPIVANP  126

Query  437   CYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESKR  616
              + L  W +NDDP+ F T HG  IWDY + EP +N++FN+A A D+ L+  V++  + K 
Sbjct  127   WHNLSTWLKNDDPTTFETTHGMLIWDYAAREPKFNNLFNDAMASDARLVTSVVIE-KCKG  185

Query  617   VFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMFE  796
             VF+GL+SLVDV GG G +A A+AK FP M+C V DLPHV+  +     +N+ +V G+MF+
Sbjct  186   VFNGLESLVDVGGGTGTMAKALAKTFPMMECNVFDLPHVVDGLQGS--DNLNYVGGDMFK  243

Query  797   SIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAYYN  976
             +IP A+A+LLKWI+HDW D+ECVKILK C++AI  + + GKVIIIDMVME  K  +    
Sbjct  244   NIPPADAILLKWILHDWNDDECVKILKNCKDAIAKKGKKGKVIIIDMVMEKEKGNNETLG  303

Query  977   KAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
               QL+ D L+M L   KER KK+W  L S +GFSDYKITP LGLRS+IE++P
Sbjct  304   -TQLFFDMLMMVLATGKERTKKEWVNLISSSGFSDYKITPVLGLRSVIEIYP  354



>ref|XP_006364318.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=357

 Score =   337 bits (865),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 170/359 (47%), Positives = 233/359 (65%), Gaps = 10/359 (3%)
 Frame = +2

Query  68    LHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKA  247
             +  E+ Q +AH + H+ S+ +S  L CA+QLGIPD IH+H +PM LS L++ L + P K+
Sbjct  5     MSSEMFQGQAHIYKHAFSFANSMVLGCAIQLGIPDVIHSHKQPMTLSQLVSELKLLPEKS  64

Query  248   PYIHRLTRFLVHSSVLLVTKSGGDE--EQEECYSLTPVGRLLVKEEAINLRAFLNICNEY  421
               IHRL R LV+S     T+   DE  E ++ Y LTP  +LL++ E  NL  F     + 
Sbjct  65    DAIHRLMRLLVYSG-FFATREFLDENSENQQGYVLTPSSKLLLRSEIPNLSPFARAMVDP  123

Query  422   VFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLN  601
             V      +LGDW   ++ +PF TAHG  +W +    P +N+VFNEA A DS+++   L+ 
Sbjct  124   VMVNPWQSLGDWILGNETTPFETAHGAPMWQFCDQNPRFNNVFNEAMASDSQMM--CLVV  181

Query  602   GESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVA  781
              + K+VF  + SLVDV GG G +A+ I   FP +KC VLDLPHV+A++P  + EN+++V 
Sbjct  182   KDCKQVFQDMDSLVDVGGGTGIIANTILAAFPHLKCTVLDLPHVVANMP--DTENLKYVG  239

Query  782   GNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEG--GKVIIIDMVMEDPK  955
             G+MF SIP+A+A+L K +MH+W DE CVKILK+CREAI  + EG  GKV+IIDMV+ D  
Sbjct  240   GDMFHSIPSADAILFKHVMHNWSDENCVKILKRCREAIKDKNEGRKGKVLIIDMVL-DRD  298

Query  956   RTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
                A   + +L  D L+M L   +ER +K+WE LF EAGF  YKITP  GLRSLIEVFP
Sbjct  299   EEAANMTEVKLIFDVLMMVLVTGRERTEKEWENLFLEAGFMSYKITPLFGLRSLIEVFP  357



>ref|XP_011016237.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=359

 Score =   337 bits (864),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 170/354 (48%), Positives = 234/354 (66%), Gaps = 7/354 (2%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYI  256
             ELLQA+ H WNH  ++I+S  LKCAVQLGIPD I  H KPM LS L++ALPIHPSKA Y+
Sbjct  11    ELLQAQTHVWNHIFNFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSKAQYV  70

Query  257   HRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQKS  436
             HRL R LVHS         G   Q E YSLT   RLL+K+   ++R  L +  + V  K 
Sbjct  71    HRLMRILVHSGFFSQQNLNGIHNQ-EAYSLTQSTRLLLKDNPWSVRPLLLLVLDPVLTKP  129

Query  437   CYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESKR  616
                L  WF+NDD + F  AH + +W+Y   +  +N++FNEA A DS L  +++++ + K 
Sbjct  130   WDCLSTWFRNDDCNAFIVAHEKTLWEYAGQDARFNNLFNEAMASDSILASKLVVS-KCKG  188

Query  617   VFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMFE  796
             +FDG+ SLVDV GG G +A  IA+ FP M C V DLPHV++ +  G  +N+++V G+MFE
Sbjct  189   IFDGVNSLVDVGGGLGTMAKGIAEAFPHMDCTVFDLPHVVSDLQGG--KNLKYVGGDMFE  246

Query  797   SIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIR--EEGGKVIIIDMVMEDPKRTDAY  970
             ++P A+A+LLKW++HDW DE CVKILK+C++A+  +  ++ GKVIIIDMV E+    +  
Sbjct  247   AVPPADALLLKWVLHDWSDEYCVKILKRCKQAVVSKGQQKAGKVIIIDMVRENLSGDEGS  306

Query  971   YNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
               + QL  D  +M      ERN+K+W KLF +AGF +YKI   LG R+LIE++P
Sbjct  307   I-ETQLLFDLEIMVAASGMERNEKEWAKLFFDAGFLNYKIHSVLGTRALIELYP  359



>ref|XP_006376392.1| hypothetical protein POPTR_0013s12620g [Populus trichocarpa]
 gb|ERP54189.1| hypothetical protein POPTR_0013s12620g [Populus trichocarpa]
Length=355

 Score =   336 bits (862),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 167/355 (47%), Positives = 230/355 (65%), Gaps = 11/355 (3%)
 Frame = +2

Query  74    GELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPY  253
             GELLQA+ H WNH   +I+S  LKCAVQLGIPD I  H KPM LS L++ALPIHPSKA Y
Sbjct  10    GELLQAQTHVWNHIFCFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSKAQY  69

Query  254   IHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQK  433
             +HRL R LVHS              +E YSLT   RLL+K+  +++R  L    + V  K
Sbjct  70    VHRLMRILVHSGFF-----SQQNLNQEAYSLTQSTRLLLKDNPLSMRTLLLFVLDPVLTK  124

Query  434   SCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESK  613
                 L  WF+ND+ + F  AH    W+Y   +   N++FN+A A DS L+ +V+++ + K
Sbjct  125   PHDCLSTWFRNDEATAFSIAHESIFWEYAGQDSRINNLFNDAMASDSILVSKVVVS-KCK  183

Query  614   RVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMF  793
              +F+G+ SLVDV GG G +A  IA+ FP M C V DLP V++ +     +N+++V G+MF
Sbjct  184   GIFEGVNSLVDVGGGLGTMAKGIAEAFPHMDCTVFDLPRVVSDLQGS--KNLKYVGGDMF  241

Query  794   ESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPI--REEGGKVIIIDMVMEDPKRTDA  967
             E++P A+ +LLKWI+H W DE+CVKILK+C++AI    +++ GKVIIIDMV E+    D 
Sbjct  242   EAVPPADVILLKWILHAWSDEDCVKILKRCKQAIMSEGQQKAGKVIIIDMVREN-LNGDG  300

Query  968   YYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
                + QL+ D  +M      ERN+K+W KLF +AGF +YKI P LG R+LIE++P
Sbjct  301   GSIETQLFFDLQMMVAATGMERNEKEWAKLFFDAGFLNYKIHPVLGTRALIELYP  355



>gb|AAR02421.1| putative O-methyltransferase [Catharanthus roseus]
 gb|AAR02422.1| putative O-methyltransferase [Catharanthus roseus]
Length=354

 Score =   336 bits (861),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 167/353 (47%), Positives = 234/353 (66%), Gaps = 4/353 (1%)
 Frame = +2

Query  74    GELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPY  253
              E  +A+ H W+ S S+I  A+LKCA+QLGI D I NH KPM LS+L   L I+PSK+ Y
Sbjct  6     AEFRKAQVHIWSQSFSFITCASLKCALQLGIADAIENHGKPMALSDLTNTLQINPSKSQY  65

Query  254   IHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQK  433
             + RL R LV+S      + G     E  Y LTP  RLL+K E +NLR  +    + +  K
Sbjct  66    LPRLMRLLVNSGFFSEQQLGDAGGGENVYGLTPSMRLLLKNEPLNLRGIVLPMLDPLQIK  125

Query  434   SCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESK  613
             +  +LG+WF+N+D + F TAHG+  WD ++ +P   ++F E  A DS L+ + ++  E K
Sbjct  126   AWNSLGNWFKNEDGTAFETAHGKSYWDCVTEDPKDVEIFTETMASDSLLVAKFVIT-EHK  184

Query  614   RVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMF  793
              +F+GL S++DV G  G  A AIA+ FP++KC VLDLP  +A++   N  N+EFV GNMF
Sbjct  185   SLFEGLDSIIDVGGSTGTFARAIAESFPSLKCTVLDLPETVANIEPTN--NLEFVGGNMF  242

Query  794   ESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAYY  973
             E IP A+ V LK ++HDW DE+CVKILK CR+AIP +E+GGKVI+I+ V++  +  D+  
Sbjct  243   EKIPPAHVVFLKMVLHDWNDEDCVKILKNCRKAIPEKEKGGKVILIETVVQG-QMHDSES  301

Query  974   NKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              K Q+ MD  ++  +G+KER +K+WE LF EAGFS YKI P + +RSLIEV+P
Sbjct  302   VKTQIAMDMDMLVSFGTKERTEKEWEILFKEAGFSSYKIFPIVDIRSLIEVYP  354



>ref|XP_007132709.1| hypothetical protein PHAVU_011G118100g [Phaseolus vulgaris]
 gb|ESW04703.1| hypothetical protein PHAVU_011G118100g [Phaseolus vulgaris]
Length=352

 Score =   336 bits (861),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 169/353 (48%), Positives = 232/353 (66%), Gaps = 10/353 (3%)
 Frame = +2

Query  74    GELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPY  253
              +LL+A+ H WNH  S+++S +LKCA+ L IPD IH + + MP S L A+L ++PSKA  
Sbjct  10    SKLLRAQTHVWNHIFSFVNSMSLKCAIDLEIPDIIHKYGETMPFSQLTASLSLNPSKANC  69

Query  254   IHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQK  433
             I+RL R L HS          + + E  Y LT    LL+K+  +++  F +   + +  K
Sbjct  70    IYRLMRILTHSG-FFSQLQVNENDLEMGYVLTDASTLLLKDNPLSMLPFFHAMLDPILTK  128

Query  434   SCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESK  613
               + L  WF+NDDP+PF TAH  KIWDY   +P  N +FN+A A D++L+  V++   S 
Sbjct  129   PWHQLPTWFRNDDPTPFHTAHEMKIWDYAGRDPKLNQLFNDAMASDAQLVSNVVIERCSG  188

Query  614   RVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMF  793
              VF GL+SLVDV GG G +A AIAK FP + C V DLPHV+A++     EN+++V G+MF
Sbjct  189   -VFKGLESLVDVGGGTGIMAKAIAKSFPHIDCTVFDLPHVVANLKG--CENLKYVGGDMF  245

Query  794   ESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAYY  973
             ES+P A+AVLLKWI+HDW DE+CVKILKKC+E I       KVI+IDMV+E  +  D   
Sbjct  246   ESVPPADAVLLKWILHDWNDEQCVKILKKCKEGI-----KRKVIVIDMVVES-EEEDFES  299

Query  974   NKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              + +L +D +VM LY  KER +K+W K+   AGFSDYKITP +GLRS IE++P
Sbjct  300   TETKLLVDMVVMVLYPGKERTEKEWAKIIFSAGFSDYKITPVVGLRSFIEIYP  352



>ref|XP_006469063.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X1 [Citrus sinensis]
 ref|XP_006469064.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X2 [Citrus sinensis]
Length=378

 Score =   336 bits (862),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 177/360 (49%), Positives = 236/360 (66%), Gaps = 10/360 (3%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYI  256
             ELL+A+A  WN + +YI+S +LKCAV+LGIPD IH H +PM LS + +AL I  +KA  I
Sbjct  21    ELLKAQAQVWNCAFNYINSMSLKCAVELGIPDVIHKHGQPMTLSQIASALDIQKNKAHCI  80

Query  257   HRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQKS  436
              RL R LVHS           +E E  YSLT   RLL+K+E      F+ +         
Sbjct  81    QRLMRILVHSGFFAQQNKIDKDESEVYYSLTLASRLLLKDEPSRAAPFMFLITHPTITTP  140

Query  437   CYALGDWFQNDDPSP---FCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGE  607
                L  WF+NDDPS    F + HG+ IW  ++ E  + +VF +A   DS+ I  VL+  +
Sbjct  141   FNFLSSWFKNDDPSTPTVFESTHGKDIWGCLAQEAKFKNVFYDAMMADSQFISSVLIK-D  199

Query  608   SKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIAS---VPAGNIENMEFV  778
              K VF GLK LVD+ GG G +A AIA+ FP MKCIV DLPHV+ +      G  +N+EF+
Sbjct  200   CKEVFKGLKCLVDLGGGTGTMAKAIAEAFPEMKCIVFDLPHVVDNNLQQQQGTNKNLEFL  259

Query  779   AGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIP-IREEGGKVIIIDMVMEDPK  955
              G+MFE+IP A+AVLLKW++H+W DEE VKILKKC+EAI   +++GGKVI+IDMV+ED +
Sbjct  260   GGDMFEAIPPADAVLLKWVLHNWGDEESVKILKKCKEAIDGSKDKGGKVIVIDMVIED-Q  318

Query  956   RTDAYYNKAQLYMDFLVMALYG-SKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
               D    + QL  D L+M+L+  +KER+ K+W+KLFSEAGFS Y +  TLGLRSLIE++P
Sbjct  319   SIDKDSTETQLCCDMLMMSLFSVAKERSIKEWKKLFSEAGFSHYNVNSTLGLRSLIELYP  378



>ref|XP_011037437.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=359

 Score =   335 bits (860),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 169/354 (48%), Positives = 234/354 (66%), Gaps = 7/354 (2%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYI  256
             ELLQA+ H WNH  ++I+S  LKCAVQLGIPD I  H KPM LS L++ALPIHPSKA Y+
Sbjct  11    ELLQAQTHVWNHIFNFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSKAQYV  70

Query  257   HRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQKS  436
             HRL R LVHS         G   Q E YSLT   RLL+K+   ++R  L +  + V  K 
Sbjct  71    HRLMRILVHSGFFSQQNLNGIHNQ-EAYSLTQSTRLLLKDNPWSVRPLLLLVLDPVLTKP  129

Query  437   CYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESKR  616
                L  WF+NDD + F  AH + +W+Y   +  +N++FNEA A DS L  +++++ + K 
Sbjct  130   WDCLSTWFRNDDCNAFIVAHEKTLWEYAGQDARFNNLFNEAMASDSILASKLVVS-KCKG  188

Query  617   VFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMFE  796
             +FDG+ SLVDV GG G +A  IA+ FP M C V DLPHV++ +  G  +N+++V G+MFE
Sbjct  189   IFDGVNSLVDVGGGLGTMAKGIAEAFPHMDCTVFDLPHVVSDLQGG--KNLKYVGGDMFE  246

Query  797   SIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIR--EEGGKVIIIDMVMEDPKRTDAY  970
             ++P A+A+LLKW++HDW DE CVKILK+C++A+  +  ++ GKVIIIDMV E+    +  
Sbjct  247   AVPPADALLLKWVLHDWSDEYCVKILKRCKQAVVSKGQQKAGKVIIIDMVRENLSGDEGS  306

Query  971   YNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
               + QL  D  +M      ERN+++W KLF +AGF +YKI   LG R+LIE++P
Sbjct  307   I-ETQLLFDLEIMVAASGMERNEEEWAKLFFDAGFLNYKIHSVLGTRALIELYP  359



>ref|XP_004490686.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cicer 
arietinum]
Length=358

 Score =   335 bits (859),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 170/361 (47%), Positives = 242/361 (67%), Gaps = 6/361 (2%)
 Frame = +2

Query  53    AENGK-LHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALP  229
             ++NG+ +   LL+A++H WNH  ++I+S +LKC V LGIPD IHN+ KP+ LS LI  LP
Sbjct  3     SQNGEHVASNLLKAQSHIWNHIFNFINSMSLKCVVDLGIPDIIHNYGKPISLSKLIPLLP  62

Query  230   IHPSKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNI  409
             IHPSK  +I+RL R + HS      ++  + E E  Y LT    LL+ +  +++  F++ 
Sbjct  63    IHPSKTIFIYRLMRIMTHSG-FFSQQNITENELETEYMLTDTSLLLLSDNPMSVAPFVHA  121

Query  410   CNEYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIME  589
               + V     + L  W  N DP+ F T HG   WD    EP +N++FN+A A D+ L+  
Sbjct  122   MLDPVLTNPWHQLSTWLTNGDPTAFETKHGMLFWDCAEREPKFNNLFNDAMASDARLVSS  181

Query  590   VLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENM  769
             V++  + K VF+GL+S+VDV GG G +A A+AK FP ++C VLDLPHV+A +     EN+
Sbjct  182   VVIE-KCKEVFNGLESIVDVGGGIGTMAKALAKSFPQLECTVLDLPHVVAGLQ--ETENL  238

Query  770   EFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMED  949
             ++V G+MF+ IP+A+A+LLKWI+HDW D+ECVKILK C++AI  + + GKVIIIDMVME+
Sbjct  239   KYVGGDMFKEIPSADAILLKWILHDWNDDECVKILKNCKDAIAKKGKEGKVIIIDMVMEN  298

Query  950   PKRTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVF  1129
              K  +    + QL+ D L+M L   KER KK+W  L S +GFS+YKITP LGLRS+IE++
Sbjct  299   EKGKNESL-QTQLFFDMLMMVLVTGKERTKKEWVNLISSSGFSNYKITPILGLRSVIEIY  357

Query  1130  P  1132
             P
Sbjct  358   P  358



>ref|XP_006388573.1| hypothetical protein POPTR_0151s00210g [Populus trichocarpa]
 gb|ERP47487.1| hypothetical protein POPTR_0151s00210g [Populus trichocarpa]
Length=359

 Score =   335 bits (858),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 170/355 (48%), Positives = 231/355 (65%), Gaps = 7/355 (2%)
 Frame = +2

Query  74    GELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPY  253
             GELLQA+ H WNH  ++I+S  LKCAVQLGIPD I  H KPM LS L++ALPIHPSKA Y
Sbjct  10    GELLQAQTHVWNHIFNFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSKAQY  69

Query  254   IHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQK  433
             +HRL R LVHS         G   Q   YSLT   RLL+K+   ++R  L +  + V  K
Sbjct  70    VHRLMRILVHSGFFSQQNLNGIHNQ-VAYSLTQSTRLLLKDNPWSVRPLLLLVLDPVLTK  128

Query  434   SCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESK  613
                 L  WF+NDD + F  AH + +W+Y   +   N++FN+A A DS L  +++++ + K
Sbjct  129   PWDCLSTWFRNDDRNAFSVAHEKTLWEYAGQDARLNNLFNDAMASDSILASKLVVS-KCK  187

Query  614   RVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMF  793
              +FDG+ SLVDV GG G +A  IA+ FP M C V DLPHV++ +  G  +N+++  G+MF
Sbjct  188   GIFDGVNSLVDVGGGLGTMAKGIAEAFPHMDCTVFDLPHVVSDLQGG--KNLKYAGGDMF  245

Query  794   ESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIR--EEGGKVIIIDMVMEDPKRTDA  967
             E++P  +A+LLKWI+HDW DE+CVKILK+C++AI  +  ++ GKVIIIDMV  D +  D 
Sbjct  246   EAVPPVDALLLKWILHDWSDEDCVKILKRCKQAITSKGQQKVGKVIIIDMV-RDNRNGDE  304

Query  968   YYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
                  QL  D  +M      ERN+K+W KLF +AGF +YKI P LG R+L E++P
Sbjct  305   GSIGTQLLFDLEMMVALSGMERNEKEWAKLFFDAGFLNYKIHPVLGTRALFELYP  359



>emb|CBI22005.3| unnamed protein product [Vitis vinifera]
Length=309

 Score =   332 bits (852),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 168/332 (51%), Positives = 213/332 (64%), Gaps = 24/332 (7%)
 Frame = +2

Query  137   ALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYIHRLTRFLVHSSVLLVTKSGG  316
             +LKCA+QLGIPD IHNH KPM L  L+A LP+HP ++  ++RL R LVHS  L   +   
Sbjct  2     SLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCVYRLMRILVHSGFLAAQRVQQ  61

Query  317   DEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQKSCYALGDWFQNDDPSPFCTAH  496
              +E+E    L  +  +L K                      + L  WFQNDDP+PF TA+
Sbjct  62    GKEEEGPLVLAMLDPILTK--------------------PWHYLSAWFQNDDPTPFHTAY  101

Query  497   GEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESKRVFDGLKSLVDVAGGNGAVAS  676
                 WDY  HEP  N+ FNEA A D+ L+  VLL  E + VF GL SLVDV GG G VA 
Sbjct  102   ERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLLK-EGQGVFAGLNSLVDVGGGTGKVAK  160

Query  677   AIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMFESIPAANAVLLKWIMHDWEDE  856
             AIA  FP + C VLDL HV+A +     +N+ + AG+MFE+IP A+A+LLKWI+HDW +E
Sbjct  161   AIANAFPHLNCTVLDLSHVVAGLQGS--KNLNYFAGDMFEAIPPADAILLKWILHDWSNE  218

Query  857   ECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAYYNKAQLYMDFLVMALYGSKERN  1036
             ECVKILK+CREAIP +E GGKVIIIDM+M    + D    + QL+ D  +M     +ER+
Sbjct  219   ECVKILKRCREAIPSKENGGKVIIIDMIMMK-NQGDYKSTETQLFFDMTMMIFAPGRERD  277

Query  1037  KKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
             + +WEKLF +AGFS YKITP LGLRSLIEV+P
Sbjct  278   ENEWEKLFLDAGFSHYKITPILGLRSLIEVYP  309



>ref|XP_006364328.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=354

 Score =   333 bits (855),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 169/359 (47%), Positives = 233/359 (65%), Gaps = 9/359 (3%)
 Frame = +2

Query  68    LHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKA  247
             +  E+ Q +AH + H+LSY +   L CA+QLGIPD IH+H +PM LS L++ L + P K+
Sbjct  1     MASEMFQGQAHIYKHALSYANCMVLSCAIQLGIPDVIHSHKQPMTLSQLVSQLKLPPQKS  60

Query  248   PYIHRLTRFLVHSSVLLVTKSGGDE--EQEECYSLTPVGRLLVKEEAINLRAFLNICNEY  421
               ++R+ R LV+S     T+   DE  E ++ Y LTP  +LL+K E  NL  F+    E 
Sbjct  61    DAVYRVMRLLVYSG-FFATRDFLDENSENQQGYILTPSSKLLLKSEIPNLSTFVRAMVEP  119

Query  422   VFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLN  601
                    +LGDWF  D  +PF TA+G  IW++    P +N+VFNEA A DS+++   L+ 
Sbjct  120   AMVNPWQSLGDWFLGDKTTPFETANGAPIWEFGDQNPRFNNVFNEAMASDSQMM--CLVA  177

Query  602   GESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVA  781
              + K+VF  + SLVDV GG G +A AI   FP +KC VLDLP V+A++P  N  N+++V 
Sbjct  178   KDCKQVFQDMNSLVDVGGGTGVIAKAILAAFPHLKCTVLDLPQVVANMPDTN--NLKYVG  235

Query  782   GNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEG-GKVIIIDMVME-DPK  955
             G+MF SIP+A+A+L K +MH+W DE+CVKILKKCREAI   ++  GKVIIIDMV++ D  
Sbjct  236   GDMFHSIPSADAILFKHVMHNWSDEDCVKILKKCREAIKDNKKNEGKVIIIDMVLDRDED  295

Query  956   RTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
                A   + +L  D  ++ L   +ER +K+WEKLF EAGF  YKITP  GLRSLIE+FP
Sbjct  296   EDKANMTEVKLIYDVAMIVLLTGRERTEKEWEKLFLEAGFMTYKITPLFGLRSLIEIFP  354



>ref|XP_011100228.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Sesamum 
indicum]
Length=367

 Score =   333 bits (855),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 164/361 (45%), Positives = 233/361 (65%), Gaps = 15/361 (4%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYI  256
             ELL A++H WNH  ++I+S +LKC +QLGIPD I  H KPM LS L  +L ++ +K+P +
Sbjct  13    ELLDAQSHVWNHLFNFINSMSLKCVIQLGIPDIILKHGKPMTLSELTHSLHLNEAKSPSL  72

Query  257   HRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQKS  436
              RL R ++HS   +  K    EE E  Y LTP   LL+++E +++R F     + +    
Sbjct  73    ERLMRIMIHSKFFINVKISHVEETE-GYWLTPASHLLLRDEPLSVRPFALSMLDPILTDP  131

Query  437   CYALGDWFQND---------DPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIME  589
              + + +WF+ D         D +PF T HG  +W+Y   +P  N +FNE  A DS+L+  
Sbjct  132   WHHVSEWFKTDVSEWFKTDGDLTPFLTTHGRTLWEYAGQDPRLNGLFNEGMASDSKLVAT  191

Query  590   VLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENM  769
             V+   + + VF+GLKS+VDV GG G VA A+A  F  + C+VLDLPHV+A        N+
Sbjct  192   VI-TKDCRNVFEGLKSMVDVGGGTGTVAKAVADAFTGLNCVVLDLPHVVAGCEG--TANL  248

Query  770   EFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMED  949
              FVAG+MFE IP A+AV +KWI+HDW DE+C+KIL+KC++AI  +++ GKVII+DMV++ 
Sbjct  249   VFVAGDMFEYIPPADAVFMKWILHDWPDEKCLKILEKCKQAISDKDKEGKVIIVDMVVDF  308

Query  950   PKRTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVF  1129
              K   A   + QL+ D L+M L   ++R +K W +LFS AGF+ YKITP LGLRSLIE+F
Sbjct  309   QKEHKAI--ETQLFFDMLIMNLASGRQRTEKDWAELFSAAGFTSYKITPVLGLRSLIELF  366

Query  1130  P  1132
             P
Sbjct  367   P  367



>dbj|BAJ05383.1| O-methyltransferase [Carapichea ipecacuanha]
Length=350

 Score =   333 bits (853),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 171/352 (49%), Positives = 235/352 (67%), Gaps = 12/352 (3%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYI  256
             ELL+A+ H      S+ + AALKCA+QLGIPD I  H KPM LS L +ALPI+PSKAP I
Sbjct  11    ELLRAQTHFSRQVFSFQNFAALKCALQLGIPDAIKQHGKPMNLSELTSALPINPSKAPCI  70

Query  257   HRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQKS  436
             HRL R LV++            ++ EC++LT +GRLL+K++ +++RA +           
Sbjct  71    HRLMRLLVNAGYF--------AQENECFALTSLGRLLLKDDPLHIRALVLSEFHTALVMP  122

Query  437   CYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESKR  616
              +AL +WF+NDD +PF TAHG+  WDY S +P   +VF+ A A DS LI + L+  E K 
Sbjct  123   WFALSEWFKNDDVAPFATAHGKSFWDYTSCDPELRNVFDGAMACDSHLIAKALVT-EFKY  181

Query  617   VFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMFE  796
             +F+GLKSLVDV GGNG +A +IAK F  +KC V DLP  +A+       N++FVAG+MFE
Sbjct  182   LFEGLKSLVDVGGGNGTLARSIAKAFTNLKCTVCDLPEAVANEQGDG--NLDFVAGDMFE  239

Query  797   SIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAYYN  976
              +P+A+A+LLK I+HDW DE CVKILK C++AI  +++GGKVI+ID V+E  K+     +
Sbjct  240   RVPSADAILLKSILHDWSDENCVKILKNCKKAISGKDKGGKVIVIDGVVELQKKA-GNDD  298

Query  977   KAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
                  MD  ++ L+ SKERN+K+W KLFS+AGFSDY I  T G   ++E+ P
Sbjct  299   PGLDNMDMQMLVLFNSKERNEKEWAKLFSDAGFSDYGIVRTFGWWCIMELSP  350



>ref|XP_008455944.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X2 [Cucumis melo]
Length=362

 Score =   333 bits (853),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 170/365 (47%), Positives = 236/365 (65%), Gaps = 13/365 (4%)
 Frame = +2

Query  62    GKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPS  241
             G+   ELLQ++AH WNH+L +I+S +LKC ++L IPD IHNH +PM LS+L+AAL I P+
Sbjct  2     GENLNELLQSQAHVWNHALKFINSMSLKCVLELEIPDIIHNHGQPMSLSSLVAALHIEPT  61

Query  242   KAPYIHRLTRFLVHSSVLLVTKSGGDEEQEEC-YSLTPVGRLLVKEEAINLRAFLNICNE  418
             KA  + RL   LVHS      ++   +  E+  YSLTP  +LL+  +      FL +   
Sbjct  62    KAECLSRLMNLLVHSGFFTTAQTQAHDRAEDVKYSLTPSSKLLLHNKQATPFLFLALDKS  121

Query  419   YVFQKSCYALGDWFQNDD------PSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSEL  580
              +   S  +L  WF + +       + F  A+G+ +W+Y + E  + ++F +    DSE+
Sbjct  122   TI--ASFQSLSSWFCSSNNNGQNYSNAFEMANGKLLWEYAAQEQTFANLFQQTMVCDSEM  179

Query  581   IMEVLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNI  760
             I +++   E   VF+GLKSLVDV GG G +  AI + FP + C V DLP VI++ P  N 
Sbjct  180   IGKIV--KECSEVFEGLKSLVDVGGGTGVMGKAIVEAFPHITCTVFDLPQVISNQPLQNA  237

Query  761   ENMEFVAGNMFES-IPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDM  937
             +N+ FV G+MFE  IP ANAVLLKWI+HDW DE+ +KILKKC++AIP RE+GGK+IIID+
Sbjct  238   KNLRFVEGDMFEEIIPLANAVLLKWILHDWNDEQSIKILKKCKDAIPSREKGGKLIIIDI  297

Query  938   VMEDPKRTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSL  1117
             VMED K+ +    + QL  D L+M   G KERN+ +W+ LF EAGFS YKI   LGLRS+
Sbjct  298   VMED-KKEEKESTETQLLFDVLMMVNLGGKERNENEWKNLFMEAGFSGYKIISKLGLRSV  356

Query  1118  IEVFP  1132
             IEV+P
Sbjct  357   IEVYP  361



>ref|XP_010320673.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X2 [Solanum lycopersicum]
Length=339

 Score =   331 bits (849),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 173/354 (49%), Positives = 234/354 (66%), Gaps = 28/354 (8%)
 Frame = +2

Query  80    LLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPI-HPSKAPYI  256
             LL A+A  WN+  ++I S+A++CA QLGIPD ++ H KPM LS++ A L + + SK  ++
Sbjct  11    LLHAQAQIWNYIFNFISSSAVRCAFQLGIPDVLYKHDKPMCLSDISAELSVVNSSKVSFL  70

Query  257   HRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQKS  436
               L +FLV S  L         + E+ YSLTP   LL K++  N+R+ L + +   F K+
Sbjct  71    PILMQFLVQSGFL--------NQHEDHYSLTPASCLLAKDDPFNVRSLLLLNHGQAFSKA  122

Query  437   CYALGDWFQNDDPSPFCTAHGEKIWDYISHE--PVYNDVFNEATAKDSELIMEVLLNGES  610
                L DWFQND P+PF TAHG+ +WD+I  E   V  D+FN+A A DS L   VL+  E 
Sbjct  123   WPELSDWFQNDSPTPFHTAHGKSLWDFIGEEQPSVLGDIFNDALASDSRLNTNVLI-AEC  181

Query  611   KRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNM  790
             K VF+GL SLVDV GG G V+ AIAK FP +KC VLDLP V+  +      N++FV G+M
Sbjct  182   KHVFEGLTSLVDVGGGTGTVSIAIAKAFPNIKCTVLDLPQVVGDLKGSG--NLDFVGGDM  239

Query  791   FESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAY  970
             F+ IP  NA+LL             K+LKKC+E+IP RE+GGKVIIID V+EDPK+++ +
Sbjct  240   FDMIPHTNAILL-------------KVLKKCKESIPSREKGGKVIIIDTVLEDPKQSNEF  286

Query  971   YNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
               +AQ  M  L+M L+ +KER +K+WEKLFSEAGF++YKI P LGLRSLIE++P
Sbjct  287   V-RAQHNMGMLMMVLFAAKERTEKEWEKLFSEAGFTEYKIFPALGLRSLIEIYP  339



>ref|XP_002305103.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|EEE85614.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=359

 Score =   332 bits (851),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 169/354 (48%), Positives = 236/354 (67%), Gaps = 8/354 (2%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYI  256
             EL QA  H  +   +YI+S +L CA QLGIPD IHNH +P+ L +L++AL I P+K   I
Sbjct  12    ELFQAHTHLHSQMFNYINSMSLMCAAQLGIPDIIHNHGRPITLPHLVSALHIAPNKTSII  71

Query  257   HRLTRFLVHSSVLLVTKS--GGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQ  430
             +RL R LVHS     TK+  G  E +EE Y LTP  +LLVK+    L  F+++ N   F 
Sbjct  72    YRLMRMLVHSGFFATTKAANGQGEGEEEAYVLTPPSQLLVKDNTNCLSPFMSLINP-AFV  130

Query  431   KSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGES  610
                 +LGDWF+ ++P+ F  A+G   W+Y +  P  N +FNEA A DS+++  V+   + 
Sbjct  131   TPWLSLGDWFRGNEPTAFEHAYGMAFWEYHNQNPELNRLFNEAMACDSQMMNLVI--RDC  188

Query  611   KRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNM  790
             K +F+GL S+VDV GG G+++  I++ FP M C VL+LP VI ++     +N+ +V G+M
Sbjct  189   KPIFEGLNSMVDVGGGTGSLSRIISEAFPHMNCTVLELPQVITNLEG--TKNLNYVGGDM  246

Query  791   FESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAY  970
             F+ IP+A+AVLLK I H W DE+C+KILKKC+EAI  +E+GGKVII+D+V+ D K+ +  
Sbjct  247   FQHIPSADAVLLKLIFHGWSDEDCLKILKKCKEAISSKEKGGKVIIVDVVI-DEKKDEKE  305

Query  971   YNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
               + +L  D L+M +   KER+ K+WEKLF EAGFS YKITP  GLRSLIEV+P
Sbjct  306   LTETKLLFDMLMMVVAAGKERSVKEWEKLFLEAGFSHYKITPLFGLRSLIEVYP  359



>ref|XP_009351009.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Pyrus 
x bretschneideri]
Length=381

 Score =   332 bits (852),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 180/376 (48%), Positives = 235/376 (63%), Gaps = 20/376 (5%)
 Frame = +2

Query  56    ENGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIH  235
             E G    ELL A+AH WNH   +I+S +LKCAVQLGIPD IHNH + + LS LIA L +H
Sbjct  7     EVGATSHELLGAQAHVWNHIFQFINSMSLKCAVQLGIPDVIHNHGQSISLSELIAGLNVH  66

Query  236   PSKAPYIHRLTRFLVHSSVL-------LVTKSGGDEEQEECYSLTPVGRLLVKEEAINLR  394
             PSKA +I RL R LVHS+             +  +EE  E YSLTP  RL +K+  +N  
Sbjct  67    PSKAHFISRLMRILVHSNFFAQHHHVHHNHDNVEEEEAVELYSLTPASRLFLKDGPVNTT  126

Query  395   AFLNICNEYVFQKSCYALGDWFQ---NDD---PSPFCTAHGEKIWDYISHEPVYNDVFNE  556
              FL +  + V     +++G W Q    DD    +PF  A+G   W+  + +P + D FNE
Sbjct  127   PFLLMILDPVMTDPFHSMGAWLQMNGGDDLVPRTPFEVANGMPFWELSAKKPRFGDSFNE  186

Query  557   ATAKDSELIMEVLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVI  736
             A   DS+LI   ++  E   VF+GLKSLVDV GG G +A AIA  FP + C V D PHV+
Sbjct  187   AMEADSKLITRAVVE-ECGGVFEGLKSLVDVGGGTGTMAKAIANAFPNINCTVFDQPHVV  245

Query  737   ASVPAGNIENMEFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGG  916
             A++  G   N+ FV G+MF+ IP ANA+LLKWI+HDW DEE VKILKKCREA+ + +  G
Sbjct  246   ANL-EGTTHNLGFVGGDMFDKIPPANAILLKWILHDWNDEESVKILKKCREAMLVSKNEG  304

Query  917   --KVIIIDMV---MEDPKRTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSD  1081
               K+IIIDMV   + +  + D    + QL  D L+M+   SKER++ +WEK+F  AGF+ 
Sbjct  305   RKKIIIIDMVVGYINNKMQLDKKSIETQLMFDMLMMSTVTSKERSELEWEKIFLAAGFTH  364

Query  1082  YKITPTLGLRSLIEVF  1129
             Y IT TLGLRSLIEV+
Sbjct  365   YNITHTLGLRSLIEVY  380



>gb|KDP35397.1| hypothetical protein JCGZ_10381 [Jatropha curcas]
Length=355

 Score =   332 bits (850),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 167/355 (47%), Positives = 238/355 (67%), Gaps = 13/355 (4%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYI  256
             ELL+A+ H WNH+L +I S +LKCAV+LGIPD I+NH +PMPLS+L++AL ++P+K  ++
Sbjct  11    ELLKAQTHMWNHTLQFIKSMSLKCAVELGIPDIINNHDQPMPLSDLVSALQVNPAKTHHV  70

Query  257   HRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQKS  436
             +RL RFLVHS    +        QEE Y LTP  R L+K+ ++    F+++  + +    
Sbjct  71    YRLMRFLVHSGFFSL--------QEEGYLLTPFSRFLLKDTSVGSIPFISLFLDPIMMDP  122

Query  437   CYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESKR  616
                L  W +NDD +PF TA G+ +++Y  H+   N++ NE TA DS  + +V    + K 
Sbjct  123   FNCLSRWLKNDDQTPFVTAFGKSLYEYAGHDIRANNMVNEVTACDSIFLGQVT-TLKCKE  181

Query  617   VFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMFE  796
             VF GL SLVDVAGG G ++ +IA  FP++KC +LDLPHV+A V +   +N+ FVAG+MF+
Sbjct  182   VFKGLNSLVDVAGGTGNMSKSIANAFPSIKCTILDLPHVVAVVDSQGAKNLNFVAGDMFQ  241

Query  797   SIPAANAVLLKWIMHDWEDEECVKILKKCREAIPI---REEGGKVIIIDMVMEDPKRTDA  967
             ++P A+AVL+KW++ DW DE CVKILK C+EAI     +E   KVIIIDMVM + K +D 
Sbjct  242   AVPPADAVLIKWVLCDWADEYCVKILKNCKEAITRNGKQENNNKVIIIDMVMGN-KNSDD  300

Query  968   YYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
                +A+L+ D   MA    K+RN+++W KLF +AGF  YKI   LG R+LIEV+P
Sbjct  301   DCIEAELFFDMAEMAYLTGKQRNEEEWAKLFFDAGFIKYKINYVLGPRALIEVYP  355



>ref|XP_011100227.1| PREDICTED: 8-hydroxyquercetin 8-O-methyltransferase-like [Sesamum 
indicum]
Length=359

 Score =   332 bits (850),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 162/353 (46%), Positives = 234/353 (66%), Gaps = 7/353 (2%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYI  256
             ELL A++H WNH  ++I+S +LKC +QLGIPD I  H KPM LS L  +L ++ +K+P +
Sbjct  13    ELLDAQSHVWNHLFNFINSMSLKCVIQLGIPDIILKHGKPMTLSELTHSLHLNDAKSPSL  72

Query  257   HRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQKS  436
              RL R ++HS   +  K    EE +  Y LTP   LL+++E  ++R F  +  + +    
Sbjct  73    ERLMRIMIHSKFFINVKISQVEETDG-YWLTPASHLLLRDEPSSMRPFALVLLDPILIDP  131

Query  437   CYALGDWFQND-DPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESK  613
              + +  WF++D D +PF T HG   W+Y + +P  N  FNEA A D+ L+  V+  G+ +
Sbjct  132   WHHVSKWFKSDHDLTPFLTTHGRTFWEYAAQDPRLNCFFNEAMACDTVLVASVI-TGDCR  190

Query  614   RVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMF  793
              VF+GLKS+VDV GG G VA A+A  F  + C+VLDLPHV+A       EN+ FVAG+MF
Sbjct  191   NVFEGLKSMVDVGGGTGTVAKAVADAFTGLNCVVLDLPHVVAGCEG--TENLVFVAGDMF  248

Query  794   ESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAYY  973
             E IP+A+AV +KWI+HDW DE+C+KIL+KC++A+  +++ GKVII+D+V++  K   A  
Sbjct  249   EYIPSADAVFMKWILHDWPDEKCLKILEKCKQAVSDKDKKGKVIIVDIVVDFQKEHKAI-  307

Query  974   NKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              + QL+ D L+M +   +ER +K W +LF  AGF+ YKITP LGLRSLIE+FP
Sbjct  308   -ETQLFFDMLMMNVASGRERTEKDWAELFFAAGFTSYKITPVLGLRSLIELFP  359



>dbj|BAI79243.1| O-methyltransferase [Carapichea ipecacuanha]
Length=350

 Score =   331 bits (849),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 170/352 (48%), Positives = 234/352 (66%), Gaps = 12/352 (3%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYI  256
             ELL+A+ H      S+ + AALKCA+QLGIPD I  H KPM LS L +ALPI+PSKAP I
Sbjct  11    ELLRAQTHFSRQVFSFQNFAALKCALQLGIPDAIKQHGKPMNLSELTSALPINPSKAPCI  70

Query  257   HRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQKS  436
             HRL R LV++            ++ EC++LT +GRLL+K++ +++RA +           
Sbjct  71    HRLMRLLVNAGYF--------AQENECFALTSLGRLLLKDDPLHIRALVLSEFHTALVMP  122

Query  437   CYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESKR  616
              +AL +WF+NDD +PF TAHG+  WDY S +P   +VF+ A A DS LI + L+  E K 
Sbjct  123   WFALSEWFKNDDVAPFATAHGKSFWDYTSCDPELRNVFDGAMACDSHLIAKALVT-EFKY  181

Query  617   VFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMFE  796
             +F+GLKSLVDV GGNG +A +IAK F  +KC V DLP  +A+       N++FVAG+MF+
Sbjct  182   LFEGLKSLVDVGGGNGTLARSIAKAFTNLKCTVCDLPEAVANEQGDG--NLDFVAGDMFD  239

Query  797   SIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAYYN  976
              +P+A+A+LLK I+HDW DE CVKILK C+ AI  +++GGKVI+ID V+E  K+     +
Sbjct  240   RVPSADAILLKSILHDWSDENCVKILKNCKRAISGKDKGGKVIVIDGVVELQKKA-GNDD  298

Query  977   KAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
                  MD  ++ L+ SKERN+K+W KLFS+AGFSDY I  T G   ++E+ P
Sbjct  299   PGLDNMDMQMLVLFNSKERNEKEWAKLFSDAGFSDYGIVRTFGWWCIMELSP  350



>gb|KGN43480.1| hypothetical protein Csa_7G039280 [Cucumis sativus]
Length=380

 Score =   332 bits (852),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 165/353 (47%), Positives = 229/353 (65%), Gaps = 13/353 (4%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHA-KPMPLSNLIAALPIHPSKAPY  253
             ELL+A++H WNH  ++I+S +LKCA+QLGIPD IH+H   P+PLS L+++L +HP+K  +
Sbjct  40    ELLEAQSHIWNHIFNFINSMSLKCAIQLGIPDAIHSHGPNPVPLSILVSSLQLHPNKTQF  99

Query  254   IHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQK  433
             I+RL R L HS   +        +QEE Y LT   RLL+K+    +  FL    +     
Sbjct  100   IYRLMRLLTHSGFFV--------QQEEGYILTNSSRLLLKDNPCAVSPFLLSMLQPALTD  151

Query  434   SCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESK  613
                 L  WFQ DD +PF TAHG   W Y+ ++P   +VFN   A D+ L+  VLL G+ K
Sbjct  152   PWQFLSIWFQTDDQTPFETAHGVPFWKYMRNKPKEGEVFNAGMASDARLVNSVLL-GKHK  210

Query  614   RVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMF  793
              VF+G+KSLVDV GG G +A AI++ FP M+C V DLP V+A +  G+  N+ +V G+MF
Sbjct  211   SVFEGVKSLVDVGGGTGTMAKAISQAFPQMECTVFDLPQVVAHL-RGDQPNLNYVEGDMF  269

Query  794   ESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDAYY  973
             + IP A+ +LLKWI+HDW DEECV+ILK C+ AI      GKV++ID+V+    + D+  
Sbjct  270   KRIPPADVLLLKWILHDWSDEECVEILKNCKAAIRSNGNKGKVMVIDIVLFGNYKKDSM-  328

Query  974   NKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              + QL  D L+M L G KER +K+W KL  EAGF  YKI P +G+RSL+E++P
Sbjct  329   -ETQLLFDMLMMTLVGGKEREEKEWAKLIKEAGFGSYKIFPIMGVRSLVEIYP  380



>ref|XP_010110665.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXC27580.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=384

 Score =   332 bits (851),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 166/370 (45%), Positives = 243/370 (66%), Gaps = 21/370 (6%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAP--  250
             EL++++AH WN   ++I+S +LKCA+QLGIPD I++H KPM LS LI++LPIH +K P  
Sbjct  18    ELVKSQAHIWNQIFNFINSMSLKCAIQLGIPDAIYSHGKPMILSQLISSLPIHQNKRPDS  77

Query  251   -YIHRLTRFLVHSSVLLVTK--SGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEY  421
               I+RL R LV+S    + +   G     EE Y LT   +LL+++  +++  FL    + 
Sbjct  78    RLIYRLMRILVNSGFFALEEVVVGETNLLEEGYVLTNASKLLLRDNPLSVTPFLLSMLDP  137

Query  422   VFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLN  601
             +  K  +++  W Q+DDP+PF T HG++ WDY  ++P   ++FNEA A D+ L+  V++ 
Sbjct  138   IMTKPWHSISTWLQSDDPTPFATTHGKEFWDYNEYDPRLGNLFNEAMASDARLVTSVVIE  197

Query  602   GESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVA  781
              + K +F+GL+SLVD+AGG G VA AIA  FP + C V DLPHVIA +     +N++FV 
Sbjct  198   -KCKSMFEGLESLVDLAGGTGTVAKAIAYAFPHLACTVFDLPHVIADLQGS--KNLKFVG  254

Query  782   GNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIR-EEGGKVIIIDMVM-EDPK  955
             G+MF+ IP A+A+ +KWI+HDW DE+CVK+L++C+ AI  +  + GKVI++DMV+ E+  
Sbjct  255   GDMFDEIPPADAIFVKWILHDWSDEDCVKLLERCKVAITCKGNKNGKVILVDMVIVEEQN  314

Query  956   RTD-----------AYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTL  1102
               D               + QL+ D L+M L   +ER + +W KLF +AGFS YKITP L
Sbjct  315   NKDIGHDHHAHDHDHQSYETQLFFDMLMMVLLSGRERKETEWAKLFFDAGFSTYKITPIL  374

Query  1103  GLRSLIEVFP  1132
             G+RSLIEVFP
Sbjct  375   GVRSLIEVFP  384



>ref|XP_010040912.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW44790.1| hypothetical protein EUGRSUZ_L01646 [Eucalyptus grandis]
Length=357

 Score =   331 bits (848),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 170/361 (47%), Positives = 230/361 (64%), Gaps = 8/361 (2%)
 Frame = +2

Query  59    NGKLHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHP  238
             NG++  + L A+AH WNH  ++I+S  LKCA+QLGIPDTIH+H +PM L  L++AL IHP
Sbjct  3     NGEMGSQQLLAQAHIWNHIFNFINSMCLKCAIQLGIPDTIHHHGQPMTLDALVSALQIHP  62

Query  239   SKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNE  418
             S+A  + RL R LVHS      K   D +    Y L  V +LL+ +   N+  F     +
Sbjct  63    SRAHCVDRLMRILVHSGFFEQKKLAPDGQG--AYVLNHVSKLLLTDNPSNVAPFALSMLD  120

Query  419   YVFQKSCYALGDWFQND-DPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVL  595
              +     + L  WF N  DP+PF    G   W Y   EP +N +FN+  A D+ L+  ++
Sbjct  121   PILINPWHGLSAWFHNHVDPTPFEMVQGMSFWRYAGQEPGFNRLFNDGMASDARLVASMV  180

Query  596   LNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEF  775
             +N E K VF+G+ SLVDV GG G  A AIA  FP M+C + DLPHV+A++     EN+  
Sbjct  181   VN-EHKGVFEGITSLVDVGGGTGTTAKAIANSFPHMECTIFDLPHVVANLEVS--ENVRC  237

Query  776   VAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAI-PIREEGGKVIIIDMVMEDP  952
             V G+MFE+IP A+A++LKWI+HDW DE+ VK+LK+CREA+     +  KVIIIDMVM++ 
Sbjct  238   VPGDMFEAIPPADAIILKWILHDWSDEDAVKVLKRCREALGKGEGKKKKVIIIDMVMDNT  297

Query  953   KRTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
             K +D    + QL+ D L+M L   +ERN+ +W KLF  AGF DYKITP LGLRSLIEV+P
Sbjct  298   K-SDKEMVETQLFYDMLMMTLTSGRERNEAEWAKLFVAAGFGDYKITPVLGLRSLIEVYP  356

Query  1133  K  1135
              
Sbjct  357   S  357



>ref|XP_004232928.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
lycopersicum]
Length=357

 Score =   330 bits (847),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 167/358 (47%), Positives = 232/358 (65%), Gaps = 8/358 (2%)
 Frame = +2

Query  68    LHGELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKA  247
             +  E+ +A+AH + H+ S+ +S  L CA+QLGIPD IH+H +PM LS L++ L +   K+
Sbjct  5     MSSEMFEAQAHIYKHAFSFANSMVLGCAIQLGIPDVIHSHKQPMTLSQLVSHLKLPLEKS  64

Query  248   PYIHRLTRFLVHSSVLLVTKS-GGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYV  424
               IHRL R LV+S     T     + E ++ Y LTP  +LL+K E  NL  F     + V
Sbjct  65    DAIHRLMRLLVYSGFFATTDFLDENSESQQGYVLTPSSKLLLKSEIPNLSPFARAMIDPV  124

Query  425   FQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNG  604
                   +LGDWF  ++ +PF TAHG  +W +    P +++VFNEA A DS+  M  L+  
Sbjct  125   MVNPWQSLGDWFLGNETTPFETAHGAPMWKFCDQNPRFSNVFNEAMASDSQ--MMCLVVK  182

Query  605   ESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAG  784
             + K+VF  + SLVDV GG G +A+ I   FP +KC VLDLPHV+A++P  + EN+++V G
Sbjct  183   DCKQVFQEIDSLVDVGGGTGIIANTILAAFPHLKCTVLDLPHVVANMP--DTENLKYVGG  240

Query  785   NMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEG--GKVIIIDMVMEDPKR  958
             +MF SIP+A+A+L   +MH+W DE CVKILK+C EAI  + EG  GKV+IIDMV+ D  +
Sbjct  241   DMFHSIPSADAILFMHVMHNWSDENCVKILKRCGEAIKDKNEGRKGKVLIIDMVL-DRDK  299

Query  959   TDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
              +A   + +L  D L+M L   ++R +K+WEKLF EAGF  YKITP  GLRSLIEVFP
Sbjct  300   EEANMTEVKLIFDVLMMVLVTGRQRTEKEWEKLFLEAGFMSYKITPLFGLRSLIEVFP  357



>ref|XP_011077108.1| PREDICTED: chavicol O-methyltransferase-like [Sesamum indicum]
Length=361

 Score =   330 bits (846),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 163/354 (46%), Positives = 233/354 (66%), Gaps = 7/354 (2%)
 Frame = +2

Query  77    ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPYI  256
             +LL A+AH WNH  S+I S +LKCA++LGIPD IHNHAKP+ LS L+ ALPI   K+ ++
Sbjct  13    QLLHAQAHVWNHLFSFISSMSLKCALELGIPDIIHNHAKPITLSELVHALPIPAGKSHFV  72

Query  257   HRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQKS  436
             +RL R L+HS    V  + GD++ EE Y LTP   LL++   +++  F  +  + V  K 
Sbjct  73    YRLMRILIHSE-FFVRVADGDDDGEEHYWLTPASLLLLRNSPLSMTPFFQLMLDPVMMKP  131

Query  437   CYALGDWFQNDD-PSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESK  613
                + +W  ++   S F   HG  +++Y+  E   N + N+AT+ DS L   VLL  + K
Sbjct  132   FDHISEWLGSEKHSSAFELVHGRSLFEYVGQEAGLNKLLNQATSSDSRLFTHVLLR-DYK  190

Query  614   RVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMF  793
             +V +G+ SLVDV GG G  A AIA+ FP MKC VLDLPHV+  +   N  N+ ++AG+MF
Sbjct  191   QVLEGITSLVDVGGGTGTTAEAIAEAFPDMKCFVLDLPHVVGGLKGTN--NLTYIAGDMF  248

Query  794   ESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREE-GGKVIIIDMVMEDPKRTDAY  970
             E+IP+ +AVL KW+MHDW+DE C+K+LKK +EAI  +++ GGKV+I+DMV++   R D  
Sbjct  249   EAIPSVDAVLFKWVMHDWDDESCLKMLKKSKEAIGGKDKTGGKVMIVDMVLDVNGR-DNK  307

Query  971   YNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
               +   + D  +M     +ER +K+W KLF +AGF++YKITP  GLRSLIEV+P
Sbjct  308   EMETCFFFDIALMPYLTGRERTEKEWAKLFFDAGFTNYKITPAFGLRSLIEVYP  361



>ref|XP_011037442.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=355

 Score =   329 bits (843),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 164/355 (46%), Positives = 229/355 (65%), Gaps = 11/355 (3%)
 Frame = +2

Query  74    GELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPY  253
             GELLQA+ H WNH  ++I+S  LKCAV+LGIPD I  H KPM LS L+ ALPIHPSKA Y
Sbjct  10    GELLQAQTHVWNHLFNFINSMTLKCAVELGIPDVIQKHGKPMTLSELVTALPIHPSKAQY  69

Query  254   IHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQK  433
             +HRL R LVHS             ++E YSLT   RLL+K+   ++R  L    + V  K
Sbjct  70    VHRLMRILVHSGFF-----SQQNLKQEAYSLTQSTRLLLKDNPWSMRTLLLFVLDPVLTK  124

Query  434   SCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESK  613
                 L  WF+ND+ S F  AH    W+Y   +P  N++FN+A A DS L  +V+++ + K
Sbjct  125   PHDCLSTWFRNDEASAFSVAHENTFWEYAGQDPRINNLFNDAMASDSILASKVVVS-KCK  183

Query  614   RVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMF  793
              +F+G+ SLVDV GG G +A  I + FP M C V DLPHV++ +     +N+++V G+MF
Sbjct  184   GIFEGVNSLVDVGGGLGTMAKGIVEAFPHMDCTVFDLPHVVSDLQGS--KNLKYVGGDMF  241

Query  794   ESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIR--EEGGKVIIIDMVMEDPKRTDA  967
             +++P A+A+LLK I+H W DE+CVKIL++C++AI  +  ++ GKVIIIDMV E+    + 
Sbjct  242   QAVPPADAILLKLILHCWRDEDCVKILRRCKQAIMSKGQQKAGKVIIIDMVRENLNGDEG  301

Query  968   YYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSLIEVFP  1132
                + QL+ D  +M      ERN+K+W KLF +AGF +YKI   LG R+LIE++P
Sbjct  302   SI-ETQLFFDLQLMVAASGIERNEKEWAKLFFDAGFLNYKIHSVLGTRALIELYP  355



>dbj|BAI79245.1| O-methyltransferase [Carapichea ipecacuanha]
Length=358

 Score =   329 bits (843),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 176/358 (49%), Positives = 237/358 (66%), Gaps = 20/358 (6%)
 Frame = +2

Query  74    GELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHAKPMPLSNLIAALPIHPSKAPY  253
              ELL+A+ H       +  +AALKCAV+LGIPD I  H KPM LS L +AL I+PSKAP 
Sbjct  10    AELLRAQMHFSTQLFGFHYTAALKCAVKLGIPDAIKQHGKPMNLSELNSALSINPSKAPC  69

Query  254   IHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAFLNICNEYVFQK  433
             IHRL R LV         +G   ++ EC+SLT  GR  +K++ +N+RA + +       K
Sbjct  70    IHRLMRILV--------TAGYFAQENECFSLTSAGRHFLKDDPLNIRALVLLELHPALVK  121

Query  434   SCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSELIMEVLLNGESK  613
                ALG+WFQNDD SPF TAHG+  WDY++ +P    +F+E+ A DS+LI + L+  E +
Sbjct  122   PWIALGEWFQNDDVSPFATAHGKSFWDYVTSDPELRKLFDESMADDSQLIAKALVT-EFR  180

Query  614   RVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNIENMEFVAGNMF  793
              VF+GLKSLVDV GG+G +A AIAK FP +KC V DLP  +A+       N++FVAG+MF
Sbjct  181   YVFEGLKSLVDVGGGSGTLARAIAKAFPNLKCTVCDLPDAVANEHGDG--NLDFVAGDMF  238

Query  794   ESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIREEGGKVIIIDMVMEDPKRTDA--  967
             E +P+A+++LLK I+HDW DE+CV+ILKKCREAIP  + GGKVII+D ++++     A  
Sbjct  239   ERVPSADSILLKHILHDWSDEKCVEILKKCREAIP--KNGGKVIIVDKLLKNRGHGHAEN  296

Query  968   ---YYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYK--ITPTLGLRSLIEV  1126
                   ++ L  D  ++ L   KER++K+W KLFS AGF+DYK  ITP LG  SLIEV
Sbjct  297   EHDEATESPLSCDMEMLVLVNGKERDEKEWAKLFSGAGFNDYKYNITPVLGSTSLIEV  354



>ref|XP_004169298.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cucumis 
sativus]
 gb|KGN43482.1| hypothetical protein Csa_7G039790 [Cucumis sativus]
Length=357

 Score =   329 bits (843),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 172/365 (47%), Positives = 236/365 (65%), Gaps = 17/365 (5%)
 Frame = +2

Query  56    ENGKLHG----ELLQAEAHTWNHSLSYIDSAALKCAVQLGIPDTIHNHA-KPMPLSNLIA  220
             E GK+      ELL+A++H WNH  ++I+S +LKCA+QLGIPD IH+H   P+PLS L++
Sbjct  4     EGGKMLAMGGDELLEAQSHVWNHIFNFINSMSLKCAIQLGIPDAIHSHGPNPVPLSILVS  63

Query  221   ALPIHPSKAPYIHRLTRFLVHSSVLLVTKSGGDEEQEECYSLTPVGRLLVKEEAINLRAF  400
             +L +HP+K  +I+RL R L HS   +        +QEE Y LT   RLL+K+    +  F
Sbjct  64    SLQLHPNKTQFIYRLMRLLTHSGFFV--------QQEEGYILTNSSRLLLKDNPCAVSPF  115

Query  401   LNICNEYVFQKSCYALGDWFQNDDPSPFCTAHGEKIWDYISHEPVYNDVFNEATAKDSEL  580
             L    +         L  WFQ DD +PF TAHG   W Y+ ++P   +VFN   A D+ L
Sbjct  116   LLSMLQPALTDPWQFLSIWFQTDDQTPFETAHGVPFWKYMRNKPKEGEVFNAGMASDARL  175

Query  581   IMEVLLNGESKRVFDGLKSLVDVAGGNGAVASAIAKCFPAMKCIVLDLPHVIASVPAGNI  760
             ++ VLL  + + VF+G++SLVDV GG G VA AI++ FP M+C VLDLP V+A +  G+ 
Sbjct  176   VINVLLE-KHRSVFEGVESLVDVGGGTGTVAKAISQAFPQMECTVLDLPQVVAHL-KGDQ  233

Query  761   ENMEFVAGNMFESIPAANAVLLKWIMHDWEDEECVKILKKCREAIPIR-EEGGKVIIIDM  937
              N ++V G+MF  IP A+ +LLKWI+HDW DEECV+ILKKC+EAI     + GKV++ID+
Sbjct  234   PNFKYVEGDMFTLIPPADTILLKWILHDWSDEECVEILKKCKEAITGSGSKKGKVMVIDL  293

Query  938   VMEDPKRTDAYYNKAQLYMDFLVMALYGSKERNKKQWEKLFSEAGFSDYKITPTLGLRSL  1117
             V+ + K  DA   + QL  D L+M + G KER +K+W KL  EAGF  YKI P L LRSL
Sbjct  294   VLFNTK-NDADSIETQLLYDMLMMIVPGGKEREEKEWAKLIKEAGFRAYKIFPILDLRSL  352

Query  1118  IEVFP  1132
             IE++P
Sbjct  353   IEIYP  357



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3345061407520