BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24056_g1_i1 len=1001 path=[2834:0-194 93:195-232 4410:233-335
234:336-338 237:339-385 4854:386-554 432:555-579 4180:580-786
661:787-811 7322:812-932 7504:933-1000]

Length=1001
                                                                      Score     E

ref|XP_002278294.1|  PREDICTED: trans-resveratrol di-O-methyltran...    266   2e-82   Vitis vinifera
emb|CAN78992.1|  hypothetical protein VITISV_005827                     263   3e-81   Vitis vinifera
ref|XP_002278149.1|  PREDICTED: trans-resveratrol di-O-methyltran...    262   6e-81   Vitis vinifera
ref|XP_002277927.2|  PREDICTED: trans-resveratrol di-O-methyltran...    262   6e-81   Vitis vinifera
emb|CDP19713.1|  unnamed protein product                                261   8e-81   
emb|CAN69333.1|  hypothetical protein VITISV_003273                     259   6e-80   Vitis vinifera
ref|XP_002274019.2|  PREDICTED: trans-resveratrol di-O-methyltran...    259   7e-80   Vitis vinifera
emb|CDP15886.1|  unnamed protein product                                259   7e-80   
ref|XP_003633249.1|  PREDICTED: trans-resveratrol di-O-methyltran...    259   8e-80   
emb|CAN73269.1|  hypothetical protein VITISV_021917                     259   9e-80   Vitis vinifera
ref|XP_002278211.1|  PREDICTED: trans-resveratrol di-O-methyltran...    258   1e-79   Vitis vinifera
emb|CAQ76879.1|  resveratrol O-methyltransferase                        258   2e-79   Vitis vinifera
emb|CAN61955.1|  hypothetical protein VITISV_020020                     258   3e-79   Vitis vinifera
ref|XP_011002666.1|  PREDICTED: trans-resveratrol di-O-methyltran...    257   3e-79   
ref|XP_003633248.1|  PREDICTED: trans-resveratrol di-O-methyltran...    257   4e-79   
gb|AEF97347.1|  O-methyltransferase                                     257   4e-79   
ref|XP_011002662.1|  PREDICTED: trans-resveratrol di-O-methyltran...    257   5e-79   
ref|XP_002262833.1|  PREDICTED: trans-resveratrol di-O-methyltran...    256   9e-79   Vitis vinifera
ref|XP_003527407.1|  PREDICTED: trans-resveratrol di-O-methyltran...    256   1e-78   
ref|XP_011002663.1|  PREDICTED: trans-resveratrol di-O-methyltran...    255   2e-78   
ref|XP_004490696.1|  PREDICTED: trans-resveratrol di-O-methyltran...    255   3e-78   
emb|CDP19709.1|  unnamed protein product                                254   3e-78   
ref|XP_002278057.1|  PREDICTED: trans-resveratrol di-O-methyltran...    254   4e-78   Vitis vinifera
ref|XP_002281368.2|  PREDICTED: trans-resveratrol di-O-methyltran...    254   6e-78   Vitis vinifera
emb|CAN83014.1|  hypothetical protein VITISV_029725                     254   6e-78   Vitis vinifera
ref|NP_001268044.1|  trans-resveratrol di-O-methyltransferase           253   1e-77   
gb|AFX68805.1|  O-metyltransferase                                      253   2e-77   
ref|XP_002278190.1|  PREDICTED: trans-resveratrol di-O-methyltran...    252   3e-77   Vitis vinifera
sp|B6VJS4.2|ROMT_VITVI  RecName: Full=Trans-resveratrol di-O-meth...    252   3e-77   Vitis vinifera
ref|XP_003633245.1|  PREDICTED: trans-resveratrol di-O-methyltran...    251   8e-77   
ref|NP_001267963.1|  O-methyltransferase                                251   1e-76   
emb|CDP19711.1|  unnamed protein product                                250   1e-76   
ref|XP_007043718.1|  Flavonoid o-methyltransferase related              251   2e-76   
emb|CAH05089.1|  putative orcinol O-methyltransferase                   249   3e-76   Rosa odorata var. gigantea
emb|CAJ65632.1|  putative orcinol O-methyltransferase                   249   3e-76   Rosa odorata var. gigantea
emb|CAJ65663.1|  putative orcinol O-methyltransferase                   249   3e-76   Rosa odorata [tea rose]
gb|ABQ02270.2|  O-methyltransferase                                     249   4e-76   Vitis vinifera
ref|XP_002326036.2|  hypothetical protein POPTR_0019s12290g             249   4e-76   Populus trichocarpa [western balsam poplar]
ref|XP_009612081.1|  PREDICTED: trans-resveratrol di-O-methyltran...    249   4e-76   
ref|XP_002525160.1|  o-methyltransferase, putative                      249   5e-76   Ricinus communis
ref|XP_009618299.1|  PREDICTED: trans-resveratrol di-O-methyltran...    249   7e-76   
emb|CAJ65628.1|  putative orcinol O-methyltransferase                   248   8e-76   Rosa odorata var. gigantea
emb|CAJ65630.1|  putative orcinol O-methyltransferase                   248   1e-75   Rosa odorata var. gigantea
ref|XP_011037437.1|  PREDICTED: trans-resveratrol di-O-methyltran...    248   1e-75   
ref|XP_011016237.1|  PREDICTED: trans-resveratrol di-O-methyltran...    248   1e-75   
emb|CAJ65641.1|  putative orcinol O-methyltransferase                   248   1e-75   Rosa marretii
emb|CAJ65597.1|  putative orcinol O-methyltransferase                   247   2e-75   Rosa chinensis [China rose]
emb|CAJ65598.1|  putative orcinol O-methyltransferase                   247   2e-75   Rosa chinensis [China rose]
emb|CAJ65642.1|  putative orcinol O-methyltransferase                   247   2e-75   Rosa marretii
emb|CAJ65601.1|  putative orcinol O-methyltransferase                   247   2e-75   Rosa chinensis [China rose]
ref|XP_011037442.1|  PREDICTED: trans-resveratrol di-O-methyltran...    247   3e-75   
emb|CAJ65604.1|  putative orcinol O-methyltransferase                   247   3e-75   Rosa beggeriana
emb|CAJ65623.1|  putative orcinol O-methyltransferase                   247   3e-75   Rosa gallica [apothecary rose]
emb|CAJ65618.1|  putative orcinol O-methyltransferase                   247   3e-75   Rosa chinensis var. spontanea
emb|CAJ65645.1|  putative orcinol O-methyltransferase                   247   3e-75   Rosa roxburghii [chestnut rose]
emb|CAJ65647.1|  putative orcinol O-methyltransferase                   247   3e-75   Rosa rugosa [Japanese rose]
emb|CAJ65640.1|  putative orcinol O-methyltransferase                   247   3e-75   Rosa majalis [cinnamon rose]
emb|CAJ65646.1|  putative orcinol O-methyltransferase                   246   3e-75   Rosa rugosa [Japanese rose]
emb|CAJ65607.1|  putative orcinol O-methyltransferase                   246   4e-75   Rosa beggeriana
emb|CAJ65625.1|  putative orcinol O-methyltransferase                   246   4e-75   Rosa gallica [apothecary rose]
emb|CAJ65613.1|  putative orcinol O-methyltransferase                   246   4e-75   Rosa chinensis var. spontanea
emb|CAN79968.1|  hypothetical protein VITISV_043678                     247   4e-75   Vitis vinifera
emb|CAJ65612.1|  putative orcinol O-methyltransferase                   246   4e-75   Rosa canina [dog briar]
ref|XP_004303127.1|  PREDICTED: trans-resveratrol di-O-methyltran...    247   5e-75   
gb|AEC13057.1|  orcinol O-methyltransferase-like protein                247   6e-75   
emb|CAH05084.1|  orcinol O-methyltransferase 3                          246   6e-75   Rosa hybrid cultivar
emb|CAJ65624.1|  putative orcinol O-methyltransferase                   246   6e-75   Rosa gallica [apothecary rose]
emb|CAJ65655.1|  putative orcinol O-methyltransferase                   246   7e-75   Rosa lucieae [memorial rose]
emb|CAH05087.1|  orcinol O-methyltransferase 4                          246   8e-75   Rosa hybrid cultivar
emb|CAJ65626.1|  putative orcinol O-methyltransferase                   246   8e-75   Rosa gallica [apothecary rose]
emb|CAJ65638.1|  putative orcinol O-methyltransferase                   246   9e-75   Rosa hugonis
ref|XP_006357086.1|  PREDICTED: tabersonine 16-O-methyltransferas...    246   9e-75   
emb|CAJ65648.1|  putative orcinol O-methyltransferase                   246   9e-75   Rosa woodsii var. ultramontana
emb|CAH05081.1|  putative orcinol O-methyltransferase                   245   9e-75   Rosa hybrid cultivar
emb|CAH05082.1|  putative orcinol O-methyltransferase                   245   9e-75   Rosa hybrid cultivar
emb|CAJ65622.1|  putative orcinol O-methyltransferase                   245   9e-75   Rosa gallica [apothecary rose]
ref|XP_003557042.1|  PREDICTED: trans-resveratrol di-O-methyltran...    246   1e-74   
emb|CAJ65602.1|  putative orcinol O-methyltransferase                   245   1e-74   Rosa banksiae
emb|CAJ65635.1|  putative orcinol O-methyltransferase                   245   1e-74   Rosa odorata var. gigantea
emb|CAJ65609.1|  putative orcinol O-methyltransferase                   245   1e-74   Rosa bracteata [Macartny rose]
ref|XP_006376386.1|  hypothetical protein POPTR_0013s12560g             246   1e-74   
ref|XP_002525159.1|  o-methyltransferase, putative                      245   1e-74   Ricinus communis
emb|CAJ65621.1|  putative orcinol O-methyltransferase                   245   2e-74   Rosa gallica [apothecary rose]
emb|CAJ65620.1|  putative orcinol O-methyltransferase                   245   2e-74   Rosa chinensis var. spontanea
emb|CAH05091.1|  putative orcinol O-methyltransferase                   245   2e-74   Rosa odorata var. gigantea
ref|XP_006376392.1|  hypothetical protein POPTR_0013s12620g             245   2e-74   
ref|XP_006376388.1|  6a-hydroxymaackiain methyltransferase family...    245   2e-74   
emb|CAJ65611.1|  putative orcinol O-methyltransferase                   244   2e-74   Rosa canina [dog briar]
ref|XP_010088036.1|  8-hydroxyquercetin 8-O-methyltransferase           245   2e-74   
ref|XP_006469135.1|  PREDICTED: trans-resveratrol di-O-methyltran...    246   2e-74   
emb|CAJ65617.1|  putative orcinol O-methyltransferase                   244   2e-74   Rosa chinensis var. spontanea
emb|CAH05079.1|  putative orcinol O-methyltransferase                   244   2e-74   Rosa gallica [apothecary rose]
emb|CAJ65615.1|  putative orcinol O-methyltransferase                   244   2e-74   Rosa chinensis var. spontanea
emb|CAJ65610.1|  putative orcinol O-methyltransferase                   244   2e-74   Rosa canina [dog briar]
emb|CAJ65665.1|  putative orcinol O-methyltransferase                   244   3e-74   Rosa odorata [tea rose]
emb|CAJ65614.1|  putative orcinol O-methyltransferase                   244   3e-74   Rosa chinensis var. spontanea
emb|CAJ65643.1|  putative orcinol O-methyltransferase                   244   3e-74   Rosa marretii
ref|XP_006446728.1|  hypothetical protein CICLE_v10015708mg             244   3e-74   
ref|XP_003615973.1|  O-methyltransferase                                244   4e-74   
emb|CAH05083.1|  putative orcinol O-methyltransferase                   244   4e-74   Rosa hybrid cultivar
ref|XP_009778350.1|  PREDICTED: trans-resveratrol di-O-methyltran...    244   4e-74   
emb|CAJ65656.1|  putative orcinol O-methyltransferase                   244   5e-74   Rosa odorata [tea rose]
ref|XP_006376381.1|  6a-hydroxymaackiain methyltransferase family...    244   5e-74   
emb|CAJ65599.1|  putative orcinol O-methyltransferase                   244   5e-74   Rosa chinensis [China rose]
emb|CAH05085.1|  orcinol O-methyltransferase 3                          243   5e-74   Rosa hybrid cultivar
emb|CAD29556.1|  orcinol O-methyltransferase                            243   5e-74   Rosa hybrid cultivar
emb|CAJ65664.1|  putative orcinol O-methyltransferase                   243   6e-74   Rosa odorata [tea rose]
emb|CAJ65633.1|  putative orcinol O-methyltransferase                   243   7e-74   Rosa odorata var. gigantea
ref|XP_003544912.1|  PREDICTED: trans-resveratrol di-O-methyltran...    243   9e-74   
emb|CAJ65606.1|  putative orcinol O-methyltransferase                   243   1e-73   Rosa beggeriana
emb|CAJ65603.1|  putative orcinol O-methyltransferase                   243   1e-73   Rosa banksiae
emb|CAH05086.1|  orcinol O-methyltransferase 4                          243   1e-73   Rosa hybrid cultivar
gb|AAM23004.1|AF502433_1  orcinol O-methyltransferase                   243   1e-73   Rosa hybrid cultivar
emb|CAJ65649.1|  putative orcinol O-methyltransferase                   243   1e-73   Rosa woodsii var. ultramontana
ref|XP_002517827.1|  o-methyltransferase, putative                      243   1e-73   Ricinus communis
emb|CAJ65608.1|  putative orcinol O-methyltransferase                   242   2e-73   Rosa bracteata [Macartny rose]
emb|CAJ65634.1|  putative orcinol O-methyltransferase                   242   2e-73   Rosa odorata var. gigantea
emb|CAJ65600.1|  putative orcinol O-methyltransferase                   242   2e-73   Rosa chinensis [China rose]
gb|KDO39394.1|  hypothetical protein CISIN_1g021867mg                   240   3e-73   
emb|CDP15888.1|  unnamed protein product                                242   3e-73   
emb|CAJ65616.1|  putative orcinol O-methyltransferase                   241   3e-73   Rosa chinensis var. spontanea
emb|CAJ65639.1|  putative orcinol O-methyltransferase                   241   3e-73   Rosa hugonis
ref|XP_004490687.1|  PREDICTED: trans-resveratrol di-O-methyltran...    241   4e-73   
emb|CAJ65627.1|  putative orcinol O-methyltransferase                   241   4e-73   Rosa odorata var. gigantea
sp|B0EXJ8.1|HTOMT_CATRO  RecName: Full=Tabersonine 16-O-methyltra...    241   4e-73   Catharanthus roseus [chatas]
emb|CAJ65631.1|  putative orcinol O-methyltransferase                   241   4e-73   Rosa odorata var. gigantea
emb|CAJ65629.1|  putative orcinol O-methyltransferase                   241   4e-73   Rosa odorata var. gigantea
emb|CAD29555.1|  orcinol O-methyltransferase                            241   4e-73   Rosa hybrid cultivar
ref|XP_006351391.1|  PREDICTED: trans-resveratrol di-O-methyltran...    241   5e-73   
emb|CDP20220.1|  unnamed protein product                                238   5e-73   
emb|CAH05090.1|  putative orcinol O-methyltransferase                   241   5e-73   Rosa odorata var. gigantea
ref|XP_006428632.1|  hypothetical protein CICLE_v10012033mg             241   5e-73   
emb|CAJ65661.1|  putative orcinol O-methyltransferase                   241   5e-73   Rosa odorata [tea rose]
emb|CAJ65605.1|  putative orcinol O-methyltransferase                   241   5e-73   Rosa beggeriana
emb|CAJ65659.1|  putative orcinol O-methyltransferase                   241   6e-73   Rosa odorata [tea rose]
ref|XP_003607523.1|  O-methyltransferase                                241   7e-73   
ref|XP_010097399.1|  8-hydroxyquercetin 8-O-methyltransferase           242   8e-73   
gb|KDP24061.1|  hypothetical protein JCGZ_25718                         241   9e-73   
gb|AAM23005.1|AF502434_1  orcinol O-methyltransferase                   241   1e-72   Rosa hybrid cultivar
ref|XP_010110665.1|  8-hydroxyquercetin 8-O-methyltransferase           241   1e-72   
ref|XP_003544914.1|  PREDICTED: trans-resveratrol di-O-methyltran...    240   1e-72   
emb|CAJ65596.1|  putative orcinol O-methyltransferase                   239   2e-72   Rosa chinensis [China rose]
emb|CAJ65636.1|  putative orcinol O-methyltransferase                   239   2e-72   Rosa odorata var. gigantea
ref|XP_002522501.1|  o-methyltransferase, putative                      240   2e-72   Ricinus communis
ref|XP_006480453.1|  PREDICTED: trans-resveratrol di-O-methyltran...    240   2e-72   
gb|ABK96707.1|  unknown                                                 239   3e-72   Populus trichocarpa x Populus deltoides
gb|AES89720.2|  orcinol O-methyltransferase                             239   4e-72   
emb|CDO96819.1|  unnamed protein product                                236   4e-72   
emb|CAJ65657.1|  putative orcinol O-methyltransferase                   239   4e-72   Rosa odorata [tea rose]
dbj|BAI79244.1|  O-methyltransferase                                    239   4e-72   Carapichea ipecacuanha [ipecac]
ref|XP_002278092.1|  PREDICTED: trans-resveratrol di-O-methyltran...    239   4e-72   Vitis vinifera
ref|XP_006388573.1|  hypothetical protein POPTR_0151s00210g             239   5e-72   
emb|CAJ65660.1|  putative orcinol O-methyltransferase                   238   5e-72   Rosa odorata [tea rose]
emb|CDO96828.1|  unnamed protein product                                236   5e-72   
emb|CAH05088.1|  putative orcinol O-methyltransferase                   238   6e-72   Rosa odorata var. gigantea
dbj|BAJ05387.1|  O-methyltransferase                                    238   8e-72   
dbj|BAJ72588.1|  7'-O-demethylcephaeline/cephaeline O-methyltrans...    238   9e-72   
gb|AFK40900.1|  unknown                                                 238   1e-71   
ref|XP_006376396.1|  hypothetical protein POPTR_0013s12670g             238   1e-71   
ref|XP_002278316.1|  PREDICTED: trans-resveratrol di-O-methyltran...    238   1e-71   Vitis vinifera
ref|XP_007142076.1|  hypothetical protein PHAVU_008G250600g             238   1e-71   
ref|XP_006446726.1|  hypothetical protein CICLE_v10015705mg             238   1e-71   
gb|KHN07780.1|  Tabersonine 16-O-methyltransferase                      236   2e-71   
ref|XP_009764108.1|  PREDICTED: trans-resveratrol di-O-methyltran...    238   2e-71   
ref|XP_008245137.1|  PREDICTED: trans-resveratrol di-O-methyltran...    237   2e-71   
emb|CAH05080.1|  putative orcinol O-methyltransferase                   237   2e-71   Rosa gallica [apothecary rose]
emb|CAJ65666.1|  putative orcinol O-methyltransferase                   237   2e-71   Rosa odorata [tea rose]
dbj|BAJ05384.1|  O-methyltransferase                                    237   2e-71   
ref|XP_009779391.1|  PREDICTED: trans-resveratrol di-O-methyltran...    237   3e-71   
ref|XP_007132709.1|  hypothetical protein PHAVU_011G118100g             236   3e-71   
ref|XP_008229109.1|  PREDICTED: trans-resveratrol di-O-methyltran...    236   5e-71   
emb|CAJ65662.1|  putative orcinol O-methyltransferase                   236   5e-71   Rosa odorata [tea rose]
ref|XP_007142077.1|  hypothetical protein PHAVU_008G250700g             236   7e-71   
ref|XP_002278517.1|  PREDICTED: trans-resveratrol di-O-methyltran...    236   9e-71   Vitis vinifera
ref|XP_009780941.1|  PREDICTED: trans-resveratrol di-O-methyltran...    236   1e-70   
emb|CDP19840.1|  unnamed protein product                                235   1e-70   
ref|XP_004505627.1|  PREDICTED: trans-resveratrol di-O-methyltran...    235   3e-70   
ref|XP_004490686.1|  PREDICTED: trans-resveratrol di-O-methyltran...    234   4e-70   
emb|CAN77288.1|  hypothetical protein VITISV_004161                     232   4e-70   Vitis vinifera
ref|XP_006388414.1|  6a-hydroxymaackiain methyltransferase family...    234   5e-70   
ref|XP_003615966.1|  O-methyltransferase                                234   5e-70   
emb|CDP21787.1|  unnamed protein product                                234   5e-70   
emb|CDP21661.1|  unnamed protein product                                234   6e-70   
ref|XP_007142043.1|  hypothetical protein PHAVU_008G247600g             233   8e-70   
ref|XP_003615967.1|  O-methyltransferase                                233   1e-69   
ref|XP_006368013.1|  PREDICTED: trans-resveratrol di-O-methyltran...    233   1e-69   
ref|XP_003527405.1|  PREDICTED: trans-resveratrol di-O-methyltran...    233   1e-69   
ref|XP_009605623.1|  PREDICTED: myricetin O-methyltransferase-like      233   2e-69   
emb|CDP21836.1|  unnamed protein product                                233   2e-69   
ref|XP_009602136.1|  PREDICTED: trans-resveratrol di-O-methyltran...    232   2e-69   
gb|ABZ89567.1|  O-methyltransferase 3                                   233   2e-69   Humulus lupulus [common hop]
ref|XP_006365444.1|  PREDICTED: trans-resveratrol di-O-methyltran...    231   3e-69   
ref|XP_002517834.1|  o-methyltransferase, putative                      232   3e-69   Ricinus communis
ref|XP_002278208.2|  PREDICTED: trans-resveratrol di-O-methyltran...    231   5e-69   Vitis vinifera
ref|XP_002278398.1|  PREDICTED: trans-resveratrol di-O-methyltran...    231   6e-69   Vitis vinifera
gb|AAB71213.1|  methyltransferase                                       231   7e-69   Prunus armeniaca
ref|XP_006364110.1|  PREDICTED: trans-resveratrol di-O-methyltran...    228   8e-69   
gb|AAR02417.1|  putative O-methyltransferase                            230   8e-69   Catharanthus roseus [chatas]
ref|XP_009625456.1|  PREDICTED: trans-resveratrol di-O-methyltran...    230   9e-69   
gb|KDO40717.1|  hypothetical protein CISIN_1g037127mg                   228   1e-68   
ref|XP_010110664.1|  8-hydroxyquercetin 8-O-methyltransferase           231   1e-68   
emb|CAJ65637.1|  putative orcinol O-methyltransferase                   229   1e-68   Rosa odorata var. gigantea
ref|XP_006469069.1|  PREDICTED: trans-resveratrol di-O-methyltran...    229   1e-68   
ref|XP_011037440.1|  PREDICTED: trans-resveratrol di-O-methyltran...    229   2e-68   
gb|KGN43481.1|  O-methyltransferase                                     228   3e-68   
ref|XP_009780812.1|  PREDICTED: myricetin O-methyltransferase-like      229   3e-68   
ref|XP_008783119.1|  PREDICTED: trans-resveratrol di-O-methyltran...    229   3e-68   
gb|KDP24060.1|  hypothetical protein JCGZ_25717                         229   3e-68   
ref|NP_001267964.1|  O-methyltransferase                                229   4e-68   
ref|XP_006469137.1|  PREDICTED: trans-resveratrol di-O-methyltran...    229   4e-68   
ref|XP_006346268.1|  PREDICTED: trans-resveratrol di-O-methyltran...    229   4e-68   
gb|KHG15351.1|  8-hydroxyquercetin 8-O-methyltransferase                228   6e-68   
ref|XP_006446725.1|  hypothetical protein CICLE_v10015630mg             229   7e-68   
gb|AAR02419.1|  flavonoid 4'-O-methyltransferase                        228   8e-68   Catharanthus roseus [chatas]
ref|XP_008779514.1|  PREDICTED: trans-resveratrol di-O-methyltran...    228   8e-68   
ref|XP_002517832.1|  o-methyltransferase, putative                      228   9e-68   Ricinus communis
ref|XP_006474725.1|  PREDICTED: trans-resveratrol di-O-methyltran...    228   1e-67   
dbj|BAI79245.1|  O-methyltransferase                                    228   1e-67   Carapichea ipecacuanha [ipecac]
ref|XP_004235335.1|  PREDICTED: trans-resveratrol di-O-methyltran...    230   1e-67   
ref|XP_010093978.1|  Tabersonine 16-O-methyltransferase                 227   2e-67   
ref|XP_006366298.1|  PREDICTED: trans-resveratrol di-O-methyltran...    227   2e-67   
ref|XP_008229108.1|  PREDICTED: trans-resveratrol di-O-methyltran...    226   3e-67   
sp|Q8GSN1.1|MOMT_CATRO  RecName: Full=Myricetin O-methyltransfera...    226   3e-67   Catharanthus roseus [chatas]
ref|XP_006469063.1|  PREDICTED: trans-resveratrol di-O-methyltran...    227   4e-67   
gb|AEN94899.1|  desoxyhemigossypol-6-O-methyltransferase                226   4e-67   
ref|XP_002305103.1|  6a-hydroxymaackiain methyltransferase family...    226   5e-67   Populus trichocarpa [western balsam poplar]
gb|KDP24062.1|  hypothetical protein JCGZ_25719                         226   5e-67   
ref|XP_004169299.1|  PREDICTED: trans-resveratrol di-O-methyltran...    224   5e-67   
ref|XP_008229106.1|  PREDICTED: trans-resveratrol di-O-methyltran...    227   6e-67   
ref|XP_004151088.1|  PREDICTED: trans-resveratrol di-O-methyltran...    224   6e-67   
emb|CAA11131.1|  O-methyltransferase                                    226   6e-67   Prunus dulcis [sweet almond]
dbj|BAJ05388.1|  O-methyltransferase                                    226   7e-67   
ref|XP_009594948.1|  PREDICTED: trans-resveratrol di-O-methyltran...    225   8e-67   
ref|XP_002451961.1|  hypothetical protein SORBIDRAFT_04g011090          224   9e-67   Sorghum bicolor [broomcorn]
ref|XP_006469136.1|  PREDICTED: trans-resveratrol di-O-methyltran...    226   1e-66   
ref|XP_010320673.1|  PREDICTED: trans-resveratrol di-O-methyltran...    224   1e-66   
gb|KHN08844.1|  8-hydroxyquercetin 8-O-methyltransferase                224   1e-66   
ref|XP_011001214.1|  PREDICTED: trans-resveratrol di-O-methyltran...    225   2e-66   
ref|XP_004241914.1|  PREDICTED: myricetin O-methyltransferase-like      224   2e-66   
gb|ACV65500.1|  deoxyhemigossypol-6-O-methyltransferase                 224   3e-66   Gossypium hirsutum [American cotton]
ref|XP_010320677.1|  PREDICTED: trans-resveratrol di-O-methyltran...    223   4e-66   
ref|XP_011027757.1|  PREDICTED: trans-resveratrol di-O-methyltran...    224   4e-66   
gb|KDP35397.1|  hypothetical protein JCGZ_10381                         223   4e-66   
ref|XP_007025515.1|  Flavonoid o-methyltransferase related, putative    224   4e-66   
ref|XP_006469138.1|  PREDICTED: trans-resveratrol di-O-methyltran...    229   4e-66   
gb|KDO73905.1|  hypothetical protein CISIN_1g017835mg                   223   5e-66   
ref|XP_002517835.1|  o-methyltransferase, putative                      223   9e-66   Ricinus communis
ref|XP_010040912.1|  PREDICTED: trans-resveratrol di-O-methyltran...    222   1e-65   
ref|XP_004229155.1|  PREDICTED: myricetin O-methyltransferase-lik...    222   1e-65   
ref|XP_006365443.1|  PREDICTED: trans-resveratrol di-O-methyltran...    222   1e-65   
gb|KDP21023.1|  hypothetical protein JCGZ_21494                         222   2e-65   
ref|XP_010111159.1|  6a-hydroxymaackiain methyltransferase 1            223   2e-65   
ref|XP_010058047.1|  PREDICTED: trans-resveratrol di-O-methyltran...    221   3e-65   
gb|KHN07781.1|  Tabersonine 16-O-methyltransferase                      221   3e-65   
gb|KCW75545.1|  hypothetical protein EUGRSUZ_E04305                     221   3e-65   
ref|XP_006356531.1|  PREDICTED: trans-resveratrol di-O-methyltran...    221   4e-65   
ref|XP_002517833.1|  o-methyltransferase, putative                      221   5e-65   Ricinus communis
ref|XP_006452811.1|  hypothetical protein CICLE_v10008718mg             221   5e-65   
ref|XP_008362624.1|  PREDICTED: trans-resveratrol di-O-methyltran...    218   6e-65   
ref|XP_006387382.1|  hypothetical protein POPTR_1124s00200g             216   8e-65   
ref|XP_010093976.1|  Myricetin O-methyltransferase                      220   8e-65   
ref|XP_010916035.1|  PREDICTED: trans-resveratrol di-O-methyltran...    220   8e-65   
ref|XP_006582298.1|  PREDICTED: trans-resveratrol di-O-methyltran...    220   1e-64   
dbj|BAJ05383.1|  O-methyltransferase                                    219   1e-64   
ref|XP_010058046.1|  PREDICTED: trans-resveratrol di-O-methyltran...    219   1e-64   
gb|AIY62760.1|  N-acetylserotonin O-methyltransferase                   219   1e-64   
ref|XP_008364164.1|  PREDICTED: trans-resveratrol di-O-methyltran...    219   1e-64   
ref|XP_002441380.1|  hypothetical protein SORBIDRAFT_09g025570          219   2e-64   Sorghum bicolor [broomcorn]
ref|XP_007025514.1|  Flavonoid o-methyltransferase related              219   2e-64   
ref|XP_009351009.1|  PREDICTED: trans-resveratrol di-O-methyltran...    219   3e-64   
ref|XP_010052409.1|  PREDICTED: trans-resveratrol di-O-methyltran...    218   4e-64   
ref|XP_010109381.1|  Tabersonine 16-O-methyltransferase                 218   5e-64   
ref|XP_004139732.1|  PREDICTED: trans-resveratrol di-O-methyltran...    218   5e-64   
dbj|BAI79243.1|  O-methyltransferase                                    218   5e-64   Carapichea ipecacuanha [ipecac]
ref|XP_004169298.1|  PREDICTED: trans-resveratrol di-O-methyltran...    218   7e-64   
gb|AAX82431.1|  3,5-dimethoxyphenol O-methyltransferase                 218   7e-64   Ruta graveolens
ref|XP_004151735.1|  PREDICTED: trans-resveratrol di-O-methyltran...    218   8e-64   
ref|XP_006364318.1|  PREDICTED: trans-resveratrol di-O-methyltran...    217   9e-64   
ref|XP_008362623.1|  PREDICTED: trans-resveratrol di-O-methyltran...    218   9e-64   
ref|XP_010095219.1|  Tabersonine 16-O-methyltransferase                 214   1e-63   
ref|XP_011077108.1|  PREDICTED: chavicol O-methyltransferase-like       217   2e-63   
ref|XP_004293905.1|  PREDICTED: trans-resveratrol di-O-methyltran...    217   2e-63   
ref|XP_002525163.1|  o-methyltransferase, putative                      216   2e-63   
gb|KCW89599.1|  hypothetical protein EUGRSUZ_A01884                     216   2e-63   
ref|XP_010070255.1|  PREDICTED: trans-resveratrol di-O-methyltran...    216   2e-63   
ref|XP_006377432.1|  6a-hydroxymaackiain methyltransferase family...    217   2e-63   
ref|XP_009345025.1|  PREDICTED: trans-resveratrol di-O-methyltran...    216   2e-63   
ref|XP_010916034.1|  PREDICTED: trans-resveratrol di-O-methyltran...    216   3e-63   
emb|CAN75971.1|  hypothetical protein VITISV_009882                     215   3e-63   
ref|XP_006364328.1|  PREDICTED: trans-resveratrol di-O-methyltran...    216   3e-63   
ref|XP_004248183.1|  PREDICTED: trans-resveratrol di-O-methyltran...    216   3e-63   
ref|XP_008343875.1|  PREDICTED: trans-resveratrol di-O-methyltran...    216   4e-63   
ref|XP_008354304.1|  PREDICTED: trans-resveratrol di-O-methyltran...    216   7e-63   
emb|CDP17644.1|  unnamed protein product                                215   7e-63   
ref|XP_011100233.1|  PREDICTED: 8-hydroxyquercetin 8-O-methyltran...    215   8e-63   
ref|XP_008343876.1|  PREDICTED: trans-resveratrol di-O-methyltran...    216   8e-63   
ref|XP_006346269.1|  PREDICTED: trans-resveratrol di-O-methyltran...    215   9e-63   
ref|XP_006356529.1|  PREDICTED: trans-resveratrol di-O-methyltran...    214   1e-62   
ref|XP_010920170.1|  PREDICTED: trans-resveratrol di-O-methyltran...    214   3e-62   
ref|XP_008392935.1|  PREDICTED: trans-resveratrol di-O-methyltran...    214   3e-62   
ref|XP_007141104.1|  hypothetical protein PHAVU_008G1678001g            209   4e-62   
ref|XP_009344934.1|  PREDICTED: trans-resveratrol di-O-methyltran...    213   4e-62   
ref|XP_007141103.1|  hypothetical protein PHAVU_008G1678001g            209   4e-62   
ref|XP_004303135.1|  PREDICTED: trans-resveratrol di-O-methyltran...    213   4e-62   
emb|CAN69556.1|  hypothetical protein VITISV_027590                     212   4e-62   
ref|XP_010093977.1|  Tabersonine 16-O-methyltransferase                 213   4e-62   
gb|AAR02421.1|  putative O-methyltransferase                            213   6e-62   
ref|XP_009597680.1|  PREDICTED: trans-resveratrol di-O-methyltran...    213   7e-62   
ref|XP_010057350.1|  PREDICTED: trans-resveratrol di-O-methyltran...    214   9e-62   
ref|XP_011100227.1|  PREDICTED: 8-hydroxyquercetin 8-O-methyltran...    212   1e-61   
gb|ACY41220.1|  O-methyltransferase-like protein                        212   1e-61   
gb|KGN43480.1|  hypothetical protein Csa_7G039280                       212   2e-61   
emb|CDP19839.1|  unnamed protein product                                210   2e-61   
ref|XP_004232928.1|  PREDICTED: trans-resveratrol di-O-methyltran...    211   2e-61   
gb|KCW74501.1|  hypothetical protein EUGRSUZ_E03213                     211   3e-61   
ref|XP_008364163.1|  PREDICTED: trans-resveratrol di-O-methyltran...    211   3e-61   
emb|CAN70493.1|  hypothetical protein VITISV_002330                     211   3e-61   
ref|XP_004139733.1|  PREDICTED: LOW QUALITY PROTEIN: trans-resver...    212   3e-61   
gb|AFW60893.1|  O-methyltransferase ZRP4                                211   4e-61   
ref|NP_001168311.1|  uncharacterized protein LOC100382077               210   4e-61   
emb|CDP19712.1|  unnamed protein product                                206   6e-61   
ref|XP_011085639.1|  PREDICTED: chavicol O-methyltransferase-like       210   6e-61   
ref|XP_010920172.1|  PREDICTED: trans-resveratrol di-O-methyltran...    210   7e-61   
ref|XP_011100228.1|  PREDICTED: trans-resveratrol di-O-methyltran...    210   7e-61   
ref|XP_006420642.1|  hypothetical protein CICLE_v10005275mg             210   8e-61   
ref|XP_006420643.1|  hypothetical protein CICLE_v10005276mg             209   8e-61   
dbj|BAA86059.1|  O-methyltransferase                                    210   9e-61   
ref|XP_004170024.1|  PREDICTED: trans-resveratrol di-O-methyltran...    210   1e-60   
ref|XP_011085377.1|  PREDICTED: chavicol O-methyltransferase-like       209   1e-60   
ref|NP_001149121.1|  O-methyltransferase ZRP4                           209   1e-60   
ref|XP_009791021.1|  PREDICTED: trans-resveratrol di-O-methyltran...    210   1e-60   
ref|XP_006471149.1|  PREDICTED: trans-resveratrol di-O-methyltran...    209   1e-60   
ref|XP_002522500.1|  o-methyltransferase, putative                      209   2e-60   
gb|KCW44789.1|  hypothetical protein EUGRSUZ_L01645                     208   2e-60   
ref|XP_006356530.1|  PREDICTED: trans-resveratrol di-O-methyltran...    208   2e-60   
ref|XP_006420638.1|  hypothetical protein CICLE_v10005279mg             208   3e-60   
ref|XP_010920173.1|  PREDICTED: trans-resveratrol di-O-methyltran...    208   4e-60   
gb|AAM97498.1|  O-methyltransferase                                     207   4e-60   
ref|XP_009791022.1|  PREDICTED: trans-resveratrol di-O-methyltran...    209   4e-60   
emb|CAN76576.1|  hypothetical protein VITISV_035390                     204   5e-60   
ref|XP_002441376.1|  hypothetical protein SORBIDRAFT_09g025540          207   7e-60   
ref|XP_009593020.1|  PREDICTED: trans-resveratrol di-O-methyltran...    207   8e-60   
gb|AAR09603.1|  O-methyltransferase                                     207   8e-60   
ref|XP_006489814.1|  PREDICTED: trans-resveratrol di-O-methyltran...    207   9e-60   
ref|XP_010916033.1|  PREDICTED: trans-resveratrol di-O-methyltran...    207   1e-59   
gb|ADZ76434.1|  myricetin O-methyltransferase 2                         206   1e-59   
ref|XP_003615962.1|  O-methyltransferase                                206   1e-59   
ref|XP_011092041.1|  PREDICTED: trans-resveratrol di-O-methyltran...    206   1e-59   
ref|XP_004241912.1|  PREDICTED: trans-resveratrol di-O-methyltran...    206   2e-59   
ref|XP_004232927.1|  PREDICTED: trans-resveratrol di-O-methyltran...    206   2e-59   
ref|XP_011070200.1|  PREDICTED: trans-resveratrol di-O-methyltran...    209   2e-59   
ref|XP_006388574.1|  hypothetical protein POPTR_0151s00220g             205   2e-59   
ref|XP_006364329.1|  PREDICTED: uncharacterized protein LOC102587683    215   2e-59   
ref|XP_010057351.1|  PREDICTED: trans-resveratrol di-O-methyltran...    206   3e-59   
ref|XP_010093975.1|  Isoflavone-7-O-methyltransferase 8                 206   3e-59   
ref|XP_008455485.1|  PREDICTED: trans-resveratrol di-O-methyltran...    206   3e-59   
ref|XP_009376908.1|  PREDICTED: trans-resveratrol di-O-methyltran...    206   5e-59   
ref|XP_008679470.1|  PREDICTED: O-methyltransferase ZRP4-like           206   5e-59   
ref|XP_008359463.1|  PREDICTED: trans-resveratrol di-O-methyltran...    206   6e-59   
gb|KDP21022.1|  hypothetical protein JCGZ_21493                         204   9e-59   
emb|CBI22005.3|  unnamed protein product                                203   1e-58   
ref|XP_011027758.1|  PREDICTED: trans-resveratrol di-O-methyltran...    204   1e-58   
ref|XP_002305104.2|  6a-hydroxymaackiain methyltransferase family...    204   1e-58   
gb|KCW74500.1|  hypothetical protein EUGRSUZ_E03212                     204   1e-58   
ref|XP_003536188.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    203   2e-58   
ref|XP_004961503.1|  PREDICTED: O-methyltransferase ZRP4-like iso...    202   2e-58   
ref|XP_010023968.1|  PREDICTED: trans-resveratrol di-O-methyltran...    203   2e-58   
ref|XP_011091580.1|  PREDICTED: trans-resveratrol di-O-methyltran...    203   2e-58   
ref|XP_002522586.1|  o-methyltransferase, putative                      202   6e-58   
ref|XP_008392936.1|  PREDICTED: trans-resveratrol di-O-methyltran...    202   6e-58   
ref|XP_010111158.1|  Tabersonine 16-O-methyltransferase                 202   7e-58   
ref|XP_011091583.1|  PREDICTED: trans-resveratrol di-O-methyltran...    202   1e-57   
ref|XP_008356011.1|  PREDICTED: trans-resveratrol di-O-methyltran...    199   1e-57   
ref|XP_010920171.1|  PREDICTED: trans-resveratrol di-O-methyltran...    201   1e-57   
ref|XP_008455944.1|  PREDICTED: trans-resveratrol di-O-methyltran...    201   2e-57   
ref|XP_006421002.1|  hypothetical protein CICLE_v10006550mg             200   3e-57   
ref|XP_003536186.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    200   3e-57   
ref|XP_002278127.1|  PREDICTED: trans-resveratrol di-O-methyltran...    200   3e-57   
gb|KDP35391.1|  hypothetical protein JCGZ_10375                         200   3e-57   
sp|Q93WU3.1|CVMT1_OCIBA  RecName: Full=Chavicol O-methyltransfera...    200   4e-57   
ref|XP_008455943.1|  PREDICTED: trans-resveratrol di-O-methyltran...    201   4e-57   
gb|AGQ21572.1|  flavone 8-O-methyltransferase                           199   6e-57   
gb|ADO16249.1|  chavicol O-methyltransferase                            199   6e-57   
gb|KDO75191.1|  hypothetical protein CISIN_1g018205mg                   199   7e-57   
ref|XP_004151906.1|  PREDICTED: trans-resveratrol di-O-methyltran...    199   1e-56   
ref|XP_011001215.1|  PREDICTED: trans-resveratrol di-O-methyltran...    199   1e-56   
ref|XP_008788394.1|  PREDICTED: trans-resveratrol di-O-methyltran...    199   1e-56   
ref|XP_007132755.1|  hypothetical protein PHAVU_011G1223001g            194   1e-56   
ref|XP_004158564.1|  PREDICTED: LOW QUALITY PROTEIN: trans-resver...    199   1e-56   
gb|KHN30531.1|  Isoflavone 7-O-methyltransferase                        198   1e-56   
ref|XP_008788395.1|  PREDICTED: trans-resveratrol di-O-methyltran...    199   1e-56   
ref|NP_001158962.1|  O-methyltransferase ZRP4                           199   1e-56   
ref|XP_004961502.1|  PREDICTED: O-methyltransferase ZRP4-like iso...    199   2e-56   
ref|XP_009597678.1|  PREDICTED: trans-resveratrol di-O-methyltran...    200   2e-56   
ref|XP_003555535.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    198   2e-56   
ref|XP_008778275.1|  PREDICTED: trans-resveratrol di-O-methyltran...    198   2e-56   
ref|XP_004987342.1|  PREDICTED: O-methyltransferase ZRP4-like iso...    196   2e-56   
dbj|BAI77794.1|  chavicol O-methyltransferase                           198   3e-56   
ref|XP_008677433.1|  PREDICTED: O-methyltransferase ZRP4 isoform X1     198   3e-56   
ref|XP_003536187.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    197   3e-56   
ref|XP_011091579.1|  PREDICTED: trans-resveratrol di-O-methyltran...    197   4e-56   
ref|XP_003615968.1|  O-methyltransferase                                196   7e-56   
ref|XP_003574581.2|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...    197   7e-56   
ref|XP_004975403.1|  PREDICTED: 5-pentadecatrienyl resorcinol O-m...    197   7e-56   
ref|XP_008649874.1|  PREDICTED: O-methyltransferase ZRP4-like           196   8e-56   
ref|XP_008466961.1|  PREDICTED: trans-resveratrol di-O-methyltran...    194   1e-55   
ref|XP_008649876.1|  PREDICTED: O-methyltransferase ZRP4-like           196   1e-55   
gb|ACU20151.1|  unknown                                                 196   1e-55   
ref|XP_003556407.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    196   1e-55   
ref|XP_010052318.1|  PREDICTED: trans-resveratrol di-O-methyltran...    196   1e-55   
emb|CAN75970.1|  hypothetical protein VITISV_009881                     196   1e-55   
ref|XP_010260367.1|  PREDICTED: trans-resveratrol di-O-methyltran...    196   1e-55   
gb|KEH29280.1|  isoflavone-7-O-methyltransferase                        196   2e-55   
gb|KDP24059.1|  hypothetical protein JCGZ_25716                         192   2e-55   
ref|XP_004961504.1|  PREDICTED: O-methyltransferase ZRP4-like           196   2e-55   
ref|NP_001140810.1|  uncharacterized protein LOC100272885               196   3e-55   
gb|KEH29286.1|  isoflavone-7-O-methyltransferase                        195   3e-55   
gb|ABD83947.1|  IOMT 8                                                  195   3e-55   
sp|Q93WU2.1|EOMT1_OCIBA  RecName: Full=Eugenol O-methyltransferas...    195   4e-55   
ref|XP_006377431.1|  6a-hydroxymaackiain methyltransferase family...    195   4e-55   
gb|AFK47832.1|  unknown                                                 195   4e-55   
ref|XP_011091736.1|  PREDICTED: trans-resveratrol di-O-methyltran...    199   5e-55   
ref|XP_009398848.1|  PREDICTED: trans-resveratrol di-O-methyltran...    194   6e-55   
ref|XP_010052398.1|  PREDICTED: trans-resveratrol di-O-methyltran...    194   7e-55   
ref|XP_011091578.1|  PREDICTED: trans-resveratrol di-O-methyltran...    194   7e-55   
ref|XP_010023967.1|  PREDICTED: trans-resveratrol di-O-methyltran...    194   7e-55   
ref|XP_008359464.1|  PREDICTED: trans-resveratrol di-O-methyltran...    194   1e-54   
gb|AJD20223.1|  norcoclaurine 6-O-methyltransferase                     194   1e-54   
gb|KEH30963.1|  isoflavone-7-O-methyltransferase                        193   2e-54   
ref|XP_004987341.1|  PREDICTED: O-methyltransferase ZRP4-like iso...    194   2e-54   
ref|XP_004249745.2|  PREDICTED: trans-resveratrol di-O-methyltran...    191   2e-54   
gb|KHN05026.1|  Isoflavone 7-O-methyltransferase                        192   2e-54   
gb|ABD83946.1|  IOMT 7                                                  193   2e-54   
gb|KHN30530.1|  Isoflavone 7-O-methyltransferase                        197   2e-54   
ref|XP_010070166.1|  PREDICTED: trans-resveratrol di-O-methyltran...    193   2e-54   
ref|XP_009628719.1|  PREDICTED: trans-resveratrol di-O-methyltran...    192   3e-54   
sp|P0DH60.1|M3OM2_PEA  RecName: Full=(+)-6a-hydroxymaackiain 3-O-...    192   4e-54   
gb|KEH29290.1|  isoflavone-7-O-methyltransferase                        192   4e-54   
ref|XP_004252468.1|  PREDICTED: trans-resveratrol di-O-methyltran...    192   5e-54   
ref|XP_006489813.1|  PREDICTED: 8-hydroxyquercetin 8-O-methyltran...    192   6e-54   
ref|XP_008778001.1|  PREDICTED: trans-resveratrol di-O-methyltran...    192   6e-54   
ref|XP_010694747.1|  PREDICTED: trans-resveratrol di-O-methyltran...    192   7e-54   
ref|XP_008807987.1|  PREDICTED: trans-resveratrol di-O-methyltran...    191   8e-54   
gb|KCW89595.1|  hypothetical protein EUGRSUZ_A01877                     192   8e-54   
gb|EYU30782.1|  hypothetical protein MIMGU_mgv1a021078mg                191   1e-53   
gb|KCW74012.1|  hypothetical protein EUGRSUZ_E02637                     190   1e-53   
ref|XP_007143925.1|  hypothetical protein PHAVU_007G114000g             191   1e-53   
ref|XP_004163430.1|  PREDICTED: LOW QUALITY PROTEIN: trans-resver...    191   1e-53   
ref|XP_010689977.1|  PREDICTED: trans-resveratrol di-O-methyltran...    191   2e-53   
ref|NP_001241397.1|  uncharacterized protein LOC100808660               186   2e-53   
ref|XP_006468348.1|  PREDICTED: trans-resveratrol di-O-methyltran...    190   2e-53   
sp|Q6VMW0.1|Q8OMT_MENPI  RecName: Full=8-hydroxyquercetin 8-O-met...    190   3e-53   
gb|KCW89594.1|  hypothetical protein EUGRSUZ_A018761                    187   3e-53   
sp|O24305.1|M3OM1_PEA  RecName: Full=(+)-6a-hydroxymaackiain 3-O-...    190   3e-53   
ref|XP_003622357.1|  Isoflavone-7-O-methyltransferase                   189   5e-53   
gb|EMT10452.1|  O-methyltransferase ZRP4                                189   6e-53   
ref|XP_006376394.1|  hypothetical protein POPTR_0013s12650g             184   6e-53   
gb|ABD83944.1|  IOMT 4                                                  189   6e-53   
ref|XP_010057348.1|  PREDICTED: trans-resveratrol di-O-methyltran...    189   7e-53   
ref|XP_008792251.1|  PREDICTED: trans-resveratrol di-O-methyltran...    189   8e-53   
ref|XP_006448856.1|  hypothetical protein CICLE_v10015723mg             188   1e-52   
gb|EMS45258.1|  O-methyltransferase ZRP4                                187   2e-52   
ref|XP_007148101.1|  hypothetical protein PHAVU_006G180900g             187   2e-52   
ref|XP_004489528.1|  PREDICTED: isoflavone-7-O-methyltransferase ...    187   2e-52   
ref|XP_009396879.1|  PREDICTED: trans-resveratrol di-O-methyltran...    187   2e-52   
ref|XP_010938927.1|  PREDICTED: trans-resveratrol di-O-methyltran...    187   3e-52   
ref|XP_003556405.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    187   3e-52   
ref|XP_006449423.1|  hypothetical protein CICLE_v10015724mg             187   3e-52   
gb|KCW74499.1|  hypothetical protein EUGRSUZ_E03211                     187   5e-52   
ref|XP_003608210.1|  Isoflavone-7-O-methyltransferase                   186   5e-52   
gb|EYU30737.1|  hypothetical protein MIMGU_mgv1a009866mg                186   6e-52   
gb|KCW59786.1|  hypothetical protein EUGRSUZ_H02535                     186   6e-52   
ref|XP_008778546.1|  PREDICTED: trans-resveratrol di-O-methyltran...    186   7e-52   
ref|XP_006467714.1|  PREDICTED: isoflavone 4'-O-methyltransferase...    186   7e-52   
ref|XP_010070184.1|  PREDICTED: trans-resveratrol di-O-methyltran...    186   7e-52   
ref|XP_008455942.1|  PREDICTED: trans-resveratrol di-O-methyltran...    186   8e-52   
ref|XP_010680776.1|  PREDICTED: trans-resveratrol di-O-methyltran...    186   8e-52   
dbj|BAK06736.1|  predicted protein                                      186   8e-52   
ref|XP_006492044.1|  PREDICTED: isoflavone 7-O-methyltransferase-...    186   9e-52   
ref|XP_008465175.1|  PREDICTED: trans-resveratrol di-O-methyltran...    185   9e-52   
sp|O22309.1|7OMT9_MEDSA  RecName: Full=Isoflavone-7-O-methyltrans...    186   9e-52   
sp|Q84KK4.1|I4OMT_LOTJA  RecName: Full=Isoflavone 4'-O-methyltran...    186   9e-52   
ref|XP_004505105.1|  PREDICTED: isoflavone 4'-O-methyltransferase...    186   9e-52   
ref|NP_001241010.1|  uncharacterized protein LOC100812688               186   1e-51   
gb|AAB88294.1|  o-methytransferase                                      185   1e-51   
gb|KGN44538.1|  hypothetical protein Csa_7G328260                       185   2e-51   
sp|O24529.1|7OMT8_MEDSA  RecName: Full=Isoflavone-7-O-methyltrans...    185   2e-51   
ref|XP_003533873.1|  PREDICTED: isoflavone-7-O-methyltransferase ...    185   2e-51   
sp|O22308.1|7OMT6_MEDSA  RecName: Full=Isoflavone-7-O-methyltrans...    185   2e-51   
ref|XP_003622356.1|  Isoflavone-7-O-methyltransferase                   184   4e-51   
ref|XP_006467715.1|  PREDICTED: isoflavone 4'-O-methyltransferase...    184   4e-51   
emb|CDP21582.1|  unnamed protein product                                184   4e-51   
gb|ABJ88947.1|  coniferyl alcohol 9-O-methyltransferase                 184   6e-51   
ref|XP_002461690.1|  hypothetical protein SORBIDRAFT_02g006645          182   6e-51   
dbj|BAJ96211.1|  predicted protein                                      184   7e-51   
emb|CAA54616.1|  flavonoid 7-O-methyltransferase                        184   7e-51   
gb|EMT23556.1|  O-methyltransferase ZRP4                                184   7e-51   
ref|XP_010231163.1|  PREDICTED: O-methyltransferase ZRP4-like iso...    184   7e-51   
gb|EMT10454.1|  O-methyltransferase ZRP4                                184   8e-51   
gb|EAZ42206.1|  hypothetical protein OsJ_26771                          184   9e-51   



>ref|XP_002278294.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   266 bits (679),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/253 (51%), Positives = 170/253 (67%), Gaps = 6/253 (2%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            E++ A+A  WNHI N+I+S +LKCA+ +GIPD+IHNHGKPM    L++ LP+HP ++  +
Sbjct  11   ELLHAQAHVWNHIFNFINSMSLKCAIQLGIPDIIHNHGKPMTFPELVAKLPVHPKRSQCV  70

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
            +RL R LVHSG L      R    +QEE Y LT A RL++ DD S+++R F+   +  V 
Sbjct  71   YRLMRILVHSGFLAAQ---RVQQGEQEEGYVLTDASRLLLMDD-SLSIRPFLLAMLDPVL  126

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGE  726
             K  + L  WF+NDDP+PF TAH Q  WDY  HE   N+ FNEAMA DS L++  LL  +
Sbjct  127  TKPWHYLSAWFQNDDPTPFHTAHEQPFWDYAGHEPQLNNFFNEAMASDSRLVISVLL--K  184

Query  727  SSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDM  906
              K +F+G+ SLVDV GG G VA AIA  FP + CTVLDLPHV+A     +N+ +  GDM
Sbjct  185  EGKGLFEGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQESKNLNYFAGDM  244

Query  907  FESIPTANAVLLK  945
            FE+IP A+A+LLK
Sbjct  245  FEAIPPADAILLK  257



>emb|CAN78992.1| hypothetical protein VITISV_005827 [Vitis vinifera]
Length=357

 Score =   263 bits (671),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/253 (50%), Positives = 169/253 (67%), Gaps = 6/253 (2%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            E++ A+A  WNHI N+I+S +LKCA+ +GIPD+IHNHGKPM    L++ LP+HP ++  +
Sbjct  11   ELLHAQAHVWNHIFNFINSMSLKCAIQLGIPDIIHNHGKPMTFPELVAKLPVHPKRSQCV  70

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
            +RL R LVHSG L      R    +QEE Y LT A RL++ DD S+++R F+   +  V 
Sbjct  71   YRLMRILVHSGFLAAQ---RVQQGEQEEGYVLTDASRLLLMDD-SLSIRPFLLAMLDPVL  126

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGE  726
             K  + L  WF+NDDP+PF TAH Q  WDY  HE   N+ FNEAMA DS L++  LL  +
Sbjct  127  TKPWHYLSAWFQNDDPTPFHTAHEQPFWDYAGHEPQLNNFFNEAMASDSRLVISVLL--K  184

Query  727  SSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDM  906
              K +F+G+ SLVDV GG G VA AIA  FP + CTVLD PHV+A     +N+ +  GDM
Sbjct  185  EGKGLFEGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDPPHVVAGLQESKNLNYFAGDM  244

Query  907  FESIPTANAVLLK  945
            FE+IP A+A+LLK
Sbjct  245  FEAIPPADAILLK  257



>ref|XP_002278149.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   262 bits (669),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 128/252 (51%), Positives = 175/252 (69%), Gaps = 6/252 (2%)
 Frame = +1

Query  190  VVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYIH  369
            ++QA+A  WNH +N+++S  LKCAV +GIPD I+NHG+P+ LS L++AL I+P KAP +H
Sbjct  12   LLQAQAHVWNHTMNFVNSMALKCAVRLGIPDAINNHGQPITLSELVTALSINPIKAPCLH  71

Query  370  RLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVYQ  549
            RL R LVHSG        + D ++QE+ YSLT A R ++  DE  +    + + +     
Sbjct  72   RLMRVLVHSGFF---AQQQADHNEQEQLYSLTYASRFLL-KDEPTSGAPLLLVQVDPHLT  127

Query  550  KSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGES  729
              C+ L DWFRN DP+PF TA+G+  WDY +HE  +N+ FNEAMA DS+LI   ++ GE 
Sbjct  128  NPCHFLSDWFRNSDPTPFVTAYGKPFWDYAAHEPKFNNFFNEAMASDSQLIASVVV-GE-  185

Query  730  SKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDMF  909
             K+VF G++SL+DV GG GT+A  IAK FP +KCTV D PHV+A     EN+EFVGGD+F
Sbjct  186  CKEVFRGLSSLIDVGGGTGTMAKVIAKAFPHLKCTVFDQPHVVANLQGGENLEFVGGDIF  245

Query  910  ESIPTANAVLLK  945
            E+IP A+A+LLK
Sbjct  246  EAIPPADAILLK  257



>ref|XP_002277927.2| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   262 bits (669),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 125/254 (49%), Positives = 170/254 (67%), Gaps = 6/254 (2%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPY  363
            +E++QA+A  WNHI N+++S +LKCA+ +GIPD+IHNHGKPM L  L++ LP+HP K  Y
Sbjct  10   SELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDIIHNHGKPMTLPQLVAKLPVHPKKTQY  69

Query  364  IHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYV  543
            ++RL R LV S         R    ++EE Y LT A RL++ DD S+++R F+   +   
Sbjct  70   VYRLMRVLVQSDFFAAQ---RAQQSEEEEGYVLTHASRLLLKDD-SLSVRPFLLAMLDPT  125

Query  544  YQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSG  723
              K  + +  WF+NDDP+PF TAH + +WDY  HE   N  FNEAMA D+ L+   L+  
Sbjct  126  LTKPWHYVSAWFQNDDPTPFDTAHERTLWDYAGHEPQLNYFFNEAMASDARLVTSVLV--  183

Query  724  ESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGD  903
            +  K VF+G+ SLVDV GG GTVA AIA  FP +KCTVLDLPHV+A     +N+ +  GD
Sbjct  184  KEGKGVFEGLNSLVDVGGGTGTVAKAIANAFPHLKCTVLDLPHVVAGLQGSKNLNYFAGD  243

Query  904  MFESIPTANAVLLK  945
            MFE+IP A+A+LLK
Sbjct  244  MFEAIPPADAILLK  257



>emb|CDP19713.1| unnamed protein product [Coffea canephora]
Length=350

 Score =   261 bits (667),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 129/256 (50%), Positives = 174/256 (68%), Gaps = 13/256 (5%)
 Frame = +1

Query  178  NENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKA  357
            N  E++ A+    N +LN+  SA+LKCA+++GIP+ I+ HGKP+ LS L+SALP++PSKA
Sbjct  6    NLTELLAAQNHVRNQMLNFRKSASLKCAIELGIPEAINQHGKPITLSELVSALPVNPSKA  65

Query  358  PYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIG  537
             +I+RL RFL  +G  ++          Q++ Y+LT AGRL++ DD   NLRA +     
Sbjct  66   SHIYRLMRFLSKAGFFVL----------QDQCYALTAAGRLLLKDD-PFNLRALIFFMSD  114

Query  538  YVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALL  717
             V  K   SL +WFRNDDP+PF TAHG+  W Y + E  + + FNEAMA DS  IV+ ++
Sbjct  115  PVLVKPWNSLTEWFRNDDPAPFDTAHGKNFWAYAAEEPNFANRFNEAMANDSTFIVQVMM  174

Query  718  SGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVG  897
            +    K VFDG+TSLVDV GG GTVA AIA+ FP ++C V DLPHVIAC    EN++FV 
Sbjct  175  T--RCKFVFDGLTSLVDVGGGTGTVARAIAQNFPNLECVVCDLPHVIACQEGTENLDFVA  232

Query  898  GDMFESIPTANAVLLK  945
            GDM E +PTA+A+LLK
Sbjct  233  GDMLEKVPTADAILLK  248



>emb|CAN69333.1| hypothetical protein VITISV_003273 [Vitis vinifera]
Length=350

 Score =   259 bits (662),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 124/254 (49%), Positives = 169/254 (67%), Gaps = 6/254 (2%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPY  363
            +E++QA+A  WNHI N+++S +LKCA+ +GIPD+IHNHGKPM L  L++ LP+HP K  Y
Sbjct  3    SELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDIIHNHGKPMTLPQLVAKLPVHPKKTQY  62

Query  364  IHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYV  543
            ++RL R LV S         R    ++EE Y LT A RL++ DD S+++R F+   +   
Sbjct  63   VYRLMRVLVQSDFFAA---PRAQQSEEEEGYVLTHASRLLLKDD-SLSVRPFLLAMLDPT  118

Query  544  YQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSG  723
              K  + +  WF+NDDP+PF TAH + +WDY  HE   N  FNEAMA D+ L+   L+  
Sbjct  119  LTKPWHYVSAWFQNDDPTPFDTAHERTLWDYAGHEPQLNYXFNEAMASDARLVTSVLV--  176

Query  724  ESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGD  903
            +  K VF+G+ SLVDV GG GTVA AIA  FP + CTVLDLPHV+A     +N+ +  GD
Sbjct  177  KEGKGVFEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGD  236

Query  904  MFESIPTANAVLLK  945
            MFE+IP A+A+LLK
Sbjct  237  MFEAIPPADAILLK  250



>ref|XP_002274019.2| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   259 bits (662),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 124/254 (49%), Positives = 169/254 (67%), Gaps = 6/254 (2%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPY  363
            +E++QA+A  WNHI N+++S +LKCA+ +GIPD+IHNHGKPM L  L++ LP+HP K  Y
Sbjct  10   SELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKKTQY  69

Query  364  IHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYV  543
            ++RL R LV S         R    ++EE Y LT A RL++ DD S+++R F+   +   
Sbjct  70   VYRLMRVLVQSDFFAAQ---RAQQSEEEEGYVLTHASRLLLKDD-SLSVRPFLLAMLDPT  125

Query  544  YQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSG  723
              K  + +  WF+NDDP+PF TAH + +WDY  HE   N  FNEAMA D+ L+   L+  
Sbjct  126  LTKPWHYVSAWFQNDDPTPFDTAHERTLWDYAGHEPQLNYFFNEAMASDARLVTSVLV--  183

Query  724  ESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGD  903
            +  K VF+G+ SLVDV GG GTVA AIA  FP + CTVLDLPHV+A     +N+ +  GD
Sbjct  184  KEGKGVFEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGD  243

Query  904  MFESIPTANAVLLK  945
            MFE+IP A+A+LLK
Sbjct  244  MFEAIPPADAILLK  257



>emb|CDP15886.1| unnamed protein product [Coffea canephora]
Length=348

 Score =   259 bits (661),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 131/256 (51%), Positives = 174/256 (68%), Gaps = 13/256 (5%)
 Frame = +1

Query  178  NENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKA  357
            N  E++ A+    N +LN+  SA+LKCA+++GIPD I+ HGKP+ LS L+SALPI+PSKA
Sbjct  6    NLTELLAAQNHVGNQMLNFRKSASLKCAIELGIPDAINQHGKPITLSELVSALPINPSKA  65

Query  358  PYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIG  537
             +I+RL RFL ++G  ++          Q++ Y+LT AGRL++  +E  NLRAF+     
Sbjct  66   NHIYRLMRFLSNAGFFVL----------QDQGYALTAAGRLLL-KEEPFNLRAFIFYMSD  114

Query  538  YVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALL  717
             V  K   SL +WFRNDDPSPF TAHG+  W Y + E  + +LFNEAMA DS LIV+ ++
Sbjct  115  PVLVKPWNSLTEWFRNDDPSPFHTAHGKNFWAYAAEEPNFANLFNEAMANDSTLIVQVMM  174

Query  718  SGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVG  897
            +    K VFDG+TSL DV GG G VA AIA+ FP +KC V DLPHVIA     EN++FV 
Sbjct  175  T--QCKFVFDGLTSLADVGGGTGAVARAIAQNFPNLKCVVCDLPHVIAGQEGTENLDFVA  232

Query  898  GDMFESIPTANAVLLK  945
            GDM E +P A+A+LLK
Sbjct  233  GDMLEKVPAADAILLK  248



>ref|XP_003633249.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score =   259 bits (661),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 125/253 (49%), Positives = 169/253 (67%), Gaps = 6/253 (2%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            E++ A+A  WNHILN+I S +LKCA+ +GIPD+IHNHGKPM L  L++ LP+HP ++  +
Sbjct  11   ELLHAQAHVWNHILNFIKSVSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
            +RL R LVHSG L      R    ++EE Y LT A RL++ DD S+++R  +   +  + 
Sbjct  71   YRLMRILVHSGFLAAQ---RVQQGEEEEGYVLTDASRLLLMDD-SLSIRPLLLAMLDPIL  126

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGE  726
             K  + L  WF+NDDP+PF TAH +  WDY  HE   N+ FNEAMA D+ L+   LL  +
Sbjct  127  TKPWHYLSAWFQNDDPTPFHTAHERPFWDYAGHEPQLNNFFNEAMASDARLVTSVLL--K  184

Query  727  SSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDM  906
              K VF+G+ SLVDV GG G VA AIA  FP + CTVLDLPHV+A     +N+ +  GD+
Sbjct  185  EGKGVFEGLNSLVDVGGGTGQVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDI  244

Query  907  FESIPTANAVLLK  945
            FE+IP A+A+LLK
Sbjct  245  FEAIPPADAILLK  257



>emb|CAN73269.1| hypothetical protein VITISV_021917 [Vitis vinifera]
Length=357

 Score =   259 bits (661),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 127/252 (50%), Positives = 174/252 (69%), Gaps = 6/252 (2%)
 Frame = +1

Query  190  VVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYIH  369
            ++QA+A  WNH +N+++S  LKCAV +GIPD I+NHG+P+ LS L++AL I+P KAP +H
Sbjct  12   LLQAQAHVWNHTMNFVNSMALKCAVRLGIPDAINNHGQPITLSELVTALSINPIKAPCLH  71

Query  370  RLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVYQ  549
            RL R LV SG        + D ++QE+ YSLT A R ++  DE  +    + + +     
Sbjct  72   RLMRVLVXSGFF---AQQQADHNEQEQLYSLTYASRFLL-KDEPTSGAPLLLVQVDPHLT  127

Query  550  KSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGES  729
              C+ L DWFRN DP+PF TA+G+  WDY +HE  +N+ FNEAMA DS+LI   ++ GE 
Sbjct  128  NPCHFLSDWFRNSDPTPFVTAYGKPFWDYAAHEPKFNNFFNEAMASDSQLIASVVV-GEC  186

Query  730  SKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDMF  909
             K+VF G++SL+DV GG GT+A  IAK FP +KCTV D PHV+A     EN+EFVGGD+F
Sbjct  187  -KEVFRGLSSLIDVGGGTGTMAKVIAKAFPHLKCTVFDQPHVVANLQGGENLEFVGGDIF  245

Query  910  ESIPTANAVLLK  945
            E+IP A+A+LLK
Sbjct  246  EAIPPADAILLK  257



>ref|XP_002278211.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   258 bits (660),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/254 (49%), Positives = 171/254 (67%), Gaps = 6/254 (2%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPY  363
            +E++ A+A  WNHI N+I+S +LKCA+ +GIPD+IHNHGKPM L  L++ LPIHP K   
Sbjct  10   SELLHAQAHVWNHIFNFINSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPIHPKKVWC  69

Query  364  IHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYV  543
            ++RL R LV SG     K    ++ +QEE Y LT A RL++ DD  +++R F+   +  +
Sbjct  70   VYRLMRILVQSGFFARQKV---EESEQEEGYVLTHASRLLLEDD-PLSVRPFLLAMLDPI  125

Query  544  YQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSG  723
              K  + +  WF+NDDP+PF TAHG+  WDY  HE   N+ FNEAMA D+ L+   L+  
Sbjct  126  LTKPWHYVSAWFQNDDPTPFDTAHGRTFWDYGGHEPKINNFFNEAMASDARLVTSVLI--  183

Query  724  ESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGD  903
            +  K VF+G+ SLVDV GG GTVA AIA  FP + CTV DLPHV+A     +N+ ++GGD
Sbjct  184  KDCKGVFEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVFDLPHVVAGLEGSKNLNYLGGD  243

Query  904  MFESIPTANAVLLK  945
            MF+ IP A+A+LLK
Sbjct  244  MFKGIPPADAILLK  257



>emb|CAQ76879.1| resveratrol O-methyltransferase [Vitis vinifera]
Length=357

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/253 (50%), Positives = 167/253 (66%), Gaps = 6/253 (2%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            E++ A+A  WNHI N+I S +LKCA+ +GIPD+IHNHGKPM L  L++ LP+HP ++  +
Sbjct  11   ELLHAQAHVWNHIFNFIKSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
            +RL R LVHSG L      R    K+EE Y LT A RL++ DD S+++R  V   +  + 
Sbjct  71   YRLMRILVHSGFLAAQ---RVQQGKEEEGYVLTDASRLLLMDD-SLSIRPLVLAMLDPIL  126

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGE  726
             K  + L  WF+NDDP+PF TAH +  WDY  HE   N+ FNEAMA D+ L+   LL  +
Sbjct  127  TKPWHYLSAWFQNDDPTPFHTAHERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLL--K  184

Query  727  SSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDM  906
              + VF G+ SLVDV GG G VA AIA  FP + CTVLDLPHV+A     +N+ +  GDM
Sbjct  185  EGQGVFAGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDM  244

Query  907  FESIPTANAVLLK  945
            FE+IP A+A+LLK
Sbjct  245  FEAIPPADAILLK  257



>emb|CAN61955.1| hypothetical protein VITISV_020020 [Vitis vinifera]
Length=357

 Score =   258 bits (658),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/254 (49%), Positives = 170/254 (67%), Gaps = 6/254 (2%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPY  363
            +E++ A+A  WNHI N+I+S +LKCA+ +GIPD+IHNHGKPM L  L++ LPIHP K   
Sbjct  10   SELLHAQAHVWNHIFNFINSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPIHPKKVWC  69

Query  364  IHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYV  543
            ++RL R LV SG     K    ++ +QEE Y LT A RL++ DD  +++R F+   +  +
Sbjct  70   VYRLMRILVQSGFFARQKV---EESEQEEGYVLTHASRLLLEDD-PLSVRPFLLAMLDPI  125

Query  544  YQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSG  723
              K  + +  WF+NDDP+PF TAHG   WDY  HE   N+ FNEAMA D+ L+   L+  
Sbjct  126  LTKPWHYVSAWFQNDDPTPFDTAHGXTFWDYGGHEPKJNNFFNEAMASDARLVTSXLI--  183

Query  724  ESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGD  903
            +  K VF+G+ SLVDV GG GTVA AIA  FP + CTV DLPHV+A     +N+ ++GGD
Sbjct  184  KDCKGVFEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVFDLPHVVAGLEGSKNLNYLGGD  243

Query  904  MFESIPTANAVLLK  945
            MF+ IP A+A+LLK
Sbjct  244  MFKGIPPADAILLK  257



>ref|XP_011002666.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=357

 Score =   257 bits (657),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/256 (48%), Positives = 175/256 (68%), Gaps = 6/256 (2%)
 Frame = +1

Query  178  NENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKA  357
            ++ E+++A+A  WNHI N+I+S +LKCA+D+GIPD+I+ H KP+ L  LI+ALP+HP KA
Sbjct  9    HDRELLKAQAHIWNHIFNFINSMSLKCAIDLGIPDIINKHSKPVTLPELIAALPVHPGKA  68

Query  358  PYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIG  537
              + RL R L+HSG     K + DD   QEE Y LT A +L++ D+   ++  F+   + 
Sbjct  69   RCVPRLMRLLIHSGFFEKQKVSEDD---QEEGYILTNASQLLLKDN-PFSVAPFLQAVLD  124

Query  538  YVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALL  717
             +  K  + +  W +NDDP+PF TAHG+  WDY  HE  +N LFN+AMA D+ L+   L+
Sbjct  125  PILTKPWHFVSTWLKNDDPTPFDTAHGRTFWDYVGHEPVFNHLFNDAMASDARLVTRVLI  184

Query  718  SGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVG  897
            +    K+VF+G+ SLVDV GG GTVA +IAK FP + CTV DLPHV+A     EN+++VG
Sbjct  185  N--ECKEVFEGLGSLVDVGGGTGTVAKSIAKAFPHLDCTVFDLPHVVADLQGSENLKYVG  242

Query  898  GDMFESIPTANAVLLK  945
            GDMFE+IP A+ ++LK
Sbjct  243  GDMFEAIPPADGIVLK  258



>ref|XP_003633248.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score =   257 bits (657),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 124/253 (49%), Positives = 169/253 (67%), Gaps = 6/253 (2%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            E++ A+A  WNHILN+I S +LKCA+ +GIPD+IHNHGKPM L  L++ LP+HP ++  +
Sbjct  11   ELLHAQAHVWNHILNFIKSVSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
            +RL R LVHSG L      + +   +EE Y LT A RL++ DD S+++R  +   +  + 
Sbjct  71   YRLMRILVHSGFLAAQSVQQGE---EEEGYVLTDASRLLLMDD-SLSIRPLLLAMLDPIL  126

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGE  726
             K  + L  WF+NDDP+PF TAH +  WDY  HE   N+ FNEAMA D+ L+   LL  +
Sbjct  127  TKPWHYLSAWFQNDDPTPFHTAHERPFWDYAGHEPQLNNFFNEAMASDARLVTSVLL--K  184

Query  727  SSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDM  906
              K VF+G+ SLVDV GG G VA AIA  FP + CTVLDLPHV+A     +N+ +  GD+
Sbjct  185  EGKGVFEGLNSLVDVGGGTGQVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDI  244

Query  907  FESIPTANAVLLK  945
            FE+IP A+A+LLK
Sbjct  245  FEAIPPADAILLK  257



>gb|AEF97347.1| O-methyltransferase [Vitis pseudoreticulata]
Length=357

 Score =   257 bits (656),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 126/253 (50%), Positives = 166/253 (66%), Gaps = 6/253 (2%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            E++ A+A  WNHI N+I S +LKCA  +GIPD+IHNHGKPM L  L++ LP+HP ++  +
Sbjct  11   ELLHAQAHVWNHIFNFIKSMSLKCATQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
            +RL R LVHSG L      R    K+EE Y LT A RL++ DD S+++R  V   +  + 
Sbjct  71   YRLMRILVHSGFLAAQ---RVQQGKEEEGYVLTDASRLLLMDD-SLSIRPLVLAMLDPIL  126

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGE  726
             K  + L  WF+NDDP+PF TAH +  WDY  HE   N+ FNEAMA D+ L+   LL  +
Sbjct  127  TKPWHYLSAWFQNDDPTPFHTAHERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLL--K  184

Query  727  SSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDM  906
              + VF G+ SLVDV GG G VA AIA  FP + CTVLDLPHV+A     +N+ +  GDM
Sbjct  185  EGQGVFAGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDM  244

Query  907  FESIPTANAVLLK  945
            FE+IP A+A+LLK
Sbjct  245  FEAIPPADAILLK  257



>ref|XP_011002662.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=357

 Score =   257 bits (656),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 123/253 (49%), Positives = 175/253 (69%), Gaps = 6/253 (2%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            E+++A+A  WNHI ++I+S +LKCA+D+GIPD+I+ H KP+ L  LI+ALP+HPSKA  +
Sbjct  12   ELLKAQAHIWNHIFSFINSMSLKCAIDLGIPDIINKHSKPVTLPELIAALPVHPSKARCV  71

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
             RL R L+HSG     K + DD   QEE Y LT A +L++ D+   ++  F+   +  + 
Sbjct  72   PRLMRLLIHSGFFEKQKVSEDD---QEEGYVLTNASQLLLKDN-PFSVAPFLQAVLDPIL  127

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGE  726
             K  + +  W +NDDP+PF TAHG+  WDY  HE  +N LFN+AMA D+ L+   L++  
Sbjct  128  TKPWHFVSTWLKNDDPTPFDTAHGRTFWDYVGHEPVFNHLFNDAMASDARLVTRVLIN--  185

Query  727  SSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDM  906
              K+VF+G+ SLVDV GG GTVA++IAK FP + CTV DLPHV+A     EN+++VGGDM
Sbjct  186  ECKEVFEGLGSLVDVGGGTGTVANSIAKAFPHLDCTVFDLPHVVADLQGSENLKYVGGDM  245

Query  907  FESIPTANAVLLK  945
            FE+IP A+ ++LK
Sbjct  246  FEAIPPADGIVLK  258



>ref|XP_002262833.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=358

 Score =   256 bits (654),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 129/263 (49%), Positives = 175/263 (67%), Gaps = 7/263 (3%)
 Frame = +1

Query  160  EIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALP  339
            ++G     +E++QA+AQ  NH+ N+++S  LKCA+D+ IPD+IH+HG+PM LS L++AL 
Sbjct  2    DLGSAERADELLQAQAQVVNHVFNFMNSMALKCAIDLAIPDVIHSHGQPMLLSQLVTALS  61

Query  340  IHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINL-RA  516
            + PSKAP +HRL R LVHSG    ++     +++QEE YSLT A R ++ D+    L  +
Sbjct  62   VQPSKAPCLHRLMRLLVHSGFF--SQQQVIHNNEQEEGYSLTSASRFLLKDEPLTGLPLS  119

Query  517  FVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSE  696
             +HL    V     + L  WFRN DP+PF TAHG+  WDY + E  +NDLFNEAMA DS 
Sbjct  120  LLHL--NPVLTAPWHFLSGWFRNGDPTPFYTAHGKPYWDYTAQEPDFNDLFNEAMASDSR  177

Query  697  LIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSI  876
            +I   L++    K+ F G+ SLVDV  G GT+  AIAK FP +KC V D PHV+A     
Sbjct  178  IIASVLIT--KCKEQFKGLFSLVDVGAGTGTMTKAIAKAFPHLKCIVFDQPHVVADLQGG  235

Query  877  ENVEFVGGDMFESIPTANAVLLK  945
             N+E VGGDMFE+IP+ANAV+LK
Sbjct  236  GNLEVVGGDMFETIPSANAVILK  258



>ref|XP_003527407.1| PREDICTED: trans-resveratrol di-O-methyltransferase isoform 1 
[Glycine max]
Length=352

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/254 (49%), Positives = 175/254 (69%), Gaps = 6/254 (2%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPY  363
            ++++ A+   WNHI ++I+S +LKCA+++ IPD+IH +G+PMPLS L ++L IHPSKA  
Sbjct  10   SKLLGAQTHVWNHIFSFINSMSLKCAIELDIPDIIHKYGQPMPLSKLTTSLSIHPSKANC  69

Query  364  IHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYV  543
            I+RL R L HSG        + ++++ E  Y LT A  L++ D+  +++  F+H  +   
Sbjct  70   IYRLMRILTHSGFF---SQHKVNENELEMGYVLTDASTLLLKDN-PLSMVPFLHAMLDPT  125

Query  544  YQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSG  723
              +    L  WF+NDDPSPF TAHG KIWDY   E   NDLFN+AMA D++L+   ++  
Sbjct  126  LTQPWLQLPTWFKNDDPSPFQTAHGMKIWDYADREPRLNDLFNDAMASDTQLVANVVI--  183

Query  724  ESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGD  903
            E  K VF+G+ SLVDV GG GT+A AIAK FP ++CTV DLPHV+A     EN+++VGGD
Sbjct  184  ERCKGVFNGLESLVDVGGGTGTMAMAIAKSFPQLECTVFDLPHVVATLQGSENLKYVGGD  243

Query  904  MFESIPTANAVLLK  945
            MFESIP+A+A+LLK
Sbjct  244  MFESIPSADAILLK  257



>ref|XP_011002663.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=357

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/253 (48%), Positives = 174/253 (69%), Gaps = 6/253 (2%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            E+++A+A  WNHI ++I+S +LKCA+D+GIPD+I+ H KP+ L  LI+ LP+HPSKA  +
Sbjct  12   ELLKAQAHIWNHIFSFINSMSLKCAIDLGIPDIINKHSKPVTLPELIATLPVHPSKARCV  71

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
             RL R L+HSG     K + DD   QEE Y LT A +L++ D+   ++  F+   +  + 
Sbjct  72   PRLMRLLIHSGFFEKQKVSEDD---QEEGYVLTNASQLLLKDN-PFSVAPFLQAVLDPIL  127

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGE  726
             K  + +  W +NDDP+PF TAHG+  WDY  HE  +N LFN+AMA D+ L+   L++  
Sbjct  128  TKPWHFVSTWLKNDDPTPFDTAHGRTFWDYVGHEPVFNHLFNDAMASDARLVTRVLIN--  185

Query  727  SSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDM  906
              K+VF+G+ SLVDV GG GTVA++IAK FP + CTV DLPHV+A     EN+++VGGDM
Sbjct  186  ECKEVFEGLGSLVDVGGGTGTVANSIAKAFPHLDCTVFDLPHVVADLQGSENLKYVGGDM  245

Query  907  FESIPTANAVLLK  945
            FE+IP A+ ++LK
Sbjct  246  FEAIPPADGIVLK  258



>ref|XP_004490696.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cicer 
arietinum]
Length=359

 Score =   255 bits (651),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/252 (48%), Positives = 168/252 (67%), Gaps = 6/252 (2%)
 Frame = +1

Query  190  VVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYIH  369
            +++A++  WNHI N+I+S +LKC VD+GIPD+IHN+GKPM LS LI  LPIHPSK  +I+
Sbjct  13   LLKAQSHIWNHIFNFINSMSLKCVVDLGIPDIIHNYGKPMSLSKLIPLLPIHPSKTFFIY  72

Query  370  RLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVYQ  549
            RL R + HSG           +++ E  Y LT    L++ D+  +N+R+FVHL    V  
Sbjct  73   RLMRIMTHSGFF---SQHNISENELETEYVLTDTSLLLLKDN-PMNMRSFVHLVFDPVLT  128

Query  550  KSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGES  729
            K  + L  W  NDDP+ F T HG   WDY   ES  N+LFN+AMA D+ L+   ++  E 
Sbjct  129  KPWHQLSSWLTNDDPTAFETTHGMLFWDYAERESKINNLFNDAMASDARLVSSVVI--EK  186

Query  730  SKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDMF  909
             K+VF+G+ SLVDV GG GT+A A+AK FP ++CTV DLPHV+      +N+++VGGDMF
Sbjct  187  CKEVFNGLESLVDVGGGTGTMAKALAKSFPQLECTVFDLPHVVVGLQGTDNLKYVGGDMF  246

Query  910  ESIPTANAVLLK  945
            + IP A+A+LLK
Sbjct  247  KEIPPADAILLK  258



>emb|CDP19709.1| unnamed protein product [Coffea canephora]
Length=348

 Score =   254 bits (650),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 129/256 (50%), Positives = 173/256 (68%), Gaps = 13/256 (5%)
 Frame = +1

Query  178  NENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKA  357
            N  E++ A+    N + N+  SA+LKCA+++GIPD I+ HGKP+ LS L+SALPI+PSKA
Sbjct  6    NLTELLAAQNHVGNQMPNFRKSASLKCAIELGIPDAINQHGKPITLSELVSALPINPSKA  65

Query  358  PYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIG  537
             +I+RL RFL ++G  ++          Q++ Y+LT AGRL++  +E  NLRAF+     
Sbjct  66   NHIYRLMRFLSNAGFFVL----------QDQGYALTAAGRLLL-KEEPFNLRAFIFYTSD  114

Query  538  YVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALL  717
             V  K   SL +WFRNDDPSPF TAHG+  W Y + E  + +LFNEAMA DS L V+ ++
Sbjct  115  PVLVKPWNSLTEWFRNDDPSPFHTAHGKNFWAYAAEEPNFANLFNEAMANDSTLTVQVMM  174

Query  718  SGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVG  897
            +    K VFDG+TSLVDV GG G VA AIA+ FP ++C V DLPHVIA     EN++FV 
Sbjct  175  T--QCKFVFDGLTSLVDVGGGTGAVARAIAQNFPNLECVVCDLPHVIAGQEGTENLDFVA  232

Query  898  GDMFESIPTANAVLLK  945
            GDM E +P A+A+LLK
Sbjct  233  GDMLEKVPAADAILLK  248



>ref|XP_002278057.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   254 bits (650),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 122/254 (48%), Positives = 167/254 (66%), Gaps = 6/254 (2%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPY  363
            +E++QA+A  WNHI N+++S +LKCA+ +GIPD+IHNHGKPM L  L++ LP+HP K  Y
Sbjct  10   SELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKKTQY  69

Query  364  IHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYV  543
            ++RL R LV S         R    ++EE Y LT A +L++ DD S+++R F+   +   
Sbjct  70   VYRLMRVLVQSDFFAAQ---RAQQSEEEEGYVLTHASQLLLKDD-SLSVRPFLLAMLDPT  125

Query  544  YQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSG  723
              K  + +  WF+NDDP+PF TAH + +WDY  HE   N   NEAMA D+ L+   L+  
Sbjct  126  LTKPWHYVSAWFQNDDPTPFNTAHERTLWDYAGHEPQLNYFINEAMASDARLVTSVLV--  183

Query  724  ESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGD  903
            +  K VF+G+ SLVDV GG GTVA AIA  FP + CTVLDLPHV+A     +N+ +  GD
Sbjct  184  KEGKGVFEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGD  243

Query  904  MFESIPTANAVLLK  945
            MFE IP A+A+LLK
Sbjct  244  MFEPIPPADAILLK  257



>ref|XP_002281368.2| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score =   254 bits (649),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 125/253 (49%), Positives = 166/253 (66%), Gaps = 6/253 (2%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            E++ A+A  WNHI N+I S +LKCA  +GIPD+IHNHGKPM L  L++ LP+HP ++  +
Sbjct  11   ELLHAQAHVWNHIFNFIKSMSLKCATQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
            +RL R LVHSG L      R    ++EE Y LT A RL++ DD S+++R  V   +  + 
Sbjct  71   YRLMRILVHSGFLAAQ---RVQQGEEEEGYVLTDASRLLLMDD-SLSIRPLVLAMLDPIL  126

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGE  726
             K  + L  WF+NDDP+PF TA+ +  WDY  HE   N+ FNEAMA D+ L+   LL  +
Sbjct  127  TKPWHYLSAWFQNDDPTPFHTAYERPFWDYAGHEPQLNNSFNEAMASDARLLTSVLL--K  184

Query  727  SSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDM  906
              K VF G+ SLVDV GG G VA AIA  FP + CTVLDLPHV+A     +N+ +  GDM
Sbjct  185  EGKGVFAGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDM  244

Query  907  FESIPTANAVLLK  945
            FE+IP A+A+LLK
Sbjct  245  FEAIPPADAILLK  257



>emb|CAN83014.1| hypothetical protein VITISV_029725 [Vitis vinifera]
Length=357

 Score =   254 bits (649),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 122/254 (48%), Positives = 166/254 (65%), Gaps = 6/254 (2%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPY  363
            +E++QA+A  WNHI N+++S +LKCA+ +GIPD+IHNHGKPM L  L++ LP+HP K  Y
Sbjct  10   SELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKKTQY  69

Query  364  IHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYV  543
            ++RL R LV S         R    ++EE Y LT A  L++ DD S+++R F+   +   
Sbjct  70   VYRLMRVLVQSDFFAAQ---RAQQSEEEEGYVLTHASXLLLKDD-SLSVRPFLLAMLDPT  125

Query  544  YQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSG  723
              K  + +  WF+NDDP+PF TAH + +WDY  HE   N   NEAMA D+ L+   L+  
Sbjct  126  LTKPWHYVSAWFQNDDPTPFNTAHERTLWDYAGHEPQLNYFINEAMASDARLVTSVLV--  183

Query  724  ESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGD  903
            +  K VF+G+ SLVDV GG GTVA AIA  FP + CTVLDLPHV+A     +N+ +  GD
Sbjct  184  KEGKGVFEGLNSLVDVGGGTGTVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGD  243

Query  904  MFESIPTANAVLLK  945
            MFE IP A+A+LLK
Sbjct  244  MFEXIPPADAILLK  257



>ref|NP_001268044.1| trans-resveratrol di-O-methyltransferase [Vitis vinifera]
 gb|AEP17011.1| O-methyltransferase [Vitis vinifera]
Length=357

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/253 (49%), Positives = 165/253 (65%), Gaps = 6/253 (2%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            E++ A+A  WNHI N+I S +LKCA+ +GIPD IHNHGKPM L  L++ LP+HP ++  +
Sbjct  11   ELLHAQAHVWNHIFNFIKSMSLKCAIQLGIPDTIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
            +RL R LVHSG L      R    K+EE Y LT A RL++ DD S+++R  V   +  + 
Sbjct  71   YRLMRILVHSGFLAAQ---RVQQGKEEEGYVLTDASRLLLMDD-SLSIRPLVLAMLDPIL  126

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGE  726
             K  + L  WF+NDDP+PF T + +  WDY  HE   N+ FNEAMA D+ L+   LL  +
Sbjct  127  TKPWHYLSAWFQNDDPTPFHTTYERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLL--K  184

Query  727  SSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDM  906
              + VF G+ SLVDV GG G VA AIA  FP + CTVLDLPHV+A     +N+ +  GDM
Sbjct  185  EGQGVFAGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDM  244

Query  907  FESIPTANAVLLK  945
            FE+IP A+A+LLK
Sbjct  245  FEAIPPADAILLK  257



>gb|AFX68805.1| O-metyltransferase [Vitis riparia]
Length=357

 Score =   253 bits (646),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/253 (49%), Positives = 166/253 (66%), Gaps = 6/253 (2%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            E++ A+A  WNHI N+I S +LKCA  +GIPD+IHNHGKPM L  L++ LP+HP ++  +
Sbjct  11   ELLHAQAHVWNHIFNFIKSMSLKCATQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
            +RL R LVHSG L      R    ++EE Y LT A RL++ DD S+++R  V   +  + 
Sbjct  71   YRLMRILVHSGFLAAQ---RVQQGEEEEGYVLTDASRLLLMDD-SLSIRPLVLAMLDPIL  126

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGE  726
             K  + L  WF+NDDP+PF TA+ +  WDY  HE   N+ FNEAMA D+ L+   L+  +
Sbjct  127  TKPWHYLSAWFQNDDPTPFHTAYERPFWDYAGHEPQLNNSFNEAMASDARLLTSVLI--K  184

Query  727  SSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDM  906
              K VF G+ SLVDV GG G VA AIA  FP + CTVLDLPHV+A     +N+ +  GDM
Sbjct  185  EGKGVFAGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLPHVVAGLQGSKNLNYFAGDM  244

Query  907  FESIPTANAVLLK  945
            FE+IP A+A+LLK
Sbjct  245  FEAIPPADAILLK  257



>ref|XP_002278190.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=357

 Score =   252 bits (644),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 124/254 (49%), Positives = 166/254 (65%), Gaps = 6/254 (2%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPY  363
             E++ A A  WNHI N+I+S +LKCA+++GIPD+IHNHGKPM LS L++ LP++P K   
Sbjct  10   TELLHAHAHVWNHIFNFINSMSLKCAIELGIPDIIHNHGKPMTLSELVAELPVNPEKTKC  69

Query  364  IHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYV  543
            ++RL R LV SG        R  +  QEE Y LT A RL++ DD  ++ R F+   +  V
Sbjct  70   VYRLMRLLVQSGFF---TRKRVQESGQEEGYVLTHASRLLLKDD-PLSARPFLLAMLDPV  125

Query  544  YQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSG  723
                   +  WF+NDDP+PF TAHG+  WDY  HE   N+ FNEAMA D+ L+   L+  
Sbjct  126  LITPWQYVSAWFQNDDPTPFDTAHGRTFWDYAGHEPKLNNFFNEAMASDARLVTSVLI--  183

Query  724  ESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGD  903
            +  K +F G+ SLVDV GG GTVA AIA  FP + CTVLDLPHV+A     +N+ ++ GD
Sbjct  184  KDCKGIFVGLNSLVDVGGGTGTVARAIANAFPHLNCTVLDLPHVVAGLEGSKNLNYLAGD  243

Query  904  MFESIPTANAVLLK  945
            MFE+IP A+A+LLK
Sbjct  244  MFEAIPPADAILLK  257



>sp|B6VJS4.2|ROMT_VITVI RecName: Full=Trans-resveratrol di-O-methyltransferase; AltName: 
Full=Resveratrol O-methyltransferase; Short=ROMT; Short=VvROMT 
[Vitis vinifera]
Length=357

 Score =   252 bits (644),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 124/253 (49%), Positives = 166/253 (66%), Gaps = 6/253 (2%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            E++ A+A  WNHI N+I S +LKCA+ +GIPD+IHNHGKPM L  L++ LP+HP ++  +
Sbjct  11   ELLHAQAHVWNHIFNFIKSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
            +RL R LVHSG L      R    K+EE Y LT A RL++ DD S+++R  V   +  + 
Sbjct  71   YRLMRILVHSGFLAAQ---RVQQGKEEEGYVLTDASRLLLMDD-SLSIRPLVLAMLDPIL  126

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGE  726
             K  + L  WF+NDDP+PF TA+ +  WDY  HE   N+ FNEAMA D+ L+   LL  +
Sbjct  127  TKPWHYLSAWFQNDDPTPFHTAYERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLL--K  184

Query  727  SSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDM  906
              + VF G+ SLVDV GG G VA AIA  FP + CTVLDL HV+A     +N+ +  GDM
Sbjct  185  EGQGVFAGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLSHVVAGLQGSKNLNYFAGDM  244

Query  907  FESIPTANAVLLK  945
            FE+IP A+A+LLK
Sbjct  245  FEAIPPADAILLK  257



>ref|XP_003633245.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Vitis 
vinifera]
Length=357

 Score =   251 bits (641),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 123/261 (47%), Positives = 171/261 (66%), Gaps = 5/261 (2%)
 Frame = +1

Query  163  IGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPI  342
            +G      E++QA+  TW H  N+++S  LKCA+ +GIPD+IH+HG+PM LS LI+AL +
Sbjct  4    LGSRERATELLQAQVHTWKHTTNFVNSMVLKCAIQLGIPDVIHSHGQPMALSQLITALSL  63

Query  343  HPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFV  522
             P+KAP ++RL R LVHSG     K   + ++  EE YSLT A + ++  DE ++   F+
Sbjct  64   EPTKAPCLYRLMRVLVHSGFFAQQKLLHNSEE--EEGYSLTFASQFLL-KDEPVSGVPFL  120

Query  523  HLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELI  702
             L +  +     + LGDWF+N+DP+PF TAH +  WDY  HE   ND+FNE M  DS LI
Sbjct  121  LLQLDPILTAPWHFLGDWFQNEDPTPFHTAHRKSFWDYAVHEPKLNDIFNETMVSDSRLI  180

Query  703  VEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIEN  882
               ++     K+VF+G+ SLVDV GG GT+  AIAK FP +KC V D PHV+A     EN
Sbjct  181  ANMIV--RQYKEVFEGLASLVDVGGGTGTMVKAIAKAFPQLKCIVFDQPHVVANLEVGEN  238

Query  883  VEFVGGDMFESIPTANAVLLK  945
            +E VGG++FE+IP A+A+LLK
Sbjct  239  LEIVGGNIFEAIPPADAILLK  259



>ref|NP_001267963.1| O-methyltransferase [Vitis vinifera]
 gb|AEP17010.1| O-methyltransferase [Vitis vinifera]
Length=357

 Score =   251 bits (640),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 124/253 (49%), Positives = 165/253 (65%), Gaps = 6/253 (2%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            E++ A+A  WNHI N+I S +LKCA+ +GIPD+IHNHGKPM L  L++ LP+HP ++  +
Sbjct  11   ELLHAQAHVWNHIFNFIKSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
            +RL R LVHSG L      R    K+EE Y LT A RL++ DD S+++R  V   +  + 
Sbjct  71   YRLMRILVHSGFLAAQ---RVQQGKEEEGYVLTDASRLLLMDD-SLSIRPLVLAMLDPIL  126

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGE  726
             K  + L  WF+NDDP+PF TA+ +  WDY  HE   N+ FNEAMA D+ L+   LL  +
Sbjct  127  TKPWHYLSAWFQNDDPTPFHTAYERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLL--K  184

Query  727  SSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDM  906
              + VF G+ SLVDV GG G VA AIA  FP + CTVLDL HV+A     +N+ +  GDM
Sbjct  185  EGQGVFAGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLSHVVAGLQGSKNLNYFAGDM  244

Query  907  FESIPTANAVLLK  945
            FE+IP A A+LLK
Sbjct  245  FEAIPPAVAILLK  257



>emb|CDP19711.1| unnamed protein product [Coffea canephora]
Length=349

 Score =   250 bits (639),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/259 (49%), Positives = 170/259 (66%), Gaps = 13/259 (5%)
 Frame = +1

Query  169  KLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHP  348
            K+ N  E+++A+   WN + ++  SA LKCAV++GIPD+I NHGKP+ LS LIS LPIHP
Sbjct  3    KVENLGELIEAQTHVWNAMFHFKKSACLKCAVELGIPDVIRNHGKPITLSDLISVLPIHP  62

Query  349  SKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHL  528
            SK+ +I RL RFL +SG  +          +  + Y+LT AGRL++  DE  N+RA + L
Sbjct  63   SKSAHIFRLMRFLANSGFFV----------ENPQGYALTSAGRLLL-KDEPFNVRAHIFL  111

Query  529  CIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVE  708
                   K    L  WF+NDDPSPF TA+G   W Y + E  +  +FNEAMA D++L VE
Sbjct  112  SCDPAMLKPWNFLTKWFQNDDPSPFDTAYGNNFWHYNAQEVRFGKMFNEAMASDNQLSVE  171

Query  709  ALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVE  888
             L++    K VF+G+T+L DV GG G V  AIA+ FP +KCTV DLPHV+A     EN+E
Sbjct  172  VLMT--KCKFVFEGLTTLADVGGGTGKVDRAIAQNFPNIKCTVYDLPHVVANQEGAENLE  229

Query  889  FVGGDMFESIPTANAVLLK  945
            F+ GDMF+S+P ANA+LLK
Sbjct  230  FLAGDMFQSVPRANAILLK  248



>ref|XP_007043718.1| Flavonoid o-methyltransferase related [Theobroma cacao]
 gb|EOX99549.1| Flavonoid o-methyltransferase related [Theobroma cacao]
Length=364

 Score =   251 bits (640),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/259 (47%), Positives = 174/259 (67%), Gaps = 6/259 (2%)
 Frame = +1

Query  169  KLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHP  348
            K  N++E++QA+A  WN++ N+I+S +LKCA+D+GIPD+I NHGKPM ++ L++ALPI+ 
Sbjct  10   KHINDHELLQAQAHVWNYLFNFINSMSLKCAIDLGIPDVIQNHGKPMTVTELVAALPINA  69

Query  349  SKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHL  528
            +KA  I+RL R LVHSG     K   +D   QEE Y LT A RL++  D  +++  F+  
Sbjct  70   TKASSIYRLMRILVHSGFFAQQKLGNND---QEEGYVLTHASRLLLNGD-PLSVTPFLKA  125

Query  529  CIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVE  708
             +  +  K  + LG WF+NDDP+PF TAHG+  WDY  H+   +  FNE MA D+ L+  
Sbjct  126  MLDPILTKPWHFLGAWFQNDDPTPFDTAHGRTFWDYGGHDPMLSHFFNEGMASDARLVSS  185

Query  709  ALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVE  888
             L+     + VF G+ S+VDV GG GTVA AI+  FP ++CTV DLP V+A      N++
Sbjct  186  ILI--HKCEGVFQGLNSMVDVGGGIGTVAKAISDAFPHLECTVFDLPRVVAGLQDRGNLK  243

Query  889  FVGGDMFESIPTANAVLLK  945
            +VGGDMFE++P A+AVLLK
Sbjct  244  YVGGDMFEAVPAADAVLLK  262



>emb|CAH05089.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   249 bits (637),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 127/268 (47%), Positives = 175/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTNASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H+      FN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE+IP AN VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAIPPANTVLLK  256



>emb|CAJ65632.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
 emb|CAJ65658.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   249 bits (637),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 127/268 (47%), Positives = 175/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTNASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H+      FN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE+IP AN VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAIPPANTVLLK  256



>emb|CAJ65663.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   249 bits (636),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 127/268 (47%), Positives = 175/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTNASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H+      FN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE+IP AN VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAIPPANTVLLK  256



>gb|ABQ02270.2| O-methyltransferase [Vitis vinifera]
Length=357

 Score =   249 bits (637),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 123/253 (49%), Positives = 165/253 (65%), Gaps = 6/253 (2%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            E++ A+A  WNHI N+I S +LKCA+ +GIPD+IHNHGKPM L  L++ LP+HP ++  +
Sbjct  11   ELLHAQAHVWNHIFNFIKSMSLKCAIQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
            +RL R LVHSG L      R    K+EE Y LT A RL++ DD S+++R  V   +  + 
Sbjct  71   YRLMRILVHSGFLAAQ---RVQQGKEEEGYVLTDASRLLLMDD-SLSIRPLVLAMLDPIL  126

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGE  726
             K  + L  WF+NDDP+PF TA+ +  WDY  HE   N+ FNEAMA D+ L+   LL  +
Sbjct  127  TKPWHYLSAWFQNDDPTPFHTAYERSFWDYAGHEPQLNNSFNEAMASDARLLTSVLL--K  184

Query  727  SSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDM  906
              + VF G+ SLVDV GG G VA AIA  FP + CTVLDL HV+A     +N+ +  GDM
Sbjct  185  EGQGVFAGLNSLVDVGGGTGKVAKAIANAFPHLNCTVLDLSHVVAGLQGSKNLNYFAGDM  244

Query  907  FESIPTANAVLLK  945
            F +IP A+A+LLK
Sbjct  245  FGAIPPADAILLK  257



>ref|XP_002326036.2| hypothetical protein POPTR_0019s12290g [Populus trichocarpa]
 gb|EEF00418.2| hypothetical protein POPTR_0019s12290g [Populus trichocarpa]
Length=357

 Score =   249 bits (637),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 123/253 (49%), Positives = 169/253 (67%), Gaps = 6/253 (2%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            E++QA+A  WNHI N+++S +LKCA+ +GIPD+IHNHGKPM LS L++ LPIHPSKAP I
Sbjct  12   ELLQAQAHVWNHIFNFVNSMSLKCAIQLGIPDVIHNHGKPMTLSELVAVLPIHPSKAPGI  71

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
            +RL R LVHSG         +  + + E Y LT A +L+I D+   ++  F+   +  + 
Sbjct  72   YRLMRILVHSGFF---ATQNNSGETEGEGYVLTNASQLLIKDN-PFSVTPFLLAMLDPIL  127

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGE  726
             +  + +  WF+ND PS F TAH +  W+Y  HE+  N  FNEAMA D+ L+   L++  
Sbjct  128  TQPWHYVSVWFQNDAPSSFYTAHQRTSWEYAGHETELNHFFNEAMASDARLVSSVLVN--  185

Query  727  SSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDM  906
              K VF+G+ SLVDV GG GTVA AIAK F  + CTV DLPHV+A     EN++++ GDM
Sbjct  186  ECKGVFEGLNSLVDVGGGTGTVAKAIAKEFQHLDCTVFDLPHVVAGLEGSENLKYLSGDM  245

Query  907  FESIPTANAVLLK  945
            FE+IP A+A+LLK
Sbjct  246  FEAIPQADAILLK  258



>ref|XP_009612081.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=350

 Score =   249 bits (636),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 131/260 (50%), Positives = 172/260 (66%), Gaps = 17/260 (7%)
 Frame = +1

Query  178  NEN---EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHP  348
            NEN   E++QA  Q WNHI N++ S+  KCAV +GIPD+++ HGK M LS L +ALP++P
Sbjct  4    NENGSTELLQAHTQIWNHIYNFVSSSAAKCAVQLGIPDVLYKHGKSMCLSDLSAALPLNP  63

Query  349  SKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHL  528
            SK  ++  L R LVHSG L          ++ E+YYSLTPA RL + DD  +++R++  +
Sbjct  64   SKISFLPILIRSLVHSGFL----------NEHEDYYSLTPASRLFLKDD-PLSMRSYFLI  112

Query  529  CIGYVYQKSCYSLGDWFRNDDPSPFCTAH-GQKIWDYFSHESGYNDLFNEAMAKDSELIV  705
                  QK  + L  WF+ND P+ F  AH G+  WDYF+ E   N++FN++MA DS LI 
Sbjct  113  MHDPCVQKPWFELSSWFQNDFPTAFHAAHNGKSFWDYFADEPRVNNIFNDSMANDSSLIA  172

Query  706  EALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENV  885
              L++    K VF+G+TSLVDV GG GT+A AIAK FPA+ CTVLDLPHVI       N+
Sbjct  173  NVLIT--ECKHVFEGLTSLVDVGGGTGTLAIAIAKAFPAINCTVLDLPHVIGDLKGSGNL  230

Query  886  EFVGGDMFESIPTANAVLLK  945
            EFVGG MFE IP ANA+LLK
Sbjct  231  EFVGGSMFEKIPNANAILLK  250



>ref|XP_002525160.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF37287.1| o-methyltransferase, putative [Ricinus communis]
Length=356

 Score =   249 bits (636),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 122/261 (47%), Positives = 178/261 (68%), Gaps = 6/261 (2%)
 Frame = +1

Query  178  NENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKA  357
            + NE++QA+A  WNHI ++I+S +LK AV +GIPD IH+HG+P+ LS LI+ALPIHP+KA
Sbjct  7    DANELLQAQAHIWNHIFSFINSMSLKSAVQLGIPDAIHSHGRPISLSQLIAALPIHPAKA  66

Query  358  PYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIG  537
              I RL R L+HSG       A+ ++  +EE Y LT A +L++ D+  +++  F+   + 
Sbjct  67   RGIPRLMRILIHSGFF---AKAKIEEKDEEEGYVLTNASKLLLKDN-PLSIAPFLLAMLD  122

Query  538  YVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALL  717
             +  K  + L  WF+NDD + F TAHG   W+Y + +   N+ FNEAMA D+ L+++ L+
Sbjct  123  PILIKPWHYLSTWFQNDDATAFDTAHGMGFWEYTASDPNLNNFFNEAMASDARLVMKVLI  182

Query  718  SGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVG  897
              +  K +F+G+ SLVDV GG GT+A+AIAK FP ++CTV DLPHV+      EN+++V 
Sbjct  183  --DEHKGLFEGLKSLVDVGGGTGTMAAAIAKAFPQLECTVFDLPHVVVGLQGTENLKYVA  240

Query  898  GDMFESIPTANAVLLKVYIVG  960
            GDMFE+IP A+AVLLK  + G
Sbjct  241  GDMFEAIPPADAVLLKWIMHG  261



>ref|XP_009618299.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=356

 Score =   249 bits (635),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 131/261 (50%), Positives = 169/261 (65%), Gaps = 11/261 (4%)
 Frame = +1

Query  178  NEN----EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIH  345
            NEN    E+++AEA +WN +  +I+   LKCA+ +GIP+ I  H KPM LS LI+ALPI+
Sbjct  5    NENLTPSELLRAEAHSWNQLYYFIEPVALKCALQLGIPNAITKHSKPMTLSELIAALPIN  64

Query  346  PSKAPYIHRLTRFLVHSGLLLVTKP-ARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFV  522
            PSK+ Y HRLTR LVH GLL++ K   RD+++  E YYSL  A R  +      N    +
Sbjct  65   PSKSHYFHRLTRILVHYGLLILHKSEGRDNENDDEGYYSLATADRYAVK-----NATWKL  119

Query  523  HLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELI  702
                   + K+  S+ DWF+N+DPS F TA+G   WD  S +    + FNE MAK+S   
Sbjct  120  MEEQDTFFLKAWNSMSDWFKNEDPSAFYTAYGDLFWDKLSRDPSIGNWFNEIMAKESRSF  179

Query  703  VEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIEN  882
            ++ LL  +  KDVFDG+TS+VDV GG GTVA AIAK FP MKCTVLDLP ++A     EN
Sbjct  180  MKVLLEYKY-KDVFDGLTSIVDVGGGTGTVAMAIAKTFPDMKCTVLDLPRLVANLQGSEN  238

Query  883  VEFVGGDMFESIPTANAVLLK  945
            +EFV  DMF+ IP ANAVLLK
Sbjct  239  LEFVAADMFQKIPPANAVLLK  259



>emb|CAJ65628.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   248 bits (633),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 126/268 (47%), Positives = 175/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A++  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQSHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTNASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H+      FN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE+IP AN VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAIPPANTVLLK  256



>emb|CAJ65630.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   248 bits (633),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 126/268 (47%), Positives = 174/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A++  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQSHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTNASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H+      FN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                  N+++ GGDMFE+IP AN VLLK
Sbjct  229  DLQGSRNLKYTGGDMFEAIPPANTVLLK  256



>ref|XP_011037437.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=359

 Score =   248 bits (634),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 130/262 (50%), Positives = 174/262 (66%), Gaps = 9/262 (3%)
 Frame = +1

Query  169  KLCNE---NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALP  339
            +L NE    E++QA+   WNHI N+I+S TLKCAV +GIPD+I  HGKPM LS L+SALP
Sbjct  2    ELINEESATELLQAQTHVWNHIFNFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALP  61

Query  340  IHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAF  519
            IHPSKA Y+HRL R LVHSG          +    +E YSLT + RL++ D+   ++R  
Sbjct  62   IHPSKAQYVHRLMRILVHSGFF---SQQNLNGIHNQEAYSLTQSTRLLLKDN-PWSVRPL  117

Query  520  VHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSEL  699
            + L +  V  K    L  WFRNDD + F  AH + +W+Y   ++ +N+LFNEAMA DS L
Sbjct  118  LLLVLDPVLTKPWDCLSTWFRNDDCNAFIVAHEKTLWEYAGQDARFNNLFNEAMASDSIL  177

Query  700  IVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIE  879
              + ++S    K +FDGV SLVDV GG GT+A  IA+ FP M CTV DLPHV++     +
Sbjct  178  ASKLVVS--KCKGIFDGVNSLVDVGGGLGTMAKGIAEAFPHMDCTVFDLPHVVSDLQGGK  235

Query  880  NVEFVGGDMFESIPTANAVLLK  945
            N+++VGGDMFE++P A+A+LLK
Sbjct  236  NLKYVGGDMFEAVPPADALLLK  257



>ref|XP_011016237.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=359

 Score =   248 bits (634),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 130/262 (50%), Positives = 174/262 (66%), Gaps = 9/262 (3%)
 Frame = +1

Query  169  KLCNE---NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALP  339
            +L NE    E++QA+   WNHI N+I+S TLKCAV +GIPD+I  HGKPM LS L+SALP
Sbjct  2    ELINEESATELLQAQTHVWNHIFNFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALP  61

Query  340  IHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAF  519
            IHPSKA Y+HRL R LVHSG          +    +E YSLT + RL++ D+   ++R  
Sbjct  62   IHPSKAQYVHRLMRILVHSGFF---SQQNLNGIHNQEAYSLTQSTRLLLKDN-PWSVRPL  117

Query  520  VHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSEL  699
            + L +  V  K    L  WFRNDD + F  AH + +W+Y   ++ +N+LFNEAMA DS L
Sbjct  118  LLLVLDPVLTKPWDCLSTWFRNDDCNAFIVAHEKTLWEYAGQDARFNNLFNEAMASDSIL  177

Query  700  IVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIE  879
              + ++S    K +FDGV SLVDV GG GT+A  IA+ FP M CTV DLPHV++     +
Sbjct  178  ASKLVVS--KCKGIFDGVNSLVDVGGGLGTMAKGIAEAFPHMDCTVFDLPHVVSDLQGGK  235

Query  880  NVEFVGGDMFESIPTANAVLLK  945
            N+++VGGDMFE++P A+A+LLK
Sbjct  236  NLKYVGGDMFEAVPPADALLLK  257



>emb|CAJ65641.1| putative orcinol O-methyltransferase [Rosa marretii]
Length=346

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 125/268 (47%), Positives = 176/268 (66%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + N+++ A+A TWNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNDLLHAQAHTWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H+      FN+AM
Sbjct  111  LSLTPFLTAVLDPVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLKSLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>emb|CAJ65597.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 125/268 (47%), Positives = 175/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTNASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H+      FN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  NLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>emb|CAJ65598.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 125/268 (47%), Positives = 175/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTNASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H+      FN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  NLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>emb|CAJ65642.1| putative orcinol O-methyltransferase [Rosa marretii]
Length=346

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 125/268 (47%), Positives = 175/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSTSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H+      FN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>emb|CAJ65601.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   247 bits (630),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 125/268 (47%), Positives = 175/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTNASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H+      FN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  NLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>ref|XP_011037442.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=355

 Score =   247 bits (631),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 123/265 (46%), Positives = 172/265 (65%), Gaps = 13/265 (5%)
 Frame = +1

Query  169  KLCNEN---EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALP  339
            +L NE    E++QA+   WNH+ N+I+S TLKCAV++GIPD+I  HGKPM LS L++ALP
Sbjct  2    ELINEESAGELLQAQTHVWNHLFNFINSMTLKCAVELGIPDVIQKHGKPMTLSELVTALP  61

Query  340  IHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAF  519
            IHPSKA Y+HRL R LVHSG            + ++E YSLT + RL++ D+   ++R  
Sbjct  62   IHPSKAQYVHRLMRILVHSGFF-------SQQNLKQEAYSLTQSTRLLLKDN-PWSMRTL  113

Query  520  VHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSEL  699
            +   +  V  K    L  WFRND+ S F  AH    W+Y   +   N+LFN+AMA DS L
Sbjct  114  LLFVLDPVLTKPHDCLSTWFRNDEASAFSVAHENTFWEYAGQDPRINNLFNDAMASDSIL  173

Query  700  IVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIE  879
              + ++S    K +F+GV SLVDV GG GT+A  I + FP M CTV DLPHV++     +
Sbjct  174  ASKVVVS--KCKGIFEGVNSLVDVGGGLGTMAKGIVEAFPHMDCTVFDLPHVVSDLQGSK  231

Query  880  NVEFVGGDMFESIPTANAVLLKVYI  954
            N+++VGGDMF+++P A+A+LLK+ +
Sbjct  232  NLKYVGGDMFQAVPPADAILLKLIL  256



>emb|CAJ65604.1| putative orcinol O-methyltransferase [Rosa beggeriana]
Length=346

 Score =   247 bits (630),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 125/268 (47%), Positives = 175/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H+      FN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>emb|CAJ65623.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   247 bits (630),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 125/268 (47%), Positives = 175/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H+      FN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>emb|CAJ65618.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   247 bits (630),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 125/268 (47%), Positives = 175/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTNASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H+      FN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>emb|CAJ65645.1| putative orcinol O-methyltransferase [Rosa roxburghii]
Length=346

 Score =   247 bits (630),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 125/268 (47%), Positives = 175/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H+      FN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>emb|CAJ65647.1| putative orcinol O-methyltransferase [Rosa rugosa]
Length=346

 Score =   247 bits (630),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 125/268 (47%), Positives = 175/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H+      FN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>emb|CAJ65640.1| putative orcinol O-methyltransferase [Rosa majalis]
 emb|CAJ65650.1| putative orcinol O-methyltransferase [Rosa lucieae]
 emb|CAJ65651.1| putative orcinol O-methyltransferase [Rosa lucieae]
 emb|CAJ65652.1| putative orcinol O-methyltransferase [Rosa lucieae]
 emb|CAJ65653.1| putative orcinol O-methyltransferase [Rosa lucieae]
 emb|CAJ65654.1| putative orcinol O-methyltransferase [Rosa lucieae]
Length=346

 Score =   247 bits (630),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 125/268 (47%), Positives = 175/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H+      FN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>emb|CAJ65646.1| putative orcinol O-methyltransferase [Rosa rugosa]
Length=346

 Score =   246 bits (629),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 125/268 (47%), Positives = 175/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H+      FN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>emb|CAJ65607.1| putative orcinol O-methyltransferase [Rosa beggeriana]
Length=346

 Score =   246 bits (629),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 125/268 (47%), Positives = 175/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H+      FN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>emb|CAJ65625.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   246 bits (629),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 125/268 (47%), Positives = 174/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H+      FN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                  N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSRNLKYTGGDMFEAVPPADTVLLK  256



>emb|CAJ65613.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
 emb|CAJ65619.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   246 bits (629),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 125/268 (47%), Positives = 175/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTNASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H+      FN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>emb|CAN79968.1| hypothetical protein VITISV_043678 [Vitis vinifera]
Length=357

 Score =   247 bits (630),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 123/253 (49%), Positives = 163/253 (64%), Gaps = 6/253 (2%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            E++ A+A  WNHI N+I S +LKCA  +GIPD+IHNHGKPM L  L++ LP+HP ++  +
Sbjct  11   ELLHAQAHVWNHIFNFIKSMSLKCATQLGIPDIIHNHGKPMTLPELVAKLPVHPKRSQCV  70

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
            +RL R LVHSG L      R    ++EE Y LT A RL++ DD S+++R  V   +  + 
Sbjct  71   YRLMRILVHSGFLAAQ---RVQQGEEEEGYVLTDASRLLLMDD-SLSIRPLVLAMLDPIL  126

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGE  726
             K  + L  WF+NDDP+PF TA+    WDY  HE   N+ FNEAMA D+ L+   LL  +
Sbjct  127  TKPWHYLSAWFQNDDPTPFHTAYEXXFWDYAGHEPQLNNSFNEAMASDARLLTXVLL--K  184

Query  727  SSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDM  906
                VF G+ SLVDV GG G VA AIA  FP + CTVLDL HV+A     +N+ +  GDM
Sbjct  185  EGXGVFAGLNSLVDVGGGTGKVAKAIAXAFPHLNCTVLDLSHVVAGLQGSKNLNYFAGDM  244

Query  907  FESIPTANAVLLK  945
            FE+IP A+A+LLK
Sbjct  245  FEAIPPADAILLK  257



>emb|CAJ65612.1| putative orcinol O-methyltransferase [Rosa canina]
Length=346

 Score =   246 bits (629),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 125/268 (47%), Positives = 175/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H+      FN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWNCLSTWFQNDDPTPFDTAHGMTFWDYGNHQPRIAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFETVPPADTVLLK  256



>ref|XP_004303127.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=367

 Score =   247 bits (630),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 123/268 (46%), Positives = 177/268 (66%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG+PM LS 
Sbjct  12   QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGRPMTLSE  66

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPI+P+K+  I+RL R L+HSG     K ++ D    EE Y LT A +L++  D  
Sbjct  67   LTSALPINPTKSHSIYRLMRILIHSGFFAKKKLSKSD----EEGYVLTDASQLLL-KDHP  121

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            +++  F++  +  V  K  +    WF+NDDP+PF TAHG   WDY +H+      FN+AM
Sbjct  122  LSITPFLNAMLDPVLTKPWHYFSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAM  181

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  + VF+G+ SLVDV GG GTVA AIA  FP +KCTVLDLPHV+A
Sbjct  182  ASDARLVTSVIV--DECRGVFEGLDSLVDVGGGTGTVAKAIADAFPHIKCTVLDLPHVVA  239

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+AVLLK
Sbjct  240  DLQGSKNLKYTGGDMFEAVPPADAVLLK  267



>gb|AEC13057.1| orcinol O-methyltransferase-like protein [Rosa chinensis]
Length=367

 Score =   247 bits (630),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 125/268 (47%), Positives = 175/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  12   QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  66

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  67   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  121

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H+      FN+AM
Sbjct  122  LSLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAM  181

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  182  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA  239

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  240  DLQGSKNLKYTGGDMFEAVPPADTVLLK  267



>emb|CAH05084.1| orcinol O-methyltransferase 3 [Rosa hybrid cultivar]
Length=346

 Score =   246 bits (628),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 125/268 (47%), Positives = 175/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  ++   +  V       L  WF+NDDP+PF TAHG   WDY +H+     LFN+AM
Sbjct  111  LSLTPYLTAMLDPVLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   +++    K VF+G+ SLVDV GG GT+A AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVIIN--DCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE+IP AN VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAIPPANTVLLK  256



>emb|CAJ65624.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   246 bits (628),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 125/268 (47%), Positives = 174/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H+      FN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                  N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSTNLKYTGGDMFEAVPPADTVLLK  256



>emb|CAJ65655.1| putative orcinol O-methyltransferase [Rosa lucieae]
Length=346

 Score =   246 bits (627),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 124/268 (46%), Positives = 175/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     + ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKRLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H+      FN+AM
Sbjct  111  LSLTPFLAAMLDPVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>emb|CAH05087.1| orcinol O-methyltransferase 4 [Rosa hybrid cultivar]
Length=346

 Score =   246 bits (627),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 126/268 (47%), Positives = 174/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GI D+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHVWNHIFSFINSMSLKSAIQLGILDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTNASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H+      FN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE+IP AN VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAIPPANTVLLK  256



>emb|CAJ65626.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   246 bits (627),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 125/268 (47%), Positives = 173/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H+      FN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTAHGTTFWDYGNHQPSIAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                  N+++ GGDMFE++P A  VLLK
Sbjct  229  DLQGSRNLKYTGGDMFEAVPPAGTVLLK  256



>emb|CAJ65638.1| putative orcinol O-methyltransferase [Rosa hugonis]
Length=346

 Score =   246 bits (627),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 125/268 (47%), Positives = 176/268 (66%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGCPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K  + L  WF+NDDP+PF TAHG   WDY +H+      FN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWHYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSMAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  171  ACDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>ref|XP_006357086.1| PREDICTED: tabersonine 16-O-methyltransferase-like [Solanum tuberosum]
Length=351

 Score =   246 bits (627),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 125/256 (49%), Positives = 172/256 (67%), Gaps = 14/256 (5%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLIS--ALPIHPSKA  357
            +E++QA+ Q WNHI +++ S+ L+CAV + IPD+++ HGKPM LS L +  +L I PSK 
Sbjct  8    SELLQAQTQIWNHIFSFMSSSALRCAVQLDIPDILYKHGKPMHLSDLSTELSLIIDPSKI  67

Query  358  PYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIG  537
             ++  L RFLVHSG++         +    +YYSLTP+ R ++  DE  NLR+ V L   
Sbjct  68   SFLPNLMRFLVHSGII---------EQHDHDYYSLTPSSRFLV-KDEPFNLRSLVLLTHD  117

Query  538  YVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALL  717
               QK+ + LG+W++ND P+ F TA+G+  WDYFS E    D+FN+ MA +S LIV  L+
Sbjct  118  PSVQKAWFELGNWYKNDIPTSFHTANGKYFWDYFSKEPKLGDIFNDVMASESGLIVNMLI  177

Query  718  SGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVG  897
            +    + VF+G+TSLVDV GG GT+A AIAK FP++ C V DLPHVI    S  N+EFVG
Sbjct  178  T--ECRHVFEGLTSLVDVGGGTGTMAIAIAKAFPSINCIVFDLPHVIEDLKSNGNMEFVG  235

Query  898  GDMFESIPTANAVLLK  945
            GDMF+ IP ANA+LLK
Sbjct  236  GDMFQKIPNANAILLK  251



>emb|CAJ65648.1| putative orcinol O-methyltransferase [Rosa woodsii var. ultramontana]
Length=346

 Score =   246 bits (627),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 124/268 (46%), Positives = 175/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + N+++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNDLLHAQAHIWNHIFSFINSTSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H+      FN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>emb|CAH05081.1| putative orcinol O-methyltransferase [Rosa hybrid cultivar]
 emb|CAJ65644.1| putative orcinol O-methyltransferase [Rosa phoenicia]
Length=346

 Score =   245 bits (626),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 125/268 (47%), Positives = 174/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H       FN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHHPSIAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>emb|CAH05082.1| putative orcinol O-methyltransferase [Rosa hybrid cultivar]
Length=346

 Score =   245 bits (626),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 125/268 (47%), Positives = 175/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H+      FN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPCIAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>emb|CAJ65622.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   245 bits (626),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 125/268 (47%), Positives = 174/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H       FN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHHPSIAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>ref|XP_003557042.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Glycine 
max]
Length=358

 Score =   246 bits (627),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/253 (46%), Positives = 171/253 (68%), Gaps = 5/253 (2%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            ++++A+   WNHI ++I+S +LKC VD+GIPD+IHN+G+PMPLS+LI++LPIHPSK  ++
Sbjct  11   KLLRAQTHIWNHIFSFINSMSLKCVVDLGIPDIIHNYGQPMPLSNLIASLPIHPSKTCFV  70

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
            HRL R ++HSG    ++   D +++ E  Y LT A  L++  +  +++  F+H  +  V 
Sbjct  71   HRLMRIMIHSGFF--SQQKHDLENELEAKYVLTDASVLLL-KNHPMSVTPFLHAMLDPVL  127

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGE  726
                     WF+N DP+PF TAHG  +WDY   +   N+LFN+AMA D+  +   ++  E
Sbjct  128  TNPWNQFSTWFKNGDPTPFETAHGMMLWDYAGADPKLNNLFNDAMASDARFVTSLVI--E  185

Query  727  SSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDM  906
              K VF G+ SLVDV GG GT+A AIAK FP ++C V DLPHV++     EN+++V GDM
Sbjct  186  KCKGVFMGLESLVDVGGGTGTMAKAIAKSFPRVECIVFDLPHVVSGLKGSENLKYVSGDM  245

Query  907  FESIPTANAVLLK  945
            FE+IP A+A+LLK
Sbjct  246  FEAIPPADAILLK  258



>emb|CAJ65602.1| putative orcinol O-methyltransferase [Rosa banksiae]
Length=346

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/254 (48%), Positives = 169/254 (67%), Gaps = 7/254 (3%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPY  363
            NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS L SALPIHP+K+  
Sbjct  10   NELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTKSHS  69

Query  364  IHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYV  543
            ++RL R LVHSG     K +  D    EE Y+LT A +L++  D  ++L  F+   +  V
Sbjct  70   VYRLMRTLVHSGFFAKKKLSTTD----EEGYTLTDASQLLL-KDHPLSLTPFLTAMLDPV  124

Query  544  YQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSG  723
              K    L  WF+NDDP+PF TAHG   WDY +H+      FN+AMA D+ L+   ++  
Sbjct  125  LTKPWNYLSTWFQNDDPAPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVII--  182

Query  724  ESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGD  903
            +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A     +N+++ GGD
Sbjct  183  DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGD  242

Query  904  MFESIPTANAVLLK  945
            MFE++P A+AVLLK
Sbjct  243  MFEAVPPADAVLLK  256



>emb|CAJ65635.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/268 (47%), Positives = 174/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GI D+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGILDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTNASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H+      FN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE+IP AN VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAIPPANTVLLK  256



>emb|CAJ65609.1| putative orcinol O-methyltransferase [Rosa bracteata]
Length=346

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/254 (48%), Positives = 169/254 (67%), Gaps = 7/254 (3%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPY  363
            NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS L SALPIHP+K+  
Sbjct  10   NELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTKSHS  69

Query  364  IHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYV  543
            ++RL R LVHSG     K +  D    EE Y+LT A +L++  D  +++  F+   +  V
Sbjct  70   VYRLMRILVHSGFFAKKKLSTTD----EEGYTLTDASQLLL-KDHPLSITPFLTAMLDPV  124

Query  544  YQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSG  723
              K    L  WF+NDDP+PF TAHG   WDY +H+      FN+AMA D+ L+   ++  
Sbjct  125  LTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVII--  182

Query  724  ESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGD  903
            +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A     +N+++ GGD
Sbjct  183  DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGD  242

Query  904  MFESIPTANAVLLK  945
            MFE++P A+AVLLK
Sbjct  243  MFEAVPPADAVLLK  256



>ref|XP_006376386.1| hypothetical protein POPTR_0013s12560g [Populus trichocarpa]
 ref|XP_006376390.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP54183.1| hypothetical protein POPTR_0013s12560g [Populus trichocarpa]
 gb|ERP54187.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=359

 Score =   246 bits (627),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/262 (48%), Positives = 172/262 (66%), Gaps = 9/262 (3%)
 Frame = +1

Query  169  KLCNE---NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALP  339
            +L NE   +E++QA+   WNHI  +I+S TLKCAV +GIPD+I  HGKPM LS L+SALP
Sbjct  2    ELINEESASELLQAQTHVWNHIFYFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALP  61

Query  340  IHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAF  519
            IHPSKA Y+HRL R LVHSG          +D   ++ YSLT + RL++ D+   ++R  
Sbjct  62   IHPSKAQYVHRLMRILVHSGFF---SQQNLNDIHNQDAYSLTQSTRLLLKDN-PWSMRPL  117

Query  520  VHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSEL  699
            + + +  V  K    L  WF+NDD + F  AH    W+Y   +   N+LFN+AMA+DS L
Sbjct  118  LLVFLDPVLTKPWDCLSTWFQNDDRNAFSVAHENTFWEYAGQDPRINNLFNDAMARDSIL  177

Query  700  IVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIE  879
            + + ++     K +FDGV SLVDV GG GT+A  IA+ FP M CTV DLPHV++     +
Sbjct  178  VSKVVVC--KCKGIFDGVNSLVDVGGGLGTMAKGIAEAFPHMDCTVFDLPHVVSDLQGSK  235

Query  880  NVEFVGGDMFESIPTANAVLLK  945
            N+++VGGDMFE++P A+A+LLK
Sbjct  236  NLKYVGGDMFEAVPPADAILLK  257



>ref|XP_002525159.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF37286.1| o-methyltransferase, putative [Ricinus communis]
Length=356

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/256 (47%), Positives = 169/256 (66%), Gaps = 6/256 (2%)
 Frame = +1

Query  178  NENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKA  357
            +  E++QA+A  WNHI N+I+S +LK A+ +GIPD IH+HGKP+ LS LI+ALPIHP+KA
Sbjct  7    DAQELLQAQAYIWNHIFNFINSMSLKTAIQLGIPDAIHSHGKPISLSLLIAALPIHPAKA  66

Query  358  PYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIG  537
              I RL R L+HSG     K   +D   + E Y LT A +L++ D+   ++  F+   + 
Sbjct  67   RCIPRLMRILIHSGFFAKAKLKEND---EAEGYVLTKASKLLLKDN-PFSVTPFLLAMLD  122

Query  538  YVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALL  717
             +  +  + L  WF+NDD + F TAHG   W+Y  +E   N+ FNEAMA D+ L++  L+
Sbjct  123  RILTEPWHYLSTWFQNDDATAFTTAHGMGFWEYAGNEPKLNNFFNEAMASDARLVMRVLI  182

Query  718  SGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVG  897
              +  K VF+G+ SLVDV GG GT+A AIAK FP + C V DLPHV+A  +  EN+++V 
Sbjct  183  --DEYKGVFEGLKSLVDVGGGTGTMAKAIAKAFPRLDCIVFDLPHVVAGLAGSENLKYVA  240

Query  898  GDMFESIPTANAVLLK  945
            GDMFE +P A+A+LLK
Sbjct  241  GDMFEGVPPADAILLK  256



>emb|CAJ65621.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/256 (48%), Positives = 169/256 (66%), Gaps = 7/256 (3%)
 Frame = +1

Query  178  NENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKA  357
            + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS L SALPIHP+K+
Sbjct  8    HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTKS  67

Query  358  PYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIG  537
              ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  ++L  F+   + 
Sbjct  68   HSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHPLSLTPFLTAMLD  122

Query  538  YVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALL  717
             V  K    L  WF+NDDP+PF TAHG   WDY +H       FN+AMA D+ L+   ++
Sbjct  123  PVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHHPSIAHFFNDAMASDARLVTSVII  182

Query  718  SGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVG  897
              +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A     +N+++ G
Sbjct  183  --DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTG  240

Query  898  GDMFESIPTANAVLLK  945
            GDMFE++P A+ VLLK
Sbjct  241  GDMFEAVPPADTVLLK  256



>emb|CAJ65620.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/268 (46%), Positives = 174/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++  +A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHVQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTNASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H+      FN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPYIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>emb|CAH05091.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/268 (46%), Positives = 176/268 (66%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ +G PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H+     LFN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTAHGMAFWDYGNHQPSIAHLFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GT+A AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPLADTVLLK  256



>ref|XP_006376392.1| hypothetical protein POPTR_0013s12620g [Populus trichocarpa]
 gb|ERP54189.1| hypothetical protein POPTR_0013s12620g [Populus trichocarpa]
Length=355

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/262 (47%), Positives = 169/262 (65%), Gaps = 13/262 (5%)
 Frame = +1

Query  169  KLCNEN---EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALP  339
            +L NE    E++QA+   WNHI  +I+S TLKCAV +GIPD+I  HGKPM LS L+SALP
Sbjct  2    ELINEESAGELLQAQTHVWNHIFCFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALP  61

Query  340  IHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAF  519
            IHPSKA Y+HRL R LVHSG            +  +E YSLT + RL++ D+  +++R  
Sbjct  62   IHPSKAQYVHRLMRILVHSGFF-------SQQNLNQEAYSLTQSTRLLLKDN-PLSMRTL  113

Query  520  VHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSEL  699
            +   +  V  K    L  WFRND+ + F  AH    W+Y   +S  N+LFN+AMA DS L
Sbjct  114  LLFVLDPVLTKPHDCLSTWFRNDEATAFSIAHESIFWEYAGQDSRINNLFNDAMASDSIL  173

Query  700  IVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIE  879
            + + ++S    K +F+GV SLVDV GG GT+A  IA+ FP M CTV DLP V++     +
Sbjct  174  VSKVVVS--KCKGIFEGVNSLVDVGGGLGTMAKGIAEAFPHMDCTVFDLPRVVSDLQGSK  231

Query  880  NVEFVGGDMFESIPTANAVLLK  945
            N+++VGGDMFE++P A+ +LLK
Sbjct  232  NLKYVGGDMFEAVPPADVILLK  253



>ref|XP_006376388.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP54185.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=365

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 125/262 (48%), Positives = 168/262 (64%), Gaps = 9/262 (3%)
 Frame = +1

Query  169  KLCNEN---EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALP  339
            +L NE    E++QA+   WNHI N+I+S TLKCAV +GIPD+I  HGKPM LS L+SALP
Sbjct  8    ELINEESVGELLQAQTHVWNHIFNFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALP  67

Query  340  IHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAF  519
            IHPSKA Y+HRL R LVHSG          +    +E YSLT + RL++ D+   N+R  
Sbjct  68   IHPSKAQYVHRLMRILVHSGFF---SQQNLNGVHNQEAYSLTQSTRLLLKDN-PWNMRPL  123

Query  520  VHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSEL  699
            +   +  V  K    L  WFRND+ + F  AH    W+Y   +    +LFNEAMA DS L
Sbjct  124  LLFELDSVLTKPWDCLSTWFRNDEATAFSVAHENTFWEYAGQDPRIKNLFNEAMASDSIL  183

Query  700  IVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIE  879
              + ++S    K +F+G++SLVDV GG GT+A  IA+ FP M CTV DLPHV++     +
Sbjct  184  ASKLVVS--KCKGIFEGLSSLVDVGGGFGTMAKGIAEAFPHMDCTVFDLPHVVSDLQGCK  241

Query  880  NVEFVGGDMFESIPTANAVLLK  945
            N+++VGGDMF+++P A A+LLK
Sbjct  242  NLKYVGGDMFQAVPPAEAILLK  263



>emb|CAJ65611.1| putative orcinol O-methyltransferase [Rosa canina]
Length=346

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/268 (47%), Positives = 175/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SAL IHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++ D  S
Sbjct  56   LTSALLIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLLKDHPS  111

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
             +L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H+     LFN+AM
Sbjct  112  -SLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>ref|XP_010088036.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXB31255.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=373

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/254 (48%), Positives = 168/254 (66%), Gaps = 4/254 (2%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPY  363
             E++ A+A  WN+I N+I+S +LKCAV +GIPD IH HGKPM LS LI ALP+H +KAPY
Sbjct  23   TELLGAQAHIWNNIFNFINSMSLKCAVQLGIPDTIHKHGKPMTLSKLIGALPVHQNKAPY  82

Query  364  IHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYV  543
            ++RL R LVHSG   + +   + D ++EE Y LT A +L++GD+  +++  F+   +  V
Sbjct  83   VYRLMRILVHSGFFSL-QTIGESDHQEEEGYVLTDASKLLVGDN-PLSVAPFLLAMLDPV  140

Query  544  YQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSG  723
              K    L  WF+NDDP+ F T +G   W Y   E    + FN+AMA D+ L++  ++  
Sbjct  141  LTKPWDFLSTWFQNDDPTAFDTVNGLPFWKYGGQEPKMANFFNDAMASDARLVISVVI--  198

Query  724  ESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGD  903
            E+ K VFD + S VDV GG GTVA AIA  FP M+CTV DLPHV+      +N++FVGGD
Sbjct  199  ENCKWVFDELESFVDVGGGTGTVAKAIAATFPKMECTVFDLPHVVGDLQGKDNLKFVGGD  258

Query  904  MFESIPTANAVLLK  945
            MF+ +P A+A+LLK
Sbjct  259  MFQQVPPADAILLK  272



>ref|XP_006469135.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=402

 Score =   246 bits (628),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/258 (47%), Positives = 175/258 (68%), Gaps = 7/258 (3%)
 Frame = +1

Query  181  ENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAP  360
            + E+++A+A  WNHI N+I+S +LKCAV++GIPD+I+ HGKPM L+ L+SAL I+PSK  
Sbjct  49   DTELLEAQAHVWNHIFNFINSMSLKCAVELGIPDIINKHGKPMTLNELVSALTINPSKTR  108

Query  361  YIHRLTRFLVHSGLLL--VTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCI  534
             ++RL R L+HSG         +R+++D +E+ Y LT A +L++ D+  +++  F+   +
Sbjct  109  CVYRLMRILIHSGFFAQQTLNSSRNNND-EEQGYVLTNASKLLLKDN-PLSVTPFLQAML  166

Query  535  GYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEAL  714
              +       L  WF+NDDP+PF TAHG+ +W+Y   E   N+ FNEAMA D+ L    +
Sbjct  167  DPILLSPWLKLSTWFQNDDPTPFDTAHGKSLWEYAGDEPKINNFFNEAMASDARLATRVV  226

Query  715  LSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVI-ACGSSIENVEF  891
            +     KDVF+G+ SLVDV GG GTVA AIAK FP ++CT  DLPHV+    S + N+++
Sbjct  227  I--HKCKDVFEGLNSLVDVGGGTGTVAKAIAKAFPNLECTDFDLPHVVNGLESDLANLKY  284

Query  892  VGGDMFESIPTANAVLLK  945
            +GGDMFE+IP A+AVL K
Sbjct  285  IGGDMFEAIPPADAVLFK  302



>emb|CAJ65617.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 123/268 (46%), Positives = 176/268 (66%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  ++   +  V       L  WF+NDDP+PF TAHG   WDY +H+     LFN+AM
Sbjct  111  LSLTPYLTAMLDPVLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   +++    K VF+G+ SLVDV GG GT+A AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVIIN--DCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N++++GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYIGGDMFEAVPPADTVLLK  256



>emb|CAH05079.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/268 (46%), Positives = 174/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H       FN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHHPSIAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GT+A AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>emb|CAJ65615.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 123/268 (46%), Positives = 176/268 (66%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  ++   +  V       L  WF+NDDP+PF TAHG   WDY +H+     LFN+AM
Sbjct  111  LSLTPYLTAMLDPVLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   +++    K VF+G+ SLVDV GG GT+A AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVIIN--DCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N++++GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYIGGDMFEAVPPADTVLLK  256



>emb|CAJ65610.1| putative orcinol O-methyltransferase [Rosa canina]
Length=346

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 125/268 (47%), Positives = 175/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SAL IHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALLIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H+     LFN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>emb|CAJ65665.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   244 bits (624),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 124/268 (46%), Positives = 174/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM L  
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSVSLKSAIQLGIPDIINKHGYPMTLFE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H+      FN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>emb|CAJ65614.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=346

 Score =   244 bits (624),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 123/268 (46%), Positives = 176/268 (66%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  ++   +  V       L  WF+NDDP+PF TAHG   WDY +H+     LFN+AM
Sbjct  111  LSLTPYLTAMLDPVLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   +++    K VF+G+ SLVDV GG GT+A AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVIIN--DCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N++++GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYIGGDMFEAVPPADTVLLK  256



>emb|CAJ65643.1| putative orcinol O-methyltransferase [Rosa marretii]
Length=346

 Score =   244 bits (623),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 124/268 (46%), Positives = 174/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H+      FN+AM
Sbjct  111  LSLTPFLTAVLDPVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLP V+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPQVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>ref|XP_006446728.1| hypothetical protein CICLE_v10015708mg [Citrus clementina]
 gb|ESR59968.1| hypothetical protein CICLE_v10015708mg [Citrus clementina]
Length=362

 Score =   244 bits (624),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 120/258 (47%), Positives = 174/258 (67%), Gaps = 7/258 (3%)
 Frame = +1

Query  181  ENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAP  360
            + E+++A+A  WNHI N+I+S +LKCAV++GIPD+I+ HGKPM L+ L+SAL I+PSK  
Sbjct  9    DTELLEAQAHVWNHIFNFINSMSLKCAVELGIPDLINKHGKPMTLNELVSALTINPSKTR  68

Query  361  YIHRLTRFLVHSGLLL--VTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCI  534
             ++RL R L+HSG         +R+++D +E+ Y LT A +L++ D+  +++  F+   +
Sbjct  69   CVYRLMRILIHSGFFAQQTLNSSRNNND-EEQGYVLTNASKLLLKDN-PLSVTPFLQAML  126

Query  535  GYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEAL  714
              +       L  WF+NDDP+PF TAHG+  W+Y   E   N+ FNEAMA D+ L    +
Sbjct  127  DPILLSPWLKLSTWFQNDDPTPFDTAHGKSFWEYAGDEPKINNFFNEAMASDARLATSVV  186

Query  715  LSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVI-ACGSSIENVEF  891
            +     KDVF+G+ SLVDV GG GTVA AIAK FP ++CT  DLPHV+    S + N+++
Sbjct  187  I--HKCKDVFEGLNSLVDVGGGTGTVAKAIAKAFPNLECTDFDLPHVVNGLESDLANLKY  244

Query  892  VGGDMFESIPTANAVLLK  945
            VGGD+FE+IP A+AVL K
Sbjct  245  VGGDVFEAIPPADAVLFK  262



>ref|XP_003615973.1| O-methyltransferase [Medicago truncatula]
 gb|AES98931.1| orcinol O-methyltransferase [Medicago truncatula]
Length=363

 Score =   244 bits (624),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 118/252 (47%), Positives = 166/252 (66%), Gaps = 6/252 (2%)
 Frame = +1

Query  190  VVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYIH  369
            +++A++  WNHI N+I+S +LKC VD+GIPD+IHNHGKPMP+S LIS+LPIHPSK P IH
Sbjct  14   LLKAQSHVWNHIFNFINSMSLKCVVDLGIPDIIHNHGKPMPISKLISSLPIHPSKKPCIH  73

Query  370  RLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVYQ  549
            RL R + HSG       A ++ + +   Y LT A RL++ D+  +++  FV+  +  V  
Sbjct  74   RLMRIMTHSGFFSQQNIAANEPEIE---YMLTDASRLLLKDN-PMSVTPFVYAMLDPVMM  129

Query  550  KSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGES  729
               +    W +NDD + F T HG  +W+Y + +S +N+LFNE+MA D++L+   L+  E 
Sbjct  130  NPWHQFSMWLKNDDTTSFETTHGMLLWEYAACDSKFNNLFNESMANDAQLVSNLLV--EK  187

Query  730  SKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDMF  909
             K VF+   SLVDV GG GT+A   AK FP M+C V DLPHV+      EN+ +VGGDMF
Sbjct  188  CKGVFNEFESLVDVGGGTGTMAKTFAKSFPQMECIVFDLPHVVDGLQGSENLSYVGGDMF  247

Query  910  ESIPTANAVLLK  945
            + IP  +A+LLK
Sbjct  248  KEIPPTDAILLK  259



>emb|CAH05083.1| putative orcinol O-methyltransferase [Rosa hybrid cultivar]
Length=346

 Score =   244 bits (622),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 122/268 (46%), Positives = 175/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    KKWSNGE-----DSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGPPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  + RL R LVHSG     K +  D    EE Y+LT   +L++  D  
Sbjct  56   LTSALPIHPTKSHSLDRLMRILVHSGFFAKEKLSETD----EEGYTLTDTSQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K  + L  WF+NDD +PF TAHG  +WDY +H+  ++  FN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWHHLSTWFQNDDLTPFATAHGMTMWDYGNHQPSFSHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   +++    K VF+G+ SLVDV GG GT+A AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVASVIIN--ECKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>ref|XP_009778350.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
sylvestris]
Length=350

 Score =   244 bits (622),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 122/256 (48%), Positives = 169/256 (66%), Gaps = 10/256 (4%)
 Frame = +1

Query  178  NENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKA  357
            + +E++QA+AQTWNHI ++ +S+ ++CAV +GIPD+++ HGKPM LS L+S LP+HPSK 
Sbjct  5    SSSELLQAQAQTWNHIFDFTNSSAVRCAVQLGIPDVLYKHGKPMCLSDLLSQLPLHPSKV  64

Query  358  PYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIG  537
              +  L R LVHSG L       +  +K   YYSLTPA RL++  +E +N+R+ + +   
Sbjct  65   SSMPILLRLLVHSGFL-------NQHEKDHYYYSLTPASRLLV-RNEPLNIRSLLLINHE  116

Query  538  YVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALL  717
               QK+ + L  WF+ND P+ F TAHG+  WDYF+ +      FN+AMA DS LI +  +
Sbjct  117  PFLQKAWFELSSWFQNDFPTAFHTAHGKSFWDYFTEKPRQGSDFNDAMASDSRLIADVFV  176

Query  718  SGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVG  897
              +  K VF+G+ SLVDV GG GTVA+ IAK  P +KC V DLP V+A      N+EFVG
Sbjct  177  --KECKHVFEGLESLVDVGGGTGTVATVIAKANPTIKCIVFDLPRVVADLKGSGNLEFVG  234

Query  898  GDMFESIPTANAVLLK  945
            G MF+ IP  NA+LLK
Sbjct  235  GSMFDEIPHVNAILLK  250



>emb|CAJ65656.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   244 bits (622),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 124/268 (46%), Positives = 173/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI N+I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFNFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++     
Sbjct  56   LSSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KGHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF T HG   WDY +H+     LFN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTTHGMTFWDYGNHQPSIAHLFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+ 
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVG  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>ref|XP_006376381.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP54178.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=359

 Score =   244 bits (623),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 128/262 (49%), Positives = 172/262 (66%), Gaps = 9/262 (3%)
 Frame = +1

Query  169  KLCNEN---EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALP  339
            +L NE    E++QA++  WNHI N+I+S TLKCAV +GIPD+I  HGKPM LS L+SALP
Sbjct  2    ELINEESAGEMLQAQSHVWNHIFNFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALP  61

Query  340  IHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAF  519
            IHPSKA Y+HRL R LVHSG          +    +E YSLT + RL++ D+   ++R  
Sbjct  62   IHPSKAQYVHRLMRILVHSGFF---SQQNLNGIHNQEAYSLTQSTRLLLKDN-PWSVRPL  117

Query  520  VHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSEL  699
            + L +  V  K    L  WF+NDD + F  AH +  W+Y   ++  N+LFNEAMA DS L
Sbjct  118  LLLLLDPVLTKPWDCLSTWFQNDDRNAFSVAHEKTFWEYAGQDARLNNLFNEAMASDSIL  177

Query  700  IVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIE  879
              + ++S    K +FDGV SLVDV GG GT+   IA+ FP M CTV DLPHV++     +
Sbjct  178  ASKLVVS--KCKGIFDGVNSLVDVGGGLGTMTKGIAEAFPHMDCTVFDLPHVVSDLQGGK  235

Query  880  NVEFVGGDMFESIPTANAVLLK  945
            N+++VGGDMFE++P A+A+LLK
Sbjct  236  NLKYVGGDMFEAVPPADALLLK  257



>emb|CAJ65599.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   244 bits (622),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 123/268 (46%), Positives = 175/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  ++   +  V       L  WF+NDDP+PF TAHG   WDY +H+     LFN+AM
Sbjct  111  LSLTPYLTAMLDPVLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   +++    K VF+G+ SLVDV GG GT+A AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVIIN--DCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>emb|CAH05085.1| orcinol O-methyltransferase 3 [Rosa hybrid cultivar]
Length=346

 Score =   243 bits (621),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 123/268 (46%), Positives = 175/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  ++   +  V       L  WF+NDDP+PF TAHG   WDY +H+     LFN+AM
Sbjct  111  LSLTPYLTAMLDPVLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   +++    K VF+G+ SLVDV GG GT+A AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVIIN--DCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>emb|CAD29556.1| orcinol O-methyltransferase [Rosa hybrid cultivar]
Length=348

 Score =   243 bits (621),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 124/269 (46%), Positives = 174/269 (65%), Gaps = 12/269 (4%)
 Frame = +1

Query  139  REKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLS  318
             +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS
Sbjct  1    NQKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLS  55

Query  319  HLISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDE  498
             L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D 
Sbjct  56   ELSSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKID----EEGYTLTDASQLLL-KDH  110

Query  499  SINLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEA  678
             ++L  F+   +  V  K    L  WF+NDDP+PF T HG   WDY +H+     LFN+A
Sbjct  111  PLSLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTTHGMTFWDYGNHQPNIAHLFNDA  170

Query  679  MAKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVI  858
            MA D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+
Sbjct  171  MASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVV  228

Query  859  ACGSSIENVEFVGGDMFESIPTANAVLLK  945
                  +N+++ GGDMFE++P A+ VLLK
Sbjct  229  GDLQGSKNLKYTGGDMFEAVPPADTVLLK  257



>emb|CAJ65664.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   243 bits (621),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 124/268 (46%), Positives = 174/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LSSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKID----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF T HG   WDY +H+     LFN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTTHGMTFWDYGNHQPSIAHLFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+ 
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVG  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>emb|CAJ65633.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   243 bits (621),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 123/268 (46%), Positives = 172/268 (64%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++  +A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHVQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            + L  F+   +  V  K    L  WF+NDDP+PF T HG   WDY +H+     LFN+AM
Sbjct  111  LTLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTTHGMTFWDYGNHQPSIAHLFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+ 
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVG  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>ref|XP_003544912.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
1 [Glycine max]
Length=358

 Score =   243 bits (621),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 116/253 (46%), Positives = 169/253 (67%), Gaps = 5/253 (2%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            ++++A+   WNHI ++I+S +LKC VD+GIPD+IHN+G+PMPLS+LI++LPIHPSK  ++
Sbjct  11   KLLRAQTHIWNHIFSFINSMSLKCVVDLGIPDIIHNYGQPMPLSNLIASLPIHPSKTCFV  70

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
            HRL R ++HSG   +     D +++ E  Y LT A  L++  +  +++  F+H  +  V 
Sbjct  71   HRLMRIMIHSGFFSLQN--HDLENELEAKYVLTDASVLLL-KNHPMSVTPFLHAMLDPVL  127

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGE  726
                     WF+N DP+PF TAHG+  WDY   +   N LFN+AMA D+  +   ++  E
Sbjct  128  TNPWNQFSTWFKNGDPTPFETAHGKMFWDYAGADPKLNHLFNDAMASDARFVTSLVI--E  185

Query  727  SSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDM  906
              K VF G+ SLVDV GG GT+A AIAK FP ++C V DLPHV++     EN+++V GDM
Sbjct  186  KCKGVFMGLESLVDVGGGTGTMAKAIAKSFPRVECIVFDLPHVVSGLKGSENLKYVAGDM  245

Query  907  FESIPTANAVLLK  945
            FE+IP A+A+LLK
Sbjct  246  FEAIPPADAILLK  258



>emb|CAJ65606.1| putative orcinol O-methyltransferase [Rosa beggeriana]
Length=346

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 124/268 (46%), Positives = 174/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SAL IHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALLIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H+      FN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>emb|CAJ65603.1| putative orcinol O-methyltransferase [Rosa banksiae]
Length=346

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 125/268 (47%), Positives = 174/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGFPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K +  D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSTTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H+      FN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTAHGMTSWDYGNHQPSIAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  F  ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFSHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+AVLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADAVLLK  256



>emb|CAH05086.1| orcinol O-methyltransferase 4 [Rosa hybrid cultivar]
Length=346

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 124/268 (46%), Positives = 174/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GI D+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGILDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTNASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H+      FN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSTAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>gb|AAM23004.1|AF502433_1 orcinol O-methyltransferase [Rosa hybrid cultivar]
 emb|CAD29458.1| orcinol O-methyltransferase [Rosa chinensis]
 emb|CAH05077.1| orcinol O-methyltransferase 1 [Rosa chinensis]
Length=367

 Score =   243 bits (621),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 123/268 (46%), Positives = 175/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  12   QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  66

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  67   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  121

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  ++   +  V       L  WF+NDDP+PF TAHG   WDY +H+     LFN+AM
Sbjct  122  LSLTPYLTAMLDPVLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAM  181

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   +++    K VF+G+ SLVDV GG GT+A AIA  FP ++CTVLDLPHV+A
Sbjct  182  ASDARLVTSVIIN--DCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVA  239

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  240  DLQGSKNLKYTGGDMFEAVPPADTVLLK  267



>emb|CAJ65649.1| putative orcinol O-methyltransferase [Rosa woodsii var. ultramontana]
Length=346

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 123/268 (46%), Positives = 173/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L S LPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSTLPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +     K    L  WF+NDDP+PF TAHG   WDY +H+      FN+AM
Sbjct  111  LSLAPFLTAMLDPALTKPWNYLSIWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPLADTVLLK  256



>ref|XP_002517827.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44345.1| o-methyltransferase, putative [Ricinus communis]
Length=356

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/256 (46%), Positives = 172/256 (67%), Gaps = 6/256 (2%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            E++QA+A  WNHI N+I+S +LK A+ +GIPD IH+HG+P+ LS LI+ALP+ P+KA  I
Sbjct  10   ELLQAQAHIWNHIFNFINSMSLKSAIQLGIPDAIHSHGRPISLSQLIAALPVLPAKARCI  69

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
             RL R LVHSG     K   +D   +EE + LT A +L++ D+  +++  F+   +  + 
Sbjct  70   PRLMRILVHSGFFANAKIKGND---EEEGFVLTSASKLLLKDN-PLSVTPFLLAMLDPIL  125

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGE  726
             +  + +  WF+NDD +PF T HG   W+Y  +E  +N+ FNEAMA D+ L++  L+  +
Sbjct  126  TEPWHYVSTWFQNDDATPFDTVHGMPFWEYAGNEPKFNNFFNEAMASDARLVMRVLI--D  183

Query  727  SSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDM  906
              K VF+G+ SLVDV GG GT+A+AIAK FP + C V DLPHV+A   S  N+++VGG+M
Sbjct  184  EYKGVFEGLNSLVDVGGGTGTMAAAIAKAFPQLDCIVFDLPHVVAGLQSSANLKYVGGNM  243

Query  907  FESIPTANAVLLKVYI  954
            FE +P A+A+LLK  I
Sbjct  244  FEGVPPADAILLKWII  259



>emb|CAJ65608.1| putative orcinol O-methyltransferase [Rosa bracteata]
Length=346

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/254 (48%), Positives = 167/254 (66%), Gaps = 7/254 (3%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPY  363
            NE + A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS L SALPIHP+K+  
Sbjct  10   NEPLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSELTSALPIHPTKSHS  69

Query  364  IHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYV  543
            ++RL R LVHSG     K +  D    EE Y+LT A +L++  D  +++  F+   +  V
Sbjct  70   VYRLMRILVHSGFFAKKKLSTTD----EEGYTLTDASQLLL-KDHPLSITPFLTAMLDPV  124

Query  544  YQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSG  723
              K    L  WF+NDDP+PF TAHG   WDY +H+      FN+AMA D+ L+   ++  
Sbjct  125  LTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAMASDARLVTSVII--  182

Query  724  ESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGD  903
            +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A     +N+++ GGD
Sbjct  183  DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGD  242

Query  904  MFESIPTANAVLLK  945
            MFE+ P A+AVLLK
Sbjct  243  MFEAAPPADAVLLK  256



>emb|CAJ65634.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 124/268 (46%), Positives = 173/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L +  D  
Sbjct  56   LSSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKID----EEGYTLTDASQL-LPKDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF T HG   WDY +H+     LFN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTTHGMTFWDYGNHQPNIAHLFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+ 
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVG  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>emb|CAJ65600.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=346

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/268 (46%), Positives = 174/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K  + D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKGKLCKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  ++   +  V       L  WF+NDDP+PF TAHG   WDY +H+     LFN+AM
Sbjct  111  LSLTPYLTAMLDPVLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   +++    K VF+G+ SLVDV GG GT+A AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVIIN--DCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>gb|KDO39394.1| hypothetical protein CISIN_1g021867mg [Citrus sinensis]
Length=306

 Score =   240 bits (613),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 120/258 (47%), Positives = 172/258 (67%), Gaps = 7/258 (3%)
 Frame = +1

Query  181  ENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAP  360
            + E+++A+A  WNHI N+I+S +LKCAV++GIPD+I+ HGKPM L+ L+SAL I+PSK  
Sbjct  9    DTELLEAQAHVWNHIFNFINSMSLKCAVELGIPDIINKHGKPMTLNELVSALTINPSKTR  68

Query  361  YIHRLTRFLVHSGLLL--VTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCI  534
             ++RL R L+HSG         +R+++D +E+ Y L  A +L++ D+  +++  F+   +
Sbjct  69   CVYRLMRILIHSGFFAQQTLNSSRNNND-EEQGYVLKNASKLLLKDN-PLSVTPFLQAML  126

Query  535  GYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEAL  714
              +       L  WF+NDDP+PF T HG+  W Y   E   N+ FNEAMA D+ L    +
Sbjct  127  DPILLSPWLKLSTWFQNDDPTPFDTLHGKSFWVYAGDEPKINNFFNEAMASDARLATRVV  186

Query  715  LSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVI-ACGSSIENVEF  891
            +     KDVF+G+ SLVDV GG GTVA AIAK FP ++CT  DLPHV+    S + N+++
Sbjct  187  I--HKCKDVFEGLNSLVDVGGGIGTVAKAIAKAFPNLECTDFDLPHVVNGLESDLANLKY  244

Query  892  VGGDMFESIPTANAVLLK  945
            VGGDMFE+IP A+AVLLK
Sbjct  245  VGGDMFEAIPPADAVLLK  262



>emb|CDP15888.1| unnamed protein product [Coffea canephora]
Length=362

 Score =   242 bits (618),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/253 (45%), Positives = 169/253 (67%), Gaps = 6/253 (2%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            E+ QA+A  WNHI N+I+S +LKCA+ +GIPD+IH HG+PM L+ LI ALPI+ +KAP++
Sbjct  12   ELFQAQAHIWNHIFNFINSMSLKCAIQLGIPDIIHKHGQPMALAQLIDALPINNAKAPFV  71

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
            +RL R L+HSG  +    A+  D++ +E Y+LT A +L++ +D   ++  F+   +  + 
Sbjct  72   YRLMRILIHSGFFI---KAKIPDNEGQEGYALTSASKLLLAND-PFSVTPFLLAMLDPIL  127

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGE  726
                +    WF+N + +PF T HG  +W+    +   N  FNE MA D+ L+   ++  E
Sbjct  128  TDPWHHFSQWFQNSEETPFHTCHGTSLWELAGRQPQLNQFFNEGMASDARLVSTMVI--E  185

Query  727  SSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDM  906
            + KDVF G+ SL+DV GG GTVA AIA  FP ++C+VLDLPHV+    S +N+ +VGGDM
Sbjct  186  NCKDVFMGLNSLIDVGGGTGTVAKAIADAFPHLQCSVLDLPHVVDGWESSKNLAYVGGDM  245

Query  907  FESIPTANAVLLK  945
            FE+IP A+AVLLK
Sbjct  246  FEAIPPADAVLLK  258



>emb|CAJ65616.1| putative orcinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=345

 Score =   241 bits (616),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 124/268 (46%), Positives = 176/268 (66%), Gaps = 13/268 (5%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKYAIQLGIPDIINKHG-PMTLSE  54

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+P ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  55   LTSALPIHPTKSPSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  109

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V       L  WF+NDDP+PF TAHG   WDY +H+     LFN+AM
Sbjct  110  LSLMPFLTAMLDPVLTTPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAM  169

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   +++    K VF+G+ SL+DV GG GTVA AIA  FP ++CTVLDLP+V+A
Sbjct  170  ASDARLVTSVIIN--DCKGVFEGLESLIDVGGGIGTVAKAIADAFPHIECTVLDLPYVVA  227

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  228  DLQGSKNLKYTGGDMFEAVPPADTVLLK  255



>emb|CAJ65639.1| putative orcinol O-methyltransferase [Rosa hugonis]
Length=346

 Score =   241 bits (616),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 123/268 (46%), Positives = 175/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++++S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFMNSMSLKSAIQLGIPDIINKHGCPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A + ++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQPLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K  + L  WF+NDDP+PF TAHG   WDY +H+      FN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWHYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSMAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  171  ACDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>ref|XP_004490687.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cicer 
arietinum]
Length=354

 Score =   241 bits (616),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 117/258 (45%), Positives = 173/258 (67%), Gaps = 10/258 (4%)
 Frame = +1

Query  178  NENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKA  357
            N + +++A++  WNH+ N+I+S +LKC VD+GIPD+IHN+ KPMPLS LIS+LPIHPSK 
Sbjct  5    NASNLLKAQSHIWNHMCNFINSMSLKCVVDLGIPDIIHNYEKPMPLSVLISSLPIHPSKI  64

Query  358  PYIHRLTRFLVHSGLLLVTKPARDD--DDKQEEYYSLTPAGRLVIGDDESINLRAFVHLC  531
            P I+RL R + H G       ++D+  +++ E  Y LT    L++  D  +++  F+ + 
Sbjct  65   PCIYRLMRIMTHLGFF-----SKDNVTENELEIEYMLTDESILLL-KDHPMSVTPFLQVV  118

Query  532  IGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEA  711
            +  +     ++L  W +NDDP+ F T HG  IWDY + E  +N+LFN+AMA D+ L+   
Sbjct  119  LDPIVANPWHNLSTWLKNDDPTTFETTHGMLIWDYAAREPKFNNLFNDAMASDARLVTSV  178

Query  712  LLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEF  891
            ++  E  K VF+G+ SLVDV GG GT+A A+AK FP M+C V DLPHV+      +N+ +
Sbjct  179  VI--EKCKGVFNGLESLVDVGGGTGTMAKALAKTFPMMECNVFDLPHVVDGLQGSDNLNY  236

Query  892  VGGDMFESIPTANAVLLK  945
            VGGDMF++IP A+A+LLK
Sbjct  237  VGGDMFKNIPPADAILLK  254



>emb|CAJ65627.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   241 bits (616),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 122/268 (46%), Positives = 175/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ +G PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  ++   +  V       L  WF+NDDP+PF TAHG   WDY +H+     LFN+AM
Sbjct  111  LSLTPYLTAMLDPVLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GT+A AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>sp|B0EXJ8.1|HTOMT_CATRO RecName: Full=Tabersonine 16-O-methyltransferase [Catharanthus 
roseus]
 gb|ABR20103.1| 16-hydroxytabersonine O-methyltransferase [Catharanthus roseus]
Length=355

 Score =   241 bits (616),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 132/257 (51%), Positives = 168/257 (65%), Gaps = 11/257 (4%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISAL--PIHPSKAP  360
            E   A+AQ W+   ++I SA+LKCAV +GIPD I NHGKP+ LS L +AL  P+HPSKAP
Sbjct  7    EFRGAQAQIWSQSCSFITSASLKCAVKLGIPDTIDNHGKPITLSELTNALVPPVHPSKAP  66

Query  361  YIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGY  540
            +I+RL R L  +G           D + E  YSLTP+ R+++   E +NLR  V      
Sbjct  67   FIYRLMRVLAKNGFC----SEEQLDGETEPLYSLTPSSRILL-KKEPLNLRGIVLTMADP  121

Query  541  VYQKSCYSLGDWFRNDDPS--PFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEAL  714
            V  K+  SL DW++N+D S   F TAHG+  W Y S    + + FNEAMA DS+LI + L
Sbjct  122  VQLKAWESLSDWYQNEDDSSTAFETAHGKNFWGYSSEHMEHAEFFNEAMASDSQLISK-L  180

Query  715  LSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFV  894
            L GE  K +F+G+ SLVD+ GG GT+A AIAK FP +KCTV DLPHV+A   S ENVEFV
Sbjct  181  LIGEY-KFLFEGLASLVDIGGGTGTIAKAIAKNFPQLKCTVFDLPHVVANLESKENVEFV  239

Query  895  GGDMFESIPTANAVLLK  945
             GDMFE IP+ANA+ LK
Sbjct  240  AGDMFEKIPSANAIFLK  256



>emb|CAJ65631.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   241 bits (616),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 122/268 (46%), Positives = 175/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ +G PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  ++   +  V       L  WF+NDDP+PF TAHG   WDY +H+     LFN+AM
Sbjct  111  LSLTPYLTAMLDPVLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GT+A AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>emb|CAJ65629.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   241 bits (616),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 122/268 (46%), Positives = 174/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM L  
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLFE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  ++   +  V       L  WF+NDDP+PF TAHG   WDY +H+     LFN+AM
Sbjct  111  LSLTPYLTAMLDPVLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GT+A AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPLADTVLLK  256



>emb|CAD29555.1| orcinol O-methyltransferase [Rosa hybrid cultivar]
Length=348

 Score =   241 bits (616),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 122/269 (45%), Positives = 175/269 (65%), Gaps = 12/269 (4%)
 Frame = +1

Query  139  REKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLS  318
             +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ +G PM LS
Sbjct  1    NQKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLS  55

Query  319  HLISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDE  498
             L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D 
Sbjct  56   ELTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDH  110

Query  499  SINLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEA  678
             ++L  ++   +  V       L  WF+NDDP+PF TAHG   WDY +H+     LFN+A
Sbjct  111  PLSLTPYLTAMLDPVLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDA  170

Query  679  MAKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVI  858
            MA D+ L+   ++  +  K VF+G+ SLVDV GG GT+A AIA  FP ++CTVLDLPHV+
Sbjct  171  MASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVV  228

Query  859  ACGSSIENVEFVGGDMFESIPTANAVLLK  945
            A     +N+++ GGDMFE++P A+ VLLK
Sbjct  229  ADLQGSKNLKYTGGDMFEAVPPADTVLLK  257



>ref|XP_006351391.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=355

 Score =   241 bits (616),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 127/254 (50%), Positives = 163/254 (64%), Gaps = 6/254 (2%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPY  363
            +E++QAE Q+WN +  +I+  TLKCA+ + IP++I  HGKPM +S L+S+LPI PSK PY
Sbjct  11   SELLQAETQSWNQLYFFIEHVTLKCALQLDIPNVITKHGKPMTISKLMSSLPISPSKFPY  70

Query  364  IHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYV  543
             HRLTR LVH G L++ K   +D D  +  YSL PA R V+ D    ++           
Sbjct  71   FHRLTRILVHYGFLILQKHDDNDVDDDKGCYSLAPADRYVVKDGPWNSMED-----QDTF  125

Query  544  YQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSG  723
            + K+   LGDWF+NDDPS F TA+G   W   S +      FNE M++DS   +  L+ G
Sbjct  126  FFKAWNCLGDWFKNDDPSAFYTAYGDLFWSKLSSDPSTGSWFNENMSRDSRSFMNVLI-G  184

Query  724  ESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGD  903
               KDVF+G+ SLVDV GG GTVA +IAK FP MKC VLDLP V+A     EN+EFV GD
Sbjct  185  NEFKDVFEGLPSLVDVGGGTGTVAMSIAKSFPDMKCIVLDLPPVVANLQGSENLEFVAGD  244

Query  904  MFESIPTANAVLLK  945
            MF+ IP ANAVLLK
Sbjct  245  MFQKIPPANAVLLK  258



>emb|CDP20220.1| unnamed protein product [Coffea canephora]
Length=270

 Score =   238 bits (608),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 117/257 (46%), Positives = 170/257 (66%), Gaps = 4/257 (2%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            E+ QA+A  W+HI N+I+S +LKCA+ +GIPD+IH HG+PM L  LI ALPI  +KA +I
Sbjct  13   ELFQAQAHIWSHIFNFINSMSLKCAIQLGIPDVIHKHGQPMTLDQLIDALPIKNAKATFI  72

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
            +RL + L+HSG  +  K   +++D Q+ Y  LTPA  L++  +   ++  F+   +    
Sbjct  73   YRLMQNLIHSGFFIEAKIPGNENDNQKGYL-LTPASELLLKSNP-FSVTPFLLAMLDPTL  130

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGE  726
                + L  WF+N D +PF T HG+ ++D+ SHE   N  FN+AMA D+ L+   +   +
Sbjct  131  TDPWHHLSQWFQNSDETPFYTCHGRSLYDFASHEPRINQFFNKAMASDARLVSSVV--TK  188

Query  727  SSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDM  906
              K VF+G+ SLVDV GG GT+A AIA  FP++KCTVLDLPHV+    S +N+ +VGG+M
Sbjct  189  DCKHVFEGLNSLVDVGGGTGTLAKAIADAFPSLKCTVLDLPHVVDGLESSKNLAYVGGNM  248

Query  907  FESIPTANAVLLKVYIV  957
            FE+IP ANAVL+K  ++
Sbjct  249  FEAIPPANAVLMKWILI  265



>emb|CAH05090.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   241 bits (615),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 125/268 (47%), Positives = 173/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GI D+I+ HG  M LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGILDVINKHGYLMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTNASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H+      FN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE+IP AN VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAIPPANTVLLK  256



>ref|XP_006428632.1| hypothetical protein CICLE_v10012033mg [Citrus clementina]
 gb|ESR41872.1| hypothetical protein CICLE_v10012033mg [Citrus clementina]
Length=362

 Score =   241 bits (616),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 119/258 (46%), Positives = 173/258 (67%), Gaps = 7/258 (3%)
 Frame = +1

Query  181  ENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAP  360
            + E+++A+   WNHI N+I+S TLKCA+ +GIPD+I  HGKPM L+ L+SAL I+PSK+ 
Sbjct  9    DTELLEAQTHVWNHIFNFINSMTLKCAIQLGIPDIISKHGKPMTLNELVSALTINPSKSR  68

Query  361  YIHRLTRFLVHSGLLLVTK--PARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCI  534
             ++RL R L+H+G     K   +R+++D +E+ Y LT A +L++ D+  +++  F+   +
Sbjct  69   CVYRLMRILIHTGFFAQQKLISSRNNND-EEQGYVLTNASKLLLKDN-PLSVTPFLQAML  126

Query  535  GYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEAL  714
              +       L  WF+NDDP+PF TAHG+ +W+Y   E   N+ FNEAMA D+ L    +
Sbjct  127  DPILLSPWQQLRTWFQNDDPTPFDTAHGKTLWEYAGDEPKLNNFFNEAMASDAWLATSVM  186

Query  715  LSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVI-ACGSSIENVEF  891
            +     KDVF+G+ SLVDV GG GT A AIAK FP ++CT  DLPHV+    S + N+++
Sbjct  187  I--HKCKDVFEGLNSLVDVGGGIGTAAKAIAKAFPKLECTCFDLPHVVNGLDSDLANLKY  244

Query  892  VGGDMFESIPTANAVLLK  945
            VGGDMFE+I  A+AVLLK
Sbjct  245  VGGDMFEAISPADAVLLK  262



>emb|CAJ65661.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   241 bits (615),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 124/268 (46%), Positives = 174/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAEKKLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L   F+NDDP+PF TAHG   WDY +H+      FN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWNYLSTRFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>emb|CAJ65605.1| putative orcinol O-methyltransferase [Rosa beggeriana]
Length=346

 Score =   241 bits (615),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 123/268 (46%), Positives = 173/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SAL IHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALLIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V  K    L  WF+NDDP+PF TAHG   WDY +H+      FN+AM
Sbjct  111  LSLTPFLTAMLDPVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +    VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCNGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>emb|CAJ65659.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   241 bits (614),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 119/254 (47%), Positives = 169/254 (67%), Gaps = 7/254 (3%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPY  363
            NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ +G PM LS L SALPIHP+K+  
Sbjct  10   NELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSELTSALPIHPTKSHS  69

Query  364  IHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYV  543
            ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  ++L  ++   +  V
Sbjct  70   VYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHPLSLTPYLTAMLDPV  124

Query  544  YQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSG  723
                   L  WF+NDDP+PF TAHG   WDY +H+     LFN+AMA D+ L+   ++  
Sbjct  125  LTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAMASDARLVTSVII--  182

Query  724  ESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGD  903
            +  K VF+G+ SLVDV GG GT+A AIA  FP ++CTVLDLPHV+A     +N+++ GGD
Sbjct  183  DDCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVADLQGSKNLKYTGGD  242

Query  904  MFESIPTANAVLLK  945
            MFE++P A+ VLLK
Sbjct  243  MFEAVPPADTVLLK  256



>ref|XP_003607523.1| O-methyltransferase [Medicago truncatula]
Length=370

 Score =   241 bits (616),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 119/258 (46%), Positives = 172/258 (67%), Gaps = 10/258 (4%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            +++QA+ Q +NHI ++I+S +LKCA+++ IPD+IHN+G+P+PLS LIS LPIHPSK   I
Sbjct  25   KLLQAQTQVFNHIFSFINSMSLKCAIELCIPDVIHNYGQPIPLSKLISLLPIHPSKTGDI  84

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
            HRL R L HSG   V+K      +  E  Y L  A RL++  D   ++ + +H+ +G + 
Sbjct  85   HRLMRVLTHSGFFNVSK------NDLEVMYELNDASRLLL-KDHPFSMTSLLHVILGPIL  137

Query  547  QKSCYSLGDWFRNDDPSPFCTA-HGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSG  723
             K  Y L +W++NDDPSPF T  +G   WDY  H+  +N+LFNEAMA ++ L    ++  
Sbjct  138  SKPWYQLSNWYKNDDPSPFHTENNGVAFWDYAGHDPNHNNLFNEAMACETRLASSVVMG-  196

Query  724  ESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGD  903
               K VF+G+ SLVDV GG GT+   IAK FP ++C V DLPHV+      EN+++VGGD
Sbjct  197  -KCKGVFEGLESLVDVGGGIGTITKVIAKSFPNIECIVFDLPHVVDGLQGSENLKYVGGD  255

Query  904  MFESIPTANAVLLKVYIV  957
            MFE+IP  +++LLKV ++
Sbjct  256  MFEAIPPTHSILLKVGVL  273



>ref|XP_010097399.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXB67905.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=384

 Score =   242 bits (617),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 121/257 (47%), Positives = 170/257 (66%), Gaps = 6/257 (2%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSK---  354
             E+V+A+A  WN+I N+I+S +LKCAV +GIPD IH+HGKPM LS LISALPIH +K   
Sbjct  17   TELVKAQAHIWNYIFNFINSMSLKCAVQLGIPDAIHSHGKPMTLSQLISALPIHQNKKSD  76

Query  355  APYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCI  534
            +  I+RL R LV+SG  ++ +    + D  EE Y LT A +L++ D+  +++   +   +
Sbjct  77   SRLIYRLMRILVNSGFFVLQEVVVGETDLLEEGYVLTTASKLLLRDN-PLSVTPLLLSML  135

Query  535  GYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEAL  714
              +  K  +SL  W ++DDP+PF   HG  IWDY  ++    +LFNEAMA D+ L+   L
Sbjct  136  DPIMTKPWHSLSTWLQSDDPTPFAATHGMGIWDYNEYDPRLGNLFNEAMASDARLVTSVL  195

Query  715  LSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFV  894
            +  +  K V +G+ SLVD+AGG GTVA AIA  FP + CTV DLPHVIA     +N++FV
Sbjct  196  I--DKCKSVLEGLESLVDLAGGTGTVAKAIAYAFPHLACTVFDLPHVIADLQGSKNLKFV  253

Query  895  GGDMFESIPTANAVLLK  945
            GGDMF+ IP A+A+ +K
Sbjct  254  GGDMFDEIPPADAIFMK  270



>gb|KDP24061.1| hypothetical protein JCGZ_25718 [Jatropha curcas]
Length=367

 Score =   241 bits (615),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 123/256 (48%), Positives = 166/256 (65%), Gaps = 5/256 (2%)
 Frame = +1

Query  178  NENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKA  357
            + N+++QA+A  WNHI N+I+S +LKCA+ +GIPD I+ HGKPM LS LI AL IHP+K 
Sbjct  12   DHNQLLQAQAHIWNHIFNFINSMSLKCAIQLGIPDAINKHGKPMTLSDLIIALSIHPAKT  71

Query  358  PYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIG  537
              I RL R LVHSG L   K   +++ ++ E Y LT A +L++  +   +L+ F+   + 
Sbjct  72   HAIPRLVRILVHSGFL--DKEKTEENSQETEGYVLTNASKLLV-KEHPFSLKTFLLAMLD  128

Query  538  YVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALL  717
             V       L  WF NDDP+PF T HG+ IW Y  H    N  FNEAMA D++++   L+
Sbjct  129  PVLTGPWDHLTTWFLNDDPTPFQTCHGRGIWKYAGHNPELNSSFNEAMACDAKMVASILI  188

Query  718  SGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVG  897
              +  + VFDG+ SLVDV GG GTVA A+A  FP + C V DLPHV+A     +N++FVG
Sbjct  189  --KECEGVFDGLKSLVDVGGGTGTVAKALADSFPQLDCCVFDLPHVVAGLQDGDNLKFVG  246

Query  898  GDMFESIPTANAVLLK  945
            GDMFE IP A+A+LLK
Sbjct  247  GDMFEEIPPADAILLK  262



>gb|AAM23005.1|AF502434_1 orcinol O-methyltransferase [Rosa hybrid cultivar]
 emb|CAD29459.1| orcinol O-methyltransferase [Rosa chinensis]
 emb|CAH05078.1| orcinol O-methyltransferase 2 [Rosa chinensis]
 dbj|BAQ20440.1| 3,5-dimethoxytoluene [Rosa hybrid cultivar]
Length=366

 Score =   241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 124/268 (46%), Positives = 175/268 (65%), Gaps = 13/268 (5%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  12   QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHG-PMTLSE  65

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  66   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  120

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V       L  WF+N+DP+PF TAHG   WDY +H+     LFN+AM
Sbjct  121  LSLTPFLTAMLDPVLTTPWNYLSTWFQNEDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAM  180

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  181  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA  238

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  239  DLQGSKNLKYTGGDMFEAVPPADTVLLK  266



>ref|XP_010110665.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXC27580.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=384

 Score =   241 bits (616),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/259 (46%), Positives = 173/259 (67%), Gaps = 6/259 (2%)
 Frame = +1

Query  178  NENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKA  357
            N  E+V+++A  WN I N+I+S +LKCA+ +GIPD I++HGKPM LS LIS+LPIH +K 
Sbjct  15   NATELVKSQAHIWNQIFNFINSMSLKCAIQLGIPDAIYSHGKPMILSQLISSLPIHQNKR  74

Query  358  P---YIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHL  528
            P    I+RL R LV+SG   + +    + +  EE Y LT A +L++ D+  +++  F+  
Sbjct  75   PDSRLIYRLMRILVNSGFFALEEVVVGETNLLEEGYVLTNASKLLLRDN-PLSVTPFLLS  133

Query  529  CIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVE  708
             +  +  K  +S+  W ++DDP+PF T HG++ WDY  ++    +LFNEAMA D+ L+  
Sbjct  134  MLDPIMTKPWHSISTWLQSDDPTPFATTHGKEFWDYNEYDPRLGNLFNEAMASDARLVTS  193

Query  709  ALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVE  888
             ++  E  K +F+G+ SLVD+AGG GTVA AIA  FP + CTV DLPHVIA     +N++
Sbjct  194  VVI--EKCKSMFEGLESLVDLAGGTGTVAKAIAYAFPHLACTVFDLPHVIADLQGSKNLK  251

Query  889  FVGGDMFESIPTANAVLLK  945
            FVGGDMF+ IP A+A+ +K
Sbjct  252  FVGGDMFDEIPPADAIFVK  270



>ref|XP_003544914.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X1 [Glycine max]
Length=358

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/253 (44%), Positives = 171/253 (68%), Gaps = 5/253 (2%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            ++++A+   WNHI ++I+S +LKC VD+GIPD+IHN+G+PMPLS+LI++LPIHPSK  ++
Sbjct  11   KLLRAQTHIWNHIFSFINSMSLKCVVDLGIPDIIHNYGQPMPLSNLIASLPIHPSKTCFV  70

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
            HRL R ++HSG    ++   D +++ +  Y LT A  L++  +  +++  F+H  +  + 
Sbjct  71   HRLMRIMIHSGFF--SQQNHDMENQLDAKYVLTDASVLLL-KNHPMSVTPFLHAMLDPIL  127

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGE  726
                     WF+N D +PF TAHG  +WDY   +  +N+LFN+AMA D+  +   ++  E
Sbjct  128  TNPWNQFSTWFKNGDTTPFETAHGMMLWDYAGADPKHNNLFNDAMASDARFVTSLVI--E  185

Query  727  SSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDM  906
              K +F G+ SLVDV GG GT+A AIAK FP ++C V DLPHV++     EN+++V GDM
Sbjct  186  KCKGMFMGLESLVDVGGGTGTMAKAIAKSFPRVECIVFDLPHVVSGLKGSENLKYVAGDM  245

Query  907  FESIPTANAVLLK  945
            FE+IP A+A+LLK
Sbjct  246  FEAIPPADAILLK  258



>emb|CAJ65596.1| putative orcinol O-methyltransferase [Rosa chinensis]
Length=345

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 123/268 (46%), Positives = 174/268 (65%), Gaps = 13/268 (5%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHG-PMTLSE  54

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  55   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  109

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  ++   +  V       L  WF+NDDP+PF TAHG   WDY +H+     LFN+AM
Sbjct  110  LSLTPYLTAMLDPVLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAM  169

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   +++    K VF+G+ SL DV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  170  ASDARLVTSVIIN--DCKGVFEGLESLADVGGGTGTVAKAIADAFPYIECTVLDLPHVVA  227

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  228  NLQGSKNLKYTGGDMFEAVPPADTVLLK  255



>emb|CAJ65636.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/268 (45%), Positives = 174/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ +G PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  ++   +  V       L  WF+NDDP+PF TAHG   WDY +H+     LFN+AM
Sbjct  111  LSLTPYLTAMLDPVLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SL DV GG GT+A AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLADVGGGTGTMAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>ref|XP_002522501.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF39801.1| o-methyltransferase, putative [Ricinus communis]
Length=359

 Score =   240 bits (612),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/258 (46%), Positives = 169/258 (66%), Gaps = 5/258 (2%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            E++QA+   +NHI NYI+S  LKCAV +GIPD+IH HGKP+ L  L+SAL IHP+K  ++
Sbjct  11   ELLQAQLHVYNHIFNYINSMCLKCAVQLGIPDIIHKHGKPITLPELVSALHIHPTKINFM  70

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
            +RL R LVHSG   +TK A   ++ Q E Y LTP+ +L++ D+ +  L+ FV   +   +
Sbjct  71   YRLMRMLVHSGFFSITKAANGQEEGQ-EVYVLTPSSKLLVKDNPNC-LKPFVDSLLKPDF  128

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGE  726
                + LGDWFR ++ + F  AHG   W+Y      +N LFNEAMA DS ++    L   
Sbjct  129  VTPGHVLGDWFRGNELTVFQRAHGMAFWEYNERNPEFNQLFNEAMASDSRMMN---LVIR  185

Query  727  SSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDM  906
              K +F+GV SLVDV GG G++A  I++ FP MKCTVL+LP VI      +N+ +VGGDM
Sbjct  186  DCKPIFEGVNSLVDVGGGNGSLARIISEAFPDMKCTVLELPQVIGNLEGTKNLNYVGGDM  245

Query  907  FESIPTANAVLLKVYIVG  960
            F+ IP+A+A++LK+ + G
Sbjct  246  FQHIPSADAIILKLILHG  263



>ref|XP_006480453.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=362

 Score =   240 bits (612),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/257 (46%), Positives = 168/257 (65%), Gaps = 5/257 (2%)
 Frame = +1

Query  181  ENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAP  360
            + E+++A+   WNHI N+I+S TLKCA+ +GIPD+I  HGKPM L+ L+SAL I+PSK+ 
Sbjct  9    DTELLEAQTHVWNHIFNFINSMTLKCAIQLGIPDIISKHGKPMTLNELVSALTINPSKSR  68

Query  361  YIHRLTRFLVHSGLLLVTKPARDDDDKQEEY-YSLTPAGRLVIGDDESINLRAFVHLCIG  537
             ++RL R L+H+G     K     ++  EE  Y LT A +L++ D+  +++  F+   + 
Sbjct  69   CVYRLMRILIHTGFFAQQKLISSRNNNDEELGYVLTNASKLLLKDN-PLSVTPFLQAMLD  127

Query  538  YVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALL  717
             +       L  WF+NDDP+PF TAHG+ +W+Y   E   N+ FNEAMA D+ L    ++
Sbjct  128  PILLSPWQQLRTWFQNDDPTPFDTAHGKTLWEYAGDEPKLNNFFNEAMASDAWLATSVMI  187

Query  718  SGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVI-ACGSSIENVEFV  894
                 KDVF+G+ SLVDV GG GT A AIAK FP ++CT  DLPHV+    S + N+++V
Sbjct  188  --HKCKDVFEGLNSLVDVGGGIGTAAKAIAKAFPKLECTCFDLPHVVNGLDSDLANLKYV  245

Query  895  GGDMFESIPTANAVLLK  945
            GGDMFE+I  A+AVLLK
Sbjct  246  GGDMFEAISPADAVLLK  262



>gb|ABK96707.1| unknown [Populus trichocarpa x Populus deltoides]
Length=359

 Score =   239 bits (611),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 126/262 (48%), Positives = 170/262 (65%), Gaps = 9/262 (3%)
 Frame = +1

Query  169  KLCNE---NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALP  339
            +L NE   +E++QA+   WNHI  +I+S TLKCAV +GIPD+I  HGKPM LS L+SALP
Sbjct  2    ELINEESASELLQAQTHVWNHIFYFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALP  61

Query  340  IHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAF  519
            IHPSKA Y+HRL R LVHSG    ++   +  D QE  YSLT + RL++ D+   ++RA 
Sbjct  62   IHPSKAQYVHRLMRILVHSGFF--SQRNLNGVDNQEA-YSLTQSTRLLLKDN-PWSVRAH  117

Query  520  VHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSEL  699
            +   +  V  K    L  WF+NDD + F  AH +  W+Y   +   N+L NE MA+DS  
Sbjct  118  LLFVLDPVLTKPWDCLSTWFQNDDRTAFSVAHEKAPWEYVGQDPRINNLCNEVMARDS--  175

Query  700  IVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIE  879
            I+   L     K +F+GV+SLVDV GG GT+A  I + FP M CTVLDLPHV++     +
Sbjct  176  ILACKLVVNKCKGIFEGVSSLVDVGGGLGTMAKGITEAFPHMDCTVLDLPHVVSDLQGCK  235

Query  880  NVEFVGGDMFESIPTANAVLLK  945
            N++FV GDMF+++P A A+LLK
Sbjct  236  NLKFVAGDMFQAVPPAEAILLK  257



>gb|AES89720.2| orcinol O-methyltransferase [Medicago truncatula]
Length=355

 Score =   239 bits (610),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 118/254 (46%), Positives = 169/254 (67%), Gaps = 10/254 (4%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            +++QA+ Q +NHI ++I+S +LKCA+++ IPD+IHN+G+P+PLS LIS LPIHPSK   I
Sbjct  11   KLLQAQTQVFNHIFSFINSMSLKCAIELCIPDVIHNYGQPIPLSKLISLLPIHPSKTGDI  70

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
            HRL R L HSG   V+K      +  E  Y L  A RL++  D   ++ + +H+ +G + 
Sbjct  71   HRLMRVLTHSGFFNVSK------NDLEVMYELNDASRLLL-KDHPFSMTSLLHVILGPIL  123

Query  547  QKSCYSLGDWFRNDDPSPFCTA-HGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSG  723
             K  Y L +W++NDDPSPF T  +G   WDY  H+  +N+LFNEAMA ++ L    ++  
Sbjct  124  SKPWYQLSNWYKNDDPSPFHTENNGVAFWDYAGHDPNHNNLFNEAMACETRLASSVVMG-  182

Query  724  ESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGD  903
               K VF+G+ SLVDV GG GT+   IAK FP ++C V DLPHV+      EN+++VGGD
Sbjct  183  -KCKGVFEGLESLVDVGGGIGTITKVIAKSFPNIECIVFDLPHVVDGLQGSENLKYVGGD  241

Query  904  MFESIPTANAVLLK  945
            MFE+IP  +++LLK
Sbjct  242  MFEAIPPTHSILLK  255



>emb|CDO96819.1| unnamed protein product [Coffea canephora]
Length=268

 Score =   236 bits (602),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 123/258 (48%), Positives = 168/258 (65%), Gaps = 15/258 (6%)
 Frame = +1

Query  181  ENEVVQAEAQTW--NHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSK  354
            EN V   EAQ +  + I N+   A+LKCA+++GIPD+I  HGKP+ LS LISALPI+PSK
Sbjct  5    ENLVELREAQDYAGSQIFNFRKCASLKCAIELGIPDVIAQHGKPITLSGLISALPINPSK  64

Query  355  APYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCI  534
            + +IHRL RFL ++G  +          +Q E YSL+  GRL++  +E  N+RAF++   
Sbjct  65   SIHIHRLMRFLSNAGFFV----------RQNEGYSLSTTGRLLL-KNEPFNMRAFLYYVS  113

Query  535  GYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEAL  714
              +  K    L +WF+NDDPSPF TAHG+  W Y + E  +  +FNEAMA DS LIVE +
Sbjct  114  DPIALKPWNFLTEWFKNDDPSPFDTAHGKNFWSYAAAEPQFGKIFNEAMAGDSSLIVEVV  173

Query  715  LSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFV  894
            ++    K VF+ +TSLVDV GG G    AIA+ FP ++C V DLPHV++     EN++FV
Sbjct  174  MT--QCKSVFEDLTSLVDVGGGTGEFVKAIAQNFPNLECLVCDLPHVVSNQQRTENLDFV  231

Query  895  GGDMFESIPTANAVLLKV  948
             G+M E +P  NA+LLKV
Sbjct  232  AGNMLEMVPPDNAILLKV  249



>emb|CAJ65657.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=345

 Score =   239 bits (609),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 123/268 (46%), Positives = 174/268 (65%), Gaps = 13/268 (5%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+  +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINPMSLKSAIQLGIPDIINKHG-PMTLSE  54

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  55   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  109

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V       L  WF+N+DP+PF TAHG   WDY +H+     LFN+AM
Sbjct  110  LSLTPFLTAMLDPVLTTPWNYLSTWFQNEDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAM  169

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  170  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA  227

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  228  DLQGSKNLKYTGGDMFEAVPPADTVLLK  255



>dbj|BAI79244.1| O-methyltransferase [Carapichea ipecacuanha]
 dbj|BAJ05386.1| O-methyltransferase [Carapichea ipecacuanha]
Length=350

 Score =   239 bits (609),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 121/256 (47%), Positives = 167/256 (65%), Gaps = 13/256 (5%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            E+++A+      + ++ + A+LKCA+ +GIPD I  HGKPM LS L SALPI+PSKAPYI
Sbjct  11   ELLRAQTHFSTQLFSFQNYASLKCALHLGIPDAIKQHGKPMNLSELTSALPINPSKAPYI  70

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
            HRL R LV +G             ++ E + LTP G L++ DD  IN+RA V L +    
Sbjct  71   HRLMRMLVKAGYFA----------QENECFDLTPIGLLLLKDD-PINIRALVLLELHPAL  119

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGE  726
                 +L +WF+NDD +PF TAHG+  WDY S +  +  LF+EAMA DSELI + L++  
Sbjct  120  LMPWIALSEWFQNDDATPFVTAHGKSFWDYTSRDPEFRKLFDEAMAGDSELISKVLVT--  177

Query  727  SSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDM  906
              K VF+G+ SLVDV GG GT+A +IAK FP +KCTV DLP  +A      N++FV GDM
Sbjct  178  EFKYVFEGLKSLVDVGGGNGTLARSIAKAFPNLKCTVFDLPEAVANEQGDGNLDFVAGDM  237

Query  907  FESIPTANAVLLKVYI  954
            F+ +P+A+A+LLK+ +
Sbjct  238  FDRVPSADAILLKIIL  253



>ref|XP_002278092.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=361

 Score =   239 bits (610),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 118/259 (46%), Positives = 173/259 (67%), Gaps = 6/259 (2%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPY  363
            +E+ QA++  + HI N+I+S  LKCAV++GIPD+IH H  P+ L  L+SAL + P+K  Y
Sbjct  10   SELFQAQSHMYKHIFNFINSMALKCAVELGIPDIIHTHNHPISLPQLVSALHLPPTKTRY  69

Query  364  IHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES--INLRAFVHLCIG  537
            ++RL R LVHSG     K   ++ ++++E Y LT + RL++  D +   NL AFV   + 
Sbjct  70   VNRLMRVLVHSGFFATAK-VHENQEEEDEGYVLTTSSRLLLSKDNNNVPNLSAFVLAMLD  128

Query  538  YVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALL  717
             V     + LGDWFR +D + F TAHG+  WDY SH+  + +LFNEAMA DS ++    L
Sbjct  129  PVLVTPWHFLGDWFRGNDLTAFDTAHGKSFWDYGSHDHKFFNLFNEAMASDSRMMS---L  185

Query  718  SGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVG  897
              +  + VF+G+ SLVDV GGKG +A  I++ FP +KCTV DLPHV++      N+++VG
Sbjct  186  VIKDCRPVFEGLGSLVDVGGGKGLIARIISEAFPQLKCTVFDLPHVVSNFPECGNLKYVG  245

Query  898  GDMFESIPTANAVLLKVYI  954
            GDMF+S+PTA+A+LLK+ +
Sbjct  246  GDMFQSVPTADAILLKLVL  264



>ref|XP_006388573.1| hypothetical protein POPTR_0151s00210g [Populus trichocarpa]
 gb|ERP47487.1| hypothetical protein POPTR_0151s00210g [Populus trichocarpa]
Length=359

 Score =   239 bits (609),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 126/262 (48%), Positives = 170/262 (65%), Gaps = 9/262 (3%)
 Frame = +1

Query  169  KLCNEN---EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALP  339
            +L NE    E++QA+   WNHI N+I+S TLKCAV +GIPD+I  HGKPM LS L+SALP
Sbjct  2    ELINEESAGELLQAQTHVWNHIFNFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALP  61

Query  340  IHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAF  519
            IHPSKA Y+HRL R LVHSG          +    +  YSLT + RL++ D+   ++R  
Sbjct  62   IHPSKAQYVHRLMRILVHSGFF---SQQNLNGIHNQVAYSLTQSTRLLLKDN-PWSVRPL  117

Query  520  VHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSEL  699
            + L +  V  K    L  WFRNDD + F  AH + +W+Y   ++  N+LFN+AMA DS L
Sbjct  118  LLLVLDPVLTKPWDCLSTWFRNDDRNAFSVAHEKTLWEYAGQDARLNNLFNDAMASDSIL  177

Query  700  IVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIE  879
              + ++S    K +FDGV SLVDV GG GT+A  IA+ FP M CTV DLPHV++     +
Sbjct  178  ASKLVVS--KCKGIFDGVNSLVDVGGGLGTMAKGIAEAFPHMDCTVFDLPHVVSDLQGGK  235

Query  880  NVEFVGGDMFESIPTANAVLLK  945
            N+++ GGDMFE++P  +A+LLK
Sbjct  236  NLKYAGGDMFEAVPPVDALLLK  257



>emb|CAJ65660.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=345

 Score =   238 bits (608),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 123/268 (46%), Positives = 174/268 (65%), Gaps = 13/268 (5%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHG-PMTLSE  54

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  55   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  109

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+   +  V       L  WF+N+DP+PF TAHG   WDY +H+     LFN+AM
Sbjct  110  LSLTPFLTAMLDPVLTTPWNYLSTWFQNEDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAM  169

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA   P ++CTVLDLPHV+A
Sbjct  170  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADALPHIECTVLDLPHVVA  227

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  228  DLQGSKNLKYTGGDMFEAVPPADTVLLK  255



>emb|CDO96828.1| unnamed protein product [Coffea canephora]
Length=268

 Score =   236 bits (601),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 123/258 (48%), Positives = 167/258 (65%), Gaps = 15/258 (6%)
 Frame = +1

Query  181  ENEVVQAEAQTW--NHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSK  354
            EN V   EAQ +    I N+   A+LKCA+++GIPD+I  HGKP+ LS LIS LPI+PSK
Sbjct  5    ENLVELREAQDYAGTQIFNFRKCASLKCAIELGIPDVIAQHGKPIMLSGLISTLPINPSK  64

Query  355  APYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCI  534
            + +IHRL RFL ++G  +          +Q E YSL+ AGRL++  +E  N+RAF++   
Sbjct  65   SIHIHRLMRFLSNAGFFV----------QQNEGYSLSTAGRLLL-KNEPFNMRAFIYYVS  113

Query  535  GYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEAL  714
              +  K    L +WF+NDDPSPF TAHG+  W Y + E  +  +FNEAMA DS LIVE +
Sbjct  114  DPIALKPWNFLTEWFKNDDPSPFDTAHGKNFWSYAAAEPQFGKIFNEAMAGDSSLIVEVV  173

Query  715  LSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFV  894
            ++    K VF+ +TSLVDV GG G  A AI + FP ++C V DLPHV++     EN++FV
Sbjct  174  VT--QCKSVFEDLTSLVDVGGGTGEFAKAIVQNFPNLECLVCDLPHVVSNQQRTENLDFV  231

Query  895  GGDMFESIPTANAVLLKV  948
             G+M E +P  NA+LLKV
Sbjct  232  AGNMLEMVPPGNAILLKV  249



>emb|CAH05088.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=346

 Score =   238 bits (608),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 121/268 (45%), Positives = 173/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ HG PM L  
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLFE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  ++   +  V       L  WF+NDDP+PF TAHG   WDY +H+     LFN+AM
Sbjct  111  LSLTPYLTAMLDPVLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHQPSIAHLFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GT+A AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++  GDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTRGDMFEAVPPADTVLLK  256



>dbj|BAJ05387.1| O-methyltransferase [Carapichea ipecacuanha]
Length=350

 Score =   238 bits (607),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 121/256 (47%), Positives = 167/256 (65%), Gaps = 13/256 (5%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            E+++A+      + ++ + A+LKCA+ +GIPD I  HGKPM LS L SALPI+PSKAPYI
Sbjct  11   ELLRAQTHFSTQLFSFQNYASLKCALHLGIPDAIKQHGKPMNLSELTSALPINPSKAPYI  70

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
            HRL R LV +G             ++ E + LTP G L++ DD  IN+RA V L +    
Sbjct  71   HRLMRMLVKAGYFA----------QENECFDLTPIGLLLLKDD-PINIRALVLLELHPAL  119

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGE  726
                 +L +WF+NDD +PF TAHG+  WDY S +  +  LF+EAMA DSELI + L++  
Sbjct  120  LMPWIALSEWFQNDDATPFVTAHGKSFWDYTSRDPEFRKLFDEAMAGDSELISKVLVT--  177

Query  727  SSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDM  906
              K VF+G+ SLVDV GG GT+A +IAK FP +KCTV DLP  +A      N++FV GDM
Sbjct  178  EFKYVFEGLKSLVDVGGGNGTLARSIAKAFPNLKCTVFDLPESVANEQGDGNLDFVAGDM  237

Query  907  FESIPTANAVLLKVYI  954
            F+ +P+A+A+LLK+ +
Sbjct  238  FDRVPSADAILLKIIL  253



>dbj|BAJ72588.1| 7'-O-demethylcephaeline/cephaeline O-methyltransferase [Carapichea 
ipecacuanha]
Length=350

 Score =   238 bits (607),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 121/256 (47%), Positives = 166/256 (65%), Gaps = 13/256 (5%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            E+++A+      + ++ + A+LKCA+ +GIPD I  HGKPM LS L SALPI PSKAPYI
Sbjct  11   ELLRAQTHFSTQLFSFQNYASLKCALHLGIPDAIKQHGKPMNLSELTSALPIKPSKAPYI  70

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
            HRL R LV +G             ++ E + LTP G L++ DD  IN+RA V L +    
Sbjct  71   HRLMRMLVKAGYFA----------QENECFDLTPIGLLLLKDD-PINIRALVLLELHPAL  119

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGE  726
                 +L +WF+NDD +PF TAHG+  WDY S +  +  LF+EAMA DSELI + L++  
Sbjct  120  LLPWIALSEWFQNDDATPFVTAHGKSFWDYTSRDPEFRKLFDEAMAGDSELISKVLVT--  177

Query  727  SSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDM  906
              K VF+G+ SLVDV GG GT+A +IAK FP +KCTV DLP  +A      N++FV GDM
Sbjct  178  EFKYVFEGLKSLVDVGGGNGTLARSIAKAFPNLKCTVFDLPEAVANEQGDGNLDFVAGDM  237

Query  907  FESIPTANAVLLKVYI  954
            F+ +P+A+A+LLK+ +
Sbjct  238  FDRVPSADAILLKIVL  253



>gb|AFK40900.1| unknown [Lotus japonicus]
Length=357

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/256 (47%), Positives = 170/256 (66%), Gaps = 6/256 (2%)
 Frame = +1

Query  178  NENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKA  357
            N  ++++A++  WNHIL+YI+S +LKC VD+GIPD+IHN+GKPMPLS LI++LPIH SKA
Sbjct  8    NAAKLLRAQSHIWNHILSYINSMSLKCVVDLGIPDIIHNYGKPMPLSKLIASLPIHSSKA  67

Query  358  PYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIG  537
              I RL R ++HSG           +++ E  Y+LT    L++      ++  F+     
Sbjct  68   GNIPRLMRVMIHSGFF---SQHNITENELEVEYTLTDDSILLL-KGHPFSILPFLLCSND  123

Query  538  YVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALL  717
             + +K  + L  WF+NDD +PF TAHG   WDY + +   N+L NE+MA D++LI    +
Sbjct  124  PILKKPWHHLSTWFKNDDLTPFETAHGMLPWDYANRDPKVNNLLNESMACDAQLIAGVFI  183

Query  718  SGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVG  897
              E  KD+ +G+ SLVDV GG GT+A AIAK FP +KCTV DLPHV+A     EN+E++G
Sbjct  184  --EKCKDMLNGLESLVDVGGGTGTMARAIAKSFPRLKCTVFDLPHVVADLQGSENLEYIG  241

Query  898  GDMFESIPTANAVLLK  945
            GDMF+ IP A+A+LLK
Sbjct  242  GDMFKEIPPADAILLK  257



>ref|XP_006376396.1| hypothetical protein POPTR_0013s12670g [Populus trichocarpa]
 gb|ERP54193.1| hypothetical protein POPTR_0013s12670g [Populus trichocarpa]
Length=359

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/262 (48%), Positives = 170/262 (65%), Gaps = 9/262 (3%)
 Frame = +1

Query  169  KLCNE---NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALP  339
            +L NE   +E++QA+   WNHI  +I+S TLKCAV +GIPD+I  HGKPM LS L+SALP
Sbjct  2    ELINEESASELLQAQTHVWNHIFYFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALP  61

Query  340  IHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAF  519
            IHPSKA Y+HRL R LVHSG    ++   +  D QE  YSLT + RL++ D+   ++RA 
Sbjct  62   IHPSKAQYVHRLMRILVHSGFF--SQRNLNGVDNQEA-YSLTQSTRLLLKDN-PWSVRAH  117

Query  520  VHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSEL  699
            +   +  V  K    L  WF+NDD + F  AH +  W+Y   +   N+L NE MA+DS  
Sbjct  118  LLFVLDPVLTKPWDCLSTWFQNDDRTAFSVAHEKAPWEYVGQDPRINNLCNEVMARDS--  175

Query  700  IVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIE  879
            I+   L     K +F+GV+SLVDV GG GT+A  I + FP M CTVLDLPHV++     +
Sbjct  176  ILACKLVVNKCKGIFEGVSSLVDVGGGIGTMAKGITEAFPHMDCTVLDLPHVVSDLQGCK  235

Query  880  NVEFVGGDMFESIPTANAVLLK  945
            N+++V GDMF+++P A A+LLK
Sbjct  236  NLKYVAGDMFQAVPPAEAILLK  257



>ref|XP_002278316.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=359

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/254 (45%), Positives = 163/254 (64%), Gaps = 6/254 (2%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPY  363
            +E++QA+   WNHI N+I+S +LKCA+ +GIPD+IHNH +PM L  L++ LP+ P+K   
Sbjct  10   SELLQAQTHVWNHIFNFINSMSLKCAIQLGIPDIIHNHCQPMTLHELVAKLPVRPNKTLC  69

Query  364  IHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYV  543
            +HRL R LVHSG   + +     D   EE Y+L  A RL++  D  ++   F+   +   
Sbjct  70   VHRLMRILVHSGFFTMQRVQESAD---EEGYALANASRLLL-KDHPLSATPFLLAMLDPD  125

Query  544  YQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSG  723
              +  + +  WF+NDDP+PF TAHG+ IWDY  HE  +N+ FNEAMA D+ L+   L+  
Sbjct  126  LTEPWHYVSAWFQNDDPTPFFTAHGRTIWDYGCHEPRFNNFFNEAMASDARLVTSVLI--  183

Query  724  ESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGD  903
            +  K  F+G+ S VDV GG GTVA  I   FP +  TVLDLPHV+A     +N+ ++ GD
Sbjct  184  KECKGAFEGLNSFVDVGGGTGTVAKTIVDAFPHLHSTVLDLPHVVADLQGSKNLTYLAGD  243

Query  904  MFESIPTANAVLLK  945
            MFE+IP A+A+LLK
Sbjct  244  MFEAIPPADAILLK  257



>ref|XP_007142076.1| hypothetical protein PHAVU_008G250600g [Phaseolus vulgaris]
 gb|ESW14070.1| hypothetical protein PHAVU_008G250600g [Phaseolus vulgaris]
Length=357

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/260 (44%), Positives = 172/260 (66%), Gaps = 9/260 (3%)
 Frame = +1

Query  175  CNENE---VVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIH  345
            C E++   +++A+   WNHIL++I+S +LKC VD+GIPD+IHNHG+PM LS+LIS+LPIH
Sbjct  4    CGEDQSAKLLRAQTHVWNHILSFINSMSLKCIVDLGIPDIIHNHGQPMSLSNLISSLPIH  63

Query  346  PSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVH  525
             SK  +IHRL R +V SG      P    +++ E  Y+LT +  L++    ++++  ++ 
Sbjct  64   SSKTHFIHRLMRIMVQSGFFSQHNPT---ENELEVKYALTDSSLLLL-KSHAMSMTPYLQ  119

Query  526  LCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIV  705
              +   +        +WF+ND P+ F  AHG+  W+Y   +  +N LFN+AMA D++L+ 
Sbjct  120  AKLDPAFTNPWNQFSNWFKNDSPTTFEMAHGKPFWEYAGSDPRFNILFNDAMASDAQLVT  179

Query  706  EALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENV  885
              ++  E  K VF G+ SLVDV GG GT+  AI+K FP ++CTV DLPHV++     EN+
Sbjct  180  SVVI--EKCKGVFMGLESLVDVGGGTGTMGKAISKSFPQLECTVFDLPHVVSGLQGSENL  237

Query  886  EFVGGDMFESIPTANAVLLK  945
            ++VGGDMFE+IP A+A+LLK
Sbjct  238  KYVGGDMFEAIPPADAILLK  257



>ref|XP_006446726.1| hypothetical protein CICLE_v10015705mg [Citrus clementina]
 gb|ESR59966.1| hypothetical protein CICLE_v10015705mg [Citrus clementina]
Length=362

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/258 (46%), Positives = 171/258 (66%), Gaps = 7/258 (3%)
 Frame = +1

Query  181  ENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAP  360
            + E+++A+A  WNHI N+I+S +LKCAV++ IPD+I+ HGKPM L+ L+SAL I+PSK  
Sbjct  9    DTELLEAQAHVWNHIFNFINSMSLKCAVELSIPDIINKHGKPMTLNKLVSALTINPSKTR  68

Query  361  YIHRLTRFLVHSGLLL--VTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCI  534
             ++RL R L+HSG         +R+++D +E+ Y LT A +L++  D  +++  F+   +
Sbjct  69   CVYRLMRILIHSGFFAQQTLNSSRNNND-EEQGYVLTNASKLLL-KDSPLSVTPFLQAML  126

Query  535  GYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEAL  714
              +       L  WF++DDP+PF TAHG+  W+Y   E   N+ FNEAMA D+ L    +
Sbjct  127  DPILLSPWLKLSTWFQSDDPAPFDTAHGKSFWEYAGDEPKINNFFNEAMASDARLATRVV  186

Query  715  LSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVI-ACGSSIENVEF  891
            +     KDVF G+ SLVDV GG GTVA AIA  FP ++CT  DLPHV+    S + N+++
Sbjct  187  I--HKCKDVFQGLNSLVDVGGGTGTVAKAIAIAFPNLECTDFDLPHVVNGLESDLANLKY  244

Query  892  VGGDMFESIPTANAVLLK  945
            VGGDMFE+IP A+AV+LK
Sbjct  245  VGGDMFEAIPPADAVVLK  262



>gb|KHN07780.1| Tabersonine 16-O-methyltransferase [Glycine soja]
Length=323

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/233 (50%), Positives = 160/233 (69%), Gaps = 6/233 (3%)
 Frame = +1

Query  247  TLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPAR  426
            +LKCA+++ IPD+IH +G+PMPLS L ++L IHPSKA  I+RL R L HSG        +
Sbjct  2    SLKCAIELDIPDIIHKYGQPMPLSKLTTSLSIHPSKANCIYRLMRILTHSGFF---SQHK  58

Query  427  DDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFC  606
             ++++ E  Y LT A  L++ D+  +++  F+H  +     +    L  WF+NDDPSPF 
Sbjct  59   VNENELEMGYVLTDASTLLLKDN-PLSMVPFLHAMLDPTLTQPWLQLPTWFKNDDPSPFQ  117

Query  607  TAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKG  786
            TAHG KIWDY   E   NDLFN+AMA D++L+   ++  E  K VF+G+ SLVDV GG G
Sbjct  118  TAHGMKIWDYADREPRLNDLFNDAMASDTQLVANVVI--ERCKGVFNGLESLVDVGGGTG  175

Query  787  TVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDMFESIPTANAVLLK  945
            T+A AIAK FP ++CTV DLPHV+A     EN+++VGGDMFESIP+A+A+LLK
Sbjct  176  TMAMAIAKSFPQLECTVFDLPHVVATLQGSENLKYVGGDMFESIPSADAILLK  228



>ref|XP_009764108.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
sylvestris]
Length=360

 Score =   238 bits (606),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/254 (46%), Positives = 173/254 (68%), Gaps = 7/254 (3%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAP-Y  363
            E++ A+A   NH+ NY++S +LKCA+ + IPD+IHNHGKPM LS+L++ALPI+ +K    
Sbjct  13   EILAAQAHIANHVFNYLNSMSLKCAIQLEIPDIIHNHGKPMTLSNLVNALPINKAKGQDC  72

Query  364  IHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYV  543
            I+RL R L+HSG  + TK    ++ ++EE Y LTP  RL++  +E ++L  FV   +  +
Sbjct  73   IYRLMRILIHSGFFIQTKI---NETEEEEGYLLTPNSRLLL-KNEPLSLVPFVLAQLDPI  128

Query  544  YQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSG  723
                  SL  W +NDD +PF TAHG+ +++Y   E   N LFNEAMA D+ L++  ++  
Sbjct  129  LMDPFQSLSKWLQNDDSTPFATAHGKPLFEYAGEEPRLNYLFNEAMASDARLMISVVI--  186

Query  724  ESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGD  903
            ++   +FDG+ SLVDV GG GTVA AI+  FP +KCTV DLPHV+      +N+ +VGGD
Sbjct  187  KTGSGIFDGLKSLVDVGGGIGTVAKAISNAFPEVKCTVFDLPHVVEGLEGSKNLSYVGGD  246

Query  904  MFESIPTANAVLLK  945
            MF+S+P+A+A+LLK
Sbjct  247  MFKSVPSADAILLK  260



>ref|XP_008245137.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=354

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/254 (48%), Positives = 164/254 (65%), Gaps = 8/254 (3%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPY  363
            +E+++A+AQ WNH  ++I+S +LKCAV + IPD+I  HG+PM LS L+SALPI P+KA +
Sbjct  9    HELLKAQAQIWNHTFSFINSMSLKCAVQLDIPDVIQKHGQPMTLSELVSALPISPTKAHF  68

Query  364  IHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYV  543
            I RL R LVHSG       A +  +  E+ Y LT A  L++ D+  ++ R F+   +  +
Sbjct  69   IPRLIRILVHSGFF-----ASESLNGGEQGYVLTDASALLLKDN-PMSARPFLLAMLNPI  122

Query  544  YQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSG  723
                   L  WF+ND+P+PF  AHG   WDY + ++     FNEAMA D+ LI   ++  
Sbjct  123  LTDPWQYLTTWFQNDNPTPFHVAHGMTFWDYGNQDTTLAHFFNEAMASDARLISSLMI--  180

Query  724  ESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGD  903
            +  K VF GV SLVDV GG GTVA +IA  FP MKCTVLDLPHV+A      N+E+V GD
Sbjct  181  DDCKGVFQGVDSLVDVGGGTGTVAKSIAAAFPHMKCTVLDLPHVVADLKGSNNLEYVAGD  240

Query  904  MFESIPTANAVLLK  945
            MFE+IP A+A+ LK
Sbjct  241  MFEAIPGADAIFLK  254



>emb|CAH05080.1| putative orcinol O-methyltransferase [Rosa gallica]
Length=346

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/268 (46%), Positives = 172/268 (64%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A   NHI ++I+S +LK A+ +GIPD+I+ HG PM LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIRNHIFSFINSMSLKSAIQLGIPDIINKHGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+      V  K    L  WF+NDDP+PF TAHG   WDY +H       FN+AM
Sbjct  111  LSLTPFLTAMPDPVLTKPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNHHPSIAHFFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   +++    K VF+G+ SLVDV GG GT+A AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVIIN--DCKGVFEGLESLVDVGGGTGTLAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>emb|CAJ65666.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/268 (45%), Positives = 174/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ +G PM LS 
Sbjct  1    QKWSHGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHS      K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSSFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  ++   +  V       L  WF+NDDP+PF TAHG   WDY +++     LFN+AM
Sbjct  111  LSLTPYLTAMLDPVLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNYQPSIAHLFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GT+A AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLLK
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADTVLLK  256



>dbj|BAJ05384.1| O-methyltransferase [Carapichea ipecacuanha]
 dbj|BAJ05385.1| O-methyltransferase [Carapichea ipecacuanha]
Length=350

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/256 (47%), Positives = 166/256 (65%), Gaps = 13/256 (5%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            E+++A+      + ++ + A+LKCA+ +GIPD I  HGKPM LS L SALPI+PSKAPYI
Sbjct  11   ELLRAQTHFSTQLFSFQNYASLKCALHLGIPDAIKQHGKPMNLSELTSALPINPSKAPYI  70

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
            HRL R LV +G             ++ E + LTP G L++ DD  IN+RA V L +    
Sbjct  71   HRLMRMLVKAGYFA----------QENECFDLTPIGLLLLKDD-PINIRALVLLELHPAL  119

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGE  726
                 +L +WF+NDD +PF TAHG+  WDY S +  +  LF+EAMA DSELI + L++  
Sbjct  120  LMPWIALSEWFQNDDATPFVTAHGKSFWDYTSRDPEFRKLFDEAMAGDSELISKVLVT--  177

Query  727  SSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDM  906
              K VF+G+ SLVDV G  GT+A +IAK FP +KCTV DLP  +A      N++FV GDM
Sbjct  178  EFKYVFEGLKSLVDVGGANGTLARSIAKAFPNLKCTVFDLPEAVANEQGDGNLDFVAGDM  237

Query  907  FESIPTANAVLLKVYI  954
            F+ +P+A+A+LLK+ +
Sbjct  238  FDRVPSADAILLKIIL  253



>ref|XP_009779391.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
sylvestris]
Length=351

 Score =   237 bits (604),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 125/260 (48%), Positives = 167/260 (64%), Gaps = 16/260 (6%)
 Frame = +1

Query  178  NEN---EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALP-IH  345
            NEN   +++ A+ QTWNH+ N+I S+  KCA+ +GIPD+++ HGKP+ LS L + L  I 
Sbjct  4    NENGSIDLLLAQTQTWNHMFNFISSSAAKCAIQLGIPDVVYKHGKPISLSDLTAELSLID  63

Query  346  PSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVH  525
             SK  ++  L RFLVHSG L         +  + E+YSLTPA +L++ DD  +++R++  
Sbjct  64   RSKVSFLPILMRFLVHSGFL---------NQHENEHYSLTPASQLLVKDD-PLSMRSYFL  113

Query  526  LCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIV  705
            +    V  K+   L DW +ND  + F TAH + +WDY+  E    D FNE+MA DS LI 
Sbjct  114  IIHDPVLLKAWSCLNDWLQNDSSTAFHTAHEKSLWDYYVQEPRVGDSFNESMASDSRLIA  173

Query  706  EALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENV  885
              L++    K VF+G+TSLVDV GG GTVA AIAK FPA+KCTVLDLP V+       NV
Sbjct  174  NVLIT--ECKHVFEGLTSLVDVGGGTGTVAIAIAKAFPAIKCTVLDLPRVVGNFKGNGNV  231

Query  886  EFVGGDMFESIPTANAVLLK  945
            EFVGG MFE IP ANA+L K
Sbjct  232  EFVGGSMFEKIPNANAILFK  251



>ref|XP_007132709.1| hypothetical protein PHAVU_011G118100g [Phaseolus vulgaris]
 gb|ESW04703.1| hypothetical protein PHAVU_011G118100g [Phaseolus vulgaris]
Length=352

 Score =   236 bits (603),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 117/254 (46%), Positives = 166/254 (65%), Gaps = 6/254 (2%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPY  363
            +++++A+   WNHI ++++S +LKCA+D+ IPD+IH +G+ MP S L ++L ++PSKA  
Sbjct  10   SKLLRAQTHVWNHIFSFVNSMSLKCAIDLEIPDIIHKYGETMPFSQLTASLSLNPSKANC  69

Query  364  IHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYV  543
            I+RL R L HSG     +   +D    E  Y LT A  L++ D+  +++  F H  +  +
Sbjct  70   IYRLMRILTHSGFFSQLQVNEND---LEMGYVLTDASTLLLKDN-PLSMLPFFHAMLDPI  125

Query  544  YQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSG  723
              K  + L  WFRNDDP+PF TAH  KIWDY   +   N LFN+AMA D++L+   ++  
Sbjct  126  LTKPWHQLPTWFRNDDPTPFHTAHEMKIWDYAGRDPKLNQLFNDAMASDAQLVSNVVI--  183

Query  724  ESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGD  903
            E    VF G+ SLVDV GG G +A AIAK FP + CTV DLPHV+A     EN+++VGGD
Sbjct  184  ERCSGVFKGLESLVDVGGGTGIMAKAIAKSFPHIDCTVFDLPHVVANLKGCENLKYVGGD  243

Query  904  MFESIPTANAVLLK  945
            MFES+P A+AVLLK
Sbjct  244  MFESVPPADAVLLK  257



>ref|XP_008229109.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=354

 Score =   236 bits (602),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 119/254 (47%), Positives = 163/254 (64%), Gaps = 8/254 (3%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPY  363
            +E++QA+A  WNHI ++I+S +LKCAV +GIPD+I  HG+PM LS L+SALPI P+KA +
Sbjct  9    HELLQAQAHIWNHIFSFINSMSLKCAVQLGIPDVIQKHGQPMTLSELVSALPISPTKAHF  68

Query  364  IHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYV  543
            I RL R LVHS        AR+     E+ Y LT A  L++ +D  ++ R F+   +  +
Sbjct  69   IPRLMRILVHSSFF-----ARESLSGGEQGYVLTDASTLLL-EDNPMSARPFLLAVLNPI  122

Query  544  YQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSG  723
                   L  WF+ND+P+PF   HG   WDY + +      FN+AMA D+ LI   ++  
Sbjct  123  LTDPWQYLTTWFQNDNPTPFHMVHGMTFWDYGNQDPTIAHFFNDAMASDARLISSLVI--  180

Query  724  ESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGD  903
            +  K VF GV SLVDV GG GTVA +IA  FP MKCTVLDLPHV+A     +N+E+V GD
Sbjct  181  DECKGVFQGVDSLVDVGGGTGTVAKSIADAFPHMKCTVLDLPHVVADLKGSKNLEYVAGD  240

Query  904  MFESIPTANAVLLK  945
            MF+++P A+A+ LK
Sbjct  241  MFDAVPAADAIFLK  254



>emb|CAJ65662.1| putative orcinol O-methyltransferase [Rosa odorata]
Length=346

 Score =   236 bits (601),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 119/268 (44%), Positives = 174/268 (65%), Gaps = 12/268 (4%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GIPD+I+ +G PM LS 
Sbjct  1    QKWSHGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGIPDIINKYGYPMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHS      K ++ D    EE Y+LT A +L++  D  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSSFFAKKKLSKTD----EEGYTLTDASQLLL-KDHP  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  ++   +  V       L  WF+NDDP+PF TAHG   WDY +++     LFN+AM
Sbjct  111  LSLTPYLTAMLDPVLTNPWNYLSTWFQNDDPTPFDTAHGMTFWDYGNYQPSIAHLFNDAM  170

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GT+A AIA  FP ++CTVLDLPHV+A
Sbjct  171  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTMAKAIADAFPHIECTVLDLPHVVA  228

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++ GGDMFE++P A+ VLL+
Sbjct  229  DLQGSKNLKYTGGDMFEAVPPADTVLLR  256



>ref|XP_007142077.1| hypothetical protein PHAVU_008G250700g [Phaseolus vulgaris]
 gb|ESW14071.1| hypothetical protein PHAVU_008G250700g [Phaseolus vulgaris]
Length=357

 Score =   236 bits (601),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 113/253 (45%), Positives = 168/253 (66%), Gaps = 6/253 (2%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            ++++A+   WNHIL++I+S +LKC VD+GIPD+IHNHG+PM LS+LIS+LPIH SK  +I
Sbjct  11   KLLKAQTHVWNHILSFINSMSLKCIVDLGIPDIIHNHGQPMSLSNLISSLPIHSSKTHFI  70

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
            HRL R +VHSG           +++ E  Y+LT +  L++  + ++++  F+   +  V 
Sbjct  71   HRLMRIMVHSGFF---SQHNHTENELEVKYALTDSSLLLLKSN-AMSVTPFLQAMLDPVL  126

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGE  726
                    +WF+N +P+ F  A G+  W+Y   +   N LFN+AMA D++L+   ++  E
Sbjct  127  TTPWNQFANWFKNGNPTTFEMAQGKPFWEYAGSDPRINSLFNDAMASDAQLVTSVVI--E  184

Query  727  SSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDM  906
              K VF G+ SLVDV GG GT+  AIAK FP ++CTV DLPHV++     EN+++VGGDM
Sbjct  185  KCKRVFMGLESLVDVGGGTGTMGKAIAKSFPQLECTVFDLPHVVSGLQGSENLKYVGGDM  244

Query  907  FESIPTANAVLLK  945
            FE+IP A+A+LLK
Sbjct  245  FEAIPPADAILLK  257



>ref|XP_002278517.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=359

 Score =   236 bits (601),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 114/254 (45%), Positives = 164/254 (65%), Gaps = 6/254 (2%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPY  363
            +E++QA+   WNHI N+I+S +LKCA+ +GIPD+IHNH +PM L  L++ LP+ P+K   
Sbjct  10   SELLQAQTHVWNHIFNFINSMSLKCAIQLGIPDIIHNHCQPMTLHELVAKLPVRPNKTLC  69

Query  364  IHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYV  543
            +HRL R LVHSG   + +     D   EE Y L  A RL++  D  +++  F+   +   
Sbjct  70   VHRLMRILVHSGFFTMQRVQESAD---EEGYVLANASRLLL-KDHPLSVTPFLLAMLDPD  125

Query  544  YQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSG  723
              +  + +  WF+NDDP+PF TAHG+ IWDY  HE  +N+ FNEAMA D+ L+   L+  
Sbjct  126  LTEPWHYVSAWFQNDDPTPFFTAHGRTIWDYGCHEPRFNNFFNEAMASDARLVTSVLV--  183

Query  724  ESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGD  903
            +  K  F+G+ S VDV GG GTVA  I + FP +  TVLDLPHV+A     +++ ++ GD
Sbjct  184  KECKGAFEGLNSFVDVGGGTGTVAKTIVEAFPHLHSTVLDLPHVVADLQGGKSLTYLAGD  243

Query  904  MFESIPTANAVLLK  945
            MFE+IP A+A+LLK
Sbjct  244  MFEAIPPADAILLK  257



>ref|XP_009780941.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
sylvestris]
Length=363

 Score =   236 bits (601),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/258 (43%), Positives = 169/258 (66%), Gaps = 5/258 (2%)
 Frame = +1

Query  178  NENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKA  357
            +E E++ A+   WNHI ++I+S +LK A+ + IPD+IH HGKPM L  L +AL I+ +K 
Sbjct  9    HETEILHAQTHIWNHIFSFINSMSLKSAIQLNIPDIIHKHGKPMTLDQLANALSINKAKT  68

Query  358  PYIHRLTRFLVHSGLLLVTKPARDDDDKQE--EYYSLTPAGRLVIGDDESINLRAFVHLC  531
             ++ RL R L+HSG  + ++   ++ + +   E Y+L P  RL++  DE +++  F+   
Sbjct  69   THLRRLMRILIHSGFFVKSRIQENEGESERIGEGYALAPPSRLLL-KDEPLSVTPFLLAM  127

Query  532  IGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEA  711
            +  +  K  + + +WF ND P+PF TAHG+  WDY  HE   N  FN+AMA D++L++  
Sbjct  128  LDPILVKPWHHVSEWFENDHPTPFDTAHGRTFWDYAGHEPRLNHFFNDAMASDAKLVMNV  187

Query  712  LLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEF  891
            ++  + SKDVF+G+ S+VDV GG GTVA +IA  FP ++CTV DLPHV+      +N+ +
Sbjct  188  VI--KYSKDVFEGLNSIVDVGGGTGTVAKSIANAFPDLQCTVFDLPHVVEGLEGNKNLNY  245

Query  892  VGGDMFESIPTANAVLLK  945
            VGGD F SIP A+A+LLK
Sbjct  246  VGGDFFVSIPPADALLLK  263



>emb|CDP19840.1| unnamed protein product [Coffea canephora]
Length=363

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/257 (44%), Positives = 167/257 (65%), Gaps = 4/257 (2%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            E+ QA+A  WNHI N+I+S ++KCA+ +GIPD+IH HG+PM L  LI ALPI  +KAP++
Sbjct  13   ELFQAQAHIWNHIFNFINSMSVKCAIQLGIPDVIHKHGQPMTLDQLIDALPIKNAKAPFV  72

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
            +RL + L+HSG  +  K   +++D Q+ Y  LT A  L++  +   ++  F+   +    
Sbjct  73   YRLMQILIHSGFFIEAKIPGNENDNQKGYL-LTSASELLLKSN-PFSVTPFLLAMLDPAL  130

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGE  726
                + L  WF+N D +PF T HG+ I+ + SHE   N  FNEAMA D+ ++   +   +
Sbjct  131  TDPWHHLSQWFQNSDETPFYTCHGRSIYAFASHEPWLNQFFNEAMASDARMVSSVVT--K  188

Query  727  SSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDM  906
              K VF+G+ SLVD+ GG GT A AIA  FP +KCTVLDLPHV+    S +N+ +VGG+M
Sbjct  189  DCKHVFEGLNSLVDIGGGTGTFAKAIADAFPRLKCTVLDLPHVVDGLESSKNLAYVGGNM  248

Query  907  FESIPTANAVLLKVYIV  957
            FE+IP A+AVL+K  ++
Sbjct  249  FEAIPPADAVLMKWILI  265



>ref|XP_004505627.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cicer 
arietinum]
Length=389

 Score =   235 bits (599),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/254 (45%), Positives = 169/254 (67%), Gaps = 10/254 (4%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            +++QA+ Q +N I ++I+S +LKCA+++ IPD+IHN+G+P+PLS LIS+LPIHPSK+  I
Sbjct  45   KLLQAQTQVFNQIFSFINSMSLKCAIELSIPDIIHNYGQPIPLSQLISSLPIHPSKSGDI  104

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
             RL R L HS   +VTK      ++ E  Y LT A RL++  D   ++ + +H+ +G + 
Sbjct  105  DRLMRVLTHSNFFIVTK------NELEVMYELTDASRLLL-KDHPFSMTSMLHVILGPIM  157

Query  547  QKSCYSLGDWFRNDDPSPFCTA-HGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSG  723
             K  + L +W++N+DPSPF T  +G + WDY  H+  +N LFNEAMA ++ +    ++  
Sbjct  158  SKPWHQLSNWYKNEDPSPFYTENNGIEFWDYAGHDPEFNHLFNEAMACETRMASTVVMG-  216

Query  724  ESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGD  903
               K VF G+ SLVDV GG GT++ AIAK FP ++C V DLPHV+      EN ++V GD
Sbjct  217  -KCKGVFQGLESLVDVGGGIGTMSKAIAKSFPNIECIVFDLPHVVDGLQGSENFKYVAGD  275

Query  904  MFESIPTANAVLLK  945
            MFESIP   ++LLK
Sbjct  276  MFESIPPTQSILLK  289



>ref|XP_004490686.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cicer 
arietinum]
Length=358

 Score =   234 bits (596),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 114/252 (45%), Positives = 165/252 (65%), Gaps = 6/252 (2%)
 Frame = +1

Query  190  VVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYIH  369
            +++A++  WNHI N+I+S +LKC VD+GIPD+IHN+GKP+ LS LI  LPIHPSK  +I+
Sbjct  13   LLKAQSHIWNHIFNFINSMSLKCVVDLGIPDIIHNYGKPISLSKLIPLLPIHPSKTIFIY  72

Query  370  RLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVYQ  549
            RL R + HSG    ++    +++ + EY     +  L+  +  S+    FVH  +  V  
Sbjct  73   RLMRIMTHSGFF--SQQNITENELETEYMLTDTSLLLLSDNPMSV--APFVHAMLDPVLT  128

Query  550  KSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGES  729
               + L  W  N DP+ F T HG   WD    E  +N+LFN+AMA D+ L+   ++  E 
Sbjct  129  NPWHQLSTWLTNGDPTAFETKHGMLFWDCAEREPKFNNLFNDAMASDARLVSSVVI--EK  186

Query  730  SKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDMF  909
             K+VF+G+ S+VDV GG GT+A A+AK FP ++CTVLDLPHV+A     EN+++VGGDMF
Sbjct  187  CKEVFNGLESIVDVGGGIGTMAKALAKSFPQLECTVLDLPHVVAGLQETENLKYVGGDMF  246

Query  910  ESIPTANAVLLK  945
            + IP+A+A+LLK
Sbjct  247  KEIPSADAILLK  258



>emb|CAN77288.1| hypothetical protein VITISV_004161 [Vitis vinifera]
Length=297

 Score =   232 bits (591),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 115/256 (45%), Positives = 166/256 (65%), Gaps = 5/256 (2%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            E+ QA++  + HI ++++S  LKCAV +GIPD+IHNH  P  L  L+SAL I P+KA  +
Sbjct  11   ELFQAQSHMYKHICSFMNSMALKCAVQLGIPDIIHNHAHPTTLPQLVSALHIPPTKASCV  70

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
            HRL R LVHSG   +   A+  + ++EE Y LTP+ RL+  D+ + NL  FV   +    
Sbjct  71   HRLMRLLVHSGFFAI---AKVHEHEEEEGYILTPSSRLLXKDNPTSNLSPFVLTVLHPXL  127

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGE  726
                +  GDW R DD + F TAHG   WD+ SH     +LFNE MA DS+++  ++++  
Sbjct  128  VTPWHFFGDWLRGDDLTAFETAHGVSFWDHGSHNPEIFNLFNEGMASDSQMM--SVVNFR  185

Query  727  SSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDM  906
              K VF+G++SLVD+ GG G +A  I++ FP +KCTV DLPHV+A      N+E+VGGDM
Sbjct  186  ELKPVFEGLSSLVDLGGGTGLLARIISEAFPQLKCTVFDLPHVVANLPESRNLEYVGGDM  245

Query  907  FESIPTANAVLLKVYI  954
            F+S+P+A+A+LLK  +
Sbjct  246  FQSVPSADAILLKCVL  261



>ref|XP_006388414.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|ERP47328.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=354

 Score =   234 bits (596),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 124/262 (47%), Positives = 166/262 (63%), Gaps = 13/262 (5%)
 Frame = +1

Query  169  KLCNEN---EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALP  339
            +L NE    E++QA+   WNHI  +I+S TLKCAV +GIPD+I  HGKPM LS L+SALP
Sbjct  2    ELINEESAGELLQAQTHVWNHIFCFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALP  61

Query  340  IHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAF  519
            IHPSKA Y+HRL R LVHSG            +  +E YSLT + RL++ D+        
Sbjct  62   IHPSKAQYVHRLMRILVHSGFF-------SQQNLNQEAYSLTQSTRLLLKDNPLSMRPLL  114

Query  520  VHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSEL  699
            + L +  V  K    L  WF+ND+ + F  AH + +W+Y   +   ++LFNEAMA DS L
Sbjct  115  LML-LDPVLTKPHDCLSTWFQNDEATAFSVAHERTLWEYAGQDPRLSNLFNEAMASDSIL  173

Query  700  IVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIE  879
              + +LS    K +FDGV SLVDV GG GT+A  IA+ FP M CTV DLP V++     +
Sbjct  174  ASKLVLS--QCKGIFDGVDSLVDVGGGSGTMAKGIAEAFPHMDCTVFDLPRVVSDLQGRK  231

Query  880  NVEFVGGDMFESIPTANAVLLK  945
            N+++VGGDMFE++P A+ +LLK
Sbjct  232  NLKYVGGDMFEAVPPADVILLK  253



>ref|XP_003615966.1| O-methyltransferase [Medicago truncatula]
 gb|AES98924.1| orcinol O-methyltransferase [Medicago truncatula]
Length=360

 Score =   234 bits (596),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 113/252 (45%), Positives = 164/252 (65%), Gaps = 6/252 (2%)
 Frame = +1

Query  190  VVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYIH  369
            +++A++  WNHI N+I+S +LKC VD+GIPD+IHN+GKP+ LS LIS LPIHPSK  +IH
Sbjct  14   LLKAQSHIWNHIFNFINSMSLKCVVDLGIPDIIHNYGKPISLSKLISLLPIHPSKTCFIH  73

Query  370  RLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVYQ  549
            RL R + HS            +++ E  Y LT A  L++ D+  +++  FVH  +  V  
Sbjct  74   RLMRIMTHSSFF---SQYNVTENELEIEYMLTDASILLLKDN-PMSVTPFVHAMLDPVLT  129

Query  550  KSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGES  729
               +    W +NDDP+ F T H   +W+Y + +S +++LFNE+MA D+ L+   L+  E 
Sbjct  130  NPWHQFSTWLKNDDPTTFETTHRMLLWEYVACDSKFSNLFNESMASDTRLVTNLLI--EK  187

Query  730  SKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDMF  909
             + VF+G+ SLVDV GG GT+A A+AK FP M+ +V DLPHV+      EN+ +VGGDMF
Sbjct  188  CRGVFNGLESLVDVGGGTGTMAKALAKSFPQMEFSVFDLPHVVDGLQGSENLNYVGGDMF  247

Query  910  ESIPTANAVLLK  945
            + IP  +A+LLK
Sbjct  248  KEIPPTDAILLK  259



>emb|CDP21787.1| unnamed protein product [Coffea canephora]
Length=365

 Score =   234 bits (596),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 115/257 (45%), Positives = 165/257 (64%), Gaps = 4/257 (2%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            E+ QA+A  WNHI N+I+S ++KCA  +GIPD+IH HG+PM L  LI ALPI  +KAP++
Sbjct  13   ELFQAQAHIWNHIFNFINSMSVKCATQLGIPDVIHKHGQPMTLDQLIDALPIKNAKAPFV  72

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
            +RL + L+HSG  +  K   +++D Q+ Y  LT A  L++  +   ++  F+   +    
Sbjct  73   YRLMQILIHSGFFIEAKIPGNENDNQKGYL-LTSASELLLKSN-PFSMTPFLLAMLDPTL  130

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGE  726
                 +L  WF+N D +PF T HG+ I+ + SHE   N  FNEAMA D+ L+   +   +
Sbjct  131  TDPWQNLSQWFQNSDETPFYTCHGRSIYAFASHEPWLNQFFNEAMASDTRLVSSVV--TK  188

Query  727  SSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDM  906
              K VF+ + SLVDV GG GT A AIA  FP +KCTVLDLPHV+    S +N+ +VGG+M
Sbjct  189  DCKHVFESLNSLVDVGGGTGTFAKAIADAFPRLKCTVLDLPHVVDGLESSKNLAYVGGNM  248

Query  907  FESIPTANAVLLKVYIV  957
            FE+IP A+AVL+K  ++
Sbjct  249  FEAIPPADAVLMKWILI  265



>emb|CDP21661.1| unnamed protein product [Coffea canephora]
Length=364

 Score =   234 bits (596),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 115/258 (45%), Positives = 166/258 (64%), Gaps = 4/258 (2%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPY  363
            +E+ QA+A  WNHI N+I+S +LKCA+ + IPD+IH HG+PM L  LI ALPI   KAP+
Sbjct  12   DELFQAQAHIWNHIFNFINSMSLKCAIQLDIPDVIHKHGRPMTLDQLIDALPIKNEKAPF  71

Query  364  IHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYV  543
            ++RL + L+HSG  +  K   +++D Q+ Y  LT A  L++  +   ++  F+   +   
Sbjct  72   VYRLMQILIHSGFFIEAKIPGNENDNQKGYL-LTSASELLLKSN-PFSVTPFLLAMLDPA  129

Query  544  YQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSG  723
                 + L  WF+N   SPF T HG+ ++D+ SHES  N  FNEAMA D+ ++   +   
Sbjct  130  LTDPWHHLSQWFQNSYESPFYTCHGRSLYDFASHESQLNQFFNEAMASDARMVSSVV--T  187

Query  724  ESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGD  903
            +  K VF+ + SLVDV GG GT A AIA  FP +KCTVLDLPHV+    S +N+ +VGG+
Sbjct  188  KDCKHVFESLNSLVDVGGGTGTFAKAIADAFPRLKCTVLDLPHVVDGLESTKNLGYVGGN  247

Query  904  MFESIPTANAVLLKVYIV  957
            MFE+IP A+AVL+K  ++
Sbjct  248  MFEAIPPADAVLMKWILI  265



>ref|XP_007142043.1| hypothetical protein PHAVU_008G247600g [Phaseolus vulgaris]
 gb|ESW14037.1| hypothetical protein PHAVU_008G247600g [Phaseolus vulgaris]
Length=357

 Score =   233 bits (594),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 113/253 (45%), Positives = 168/253 (66%), Gaps = 6/253 (2%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            ++++A+   WNHI ++I+S +LKC VD+GIPD+IHNHG+PM LS+LIS+LPIH SK  +I
Sbjct  11   KLLRAQTHVWNHIFSFINSMSLKCIVDLGIPDIIHNHGQPMSLSNLISSLPIHSSKTHFI  70

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
            HRL R +VHSG      P    +++ E  Y+LT +  L++  + ++++  F+   +  V 
Sbjct  71   HRLMRIMVHSGFFSQHNPT---ENELELKYALTDSSLLLLKSN-AMSVTPFLQAMLDPVM  126

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGE  726
                    +WF+N +P+ F   +G+  W+Y S +  +N LFN+AMA D++L+    L  E
Sbjct  127  TNPWNQFSNWFKNGNPTTFEMENGKPFWEYASCDPRFNILFNDAMASDAQLVTS--LVTE  184

Query  727  SSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDM  906
              K VF G+ SLVDV GG G +  AIAK FP ++CTV DLPHV++     EN+++VGGDM
Sbjct  185  KCKGVFMGLESLVDVGGGTGIMGKAIAKSFPQLECTVFDLPHVVSGLQGSENLKYVGGDM  244

Query  907  FESIPTANAVLLK  945
            FE+IP A+A+LLK
Sbjct  245  FEAIPPADAILLK  257



>ref|XP_003615967.1| O-methyltransferase [Medicago truncatula]
 gb|AES98925.1| orcinol O-methyltransferase [Medicago truncatula]
Length=359

 Score =   233 bits (594),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/252 (45%), Positives = 161/252 (64%), Gaps = 6/252 (2%)
 Frame = +1

Query  190  VVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYIH  369
            +++A++  WNH+ N+I+S +LKC VD+GIPD+IHN+GKP+PLS LIS+L IHPSK   IH
Sbjct  13   LLKAQSHVWNHMFNFINSMSLKCVVDLGIPDIIHNYGKPIPLSKLISSLSIHPSKNHGIH  72

Query  370  RLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVYQ  549
            RL R + HSG            ++ E  Y LT A +L++ D+  +++  +VH  +  V  
Sbjct  73   RLMRIMTHSGFF---SQKNVIGNELEIEYMLTDASKLLLKDN-PMSVAPYVHAMVNPVMM  128

Query  550  KSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGES  729
               Y    W +NDD + F T HG   W+Y + +S  N+LFNE+MA D+ L+ + L+  E 
Sbjct  129  NPWYQFSTWLKNDDTNTFETTHGMSTWEYAARDSEINNLFNESMANDTRLVSDLLV--EK  186

Query  730  SKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDMF  909
             K VF+ V SLVDV GG GT+A  + K FP M+C V DLPHV+      E + +VGGDMF
Sbjct  187  CKGVFNEVESLVDVGGGTGTMAKTLVKSFPQMECIVFDLPHVVDGLQGSEKLRYVGGDMF  246

Query  910  ESIPTANAVLLK  945
            + IP A+A+LLK
Sbjct  247  KEIPPADAILLK  258



>ref|XP_006368013.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=353

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/255 (46%), Positives = 169/255 (66%), Gaps = 14/255 (5%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKA-P  360
            NEV+ A+A   NH+LNY++S +LKCA+ +GIPD+IH+HG+ M  S L++ALPI+ SK   
Sbjct  12   NEVLAAQAHILNHVLNYVNSMSLKCAIQLGIPDIIHSHGRAMTRSDLVNALPINKSKGHE  71

Query  361  YIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGY  540
             I+RL R L+H+G  +          + EE Y LTP  RL++  +E +NL  FV   +  
Sbjct  72   CIYRLMRILIHTGFFI----------EGEEGYLLTPTSRLLL-KNEPLNLAPFVQAHLDP  120

Query  541  VYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLS  720
            +     +SLG+WF N D +PF TAHG+ ++DY   +   N +FNEAM  D+ LI+  L+ 
Sbjct  121  ILMDPWHSLGEWFANGDSTPFATAHGKPLFDYAGDDPRLNRIFNEAMESDARLIMSVLI-  179

Query  721  GESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGG  900
             ++ K VF+G+TSLVDV GG GTVA AI+  FP +KC+V DLPHV+       N+ ++ G
Sbjct  180  -KNGKRVFEGLTSLVDVGGGIGTVAKAISNAFPELKCSVFDLPHVVEGLEGGNNLSYITG  238

Query  901  DMFESIPTANAVLLK  945
            DMF+S+P+A+A+LLK
Sbjct  239  DMFKSVPSADAILLK  253



>ref|XP_003527405.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
1 [Glycine max]
 gb|KHN07776.1| 8-hydroxyquercetin 8-O-methyltransferase [Glycine soja]
Length=359

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/256 (44%), Positives = 164/256 (64%), Gaps = 3/256 (1%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            ++++A+   ++    +I+S +LKCA+D+ IPD+IH +G+PMPLS LI++LPIHPSKA +I
Sbjct  11   KLLRAQTHIFDQTFGFINSMSLKCAIDLCIPDVIHKYGQPMPLSQLIASLPIHPSKACFI  70

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
             RL + L HSG       A ++ +++E  Y LT A +L++  D   ++ +   + +  + 
Sbjct  71   FRLMQILTHSGFFSQHNNATENYEQEEVSYVLTDASKLLL-KDHHFSMISLPQVILDPIL  129

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGE  726
                +    WF N+DP+PF T +G   WDY S E   N LFN+AM  DS LI   L+  E
Sbjct  130  VNPWFQFSTWFTNEDPTPFHTQNGMAFWDYASSEPKLNHLFNDAMTNDSRLISSVLI--E  187

Query  727  SSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDM  906
              K VF G+ SLVDV GG GT+A AIAK FP +KC V DLPHV+      ENVE+V GDM
Sbjct  188  KCKGVFSGLESLVDVGGGTGTMAKAIAKSFPQLKCIVFDLPHVVDGLQGTENVEYVHGDM  247

Query  907  FESIPTANAVLLKVYI  954
            FE+IP+A++++LK  +
Sbjct  248  FEAIPSADSIMLKTIM  263



>ref|XP_009605623.1| PREDICTED: myricetin O-methyltransferase-like [Nicotiana tomentosiformis]
Length=364

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/260 (46%), Positives = 168/260 (65%), Gaps = 16/260 (6%)
 Frame = +1

Query  178  NEN---EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALP-IH  345
            NEN   ++++A+AQ WNH+ ++I+S+  KCAV +GIPD+++ H KPM  S+L + LP +H
Sbjct  15   NENGSTDLLRAQAQIWNHMFSFINSSAAKCAVQLGIPDILYKHDKPMSFSNLSAELPLVH  74

Query  346  PSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVH  525
             SK  ++  L RFLVHSG L         +   + +YSLTPA RL++ ++ S   R+   
Sbjct  75   LSKVSFLPILMRFLVHSGFL---------NQHDQNHYSLTPASRLLVTNNPS-GTRSHFL  124

Query  526  LCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIV  705
            +    ++QK+ + L  WF+ND P+ F TA+G   WDYF  +    + FN+AMA DS L+ 
Sbjct  125  INHDQLFQKASFELSSWFQNDSPTAFHTAYGISFWDYFVEKPKLGESFNDAMASDSMLVA  184

Query  706  EALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENV  885
              L++    K VF+G+TSLVDV GG GTVA AIAK FP + CTV DLPHVI       N+
Sbjct  185  NVLIT--ECKYVFEGLTSLVDVGGGTGTVAIAIAKAFPMINCTVFDLPHVIGDLKGSGNL  242

Query  886  EFVGGDMFESIPTANAVLLK  945
            +FVGG MF+ IP ANA+LLK
Sbjct  243  DFVGGSMFDKIPNANAILLK  262



>emb|CDP21836.1| unnamed protein product [Coffea canephora]
Length=365

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/257 (44%), Positives = 166/257 (65%), Gaps = 4/257 (2%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            E+ QA+A  WNHI N+I+S ++KCA+ +GIPD+IH HG+P+ L  LI ALPI  +KAP++
Sbjct  13   ELFQAQAHIWNHIFNFINSMSVKCAIQLGIPDVIHKHGQPITLDQLIDALPIKNAKAPFV  72

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
            +RL + L+HSG  +  K   +++D Q+ Y  LT A  L++  +   ++  F+   +    
Sbjct  73   YRLMQILIHSGFFIEAKIPGNENDNQKGYL-LTSASELLLKSN-PFSMTPFLLAMLDPTL  130

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGE  726
                + L  WF+N D +PF T HG+ I+ + SHE   N  FNEAMA D+ L+   +   +
Sbjct  131  TDPWHHLSQWFQNSDETPFYTCHGRSIYAFASHEPWLNQFFNEAMASDTRLVSSVV--TK  188

Query  727  SSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDM  906
              K VF+ + SLVDV GG GT A AIA  FP +KCTVLDLPHV+    S +N+ +VGG+M
Sbjct  189  DCKHVFESLNSLVDVGGGTGTFAKAIADAFPRLKCTVLDLPHVVDGLESSKNLGYVGGNM  248

Query  907  FESIPTANAVLLKVYIV  957
            FE+IP A+AVL+K  ++
Sbjct  249  FEAIPPADAVLMKWILI  265



>ref|XP_009602136.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=361

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/256 (43%), Positives = 168/256 (66%), Gaps = 3/256 (1%)
 Frame = +1

Query  178  NENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKA  357
            +E E++ A+   WNHI ++I+S +LK A+ + IPD+IH HGKPM L  L +AL I+ +K 
Sbjct  9    HETEILHAQTHIWNHIFSFINSMSLKSAIQLNIPDIIHKHGKPMTLDQLANALSINKAKT  68

Query  358  PYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIG  537
             ++ RL R L+ SG  + ++   ++ + + E YSL P  RL++  DE +++  F+   + 
Sbjct  69   THLRRLMRILIRSGFFVKSRIQENEGESEGEGYSLAPPSRLLL-KDEPLSVTPFLLAMLD  127

Query  538  YVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALL  717
             +  K  + + +WF ND P+PF TAHG+  WDY  HE   N  FN+AMA D++L++  ++
Sbjct  128  PILVKPWHHVSEWFENDHPTPFDTAHGRTFWDYAGHEPRLNHFFNDAMASDAKLVMNVVI  187

Query  718  SGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVG  897
              + SKDVF+G+ S+VDV GG GTVA +IA  FP ++CTV DLPHV+      +N+ +VG
Sbjct  188  --KYSKDVFEGLNSIVDVGGGTGTVAKSIANAFPDLQCTVFDLPHVVEGLEESKNLNYVG  245

Query  898  GDMFESIPTANAVLLK  945
            GD F SIP A+A+LLK
Sbjct  246  GDFFVSIPPADALLLK  261



>gb|ABZ89567.1| O-methyltransferase 3 [Humulus lupulus]
Length=377

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/257 (46%), Positives = 165/257 (64%), Gaps = 4/257 (2%)
 Frame = +1

Query  178  NENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKA  357
            N  E++ A+A  WN I N+I+S +LKCA+ +GIPD+I+NHGKPM +S L  ALPI+  K+
Sbjct  22   NSTEILGAQAHIWNQIFNFINSMSLKCAIQLGIPDIINNHGKPMTISQLTLALPINRKKS  81

Query  358  PYIHRLTRFLVHSGLLLVTKP-ARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCI  534
            P ++RL R L+HSG   + K    ++   +EE Y +T A +L++ D+  +++  F+   +
Sbjct  82   PCVYRLMRILIHSGFFALQKAEVGEEGGGEEEGYVITDASKLLLKDN-PMSVTPFLLAML  140

Query  535  GYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEAL  714
              V  K    L +WF+N DP+PF TA+G   WDY SHE      FN+AMA D+ L+   +
Sbjct  141  DPVMTKPWDFLSNWFQNGDPTPFDTANGMAFWDYGSHEPKLARFFNDAMASDARLVTSVV  200

Query  715  LSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFV  894
            +  E  K VF+GV SLVDV GG GTVAS+IA  FP ++CTV DLPHV+A      N+ FV
Sbjct  201  I--EKCKGVFEGVESLVDVGGGTGTVASSIAAAFPHIQCTVFDLPHVVADLQGGNNLNFV  258

Query  895  GGDMFESIPTANAVLLK  945
            GGDMF  +P    VLLK
Sbjct  259  GGDMFVDVPATEVVLLK  275



>ref|XP_006365444.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=352

 Score =   231 bits (590),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 120/252 (48%), Positives = 166/252 (66%), Gaps = 16/252 (6%)
 Frame = +1

Query  199  AEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPI-HPSKAPYIHRL  375
            A+AQ WN+I N++ S+ +KCA+ + IPD+++ H KPM LS L + L + + SK  ++  L
Sbjct  14   AQAQIWNYIFNFVSSSAVKCALQLEIPDVLYKHEKPMCLSDLSAELSVVNSSKISFLPIL  73

Query  376  TRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVYQKS  555
             RFLV SG L          ++ E++Y LTPA RL++  +ES N+R+F+ L     + K+
Sbjct  74   MRFLVQSGFL----------NQHEDHYFLTPASRLLV-KNESFNVRSFLLLSHSQAFSKA  122

Query  556  CYSLGDWFRNDDPSPFCTAHGQKIWDYFSHE--SGYNDLFNEAMAKDSELIVEALLSGES  729
               L DWF+ND P+PF TAHG+ +WDY   E  S   D+FN+A+A DS L    L++   
Sbjct  123  WSELSDWFQNDSPTPFHTAHGKSVWDYIGEEQPSVLGDIFNDALASDSRLNTNILIT--E  180

Query  730  SKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDMF  909
             K VF+G+TSLVDV GG GTV+ AIAK FP +KCTVLDLP VI       N++F+GGDMF
Sbjct  181  CKHVFEGLTSLVDVGGGTGTVSIAIAKAFPNIKCTVLDLPQVIGYLKGSGNLDFIGGDMF  240

Query  910  ESIPTANAVLLK  945
            + IP ANA+LLK
Sbjct  241  DKIPQANAILLK  252



>ref|XP_002517834.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44352.1| o-methyltransferase, putative [Ricinus communis]
Length=362

 Score =   232 bits (591),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 122/258 (47%), Positives = 170/258 (66%), Gaps = 9/258 (3%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALP-IHPSKAP  360
            NE++QA A  W+H  ++I S +LKCAV++GIPD+IHNHG+PM LS L++ LP + PSK+ 
Sbjct  10   NELLQAHAHVWSHAFSFIKSMSLKCAVELGIPDIIHNHGQPMTLSELVAGLPHVLPSKSH  69

Query  361  YIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGY  540
            ++ RL R L HSG   + K +   D++ E+ Y LT    L++  D  I+ R ++   +  
Sbjct  70   HVCRLMRVLTHSGFFTLQKAS---DNRDEDGYLLT-KPCLLLLKDSPISARPYLFAVLDP  125

Query  541  VYQKSCYSLGDWFRNDDP--SPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEAL  714
            +  K    L  WF+NDD   SPF  AHG+  WD  SHE+ +N +FNEAMA DS ++ E +
Sbjct  126  ILTKPWDCLSSWFQNDDSKCSPFSIAHGKTFWDLASHEARFNSIFNEAMASDSSVVREVV  185

Query  715  LSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFV  894
            +S    KDVF G+ SLVDV G  G +A AI + FP +KCTVLDLPHV+A      N+ F+
Sbjct  186  IS--KCKDVFMGLNSLVDVGGSTGIMAKAIVETFPELKCTVLDLPHVVAGMQDDHNLSFL  243

Query  895  GGDMFESIPTANAVLLKV  948
            GGDMFESIP A+A++LK+
Sbjct  244  GGDMFESIPPADAIMLKM  261



>ref|XP_002278208.2| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
Length=369

 Score =   231 bits (590),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 114/256 (45%), Positives = 167/256 (65%), Gaps = 5/256 (2%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            E+ QA++  + HI ++++S  L+CAV +GIPD+IHNH  P  L  L+SAL I P+KA  +
Sbjct  22   ELFQAQSHMYKHICSFMNSMALRCAVQLGIPDIIHNHAHPTTLPQLVSALHIPPTKASCV  81

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
            HRL R LVHSG   +   A+  + ++EE Y LTP+ RL++ D+ + NL   V   +  V 
Sbjct  82   HRLMRLLVHSGFFAM---AKVHEHEEEEGYILTPSSRLLLKDNPTSNLSPLVLTMLHPVL  138

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGE  726
                +  GDW R DD + F TAHG   WD+ SH     +LFNE MA DS+++  ++++  
Sbjct  139  VTPWHFFGDWLRGDDLTAFETAHGVSFWDHGSHNPEIFNLFNEGMASDSQMM--SVVNFR  196

Query  727  SSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDM  906
              K VF+G++SLVD+ GG G +A  I++ FP +KCTV DLPHV+A      N+E+VGGDM
Sbjct  197  ELKPVFEGLSSLVDLGGGTGLLARIISEAFPQLKCTVFDLPHVVANLPESRNLEYVGGDM  256

Query  907  FESIPTANAVLLKVYI  954
            F+S+P+A+A+LLK  +
Sbjct  257  FQSVPSADAILLKCVL  272



>ref|XP_002278398.1| PREDICTED: trans-resveratrol di-O-methyltransferase [Vitis vinifera]
 emb|CBI21930.3| unnamed protein product [Vitis vinifera]
Length=358

 Score =   231 bits (588),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 118/254 (46%), Positives = 166/254 (65%), Gaps = 7/254 (3%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPY  363
            +E++QA+A  WNHI N+I+S +LKCA+ +GIPD+IHNH KPM L  L++ LP+ P+K   
Sbjct  10   SELLQAQAHVWNHIFNFINSMSLKCAIQLGIPDIIHNHCKPMTLHELVAKLPVRPNKTLC  69

Query  364  IHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYV  543
            +HRL R LVHSG    TK  R  +   EE Y L  A RL++  D  +++  F+ L    +
Sbjct  70   VHRLMRILVHSGFF--TK-QRVQESADEEGYVLANASRLLL-KDHPLSITPFLLLLDPDL  125

Query  544  YQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSG  723
             +   Y+   WF+NDDP+PF TAHG+ +WDY  HE  +N+ FNE MA D+ L+   L+  
Sbjct  126  TEPWDYA-SAWFQNDDPTPFFTAHGRTLWDYGCHEPRFNNFFNEGMASDARLVTSVLV--  182

Query  724  ESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGD  903
            +  K  F+G+ S VDV GG GTVA  I + FP +  TVLDLPHV+A     +N+ ++ GD
Sbjct  183  KECKGAFEGLNSFVDVGGGTGTVAKTIVEAFPHLHGTVLDLPHVVADLRGSKNLTYLAGD  242

Query  904  MFESIPTANAVLLK  945
            +FE+IP A+A+LLK
Sbjct  243  LFEAIPPADAILLK  256



>gb|AAB71213.1| methyltransferase [Prunus armeniaca]
Length=354

 Score =   231 bits (588),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 119/262 (45%), Positives = 168/262 (64%), Gaps = 9/262 (3%)
 Frame = +1

Query  163  IGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPI  342
            +G +   +E++QA+A  WNHI ++I+S +LKCAV + IPD+I  HG+PM LS L+SALPI
Sbjct  1    MGSVRASHELLQAQAHIWNHIFSFINSLSLKCAVQLDIPDVIQKHGQPMTLSELVSALPI  60

Query  343  HPSKAPYIHRLTRFLVHSGLLLVTKPARDD-DDKQEEYYSLTPAGRLVIGDDESINLRAF  519
             P+KA +I RL R LVHSG       A++      E+ Y LT A  L++ D+  ++ R F
Sbjct  61   SPTKAHFIPRLMRILVHSGFF-----AKESLSGCGEQGYILTDASALLLKDN-PMSARPF  114

Query  520  VHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSEL  699
            +   +  +       L  WF+ND+P+PF   +G   WDY + +      FN+AMA D++L
Sbjct  115  LLAMLSPILTDPYQYLTTWFQNDNPTPFHVVNGMTCWDYVNQDPTLAHFFNDAMASDAQL  174

Query  700  IVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIE  879
            I   ++  +  K+VF GV SLVDV GG GTVA +IA  FP MKCTVLDLPHV+A     +
Sbjct  175  ISSLVI--DDCKEVFQGVDSLVDVGGGTGTVAKSIADAFPHMKCTVLDLPHVVADLKGSK  232

Query  880  NVEFVGGDMFESIPTANAVLLK  945
            N+E+V GDMFE++P A+A+ LK
Sbjct  233  NLEYVAGDMFEAVPAADAIFLK  254



>ref|XP_006364110.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=267

 Score =   228 bits (580),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 112/261 (43%), Positives = 164/261 (63%), Gaps = 7/261 (3%)
 Frame = +1

Query  178  NENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKA  357
            +E E++ A+   WNHI ++I+S +LK A+ + IPD+IH HGKPM L  L +AL I+ SK 
Sbjct  9    HETEILHAQTHIWNHIFSFINSMSLKSAIQLNIPDIIHKHGKPMTLDELANALSINKSKI  68

Query  358  PYIHRLTRFLVHSGLLL----VTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVH  525
             ++ RL R L+HSG  L    +          + E Y L P  RL++  DE + +  F+ 
Sbjct  69   THLRRLMRILIHSGFFLKFAMIPLEEGSSGSGEGEGYVLAPPARLLL-KDEPLTVTPFLL  127

Query  526  LCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIV  705
              +  +  K  + + +WF +D+P+PF  AHG+  WDY  HE   N  FN+AMA D++L++
Sbjct  128  AMLDPILVKPWHHVNEWFSSDEPTPFEVAHGRTFWDYAGHEQRLNHFFNDAMASDAKLVM  187

Query  706  EALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENV  885
              ++  + SKDVF+G+ S+VDV GG GTVA  IAK FP ++CTV DLPHV+      +N+
Sbjct  188  SVVM--KYSKDVFEGLNSIVDVGGGTGTVAKTIAKKFPNLQCTVFDLPHVVEGLEGSDNL  245

Query  886  EFVGGDMFESIPTANAVLLKV  948
             +VGGD F S+P A+A+LLKV
Sbjct  246  SYVGGDFFVSVPPADALLLKV  266



>gb|AAR02417.1| putative O-methyltransferase [Catharanthus roseus]
 gb|AAR02418.1| putative O-methyltransferase [Catharanthus roseus]
Length=348

 Score =   230 bits (587),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 124/257 (48%), Positives = 169/257 (66%), Gaps = 13/257 (5%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            E  +A+A  WN + ++   A+LKCAV +GI D I +HGKPM L +L  AL I+PSKAPYI
Sbjct  7    EFCKAQAHIWNQVFSFTTCASLKCAVQLGIADAIDDHGKPMSLFYLTKALQINPSKAPYI  66

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
             RL   LV+SG     K +         YYSLTP+ RL++   E +NLR  V + +    
Sbjct  67   QRLMGILVNSGFFSQDKLS---------YYSLTPSSRLLLKK-EELNLRGAVEIMLDPAE  116

Query  547  QKSCYSLGDWFRNDD-PSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSG  723
             K+  SL DWF+++   + F  AHG+  WD+ + ES + ++FN AM+ DS+LI + L++ 
Sbjct  117  LKAWSSLSDWFKDEKCRTTFEMAHGKNFWDFCAEESIHGEIFNRAMSTDSQLISKLLVT-  175

Query  724  ESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGD  903
               K +F+G+TSLVD+ GG GT+A AIAK FP +KCTV DLPHV+A   S EN+EFVGGD
Sbjct  176  -EYKFLFEGLTSLVDIGGGTGTIAKAIAKSFPKLKCTVFDLPHVVANLESKENLEFVGGD  234

Query  904  MFESIPTANAVLLKVYI  954
            MFE IP ANA+LLK+ +
Sbjct  235  MFERIPNANAILLKIVL  251



>ref|XP_009625456.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=357

 Score =   230 bits (587),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 120/257 (47%), Positives = 172/257 (67%), Gaps = 15/257 (6%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLIS--ALPIHPSKAP  360
            E+++A+AQ WNHI N+I S+ ++CA+ +GI D+++ +GKPM LS L +  +L I+PSK  
Sbjct  9    ELLRAQAQIWNHIFNFISSSAVRCALQLGILDVLYKYGKPMSLSDLSAELSLVINPSKVS  68

Query  361  YIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGY  540
            ++  L RFLVHSG L        + D Q+ +YSLTPA  L++  +E  N+R+ + +    
Sbjct  69   FLPILMRFLVHSGFL--------NQDDQDHHYSLTPASCLLV-KNEPFNVRSLLVINHDP  119

Query  541  VYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESG--YNDLFNEAMAKDSELIVEAL  714
            V+ K+ + L  WF+ND P+ F TA+G+ +WDY   +      D+FN+A+A DS L    L
Sbjct  120  VFSKAWFVLSTWFQNDSPTAFHTANGKSLWDYIVDQESRVLGDIFNDALASDSRLNTNVL  179

Query  715  LSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFV  894
            ++    K VF+G+ SLVDV GG GTV+ AIAK FP +KCTVLDLPHV+       N+EFV
Sbjct  180  IT--ECKHVFEGLNSLVDVGGGTGTVSIAIAKAFPNIKCTVLDLPHVVEDCKGSGNLEFV  237

Query  895  GGDMFESIPTANAVLLK  945
            GGDMF++IP ANA+LLK
Sbjct  238  GGDMFDNIPHANAILLK  254



>gb|KDO40717.1| hypothetical protein CISIN_1g037127mg, partial [Citrus sinensis]
Length=307

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/258 (44%), Positives = 168/258 (65%), Gaps = 7/258 (3%)
 Frame = +1

Query  181  ENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAP  360
            + E+++A+A  WNHI N+I+S +LKCAV++ IPD+I+ HGKP  L+ L+SAL I+PSK  
Sbjct  9    DTELLEAQAHVWNHIFNFINSMSLKCAVELSIPDIINKHGKPTTLNDLVSALTINPSKTR  68

Query  361  YIHRLTRFLVHSGLLL--VTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCI  534
             ++RL R L+HSG         +R+++D +E+ Y LT A +L++ D   +++   +   +
Sbjct  69   CVYRLMRILIHSGFFAQQTLNSSRNNND-EEQGYVLTNASKLLLKD-SPLSVTPLLQAVL  126

Query  535  GYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEAL  714
              +       L  WF++DDP+PF   HG+  W+Y   E   N+ FNEAMA D+ L    +
Sbjct  127  DPILLSPWLKLSTWFQSDDPAPFDMVHGKSFWEYAGDEPKINNFFNEAMASDARLATRVV  186

Query  715  LSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVI-ACGSSIENVEF  891
            +     K+VF+G+ SLVDV G  GTVA AIAK FP ++CT  DLPHV+    S + N+++
Sbjct  187  I--HKCKNVFEGLNSLVDVGGATGTVAKAIAKAFPNLECTDFDLPHVVNGLESDLANLKY  244

Query  892  VGGDMFESIPTANAVLLK  945
            VGGDMFE+IP A+AV+LK
Sbjct  245  VGGDMFEAIPPADAVVLK  262



>ref|XP_010110664.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
 gb|EXC27579.1| 8-hydroxyquercetin 8-O-methyltransferase [Morus notabilis]
Length=377

 Score =   231 bits (588),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/257 (45%), Positives = 166/257 (65%), Gaps = 7/257 (3%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSK---  354
             E ++A+A  WN I N+I+S +LKCA+ +GIPD IH+HGKPM LS LISALPIH +K   
Sbjct  16   TEQLKAQAHIWNQIFNFINSMSLKCAIQLGIPDAIHSHGKPMTLSQLISALPIHQNKKLD  75

Query  355  APYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCI  534
            +  I+RL R LV+S    + +    + D+ E+ Y LT + +L++ D+   +L   +   +
Sbjct  76   SHLIYRLMRILVNSSFFSL-QEVVGETDQLEDGYVLTNSSKLLVRDN-PFSLTPILLTVL  133

Query  535  GYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEAL  714
              +  K  +S+  W ++DDP+PF T HG + WDY   +  + ++FNEAMA D+ L+V  L
Sbjct  134  DPIMTKPWHSISTWLQSDDPTPFATTHGMEFWDYTVRDPRFGNVFNEAMASDARLVVSVL  193

Query  715  LSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFV  894
                 S  VF+G+ SLVD+AGG GTV  AIA  FP ++CTV DLPHVIA      N++FV
Sbjct  194  FDKRIS--VFEGLESLVDLAGGTGTVGKAIADAFPHVECTVFDLPHVIADLQGSTNLKFV  251

Query  895  GGDMFESIPTANAVLLK  945
            GGDMF+ IP A+A+ +K
Sbjct  252  GGDMFDEIPPADAIFMK  268



>emb|CAJ65637.1| putative orcinol O-methyltransferase [Rosa odorata var. gigantea]
Length=341

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 121/268 (45%), Positives = 170/268 (63%), Gaps = 17/268 (6%)
 Frame = +1

Query  142  EKYVMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSH  321
            +K+  GE     + NE++ A+A  WNHI ++I+S +LK A+ +GI D+I+ HG  M LS 
Sbjct  1    QKWSNGE-----HSNELLHAQAHIWNHIFSFINSMSLKSAIQLGILDVINKHGYLMTLSE  55

Query  322  LISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDES  501
            L SALPIHP+K+  ++RL R LVHSG     K ++ D    EE Y+LT A +L++ DD  
Sbjct  56   LTSALPIHPTKSHSVYRLMRILVHSGFFAKKKLSKID----EEGYTLTNASQLLLKDD-P  110

Query  502  INLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAM  681
            ++L  F+         K    L  WF+N+DP+PF TAHG   WDY +H+      FN AM
Sbjct  111  LSLTPFL-----TAMNKPWNYLSTWFQNNDPTPFDTAHGMTFWDYGNHQPSIAHFFNNAM  165

Query  682  AKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA  861
            A D+ L+   ++  +  K VF+G+ SLVDV GG GTVA AIA  FP ++CTVLDLPHV+A
Sbjct  166  ASDARLVTSVII--DDCKGVFEGLESLVDVGGGTGTVAKAIADAFPHIECTVLDLPHVVA  223

Query  862  CGSSIENVEFVGGDMFESIPTANAVLLK  945
                 +N+++  GDMFE++P A+ VLLK
Sbjct  224  DLQGSKNLKYTRGDMFEAVPPADTVLLK  251



>ref|XP_006469069.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=353

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/257 (47%), Positives = 168/257 (65%), Gaps = 13/257 (5%)
 Frame = +1

Query  178  NENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKA  357
            + +E+++A+AQ WN   NY++S +LKCAV++GI D+IH+HG+P  LS + SAL I P+K 
Sbjct  9    SSSELLKAQAQVWNCTFNYVNSMSLKCAVELGIADIIHSHGQPTTLSQIASALNIKPNKV  68

Query  358  PYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIG  537
              I  + R LVHSG       A+  DD+    Y LTPA RL++  D  +    FV L   
Sbjct  69   ECIQSVMRILVHSGFF-----AQQKDDE----YFLTPASRLLL-KDTPLKAAPFVDLVAD  118

Query  538  YVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALL  717
             +Y  + + LG W +NDDP+ F TAHG+K+WD  + E  +  LF + M  DSELI   ++
Sbjct  119  PLYTTAFHCLGTWLQNDDPTLFETAHGKKVWDRVADEPKFKSLFYDLMITDSELIAGIVI  178

Query  718  SGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVI-ACGSSIENVEFV  894
              +  K+VF+G+ SLVDVAGG G +A AIA  FP +KCTV DLPHV+     + +N++F+
Sbjct  179  --KDCKEVFEGLKSLVDVAGGTGIMARAIATAFPDIKCTVFDLPHVVDNLQGTNDNLDFL  236

Query  895  GGDMFESIPTANAVLLK  945
            GG+MFE+IP ANAVLLK
Sbjct  237  GGNMFEAIPQANAVLLK  253



>ref|XP_011037440.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
 ref|XP_011037441.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=355

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/254 (46%), Positives = 164/254 (65%), Gaps = 11/254 (4%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            E++QA+   WNHI N+I+S TLKCAV +GIPD+I  HGKPM LS L+SALPIHPSKA Y+
Sbjct  11   ELLQAQTHVWNHIFNFINSMTLKCAVQLGIPDVIQKHGKPMTLSELVSALPIHPSKAQYV  70

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
            HRL R LVH+G            +  +E YSLT + RL++ D+        + + +  V 
Sbjct  71   HRLMRILVHAGFF-------SQQNLNQEAYSLTQSTRLLLKDNPLSMRPLLL-MLLDPVL  122

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGE  726
             K    L  WF+ND+ + F  AH + +W+Y   +   ++LFNEAMA DS L  + ++S  
Sbjct  123  TKPHDCLSTWFQNDEATAFSVAHERTLWEYAGQDPRLSNLFNEAMASDSILASKLVVS--  180

Query  727  SSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA-CGSSIENVEFVGGD  903
              + +F+GV SLVDV GG GT+A  IA+ FP M CTV DLP V++   +  +N+++VGGD
Sbjct  181  KCQGIFEGVNSLVDVGGGSGTMAKGIAEAFPHMDCTVFDLPRVVSDLQAGSKNLKYVGGD  240

Query  904  MFESIPTANAVLLK  945
            MFE++P A+ +LLK
Sbjct  241  MFEAVPPADVILLK  254



>gb|KGN43481.1| O-methyltransferase [Cucumis sativus]
Length=313

 Score =   228 bits (580),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 119/271 (44%), Positives = 172/271 (63%), Gaps = 16/271 (6%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHG-KPMPLSHLISALPIHPSKAP  360
            +E+++A  Q   HI N+I+S +LKCA+ +GIPD IH+HG  P+PLS L+S+L +HP+K  
Sbjct  14   DELMEAHGQICKHIFNFINSMSLKCAIQLGIPDAIHSHGPSPLPLSRLVSSLQLHPNKTQ  73

Query  361  YIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGY  540
            +I+RL R L HSG  ++          QEE Y LT +  L++ D+ S  L  F+   +  
Sbjct  74   FIYRLMRLLTHSGFFVL----------QEEGYVLTTSSHLLLKDN-SCTLSPFLLSMLQP  122

Query  541  VYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLS  720
            V+ +  + L  WFR DD +PF TAHG+  W++  ++    D FN  MA D+ L++  L+ 
Sbjct  123  VFVEPSHFLSAWFRTDDQTPFETAHGKSFWEFVGNKRKDGDTFNAGMASDARLVMSVLMG  182

Query  721  GESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA-CGSSIENVEFVG  897
              +S  VF+GV SLVDV GG GT+A AIAK FP ++CTVLDLP V+A     I N ++V 
Sbjct  183  KHTS--VFEGVESLVDVGGGTGTMAKAIAKAFPQIECTVLDLPQVVAELKPDIPNFKYVE  240

Query  898  GDMFESIPTANAVLLKVY-IVGKLFSTQYYV  987
            GDMF++IP A+A+LLKV  I+ K  S   ++
Sbjct  241  GDMFDAIPPADALLLKVANILTKPLSAHSFI  271



>ref|XP_009780812.1| PREDICTED: myricetin O-methyltransferase-like [Nicotiana sylvestris]
Length=353

 Score =   229 bits (583),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 122/262 (47%), Positives = 164/262 (63%), Gaps = 20/262 (8%)
 Frame = +1

Query  178  NEN---EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALP-IH  345
            NEN   ++++A+AQ WNH+ ++I+S+  KCAV +GIPD+++ HGKPM  S L + LP +H
Sbjct  4    NENGSTDLLRAQAQIWNHMFSFINSSATKCAVQLGIPDVLYKHGKPMSFSDLSAELPLVH  63

Query  346  PSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVH  525
            PSK  ++  L RFLVHSG L         +   + +YSLTP  RL+  ++ S   R+  H
Sbjct  64   PSKVSFLTILMRFLVHSGFL---------NQHDQNHYSLTPVSRLLATNNPS-GTRS--H  111

Query  526  LCIGYV--YQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSEL  699
              I ++    K+ + L  WF+ND P+ F TAHG   WDYF       + FN AMA DS L
Sbjct  112  FLINHIQLLSKASFELSRWFQNDSPTAFHTAHGISFWDYFVENPKLGESFNVAMASDSML  171

Query  700  IVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIE  879
            +   L++    K VF+G+TSLVDV GG GTV+ AIAK FP + CTV DLPHVI       
Sbjct  172  VANVLIT--ECKYVFEGLTSLVDVGGGTGTVSIAIAKAFPMINCTVFDLPHVIGDLKGSG  229

Query  880  NVEFVGGDMFESIPTANAVLLK  945
            N+EFV G MF+ IP ANA+LLK
Sbjct  230  NLEFVRGSMFDKIPKANAILLK  251



>ref|XP_008783119.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008783121.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X2 [Phoenix dactylifera]
 ref|XP_008783122.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X3 [Phoenix dactylifera]
Length=366

 Score =   229 bits (584),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 118/258 (46%), Positives = 163/258 (63%), Gaps = 9/258 (3%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPY  363
             E +Q  AQ WNH L+++ S +LKCA+++GIPD++HNHGKP+ LS L ++L I PSKAP 
Sbjct  14   REQLQDTAQLWNHALSFLRSMSLKCAIELGIPDVLHNHGKPITLSELATSLSIPPSKAPA  73

Query  364  IHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYV  543
            +  L R LVHSGL       RD +  +EE Y LTPA +L++ + ++  L  F  + + + 
Sbjct  74   LGSLMRLLVHSGLF---ASHRDQEGGEEESYFLTPASKLLVKEKKAC-LSPFALMILNWT  129

Query  544  YQKSCYSLGDWFRND--DPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALL  717
                 + LG WFR      +PF  AHG+  ++  +  + +N+LFNE MA D+ L+ E  +
Sbjct  130  LLAPAHQLGAWFRAGAARATPFDMAHGKGFFEETNARADFNELFNEGMASDARLVTEVAV  189

Query  718  SGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIAC--GSSIENVEF  891
             G    +V  GV S+VDV GG GT+A AIAK FP ++C VLDLPHV+A       E VEF
Sbjct  190  -GRRQWEVLHGVRSVVDVGGGTGTLAKAIAKAFPGVRCAVLDLPHVVATVDEEEREGVEF  248

Query  892  VGGDMFESIPTANAVLLK  945
            +GGDMFE IP A+AVL K
Sbjct  249  IGGDMFEHIPPADAVLFK  266



>gb|KDP24060.1| hypothetical protein JCGZ_25717 [Jatropha curcas]
Length=358

 Score =   229 bits (583),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 118/258 (46%), Positives = 171/258 (66%), Gaps = 15/258 (6%)
 Frame = +1

Query  178  NENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIH-NHGKPMPLSHLISALPIHPSK  354
            N +E+++A++  W H L +I S +LKCAV++G+P     +HG+PMPLS L+SAL ++P+K
Sbjct  8    NIDELLKAQSHIWTHSLQFIKSMSLKCAVELGVPVAFSTHHGQPMPLSDLVSALQVNPAK  67

Query  355  APYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCI  534
              ++HRL R LVHSG   +          +E+ Y LT + RL++  D  +N R F+ L +
Sbjct  68   THHLHRLMRILVHSGFFSL----------KEDGYLLTASSRLLL-KDTPLNSRPFISLVL  116

Query  535  GYVYQKSCYSLGDWFRND-DPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEA  711
              +  +    +  W ++D D +PF TA G+ +W++  HE   N+LFNEAMA DS LI EA
Sbjct  117  DPILTEPYNCMSKWLKDDHDQTPFVTAFGESLWEHAGHEIRVNNLFNEAMASDSFLISEA  176

Query  712  LLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEF  891
            ++     K+VF+G+ SLVDVAGG G +A AIA  FP +KCTVLDLPHV+A    I+N+ F
Sbjct  177  VIV--KCKEVFEGLDSLVDVAGGTGNMAKAIANTFPNLKCTVLDLPHVVAGLQGIKNLNF  234

Query  892  VGGDMFESIPTANAVLLK  945
            + GDMFE++P A+AVLLK
Sbjct  235  LAGDMFEAVPPADAVLLK  252



>ref|NP_001267964.1| O-methyltransferase [Vitis vinifera]
 gb|ABQ02271.1| O-methyltransferase [Vitis vinifera]
Length=359

 Score =   229 bits (583),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 115/257 (45%), Positives = 169/257 (66%), Gaps = 6/257 (2%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            E+ QA++  + HI ++++S  LKCAV +GIPD+IHNH  P  L  L+SAL I P+KA  +
Sbjct  11   ELFQAQSHMYKHICSFMNSMALKCAVQLGIPDIIHNHAHPTNLPQLVSALHIPPTKASCV  70

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
            HRL R LVHSG   +   A+  + ++EE Y LTP+ RL++ D+ + NL  FV   +  V 
Sbjct  71   HRLMRLLVHSGFFAI---AKVHEHEEEEGYILTPSSRLLLKDNPTSNLSPFVLTVLHPVL  127

Query  547  QKSCYSLGDWFR-NDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSG  723
                +  GDW R +DD + F TAHG   WD+ SH     +LFNE +A DS+++  ++++ 
Sbjct  128  VTPWHFFGDWLRGDDDLTAFETAHGVSFWDHGSHNPEIFNLFNEGLASDSQMM--SVVNF  185

Query  724  ESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGD  903
               K VF+G++SLVD+ GG G +A  I++ FP +KCTV DLPHV+A      N+E+VGGD
Sbjct  186  RELKPVFEGLSSLVDLGGGTGLLARIISEVFPQLKCTVFDLPHVVANLPESRNLEYVGGD  245

Query  904  MFESIPTANAVLLKVYI  954
            MF+S+P+A+A+LLK  +
Sbjct  246  MFQSVPSADAILLKCVL  262



>ref|XP_006469137.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=362

 Score =   229 bits (583),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 113/258 (44%), Positives = 168/258 (65%), Gaps = 7/258 (3%)
 Frame = +1

Query  181  ENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAP  360
            + E+++A+A  WNHI N+I+S +LKCAV++ IPD+I+ HGKP  L+ L+SAL I+PSK  
Sbjct  9    DTELLEAQAHVWNHIFNFINSMSLKCAVELSIPDIINKHGKPTTLNDLVSALTINPSKTR  68

Query  361  YIHRLTRFLVHSGLLL--VTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCI  534
             ++RL R L+HSG         +R+++D +E+ Y LT A +L++ D   +++   +   +
Sbjct  69   CVYRLMRILIHSGFFAQQTLNSSRNNND-EEQGYVLTNASKLLLKD-SPLSVTPLLQAVL  126

Query  535  GYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEAL  714
              +       L  WF++DDP+PF   HG+  W+Y   E   N+ FNEAMA D+ L    +
Sbjct  127  DPILLSPWLKLSTWFQSDDPAPFDMVHGKSFWEYAGDEPKINNFFNEAMASDARLATRVV  186

Query  715  LSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVI-ACGSSIENVEF  891
            +     K+VF+G+ SLVDV G  GTVA AIAK FP ++CT  DLPHV+    S + N+++
Sbjct  187  I--HKCKNVFEGLNSLVDVGGATGTVAKAIAKAFPNLECTDFDLPHVVNGLESDLANLKY  244

Query  892  VGGDMFESIPTANAVLLK  945
            VGGDMFE+IP A+AV+LK
Sbjct  245  VGGDMFEAIPPADAVVLK  262



>ref|XP_006346268.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=353

 Score =   229 bits (583),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 115/255 (45%), Positives = 169/255 (66%), Gaps = 14/255 (5%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKA-P  360
            NEV+ A+A   NH+LNY++S +LKCA+ +GIPD+IH+HG+ M  S L++ALPI+ SK   
Sbjct  12   NEVLAAQAHILNHVLNYVNSMSLKCAIQLGIPDIIHSHGRAMTRSDLVNALPINKSKGHE  71

Query  361  YIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGY  540
             I+RL R L+H+   +          + E+ Y LTP  RL++  +E ++L  FV   +  
Sbjct  72   CIYRLMRILIHASFFI----------EGEDGYLLTPTSRLLL-KNEPLSLAPFVQAQLDP  120

Query  541  VYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLS  720
            +     +SLG+WF N D +PF TAHG+ ++DY   +   N +FNEAM  D+ LI+ AL+ 
Sbjct  121  ILMDPWHSLGEWFANGDSTPFATAHGKPLFDYAGDDPRLNRIFNEAMESDARLIMSALI-  179

Query  721  GESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGG  900
             ++ K VF+G+TSLVDV GG GTVA AI+  FP +KC+V DLPHV+       N+ ++ G
Sbjct  180  -KNGKRVFEGLTSLVDVGGGIGTVAKAISNAFPELKCSVFDLPHVVEGLEGGNNLSYITG  238

Query  901  DMFESIPTANAVLLK  945
            DMF+S+P+A+A+LLK
Sbjct  239  DMFKSVPSADAILLK  253



>gb|KHG15351.1| 8-hydroxyquercetin 8-O-methyltransferase [Gossypium arboreum]
Length=366

 Score =   228 bits (582),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 112/256 (44%), Positives = 169/256 (66%), Gaps = 11/256 (4%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALP-IHPSKAPY  363
            E +QA+A  W H  N++   +LKCA+D+GI D+IHNHGKPM ++ L+ AL  ++P+KA  
Sbjct  13   EALQAQAHIWRHAFNFVSFMSLKCALDLGILDIIHNHGKPMTITELVVALRMLNPTKACD  72

Query  364  IHRLTRFLVHSGLLLVTKPARDD--DDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIG  537
            I+R+ R LVHSG+      AR +  +D QEE Y LT + R+++ ++    +   +   + 
Sbjct  73   IYRIMRVLVHSGIF-----ARQNLFNDAQEEGYVLTNSSRMLLKNN-PFCITPTLKATMD  126

Query  538  YVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALL  717
             +  K    LG WF+ND+ +PF TA+G+ +WDYF+H+    DL N+ +A DS+L+   L+
Sbjct  127  PIITKPWSFLGTWFQNDEHTPFATAYGKTLWDYFTHDPQLKDLINDGLASDSQLVTNVLV  186

Query  718  SGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVG  897
              +  K+ F+G+ SLVDV GG GT A AIA  FP M+CTV DLPH++A     +N+++VG
Sbjct  187  --DKCKEAFEGLNSLVDVGGGTGTTAKAIADTFPHMECTVFDLPHIVAGLQGSKNLKYVG  244

Query  898  GDMFESIPTANAVLLK  945
            G+MFE+ PT +A+LLK
Sbjct  245  GNMFEAFPTGDAILLK  260



>ref|XP_006446725.1| hypothetical protein CICLE_v10015630mg [Citrus clementina]
 gb|ESR59965.1| hypothetical protein CICLE_v10015630mg [Citrus clementina]
Length=377

 Score =   229 bits (583),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 121/261 (46%), Positives = 165/261 (63%), Gaps = 13/261 (5%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            E+++A+AQ WN   +YI+S +LKCAV++GIPD+IH HG+PM LS + SAL I  +KA  I
Sbjct  20   ELLKAQAQVWNCAFSYINSMSLKCAVELGIPDVIHKHGQPMTLSQIASALDIQKNKAHCI  79

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
             RL R LVHSG     +  + D D+ E YYSLTPA RL++  DE +    F+ L    + 
Sbjct  80   QRLMRILVHSGFF--AQQNKIDKDESEVYYSLTPASRLLL-KDEPLRAAPFMFLITHPII  136

Query  547  QKSCYSLGDWFRNDDPSP---FCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALL  717
                  L  WF+NDDPS    F + HG+ IW   + E+ + ++F +AM  DS+ I   L+
Sbjct  137  TTPFNFLSSWFKNDDPSTPTVFESTHGKDIWGCLAQEAKFKNVFYDAMMTDSQFISSVLI  196

Query  718  SGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVI-----ACGSSIEN  882
              +  K VF G+  LVD+ GG GT+A AIA+ FP MKC V DLPHV+         + +N
Sbjct  197  --KDCKVVFKGLKCLVDLGGGTGTMAKAIAEAFPEMKCIVFDLPHVVDNNLQQQQGTNKN  254

Query  883  VEFVGGDMFESIPTANAVLLK  945
            +EF+GGDMFE+IP A+AVLLK
Sbjct  255  LEFLGGDMFEAIPPADAVLLK  275



>gb|AAR02419.1| flavonoid 4'-O-methyltransferase [Catharanthus roseus]
 gb|AAR02420.1| flavonoid 4'-O-methyltransferase [Catharanthus roseus]
Length=359

 Score =   228 bits (581),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 115/256 (45%), Positives = 162/256 (63%), Gaps = 6/256 (2%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNH-GKPMPLSHLISALPIHPSKAPY  363
            E  +A+A+ W+   ++ + A LKCAV +GI D I NH  K + LS L   L I PSK+P+
Sbjct  7    EFREAQAKIWSQAFSFANCAALKCAVKLGIADAIDNHDKKALTLSELTEELSIKPSKSPF  66

Query  364  IHRLTRFLVHSGLLLVTKPARDD--DDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIG  537
            + RL R LV++G     K  RDD  D +    Y+LTP  RL++ + E  NLR  V   + 
Sbjct  67   LQRLMRQLVNAGFFTEAKQLRDDNKDGRTTTAYALTPVSRLLLKN-EQWNLRGIVLTMLD  125

Query  538  YVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALL  717
                K+   L DWF+NDDP+ F TAH +  WDY +  + +  +F +AMA DS L+ + L+
Sbjct  126  PAELKAWSVLNDWFKNDDPTAFQTAHEKNYWDYTAENTQHCQIFEDAMANDSVLVSKLLV  185

Query  718  SGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVG  897
            +    K +F+G+TSL+D+ G  GT+A A+AK FP +KCTV DLPHV+A   S +N+EFVG
Sbjct  186  T--EYKFLFEGLTSLIDLGGSTGTIAKALAKSFPNLKCTVFDLPHVVANLESTKNLEFVG  243

Query  898  GDMFESIPTANAVLLK  945
            GDMFE +P +NA+LLK
Sbjct  244  GDMFEKLPPSNAILLK  259



>ref|XP_008779514.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Phoenix 
dactylifera]
Length=366

 Score =   228 bits (581),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 117/258 (45%), Positives = 164/258 (64%), Gaps = 9/258 (3%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPY  363
             E +Q  AQ WNH L+++ S +LKCA+++GIPD++HNHGKP+ L  L ++L I PSKAP 
Sbjct  14   KEQLQDTAQLWNHALSFVRSMSLKCAIELGIPDVLHNHGKPITLCELATSLSIPPSKAPA  73

Query  364  IHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYV  543
            +  L R LVHSGL       RD + ++EE Y LTPA +L++ ++++  L  F  + + + 
Sbjct  74   LGSLMRLLVHSGLF---ASHRDQEGEEEESYFLTPASKLLVKEEKAC-LSPFALIVLKWT  129

Query  544  YQKSCYSLGDWFRNDDP--SPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALL  717
                 + LG WFR   P  +PF  AHG+ +++     + +N+LFNE MA D+ L+ E  L
Sbjct  130  MLGPAHQLGAWFRAGAPRATPFDMAHGKGLFEETDARADFNELFNEGMASDARLVTEVAL  189

Query  718  SGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIAC--GSSIENVEF  891
              +   +V  GV S+VDV GG GT+A AIAK  P ++C VLDLPHV+A       E VEF
Sbjct  190  LRQQW-EVLRGVRSVVDVGGGTGTLAKAIAKALPGVRCAVLDLPHVVATVDEEEREGVEF  248

Query  892  VGGDMFESIPTANAVLLK  945
            +GGDMFE IP A+AVL K
Sbjct  249  IGGDMFEHIPPADAVLFK  266



>ref|XP_002517832.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44350.1| o-methyltransferase, putative [Ricinus communis]
Length=362

 Score =   228 bits (581),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 115/254 (45%), Positives = 166/254 (65%), Gaps = 6/254 (2%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPY  363
            +E+++A+   WNH  ++I S +LKCAV +GIPD+I++HG+PM LS L+  L +HP+K  +
Sbjct  10   DELIKAQTHIWNHTFHFIKSMSLKCAVQLGIPDIINSHGQPMTLSELVLTLQVHPTKTDH  69

Query  364  IHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYV  543
            ++RL R LVHSG   +   +   D+  +E Y LTPA RL++  D S + R F+ L +  V
Sbjct  70   LYRLMRVLVHSGFFNLQNAS---DNHSQEGYILTPASRLLL-KDCSFDTRPFISLALDPV  125

Query  544  YQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSG  723
              +    L  + RNDDP+ F TA G+ ++ Y  +E+  N LFNE MA DS +I  A++  
Sbjct  126  ATEPYNYLIPFLRNDDPTAFVTAFGETLFGYAGNEARINHLFNECMASDSSVIGRAVII-  184

Query  724  ESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGD  903
               K VF+GV SLVDV GG G +A AI + FP +KCTVLDLPHV+       N+ F+GGD
Sbjct  185  -KCKKVFEGVNSLVDVGGGTGNMAKAIGQTFPNLKCTVLDLPHVVDKLQGSNNLSFLGGD  243

Query  904  MFESIPTANAVLLK  945
            MF+++P A+A+LLK
Sbjct  244  MFQAVPPADAILLK  257



>ref|XP_006474725.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=365

 Score =   228 bits (580),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/258 (45%), Positives = 169/258 (66%), Gaps = 10/258 (4%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPY  363
            +E++Q++A  WN+I ++++S +LKCA+ +GIPD+IHNH KPM L+ L++AL IHP+K   
Sbjct  14   DELLQSQAHVWNNIFSFVNSMSLKCAIQLGIPDIIHNHAKPMTLNQLLTALQIHPTKTQC  73

Query  364  IHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYV  543
            ++RL R LVHSG   + K +   +++QEE Y LT A +L++  D  ++L  F+   +  +
Sbjct  74   VYRLMRILVHSGFFALQKTS---ENEQEEGYILTSASKLLL-KDHPLSLAPFLLAMLDPI  129

Query  544  YQKSCYSLGDWFRN----DDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEA  711
              K  + +  W +N    D  + F   HG   WDY   E+  N  FNE MA D+ L   A
Sbjct  130  LTKPWHQVSTWIQNDDDDDAATTFALPHGMNFWDYAVRETRLNHFFNEGMASDTRLTSSA  189

Query  712  LLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEF  891
            L+     KDVF+G+ +LVDV GG GT+ASAIAK FP ++CTV D PHV+A   S  N+++
Sbjct  190  LI--HKCKDVFEGLNTLVDVGGGTGTLASAIAKKFPHIECTVFDQPHVVADLKSNGNLKY  247

Query  892  VGGDMFESIPTANAVLLK  945
            VGG+MFE+IP A+AVL+K
Sbjct  248  VGGNMFEAIPPADAVLIK  265



>dbj|BAI79245.1| O-methyltransferase [Carapichea ipecacuanha]
Length=358

 Score =   228 bits (580),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 121/253 (48%), Positives = 163/253 (64%), Gaps = 13/253 (5%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            E+++A+      +  +  +A LKCAV +GIPD I  HGKPM LS L SAL I+PSKAP I
Sbjct  11   ELLRAQMHFSTQLFGFHYTAALKCAVKLGIPDAIKQHGKPMNLSELNSALSINPSKAPCI  70

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
            HRL R LV +G             ++ E +SLT AGR  + DD  +N+RA V L +    
Sbjct  71   HRLMRILVTAGYFA----------QENECFSLTSAGRHFLKDD-PLNIRALVLLELHPAL  119

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGE  726
             K   +LG+WF+NDD SPF TAHG+  WDY + +     LF+E+MA DS+LI +AL++  
Sbjct  120  VKPWIALGEWFQNDDVSPFATAHGKSFWDYVTSDPELRKLFDESMADDSQLIAKALVT--  177

Query  727  SSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDM  906
              + VF+G+ SLVDV GG GT+A AIAK FP +KCTV DLP  +A      N++FV GDM
Sbjct  178  EFRYVFEGLKSLVDVGGGSGTLARAIAKAFPNLKCTVCDLPDAVANEHGDGNLDFVAGDM  237

Query  907  FESIPTANAVLLK  945
            FE +P+A+++LLK
Sbjct  238  FERVPSADSILLK  250



>ref|XP_004235335.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
lycopersicum]
Length=445

 Score =   230 bits (586),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/255 (46%), Positives = 168/255 (66%), Gaps = 14/255 (5%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKA-P  360
            NEV+ A+A   NH+ NYI+S +LKCA+ +GIPD+IHNHG+ M  S L++ALPI+ SK   
Sbjct  104  NEVLAAQAHIANHVFNYINSMSLKCAIQLGIPDIIHNHGRAMTQSDLVNALPINKSKGHD  163

Query  361  YIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGY  540
             I+RL R L+H+G             + EE Y LTP  RL++  +E ++L  FV   +  
Sbjct  164  CIYRLMRILIHAGFF----------TQGEEGYLLTPTSRLLL-KNEPLSLAPFVQAQLDP  212

Query  541  VYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLS  720
            V     +SLG+WF N+D +PF TAHG+ +++Y   E   N+LFNEAM  D+ LI+  L+ 
Sbjct  213  VLMDPWHSLGEWFANEDSTPFATAHGKPLFEYAGDEQRLNNLFNEAMGCDARLIMSVLI-  271

Query  721  GESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGG  900
             ++ K VF+G+ SLVDV GG GTVA AI+  FP +KC+V DLPHV+      +N+ ++ G
Sbjct  272  -KNGKGVFEGLKSLVDVGGGIGTVAKAISNAFPELKCSVFDLPHVVEGLEGGKNLTYIAG  330

Query  901  DMFESIPTANAVLLK  945
            DMF+ +P+A+A+LLK
Sbjct  331  DMFKFVPSADAILLK  345



>ref|XP_010093978.1| Tabersonine 16-O-methyltransferase [Morus notabilis]
 gb|EXB54965.1| Tabersonine 16-O-methyltransferase [Morus notabilis]
Length=364

 Score =   227 bits (578),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 126/271 (46%), Positives = 167/271 (62%), Gaps = 17/271 (6%)
 Frame = +1

Query  160  EIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALP  339
            ++G   + NE++QA    WN  LN+I   +LKCAV++GIPD+I+NHG+P+ LS LIS+LP
Sbjct  2    DVGDEVSANELLQAHGLIWNCSLNFIKPMSLKCAVELGIPDIINNHGQPITLSKLISSLP  61

Query  340  IHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEY----YSLTPAGRLVIGDDESIN  507
            IH SKA  I+RL R LVHSG     K     D+ +EE     YSLT A RL++ D     
Sbjct  62   IHSSKAHCIYRLMRILVHSGFFATQKVDNKIDEGEEEEEEEAYSLTIASRLLLKDGPWRA  121

Query  508  LRAFV-----HLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFN  672
               F+     HL   + +      +  W +N DP+PF   HG+  WD    E     LF 
Sbjct  122  TPFFLVQLEPHLMTPWHF------VSTWLQNSDPTPFEMVHGKTFWDGVGDEPRLKYLFT  175

Query  673  EAMAKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPH  852
            EAMA DS+L+V+ ++  E  K VF+G+TSLVDV GG G VA AIAK FP + CTVLDLP+
Sbjct  176  EAMATDSQLMVKVIV--EECKQVFEGLTSLVDVGGGTGIVAKAIAKTFPNIMCTVLDLPY  233

Query  853  VIACGSSIENVEFVGGDMFESIPTANAVLLK  945
            V+A     +N+ F+ GDMF+ IP ANA+LLK
Sbjct  234  VVANSQGAKNLNFIAGDMFKEIPPANAILLK  264



>ref|XP_006366298.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=365

 Score =   227 bits (578),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/260 (43%), Positives = 165/260 (63%), Gaps = 7/260 (3%)
 Frame = +1

Query  178  NENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKA  357
            +E+E++ A+   WNHI ++I+S +LK A+ + IPD+IH HGKPM L+ L +AL I+ SK 
Sbjct  9    HESEILHAQTHIWNHIFSFINSMSLKSAIQLNIPDIIHKHGKPMTLNELANALSINKSKI  68

Query  358  PYIHRLTRFLVHSGLLL----VTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVH  525
             ++ RL R L+HSG  L    +          + E Y L P  RL++  DE + +  F+ 
Sbjct  69   THLRRLMRILIHSGFFLKFAMIPLEEGSSGSGEGEGYVLAPPARLLL-KDEPLTVTPFLL  127

Query  526  LCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIV  705
              +  +  K  + + +WF +D+P+PF  AHG+  WDY  HE   N  FN+AMA D++L++
Sbjct  128  AMLDPILVKPWHHVNEWFSSDEPTPFEVAHGRTFWDYAGHEQRLNHFFNDAMASDAKLVM  187

Query  706  EALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENV  885
              ++  + SKDVF+G+ S+VDV GG GTVA  IAK FP ++CTV DLPHV+      +N+
Sbjct  188  SVVM--KYSKDVFEGLNSIVDVGGGTGTVAKTIAKKFPNLQCTVFDLPHVVEGLEGSDNL  245

Query  886  EFVGGDMFESIPTANAVLLK  945
             +VGGD F S+P A+A+LLK
Sbjct  246  SYVGGDFFVSVPPADALLLK  265



>ref|XP_008229108.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=355

 Score =   226 bits (577),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 117/255 (46%), Positives = 163/255 (64%), Gaps = 9/255 (4%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPY  363
            +E+++A+A  WNHI ++++S +LKCAV + I D+I  HG+PM LS L+SALPI P+KA +
Sbjct  9    HELLKAQAHIWNHIFSFVNSMSLKCAVQLDIADVIQKHGQPMILSELVSALPISPTKAHF  68

Query  364  IHRLTRFLVHSGLLLVTKPARDD-DDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGY  540
            I RL R LVHSG       AR+      E+ Y LT A  L++ D+  ++ R F+   +  
Sbjct  69   IPRLMRILVHSGFF-----ARESLSGGGEQGYVLTDASALLLKDN-PMSARPFLLAMLNP  122

Query  541  VYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLS  720
            +       L  WF+ND+P+PF   HG   WDY + +      FN+AMA D++LI   ++ 
Sbjct  123  MLTDPWQYLTTWFQNDNPTPFHVVHGMTFWDYGNQDPTLAHFFNDAMASDAQLISSLMI-  181

Query  721  GESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGG  900
             +  K VF GV SLVDV GG GTVA +IA  FP MKCTVLDLPHV+A     +N+E+V G
Sbjct  182  -DDCKGVFQGVDSLVDVGGGTGTVAKSIADAFPHMKCTVLDLPHVVADLKGSKNLEYVAG  240

Query  901  DMFESIPTANAVLLK  945
            DMFE++P A+A+ LK
Sbjct  241  DMFEAVPEADAIFLK  255



>sp|Q8GSN1.1|MOMT_CATRO RecName: Full=Myricetin O-methyltransferase; AltName: Full=CrOMT2; 
AltName: Full=Flavonoid O-methyltransferase [Catharanthus 
roseus]
 gb|AAM97497.1| flavonoid O-methyltransferase [Catharanthus roseus]
Length=348

 Score =   226 bits (576),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 118/254 (46%), Positives = 164/254 (65%), Gaps = 13/254 (5%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPY  363
            +E+  A+A  +  + ++   ++LKCAV +GIPD IH+HGKPM LS L ++LPI+PSKAPY
Sbjct  6    SEIRNAQAHFFTQVFSFTSMSSLKCAVQLGIPDAIHSHGKPMALSDLTNSLPINPSKAPY  65

Query  364  IHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYV  543
            I+RL R LV +G            ++++  YSLTP  RL++ +D  +N  + V       
Sbjct  66   IYRLMRILVAAGYF---------SEEEKNVYSLTPFTRLLLKND-PLNSISMVLGVNQIA  115

Query  544  YQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSG  723
              K+  ++ +WF+N+D + F TAHG+  WD F  E  Y   F+  MA DS L+ + L+  
Sbjct  116  ELKAWNAMSEWFQNEDLTAFETAHGKNFWD-FGAEDKYGKNFDGVMAADSILVSKMLIP-  173

Query  724  ESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGD  903
                 +F+G+ SLVDV GG GT+A AIAK FP +KCTV DLPHV+A   S EN+EFVGGD
Sbjct  174  -EFNYLFEGLDSLVDVGGGTGTIAKAIAKSFPDLKCTVFDLPHVVANLESTENLEFVGGD  232

Query  904  MFESIPTANAVLLK  945
            MFE IP+ANA+LLK
Sbjct  233  MFEKIPSANAILLK  246



>ref|XP_006469063.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X1 [Citrus sinensis]
 ref|XP_006469064.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X2 [Citrus sinensis]
Length=378

 Score =   227 bits (578),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 121/261 (46%), Positives = 164/261 (63%), Gaps = 13/261 (5%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            E+++A+AQ WN   NYI+S +LKCAV++GIPD+IH HG+PM LS + SAL I  +KA  I
Sbjct  21   ELLKAQAQVWNCAFNYINSMSLKCAVELGIPDVIHKHGQPMTLSQIASALDIQKNKAHCI  80

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
             RL R LVHSG     +  + D D+ E YYSLT A RL++ D+ S     F+ L      
Sbjct  81   QRLMRILVHSGFF--AQQNKIDKDESEVYYSLTLASRLLLKDEPS-RAAPFMFLITHPTI  137

Query  547  QKSCYSLGDWFRNDDPSP---FCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALL  717
                  L  WF+NDDPS    F + HG+ IW   + E+ + ++F +AM  DS+ I   L+
Sbjct  138  TTPFNFLSSWFKNDDPSTPTVFESTHGKDIWGCLAQEAKFKNVFYDAMMADSQFISSVLI  197

Query  718  SGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVI-----ACGSSIEN  882
              +  K+VF G+  LVD+ GG GT+A AIA+ FP MKC V DLPHV+         + +N
Sbjct  198  --KDCKEVFKGLKCLVDLGGGTGTMAKAIAEAFPEMKCIVFDLPHVVDNNLQQQQGTNKN  255

Query  883  VEFVGGDMFESIPTANAVLLK  945
            +EF+GGDMFE+IP A+AVLLK
Sbjct  256  LEFLGGDMFEAIPPADAVLLK  276



>gb|AEN94899.1| desoxyhemigossypol-6-O-methyltransferase [Gossypium barbadense]
Length=365

 Score =   226 bits (577),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/254 (44%), Positives = 166/254 (65%), Gaps = 7/254 (3%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPI-HPSKAPY  363
            E +Q++A  W H  N++   +LKCA+D+GI D+IH+HGKPM ++ L++AL I +P+KA  
Sbjct  13   EALQSQAHIWRHAFNFVSFMSLKCALDLGILDIIHDHGKPMTITQLVAALQILNPTKACD  72

Query  364  IHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYV  543
            I+RL R LVHS      K    D+D QEE Y LT + R+++ ++    +   +   +  +
Sbjct  73   IYRLMRILVHSDFFARQKL---DNDAQEEGYVLTNSSRILLKNN-PFCITPTLKATMDPI  128

Query  544  YQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSG  723
              K    LG WF+NDD +PF TA+G+ +WDYF+H+    DL N+ +A DS+L+   L+  
Sbjct  129  ITKPWSFLGTWFQNDDHTPFATAYGKTLWDYFTHDPQLKDLINDGLASDSQLVTSVLV--  186

Query  724  ESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGD  903
            +  K  F+G+ SLVDV GG GT A AIA  FP M+CTV DLP+++A     +N+++VGG+
Sbjct  187  DKCKGAFEGLDSLVDVGGGTGTTAKAIADTFPLMECTVFDLPNIVAGLQGSKNLKYVGGN  246

Query  904  MFESIPTANAVLLK  945
            MFE+ PT +A+LLK
Sbjct  247  MFEAFPTGDAILLK  260



>ref|XP_002305103.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
 gb|EEE85614.1| 6a-hydroxymaackiain methyltransferase family protein [Populus 
trichocarpa]
Length=359

 Score =   226 bits (576),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 115/258 (45%), Positives = 162/258 (63%), Gaps = 5/258 (2%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            E+ QA     + + NYI+S +L CA  +GIPD+IHNHG+P+ L HL+SAL I P+K   I
Sbjct  12   ELFQAHTHLHSQMFNYINSMSLMCAAQLGIPDIIHNHGRPITLPHLVSALHIAPNKTSII  71

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
            +RL R LVHSG    TK A    + +EE Y LTP  +L++ D+ +  L  F+ L I   +
Sbjct  72   YRLMRMLVHSGFFATTKAANGQGEGEEEAYVLTPPSQLLVKDNTNC-LSPFMSL-INPAF  129

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGE  726
                 SLGDWFR ++P+ F  A+G   W+Y +     N LFNEAMA DS+++    L   
Sbjct  130  VTPWLSLGDWFRGNEPTAFEHAYGMAFWEYHNQNPELNRLFNEAMACDSQMMN---LVIR  186

Query  727  SSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDM  906
              K +F+G+ S+VDV GG G+++  I++ FP M CTVL+LP VI      +N+ +VGGDM
Sbjct  187  DCKPIFEGLNSMVDVGGGTGSLSRIISEAFPHMNCTVLELPQVITNLEGTKNLNYVGGDM  246

Query  907  FESIPTANAVLLKVYIVG  960
            F+ IP+A+AVLLK+   G
Sbjct  247  FQHIPSADAVLLKLIFHG  264



>gb|KDP24062.1| hypothetical protein JCGZ_25719 [Jatropha curcas]
Length=358

 Score =   226 bits (576),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 114/258 (44%), Positives = 165/258 (64%), Gaps = 12/258 (5%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPY  363
            NE+++A A  WNH  N++ S +LKCA+++GIPD+IH+HG+PM LS L+SAL I  SK+ +
Sbjct  10   NELLRAHAHIWNHTFNFVKSMSLKCAIELGIPDIIHSHGQPMTLSDLVSALKIPQSKSHH  69

Query  364  IHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYV  543
            IHRL + LV SG   + K +       E  Y LT +  L++  +  +  R +V   +  +
Sbjct  70   IHRLMQVLVQSGFFSLQKVS------DENGYLLTQSSLLLV-KEHPVTARPYVLAVLDPI  122

Query  544  YQKSCYSLGDWFRNDD---PSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEAL  714
              K  + L  WF+N D    +PF  AH QK WD  S+E  +N  FNEAMA DS ++ + +
Sbjct  123  LTKPWHFLSSWFQNTDDKETTPFSVAHEQKFWDLASNEDRFNKFFNEAMASDSSIVKQVV  182

Query  715  LSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFV  894
            +S  + K+VF G+ SLVDV G  G +  AIA+ FP +KCTVLDLPHV+A     +N+ ++
Sbjct  183  IS--NCKEVFKGLKSLVDVGGNTGAMTKAIAETFPNLKCTVLDLPHVVAGLKGTKNLNYI  240

Query  895  GGDMFESIPTANAVLLKV  948
            GG+MFE IP A+A+LLK+
Sbjct  241  GGNMFEFIPPADAILLKM  258



>ref|XP_004169299.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like, partial 
[Cucumis sativus]
Length=304

 Score =   224 bits (571),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 115/256 (45%), Positives = 165/256 (64%), Gaps = 15/256 (6%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHG-KPMPLSHLISALPIHPSKAP  360
            +E+++A  Q   HI N+I+S +LKCA+ +GIPD IH+HG  P+PLS L+S+L +HP+K  
Sbjct  14   DELMEAHGQICKHIFNFINSMSLKCAIQLGIPDAIHSHGPSPLPLSRLVSSLQLHPNKTQ  73

Query  361  YIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGY  540
            +I+RL R L HSG  ++          QEE Y LT +  L++ D+ S  L  F+   +  
Sbjct  74   FIYRLMRLLTHSGFFVL----------QEEGYVLTTSSHLLLKDN-SCTLSPFLLSMLQP  122

Query  541  VYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLS  720
            V+ +  + L  WFR DD +PF TAHG+  W++  ++    D FN  MA D+ L++  L+ 
Sbjct  123  VFVEPSHFLSAWFRTDDQTPFETAHGKSFWEFVGNKRKDGDTFNAGMASDARLVMSVLMG  182

Query  721  GESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA-CGSSIENVEFVG  897
              +S  VF+GV SLVDV GG GT+A AIAK FP ++CTVLDLP V+A     I N ++V 
Sbjct  183  KHTS--VFEGVESLVDVGGGTGTMAKAIAKAFPQIECTVLDLPQVVAELKPDIPNFKYVE  240

Query  898  GDMFESIPTANAVLLK  945
            GDMF++IP A+A+LLK
Sbjct  241  GDMFDAIPPADALLLK  256



>ref|XP_008229106.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Prunus 
mume]
Length=391

 Score =   227 bits (578),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 122/282 (43%), Positives = 169/282 (60%), Gaps = 31/282 (11%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPY  363
            +E++QA+A  WNHI  +I+S +LKCAV +GIPD+IH+HG+P+ LS+LIS L +HPSKA +
Sbjct  11   HELLQAQAHVWNHIFQFINSMSLKCAVQLGIPDVIHSHGQPISLSNLISGLNVHPSKAHF  70

Query  364  IHRLTRFLVHSGLLLVTKPA-----------------RDDDDKQEE----YYSLTPAGRL  480
            I RL R LVHS      +                   +D DD++EE     Y LTPA RL
Sbjct  71   IARLMRILVHSNFFAQDQQVQLPLLPNDNNNNENIVHQDLDDEEEEKTVVVYRLTPASRL  130

Query  481  VIGDDESINLRAFVHLCIGYVYQKSCYSLGDWFR------NDDP-SPFCTAHGQKIWDYF  639
            ++  +  ++   F+ + +  V     + +G W +       D P SPF  AHG+  W   
Sbjct  131  LL-KESPLSTTQFLLMILDPVVTDPFHLMGTWCQMNNHGNQDHPASPFEMAHGRPFWGLA  189

Query  640  SHESGYNDLFNEAMAKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFP  819
            + +  +  LFNEAM  DS+L+  A++  E  + VF+G+ SLVDV GG GT+A AIAK FP
Sbjct  190  AQQPKFGSLFNEAMEADSQLLARAVV--EECEGVFEGLNSLVDVGGGTGTMAKAIAKAFP  247

Query  820  AMKCTVLDLPHVIACGSSIENVEFVGGDMFESIPTANAVLLK  945
             + CTV D PHV+A      N++FVGGDMFE IP ANA+ LK
Sbjct  248  NINCTVFDQPHVVANLQGTHNLDFVGGDMFEKIPPANAIFLK  289



>ref|XP_004151088.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Cucumis 
sativus]
Length=305

 Score =   224 bits (571),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 115/256 (45%), Positives = 165/256 (64%), Gaps = 15/256 (6%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHG-KPMPLSHLISALPIHPSKAP  360
            +E+++A  Q   HI N+I+S +LKCA+ +GIPD IH+HG  P+PLS L+S+L +HP+K  
Sbjct  7    DELMEAHGQICKHIFNFINSMSLKCAIQLGIPDAIHSHGPSPLPLSRLVSSLQLHPNKTQ  66

Query  361  YIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGY  540
            +I+RL R L HSG  ++          QEE Y LT +  L++ D+ S  L  F+   +  
Sbjct  67   FIYRLMRLLTHSGFFVL----------QEEGYVLTTSSHLLLKDN-SCTLSPFLLSMLQP  115

Query  541  VYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLS  720
            V+ +  + L  WFR DD +PF TAHG+  W++  ++    D FN  MA D+ L++  L+ 
Sbjct  116  VFVEPSHFLSAWFRTDDQTPFETAHGKSFWEFVGNKRKDGDTFNAGMASDARLVMSVLMG  175

Query  721  GESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIA-CGSSIENVEFVG  897
              +S  VF+GV SLVDV GG GT+A AIAK FP ++CTVLDLP V+A     I N ++V 
Sbjct  176  KHTS--VFEGVESLVDVGGGTGTMAKAIAKAFPQIECTVLDLPQVVAELKPDIPNFKYVE  233

Query  898  GDMFESIPTANAVLLK  945
            GDMF++IP A+A+LLK
Sbjct  234  GDMFDAIPPADALLLK  249



>emb|CAA11131.1| O-methyltransferase [Prunus dulcis]
Length=356

 Score =   226 bits (575),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 117/252 (46%), Positives = 159/252 (63%), Gaps = 6/252 (2%)
 Frame = +1

Query  190  VVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYIH  369
            ++QA+A  WN I ++I+  +LKCAV +GIPD+I  HG PM LS LISALPIHP K+  ++
Sbjct  12   LLQAQAHIWNCIFSFINPMSLKCAVQLGIPDIIKKHGNPMSLSDLISALPIHPKKSNCVY  71

Query  370  RLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVYQ  549
            RL R LVHSG     K +  D   +EE Y LT A RL++ DD  ++ R F+   +     
Sbjct  72   RLMRILVHSGFFCRQKLSELD---EEEGYVLTDASRLLLKDD-PLSARPFLLGALDPFMT  127

Query  550  KSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGES  729
            K  +    WF+NDDP+   TAHG   WD+   E   + +FN+AMA D+ LI + +     
Sbjct  128  KPWHYFSTWFQNDDPTACVTAHGTTFWDFGCLEPSLSHIFNDAMASDARLISKVV--SNE  185

Query  730  SKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDMF  909
             K VF+G+ SLVDV GG GT+  AIA  FP ++C V DLPHV+A     EN++F GGDMF
Sbjct  186  YKGVFEGLESLVDVGGGIGTMPKAIADVFPHVECIVFDLPHVVADLKGSENLKFFGGDMF  245

Query  910  ESIPTANAVLLK  945
            E+IP  +A+L+K
Sbjct  246  EAIPPTDAILMK  257



>dbj|BAJ05388.1| O-methyltransferase [Carapichea ipecacuanha]
Length=358

 Score =   226 bits (575),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 120/253 (47%), Positives = 163/253 (64%), Gaps = 13/253 (5%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            E+++A+      +  +  +A LKCAV +GIPD I  HGKPM LS L SAL I+PSKAP I
Sbjct  11   ELLRAQMHFSTQLFGFHYTAALKCAVKLGIPDAIKQHGKPMNLSELNSALSINPSKAPCI  70

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
            HRL R LV +G             ++ E +SLT AGR  + DD  +N+RA V L +    
Sbjct  71   HRLMRILVTAGYFA----------QENECFSLTSAGRHFLKDD-PLNIRALVLLELHPAL  119

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGE  726
             K   +LG+WF+NDD SPF TAHG+  WD+ + +     LF+E+MA DS+LI +AL++  
Sbjct  120  VKPWIALGEWFQNDDVSPFATAHGKSFWDHVTSDPELRKLFDESMADDSQLIAKALVT--  177

Query  727  SSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDM  906
              + VF+G+ SLVDV GG GT+A AIAK FP +KCTV DLP  +A      N++FV GDM
Sbjct  178  EFRYVFEGLKSLVDVGGGSGTLARAIAKAFPNLKCTVCDLPDAVANEHGDGNLDFVAGDM  237

Query  907  FESIPTANAVLLK  945
            FE +P+A+++LLK
Sbjct  238  FERVPSADSILLK  250



>ref|XP_009594948.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=359

 Score =   225 bits (574),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 113/254 (44%), Positives = 167/254 (66%), Gaps = 8/254 (3%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAP-Y  363
            E++ A+A   NH+ NYI+  +LKCA+ + IPD+IHNHGKPM LS+L++ALPI+ +K    
Sbjct  13   EILAAQAHIANHVFNYINFVSLKCAIQLEIPDIIHNHGKPMTLSNLVNALPINKAKGQDC  72

Query  364  IHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYV  543
            I+RL R L+HSG  + TK     ++ +EE Y LTP   L++  +E ++L  FV   +  +
Sbjct  73   IYRLMRILIHSGFFIQTKI----NENEEEGYLLTPNSHLLL-KNEPLSLAPFVLAQLDPI  127

Query  544  YQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSG  723
                  SL  W +N D +PF TAHG+ +++Y   E   N LFNEAMA D+ L++  ++  
Sbjct  128  LMDPFQSLSKWLQNSDSTPFATAHGKPLFEYAGDEPRLNYLFNEAMASDARLMISVVI--  185

Query  724  ESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGD  903
            ++ + +F+G+ SL DV GG GTVA AI+  FP +KCTV DLPHV+        + +VGGD
Sbjct  186  KNGRGIFEGLKSLADVGGGIGTVAKAISNAFPEIKCTVFDLPHVVEGLEGSNKLSYVGGD  245

Query  904  MFESIPTANAVLLK  945
            MF+S+P+A+A+LLK
Sbjct  246  MFKSVPSADAILLK  259



>ref|XP_002451961.1| hypothetical protein SORBIDRAFT_04g011090 [Sorghum bicolor]
 gb|EES04937.1| hypothetical protein SORBIDRAFT_04g011090 [Sorghum bicolor]
Length=315

 Score =   224 bits (570),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 113/258 (44%), Positives = 163/258 (63%), Gaps = 10/258 (4%)
 Frame = +1

Query  178  NENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKA  357
            +E  V+ A+ Q W+H + Y+ S  LK A+D+ IP+ IH HG    L  +++ + +HPSK 
Sbjct  12   DEQAVLDAQLQLWHHTVGYVKSMALKAALDLNIPNAIHLHGGSATLPQIVTKVTLHPSKI  71

Query  358  PYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIG  537
            P + RL R L  +G+  V     D D   E  Y LTPA RL+IG    +NL   + L +G
Sbjct  72   PCLRRLMRVLTFTGVFSV----HDGDGGDEPVYGLTPASRLLIG--SGMNLTPLLTLMLG  125

Query  538  YVYQKSCYSLGDWFRND--DPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEA  711
             V+  S   +G+WFR++   PSPF  A+G+ IWD  +H++G+  LF++ M  DS+ I++ 
Sbjct  126  AVFVSSFLDIGEWFRHEMPGPSPFEMANGRDIWDLCNHDAGFGKLFDDGMVADSDFIMDV  185

Query  712  LLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEF  891
            ++  +   DVF G++SLVDVAGG G  A  IAK FP ++C+VLDL HVIA   +  NV++
Sbjct  186  VV--KECSDVFQGISSLVDVAGGHGGAAQTIAKAFPHVECSVLDLSHVIASAPTNTNVKY  243

Query  892  VGGDMFESIPTANAVLLK  945
            + GDMFESIP+ANAV LK
Sbjct  244  IAGDMFESIPSANAVFLK  261



>ref|XP_006469136.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=375

 Score =   226 bits (575),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 120/261 (46%), Positives = 163/261 (62%), Gaps = 13/261 (5%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            E+++A+AQ WN   NY +S +LKCAV++GIPD+IH HG+PM LS + SAL I  +KA  I
Sbjct  18   ELLKAQAQVWNCAFNYTNSMSLKCAVELGIPDVIHKHGQPMTLSQIASALDIQKNKAHCI  77

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
             RL R LVHSG     +  + D D+ E YYSLTPA RL++  DE +    F+ L      
Sbjct  78   QRLMRILVHSGFF--AQQNKIDKDESEVYYSLTPASRLLL-KDEPLRAAPFMFLITHPTV  134

Query  547  QKSCYSLGDWFRNDDPSP---FCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALL  717
                  L  WF+NDDPS    F + HG+ IW   + E+ + ++F +AM  DS+ I   L+
Sbjct  135  TTPFNFLSSWFKNDDPSTPTVFESTHGKDIWGCLAQEAKFKNVFYDAMMADSQFISSVLI  194

Query  718  SGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVI-----ACGSSIEN  882
              +  K+VF G+  LVD+ GG GT+A AIA+ FP MKC V  LPHV+         + +N
Sbjct  195  --KDCKEVFKGLKCLVDLGGGTGTMAKAIAEAFPEMKCIVFYLPHVVDNNLQKQQGTNKN  252

Query  883  VEFVGGDMFESIPTANAVLLK  945
            +EF+GGDMFE+IP A+AVLLK
Sbjct  253  LEFLGGDMFEAIPPADAVLLK  273



>ref|XP_010320673.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X2 [Solanum lycopersicum]
Length=339

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 118/256 (46%), Positives = 166/256 (65%), Gaps = 16/256 (6%)
 Frame = +1

Query  190  VVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPI-HPSKAPYI  366
            ++ A+AQ WN+I N+I S+ ++CA  +GIPD+++ H KPM LS + + L + + SK  ++
Sbjct  11   LLHAQAQIWNYIFNFISSSAVRCAFQLGIPDVLYKHDKPMCLSDISAELSVVNSSKVSFL  70

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
              L +FLV SG L          ++ E++YSLTPA  L+  DD   N+R+ + L  G  +
Sbjct  71   PILMQFLVQSGFL----------NQHEDHYSLTPASCLLAKDD-PFNVRSLLLLNHGQAF  119

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHE--SGYNDLFNEAMAKDSELIVEALLS  720
             K+   L DWF+ND P+PF TAHG+ +WD+   E  S   D+FN+A+A DS L    L++
Sbjct  120  SKAWPELSDWFQNDSPTPFHTAHGKSLWDFIGEEQPSVLGDIFNDALASDSRLNTNVLIA  179

Query  721  GESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGG  900
                K VF+G+TSLVDV GG GTV+ AIAK FP +KCTVLDLP V+       N++FVGG
Sbjct  180  --ECKHVFEGLTSLVDVGGGTGTVSIAIAKAFPNIKCTVLDLPQVVGDLKGSGNLDFVGG  237

Query  901  DMFESIPTANAVLLKV  948
            DMF+ IP  NA+LLKV
Sbjct  238  DMFDMIPHTNAILLKV  253



>gb|KHN08844.1| 8-hydroxyquercetin 8-O-methyltransferase [Glycine soja]
Length=329

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/233 (47%), Positives = 155/233 (67%), Gaps = 5/233 (2%)
 Frame = +1

Query  247  TLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPAR  426
            +LKC VD+GIPD+IHN+G+PMPLS+LI++LPIHPSK  ++HRL R ++HSG    ++   
Sbjct  2    SLKCVVDLGIPDIIHNYGQPMPLSNLIASLPIHPSKTCFVHRLMRIMIHSGFF--SQQNH  59

Query  427  DDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFC  606
            D +++ E  Y LT A  L++  +  +++  F+H  +  V          WF+N DP+PF 
Sbjct  60   DLENELEAKYVLTDASVLLL-KNHPMSVTPFLHAMLDPVLTNPWNQFSTWFKNGDPTPFE  118

Query  607  TAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKG  786
            TAHG  +WDY   +   N LFN+AMA D+  +   ++  E  K VF G+ SLVDV GG G
Sbjct  119  TAHGMMLWDYAGADPKLNHLFNDAMASDARFVTSLVI--EKCKGVFMGLESLVDVGGGTG  176

Query  787  TVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDMFESIPTANAVLLK  945
            T+A AIAK FP ++C V DLPHV++     EN+++V GDMFE+IP A+A+LLK
Sbjct  177  TMAKAIAKSFPRVECIVFDLPHVVSGLKGSENLKYVAGDMFEAIPPADAILLK  229



>ref|XP_011001214.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=373

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/260 (44%), Positives = 163/260 (63%), Gaps = 5/260 (2%)
 Frame = +1

Query  181  ENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAP  360
            E E+ QA+   +  + NY++S +L CA  +GIPD+IHNHG P+ L  L+SAL I P+K  
Sbjct  24   ETELFQAQTHLYGQMFNYLNSMSLVCAAQLGIPDIIHNHGSPITLPELVSALHIPPNKTS  83

Query  361  YIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGY  540
             I+RL R LVHSG    T+ A    + +EE Y LTP  +L++ D+ +  L  F+ L I  
Sbjct  84   CIYRLMRMLVHSGFFATTRAANGQGEGEEEAYVLTPPSQLLVKDNTNC-LSPFMSL-INP  141

Query  541  VYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLS  720
             +    +SLGDWFR  +P+ F  A+G   W+Y +     N LFN AMA DS+++    L 
Sbjct  142  AFVTPWHSLGDWFRGSEPTAFQQAYGMAFWEYNNQNPELNCLFNAAMACDSQMMN---LV  198

Query  721  GESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGG  900
                K +F+G+ S+VDV GG G++A  I++ FP MKCTVL+ P VIA     EN+++VGG
Sbjct  199  IRDCKPIFEGLDSMVDVGGGTGSLARIISETFPHMKCTVLETPQVIANLEGTENLKYVGG  258

Query  901  DMFESIPTANAVLLKVYIVG  960
            DMF+ IP+A+AVLLK+   G
Sbjct  259  DMFQHIPSADAVLLKLIFHG  278



>ref|XP_004241914.1| PREDICTED: myricetin O-methyltransferase-like [Solanum lycopersicum]
Length=355

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 124/256 (48%), Positives = 166/256 (65%), Gaps = 14/256 (5%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKP-MPLSHLISALP-IHPSKA  357
            NE+++AEA +W++IL Y+    ++CA+ +GIPD++H    P M LS LI+ALP ++PSK 
Sbjct  11   NELIEAEALSWDYILTYLRPPCIRCAIQLGIPDILHKSAHPIMSLSDLIAALPNVNPSKT  70

Query  358  PYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIG  537
             +I  L R LV  GL        +   +Q + YSLT  GRL +  D S N R+     I 
Sbjct  71   TFIPILMRVLVDLGLF-------NYHPQQGDGYSLTSVGRLFVESDPS-NKRSIFTFLIQ  122

Query  538  YVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALL  717
            +   +   S+ DW RND P+ F TAHG+ IWDY S ES Y+ +FN+AMA DS+LI   L+
Sbjct  123  F---EIVDSMSDWLRNDLPTAFETAHGKSIWDYCSGESEYSGVFNDAMASDSKLISNLLI  179

Query  718  SGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVG  897
            S +    VF+G+TSLVDV GG GTVA AIA  FP++KCTVLDLPH I      +N+EFV 
Sbjct  180  S-DCCSGVFEGLTSLVDVGGGTGTVAMAIAGAFPSLKCTVLDLPHAIGDRKGTQNLEFVA  238

Query  898  GDMFESIPTANAVLLK  945
            G+MF+ IP ANA+LLK
Sbjct  239  GNMFDKIPHANAILLK  254



>gb|ACV65500.1| deoxyhemigossypol-6-O-methyltransferase [Gossypium hirsutum]
Length=365

 Score =   224 bits (571),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 111/254 (44%), Positives = 163/254 (64%), Gaps = 7/254 (3%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALP-IHPSKAPY  363
            E +QA A  W H  N++   +LKCA+D+GI D+IH+HGKPM ++ L+ AL  ++P+KA  
Sbjct  13   EALQAHAHIWRHAFNFVSFMSLKCALDLGILDIIHDHGKPMTITQLVGALQMLNPTKACD  72

Query  364  IHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYV  543
            I+RL   LVHS      K    D+D QEE Y LT + R+++ ++    +   +   +  +
Sbjct  73   IYRLMHILVHSDFFARQKL---DNDAQEEGYVLTNSSRILLKNN-PFCITPTLKATMDPI  128

Query  544  YQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSG  723
              K    LG WF+NDD +PF TA+G+ +WDYF+H+    DL N+ +A DS+L+   L+  
Sbjct  129  ITKPWSFLGTWFQNDDHTPFATAYGKTLWDYFTHDPQLKDLINDGLASDSQLVTSVLV--  186

Query  724  ESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGD  903
            +  K  F+G+ SLVDV GG GT A AIA  FP M+CTV DLPH++A     +N+++VGG+
Sbjct  187  DKCKGAFEGLESLVDVGGGTGTTAKAIADTFPHMECTVFDLPHIVAGLQGSKNLKYVGGN  246

Query  904  MFESIPTANAVLLK  945
            MFE+ PT +A+LLK
Sbjct  247  MFEAFPTGDAILLK  260



>ref|XP_010320677.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like isoform 
X3 [Solanum lycopersicum]
Length=336

 Score =   223 bits (568),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 117/255 (46%), Positives = 165/255 (65%), Gaps = 16/255 (6%)
 Frame = +1

Query  190  VVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPI-HPSKAPYI  366
            ++ A+AQ WN+I N+I S+ ++CA  +GIPD+++ H KPM LS + + L + + SK  ++
Sbjct  11   LLHAQAQIWNYIFNFISSSAVRCAFQLGIPDVLYKHDKPMCLSDISAELSVVNSSKVSFL  70

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
              L +FLV SG L          ++ E++YSLTPA  L+  DD   N+R+ + L  G  +
Sbjct  71   PILMQFLVQSGFL----------NQHEDHYSLTPASCLLAKDD-PFNVRSLLLLNHGQAF  119

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHE--SGYNDLFNEAMAKDSELIVEALLS  720
             K+   L DWF+ND P+PF TAHG+ +WD+   E  S   D+FN+A+A DS L    L++
Sbjct  120  SKAWPELSDWFQNDSPTPFHTAHGKSLWDFIGEEQPSVLGDIFNDALASDSRLNTNVLIA  179

Query  721  GESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGG  900
                K VF+G+TSLVDV GG GTV+ AIAK FP +KCTVLDLP V+       N++FVGG
Sbjct  180  --ECKHVFEGLTSLVDVGGGTGTVSIAIAKAFPNIKCTVLDLPQVVGDLKGSGNLDFVGG  237

Query  901  DMFESIPTANAVLLK  945
            DMF+ IP  NA+LLK
Sbjct  238  DMFDMIPHTNAILLK  252



>ref|XP_011027757.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Populus 
euphratica]
Length=359

 Score =   224 bits (570),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 113/258 (44%), Positives = 162/258 (63%), Gaps = 5/258 (2%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYI  366
            E+ QA     + + NYI+S +L CA  +GIPD+IH+HG+P+ L HL+SAL I P+K   I
Sbjct  12   ELFQAHTHLHSQMFNYINSMSLMCAAQLGIPDIIHDHGRPITLPHLVSALHIAPNKTSII  71

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
            +RL R LVHSG    T+ A    + +EE Y LTP  +L++ D+ +  L  F+ L I   +
Sbjct  72   YRLMRMLVHSGFFATTRAANGQGEGEEEAYVLTPPSQLLVKDNTNC-LSPFMSL-INPAF  129

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGE  726
                 SLGDWFR ++P+ F  A+G   W+Y +     N LFNEAMA DS+++    L   
Sbjct  130  VTPWLSLGDWFRGNEPTAFEQAYGMAFWEYHNQNPELNRLFNEAMACDSQMMN---LVIR  186

Query  727  SSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDM  906
              K +F+G+ S+VDV GG G+++  I++ FP M CTVL+LP VI      +N+ +VGGDM
Sbjct  187  DCKPIFEGLNSMVDVGGGTGSLSRIISEAFPHMNCTVLELPQVITNLEGTKNLNYVGGDM  246

Query  907  FESIPTANAVLLKVYIVG  960
            F+ IP+A+AVLLK+   G
Sbjct  247  FQHIPSADAVLLKLIFHG  264



>gb|KDP35397.1| hypothetical protein JCGZ_10381 [Jatropha curcas]
Length=355

 Score =   223 bits (569),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 113/258 (44%), Positives = 166/258 (64%), Gaps = 15/258 (6%)
 Frame = +1

Query  178  NENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKA  357
            N +E+++A+   WNH L +I S +LKCAV++GIPD+I+NH +PMPLS L+SAL ++P+K 
Sbjct  8    NVDELLKAQTHMWNHTLQFIKSMSLKCAVELGIPDIINNHDQPMPLSDLVSALQVNPAKT  67

Query  358  PYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIG  537
             +++RL RFLVHSG   +          QEE Y LTP  R ++  D S+    F+ L + 
Sbjct  68   HHVYRLMRFLVHSGFFSL----------QEEGYLLTPFSRFLL-KDTSVGSIPFISLFLD  116

Query  538  YVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALL  717
             +       L  W +NDD +PF TA G+ +++Y  H+   N++ NE  A DS  I    +
Sbjct  117  PIMMDPFNCLSRWLKNDDQTPFVTAFGKSLYEYAGHDIRANNMVNEVTACDS--IFLGQV  174

Query  718  SGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSS--IENVEF  891
            +    K+VF G+ SLVDVAGG G ++ +IA  FP++KCT+LDLPHV+A   S   +N+ F
Sbjct  175  TTLKCKEVFKGLNSLVDVAGGTGNMSKSIANAFPSIKCTILDLPHVVAVVDSQGAKNLNF  234

Query  892  VGGDMFESIPTANAVLLK  945
            V GDMF+++P A+AVL+K
Sbjct  235  VAGDMFQAVPPADAVLIK  252



>ref|XP_007025515.1| Flavonoid o-methyltransferase related, putative [Theobroma cacao]
 gb|EOY28137.1| Flavonoid o-methyltransferase related, putative [Theobroma cacao]
Length=380

 Score =   224 bits (571),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 114/251 (45%), Positives = 164/251 (65%), Gaps = 8/251 (3%)
 Frame = +1

Query  196  QAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPYIHRL  375
            QA+A  + H+ NYI S +LKCAV +GIPD++H+HG+ + LS L+SAL IHP+K   ++RL
Sbjct  37   QAQAHLYKHMFNYIGSMSLKCAVQLGIPDIVHSHGESIALSELVSALQIHPAKTNCVYRL  96

Query  376  TRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESIN-LRAFVHLCIGYVYQK  552
             R LVHSG    TK    + D++EE Y LTP+ +L++ D   IN L  FV   +  +   
Sbjct  97   MRMLVHSGFFGTTKV--HEHDQKEEAYVLTPSSKLLLTD--KINCLSPFVLEVLDPISVN  152

Query  553  SCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALLSGESS  732
              + LGDW + D  + F  AH    WDY      + DLF+EAMA+DS+++    L  +  
Sbjct  153  PFHFLGDWIKGDKNTAFEIAHSLSFWDYVDQNLEFKDLFHEAMARDSQMMN---LVIKDY  209

Query  733  KDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGGDMFE  912
            K +F+G++SLVDV GG+G +A  I+K +P +KCTVLDLPHV+A     EN+ F+GGDMF+
Sbjct  210  KLIFEGLSSLVDVGGGRGCIAKIISKAYPHLKCTVLDLPHVVANLPESENLNFIGGDMFQ  269

Query  913  SIPTANAVLLK  945
             IP+ +A+L+K
Sbjct  270  YIPSTDAILMK  280



>ref|XP_006469138.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Citrus 
sinensis]
Length=551

 Score =   229 bits (583),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 124/273 (45%), Positives = 172/273 (63%), Gaps = 20/273 (7%)
 Frame = +1

Query  154  MGEIGK--------LCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPM  309
            +GE+GK          + +E+++A+AQ WN   NY++S +LKCAV++ I D+IH+HG+P 
Sbjct  190  VGELGKGNMNNGENAASSSELLKAQAQVWNCTFNYVNSMSLKCAVELDIADIIHSHGQPT  249

Query  310  PLSHLISALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIG  489
             LS + SAL I P+K   I  + R LVHSG     K   DDD+     Y LTPA RL++ 
Sbjct  250  TLSQIASALNIKPNKVQCIQSVMRILVHSGFFAQQK---DDDE-----YFLTPASRLLL-  300

Query  490  DDESINLRAFVHLCIGYVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLF  669
             D  +    FV L    +Y  + + LG W +NDDP+ F TAHG+  WD  + E  +  LF
Sbjct  301  KDTPLKAAPFVDLVADPLYTTAFHYLGTWLQNDDPTLFETAHGKNFWDRVADEPKFKSLF  360

Query  670  NEAMAKDSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLP  849
             + M  DSELI   ++  +  K+VF+G+ SLVDVAGG GT+A AIA  FP +KCTV DLP
Sbjct  361  YDLMITDSELIARIVI--KDCKEVFEGLKSLVDVAGGTGTMARAIAAAFPDIKCTVFDLP  418

Query  850  HVI-ACGSSIENVEFVGGDMFESIPTANAVLLK  945
            HV+     + +N++F+GG+MFE+IP ANAVLLK
Sbjct  419  HVVDNLQGTNDNLDFLGGNMFEAIPQANAVLLK  451



>gb|KDO73905.1| hypothetical protein CISIN_1g017835mg [Citrus sinensis]
Length=365

 Score =   223 bits (569),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 113/258 (44%), Positives = 167/258 (65%), Gaps = 10/258 (4%)
 Frame = +1

Query  184  NEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKAPY  363
            +E++Q++A  WN+I ++++S +LKCA+ +GIPD+IHNH KPM L+ L++ L IHP+K   
Sbjct  14   DELLQSQAHVWNNIFSFVNSMSLKCAIQLGIPDIIHNHAKPMTLNQLLTTLQIHPTKTQC  73

Query  364  IHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYV  543
            ++ L R LVHSG   + K +   +++QEE Y LT A +L++  D  ++L  F+   +  +
Sbjct  74   VYHLMRILVHSGFFALQKTS---ENEQEEGYILTSASKLLL-KDHPLSLAPFLLAMLDPI  129

Query  544  YQKSCYSLGDWFRN----DDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEA  711
              K  + +  W +N    D  + F   HG   WDY   E+  N  FNE MA D+ L   A
Sbjct  130  LTKPWHQVSTWIQNDDDDDAATTFALPHGMNFWDYAVRETRLNHFFNEGMASDTRLTSSA  189

Query  712  LLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEF  891
            L+     KDVF+G+ +LVDV GG GT+ASAIAK FP ++CTV D PHV+A   S  N+++
Sbjct  190  LI--HKCKDVFEGLNTLVDVGGGTGTLASAIAKKFPHIECTVFDQPHVVADLKSNGNLKY  247

Query  892  VGGDMFESIPTANAVLLK  945
            VGG+MFE+IP A+AVL+K
Sbjct  248  VGGNMFEAIPPADAVLIK  265



>ref|XP_002517835.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF44353.1| o-methyltransferase, putative [Ricinus communis]
Length=356

 Score =   223 bits (567),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 113/256 (44%), Positives = 164/256 (64%), Gaps = 7/256 (3%)
 Frame = +1

Query  178  NENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPIHPSKA  357
            N +E+++A+    N   ++I S +LKCAV +GIPD I++HG+PM LS L+ AL +HP+K 
Sbjct  8    NTDELIKAQTHIRNETFHFIKSMSLKCAVQLGIPDTINSHGQPMTLSELVRALQVHPTKT  67

Query  358  PYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIG  537
             +++ L R LVHSG   +    ++  D   + Y LTPA RL++  D S + R F+ L + 
Sbjct  68   HHLYCLMRVLVHSGFFNL----QNASDNYSQKYVLTPASRLLL-KDSSFDTRPFISLVLD  122

Query  538  YVYQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAKDSELIVEALL  717
             +  +   SL  + RNDD +PF TA G  +W Y  +E+  N L N+ MA DS +I  A++
Sbjct  123  PIMTEPYNSLTPFLRNDDLTPFVTAFGVTLWGYTGNEARANHLVNDCMASDSSVIGRAVI  182

Query  718  SGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVG  897
                 K+VF+G+ SLVDV GG G +A AIA+ FP +KCTVLDLPHV+     I N+ F+G
Sbjct  183  I--KCKEVFEGLNSLVDVGGGTGNMAKAIAQTFPNLKCTVLDLPHVVDKLQGINNLSFLG  240

Query  898  GDMFESIPTANAVLLK  945
            GDMF+ +P A+A+LLK
Sbjct  241  GDMFQPVPPADAILLK  256



>ref|XP_010040912.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW44790.1| hypothetical protein EUGRSUZ_L01646 [Eucalyptus grandis]
Length=357

 Score =   222 bits (566),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 120/266 (45%), Positives = 160/266 (60%), Gaps = 13/266 (5%)
 Frame = +1

Query  151  VMGEIGKLCNENEVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLIS  330
            V GE+G     ++ + A+A  WNHI N+I+S  LKCA+ +GIPD IH+HG+PM L  L+S
Sbjct  2    VNGEMG-----SQQLLAQAHIWNHIFNFINSMCLKCAIQLGIPDTIHHHGQPMTLDALVS  56

Query  331  ALPIHPSKAPYIHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINL  510
            AL IHPS+A  + RL R LVHSG     K A D     +  Y L    +L++ D+ S N+
Sbjct  57   ALQIHPSRAHCVDRLMRILVHSGFFEQKKLAPDG----QGAYVLNHVSKLLLTDNPS-NV  111

Query  511  RAFVHLCIGYVYQKSCYSLGDWFRND-DPSPFCTAHGQKIWDYFSHESGYNDLFNEAMAK  687
              F    +  +     + L  WF N  DP+PF    G   W Y   E G+N LFN+ MA 
Sbjct  112  APFALSMLDPILINPWHGLSAWFHNHVDPTPFEMVQGMSFWRYAGQEPGFNRLFNDGMAS  171

Query  688  DSELIVEALLSGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACG  867
            D+ L+   +++    K VF+G+TSLVDV GG GT A AIA  FP M+CT+ DLPHV+A  
Sbjct  172  DARLVASMVVN--EHKGVFEGITSLVDVGGGTGTTAKAIANSFPHMECTIFDLPHVVANL  229

Query  868  SSIENVEFVGGDMFESIPTANAVLLK  945
               ENV  V GDMFE+IP A+A++LK
Sbjct  230  EVSENVRCVPGDMFEAIPPADAIILK  255



>ref|XP_004229155.1| PREDICTED: myricetin O-methyltransferase-like isoform X1 [Solanum 
lycopersicum]
Length=352

 Score =   222 bits (566),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 117/255 (46%), Positives = 165/255 (65%), Gaps = 16/255 (6%)
 Frame = +1

Query  190  VVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPI-HPSKAPYI  366
            ++ A+AQ WN+I N+I S+ ++CA  +GIPD+++ H KPM LS + + L + + SK  ++
Sbjct  11   LLHAQAQIWNYIFNFISSSAVRCAFQLGIPDVLYKHDKPMCLSDISAELSVVNSSKVSFL  70

Query  367  HRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYVY  546
              L +FLV SG L          ++ E++YSLTPA  L+  DD   N+R+ + L  G  +
Sbjct  71   PILMQFLVQSGFL----------NQHEDHYSLTPASCLLAKDD-PFNVRSLLLLNHGQAF  119

Query  547  QKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHE--SGYNDLFNEAMAKDSELIVEALLS  720
             K+   L DWF+ND P+PF TAHG+ +WD+   E  S   D+FN+A+A DS L    L++
Sbjct  120  SKAWPELSDWFQNDSPTPFHTAHGKSLWDFIGEEQPSVLGDIFNDALASDSRLNTNVLIA  179

Query  721  GESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVGG  900
                K VF+G+TSLVDV GG GTV+ AIAK FP +KCTVLDLP V+       N++FVGG
Sbjct  180  --ECKHVFEGLTSLVDVGGGTGTVSIAIAKAFPNIKCTVLDLPQVVGDLKGSGNLDFVGG  237

Query  901  DMFESIPTANAVLLK  945
            DMF+ IP  NA+LLK
Sbjct  238  DMFDMIPHTNAILLK  252



>ref|XP_006365443.1| PREDICTED: trans-resveratrol di-O-methyltransferase-like [Solanum 
tuberosum]
Length=352

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 117/256 (46%), Positives = 161/256 (63%), Gaps = 16/256 (6%)
 Frame = +1

Query  187  EVVQAEAQTWNHILNYIDSATLKCAVDIGIPDMIHNHGKPMPLSHLISALPI-HPSKAPY  363
            E++ A+ Q WN+I N+I S+ + CA  +GIPD+++ H KPM LS L + L + + SK  +
Sbjct  10   ELLHAQEQIWNYIFNFISSSAVTCAFQLGIPDVLYKHEKPMCLSDLSAKLSVVNSSKISF  69

Query  364  IHRLTRFLVHSGLLLVTKPARDDDDKQEEYYSLTPAGRLVIGDDESINLRAFVHLCIGYV  543
            +  L RFLV SG L          ++ E++Y LTPA RL++  +E  N+R+F+       
Sbjct  70   LPILMRFLVQSGFL----------NQHEDHYFLTPASRLLV-KNEPFNVRSFLLFTNIQA  118

Query  544  YQKSCYSLGDWFRNDDPSPFCTAHGQKIWDYFSHESG--YNDLFNEAMAKDSELIVEALL  717
              K+ + L DWF+ND P+PF TAHG+ +WDY   E      D+F +A+A DS LI   L+
Sbjct  119  CSKAWHELSDWFQNDSPTPFHTAHGKSLWDYMGEEKHRVLGDIFYDALASDSRLITNVLI  178

Query  718  SGESSKDVFDGVTSLVDVAGGKGTVASAIAKCFPAMKCTVLDLPHVIACGSSIENVEFVG  897
            +    K VF+G+TSLVDV GG GTVA AIAK FP + C VLDLP VI       N+ F+G
Sbjct  179  T--ECKHVFEGLTSLVDVGGGTGTVAIAIAKAFPNINCAVLDLPQVIGDLKGSGNLAFIG  236

Query  898  GDMFESIPTANAVLLK  945
            GDMF+ IP ANA+LLK
Sbjct  237  GDMFDKIPHANAILLK  252



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2230116990256